2BIOA

Human p53 core domain mutant m133l-v203a-n239y-r249s-n268d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
186
Chain Sequence
VPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRSPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bioA00
2VUKA 3WTTA 4IBTA 4IBYA 2BINA 3WTSA 4IBWA 5LGYA 1EANA 4G82A 3Q05A 1E50A 4L0ZA 5AB9A 2J1WA 4MZIA 3IGLA 2MEJB 2J21A 2OCJA 2PCXA 5G4MA 1UOLA 5KBDA 2XWRA 3VD0A 1TUPA 2J1XA 4AGLA 2BIMA 4MZRA 1CO1A 2IOMA 3VD2A 3Q06A 4HJEA 5AOMA 4XR8C 1TSRA 3EXJA 2AC0A 3D0AA 3QYNA 2J6WA 5ECGA 2X0WA 2IOIA 3EXLA 2GEQA 3TS8A 5A7BA 2AHIA 3KMDA 3WTXA 4IBZA 1EAOA 2J20A 1HJBC 1CMOA 5AOJA 5AOLA 1T4WA 1EAQA 1H9DA 1GZHA 2ATAA 4KVPA 2BIOA 4GUOA 3D05A 2P52A 5ABAA 2FEJA 4IBVA 4AGOA 2IOOA 1YCSA 2ADYA 2J1ZA 4L18A 3Q01A 3D08A 1HJCA 4G83A 2X0UA 2WGXA 4A63A 3D06A 2X0VA 2J1YA 4LOEA 3US0A 3WTYA 4IBQA 4AGPA 3US1A 1GZHC 5AOIA 1LJMA 4QO1B 4LO9A 3WTVA 4LOFA 4AGMA 2H1LM 5BUAA 3D07A 5LAPA 3VD1A 4IJTA 4IBUA 3WTWA 1IO4C 3WU1A 3WTUA 4GUQA 1HU8A 4L0YA 4IBSA 3QYMA 3D09A 5G4NA 2BIPA 3ZMEA 2BIQA 2RMNA 5AOKA 2YBGA 4AGQA 3IGKA 4AGNA 1KZYA 2XWCA 3KZ8A 5G4OA
chains in the Genus database with same CATH superfamily
2W0PA 3L3OB 2CLVB 3U4KA 2XVLA 3PQYE 2EIKB 2YARA 4TQEH 2XWJB 3K46A 1ETZA 2NZ9D 5CMAA 3NVQA 4XOBA 3IDXH 3T77A 4WFEE 3U7AA 1LDPL 2ZX8A 3APDA 3H3BC 4MS8C 4W6WB 2J88H 4FABH 4NZFA 1KB5L 2R27A 1VB9A 1F6FB 4EIUA 1NAMA 2MNWA 3JV6B 3VD0A 4IKKA 5B3NA 3BW9B 5DUMH 2HLAB 4I1RA 5DYOA 3S35X 5ICYA 1DLHB 3C5JB 4F33B 4UAOC 2QVKA 2FAUA 3PWPD 1IAOB 4B9GA 4FTDA 5DRXA 5IB2B 1XIWA 3VXSA 2UWEF 4MKTA 4QDGA 3S36H 1XR9B 3DIFB 4RBPH 3GBLA 4W9HC 2E27L 1JZHA 4NQDA 5ESQA 2QLVB 3F7PC 3QZBA 3V7AG 1E4WL 5CGTA 5DO2D 3AREA 3K2KA 3L4TA 4JDEB 4X83A 4X6BA 3MXVH 4TNGA 1D9KA 4YE4H 1AKJB 3PGDB 3Q3GB 5KBNC 4I2XA 3UYPB 4B95C 1C8QA 3FT2A 5JHLL 1OAKL 5EOTB 4P9HC 1NWOA 4R2GC 4A39A 4Y5VA 5GGVH 4YHML 2FATH 4F7CB 2VISA 4KI5C 4UT9L 1NMCB 4WVRA 3ROOA 2VDPL 5D1QB 3RNQB 4MQXC 4I5BB 2ZXQA 4QKXB 4YOKA 2FNWA 3GMMB 4AEHH 4E41B 2X2HA 4RAVB 1V7MH 4XX5A 1MDAA 4MMZB 1CQYA 4KU1A 2NY5C 1SJMA 4K2UL 5CU5A 4DEUA 5T3XD 1CIDA 4BH8A 2X4UB 1CFQA 1FORH 1KY6A 2JF1A 3DX0A 3D4YA 3HS0A 3LPPA 2OJZL 4WUUE 1KPRB 1RQ5A 4KK5C 2XFGB 4M1GL 1B4LA 3KBFA 1C5CL 2CBMA 4AMKH 3I02A 2HFEA 4CA4A 3GSWA 2EEAA 4U31A 5D93B 3KLHC 2VERA 5F96L 5KJRL 5LXGL 1WS8A 1J9TA 2R9HD 4X9HA 1EJ6A 4H25A 1B2YA 4Y5YA 3MLYL 3KLLA 1F6LL 1PZBA 2HKFL 3IXAB 1ZGLA 1I3GL 2V2XA 3KPTA 3UABA 3BH9B 3U6RA 1IAIL 2R4RL 4P2QB 4HOXA 2WB1A 3EGDB 3GXUB 5DS2A 5I1IH 1Q9WB 5GS2D 1OQOA 2F19H 1ACXA 4IEFB 2Q7YB 2CO2A 4YSQA 5TDOA 5C0IA 1RPQA 4P5TD 3LKQB 4U1NB 1JVOA 3MLTA 1KDJA 2PKDA 1WFIA 2HXAA 3LIZL 4XZUB 2ZXCA 5E8EA 3IRPX 1K5NA 5KSAD 1GTFA 3S5ZA 2YJQA 4HUCA 4HW6A 1X9RA 2NY0C 4PPTA 2XKSA 5IROA 3KYNB 3G5ZB 3BWUF 3O6FA 1K8IA 1U8NB 2WQXA 2Y06H 4NRYB 5IVXF 4F91B 4IDJL 4HFWA 5CHNA 4CDHA 4OZIA 1VEOA 2RTTA 4P2OA 1R3IH 1T22B 3G04A 3OLEA 2EXTA 2HG5A 1AD9B 4MCYA 1KV3A 3MRJB 3CH8A 3P3RA 2CO3A 3MRBB 4S1DC 3WFHB 1TEFA 1IAIM 2YK1L 3MJ7B 4L3AA 1DDHB 5AG9A 4UQ2A 1FYTB 3TO4B 3KL5A 3AU1A 5D2LA 5C71A 2A99A 2APSA 3VXRE 1U93B 3OXSB 3QS3A 1YEFH 2WBXA 3BXNA 5DJYA 1S7UB 1R19A 3KL3A 5CSBA 1B3IA 2AHIA 1KJ2A 3CVHA 3GSOA 3QEHA 4JFFA 3QXAB 1UT1A 2O5ZL 4GXUN 4GXUM 1BFOB 3GB7B 2X28A 5GS0C 3TFBA 2KS0A 5IB5A 3EO0B 4KX8A 2FYVA 4LCWE 3RGHA 3KS0J 3H0TA 3W39A 5L7XL 4DT2A 4TUOB 4GKZB 1NGYA 2XV6B 2WV3A 4R7DB 5EB9A 2X9WA 5GHWH 1UUSA 2VM3A 4M62H 1H8NA 3EJTA 5D7JB 5IW6B 1U8JB 1TZIA 2N59A 3JZYA 2W95A 1SN2A 2P8MA 1CXEA 4PJDA 4X7TA 1T3FA 2KLSA 3KCPB 1HX0A 5FR3A 4DUWA 3MGTB 1QNZL 2EO9A 1IBYA 1LO3L 2F58H 1GVIA 4S11A 3K74B 3X1BA 1RMFH 1UVQB 4ZMNA 2F5BH 4N0YL 3FRPB 1QRNA 2H1PL 3OAYH 3GHBL 1D7BA 2CA3A 3ZE2E 4KQ4H 2ZX9A 5IVZA 3VD5A 3FSOA 4BZ2L 2H45A 2B5IC 1HQRA 1ASOA 1QBML 2WLYA 3T04D 3TH4T 1NCTA 1CFNB 3P9LB 4PV8B 5JW5B 1JXDA 5DJZA 1RZKC 1G9NL 4PJXA 2VAJA 4XVUC 5KOMC 4C8XA 4LNRA 3DVNB 3PFUA 3V0IA 1KJVA 5D5MF 5HYSA 3DHMA 3B9EA 1LO0L 2F7IA 2E27H 2FH8A 1A6ZB 4TULL 4G6JH 4F8QA 3QDJA 4HXAH 1AHWB 1P6FA 4ZSOB 3RVTD 3QUYB 2ESVE 4LBAA 4AYSA 5DUPL 1HKLL 1KEML 5H37H 4AQAA 5DZPA 2FJHA 3H4FA 2V4LA 2E75C 5CBAA 3UADA 5JHLH 1OAKH 1LEKB 1NDMB 5IVOA 3O81A 3B6SB 4NKIL 3JWDL 4BXVA 4N2GA 4YHMH 4BFNA 1C12B 4N8CH 3O2VL 4KKNA 4R4ND 4EDWL 2VDPH 4N2DA 1O7VA 5JLZA 3WKML 2NW3A 2IANB 2PNDA 4HJGA 5J6HB 2F7OA 3P9WB 3Q1EA 4KXDA 5I0YA 1J5OL 1DBBL 2A9DA 1QSEE 1Z3RA 4K2UH 5LG1A 3FRUB 3FN9A 2X0WA 4YZFF 3S9DB 2WK2A 3HJEA 4OUOA 1JV5B 3CCHA 4FQXC 3O6ML 4FQJH 5LN8A 4X6DA 1MPAL 1XGUA 4ZPTA 4M1GH 3RHWK 3DYPA 4FFVC 1MDTA 1A6TA 2I07B 5HVHC 1C5CH 5FO8A 2QADB 3VWKA 3QFJB 3Q8BA 3AGWA 3OXRA 3TT3L 3B9DA 2VITA 5A1AA 4YXKL 3II3A 3K8KA 1UB6B 5F96H 5LXGH 3EO9L 3EH2A 5TE6L 1W16A 4D0CB 2WYZA 3FTVA 4OD1L 1B6UA 3W2DL 5DD3L 1HE7A 3ZZSA 3MV9D 1IL1B 1H5BB 4GKOA 4BUGA 1YLBB 2HKFH 3IAQA 4NSKA 1I3GH 4HHAB 4M4RB 1U36A 4PJAF 1IAIH 1MJJB 3WMQA 3B7TA 2OTUA 3OJ2C 2QHRH 5FGCB 3TZVD 2W65A 4NERA 1SLVA 4HIHB 3U30B 2B1AL 4X6EA 3N9GL 5KJ7E 5C0AE 1HOCA 1MAKA 1T0NA 1TIUA 4FFTA 4PLKC 2YPLB 5B38B 2WTPA 1U4FA 5JA9A 5BZDB 5AAPA 2QPFA 1DJGA 5E94B 5DHEA 1PX3A 4BRJA 3FUHA 1FFPA 2WZ6A 4Z7UF 3RRQA 1YEIL 5I8OH 2CAKA 3AXLB 1FG9C 3VDCA 5A6MA 1LMIA 1WTLA 4WGWB 2GCYA 4Z78B 2AEWA 4QHMB 3GTVA 4YE0A 4TNWK 3IE9A 2H1LM 4PJHF 5BUAA 3DXAD 4FI7A 1KEGL 2ATPA 4L3EE 5LAPA 4E9TA 4AUUA 2R69L 3AQXA 4Y4KC 3RWFB 3SPIA 4RBPK 2LGNA 5I82A 3PV6A 2WJ5A 3GSNA 1R0AL 1N8OE 2G3MA 1RJLA 2DEWX 3C60C 1T80A 4QTIL 5CAYB 1MY7A 3MCG1 4HOMA 1SNRA 7PCYA 3I6GB 4QCIB 2GIMA 5C07D 3G6JF 4G7RB 4NQXA 4HIEB 4JLRA 2CCLA 3WGUB 2XTSA 3FO2B 3Q2CA 2YLHA 4TLSA 3WDJA 5INCB 3Q43A 3MJ9L 4ELMA 4U0QB 3L48A 1BIIB 5FFLA 5F8RC 3QWRA 3P9MA 4HH8A 2G9HB 2O5ZH 3AJ7A 2R0LH 3IJSA 3ULVD 5FHAL 1OGTB 1UG9A 3NPSB 5FM8A 2MOVA 1W0YT 2VDQL 2QV2A 3RVUC 2PW1B 2VSKB 4WW2B 4Z76B 5AFAA 1XH1A 2X2UA 4KJQC 4Q58C 1LD9A 4W4OA 1UCTA 3O11B 3NFNA 4LBEB 3BRDA 2YD8A 3SCMD 2K9UA 1X3DA 1YUHB 3BAKA 4YSRA 3L3JB 1FIGL 1MF2L 1KIPB 5C0BA 1YNKL 3LEVL 3UX9B 1Y6KR 3PWUA 1OQXA 3VWJB 1QNZH 3M1OA 4N1CA 2ZSVB 5KYXA 5F1OB 4QJ4B 3UBXG 3RUGE 1CFBA 1JOIA 1OP3K 1T4WA 4ZOAA 4KVPA 2QPSA 2H1PH 5J1AA 2CM6A 4GUPB 3GHBH 1H19A 3NABL 1PQZB 1FYHB 1AO7D 4I9WD 1X5YA 3HLAA 3SKOB 3UOAB 5IB1B 1QR1B 1Z9LA 2ZX6A 1QUNA 3ALPA 3O2DH 3MO1B 4HGWA 3QQ9C 4M61A 1QBMH 1P6AB 4CL7A 1DBJL 1M1XB 2VLME 1I1AD 4A6YB 4N8VG 3LRSB 4OY9A 3M8OH 2XACC 4J3OF 4RGNC 4ANVA 3UBGA 1G9NH 1Q0XL 3VI4F 3F62A 4LCUA 1BD2B 2Z7ZA 3VXMD 1CVRA 2VSCA 3ARGC 4PP2B 3TO2B 5AW8B 3B5GA 1YJDL 3SZKC 1U58B 1LO0H 4PJEF 4HWBL 4P07A 4IBQA 1HTYA 5IQMA 4WWKD 4MAYC 3PUUA 5KYUB 4U3XA 1MCPH 1ZHLA 2NSXA 5CR1A 1U8HA 1A6AA 1CB4A 2OX5B 5DUPH 1HKLH 3FFOA 4MQSB 2FE0A 1CLOL 3RJOA 1J9RA 4LLVB 4F1SA 4M1DH 3K8MA 1JPFA 1OL0A 3CFEA 2AMUA 1KB5B 4GW5A 1J05B 3MR9A 3QULA 3UTOA 2YN3A 5JOPE 3FJTA 4NKIH 2HKHL 3QE5A 1WEJL 1H6TA 5GZOA 4UNUA 5CU9A 2YAEA 3AAZA 2M2DA 3FT1A 3ILPA 3KD4A 4RDQF 5CSZB 4AC4A 4XB7A 4NXKA 5AKSA 4ZQKA 3RGVC 5B39B 3PIQA 5BVPL 3WIFA 3BE1L 1VRSA 1ZK9A 4KVCL 1H8LA 5EN3A 1J5OH 2Y1YA 4DESA 5D7IE 1EV2E 1BM7A 4AW4A 4G8IB 3MRNA 5F93C 5KWYC 2AK1L 4LLDB 4Z7WF 3F7LA 3ARFA 3O6MH 1OT1A 4YSSA 3B8YA 4FG4A 1MPAH 4FDWA 4EZMA 4UUJA 3K5SA 1QW9A 2VH5H 2X4RB 1E50A 2PPEA 4XXCC 3S8FB 3TV3H 3AT0A 3S2AA 4QRQA 2OCJA 4HIQA 43CAB 2C9UA 2GY7B 1PEZA 3EO9H 2P5WE 1IGTB 5FYJE 1BF8A 4L05A 4NQCD 2XTJD 3IAPA 4OD1H 5TGBB 5DD3H 3B8SA 2IVFC 4W9LC 1MCIA 2VDPB 5F71A 4WNJA 3EJZC 2UXFA 2X4TB 3PHQB 5ICZB 4PB0L 4EDXB 3BYTA 1JTTA 1UACL 2B1AH 3QO0B 4F2ME 3N9GH 1HXMA 1S7RA 3VAEA 3MRCA 4W6XB 3QJVB 3QJQB 2WC7A 5MEQA 1WUNT 1MW2A 3MACL 3OAYK 5ERWB 2ODIA 1MVUB 2P26A 2GSMB 4C83B 3U0WL 1YEIH 4ICWA 3K5RA 3DURA 3RIFK 4ELDA 2EYTA 3AG4B 3MROB 2EUXA 2XA8H 3VYOA 3IJ8A 3VX1A 4WNQB 3HG2A 1HYSC 4K7FB 1NLDL 1KEGH 4IW4C 3BP4A 4OZFB 3SDXB 2R0ZL 2JVUA 2VC2L 4PJIA 5IFJB 1RSYA 2ADYA 5EEVA 2R69H 4YFEA 3Q01A 1YY9C 4XPTL 1RLWA 2W0KA 3KM1A 5CS7A 4HK0A 1EFXB 5CEZH 2VR3A 1R0AH 2EABA 4QTIH 5JW4N 2EDFA 1NJ9B 2W94A 5JW4M 3O4LD 3VSUA 3KWXA 3W5MA 1KTLA 1U8LB 2V7HA 3H2PA 4IRZA 4LSVL 1D5XA 3RBGA 1LE9B 2ITCA 2X1WL 4DP9X 5JHAA 5D9SA 2Z1PA 4L1TA 3QZOA 3MJ9H 4F2EA 1EUTA 5EIIB 3SDAD 4MQTB 4Z7NB 1RU9H 1NH6A 4PJ5D 3GLEA 3OKKA 3VD1A 1HSAA 4KZDL 3HCVB 3EOYG 2JNZA 5FHAH 1JXFA 1KYOK 4UM9B 4L29B 1PJ9A 2YPVA 1XF3A 4MDRA 2JJSA 2GJRA 1VHPA 3BCFA 3EADA 2VDQH 1RKRA 1IZKA 2FTAA 3ZRCC 4JK0D 3FBQA 3VB9A 4I88A 2BWIA 4QMEA 3GUTA 1AFVH 2ADFH 1U8KB 4JREC 3HRZC 1WRFA 3MV7A 4X7DC 4ADJA 3BIBX 2Y6SD 2ZYSA 3SBQA 2ENSA 2YQGA 1FIGH 1MF2H 3KZ8A 1YNKH 3LEVH 1NFDE 1WC7B 4P2RD 4R90L 1JGVH 2DQDL 2B59B 4JFXB 5DJ0A 4F5CA 3CSTA 5I71C 1WQVT 4X4KA 1H3PL 2AK4B 3JTTA 3Q6FB 5DHDA 3M1BA 3NPZB 5ACLA 3BFQG 3IFPB 1OSEA 2Z4QA 5LGJA 1MCDA 5TF1H 2AFNA 3CC5B 5CN1A 2AJVL 4Q9QL 1ZHNB 4ZO7A 3NABH 2DM4A 1IM9D 1S8DB 2JFCA 4OZHB 3V4UL 1E4JA 2A74A 5DEFA 5HYJD 4C59B 1WAAA 1Z9PA 3C6EA 2EYRB 5TF0A 3WLBA 1XZ0A 4JE0A 1TVDA 3FTWA 4E9WA 3WELA 4S1QL 3LXUX 5FECB 2CALA 3DUSB 5K5YA 3B7UX 3DROB 2OV0A 1Q0XH 4F7PA 3G6AA 2A6IA 4JQIL 3VM5A 4ZDHA 2GJPA 1DVQA 1YJDH 2DIEA 3GEFA 5T1LB 2Y7SA 2IAMA 5IHBA 1Q9OA 1F3DJ 2J20A 4IBZA 5JIPA 4MVBC 5D1XC 4BQBA 3MSPA 1ZLSH 2GJZA 1F3JA 1CLOH 1IGFH 4TNVF 1L9QA 1QO3B 1RJZA 2OL3L 2ZUWA 1FZOA 3DK2A 3QJOA 4GJTB 4JRXA 2GW5A 1JWUA 3TJHD 1YMHB 5ELIA 1N0XL 4MJ6B 4MXWL 4JFYA 2HKHH 1XAKA 1VGKA 2DTML 1WEJH 3D3VA 3NA4A 5L4JA 3NSDA 2AXFB 4Z8FL 1DSYA 3I6SA 3KH4A 1AS7A 1J1OL 5FDYA 1EHKB 2N56A 3TYFB 4UF7C 1YMMB 2QKSA 4PLNC 3CFJB 3BE1H 1FQ9C 1MWAL 1QSFB 4HWZB 4KVCH 3L45A 4ZAKC 4LASL 1D7CA 3IFNL 4HIJB 3T0DA 1LEGB 2AK1H 4D9QD 1DJZA 5EF1A 1X4YA 4UB0L 1FVEA 1NBQA 3I6KB 4ELKA 4ZNEE 1PNCA 3FC8A 3AC0A 4PCYA 4N6QA 1RUML 3RPKA 2FCBA 3QHTC 3BUDA 4PBDA 5E5LA 4PJDF 2FGZA 3LEYL 4HWUA 1ZA3A 3RVVC 3VXTA 1ILSA 3AT9A 3FMGL 3UTSE 1JFHA 4M5SA 4AQZA 4N3TA 4HGKC 2E7BA 3BWAB 5K93A 1BFVL 4C47A 4ORGA 3TNMA 3DBXB 4PB0H 3WFDL 1IFHL 4FXKC 3DKHA 1UACH 4QHLB 4JCMA 1KJMA 5ID0A 5EUOB 1M4KA 4G9DA 3RVXD 1MIEL 3RWEB 1P4LA 3HB3D 2BMKB 3IEAA 4DZ8A 2E74C 3GHPA 5BUGA 1CDCA 2NY2D 4DNLA 3LV3A 4LCCA 5J9PB 1FO0A 3BFWA 3U0WH 1I3RA 3VFNB 3D51A 2EDEA 1FN4B 3DPDA 4LKXA 1HINH 2YN5A 1XCTB 4PJFF 5D1ZB 3P4NB 4KTGA 2OPCA 4I77L 3MRLA 4YDZA 2R0ZH 3S5LG 1UD5A 4IRJC 3ZTJH 5BZZA 1PKQE 2ID5A 4NRZB 5CR8A 3DX8B 3VGEA 4B9PA 5E6RB 4G3YL 2WAHA 3F58L 3QWOB 4UM8A 2WGNB 3O9WD 5IJVA 4RSVA 3WHXA 2XXGA 3PAZA 2Y7QB 2YSSB 1NBYA 2JWYA 4XNUL 1H9VA 4KNQA 4LSVH 3JBG7 5F3HB 2YPKB 1XH2A 3V8CA 1A1MA 1JZFA 2C4FT 2YXMA 4A7TA 3TNNB 4DSYA 4F57L 3Q8EA 1ID5I 5FF6A 3WKQA 2R29L 4OF5A 5IFAL 3BAYA 4RRPG 3TVMD 2NR6A 1AZVA 5IEHA 1ZY9A 4KZDH 2PPDA 3VQ2C 3ZOAA 3HUJA 4YIQA 4JDZB 4JM2D 2E6PA 3MV8D 4B97A 4JVPA 1QG3A 2J8UA 1JN6B 3EJSA 3IJHB 3MREA 4CVXB 4HG4K 4PV9B 2ZOKA 4MBOA 2F53B 2VGLM 3KPSD 5DJ6A 1A64A 3HE7B 4AWJC 3V6FA 1T2QL 2Z8WC 5E5RB 1SEBB 3Q48A 2FHCA 2VZ3A 1QZ1A 3TCLB 2DM7A 3IS0X 4X8JA 3V52L 1BREA 1JXGA 3NCFB 3TTYA 1U92B 5SV4A 5JW3L 3OAZH 1UTDA 1IVTA 3D2UB 1F58L 2X12A 4R90H 5IJBC 1BGXL 4O5LL 3BLPX 1NMAL 2L3BA 4YSDA 4YS4A 1PMYA 1M6OB 2AXHA 5BV7C 1S7XB 2J4WL 1ZV2A 1TQUA 4LEEA 1S6NA 3OF6D 1II4E 3QIWA 2FEDC 1DJIA 1UC6A 1YNTA 1DSFH 2AJVH 2G0LA 2BNRD 1DVTA 2R15A 2Y07H 3E3QE 3S48A 2BNUB 3D7PA 3LNHA 1MCQA 3V4UH 4PJBE 5FAAA 4I4WA 2VDQB 3C6LB 2OZ4L 1NUFA 4ONFH 3L3HA 1XGZA 1FNEA 4YDNA 4HPOL 3IM1A 3B9KD 3MOQA 2OCFD 2Y5TA 1K5WA 2NY3D 3NAAH 3O0RL 3QIBD 4OZGA 4ZW3A 1K4DB 4I48A 4FLRA 2H4EA 3IDIB 2G3XA 3WN5A 4E0RA 1DUYA 2VDML 4ODWB 5IV2B 3OZ9L 4F15B 4IMLA 5A2BA 5BUPA 5TE4L 3QWQB 4HISA 2EIDA 2CK0L 2A5UA 4BQ6A 3T6QC 2GSIA 2OL3H 1S2EA 2EICA 5C3TA 2QGCA 5GGSY 5IP4A 5K9KA 2NNAA 3MNZA 1H3VA 1N0XH 1YYML 3Q44A 1CQKA 1UZ8B 1F97A 4HKZA 4PJCB 5C08B 4PLJC 3L54A 4Z8FH 5I23A 2CKBL 5DK0A 2AJYL 2IEPA 1HHKA 3BT2H 2LTQC 2IF7A 4H20L 1BOGA 1YDPB 4AYEC 1D3CA 1MWAH 4KRMB 3EO1A 2EVIA 3PNRB 4KXAA 2CMRL 1OGAD 2J8HA 1BLNB 4HJ1A 5JPNC 1S78C 4LASH 1GPOL 4S2SB 1JNJA 3IFNH 4IBLT 4JHAL 5HJ3A 1UADC 1Z3GL 5J13C 2IXQA 4P46C 3OKDB 1JTOA 1KCUH 4UB0H 3DECA 4LKCA 5DK2A 4L37A 1FFRA 2WUCH 4GUOA 1QFPA 1AGEB 3LRGA 4AW7A 1I7RB 1E9PA 2AQSA 1RUMH 4RX4A 5JNYA 3BWUC 5IF0B 4WFED 3F5WB 4NQVA 3LEYH 4XBEL 3KPMA 2BVOB 3E2HC 3IPEA 1E4XL 3FMGH 3CZEA 2F7QA 3ZR6A 2Q3AA 2OSYA 4TV3A 1BFVH 2X9XA 4W9JC 3JT0A 4GLRH 5JXEC 4EXKA 4JFPA 3WFDH 1VAHA 1IFHH 5DZAA 3QPXH 5KG9A 4HQQH 1CFTB 3T2LA 1YN6A 4LPCA 5D2NC 1HQ4B 4Q6IB 2W59A 4U3SB 4AVIA 5BVJB 3STLB 2VQ4A 2AEOA 2BDNL 1GRWA 2F18A 4X7EC 4Z7OF 3ASOB 3O4OC 4MXQC 3BKCL 1U3YA 3EFFB 1WHPA 3OJDB 3FSVA 4PRHD 4AMWA 4NO2B 1A3QA 1FJ1A 1PTZA 4LPVA 1MI5D 4BFEA 4DN3L 3VXQA 3HI1A 1A9BA 4ANKA 3O8XC 1LE5B 3GO1L 2G4EA 4NDMB 3HBPA 1OW0A 3RWCA 4I77H 3EYFA 4RAUB 1DVUA 2Q9OA 4PJGF 3NZUA 4W70A 3PWNA 3TBVB 1AIFB 1NM9A 5D6CB 4G3YH 3F58H 1DDTA 3KLAA 4PM1A 1EEYA 3CJJA 5DQJB 2BVYA 5EU4A 1HILB 2QPDB 2DH3A 4E42A 4HJTA 5GIRB 4NC0B 2P8LB 2XFXB 4J4PD 4L4JA 4QRRD 1BBJB 4EO5A 3RTQB 4FQLL 4ZNCD 1ZPUA 1I31A 4JFHE 4QT5A 2VLKD 3TFKD 2P9RA 3ME0A 1W0VB 2LFGA 1MHCA 4X4XA 3B9AA 4GBXD 4HS6A 2R29H 5J0BA 5IFAH 1UOLA 2J55A 3HZKB 4WU5A 3R8QA 5KYWB 4AKPA 3O0LA 4JN2A 3BEVB 1QLFA 2DYRB 3FTZA 3QZLA 4Y16A 3EFDL 5E8NA 2VC2B 4K5MA 2CLZA 1BMZA 4I0PC 5MENE 1XF1A 2X7LA 4KI5E 4CGUB 4R4FL 5AW3B 1P53A 4M8UA 2NYYD 1NDGA 1JGEB 2ED9A 4QR7A 4B53A 2GEQA 5I5IA 3WEMA 4JO3L 3EBAA 3LS5L 1RZFH 4XAKD 5F7BA 3F7RA 5JW3H 2NY6C 2H47C 1T1ZB 2EC8A 1HZHL 3L3KB 1SLXA 1BGXH 1TMCB 1U3HC 3DJ9A 3MJGX 3AROA 4O5LH 3RG1C 3UJTL 4XI5C 4XBPA 3DWTA 4XX1E 5E2VL 2VL4A 5HJBA 2J4WH 3S5LA 5C6WH 3AY4C 1GYUA 2OMYB 1BDYA 4N9OB 4NNPL 1P1ZA 2HP4A 3QDGB 3F05A 5AW2B 3ZSTA 4I18C 2A6DA 1Z9NA 4Y4HD 2OZ4H 2NNCA 4HPOH 4Y8AA 5F9DC 5F9JB 2DV6A 4KK9C 1TZHB 3O0RH 2QR0B 4MWFB 5MEPA 5FB8A 2MKWA 3OKNB 1T1WB 3ESVF 4YHPB 3OPZL 5I6PA 2VDMH 2JSFA 1UQSB 4C56E 1NCAH 3MRDB 4HUWB 5GSRA 5JUEL 3VI3B 4HALA 3D07A 2CK0H 3BFOA 4Z5RA 3QIUC 2J2ZA 2OCCB 4PRPB 2ED7A 4L1BA 4N2LA 5BO1H 4AQ8A 3D25B 1UXSA 4DTGL 4R7LA 3QUXB 3OX8B 1JV2A 2KZBA 4HBCL 4OT1L 3VXPB 3N1MC 5EO9A 4DPRA 5KTEL 1FP5A 3PNWA 4X8CA 1YYMH 3R8BB 3PABA 4YDJB 3H9YA 4KRLB 4XNAA 5F0LB 1NCCL 3PQYB 2W0LA 3L9BA 3RB7A 2X44D 3ILQC 1L3WA 2CKBH 2P80D 1A4KA 2Z4TA 3OAUL 4BE5A 1DN2A 4H20H 1IKNC 5DWUL 3PDOA 2IH3A 4OQ1A 1E4KA 5LB1A 1YEDA 2HWZL 4OFIA 2CMRH 4K8RD 3LZRA 1GPOH 5BNXD 4FZ8L 4JHAH 5IOPA 4NZJA 3PHAA 1QSVA 5IQ7H 5DRWB 2PP9A 2EJ1A 1JP5A 4HV8B 3U2SB 3A5VA 4ZFFB 5MEOA 3BSZL 1UWXH 2K6YA 4KKLD 3V5KA 3MRGB 5G4MA 5KBDA 3KLKA 3RWDA 3UC0L 2OL3B 3CQPA 3LY6A 2IJ0C 2VLRE 1ID2A 1CBJA 3S3PA 5HP5A 4HXBL 4XN5A 4DEPC 1MCRA 1WTGT 5BOJA 5F6HI 4XBEH 4H26B 1E8XA 1E4XH 2UY6B 3RFRA 2EXSA 3OAZK 3VRJB 5M94B 3F00A 3U4AA 1JHTA 4OCYL 3QUKA 5JHDE 3TT1L 1Z9SB 4FHJA 4HU8A 5IQOA 1MQKL 1MWAB 4L23A 3WS3B 1GZPA 1EMTL 2OTPA 3QJFA 4A7QA 2Q6WB 4GRWF 5FYJL 1RVFL 4NKMB 2BSRA 1EAOA 4XCEA 2FWLB 4NM4L 5CIPB 5CLYA 1FUNA 3GIVA 1BW8A 2BDNH 3MJ8B 4UQCA 4XNXL 1PY9A 2HLFD 4OKDA 3BKCH 3V0VB 5IFHL 1MREL 5IQ9B 1NINA 2ESVD 2WOBA 4ZS7L 2XXCB 4X7CC 3BPOB 3D6GA 3FRPG 4HPYL 4DN3H 3GO1H 4DVRL 6FABL 4QHUB 4WUUB 2C26A 1QRNE 3ZR5A 3I3BA 5D72L 2H5UA 2H3XC 3IFOA 4M6AA 1IAKB 2QZQA 3MYJB 3U2IA 2E4TA 4D8OA 4JUSA 2O61A 4E41D 3QUZA 4BA8A 4OFYD 1TQTA 2ICWJ 3TEWA 3T4AB 2R51A 3LKPB 1BQHA 1XB3A 4FQLH 1B0RA 4JL2A 5FO7B 3T2PA 2Y25A 4XP4L 2FL5B 3L95B 1EQWA 1J5IA 4WGVB 4QRSB 5DD1L 3U9UB 3NZ8B 4AV4A 1RHFA 1ZDSA 1KG0A 4DP1X 2DLTA 4MAZA 3KNBA 3KPNB 3O2WL 2IH8A 1E6OL 3LN4B 3ABLB 3MTRA 1YO4A 1CYXA 2GHZA 1FI8C 4HJ0D 3W0WE 2XPGB 3DX6A 1L0PA 2X5PA 3G5XA 3QAZB 4FJ6A 3QORC 4AXWA 5AAMA 3NESA 4P2QD 1ORSB 3GDBA 1O9ZA 4R4FH 4J3OC 4CC0A 5CJXA 5BJTB 4Q97A 3NSJA 2B08A 3E8UL 2IMNA 3ARDB 4DVBA 5E4EC 1YECL 1JZ3A 5GGUB 4CSTA 2E46A 4FCHA 3Q9PA 2CLVA 4WJ5B 4XMLL 1GC1L 5C0AD 5FX3A 3TH2T 2BFGA 2WWOA 5IBTL 2YGVA 3AB0B 4K94L 1AGCB 4KDVA 3UJTH 3DX1A 3KVQA 2CUMA 1SDDA 5E2VH 3NJJA 4W6YB 1TLMA 2ZOTA 3JV6A 2FX7H 1DEEA 4X6DE 4Y9EA 1S4IA 2NY1C 5B22A 4P23C 4ZYKB 4ADGA 1WPCA 1ZHKB 3BW9A 4EVNB 2AJZA 2HLAA 1EBAA 2CR0A 3U4BL 3L3GB 3B3IA 3C5JA 3ESNA 4ENZA 4A55A 3IDGB 2ZWYA 5DT1L 3LVTA 1QD0A 2OMUA 4Y1TA 2R0KH 1TEGA 1NEZB 1JYVA 4M93B 3OMZA 1PU0A 3DIFA 5DU7A 4U4BA 3L9RA 2WVVA 4N9GB 4WEBL 5F2FA 1OWWA 1QFWI 2YS4A 3GPSA 2PYEE 2X9ZA 4PTUA 3P77B 4W9FC 4RGMC 4YK4C 5B38G 3QCTL 4HS8L 1JUFA 4M8QA 4ZS6C 3RKDC 2IADA 3T6VA 3BPNB 3Q3GA 3PGDA 4NLHA 2OJEB 1SXZA 1KMGA 1OTSD 3TN0B 4TL4A 2K7PA 3ECBB 3DX9B 3QH3B 5EBLA 2ZOUA 3OHMB 4G6FD 4XOAA 3WFZA 2B0SL 4OTXL 4DTGH 4F7CA 4OT1H 5KTEH 3RNQA 5D1QA 4TL5A 4YDLB 1HEZA 1Q94A 1FRGL 4N90E 5J12C 4CNIA 4LAQL 3GMMA 2WLZA 1EGJL 3SB3A 4CVZA 3OAUH 5F7MC 3ZDZF 5DWUH 4GSDL 3B2DC 1KGXA 1P7KB 2C34A 2X4UA 3ZE2B 2CD0A 5DJ8B 4KTYA 1OK8A 3CLFL 5IWLC 1KPRA 3SOBL 4IU3A 4FZ8H 4P3CL 2DIJA 4X9IA 5KVFE 4ES9A 2B1HL 2VDMB 1XB8A 2X6CA 3EG9B 3QG6A 5EEXA 3J7HA 1YQVL 3SE4A 3BSZH 3MYZA 1FAKT 2F54E 3WU1A 3TJEH 3WTUA 2MCG1 5AW6B 1L4IA 4PU2A 2ZUQC 5FWRA 4P5RA 4GKNB 4F9PC 1S9KC 1L9MA 3IXAA 1HH9A 4XPFL 1S7QB 3RDTB 4QWWC 1CDUA 3LPOA 2BCMA 3BH9A 2ILLA 4PJ8C 4J39A 1CICA 3EGDA 4JG1L 1WBXB 3D4GA 5DHVA 4YR6B 2CKBB 4KROD 3VSQA 5I9QB 5D6DA 4OCYH 3TT1H 4A1RA 4IEFA 1MQKH 5JQIB 2QHLA 1CI3M 5G5DA 5FYJH 3LKQA 3O45B 4U1NA 2DLGA 5HDWA 4NM4H 4JRYE 1AGFA 5EG6C 4FFYA 2WXRA 4QTHB 4R97B 4E9LA 3H53A 4ISVB 4XNXH 4ZW7A 2VXTH 1R3JA 1U8MA 5FYKH 5HI4D 5IFHH 3OMIB 3A23A 3KYNA 4U1LA 4BCYA 1QSEB 4LCYB 4NRYA 1GY1A 4OZGF 3LNEA 4Y1SA 4P3DB 2EADA 1VF5C 3AG1B 2GTZB 3MC0A 4K5PA 4A2DA 3GT6A 3QNFA 4DVRH 2KLRA 1T6VN 1ICTA 5IJKA 4KK6D 1AD9A 3MRJA 4EEEA 2WKOF 5D72H 3U1SL 5I8CB 3CX5J 2VXQA 4NBZB 3WFHA 1DANT 3WJJC 3MJ7A 2R39A 1DDHA 1IBHA 4G71B 4QKTA 3ZMNA 5J57B 4IHBA 3GMPB 4XNZC 3OXSA 2V9RA 5KSBB 1A3RL 1MJUL 3ARRA 2PR9A 2JV6A 3HNSH 5BRZE 2IPKB 2EP6A 1OLLA 3WLWC 5A2IH 3MA9L 4KUCD 5CWSA 1KNOB 2FWUA 4R5XA 2H26B 2V2WB 4QGTA 2G0KA 5DD1H 2NQ3A 2E0PA 3RBSA 1XH0A 4JGUA 4JFQA 2Q3XA 3KDMA 4JY5L 3KLSA 4TUOA 4GKZA 4R7DA 3O2WH 4XWOD 1VFOA 1E6OH 1KBWA 5DGQA 4WFFE 4NEHB 5D7JA 3AADB 1A7PL 2NZ9C 3CFUA 4IGBB 5KBPA 4HCRL 1INEH 4GFTB 5GZND 3SQOL 3FUDA 5IR1B 3WNIA 2UYLB 4MB3A 2CDGA 4APQD 2HRGA 5I5RA 1ZA6A 1T6BX 1JWSA 5B39G 2Q86B 3E8UH 4AZ8B 5EC2A 4J3UA 4L3EB 3KCPA 4OGYL 4X5XB 1BZ7B 1YECH 4NFBA 1M7XA 4XMLH 1BWWA 5ENWB 3WY3A 1GC1H 1FCGA 2WCPA 3WAKA 2IALB 3BYYA 4J3XA 1C7TA 4R3SA 3QQDB 4NQUA 4UYQA 5IBTH 3FS9A 4JM4L 3WNNA 1EDYA 4K94H 3AWFA 1N12A 3FRPA 4OIIL 2X6VA 1FFOA 3IWVA 2DMGA 2W91A 1BQRA 4ZX4A 5B4MC 5E4OA 2UX7A 2TSBA 1PF3A 2XNAA 2XN1A 1U8OB 4IJ3B 4H8PA 4WGKA 3D0VB 3SBRA 1XSOA 2A3TA 5BZWA 3P9LA 4PV8A 4MJIB 5JW5A 5DMGC 2OXHB 3TA4D 3X3GH 4LHUB 4WHYG 1V7NL 1AXIB 1KB3A 3GSVB 2O5YL 4YSTA 4AGNA 4QGYA 5IUSA 3HKFA 2YA2A 3DVNA 1G4MA 2IQAA 3NEOA 2OLDA 5CGYD 2W81C 4QXTB 5IHLB 3FQUA 1J18A 1ET7A 2HT4C 2HX8A 4YBQD 3T8VA 3UTPD 1BYNA 5IW1A 2FGWL 3M07A 4WEBH 2XETA 5IGXH 3TF4A 1AHWA 3QCTH 3L4CA 4PG2C 1GOGA 3HLKA 1EX0A 1BG1A 4ECNA 4P59L 2AABL 1WA2X 3ZQWA 1CT8B 3PXHA 3SPCA 5I8EB 1DANU 2WWMD 2V2TA 1NDMA 3V6OC 3LXCA 3QSKB 3B6SA 5FUOL 5L0QC 2D4DA 3P3UA 1Q1JL 5D7LB 1T7YA 3HHMA 4G1EB 4OTXH 5FM4A 2OR9H 3GSRB 2J5WA 4N2EA 4OZFG 4TVPE 1INQB 2IANA 2MPVA 3EXJA 1BPVA 4LAQH 5ABZA 5KVDE 2HLEB 3RUGB 4MD0B 3ZDXE 1EGJH 3SDCB 2P5EA 2BX5A 1OVZA 4K7PL 4GSDH 4D3CL 4DKAA 3FRUA 5HGAA 2W9LA 3JWOL 1DTUA 3PP3H 2K4WA 5FA4B 3HPJA 1VZGA 5JMRA 1HJBC 2UVEA 1BYOA 2EDKA 1CD9B 5IQLA 3SOBH 4AJWA 4AYGA 4FA7B 1MCOL 2I07A 4G8GD 3D85D 1UH2A 5T5FA 2FJFA 5G55A 3QFJA 1QA9B 1YQVH 1PDKB 5EIIG 4JDTL 4M5ZH 3UJJL 1UB6A 4I3RH 1A7QL 3E1F1 3T1FB 2PXYB 4ZI8A 4GP5B 4P5TC 3OKLB 3CIAA 1JIBA 2AQRA 1IL1A 3RX5A 4HHAA 3O6KL 3P0YL 4M4RA 5KSAC 4KO7A 2ZP0T 4W1TA 1MJJA 3COOA 1UEYA 3WO3B 3NCXA 1KXVA 1NGQH 4G9FE 5DJ2B 2DL2A 3S3DB 4WDIB 4AI7A 4NQSA 2WLJA 1UT2A 2BCKA 5BZDA 3CVBA 4I1PA 5H4ZA 5E94A 2E7HA 3LQAL 3HPLB 4PRDB 4E5XA 3L1GA 4YPGA 3ESMA 1VA9A 2QTEA 2DH2A 2DMBA 1Z7JA 5JHBA 2HFTA 2Z31B 2WIIB 4AQ1B 5D4HA 4DFIA 2HCZX 5HHQB 2I9TB 1HESA 2MPAH 5KS9F 3GRWA 5D7IB 4E68A 5IM7B 3IDNA 3A4DA 3V0GA 3PWVB 3CBJB 5IEKA 1VFBB 1ZIAA 3FAXA 1SLUA 3LKOB 3U1SH 3SE9H 4B41A 4YPJA 5IB4A 4G7QB 1RZ7H 3VWKC 3FKUS 5I1KL 3I6GA 5GGRB 2XU9A 1F2XK 3JVFC 3DOIA 4L4TE 1B0IA 3UO1L 3VRLE 2ZYHA 4IBTA 4HIEA 5I0VA 1W72A 3UTQB 2GIXA 2P5WB 2VTFA 4X9GA 1MJUH 3FO2A 4QO1A 2X05A 3MLUL 1BIIA 1S7WB 3DV6A 3ARQA 1OKEA 5F0JB 5TH2A 1JF1A 2GSGA 1OPOA 2B1OA 4KNUA 1I1YA 4LLMB 4X5PA 5I0DA 1AR2A 3FZUD 3GDCA 5D1XE 1JL8A 4F2MB 4AH2B 4WWNA 4ESKA 2HAZA 1WA1X 4EI5B 4WW2A 4Z76A 3V2AR 3UTZB 1SOKA 2WINB 3O11A 3UAJD 3D5OF 1UXLA 4HCRH 4LBEA 1MFCL 2WXGA 4AIOA 3N40P 4M1CC 1FSKC 1YUHA 5EOCJ 3ZL1A 2IC2A 3L3JA 1KIPA 4OGYH 3VWJA 1KLGB 3RY5A 4QUOA 1YVLA 4P9HL 2VL5B 1A1OA 2ZSVA 3DRQA 3E9TA 4UTBL 3KBEA 4QIRA 4WO4B 1MLCB 2W07A 1KN4L 3DGGA 4X6CE 1NCJA 5I73B 2HB0A 2NT0A 25C8L 1XF2B 2BSED 5CD5D 1I8IA 3WXVH 4OIIH 4OGAC 3F84A 5IG7B 1D5MB 4NM8L 1PQZA 3EJRA 3SPHA 4L18A 3SKOA 1ZE3H 5IB1A 2NY5L 5F70A 5E2UH 1JD9A 1M1XA 4A6YA 3RVTC 3ZL4H 2BY1A 5C0FB 5SWZB 3REWA 1KIUA 2LAAA 35C8L 4NQEE 1V7NH 1BD2A 2O5YH 3IMVA 2ZIDA 1OHZA 3TO2A 4HFUH 2AZUA 3DX7A 3WIHA 3KHOA 4JGNA 1IM3D 1YAIA 2D0GA 2H0PA 3QDHA 2FGWH 1TJMA 1ED3B 5KYUA 4XN9A 3TCXA 3W1ZA 3R7QA 2JIXD 5EFIB 5JPMA 4P59H 4QOKE 1F4WL 4XO5A 1AC0A 1KB5A 1DVFD 2D03L 4U7MA 4M7JL 3FB7B 2ICEA 2ADJA 1DZBA 1T1YB 4MB4A 1OHQA 1Q1JH 4OLEA 5EZLB 1QHPA 3UAAA 5CSZA 1VADB 1GOHA 1EVUA 2EVHA 4TTDD 1RSFA 4XP6L 1UJ3A 5ISZE 2DMCA 4LFHG 4KMTL 5JTWA 1Z5LB 1J0IA 1YEEL 3DJTA 4HCFA 3EOBA 1NFIB 4K7PH 3X12B 4D3CH 5I6XB 3JWOH 4PJ7E 3ARUA 5IMMB 2IPUK 1PYWA 1XGQA 3TZVA 2OFQA 3RL1A 3GMOB 1MCOH 1D6EA 2KHAA 2X4RA 3V4PL 2H3NB 2JB6A 4IOSA 2XWRA 1L6XA 1CCZA 5LNDA 3VFRA 4RMWA 3LEXA 4C4BA 2YD6A 3M46A 3UJJH 1P7BA 1A7QH 2ZCHH 3UAFA 1BF2A 1IGTA 4MZRA 2J7LA 5TGBA 1ZGLM 4UT9A 4PR5B 3SDYL 5EOCL 2BS9A 2B4CL 4X8XA 2FSEB 2ICWB 1T2JA 5ICZA 2H32A 3DXAA 1KXQE 3D0AA 1F1GA 1M6UA 3C2SA 4GMTH 3UIZA 1YN7A 5IBLD 5CCHE 5DJDB 3QEGL 4K5OA 4BGLA 4R84A 4YVNA 3I50L 1RZPA 4QRUB 3BN9C 3SO5A 5F7FA 1KJ2L 3PFQA 4K3EL 5HHXH 1MOEA 2PYFA 3LQAH 1M2OA 1SXBA 3KPRD 2UWEE 5T1LD 3FUFA 4C83A 1HI6A 5C0CA 4POYA 5EU6D 3RB5A 3A24A 3MROA 4RLDA 3P3YA 1LM8V 3HHSB 4NHCH 4K7FA 1UKQA 3HC4L 2FQGA 4LPYA 4X5WA 3US9A 2IBBA 1A4JB 4AKQA 4OZFA 2FD6H 2FO4B 1RIUL 4TQHA 3SDXA 2GKIA 1MCBA 3CZFB 5HHMD 5TDPB 5IFJA 2WN2A 3IB4A 4H13C 1ITCA 1C1EH 1A7BA 3NP3A 4RGOL 1GCFA 3EH4B 1ADWA 2FJSA 1EFXA 3FCTA 4OCLC 4ZX6A 3ARPA 1MFDL 2FEEI 4LPWA 2AAVA 5E9DD 5I1KH 1J5DA 4ZZKA 3ABMB 3UO1H 4FXGC 5JIKA 2X2YA 4FTVE 1OTUD 4AIZB 4K23L 5JO5A 2Y7OA 3AQZA 1NKGA 1LE9A 4M7KL 2VMEA 2CIIB 4HSAC 4E9QA 3QVAA 4JFDE 4FFZA 3UTSB 3LIZA 3MLUH 3C6SB 3KPQA 4NKOB 5DUBB 2GHWB 5EIIA 3L3DB 4R0LC 1JZ5A 1JRHI 3SCMC 3IJYB 2OYPA 3KPPB 3HCVA 1NTDA 2ATKB 1RZKL 3VXUD 2FYYB 4UM9A 2XZZA 1C8PA 4X4MA 1SJEB 2CH8A 5EZJB 5ADPH 4TSCH 2GJJA 3TXAA 3GYRA 4H8VA 4ONGH 5CCGE 1JCKA 4F9LA 5T5NF 2AQNA 2A4CA 3SO3B 3PP3K 1S7TA 4GAFB 4CU7A 1AMXA 4H0LC 3SQBB 4I13B 3QI9D 5CKGA 3LN9A 3PJLA 3KLDA 3BMWA 3E80A 3GJFA 4D9RE 2JJTA 3VQ1C 3EJPA 3BISA 1WC7A 5IQNA 1M2VB 4DOHE 3Q05A 3ZSSA 1I1AC 1PKQB 4PY7B 1KN4H 4LPXA 4MKMA 2WLLA 4Q2ZA 3IFPA 5DHYB 3FN0L 4JGMA 1ZHNA 2X70B 2V7NA 2VCOA 5C0DB 1S8DA 1NGWA 2F6AA 1QWHA 3CPUA 4EN3C 4H5SB 2EYRA 4WWKC 5GRZA 3SE3A 4FA8A 5I15L 4GO8A 1JZ4A 4MS8D 5FECA 2N1TE 3DUSA 1A5FL 3DROA 4LRNH 4NKDB 1BJ1J 1AGDB 35C8H 2WAQA 1S7VA 3BAXA 4NO5A 3ULUE 2E5EA 5A7BA 1WAEA 2P7TB 1L5GA 1T83A 3BZFA 4WSKA 1QACA 1ULVA 2A6KA 4NO0B 1FZMA 2PO6B 4KTDL 1F00I 2ZWZA 5HDBF 3LRLA 1P7QD 4Y9CA 5D2NE 4X0KA 1CD0A 4WJKB 1MJ8L 5SWSE 1YYLL 1KV7A 5E0QA 3P0VL 3K4AA 2A7BA 1F4WH 3DMMB 3B56A 4D8PB 1Q9KB 2BK8A 1WCBB 5HHVL 2K0RA 2X89D 1V54B 3B37A 1FH5L 2GTWB 4HETA 4BZ2A 1AQKH 5B8CC 3PWJA 2AV1B 5I1CH 2A9BA 2C1OB 1TVBB 2H41A 2HN7A 5ID1B 3TYFA 2RJMA 1AXSB 1I9IL 3CFJA 4XP6H 4PWEA 4R2GD 5E51A 1E2WA 5CEZD 3S35H 1C5BL 2Z7WA 3UROR 2FECI 4KMTH 1I7TA 4GG6A 1YEEH 5C0JB 5FDWA 1PKOA 4MQXD 1CFSA 4R96B 5FO9A 3SY6A 5B1JC 4XBMA 1TPXB 3MU3A 1O75A 3VNZA 2A74C 3I6KA 2DDQL 3LS4L 1NUNB 2EH7H 2JKWA 5BQDA 1RHHB 3RI5K 4PYHA 4Z7VB 2Q8BL 3BESR 3ZHFA 4NUJA 2F2HA 1MLBB 4P2CG 2EEBA 2Z64C 1NA8A 4JPQA 1MY5A 4KK5D 1FC1A 2IH9A 2WLIB 3GSNL 3HC0B 5D8JH 5LNEA 1S9VA 2LAGB 1K2DB 5BQ7B 4PJ9D 5EOCH 2Y4SA 2DEYX 1NKOA 2B4CH 2XN9E 2KDGA 2ZKMX 3C6LD 2P49B 4XPGH 4XZ4A 1NGZA 4PW4A 4YUEH 1HHJB 1PAZA 2H6PB 4N85A 4H8WH 5KZCB 4E9YA 5D7KD 3G3LA 1RAMA 4FS0A 1XCQA 3QEGH 3H9HB 2JCWA 1KACB 1P9MC 2AJUL 1E0OB 1KLFB 3FFCE 4PRBB 4X5LA 2ZOLA 3RWEA 1KJ2H 3CVHH 3ESPA 4UOJA 1NCBL 4K3EH 4QNPE 4IHOB 3BP5A 1CGSL 1BSIA 3ZN6A 2XQ0A 2P8PB 5H4YA 3AG2B 3VFNA 3MODL 2AV7B 2QMKA 2YUXA 3MXWL 1DLFL 4L48A 1FN4A 4N26A 4C56D 3BPLB 3HC4H 2P24B 3T6XA 1XCTA 1EO8L 3P4NA 4L9DA 1RIUH 4WV1B 1GKOA 3OKMA 3PS6A 1Q8MA 1NIBA 4HZAA 3WN6A 1PG7X 4JFWA 3DX8A 3SDAC 4RGOH 3DETC 1TJHH 1X5LA 2WXQA 3QWOA 4FJYA 2OR7A 1CDBA 2MHAA 3QUMA 2NOYA 3C5ZB 1ERNA 3AS2A 1MFDH 2WBWB 1JGDB 3KJ4B 4A2HA 2YSSA 1I85A 3IRCA 3PL6D 5J4MA 2JCCB 4K23H 4AUYA 4KY2A 3QDMD 5FYJU 4AYID 4M7KH 5F3HA 2YPKA 3Q5TA 4PRAA 3V10A 4MA8L 4L9LC 1ZXQA 3CX5K 1DFXA 3TNNA 1MCKA 3BZDA 3FO9B 1QEWA 4YC2C 2Y6SC 3QXUA 1PLCA 4P2RA 2NUTB 1A8ZA 1MEXL 1QWNA 4EI6B 2ITEA 3ATBA 5HGHB 1J12A 4JDZA 1KGWA 1UM5L 2BY2A 2CO7B 3IJHA 2BC4A 5T33L 1U95A 4XP1H 4RIRB 2VLRD 4PW9A 2XY1A 1QWUA 3ABZA 2EDHA 5AUMA 5GS1B 1KIRB 1FNSH 3FB5B 5GS0D 1M3IA 2XYCA 4G5ZL 3IDMA 3QQ3B 2HMIC 1IGYA 3TBYB 1BBDL 4OJYA 2YRLA 4F24A 1F6AA 4PJAE 5EA0L 1ZVYA 5B7EA 5D70L 4L1DA 2YGNA 5EU3B 1NOLA 3D2UA 5JHDD 3S34L 3NSXA 1IE5A 3T77B 3HE6D 5JMOC 4UIKH 3BPCB 1QAWA 4Q6KA 3F85A 4WHTB 2Y72A 1L0YA 4HJIA 4XVTH 3UEQA 5J3HD 5C6PB 3VE0A 1ZEAH 1G84A 3FN0H 4IBSA 4Z7UE 5MP6L 1UWYA 1Y7VA 2XKNB 3CVIH 4TS6A 3IAGC 2BIQA 3HZMA 4APXB 5DYOB 1LL1A 5ICYB 1WHOA 2YR3A 2ZONA 5ALBH 3SYOA 5FW7A 4M3JA 3STZA 4PJHE 1UATA 2F1EA 3PJSA 1TCMA 2UXVA 4ZRGA 1U3ZA 1UXWB 1A2YB 2JI1A 5LXVA 4F58L 4WI4A 4NQDB 5ESQB 3WTTA 3TJHC 1LGVA 3AREB 4ZFGL 3IDIA 1EANA 4PRIE 3F6LA 2EYSB 4UOZA 5IV2A 4KTDH 5JQ6L 1T21B 3FO1B 3G9AB 3VSTA 3KVPA 3WBDA 2BXYA 3UXFA 3DIDA 3FT2B 3G6JE 1OV8A 4M7ZC 1MJ8H 5MENB 4Q56A 2DBJA 1YYLH 3B2PA 2YQ2A 3AACA 4Y5VB 3P0VH 2XDHA 2AS5M 2KZ1B 5DJXA 2CDFB 5DS8A 5HHVH 3MNWA 4HIIB 1XSJA 4GW1B 1UZ8A 4MNQD 5C08A 4JFZL 4LLWB 4NCC2 1RULH 2HT3D 3Q8FA 5HHOE 1I9IH 3K2UH 4BH8B 1CFQB 1C5BH 1CL7H 3HS0B 3V79C 4RMBA 4MNHA 5E2TL 4HWBA 4WW2F 3I02B 2EDRA 4Y0GA 2DDQH 3BKJL 3LS4H 1T0OA 1J88A 1N64L 2OI9B 4JHWL 1AGEA 4H25B 2Y1VA 2WKGA 2YD3A 1QTPA 3ABGA 3DTXB 1I7RA 4FI6A 1EHLH 4AC2A 4JQVA 4FQXD 2VR4A 1NCIA 2V2XB 1N3NA 2E59A 3F5WA 5KBKA 3GHEL 3T0EC 4G11A 2KMWA 3U6RB 1NC4D 2BVOA 3GSNH 3IMBA 3BD4A 4FFVD 2G9KA 4YXHL 4FKEA 2ENYA 3QDGD 3PRZA 4LLYB 4PWFA 4JRLA 3I3DA 4M43L 3Q1SH 2WBJC 2K4AA 4LOVA 1AI1L 1IGMH 5F0MB 2BXZA 4XMXA 5C0IB 3NCEB 5TDOB 4AENA 5TTRA 1CFTA 4WI8A 3MNDA 1HQ4A 4GKSB 5DMKA 3MLTB 4Q6IA 4U3SA 4HF5H 5E8EB 1K5NB 4GI8A 2NY0B 3VI4E 4MD4B 1ZHBB 2CBOA 3OD3A 2GAZA 1CGSH 1G9MC 3ZL2A 3IDUA 1UM6L 3QC6X 3IPFA 3F3HA 1PD6A 3MODH 2XA3A 3V4PB 1WGOA 1K8IB 2YPVL 3GXNA 1DLFH 3CVCA 3O9WC 4PLKD 4OH2A 3Q2VA 4HFWB 3PGFH 1SOXA 5CHNB 3TBBA 3IN0A 4OZIB 4P2OB 4OSUL 1KGUA 5EDXA 3H9SD 1I1CA 3G04B 1TLKA 1EO8H 1F5WA 2APTA 4KTEL 4MCYB 5E95B 5AKTA 4P99A 1ZLVH 1CL7I 3WJMB 3QUXD 5B3SB 1J8KA 3OR6A 2Q20A 4UDUA 4U3CA 5AB1A 3A6BL 3QR2A 4OCNC 4LEBA 4IIZA 5D6CA 3TVMA 4GXVL 1TZOA 1T89C 4UQ2B 3ZTEA 2XWXA 5D2LB 2DL9A 4P4KC 5DQJA 1HILA 3NJLA 1TG8A 4JM2A 3MV8A 5GIRA 3BXNB 3GXFA 5DJYB 4XMZA 2XFXA 2LOEA 2PCFB 5JYMA 3IDJB 4LT7A 2WO4A 1BBJA 3RTQA 4LSUL 5EPMA 3CLEL 1KJ2B 1BZOA 3QEHB 1IQWL 4JFFB 3GIZL 3HG1D 3C60D 5E2WL 3A4AA 3LDBB 4MA8H 3D39D 5GRXG 3IGLA 3N0PB 5AVXB 5FA3B 3B2XA 5IB5B 3W82A 3L08A 1KLUA 4J6IA 3H0TB 1XD1A 3W39B 5AW4B 3LQMA 4P5KB 1NGYB 5DA4A 5FKAB 2EDJA 1MEXH 3NGBC 4LLAA 5KYWA 1OCZB 5EEZA 3F01A 2F54D 4K9EC 4J5VA 5T33H 4AOFA 1E8WA 1TZIB 5E08L 3WDHA 3I9IA 3OF6A 4ATTA 1GW0A 2P8MB 3CSBA 4CVUA 2BNRA 1T3FB 3LAFA 4HZLA 3TA3C 1BBDH 3RVUD 1GR7A 3WHE0 3VYNA 5EA0H 3Q0HA 5D70H 5FYLH 4KJQD 1BVLB 1BEXA 3B9KA 3BAEL 1HHGA 1MN4A 2BSTB 3CN1A 3CTTA 2OMZA 4WEUD 3KG5A 5FFOA 1QRNB 3RGBA 1A7OH 3B7SA 5F1NB 3FUMA 3QG7L 3CZLA 4Q0XH 2D31A 1CDIA 2DI7A 2NY3C 3QIBC 3VD9A 2N4IA 3ARYA 2XZAL 2EIMB 2OMYA 3PREA 1SLWA 2P48B 2PP7A 2PR4L 4IOIA 5DJZB 2DQGH 2XPYA 1H0DB 2X42A 3VD3A 3FOLA 3QPQC 4PJXB 4XOCA 3T1WA 4KUZL 3OSVA 4LNRB 2BZCA 1KJVB 5HYSB 5EZOL 4NBXB 2CCVA 3ZLQC 3LX9A 4F58H 4JUTA 3QQ9D 2OMNA 3KGTA 3SDXF 3QDJB 4CJ0A 3OKEA 5JIDA 2MCAA 1JZDC 1YG9A 4YHPA 3V0FA 4NN7B 3G6DL 4RGND 4XGZB 3W0WB 4AQAB 5JQ6H 2B8OT 1GMIA 2FJHB 2GUOA 3MRDA 5E6UB 5KOVC 4IBUA 5CBAB 1ACYH 3ARGD 1UOWA 1OGAA 4H1LG 5DJCB 5J6GA 1QABA 3D25A 1K6QH 1GYCA 3OX8A 1OWRM 2NW3B 4HJGB 4YDJA 2B14A 3PQYA 4NLAA 1MZZA 2ZXBA 3EGSA 1TO5A 2WUBL 4YHYC 4JFZH 5K59F 4GS7B 4AQEA 4ZW8A 5LBSA 4Z7NF 5INDA 3MBEB 4FZEL 2VLJD 4JQIA 1D5IH 4X6DB 1UWEL 4O2EB 4V1DD 4ZPTB 4Y1AD 4LMQI 3GBEA 1ZCRA 3B2VL 5FGSA 3OR7A 5DRWA 5FO8B 2AF2A 5C09D 2LE9A 4Z3FA 1LHZA 1P5VB 2VITB 3BKJH 2NXZD 1TQVA 1N64H 2WLHA 2J56A 2BWDA 2DTSA 2VDLL 1EDHA 3EF4A 1MRFH 1MRDL 3MRRA 4NSKB 3SDDB 1EHNA 4BE6A 3GHEH 2G2NA 3CZGA 4H26A 1IFGA 4ES8A 2OTUB 2PYEB 3B1TA 4PRHA 2W65B 3DHJA 4OUUA 3ZYIA 4X6EB 3T4YB 4WW1A 3TJPA 2X53A 4M43H 3WE6B 4BSWB 4IRZH 3QQ4A 1AI1H 1H6EA 3RQ3A 3X2QB 4AYFA 3D87B 3BRFA 2EEDA 3VX0A 3QYCA 1FFPB 2WN3A 5AOLA 4MX7B 4OZHF 4NKMA 5CIPA 3VGGA 4JFED 3EJZD 5CN3A 1ZGLP 1C16B 1TQWA 4PI0A 1I8LA 2GCYB 2RIKA 3MJ8A 2P44B 2VLLB 3CSFA 4E2OA 2O6EA 1UM6H 2ATPB 2R1XA 4UNIA 4BEIA 2VN6A 4Y4KB 3VFVB 2YPVH 4MBRA 3PWPE 2O93L 3V55A 4MQ7A 3UYOD 4J4PC 5A2KH 4EMZA 4OSUH 4DO5A 5JXAL 2VQUA 5BS0E 4KY1L 3PV6B 2ZAHA 3MLPA 3GSNB 3QZWG 4KNSA 1DL7H 1XO8A 4WUUA 5AZ2L 5D4IA 3TFKC 4DQOL 4TPRH 5E70A 3QHFL 4GBXC 4GXVH 2J1YA 5HD8D 3BVVA 4L8SA 1GJUA 1NCDL 4NQXB 4TVPD 2OSXA 4JLRB 2DQFB 2HRPL 4LHUG 4TUKL 1LEIB 2GBVA 4J8RA 1YY9D 4BZ1A 4LSUH 3T6WA 5FK9A 1KGIA 3P9MB 5LCVL 1IQWH 3GIZH 2QVTA 2A1WL 1QP1A 5E2WH 2YFNA 4P3WA 5C7XH 4OM1L 1ZANL 3QWNA 3MI6A 3NZ8A 3N5AA 4UQ3B 1BCIA 5I1EH 3DYMA 2Q8AL 3S88H 1S5HA 3KPNA 4YDIH 2EC9T 1PNDA 2X6BA 5HHPB 4OCMC 3LN4A 3W57A 5L9DL 4KQ3H 1A3LH 1J1XL 5IZ7A 3V6OE 2XPGA 3NFNB 4J8QA 5T3XE 5JA8B 1J9QA 1BWMA 4JRYB 5E08H 2EIEA 5C0BB 2BP8B 4W9GC 3ESOA 1MSPA 4NI3A 3PWUB 2IGFL 4Y4HA 5DWPA 4QJ3B 3G9VA 3OGCA 4K71C 3ARSA 5A2FA 4FLHA 3LKNA 4DW2H 1DJHA 4ZX3A 4JY6A 3VFSA 1FC2D 5FS5A 5E6ID 5J1AB 5E0FA 3QG7H 2ICES 4FQ1H 2E3VA 5AOZA 3LPWA 3AWGA 3UMTA 3HLAB 4XNQB 3SKMB 2XZAH 4HGWB 1QUNB 1V3JA 3K8LA 4LU5L 4M61B 5EUOF 3VXRA 4ZYKA 5HPOA 2CCWA 1GJWA 1GGYA 1E8ZA 2WB7A 3ARBD 2PR4H 3GQFA 3H3PL 3HBZA 3L3GA 5HDOA 3IMRA 4LAJH 2TAAA 3IDGA 2HJLA 4F8OA 5LJYH 4ZBJA 1AYRA 3IDYC 3C2AH 4KUZH 3VM7A 1ZXKA 4K55A 4TLKA 4MAYB 5EZOH 3VMOA 3BIKA 3MLZH 4AIXA 4LCWA 2UUDH 2A0LD 3SGJA 4RISH 4KOBA 4ZMVA 1MFAL 2NY4C 3HMXL 3P77A 1GHFL 4HOWA 1P1VA 2LHAA 2GYSA 4NYLA 3V5HA 4L4TD 4JG9A 4N2OA 1EAPB 4BK5A 5IVNA 2HTKC 3CN2A 5A7EA 1BQLL 1ZLVK 3WEBA 2OJEA 1XEUA 3CFEB 5L2KD 1JK8A 3IJEA 1CZ8H 3MR9B 3QULB 4QPEA 4WSGA 4AUJA 5HPMB 5I1HL 3ULUL 3QH3A 5IHUH 3RGVB 4B0MM 4K8RC 2Y24A 3QARA 3ROLB 3AAZB 3ILPB 5F7EH 4QRPD 5D1XD 3E38A 1FA4A 4LGSB 3L3OC 3GI9L 5CF3A 5BRPA 2CRIA 2WUBH 1DSWA 1DQDL 4N0CC 1K9TA 4QHKI 1Z0MA 3U9WA 3DBSA 3SGKA 4ZMTA 2C1PA 1HEHC 2MQ3A 4FZEH 3VSVA 1P7KA 5I5JA 3KXFE 3GMQA 4GRLD 4AYDC 4ZMAT 1XSIA 1FO0H 2BSSA 1UWEH 4XXWA 4G1MB 4UUJB 4XO4A 1T5WA 1CYWA 4FMFA 5I1DB 5JOEA 4KQ0A 3HVDA 1MAJA 2ZYRA 4JQXC 2C9SA 3EG9A 1BF5A 3MRIA 1IC7L 4QRQB 3CZJA 4FD0A 4ZAKD 1TDQA 3WN5B 3DLQR 4H8HA 1O6SA 2VDLH 4MXVF 4RQQA 5L2JB 3T0XA 4AEIH 1WZ1H 3RDTA 3KYKL 1SJVA 1WH0A 3UBXI 2XXFA 4OFVA 2HLFC 2ESVA 5LLIC 1HXMB 3NJXA 1S7RB 1MHEA 2NW2A 1SHXA 1MH5A 3B83A 4N0UE 1OCRB 3POCA 5E56A 2P47B 2BINA 4OI9A 5MEQB 2DYPA 2WMPA 4IRSD 2ARWA 2H1XA 1QQDA 3K1DA 4BSJA 4IK7A 4JR9L 4NQED 3O45A 2BP3A 5F8QC 2H8PB 2EDDA 3DURB 4MCNA 4MB1A 3UGEA 4H1LA 4YSPA 4TN9A 3OZKA 4ISVA 1K3ZA 1LO4L 2YBRB 5CJQL 3RILA 3CN0A 3D0LA 3FUKA 4UV7L 4MMZC 4QHPA 1QSEA 2WOYA 2VW4A 1M7DA 4IMKA 5C6TL 5JXAH 1AZUA 4HK0B 4KY1H 5DRZB 5C8JA 3QQNA 1NCOA 2KQMA 5D7LD 3IJ7A 1QEXA 5AZ2H 4DQOH 2AJ3B 5I8CA 3K71B 1WZKA 2X4PA 5E1QA 3QHFH 1MNNA 3R06A 3NJHA 1KTLB 2H0FA 2V7HB 2NPLX 4ODVL 1NCDH 3WTXA 2DQIL 2ITCB 3QFGA 2AEPL 2G75B 2HRPH 3GF8A 4TUKH 5D9SB 3JWNE 4L1LA 5LO7A 5ISZD 2BVUA 4LQ1A 3GFUA 1UD8A 4HJ0C 3D4CA 2ZPKL 5EH1A 4I1NB 5TE7L 2ORBL 1KNOA 4PJCF 1RI8A 3OKKB 4ACTA 2H26A 4RESB 2B9BA 2O6PA 3H7LA 3QO1B 1ZANH 2QSQA 1EO5A 4G9FB 1XF3B 5F7UA 2APVA 4LPTA 5C0AA 1CBVL 3FU0A 2D8KA 4U6YA 3QJHB 3FFDB 1RZJC 2PCPA 4GQZA 1KCVL 2LLLA 1CGXA 3ZGIA 4J23A 1I4FB 4DETA 2WNKA 4IGBA 3DOHA 5CZVL 1KBPA 3AM8A 5IR1A 4NGHL 2UYLA 4BUQA 1H3XA 5I71B 2Q86A 4MHHG 4AZ8A 4BV1A 4FE9A 2IGFH 4J2QA 5DJ0B 4X5XA 2DWYA 5GGTA 5LWYL 5T3ZE 5J56B 3ZZ1A 5LBVA 3M1BB 1BA9A 1CXLA 1DQML 1QUPA 3AS3A 2UXTA 1MRCH 4AZUA 2Z4QB 4EQ2A 5TK2A 3MV9E 3S5YA 5DMYA 1YEGL 1HZKA 1B2WH 3EYSH 2B3RA 1P5UA 3KJ6L 3AWEA 4DKFL 2RMNA 1NEUA 2Z31D 3QZWA 4TUJA 3TO4C 2F9BT 3WLBB 2IG2H 2X1XR 4LU5H 1UB5A 1R46A 4WK2B 5CZXC 4H0IA 3P73B 3ZE1B 3H3PH 4OLZL 3W11C 3I6LD 2XWCA 2OXHA 4F7PB 3G6AB 2A6IB 4LHUA 4ZDHB 1OTSC 1BG9A 2EKSA 2Y7MA 3GKWH 2HX9A 4QXTA 2IAMB 3ZKSD 1Q9OB 3TBTB 3MLSH 5CGBA 3HMXH 4XVSL 3LB6D 1FNLA 3L1EA 4Y2NA 1RJZB 1P6WA 1BQLH 1FZOB 4J12A 4X9BA 5AYTA 1R3LB 1CT8A 1ZLWK 3UYRL 1ZWIA 1N6UA 5FKPA 5AEAA 5I1HH 3ULUH 5FYKD 3VD2A 1BLIA 1P4BL 3D3VB 4FNTA 4BIKA 1HCYA 4XN1A 4K07A 4G1EA 4YJZL 4NX0A 4Y4FB 5C07E 3KYOA 5I74C 1MVFA 4ZT1A 3VYPA 4ALAL 4JO1H 3MX0B 4O2CB 1U33A 2XT1B 3LNFA 4X6CB 3NJIA 1U8PA 2G5UA 3UZEC 5EEWA 4Q9QH 1DQDH 1BAFL 3KEDA 4XRCB 3GMLB 5CFAA 3PCYA 4KBPA 3FB8B 2YD1A 4PVBA 4F8NA 3KWUA 4HP5A 3ULVE 4D9RD 4PLJD 5K1VA 4RWYH 4PN6A 4CU6A 4ELKB 2VW7A 3RWIA 4AE1A 2DN7A 1ZLDA 3TBCA 4LSTL 1PAMA 3CMOL 1VJSA 1QA9A 4KROC 1IC7H 2BFVH 4MA1B 3MGAA 4NBYB 3QHZH 3T1FA 5AD0B 1UHVA 3BZ4B 2HVKB 1HJCA 1DZ0A 1OP4A 4HGMA 2Q76A 2FDBP 2RD0A 1GGBL 4JJHA 5CSGA 2D9QB 2MKLC 4MFHA 3U2JA 1RPUA 1RL1A 3AMLA 4ORGB 4UT6L 3KYKH 3HR5B 2G2PA 3QUYC 1I8AA 4XCYA 1KJMB 2ZXAA 5HI4C 2R2HB 3NIDE 4G9DB 3WTYA 4WDIA 4QOKB 1P4LB 3U7YL 5L4MA 3VFUB 2VZSA 4AYBA 1DFBL 2VMDA 4DZ8B 4FC3E 5KN5A 3VMPA 3LV3B 4LCCB 3O41B 4KITB 1JZGA 5ETUB 3P1VA 1AO7E 4I9WE 1BMGA 2D2CC 2Q7AA 2DQJL 1M05B 1XGRA 1NIEA 4NQTA 5JOFB 2WIIA 1LO4H 1TOXA 4IRJB 1JDDA 2I9TA 5CJQH 5HHQA 5CINL 4AEEA 3FU8A 3H9ZA 1L0XA 5JR1L 4UV7H 4PH8A 3MRLB 5D7IA 5SWSD 1KCWA 4ODBD 2VDLB 5IM7A 2YD4A 2WY3B 3IK2A 3VXME 3EOTL 2IGLA 5C6TH 4UM8B 4Y89A 4MXQD 1HWWA 2PP8A 2UUDK 4ZMPA 5HYEA 1UA6L 3EDJA 3LKOA 5IJVB 1IRAY 3APMA 4JZJA 3BHBA 1BXAA 32C2A 3VI3F 2W80C 1NBYB 2PWHA 1XD0A 3O8XD 4ODVH 1KELL 3SODB 4JHBA 2DQIH 3UH8A 1OXYA 3UTQA 4XWOC 1RP9A 3QXWA 1A1MB 5GZNA 2D3NA 1TCRB 3ZKMC 5AB9A 4APQA 1QX1A 1H5BC 1FF5A 2ZPKH 4GKLA 3ZYOA 3EH5B 5TE7H 2ORBH 4K4KA 1MIML 4LLMA 2VUYA 3CDZA 3UDWC 2EZ0C 4PRNA 3SHSA 2J8UB 3MREB 4NNYA 1CBVH 1OLZA 1MUJB 3I9GL 4EI5A 4C4UA 1KCVH 4Z3GA 3UTZA 4JPWL 4K3DL 2WSKA 5DD5H 2W9DL 4M00A 3LZNA 1BX2A 4KJYA 4X8JB 5CZVH 2FZ3A 4JKNA 2WLKA 4NGHH 4RMUA 3MFFB 4YH6A 5EU7C 4ZZFA 3KMDA 1CJYA 1LK2A 3MNMA 4OFQA 4ZXBD 3FU9A 4M6OL 3MDJA 2XX0A 2CHNA 1EAQA 1UCBL 2UZYA 2VL5A 4I0PD 4MMXC 3FTXA 3CQQA 3EHBB 1DQMH 1QLRA 4LRIA 3APNA 9PCYA 1WCQA 4J3BA 4NQCE 2XTJE 1OZTG 4P5MA 2PN5A 3GM0A 1G87A 4GSQA 5EO1B 1YNTB 2J57A 2MIZA 4WI0B 5HDLA 2RCSL 3KJ6H 4DKFH 1EK3A 1VFMA 1YEJH 1NIAA 5CGYC 5ILTL 1QMUA 5IG7A 5IY5B 3ETBJ 2NY6D 4OCSL 3L3HB 4FTVB 4YBQC 1X7SA 1M9SA 3ALWA 1PIGA 2WGXA 4WWOA 5FV2A 3T0BA 1ZVSA 4XI5D 3T6ZA 2MWCA 4JFDB 2C9RA 1FVCB 2JB5H 3CFNA 4OLZH 2Y5TB 5ESAA 5MI0B 5C0FA 3IVKA 3BQUD 2VO8A 5A2JH 1K3IA 1NUGA 2YAHA 3D8MA 4I48B 2R4SH 4G7YL 1HDMA 3V4LA 1GYAA 3SJVD 2ZOOA 3NPSC 4IMLB 1ED3A 2ROYA 3KW8A 4YHNB 4HEPG 4XVSH 2UZXB 1EEZA 5IKCA 4ODSH 3OV6A 5HI3C 5EIQA 2GSIB 1NANI 4KK9D 5EFIA 3ZQXA 4AX3A 5KVEE 2QV4A 4GSXA 4BDVA 1TYEB 3MNZB 3IJ9A 5A3ID 1ZMYA 4HLZH 4PCSA 5EEUA 2VUOA 2LTQB 1P4BH 3JVGA 3O4LE 1T1YA 1OE3A 1NFDA 5HVFB 4DEWA 4DOHB 4ZTOL 3S97C 3EUDA 1N5YL 1GGCL 4J3SA 4ALAH 1VFUA 5G4OA 5JPNB 4LE8A 3EO1B 5I6NA 4P46B 1BAFH 3LZOA 4XCCL 15C8H 1Z5LA 3MLWH 2AVGA 5EBGA 4JRFA 1NFIA 3X12A 4G82A 4PJ5E 2LABA 2GJ6E 1XHHA 2IXQB 4ONOA 4FFYL 1TJGL 3TLRA 1OARH 4ZTPL 3ILQD 5LVEA 1JVKA 5DK2B 1MCFA 3HNTL 1U42A 3OG4B 1G7HB 3L2MA 2EILB 2H3NA 4KZCA 3CMOH 1QBLL 3KGUA 2PPAA 3E2HB 1E9PB 3ISRA 3NZHL 3LZLA 4IK6A 4NQVB 3FTGB 3KPMB 1DQQA 1J8HD 2O72A 4FXLA 1ZT4B 3L81A 3V9CA 1XFPA 2VXQL 2C8NA 4DO4A 2ICWA 3MRMA 4JFPB 4P2RE 2JKLA 2C9AA 3RZCA 5KG9B 1YN6B 2IO5A 4N2IA 1M42A 5BW7A 3OQRA 4G2AA 4LESA 5AVSB 4B5ZA 5T1KD 3O4OB 2YXVA 1DFBH 4KRPB 4NP4H 3ML8A 1E30A 2D9CA 3MBWA 4YHLL 4S1RH 1N6QH 3CWGA 2FNBA 3FTUA 1WITA 2PO6D 5J7CC 5HYJE 4Y2DB 3AG3B 3L4WA 2DQJH 1UZ6F 3KYAA 3INOA 1K4CB 1MNUL 3RIAF 4HUUA 5DFAA 3HI1B 3I75A 1JZEA 4H0HB 4I3SL 3PAVA 5GGQL 5CINH 9CGTA 5JR1H 2FO4A 3BDBA 3EYFB 4JKMA 2HZHA 1KUMA 4N2FA 4OD2B 3X1NA 3DUUA 3TTSA 4MJHA 2XV2A 4KDTA 1NMBL 3PWNB 4PD4J 5F1SA 5TDPA 3EOTH 1I75A 3FO0L 4EAEA 3NTCH 5EU4B 4E42B 3OQ3B 1KY7A 1SQMA 4ZNEA 1WZAA 4ABUA 3FZUC 5GSVA 1ZOXA 1WWWX 3GZQA 2K8MA 3VA2C 1KELH 1PX8A 1B4JH 4AIZA 1I7ZA 5DC4B 5F9WB 3V0HA 2X6MA 5I1LA 2G3NA 3CXDL 2UY7B 1LWHA 2XZQL 1NIDA 3UTSA 1XAUA 2D7PA 4NKOA 4ZFQA 4HS6B 4HPHA 5GRJL 3UAJC 2XN9B 2VSDA 5IHZA 3CZSA 5CJOL 2FLBT 4YHIA 1OAZH 1PJWA 3AQYA 3IJYA 4IU2A 4WU5B 1FBIL 5AENA 4I89A 1Z0NA 2ATKA 3ZYZA 4V2BA 5E8NB 3KLQA 3ZE2F 1YQ2A 2DWDA 3O3BA 4AGQA 3I9GH 3MJWA 1SHSA 1S5IH 2X7LB 2XQBH 5LGHH 2BSEA 5F7NC 2PWFA 5IMLA 3F7YA 2DAVA 4JPWH 4K3DH 4UINH 3SQBA 4GAGL 1WIOA 5AL0A 4PIRF 5CD5C 4YHOH 2RHEA 2GITB 2CHDA 3PDGA 1CGWA 2JTYA 3ALXA 5K1JA 1U3HB 2Z35B 3VGFA 4DFHA 3TESA 1EZSA 4FNPA 5D96B 5DEGB 2FB4H 4XX1G 5AW0B 1UCBH 4MCMA 3QORD 5IB3A 4RAHA 4GI9A 5T3XL 3RA7L 4XBPB 1PKQA 1KWKA 4J3OD 1DQLH 3HC3L 4B60A 3S5LB 3TYGL 1IM3A 1S46A 4I18B 1EZUA 2EDMA 5DHYA 1PZAA 2RCSH 1MW1A 1P1ZB 2X70A 5ILTH 3QNXA 4FNUA 5E8PB 4KXZH 4OCSH 4LVNB 4H5SA 1PBYA 2P45B 2Y7LA 4NUQA 2JIXA 4HAKA 4F92B 5C2BL 1FAIL 2OAAA 1DVFA 3U6XA 3HG4A 4LLUA 1LO2L 5FB8B 2YQBA 2QELA 4K3JH 1SYVA 2KLTA 3F12B 2R7EB 3JV0A 4P23D 3T2QA 1CMOA 5FGBC 4G7YH 1JWMA 1IX2A 1GZHA 3RY6A 4P49A 4NO0A 5T5FL 4O4YL 3QIUB 1XR8B 3C08H 4GG8B 4WTWA 2PTTA 4NPJA 5IT2L 4YFLI 2DQHL 1ZS2A 5M95B 2OSLB 4OLWH 5EO9B 5CGMA 1TTCA 5AVUB 2QFRA 3RFZC 2GTWA 3PABB 5KSBF 1B9ZA 2ZE0A 2N3JA 3GBNL 1EVTC 2ADGA 2AV1A 2X0VA 5DHVH 5I0WA 2C1OA 4ZTOH 4ODXB 5ID1A 4MASA 1N5YH 1GGCH 4NENB 2IDQA 3I9PA 2IH3B 1AXSA 3II1A 1YEDB 1ZLUH 4U0RB 4UZUA 1SEQL 3VGAB 1JYWA 1RURL 5I66A 4R96A 1RFDL 2LU4A 4U6TA 4FFYH 2F8OA 1DVSA 2KH2B 4PJBA 1OK0A 2YD7A 4ZTPH 3MV8E 3W9DB 3HNTH 4DEPB 3ZKXB 1TQCC 3RWDB 1JPGB 1A25A 2X88A 3NZHH 1QBLH 3KPSE 4S0SD 5LKNA 3PDDA 2VXVL 4HKJA 4JG0H 3N0AA 2QKIA 3X11B 2ZICA 4RETB 1WO2A 4LSDA 4KAQL 5AYUL 5B3JE 4WNSA 1RZGA 2VXQH 3Q13A 1REIA 6PAZA 4O2FB 2VUKA 2NYKA 1BXUA 3E1ZA 3G6JB 4FG0A 1HHJA 1GZPB 1XIWD 2EAEA 1W72L 3QJFB 3VXSD 1ZRUA 3W37A 3H9HA 1OGPA 4KKPA 5C2UB 4XCEB 1E28B 3HRPA 1N18A 4QWWD 3GIVB 3X13A 4IDLA 4YHLH 1DQKA 1LO5B 2BVQB 1ETB1 3GBML 1D9KD 1IQDA 2AV7A 1A1NB 1JXKA 1ZSHA 3QZPA 4X2UA 1MNUH 5HHOB 4FQIL 1DBKH 1MXDA 4XP5L 1G9NC 4I3SH 5GGQH 4HJEA 4GI6A 1OTUC 4CC1A 2R2BA 4WV1A 1AOZA 5JIMA 4EJ1C 1HNFA 1NMBH 4N5ED 4XTRC 1F86A 4YGAB 3UFIA 3PE9A 3FO0H 4M5YL 3PP4L 2O61B 3H1ZA 2V9QA 3QUZB 5HGGS 4KO9A 1Z1WA 2CUHA 1BQHB 1QFUL 3A47A 3D52A 4X8GA 1XCWA 4A66A 2YZ8A 2N0KA 4WKXA 3D05A 3QZNA 3JUYA 4ZX5A 5GRJH 1KG0B 3FO9A 1ZJAA 3H56A 3QI9C 5CJOH 4OLXL 2BO0A 3RUGF 1FBIH 2NUTA 1EEUA 1WV7T 4IQHA 4EI6A 2DQCL 4FQQA 5A6IA 3E0GA 5SWQA 3DX6B 5L8LB 3WLWD 2KERA 3G5XB 1IC1A 4U7SA 3PUCA 2WZPA 4IOFC 4RIRA 5GS1A 1KIRA 3FB5A 4IIQA 1V8HA 3WIHL 3QQ3A 2XCMC 4GAGH 3TBYA 4J6RL 4DVBB 3T3PB 1KCRL 3FU6A 4ZUUB 3GK8L 2CQVA 1UD6A 5AALA 5EU3A 5PAZA 1EH9A 5D1ZC 3EYQC 3BPCA 5T3XH 3RA7H 1RIVL 2NY1B 1SDDB 4FG2A 4WHTA 3HC3H 2FO1A 1JNNL 3OBAA 3TYGH 1G9EA 5IROD 1DEEB 1IC4H 1O9VA 1SZNA 2E9IA 2XKNA 1J0JA 2AJZB 3O6FD 2ZUSA 3ZTCC 4A2GA 4RMSA 4APXA 4F20A 3B3IB 1P7QA 3EUUA 2B3IA 2F0CA 4DGVL 4WI3A 3V6ZA 3ZT6A 2OULB 3C5SB 2OMUB 1SHMA 1TVHA 4N86A 2KBGA 3QNYA 4M8VA 1UXWA 2SEBA 5BS0D 5C2BH 1E5UI 1FAIH 4W68A 5C86A 1Z66A 4WTZG 1A2YA 3MRHB 4IBYA 1LO2H 2ZJSH 3DPBA 5B4MD 4P9ML 3L9RB 2WVVB 4P05A 2VXUL 4PTUB 1TZGL 5D7IF 2EE2A 3CFDB 4PRHE 1BV8A 1C08B 3Q2NA 1HWHB 3SY0A 1JUFB 1MI5E 4M8QB 5DMIH 2IADB 2EYSA 5DMGD 5T5FH 4O4YH 1T21A 3FO1A 3EKCA 3OHXC 1V5JA 4JFFD 5IW3A 4NIKB 4UTBA 1UM4L 5MENA 2DQMA 4FEMA 3ZE0F 5EBLB 3HE7C 3GLDA 2R1YA 2TRYA 3HTLX 1E5AA 2HT4D 1FIEA 4G6ML 3W56A 2CDFA 4GOSA 2A83A 4RA3A 1HEZB 1Q94B 3UPRA 4HIIA 4BUHA 4CNIB 2FLRT 4GW1A 4JBSA 4OVVA 1NGXA 3GBNH 3TONA 5B1BB 5E1AB 4QRRE 4CVZB 1ET8A 3AGVA 2J5LB 1KIQA 4LLWA 3TS8A 2DQTL 5F0PB 2VLKE 5AW9B 1XVSA 2K3HA 4D0BB 3NYKA 3WJLA 4FLQA 2D7NA 1BJ8A 3CVDA 1EEQA 1SEQH 2XICA 4IU3B 1RURH 1X9LA 3QG6B 2HUEA 4PJ9C 4X98B 2R0WL 1SRDA 2BZ7A 3C6LC 2CRYA 2GK2A 4AGOA 4FLSA 2C9QA 2IMMA 5E9AA 3GRWH 2GT9B 2JQAA 3DTXA 5BO0D 4PJ8B 1NCUA 2VXVH 2AI0L 4FRWA 5IUCA 1HH9B 4LL4A 2X38A 1KBKA 5JZ7C 1KULA 3ULVL 1T7VA 3VACA 1CICB 1LWRA 3RX9A 3MOBL 4QF1A 1O7SA 4LLYA 4WFHD 2VZOA 5DHVB 3ZRSA 4XAKE 4C56A 1SBSL 3U25A 3FQNB 3ULAB 1CURA 1W72H 1PGRB 3MCLL 5G5DB 4U1GB 4ZFOL 4U1HB 4GKSA 4FFZL 2WXPA 2YXWA 1AGFB 1GYWA 2E56A 3BWSA 2J72A 1BECA 1KGYE