2BIOA

Human p53 core domain mutant m133l-v203a-n239y-r249s-n268d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
186
Chain Sequence
VPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRSPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 42
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bioA00
1HJCA 3D06A 4GUOA 2ADYA 4L0YA 5AOMA 5LGYA 1HJBC 1HU8A 3Q05A 4LOFA 2AHIA 3EXLA 3WTUA 2J1WA 1IO4C 3D08A 5AOLA 2J1YA 4IBZA 2FEJA 4IBQA 2PCXA 5AOKA 4HJEA 5AB9A 2X0WA 4KVPA 3VD2A 5KBDA 1KZYA 5G4NA 4MZIA 1EAQA 2XWCA 3Q01A 3D07A 5ECGA 4IBWA 4AGPA 4LO9A 4A63A 3WTVA 4G83A 2OCJA 1EAOA 4MZRA 2J6WA 2X0VA 3WTYA 4IBVA 3IGLA 1E50A 2X0UA 2BIQA 4IBUA 4XR8C 1CO1A 4IBYA 2MEJB 4IJTA 2YBGA 3KMDA 2J1ZA 1TSRA 2IOIA 2BINA 2ATAA 3EXJA 4LOEA 1GZHC 2IOOA 4GUQA 4AGOA 3US1A 3D09A 2J20A 2AC0A 1GZHA 3WU1A 5AOIA 3QYNA 4G82A 2GEQA 3IGKA 5G4OA 3ZMEA 5ABAA 2BIMA 2XWRA 3WTSA 2WGXA 4AGMA 2J21A 3Q06A 4AGNA 5G4MA 3D05A 2BIOA 2H1LM 3US0A 4IBSA 1YCSA 4QO1B 3WTWA 5AOJA 3TS8A 2VUKA 1EANA 3VD0A 5A7BA 3VD1A 2BIPA 3D0AA 1T4WA 4IBTA 1CMOA 4L0ZA 5BUAA 3WTTA 4AGLA 1TUPA 2P52A 2J1XA 4AGQA 3WTXA 1LJMA 4L18A 1UOLA 2RMNA 5LAPA 1H9DA 3QYMA 3KZ8A 2IOMA
chains in the Genus database with same CATH superfamily
3GXNA 3Q7JA 2VDKH 3LSOA 1WQVT 4AITA 3WS3A 4FZEL 1BREA 1Y18A 3WLWC 4AEIH 4YS4A 2ZG2A 1AH1A 1EHLL 4RIRA 4DW2H 5E5LA 3UBHA 1YEIH 2MCMA 1ODAA 1T7WA 3DYPA 3IF1A 2DIBA 3HG1A 5HYJD 4KZCA 2CDFA 1KEGL 5DJXA 3GBMH 1UWEH 1LO5B 3PQYB 4WFEE 1CXKA 4F33B 1E4WL 2VKWA 5CBEA 1OSPH 5IGXH 1U2CA 3LIUA 3S3DB 3CFDA 4UIKH 1FP5A 4PB0L 1HAUA 4Y1AB 4M5ZL 1HKLH 3TEYA 3CDZB 5DJ2B 5IQ9B 5IW1A 4KI1A 5ENWA 4DZBA 4K73A 1W72A 4HOMA 4ZRGA 3V0DA 5DYFA 4WO4B 4WWKD 2VQ1A 3RQ3A 4KZDH 3F5WB 4PBXA 1FO0H 3JV4B 4FFWD 4QDGA 4M9OA 3B9KA 3CXFA 1OZUA 3JWDL 4HIPA 1SLXA 2YFOA 5L6YL 25C8L 5B39G 3FQUB 4Z7QE 3QQ4A 3GEWB 1G7JB 4L5FE 2Q76B 4MD5B 4NQDB 2ZXDA 1T83A 4PJIA 5DD1L 1HDMA 1AZRA 4KKLC 4LSUH 3U1SH 4C4KO 4BFBD 4FF9A 3SDYL 2WWOA 1A6UH 4U2YA 1BJMA 1R33A 2XVGA 2UWEA 2XYBA 4PAZA 4KJPD 4BFIA 5JUEH 1N5AB 2ZCZA 3WBDA 5D71H 3NG5A 2X6UA 1PKQE 1LP9A 3NJIA 2HJKA 3TTSA 3QWOB 1XB3A 4LVOC 3O9WD 3QQNA 4H1LB 3U7WH 5HHQA 4Y4FD 1MAKA 5T3ZH 2CJ3A 4JO1H 4K9EL 2OJ1A 2VW7A 4ANUA 2OXGB 1HH6B 4YHML 2YD6A 2WVSA 3QC5X 2OMWA 4GRWF 4PUBH 3NSCA 5D7KE 1C12A 2H9GB 3MBEB 4RDBA 5IESL 1UUSA 2NNAB 2NY3C 3I9GH 5KSBA 4ZUVB 1UWFA 3NPSC 2CKBH 1N10A 3GZPA 4XI5C 3PHQB 4EF3A 5D4IA 2I9TB 5HI4D 3RTQD 3HS0A 4JRYA 4Y2NA 2XPGB 4DGYH 1AE6L 2PCPA 4OCWL 1QSEE 4G3YH 3IAGC 1CE6B 2KLTA 4CDGC 1ZLDA 5E95B 4W9JC 5G5DB 5CLYA 4S1RH 2AJSH 2QV2A 3FUMA 2JFCA 4RA0C 4AGQA 1FAKT 1FH2A 1S9WB 4X6DF 4UQCA 1II4E 1ORSA 5D2NA 3U30C 1AJ7L 1S9VB 3ILQD 3UTSA 1TU2A 3CHOA 1E65A 4PGJA 5F1NB 1HQ4A 1YMME 2AEQL 4R7DB 1TG8A 3UPRA 3QUHA 4JE0A 3W9EA 3QDJB 1ZLSH 1BMGA 5L4IA 1CLOH 1Y0LA 1GJIA 4X7SL 3QO1A 1H6EA 3OKKA 1T2QL 5ISZD 4W68A 4AG4L 4M7LH 4OD2B 2GUOA 1ID5I 5FYLE 4K71C 4R97B 2F54B 3BHBA 4HPYH 3C6SB 2V6HA 3GSQA 4KOBA 1EEYB 1G0XA 2OMYA 3U1PA 5AKTA 2Z92A 3BLBA 2YQ2A 4N2BA 4XN8A 2DDQH 1BAGA 4JY5H 4Z7UF 2ZCLL 2ZUQC 4RNRB 1JCVA 2APSA 3LQAL 4PLNC 1KJ3H 1IT9L 3B7RL 1AY1H 2AITA 1VADA 5FGSA 4ALAL 4CSTA 4LVEA 2X42A 1H0DB 2K9FB 1E4KC 1E28B 2VLJD 5T33H 4DUWA 3WO4B 4ZUSB 1HZHL 4G83A 2MPAH 2FZ3B 2GIXA 2XWJA 2LGNA 5F7YC 2PWGA 4G8GB 3M86A 4S2SA 1JMXA 4NWUL 3DBXB 2EE0A 2R0LH 3VA2C 4ODHH 5B1BB 2V0AA 2ALAA 4R8WL 2VISA 3HZYB 2CDGB 3VMNA 1TSRA 5MEPB 4GYBA 1ZEAH 4UINH 4G6JL 4ADJA 1UQSB 3E6FB 3LNDA 4D9QD 4F57H 4N0YH 3LAFA 4RH4A 4OLVL 1U8CB 2EACA 4NYLA 1JFQL 3PWPA 3WHXA 2CO7A 4ENZA 3OG4B 3QDMD 4FFTA 5I8KH 1T5XB 3HNVL 3UPAA 2TAAA 1F11A 1F4WL 1CE1L 4A2HA 1NIAA 3DX7B 3MCLH 4KTYA 5JXEC 1SYVB 4N1EA 5DVPA 4PRIB 4L1TA 2BIOA 3MO1B 3ARGC 2OMVA 2H6PA 1OCWH 1YY8B 2VDOB 4Y19D 2NQDA 2UV3A 2BSRB 3LZQA 3FL7A 2LLNA 1FZJB 4HEPG 4IKIA 5D93C 1CD1A 3DJSA 1KBKA 3D0AA 4R0LB 3P3UA 5GRXG 3ZX1A 2H0PA 2JK5A 1A2YA 3L9RA 1QTPA 1NFDE 4UT7H 3V4UH 4F7PA 4WIQA 2FNBA 3QSKB 3JYBA 1KN2L 3G04A 5GSVB 3GKWL 5CHNB 5GGVY 2PWEA 5AWNL 3D7PA 3QYMA 1TCMA 1NMAH 2CM5A 4HWUA 3FQ2A 3AY4C 4GBXA 4JAMA 4Z0BH 3V0FA 1MJJB 4EIBA 1U21A 5IVZB 3SYCA 1OAYH 5BVJA 2PP7A 3OR7A 4OAWB 2XFXA 3PGCB 3HMXA 5LGJB 3QRGL 4QTHB 2ZCKH 1NMBL 1JBJA 4JB9L 2NY1C 2E6PA 2P1YA 1B2WL 3QIWB 3VFGL 1PL3A 2DWSA 2QGDA 4FYRA 4RGNC 4BH7A 4EI6B 3L9BA 3LKOA 5T1JA 4F7EB 3PQYD 4UNUA 2OMZA 4DGWC 1PDKA 3MN8A 4HYTB 3OZKA 3LS4L 3FQTB 4WI0B 3VI4F 5L2KB 5ABZA 3H2PA 3LPGA 3BN9D 3DPBA 2D4FA 4NP4H 4HZAA 2QFPA 5D70L 2YK1L 3PGDB 3KWXA 4Y1AD 1NBVL 4HSCX 3TVMA 3JWOC 1MIMH 4XPBL 4LLYB 5F7EH 2NYZA 2A77L 4R90L 4WO4D 2P49B 4EUPB 4PBWD 3BDYH 1DE4B 3KWVA 3M46A 1WZ1L 4UWQB 5GZOC 4R7NA 3K5RA 1HCYA 4XCFH 4Q7DA 4DSYA 3NJLA 5DJZB 1S46A 2AQTA 3W2DL 3Q5YA 5FO9A 3QJHA 4FMFA 5J3HC 1FRGH 4FE9A 4NQDD 3RB7A 3WIAA 1WWWX 4CJ0A 2J72A 2V33A 1NGYA 5GJSL 2BSTA 2VYRE 2DN7A 2ZPKL 3AG1B 3FYIB 4C4KT 5KVEL 2VITB 1T0PB 2GITA 2VO5A 5F6IB 5L0QB 1OAKH 3D39A 4MB4A 4HQQL 2YGOA 1R5VB 1CDJA 1F86A 4J7RA 3US1A 2DH3A 3Q9QA 5AOIA 5BQ7B 1TQCB 3QRLA 2O72A 5I76B 1J5CA 4Y4HA 5E51A 1ITCA 4GSDH 5E6IA 3VQ1C 2KLRA 3F58L 1HHGB 3VRIA 1CLYH 1L0XA 1U8PB 1A66A 4I13B 2MMXA 2FL5A 3HA0A 2OW6A 4NOBA 3RPKA 1LO3L 3OKMB 3NN8A 4MJIE 3US0A 1UZ8A 1UXMA 1EXHA 5HGBB 4XCCL 3GC3A 4W70A 3KLHD 1JGEB 3QUML 1F6FB 3Q2NA 4PGBB 2V7NA 2XIIA 2Z64C 3F05A 3FULA 4UI2A 5D1QD 4JPVH 3ARXA 1KPUA 1FSKC 2ICWA 2BFVL 1UUNA 2ESVA 2YUZA 3U0TA 3FB6A 2FJHA 4Q2ZA 4OCNC 4TNGA 2X4NA 3V0VB 3T09A 2J1XA 5HDRA 5HGDB 3X1NA 5K1VA 4MMZA 2XTJC 6FABH 1ZHKB 4AYEC 5CEZE 2RBLA 5DWUH 2A9BA 8FABB 5M95B 3L5WB 3MRRA 2WW8A 2VAAA 3FSOA 4LKXB 1W8EA 2XWBA 5DHVH 4L8BB 2VAJA 4FQQB 1E4HA 1BEXA 2IADB 3QDJD 4UDTB 3HAEH 4FX5A 3ZDXB 3DPDA 3NTCH 1KB5A 4ANVA 3QZWG 4V1DE 5KBMA 3NGBC 3B1TA 3ZOAA 3BYYA 3LEXB 4HXBL 3B9EA 4X4XA 3RGVA 5IVXF 2F54D 1RK0B 2MCPL 1MWAH 3N6YA 2QQKL 4Z3IA 1OCZB 2MKWA 4U6VH 5KUKA 3B6SB 3RFRA 2IWGA 2CRMA 5K1JA 3NDYE 1LK2B 5FYKD 3V5KA 1Z1WA 5IY5B 3JBG7 1P5VB 1U8MB 1HVXA 3BFOA 1SLWA 3FB5B 4JG1H 3WY3A 2FEDC 1YYCA 2OMNA 3DUUB 4R4BA 4N8VA 1UD5A 2JI2A 5IBTH 2P28B 2ADIA 3TH3T 2FWSA 1HYSD 5FGCE 4G8GD 2OJZH 1LMKA 4WW2A 3NIGF 1SY6L 1G5AA 4L23A 1SVCP 2HVBA 3PNWA 5D2LE 5ANMA 4MXVE 2WPGA 2GJ6E 2O6EA 1QOKA 1FNFA 5KVFH 3QEQE 5DFVC 4RFNC 4KX8A 4PBDA 1LEKA 4F9PC 1IJNA 1GR7A 2E4TA 4IOFC 4UYQA 3KW8A 5DDHB 2WZ0A 3AAZB 4LQFH 1CL7H 2APBA 1IFHL 2EIJB 3PAVA 2AC0A 5D6CA 1UTDA 4JDZB 4HJIA 2XN2A 2ADFL 3OX8A 4NGHL 4XVSH 1HWWA 3ZBMA 2YPKA 1HSAA 4KQ0A 2XIBA 4TNEA 4W9ZA 4IK6A 3ARUA 4XBPB 5EU6E 4L9DA 3FPXA 4PRID 3IMUA 1IC5L 4K3DH 4PRBA 4X7TA 2ZCHL 3NSFA 2DYPB 3IDXH 1S9KC 1CDUA 3NDZE 4IRJA 1RH8A 3M07A 2W81C 5IMLB 1MCDA 4E68A 1BIIB 2ZWSA 2IQAB 3QS2A 1T6BX 4NZTL 2W0KA 4L4VA 4DP9X 3CFBA 1BWWA 3D2UB 4YSAA 1INDH 5IT2L 4CVZB 2APVA 5C92A 3BZ4B 3GEFA 1NCUA 1YN6B 4JQIA 5DHYB 5ERWA 5ADPH 1UXWB 2BW5A 3S3BB 5LBVA 1F6LL 1JF5A 2Z0UA 5MEOB 1MWOA 3O2DH 3ZT5A 3A3YB 5K5YA 3MJ9L 3S3CB 3IPFA 2MPVA 3TPUA 1J5OH 3L7FB 3O0RL 3VXSE 4YHYB 1NKOA 2P44B 3KDPB 3KZ8A 2MCG1 1S7WB 1D2PA 5HHOE 4XP4L 3NJVA 5D1XD 5F21B 2Z91A 3SE8H 4K7PH 4P4RB 3ME0B 4R7XA 4PJ5A 4H8WL 4AVKA 1G6RA 4B0MM 2DQMA 3MRFB 2B0SL 1FYTA 3L3GB 4H8UA 5EO1A 4NC0B 3IJYA 3MLSH 4TOYH 4I4WB 3FT2A 3O6KH 3QIWD 3ZHDA 3QHZL 5EULV 4TVUA 4X6EB 3K6SB 3BESR 2CO3A 4X5LA 3VFUB 1K4CA 2A73A 5EC2A 4AV0A 2HRPH 4NQXA 4OIBA 5L2KD 1AD0A 2XZCH 5CP3H 4ZX3A 3LDBC 4A2LA 3ULUC 5IJKA 3DDFA 4NAQA 1ZHBB 2VKXA 5IHZA 2D3NA 1B0GB 3CZFA 4G7YL 1UB6A 2W9EH 5GS1B 1FDLH 3CBKB 1K8IA 3MREA 1Q4NX 1VA9A 4WU5A 2LT9A 2J6WA 3FSWA 3H42L 4MNQA 4R3SA 1GPOH 1RLWA 3BH9A 3E9UA 1S7VA 1KIPA 2ILLA 5HJ3A 4B9PA 1M57B 3IDMA 3VU1A 1VF5C 4DP7X 4GP5B 4LLWB 4O2EB 1QO3B 2DF3A 3PV7A 2LR4A 4J5VA 1XF5A 4U1SA 1NEZA 1E90A 4WTZA 1F4HA 4KBPA 3RWIB 1OB1A 3SGEH 2XI9A 3QH3B 4OH2A 2QDVA 3RVTC 4U7SA 1IBZA 2DQGL 4LCWE 2P8PA 1UM4L 3CK0L 3F7VA 4HJSA 4U33A 3TA3B 5F7KC 3QA3A 4AEEA 3L3IB 4JO8A 3EO0B 3UCRA 3SY0B 2NUPA 4UM8B 5FK9B 5AL0A 2L7JA 3B4NA 4QHKI 1R5WA 2YD8A 3BUBA 4LGPB 2GABA 4WQOA 3RU8H 3TIDB 4J6RH 4R26L 4KROC 3X11B 4MD0A 4QRRB 2CD0A 1CU4H 1JNHA 3JZ7A 4F8TA 4KO9A 4H13C 1J5DA 3STZB 1MLBA 4Z76B 1ZHNB 3FT1A 2HJFB 5IROA 3JTSA 5GS0H 4LSPH 4JFOA 3C5ZB 5DD3H 4DGVL 4N85A 5HDQH 1IAII 3PHOB 1D5MB 2HFTA 1I8LA 3ENEA 1ROCA 4IRZL 4X0NA 4OCYL 5EORL 2W91A 4I9XA 4MA7L 2D31A 1OF2B 4FXTA 3I6GB 4A6YA 4KNQA 2YOAA 4PYGA 2K45A 4O2FA 3BQUD 3U83A 1MCHA 2R0KL 3T3PB 2MNUA 5L4JA 2PYEE 1G7IB 5CJXC 2I69A 1J0KA 2C9QA 1DQVA 3PNRB 2J8OA 2WQ8A 1CBVL 1YMHB 1T04B 3D52A 4XBEH 3QZMA 2HN7B 5FKPA 4BFFA 4S1QH 1SM3L 4PWFA 2IPKB 4G6ML 4K8RC 1WYJA 3ZO9A 5CJQH 5B8CA 5HDWA 1RHHA 4LGRB 3HHMA 3KBEA 3UTZA 4BSWB 2FO1A 1IBGL 4NSKB 3KPQA 1QSFE 4YHZH 3UC0L 4N2OA 4GPVA 1TEYA 3U82B 3OGCB 3RWEA 5J12C 2PCXA 1KZQA 1UC6A 1MF2L 3FPYA 3PFQA 4PJ6A 3DSNB 4L8DA 5EIQA 1CLZL 4RMQA 4B9ZA 2FQDA 2ATPB 2NY1D 4QCIA 3C08L 1DANU 1BD2A 3WKNA 3ECUA 4U6TA 1C5CH 2HYMA 1C5DB 1GSMA 4HU8A 4GQ9L 1G7PB 3BISA 1KENH 3MRQB 4DKAA 2OZNA 3VXPB 5A1AA 3N0AA 3W5MA 4J3OC 3DXAD 5A16A 1F4XL 5IV2B 3TEZA 4I2XE 4Y16D 1EO5A 3WMQA 1E5AA 3LCYA 3AY2A 3N43F 4G6AC 3RI5F 5C7XH 4FJ6A 3SSGA 1XTMA 1JGLL 1NH6A 3FC8A 4P48A 5DJXB 1LEGB 1O9VA 1EHNA 1KTRL 5GZOD 5FWRA 1A6VH 1DUZB 2DIEA 3V8OA 4HIEB 2QPDB 4MYWB 1MVFA 1VZHA 5DFTA 5CBEB 2JI1A 4P2RE 1AD9A 3MFFA 4JJHA 1OTTC 5GJTH 3GXPA 3FOLA 3N9GH 4Z6AT 2D2OA 2E9JA 4PJAF 5D96C 3N85H 2MOVA 4OB5L 4KI5C 4DH2A 2VQ1B 4PMFA 3MRBA 3M88A 4ONGL 2DYPD 1KJ2H 3MQIA 2NMSA 3IWUA 5BZZA 3ZTNL 4X7CC 3D2UD 2A7BA 2BJMH 2WXNA 2C3VB 2ICWJ 5DS2A 2P80D 3WJLC 4PJIB 1NBQA 2JTYA 4MB5A 1JWSB 4FZEH 2XXFA 3NJFA 2UWEB 4U1LA 5DRZA 3V6ZA 3JV6A 4EQ2A 4BFIB 4ZMQA 5BOZG 1EHLH 1TFHA 2IFGA 2IDCA 3CU1A 3TURA 3MUJA 4MS8D 3LRMA 4PJBA 4G9FD 2XCMC 4Z7OF 2VB5A 3W56A 1KEGH 3QNFA 3QDAA 4LCCC 2HJKB 4CA4A 2DIAA 1YG9A 4GOSA 3VO0A 1MXGA 1JGVL 2FECL 1SLVA 4FQXC 5C0AE 4PB0H 1OF0A 4B5ZA 4M5ZH 1HC1A 2LLLA 2VNCA 4KK8C 4YHPA 4APXA 2C34A 1G9HA 4DPBX 1X44A 1NCHA 4J4PC 4IS6A 1UVQB 3HS0B 3TPKA 4JRYB 5KSVA 2PPAA 1EX0A 4X6FA 1ZD6A 3DURA 4OFYA 4F7MA 1A8ZA 3JWDH 4F1SA 2VZSA 3BWZA 4WWPA 25C8H 1THCA 3L45A 3VWKB 2YBRA 2N1TE 3QUXC 1FORL 3ARSA 2UX7A 5IR1B 1S3KL 2VDNB 4OGXL 3ARVA 4W9CC 5DD1H 2MCAA 3C60C 1SDYA 4KKNA 3JVGC 5D2NB 1WUNT 3UTSB 3FBKA 1NIDA 1TU2B 4P59L 4LEBA 4EXPX 4MBRA 1HQ4B 5FAAA 5KVDL 1TO4A 3UPRB 4FXGA 1MI5B 1FVEA 1Y0LB 1T5WA 9CGTA 4ZUUA 1D2OA 5F2FA 3FTSA 3LN4B 3OKKB 5E8NA 2G0KA 4N2KA 3LHPH 4MLSA 1TKWA 2ZOLA 1SQMA 1YZZA 4PW9A 1UOWA 2ZAHA 2UZPA 4K9EH 4YHMH 5BV7C 4N5EC 3BHBB 4CADB 4F8QA 1U8KB 5IESH 3ZLQC 2OMYB 3TA3D 5DZNA 3P9WB 4LPWA 2Z92B 3DGDA 3V7AG 4G82A 2BPBA 1XSIA 4LSDA 5J89A 3VAEA 2BSEA 4LSSL 1C1EL 2CBPA 5DFVD 3FO2A 2EEDA 1FIGL 3L4YA 1MH5A 3T6XA 5JW3H 2VN5A 2WSPA 2QJDA 5H8DA 1PLAA 3G5YA 4KV5F 4ODBD 5HHVL 2XWJB 1F56A 4N0UA 4QRRD 1S2EA 2FEEI 1YCSA 2Y5QA 3BPNC 3CXDH 4AUYA 3D4GA 3DTUB 4YSUA 4MNGE 1AJ7H 5I6PA 5DD0H 4PRPA 6TAAA 4KRPC 5HYSB 3DNKA 2H3KA 3BAYA 3ZZQA 1RULH 2AEQH 4HETA 5I0WA 5F7AA 3MRHA 1FFQA 2YD9A 1QLEH 5E8PB 3TN0C 1ZXQA 5K9QI 1QHQA 1O7SA 1AZCA 4LVHB 2X38A 1MDAA 5C2UB 1WT5C 5DJYB 1T2QH 5HYQB 4NYLB 4AG4H 3L7EA 3PWPB 2CO7B 3KYKH 3QXDA 4K3HA 3SIKA 1LO2L 3U2IA 4CU6A 1IV8A 1XD1A 2P43B 1OSZA 2AEPL 2C7FA 4Y2LA 4J6IA 5K9OA 1KXQE 3CLFL 3DMMB 4MHHG 3BPOC 2WKGA 4P2CG 4WZ9A 5HD8C 1SZNA 2EC9T 2OMVB 3EJTA 3LQAH 4EDWL 2F7OA 4TSAL 5MHSD 1FFPB 5IB5A 3P69A 5I23A 4PLKD 1HZHH 1A4JA 3ZYOA 1HX0A 4HKXA 2W0LA 4PS7A 4QJ5B 2AJZA 2KZKA 1BG9A 2DS4A 2QTVA 4M6ML 2JK5B 1A2YB 2E9WA 4NWUH 4HOXA 4YBLB 1KELH 4F7PB 2G60L 2VLKD 5BRZB 4GS7B 3FCGA 2JCCB 4GIAA 2HKFL 3G04B 1QRNA 3LEYH 2WZPA 4R8WH 4IK7A 3BOVA 5GZNC 1X7SA 1N3NA 4G6JH 1WJ3A 7FABH 4D0BA 4XXCC 5I71C 4K94C 2X6CA 4D0CA 1WC7A 1J0JA 3BZEA 3NCYP 5GIRA 3TYGL 2VM9A 4NZJA 3TZVA 4NERA 4L48A 2A6JA 3ZRFC 4UYPA 5BVJB 2BHZA 3MCKA 1J8HE 2C7UB 3DX8A 4PJEE 3BO8B 1F4WH 4KZ0A 1LM8V 1A9VA 3SGKA 2BWQA 3POHA 4N2AA 1GGYA 2EAEA 4M93B 4OD1L 5ES4B 1A3RL 3UBXA 4XMKL 2QHLA 4XWOC 5KYUA 5L8KB 4CU8A 2BNRB 3KJ6L 1WPCA 3KXFE 3E38A 3LKOB 2YWZA 4GP4B 3S36L 2OMZB 5CCGE 3GMMB 1JUFB 1PDKB 2CHDA 4HC1H 4L3ED 5G2NA 4ZX4A 3CSTA 4OZHE 5IOKA 4HHWA 3BMWA 4JRXA 1WFUA 3HMWL 2HG5B 1I3GL 2X9ZA 5DD6A 1E4KA 1NAKL 3TVMB 5BZWB 4LVNC 2F6AA 1A1MA 2EDNA 3UERA 3QQ9C 4OZGA 2VDNL 2EDRA 1L7TL 2WLYA 3TXAA 1NCOA 3HS9A 4K5OA 4R4FL 3OAUH 1KN2H 3HC3L 5E8DL 1JYVA 3BRGC 1GIGH 5E5RB 4R7NB 5KW9H 3C6LA 1P5UC 3O4OB 1VZGA 5AWNH 3SQOH 1UKQA 4Y5VC 2DEXX 5FO9B 1P84K 1L6ZA 1MIEL 1HHJB 4MYPA 4A66A 4C54A 5BUAA 4HJJH 5F7MC 2NSMA 4JM2C 3BLKA 3VI3E 1A7OL 4BK5A 3QRGH 1N70A 2CG9X 4H1LH 4MAYB 1UACL 4MJ5B 1NMBH 1HKFA 2IDFA 4JB9H 5KSUB 1E6OH 1B2WH 3VFGH 4GG6B 2J55A 2P24B 3LB6C 4LARH 1ILUA 4Y4HB 1JD9A 4HAFA 1VFMA 5E6IB 2BWDA 4BXVA 3ARGA 3AQXA 1J9RA 3VRIB 1QTYT 2DZEA 5HTSA 2WNGA 5GHWL 3IDNA 4YC2C 2FL5B 4ZMXA 2YK1H 1YY9C 2CBOA 4U31A 3ATBA 4J2XA 4ZW7A 5BUPA 4IGBB 4XPBH 2AXFA 4P49A 2OFQA 3WDIA 2ZD0A 3QDGA 2A77H 4E2OA 3ISWA 5FDWA 1J1XL 4YR6B 4R90H 3F65A 2IALA 2ICEB 2Z4QA 3WNNA 4X4YA 3FTZA 4JRYD 4UB0H 1WZ1H 1KPUB 1QW8A 3F7LA 2ESVB 5DRXA 4C8XA 5HYEA 3U0TB 1R3HA 2XACC 3OBAA 4LHUA 2FJHB 5GGVL 1FG2A 3VWKD 3W2DH 3G7TA 2GBUA 3BD5A 4U6XA 5IJBC 3V2AR 4JKWA 4V33A 4YBQC 5GJSH 2ZPKH 1YPZF 1TYRA 1PG7H 1YEFL 2OW7A 4M8UA 4YGAB 3LNGA 3UTSD 2O61B 2C1PA 4P5KB 7PCYA 1GC1L 4MA3A 2AV7A 3ASWA 4HCIA 3UH8A 4HQQH 1N7MH 2XWBB 1BHGA 2ED9A 3QW9A 1QBLL 1K2DA 3OXSB 1MI5D 5SX5K 1V55B 3U6RA 4LPTA 4HUUA 3ZMNA 1A1OB 2WGNB 5EU5A 3WAJA 4TSBL 1QUPA 2D2CC 1DQQA 3D18A 3GRBA 4X4XB 3RGVB 2F61A 2N0MA 2KDGA 3MA7B 4J3OD 1Q9LA 4WK0B 4ZDHA 3N40F 2E8ZA 4XCCH 3VFMA 4YUEL 3L81A 4LASL 2ZYRA 2J4WH 4XN1A 5CNHA 3QUMH 3S4SG 2WXGA 4FXKC 1JZ5A 1TQUA 1UZ6E 1A7NL 2R1YA 1X5HA 4R4BB 2NY7L 2G5BA 2BFVH 4N8VB 3D3VB 3JXAA 5TH2A 4AQOA 4M8QB 2WZAA 5CUSH 2YAMA 5CU5A 3RKPA 5F72S 1Y6NR 2ADIB 5T5NF 3VNZA 4TLUA 1IQWL 2XSKA 2WLHA 3F7YA 3VG9C 4WW2B 4X6DA 4EEEA 3H3KA 3FQ4A 1D5XB 5GGRY 3WFDL 2EYTB 1CICD 1E3ZA 1KB9K 1A21A 1B90A 4KI5D 4A2DA 3HMXL 1TQBC 5E5UB 2EZ0D 1MFBH 2A5UA 2EIZA 4LHQB 4TVPL 2P52A 4FJZA 4QRQA 3UOAB 4ZOAA 1P4IL 4YSRA 4JVWA 5DHXB 3BP7A 1EEUA 4W9LC 4X6BB 3PWPD 3OD3A 4AM0B 4ELMA 1RUML 3OX8B 4HXBH 4X99B 2LQRA 2MCPH 4ZT1A 4EN3A 1F3JB 4QRTA 1MCPL 4G7SB 3DMMD 5I1AB 2CRIA 1WITA 4X7TB 2O5ZL 4PLOB 4Z7UA 1TETL 3NZUA 4N2EA 3GI8H 4IRJB 3PDOB 3WKPA 1BF8A 3SKMA 2IPUG 2YN5A 4IDLA 3WTUA 2PF6A 1CDIA 5LCVH 2QVTA 1IGJB 2OTUA 2IDQA 4HMDA 4L4VB 1AR2A 3EOBA 3ZGHA 1U41A 1SUHA 3QZOA 5ERWB 4WDIB 2FO8A 2N4IA 1RJLA 4JFZL 3F12A 5F7BA 4KJYA 5HI3C 1WAAE 3MV9A 3TO4B 1SY6H 3ZTDC 3JUYA 3BUTA 5BRZD 15C8L 3EFOA 4HJ0C 5I0XA 5F3FA 3M17A 5I82A 4Z3JA 5FO8A 1O7DC 3HZKB 1VEMA 4OLUL 3FBQA 3GMQA 4FLRA 4NO0A 2Z91B 3QUXD 1IFHH 2V17L 1NZRA 4PJ5B 4G43B 1G6RB 4NGHH 2GG1A 4YHNA 3MROA 3BVDB 1YNKL 1UH3A 3FSVA 3HG5A 3IJYB 1AQMA 1NUNB 3R1GH 4L8CA 1IC5H 5AVUB 2BNRD 1X7QA 5JW4M 3RVUD 3EDDA 4KO7A 1PBYA 4D9RD 2A73B 5EC2B 2DQDL 4JGJA 4FQCL 1A4BA 4NHCL 1AD0B 1G7MB 2G2RA 4HGWA 5DMIH 1HHIA 3GMNB 5IT2H 5F96L 2NQCA 4X9BA 3CPUA 3HC0B 3TVMD 2E27L 3T0EE 5D5MF 2Q2EB 3CZFB 4LL1A 3VJ6B 1WEJL 1IMHC 4N5ED 1AQHA 2XUWA 5CZKA 3MJ9H 4I89A 4WI5A 4PRHB 3MREB 4HLZH 4RWYH 5GRUH 4BWUA 4U6HA 1WICA 1JPSH 3ARWA 4WU5B 4NRZA 3QZBA 4JQXC 4R3SB 3CH8A 4MNQB 2V2TA 43C9B 3BH9B 1S7VB 1KIPB 4YFLF 3Q2WA 2HKHL 3IDMB 3FQWA 2APXA 4XO5A 2VABB 2AEOA 2OMTA 1AOHA 2R9HD 4F27A 1N4XL 1XF5B 4F9PA 4OKVB 1RVFL 3QHTC 5INDA 1E4XL 1OB1B 4H8WH 1R6VA 1KY7A 3QXWA 3O41A 3H8NA 1KB5L 2DJSA 1NBZA 5E94B 3F7VB 4PPTA 4Q52A 4MAYD 3QA3B 1L5GA 2EO7A 2EVIA 3T4YB 4F2ME 3SGDI 3H7LA 2ETWA 1IFRA 3MV8B 1R0AL 1FL5B 4AYFA 4Y4HD 5EPMA 4NN5B 2B4CL 3R8BB 1OAUH 4CSSA 5HGAB 1QEXA 3SDXE 4HUMB 2YPLE 1HJBC 1XSJA 1U58A 4QHKJ 1NOFA 3H53A 4XNQA 4MD0B 4TLTA 4QOKA 1JNHB 3N1MC 4JY6A 4QMEA 2AANA 4IGBD 4JZOA 4M5YL 1CFBA 2D0FA 3JTSB 3RVWC 3EAKA 5CN3A 4GAYA 5GPRA 3LZOA 3DA0A 3CBRA 2WUBL 4AUUA 4MAUH 5HD8D 2D31B 1ICTA 4A6YB 4ZMAT 3N55A 4O2FB 4DAGH 4JO3L 2EVHA 4OD3L 1PZ3A 5JHDA 3KL5A 4IOSD 2A9NL 4J3WA 2NT0A 3AGWA 2E74C 2W0PA 1T66D 4PJ7E 2R69L 1K8DA 4W4NA 1D6EA 2DQGH 3B2UD 2X9YA 1BA9A 1UM4H 3CK0H 3TCTA 43CAA 2XX1A 5ITBL 5FKPB 2VLRE 4I87A 5EOTB 2Y3AA 4GQRA 1P4LB 2R1XA 4E9XA 3QAQA 5F9JA 3C5XA 5B8CB 2R23B 3CVHA 4NQUA 3WV0A 1PCXA 3DJZA 4WGKA 2AVFA 4N2DA 1CGTA 4HIQA 3UJIL 1ETZB 4TN9A 4ODXB 2H4EA 3FUFA 3S35H 1CUOA 1CZ8L 1E6JL 3NP3A 4OF5A 3WS6A 3LZPA 1CPUA 4JREC 2NX5E 4Z78A 2EUVA 1B0RA 1JZ7A 1FYHB 2ERJB 1FLTX 3OM3B 4JQIL 4OCSL 4DGVH 3F7QA 5F8RC 4FKEA 1E3XA 2GT9A 4IRZH 1ONQA 3PPEA 1BYNA 4OCYH 5EORH 2XQBH 1OL0A 1U8IA 4MA7H 3OJDA 3D3VD 4YPJA 2DWEA 2R0KH 3G08A 4ZZKA 3QCTL 3GK8L 4YDLB 2FWOA 3HE6C 3ZUNC 5JO5B 5DS8A 5IHLB 4XAKD 3AQZA 3I75A 4QAWA 1PX8A 1CBVH 1ZVYA 4Y2OB 3ZDZF 4HW6A 4WAFA 1ZSHA 2B5IB 4WNQB 1G6RL 3RUGF 4P04A 1J9QA 5K33A 4AC2A 4DP8X 3SDCC 2RFXB 4FTVB 4AGLA 3S5ZA 4AMXA 3GINA 2Y6SD 4MJ6B 4RAHA 3F2LA 4YX2L 3WUWA 5DXWA 3UFIA 5E9DA 4FG6C 1IBGH 4LU5H 3AXHA 4FXLA 1AD9B 3VFOA 3H7BB 3QWRD 2HTKC 5IEHB 1ECZA 2OKMA 2YSSB 3CLEL 4JVPA 1ZMYA 4XNYL 1MF2H 5E56A 1XGTA 1Z32X 2O5YL 4ZTOH 3A67L 3H85A 1WBXB 1CLZH 1IGML 5INCA 3IFLL 5BO1L 4AJWA 3MRBB 2VH5L 3QQDB 5IB2A 4MMXB 4OM1L 2FQGA 4KDWA 4L4TA 1J10A 2X2HA 1ZJAA 5EOQH 1RZFL 3V0WL 3I3DA 3ASNB 3WN5A 1PLCA 3G6JF 3D4CA 3ESOA 4HJEA 4Z7QF 4XODA 1YNTB 1VFUA 1U42A 4HX1B 5T1KA 3KW7A 5CJXA 1F4XH 3B37A 3TO4D 1AXSA 4WFGD 3N91A 1W15A 4AQEA 1YJDL 3KLLA 4M5SA 3UTQA 3OVUB 1CTMA 3EJCA 4NM4L 1P7KA 4AGPA 4PJBB 3FAXA 1RIVL 2LTQB 3MLVH 4WTQA 2UZIL 3WSQL 4FA7B 1Q0YL 4IMKC 4LKCB 5CBAA 2DTML 3IFPA 5E7BA 3FO9B 3ZE1F 5HYJE 5FECA 5DT1L 5JIKA 2YAFA 3B43A 1TZ8A 1P1ZB 1OGSA 4PWHA 3RL2B 1CTOA 1V3LA 2WBJB 4YHPB 2YA1A 3II1A 1EZLA 1JN6B 4OB5H 1CI3M 5DLML 3SKNA 3LPOA 4IS6B 2XZQL 1T0NA 4ONGH 5KSVB 4TQEL 2Q7NA 1BW8A 4RFOH 4F7MB 1SJMA 5C0EB 2IBGA 2YBRB 2XWTB 2XWRA 4TTGA 3GHPA 4A6YL 1MCEA 5CCKL 3HVDA 4WVRA 4YSQA 2NTFB 1BQKA 2XPYA 1F90L 3RFZA 2F74A 2VR9A 3OZLA 3L5JA 3GGWB 4PRHD 5LXGL 1F4YL 4LL4A 2OX5B 4E41A 1GKOA 4OJYA 1IC0A 3S2CA 1RAMA 4FXGB 4PU2A 3K6OA 1T5WB 2BIPA 3IDYC 1EAPA 3TX4A 3LKNA 5EA0L 4C59B 3Q3GA 3H9YA 4KUZL 4L8SC 2GTZA 1TKWB 2ZOLB 2GBAA 5J11C 1GTNA 5AENA 1JGVH 1TOXA 3KHQA 5F9WC 3H4FA 4OUUA 5LNGA 1QLRB 2ATKA 3RAJH 5JOFA 2YOCA 2BP3A 3VXNA 1ZLUH 3WJMA 1A47A 3TESA 4AJ0A 4AYSA 5C0IA 2MTPA 3MV8D 4YLCA 1OE1A 3L16A 2J44A 4HGKC 1RZKL 1TPXC 3VGDA 3ZSSA 1RIUL 1E2VA 5J06A 3GXUB 4XAWH 1NWOA 4JFDA 3LNIA 4K2UL 4PGDA 4NM8L 2B14A 1FORH 4FC3E 3W11D 4B95C 4PJDB 1S3KH 2XU9A 4N0UB 2BSDA 4OGXH 4XVJL 4CMMA 5I30L 5M7QA 1MNNA 4WCYL 3TNMA 3P2TA 2JKWA 2VERN 32C2A 3V79C 3KG5A 1CWVA 1GW6A 3BDBA 3CFNA 5C0FB 5KVDH 1ADQA 2IAMD 1BQHA 1M1SA 3CE1A 4Q6IA 3VD7A 4GKNA 1SHMA 3PWVA 1X6LA 4EIZC 1L3NA 3DK2A 3BVVA 2NNFA 2YEQA 1FE8L 2X88A 4LCCA 3L7EB 5F9AC 1X5LA 3QXDB 4OQ1A 5GGTA 4Z7WB 4L0PB 5F9OH 1KSRA 4WI4A 1OSZB 2J73A 1E9QB 3EOYG 4FQXA 5HI3D 4AX3A 4IBVA 5ISZE 2JVUA 3V6FA 3M7FB 4JR9L 1O5DT 1DANT 4LSSH 1C1EH 2OS7A 4J4PA 4A67A 3PP3H 1I1FB 1S4IA 1PZ5A 4OJCA 4XMUA 1FIGH 2AABL 5IB5B 3WEBA 1HIML 1HI6A 4L1SA 4ZW5A 1KTJA 2VJ8A 1A4JB 3MLZL 3NCWA 1OEZW 4NNXB 1DJYA 1NGWA 2J1KA 4HKXB 4HUVA 4GSRA 3ZRSA 1WGOA 3KE0A 3GNML 4E5XB 3C60A 3JVGA 2VLJE 4ZMPA 4DEUA 4BA8A 1NFDF 3T0WA 2R83A 1QRNB 1AYRA 2VLMD 4UOQA 2X4UA 1JYXA 3W0WA 2V5TA 4Z7AA 3OKDB 3RBSA 3BE1H 4UV7L 3EFDH 4YNYA 4NRXA 5TPWL 4X5WA 4MJJA 4M5TA 4UU9A 4D0CB 3NESA 2X44D 1OARL 4NKIL 3SGJC 2V5SA 3TZVB 4U0QB 3WDHA 4XX1E 1LO2H 3T0VA 4D9QE 1R3JB 4YVNA 4KKAD 3DX8B 2DM2A 1YDPA 3E3QE 3RJOA 5IIEA 2FJGB 4PRAB 2NSXA 2BVEA 3QDME 1AO7A 1U8NB 4FTVD 3HUJE 2VXVL 4XXWC 1W72H 4TSAH 3PJSB 5IQ7L 4JRXB 4FLHA 3ZW3A 4GW5A 1WE5A 2UX6A 1ZT4B 2HLAA 3ARFA 2ZIDA 5EBWB 4DGIL 2H32B 3D1MC 5GRVL 3S0PA 4Y19E 1A1MB 1RP8A 1PD0A 4M6MH 3FMGL 1WCBA 3L54A 5JORA 4KO5A 2G60H 4Y8AA 5I1DB 2HKFH 3SPGA 1T20B 2KC0A 3KPSA 1FNGB 3MRGA 5DO2D 5HHMB 5B7EA 3EYVA 1C5BL 3C6LB 3NABL 2XXMB 4HDIB 3WIIL 1ZY9A 2Q10A 1QFWM 1AQDA 1DVSA 1A5FL 1IAOA 3BGMB 3P4LA 5AVVB 3TN0A 5LLIC 5IFJA 1I7TA 2W9LA 3ZR5A 4JDTL 1KIQA 3TYGH 2R7EB 2B39A 4HCFA 3VXOB 1TTRA 5J6SA 3T0AA 4KMTL 2VC2B 4J3XA 2NQ3A 5D72L 5L9DL 2FYYB 3NCFB 3S5LA 4M8RA 4BZ1A 4OF6A 2QBWA 1TXKA 2B1AL 3RVWD 5EO0A 4OD1H 5EMYA 2XKNB 4PLJC 3CN1A 1EQWA 4N9GA 5MI0C 3LKRA 5CP7B 1QZNA 4TNFA 3KJ6H 3AG4B 4QXUL 3TC9A 4BK4A 1OGAA 1BIHA 1EH9A 3O6LL 2W8CA 4LOVA 3COOA 4IU3B 4YPGB 4EKXA 1DDHB 5B39A 1NAKH 1DL7H 2JI3A 2YJLA 3FUJA 3PQYE 2IWFA 3DHUA 4HIIA 5D93B 2AXFB 2WBJD 3CLWA 3B9AA 4F2FA 3IFOB 4F5CE 2VDNH 4JKPL 5FDWB 4ZX6A 4LAJH 2IALB 4X4YB 2Z4QB 1N59A 4R4FH 2IFFH 4LPVA 4UOW0 3FRPA 1JXDA 4NX0A 4DUXA 4Y1AE 5E8DH 3MRMA 1IEAA 1WZKA 3A23A 5LNDA 4OSUL 4GUPA 5DRXB 3BIBX 1HQRA 4GI8A 4FAAB 3DJTA 1TZGH 1L0YA 5ABAA 1T22A 1BZOA 3LZRA 3SDAC 1MIEH 1WA2X 4XXCA 4UNIA 2A6KA 2DBLL 2VMEA 3NACL 1VB9A 3HC2A 3IDGB 1A7OH 2CJUH 2C1PB 4LRNH 5FHAH 4XO4A 5SWSD 2AV7B 5AW9B 1RP9A 1F8TL 4NQDE 1IUZA 4JCMA 1JHLL 3L2NA 5DRNA 4FNTA 2BY0A 1TVHB 1K2DB 3STLA 4D94A 2TRHA 3UP1A 5K9KA 3U6RB 2P8MA 2OP4H 4HUUB 4NKDA 1JV5B 3NVQA 4XB3A 1HL5A 3P0VH 3V52H 4XN9A 5CGYC 5GHWH 2K6WA 4YHIB 2UY6B 3NAAL 4EI5D 1JAEA 1T0MA 5C3IA 2PNDA 5JHLA 4GRWB 4J1UA 1ASQA 4GEJA 2JKXA 4IKNA 4KK6C 4JGNA 2O30A 1CFSA 5EWIH 1J1XH 4GRLC 3AACA 2XG5B 3ATAA 4JDEB 4KKZA 2WXMA 4NZFA 2BSED 5E2UL 3G5XA 1JZDC 2R1YB 4FFZA 3VTTA 1F02I 2VZ1A 4MB3A 3F85A 2G5BB 1UCTA 3C6EA 3QQXA 1KBWA 1OLLA 1VACB 3UP6A 5A6MA 1VFAA 3CFJA 4Y5VA 3DUSA 1D9KC 3QEUA 1J1OL 1J5HA 4I7ZC 5D1QE 4D3CL 1CYXA 1CGYA 3H6AA 1YEFH 4X6DB 4PQXA 2HX7A 5F0JB 1KCUL 1GC1H 2FJSA 4JM2A 5DVNA 3UZVB 4AI7A 1L9PA 3IJEA 4S1SL 4MXVF 5D2LF 4I5BA 2QKIB 2C4FU 2EIZB 1YUHA 4QRQB 1HXYB 1JFHA 3BP7B 1XXDC 1HINL 4TSBH 1Y1DA 1GOHA 5E08L 2Z7ZA 3D25A 1CI5A 5BZDB 1FGNH 4F9LA 4UOZA 3QDJE 1TQWA 4EN3B 1KPRA 2CLVB 3GS4A 5I6XB 5AVYB 3DX2A 3QIUB 4DQOH 1YNLL 3MKKA 4NUJB 4P4KC 2DH2A 1K85A 3O6FB 4Z7UB 4GI6A 2F54E 2OTUB 3UTPD 2NY7H 3F00A 2DTSA 3U1QA 4I0PB 1AR1C 2FT6A 5I0VA 3EOBB 2Z31C 5FYKE 2NUTB 2XVKA 4TPRL 1GGIH 1JF1B 3F12B 1H15A 4YZWA 2AJXL 3MX0B 4KJYB 4AYID 3MV9B 4BH8A 2CIIA 3X12A 4KTEL 5C07A 5I2IA 4P46A 3SE6A 1WRFA 3WFEL 5C09D 2VC2L 3M17B 3HMXH 4G8GE 5I5JA 2EYSA 3LTVA 4N2MA 3WFHB 5J9PA 5BVPH 3JTTA 3VXMA 3V4PA 3S36X 4TVPH 3P4MB 1TLKA 3L3HB 4O02B 4NO0B 4RRPG 5I5MA 2QPSA 2A74C 1RUMH 4DP4X 1XR9A 4HEPA 1XCTA 3RNQB 4OFIA 4YHNB 2R2BB 5B7MA 1G4RA 3EBGA 3DX0A 3ZY7A 1MCPH 2GCYB 2XA8L 3X3FL 1BZ7B 1ZCRA 4NBZB 3OKEA 4L8CB 1THAA 3SO3B 2EIMB 4AYMC 3N1QC 2O5ZH 3N41F 2QT6A 3QFDB 4FYSA 5HI5C 1XZWA 3O2WH 3H6JA 1IC4H 3ESUF 1N0LB 4UOJA 4FXKA 5DUJA 4HGWB 1DQMH 3R7RA 4CVUA 1ET8A 5DEFB 4PRIE 3MGAA 2JQAA 3DDGA 3FN9A 3STBA 3I6KB 2FB4L 4U6HB 2BC4A 3B8SA 2NY0C 4JANA 1I7RA 4JFSA 5HHMD 4QYAA 1A3ZA 1KCRL 2VZVA 4BD4A 3FQWB 4FNPA 3FU3A 3IYLW 3VXRA 2OMTB 4RFNB 4QF1A 4HF5L 1A6AB 1LQBC 1LK3L 1UWYA 2Z65C 4OLUH 3O3BA 4A7VA 2V17H 1CL7I 1OQXA 1JPFA 2D3VA 1QW9A 1SXNA 4HXAH 1EAQA 3Q01A 4RVBA 2XN9A 3TH4T 3QJOA 1L5GB 5D1XE 3NZSA 3VYNA 2ZXEB 1YAZA 2AQRA 2EE3A 3QFJA 4IMLA 2FBRA 4K3EH 5D7IE 3K3QA 4AYFB 2DQFA 5TQ2L 3IFNL 3EGXB 4BGLA 4FNQA 1S7RB 2DQDH 2MFNA 3JWOL 3DVFA 1ZT1A 4HIHA 4NEHB 4FL4C 3BVWA 4XPFL 3VI4B 1ED3A 1RPKA 4QRPD 1U58B 2YRBA 4XNQB 1KBGL 3IKKA 4QOKB 1O5PA 2YXFA 4JY6B 2F53A 2VDMH 5E1AA 3P11H 1E5UI 4PD4J 2P5WA 5L2KE 1WEJH 4MRCA 4ZX5A 3Q6GL 4LMQE 1FQ9C 4U1KA 1R3IH 1WAEA 3QJXA 4HCRA 2V8LA 4KXBA 3ZMRA 4AGOA 3K91A 1A0QL 4XMPL 4XOCA 3IU3A 2HKHH 3CFTA 1TJHL 5HPOA 4P3CL 4UANA 1EV2E 2ZOWA 1N4XH 1N64L 3UCQA 1R75A 3QIBB 4PV8A 3ZE2E 3MODL 3KCPB 2P5EA 3IM1A 3PS6A 1E4XH 2OAAA 4TUJA 4XN7A 3HN3A 4QPEA 3S3JA 4G1EA 1KB5H 5TK2A 4AQZA 5FM8A 1LVEA 3B2MA 1N67A 4JY4A 1XVSA 2VUKA 2ED7A 3ARBC 2R1XB 5F9JB 4ACPA 1NCCL 1R0AH 4NZRH 1L9MA 2FH8A 1JGUL 1PZSA 4GLRH 4P3DA 2COQA 5I18L 1PJ9A 2CJSA 1NANH 1ZK9A 2C3GA 3MLPA 4MQXD 1XIWC 1E27B 1M3JA 5KZCD 3EYQC 2Z8RA 3LDBB 5HY9A 4Z78B 1ZE3C 4X5PA 7PAZA 4B9JA 1HE8A 4ZMNA 1Y6MR 3OF6D 4NN7C 2VSMB 1SMDA 4GKZA 4JGUA 2FEEL 4FA8A 3QXUA 4F2EA 2GT9B 3RL1A 4GSXA 2WUBH 1JV2A 2WBKA 4MX7A 3T1FB 3V4VA 1DUYA 3OJDB 1FH5L 4JQXA 2VR5A 4Z95L 3JWNH 3H9SA 4OJAA 5JMRA 4GINA 4JO3H 3G5ZA 3G9AB 2CCWA 2FWOB 3LRSA 1Q9KA 5FUZL 4FG4A 5DS8B 1WHOA 3O11A 4BQ6A 2RIKA 1YSOA 4C47A 3EGSA 1M2VA 5JPNB 3KS0J 3SGEI 4O02L 1XCWA 5GISL 3EH5B 4ONHA 3B2DC 4P9HC 3ROOA 4N2HA 4ZFFB 3HRZB 1ND0A 2XBZA 4Z1PA 3CU7A 3KGUA 4UQAA 2JCWA 1GS8A 4AC4A 4L3AA 2GJJA 2B59A 4K55A 4JN1L 5E9DB 2HT4C 2Y1AA 3S48A 3UJIH 5I0DA 4HISA 3DVGA 1G9MC 1CXEA 2X1XR 1WTGT 3EOAB 4RFEA 4XP9L 4A63A 5CEXA 5JA8B 2HLEB 1E6JH 3NZ8A 5IVXB 1ZLUK 1IKOP 4TLSA 1MFEL 2FSDA 3ZDXE 1XGTB 4RDQG 3QIUD 1KGJA 5EF3A 3FT3A 4OCSH 4JQIH 4WKXA 5INCB 1TZIA 1YEKL 2VDPB 3O6FD 4Q6YA 3QISA 5JXAH 2BVTA 3QUYB 4P3WA 1R3LB 4M7ZB 4MS6A 4AJVA 4DEPB 1JZ3A 5T1LD 3ZSTA 3MLXL 4I0PD 3VQ2C 3WN5B 5A2KH 1PAZA 3QCTH 3GK8H 3QE5A 4Y2DC 5FFGA 3QORC 3Q2LA 2CHNA 4GIPD 1M4KA 4H26B 4PJ8A 3KEHA 1ZDSA 4MQ7B 3MV9D 2J8UA 3NIGB 4DKTA 5F71A 2Y9RT 5DZLA 3EZJB 2IH9A 1G6RH 1VPOL 1L9QA 2CO6A 5E0FA 1IGCL 1JZFA 4J12A 3DXAE 3SBWC 1PLGL 4AMKH 2UZXA 4EAEA 4LNVA 4YX2H 3RDTD 4KAQL 3IFPB 4NO0D 4HUXB 1OPGL 1SUJA 4UNVA 1IGIL 1IM9A 3E0GA 4OLYL 4QTIL 1OP5H 5FECB 3CFCH 3KHOA 2APFA 2EIBA 3CLEH 1M1XA 3L2MA 4XNYH 5D7LB 5J12B 4KKCC 1Q94A 1GMIA 3A67H 3QRBA 1LE5A 1IGMH 3K46A 3IFLH 5F9DC 5DCCA 4AL8H 5B7FA 1T0NB 2NY6B 2ZX5A 3NIDF 4ATWA 4OM1H 2EILB 3PP3K 4N24A 1CC3A 3PL6B 1IM3D 5LAPA 3QJQB 3VD9A 2WWMC 3V0WH 4KK5C 1BFVL 1M05B 5MEQB 4CKVX 4GUOA 2XV0A 5L88L 4MQTB 3HE6A 4KXZH 5DURB 3RFZB 2F74B 1K5NA 1YJDH 3SQRA 4C56D 2Z34A 3MUGB 4X6CE 5EIIB 1FZKA 2K3TA 4NM4H 4RA3A 1YAIA 4AK2A 1BECA 4XMLL 1QRKA 1MW1A 2DLTA 5AUMB 3WFCL 4ZPVB 1OANA 2UZIH 3FQRA 3WSQH 3NFPA 1CVRA 4ALAH 1T7XA 3EDFA 3Q3GB 3DETC 4C83B 5I1HH 2GTZB 1JPST 4NZ8A 3GBNL 5I16B 1J86A 4XCYB 2NY2B 5C97A 4OUUB 1KCVL 1XEUA 4G9FE 4GMTL 5DC2A 2ATKB 5JOFB 1RUKL 5KBDA 4YZFE 2BMKB 2N7AA 4JHBA 1T2JA 2WP3O 4GO6B 4LQ1A 4BGDA 4XOEA 4XB8A 2DPKA 1XB6A 3H4HA 5DLMH 5C0IB 5FF6A 2XZQH 4H5SB 5D55A 1CF8L 3KPMA 1T0OA 3QZPA 4TQEH 4JFDB 2XY1A 5ILTL 2DQIL 5KBKA 4QHLB 2R56L 4M62L 4EIGB 2ICES 1FFNB 1M7IB 4A6YH 5CCKH 5DQDH 2EKSB 2QPFA 3D50A 5FR3A 1AQKL 5EF2A 3TNMB 5JHAA 5KJRL 1F90H 1Q9WA 4H20H 3FU0A 32C2B 3QJTB 4UZGA 4XMXA 3U4EA 5LXGH 1F4YH 1JOIA 4O5LL 5DYOA 4XHJD 3GZOA 4NXSA 3CFQA 3FQNB 2YS4A 4XCNA 2XBTA 4P4KD 5AW7B 4LBEA 4B9GA 3LH2H 4Q6IB 1BQHB 2CBQA 1P1VA 4GKNB 4YSDA 5T8IA 1JERA 3EZ8A 3TU6A 5F7HA 4BUHA 4MSWB 5EA0H 3QIBD 1NTDA 4AGNA 3MMEA 4KUZH 2KPNA 4X83A 4NP9A 5EEVA 1E4JA 1R3KB 1T6WA 3T4AC 4Z7NE 1W16A 2OM5A 3AS1A 4NLHA 5DEZA 4HLEA 3GPSA 1G9NC 1BBJA 1IVLA 3V6FB 3VFRA 3UPCA 4GB9A 5BUGA 3KPPA 3V0JA 1VEOA 1IAKB 5D7JC 1RZKH 1RIUH 5B3SB 3EBIA 3BEWB 2G3ZA 4K2UH 5CD3A 2ZKWA 3HKZA 2XN1A 4WI3A 5AW8B 1BCIA 2YXWA 4NM8H 1TMQA 4HUVB 1VCAA 3CSYA 4BHUI 1DBJL 3EF7A 4XVJH 5I30H 1OGTA 1OCRB 1P6FA 1OV8A 1OTUD 4O9HL 4WCYH 3O81A 1I1YB 3W82A 1A7PL 3Q1SH 12E8H 4UQ2A 1ZV9A 3MJ7A 5JHBA 1A8JH 2X4UB 4QRRE 5F3HA 1BQLL 5EHFA 3OAZK 1EZSA 4PG2C 2HTLD 4ZAKA 1ZPLA 5F8QC 4YNYB 5AALA 4X5WB 5A43C 3NFNA 2EEAA 4UU9B 5E1HB 2NXYC 3DI3B 1J8RA 1FE8H 4HFWB 3V5HB 3BUPA 4FCHA 3VE0A 4HJGA 3FTUA 3KH3A 1MCJA 2FVNA 4L8SA 4OGZA 2QADB 2UXFA 3FSAA 1U8OA 2CO4A 5TDOB 1WBYA 1KV3A 4OI9A 1MELA 3TBYB 1J88A 3T3PE 3VFTA 1YDPB 3LX9A 1U3JA 5IM7B 4Z23A 5FCUH 2O6CA 2OYPA 4PJEF 1I8KA 4ZODA 1KYUA 4IHOA 1DP0A 5D7SL 4I1PA 2XWXA 2F19H 4QY8A 3TJPA 2CHWA 2X4RA 3HVNA 4OFVA 2CWRA 3B3IA 5L7XH 2AABH 3MOAL 5FO2A 4CW1B 4GW5B 4AZ8A 4O2CA 2HLAB 1BVKA 3ARFB 2M83A 3MLZH 5IUSA 5CEYB 4TS6A 1QUNB 3HRPA 4NZDA 5E2TL 1WCBB 5MHSE 5JORB 3GNMH 3MJWA 3CTTA 3A0OA 1URZA 1RUPL 2YLKA 3KPSB 3P3YA 1BVLA 5FA3A 3QUYD 2K7QA 4H7VA 1VENA 3BXNB 4FZ8L 3BZDA 3PWUA 1UXSB 4WUUD 1C8QA 5TPWH 1AQDB 1IAOB 2H45A 2VLKE 3TN0B 5BO0D 1I7TB 4FHKA 3VM5A 1OARH 1KIQB 3GLDA 1O9WA 1AQ8A 1RJCA 4NKIH 4LIQH 1MCRA 4ZTPL 1PIFA 4BQ9A 4Q58C 4OGAC 2WK2A 5F70A 4M6OL 4K7PY 1DN2A 3VI3F 4HSAC 5EO0B 3N43B 2J8HA 1MHCA 3D0LA 3VRJA 2WN2A 3LKRB 5EFIA 3KLQA 4X8GA 2X2IA 2Q86B 2JKIS 2VXVH 2X1QA 4GFTB 2NR6C 5LGHL 4DFHA 2YAQA 4ZW8A 3H9ZA 4HBCH 1QNZL 1TTCA 5IQ7H 5D1ZA 3C8KB 1MPAL 5TDPA 4DGIH 4HIIB 3MLUH 3QNYB 3OXRB 4G72B 1FAIH 5D7LD 3HBPA 4NKMA 4L3EE 3FMGH 3T65B 4PJAB 2CM6A 1XWVA 1T6VN 1Q1JL 1BDYA 3KWWA 2EDJA 1TVBB 4Y9BA 4LEOA 3VA6A 2NY6D 3FRPB 3ZKMD 5I8OL 2X10A 1HNGA 1AIZA 2Q87A 3BP5A 1IEAB 1K6QL 3BKYH 3NABH 3PL6D 5GGUA 3V6OC 1HEHC 2H3NA 4TYUA 1NGQL 4OCXL 1JYWA 1MHEB 3QAZC 1A5FH 4Z18A 5DK2A 1ADQL 4B97A 2EIKB 4KMTH 1Z5HA 1BEYL 5D72H 5L9DH 3EYQD 1HXMA 3IXAA 3SGJA 1ZLVH 2C9SA 4HWZB 5E24E 1IIKA 3GIZL 3QXTA 3Q44A 4K0OA 5LJYH 2B1AH 5GGTL 1MJ8H 4APQC 4QXUH 4Z7OB 3MV7B 2P8MB 4FERA 2OK0H 3ATDA 2G5UA 4NKOA 3ML9A 5DZPA 3O6LH 1PKQA 2PO6B 2ZSWA 3U9UA 4XXWA 4PVLA 5EZLA 1TYEB 2GQHA 2NY2D 2IMNA 2Z93A 2XTSA 5HPMB 1N2RB 3MRNA 3ZUCA 3WNOA 3GMRA 1ES0B 1E0OB 2I32A 4J1UB 2FJUB 4KUCD 4BKLA 2Z7UA 4ZMYA 1CFSB 4JKPH 5FYKU 2YR3A 1BZEA 1SOXA 2WUCL 3H54A 3LZFH 5EZJB 5JPMC 3G5XB 3QUZB 1I8AA 3GJEA 3E6HB 4OSUH 3WL9B 2AVGA 4PJCE 4M1CC 3A6CL 2DQEL 1DJXA 2NYKA 5CFHA 4B53A 4YDNA 1P9MC 1AKPA 1VFAB 3CFJB 4Y5VB 1CGSH 5DUBB 1OM3L 1QSEA 5BXFA 1KPVA 3ARDC 3QEUB 4JRYE 5JW5A 3KMDA 2DBLH 1ZKAA 1LP9F 3VFWA 3S8GB 2VDKB 3NACH 3HE7B 3QEGL 4H1LG 2KPWA 4YHKL 1F8TH 2OR9L 2XKUA 5DTFB 1JHLH 3IJEB 1GZHA 3QJUB 4TTDC 4YDMA 2B08A 3CGTA 1JGDA 1SJHA 5A2AA 1NUFA 1YMMA 3BJLA 4L37B 4DP1X 3UTSE 2PN5A 3KDMA 3LZLA 1YUHB 4BRJA 5KSBF 1IL1A 1X9UA 3KL0A 5I0ZA 4Y2DD 1RPQA 3G3LA 1MI5E 3HKFA 2G3NA 3NAAH 3RIAF 4AYBA 1NFKA 5L4MA 4E9QA 4WKZA 1KPRB 4PJGF 3WTWA 1PKOA 4B41A 3HIZA 4LSTL 3B1UA 2YMTA 2AJ3A 5E00A 5H4ZA 2OA9A 3FU7B 2D03L 1WGVA 1CFMA 3X1BA 5E2UH 3FRUB 1D7FA 1KJ2A 1SRDA 1KXTB 1FO0B 3P4OB 3NEOA 2XC8A 1UASA 1EO7A 1V54B 4FQJL 1NUDA 3P54A 5F89B 2HVKA 4OF0A 1J1OH 1NDMB 3LNEA 3SDAA 1G7HA 4D3CH 4LCVA 1HZKA 4XPGL 1UD8A 2CIIB 3X12B 1KLGA 3IT8D 4LL9A 5FYJL 5C07B 5I2IB 2IOMA 4P46B 4W93A 1KCUH 1SDDA 1WAAF 5T3XD 4J27A 2G75A 1NIBA 1RQ5A 3O3AB 4OZFA 2I9LA 4S1SH 4BZ1L 5I28A 2L7QA 1DLHA 5ACLA 4KHXH 5J9PB 3V4PB 1DBML 1Z0NA 4M61A 4KDTC 4CNIA 1LQSR 4XZUA 4ODWA 1HINH 1G87A 4KI5E 5E08H 1XR9B 2QADD 1XCTB 4YLBA 2FEJA 2HT2D 3D9AL 3X3GL 3VCLA 5F6HI 4MZ2A 3TJHD 3UDWC 3V55A 4KXCA 1B9KA 3AS0A 3R0NA 2NW3A 5JQHC 1L6XA 2YARA 3SJVD 1E8WA 4X5XB 2WHVA 2CKBB 4M7JL 3W38A 5DJDA 5KS9A 1TT6A 1EXUA 2FJFA 3OB0H 1CXLA 5JIPA 1SHXA 3RWHB 2D7PA 3ZKXB 1S7UB 3ARFD 2QQQA 2WVVA 1ZGLB 4P5TA 5FO7B 3W1ZA 1LGVA 2PW1B 2YD1A 2AJXH 3DRTB 1E50A 4IKJA 2X0UA 4U1GB 1D9KA 1BVNP 2Z1PA 4KTEH 1TIUA 4FI6A 4XTRD 3ALXA 2J6EH 3WFEH 5EDSA 5J1SC 4JANB 1I7RB 1UG9A 1NFDA 5MENB 1W0WB 3EYSL 4A38A 2IOIA 3T5WA 4YMPA 3GB7A 2AMGA 4LOEA 3CVIL 4YDKL 3VXRB 1LMIA 1UFGA 3WIFA 1SF5A 1TZHB 5BRZE 1R46A 1S9XA 5FYJD 1JTTA 2JCCE 5FHBH 3O3BB 4W9KC 5I1IL 1XV8A 5FGRA 2C8NA 2IBZY 2OL3A 2CUIA 4A2GA 2GW5A 1QQDB 2WCPA 1ZA6A 5EN2B 4PJXE 4K23L 4PTTA 3VRLE 4XNXH 4UILH 3EJZD 2WTOA 4QHNB 4LOUD 1MFCH 1HH9A 5JHLL 2H8PA 4IHBA 4ZQKB 2DQFB 4QXGL 5FOJA 3ET9F 1VJSA 2VMDA 1ED3B 3D87B 4FFZL 1NBYB 2BNRE 1T1XA 3NJGA 1IGYA 1M2OA 1TYJA 1EFQA 1FVCA 2F53B 2IH3A 2Z31A 5E1AB 4D9RE 5HGHA 4ZZFA 3UEQA 3SY6A 1MQ8A 5I15L 2LU4A 4UQ3B 2FB4H 4U1KB 5KYXA 4FLQA 4HUWB 5H4YA 4FNLL 4Y5YC 5A2IH 1KCRH 4N2GA 1ORQA 1EUUA 1QFWL 3TF4A 1BQ5A 4GAAA 4N8UA 1LK3H 1GYAA 3ARED 4PV8B 3TEWA 2CDEA 3HC4L 3PUUA 4PWGA 2HSIA 2YD2A 5CWSA 4Y4KB 5J0BA 3SO5A 4TUJB 1MW0A 2K0RA 1NPUA 5DZAA 1GZQA 2V3FA 4G1EB 1DQKA 2A74A 2NZ9C 4O51A 4PJ9C 4AYDC 3ULVD 3L95B 2Y2WA 4JY4B 3X2QB 5FOBA 1RZJL 2EXYC 2L7EA 3VXUD 3MV7D 4GRWH 4XH2A 5TQ2H 5KUMA 3JWOH 2PO6D 3IAQA 5GQBA 4ELKA 5TDNB 4P3DB 4XPFH 4EUPG 3Q6FB 2BP0A 3QO0A 5IK3A 2EEXA 4GG6E 1O6TA 3HB3C 5K9JL 2TSAA 3EFFB 1A6ZA 5HY9B 3QVAA 4MJIA 2ODHA 3GTTA 3VFPA 1MRFH 1NSNL 1QZ1A 2AV1B 1ETJA 2H41A 2YXMA 3QUZD 4JLRA 1SYSB 4MX7B 1JV2B 4U3SB 4LSUL 3V4VB 3WTYA 4XMPH 2PMZA 2F15A 3X1GA 3ARQA 1GYUA 1TJHH 4P3CH 4OI7A 1F1GA 3G5ZB 1N64H 1Q9KB 3INOA 3ZTJH 4LSRL 2EUWA 3V4PL 1C9SA 1MJUL 1KBVA 1YPZB 4URTB 2VT0A 4L1DA 3HE7D 4RISH 4NPYB 4ONHB 4ZSOB 2R59A 4LZKA 3NCCB 3T1WA 1K72A 5T3ZL 3QI9B 4JO1L 3UGXA 5FXCH 4MJ2A 5E7FA 5DA4A 5BCAA 1GGCL 2BIMA 4TULH 1NCCH 4MKMA 2A38A 3TFKC 1DVFC 1T1YA 1FN4A 2B59B 2D0HA 3I9GL 3RKDD 1CK0L 2QGBA 4HC1A 5TK4A 5CEXB 1XF2A 4KRLB 4KQ4H 3QJFB 3I02A 3NZ8B 4NHUB 4TQHA 1ETB1 4V1DA 3VFSA 1XF4A 2YPVA 4BINA 4K5MA 3FT3B 3SHSA 4UAHA 1FWXA 1U30A 2VQUA 4GH7B 2V9TA 3O0LA 3RDJA 3EYFB 3OKOA 4ZJ9A 3HCVB 3OJ2C 1KJMA 1G1OA 1JD7A 5ELIA 1FH5H 1KIUA 4PY7B 3LZNA 3MRDB 1YEDA 5EEWA 3BUIA 4X9YA 5FUZH 1Z9NA 4FHBD 1TENA 2BY3A 3T0EC 4RESB 4PJ8B 3AZUA 1KFGA 1JDCA 1GYVA 5D7EA 3D3VE 4Y0GA 3MRKB 5CLXA 4P46D 4F58H 1QI3A 3DIVA 4CAGA 5A2JH 5C0GA 3CZKA 2XT1B 3MI6A 4G5ZH 4XAKE 2CO6B 5D2LA 2K8MA 2IANB 2KT6A 3VWJA 3O8XD 4NUGH 2VXTL 3CV5A 2GJ6A 5ABDE 4HPYL 2IC2A 3ARBA 3EO9H 3QEQA 4DOHB 1XGUB 3GUTA 4W6YB 4EZMA 2WY3B 4JY5L 1W2KT 3KPRE 5T3ZD 5IEKA 5TE7H 1XIWA 5F0LB 1NL0L 3GRWH 1QX1A 1KTDB 2C3WA 4U1JA 1AS7A 1YEKH 1L4IA 1A4CA 5EU6A 5HVHC 2V9RA 4PN6A 1UWGH 4APQD 3UJJL 4IBWA 4DERA 2R0LL 3MLXH 2RCSH 4HCRL 4UDUB 5FM5M 1Z9LA 3WJJC 2XN0A 4BRVA 4JFYB 3KCWA 4QJ3B 3IWVA 3CCHA 2WINA 1ZEAL 4NJAL 4BZYA 2BRRL 2IAAC 4GQQA 3RIFK 3CUPA 3CD4A 1VPOH 4KPHH 5MEND 3LMJH 4PR5A 1IGCH 5DHVB 1WFOA 2JB6B 3IETB 1PLGH 1KLUA 2OPCA 4WFGE 3VXSA 5LKNA 4AQAB 3T77A 3HAEB 2Q8AL 1A6WH 2KKQA 1OPGH 5FV1L 1TFPA 1IGIH 4NQCB 2J57A 3AU1A 3BWUF 1WIPA 1JTPA 1WZAA 4OLYH 4QTIH 5HHOA 3UAEA 4UTCA 3QHFL 1OGPA 3PV6B 2DEYX 5DZJA 1MWAB 4PGZA 2P45B 3EH3B 1NC4B 5FF6B 2CR0A 2YUXA 5CGMA 4TTDD 2ITCB 4ANKA 4U1NA 5JYLA 1KJVA 4X9FA 4CUCA 4NO3B 4PJHE 3ZKND 5C0ND 4PS3A 3ZVVA 3S37X 2FNWA 3T3MF 4JG5A 1H9VA 3V4VL 5KWYC 3A21A 1A7RL 3X1FA 5L88H 2DI9A 1Z3GL 5D5MB 1AS6A 1O9ZA 2DQHL 2QZQA 1Q9WB 3AT0A 4CBPA 3BPLC 3C87A 3OMNB 3U4EB 4DKFH 1V10A 1P7QA 2E86A 5DYOB 1LJMA 4XCNB 5H37A 3UYOD 4LBEB 4XMLH 3CX5J 3AITA 5A6IA 3DGGA 2NY4C 3WFCH 2WM0A 3L3OA 4PRHE 1HXKA 2ZCKL 3S2AA 1U8LA 3MMEB 4QT5B 3NCJL 4WHYH 4FNUA 4I18C 4Y4KD 3CVHH 3MCYA 6CGTA 4GMTH 8CGTA 1RUKH 4J3UA 5TDNA 5JQ6H 4G8FA 3GMOA 4IJ3C 4TRPL 1XFPA 4LCWA 3AJ7A 2W60B 3B8YA 3ULUH 3KPPB 1QFPA 1A22B 3S98A 1LD9A 3D51A 1MIML 3MRLB 4KVPA 5F7EL 4DK5A 5CD3B 2QVFB 4JZJC 2DQIH 5HYIA 1CT8B 3KYOA 5LCVA 3RWFA 4ETQA 4JQVA 4M62H 4FQIL 3MV8E 4BFOA 3BDYL 3CSYB 2VRKA 4FI7A 5GRVK 5A40E 1L0QA 3PWJA 4LBAA 5KJRH 3WNIA 3TASA 1BZ9A 4QXVA 4I3RL 5F3HB 2FX7L 4ZAKB 2Q7YA 4C55A 2MEJB 3NFNB 3DC0A 1NMCB 1OAKL 4QRUB 4RX4A 4YL4A 2YJQA 1JNLL 4O58L 2DAVA 2PW2A 5KYYB 5ID0A 2ATAA 3OPUA 1U8OB 3OSKA 4M8VA 1CFQA 1ZLVK 5F9WB 1CD0A 4PG9B 3VFTB 1KCWA 1DR9A 2LLGA 3L4VA 4UTAA 3ECBA 4IHOB 1U33A 3QI9D 4YSSA 1CFNB 1DVZA 3THML 1QMUA 3II3A 4QY8B 1VLXA 2X4RB 3R4RA 3ULVF 2C9AA 1TPXB 3LNFA 5LO7A 1C16A 3O4LD 1AMYA 4O2CB 1O6SA 1DBJH 1QSFA 4IEFA 2WVTA 4R2GB 2OLDA 1O7DE 2A83A 4O9HH 1AGBA 2OXHA 1Z6JT 1RHFA 3L5XL 5B3NA 4AT6B 3TIEA 1BVLB 4YSCA 3K72A 1Q9OB 5FA3B 1BQLH 2QVMA 2XKSA 3L5IA 3DV4B 2HG0A 4CC0A 3DX3A 4QWWD 1SDAB 1N12A 3IVKA 3MBWB 4RGOH 3LKPB 4FFWC 5C71A 4K8RH 3MTRA 1E9PA 1NGXB 3NJMA 1X5KA 4H25A 3ZDZB 1B6UA 1HHKA 2F0CA 3EH1A 2QDWA 4ABQA 3MJGX 4I2XA 3T4AA 5D7SH 3V9CA 5LXVA 3VRJB 3RUGB 2MQ0A 5EFIB 2IAND 2V4LA 2YC1A 5J13C 3CWGA 1MWAL 3SKUD 4PRNA 1UM6L 1LLAA 2Y3NA 2XVLA 5C0JB 2J1WA 3TTYA 4KJPC 5CGBA 5D7JA 3MOAH 4NO2A 4PYHA 1KGCD 3BRDA 2OULB 5D1ZB 5AOKA 2UZYB 5DFWH 1M71A 4FTVE 4P2RA 3FU9A 4JG1L 2B20A 5E2TH 4ELDA 4EDXA 4NKMB 3QCVL 2GJZA 3TEUA 5E4AA 3D12B 2A0LD 1NJ9B 3O9WC 3KWWB 2FSEB 4KFZC 1G5GA 4LEOB 4Y4FC 3WD5H 1ANUA 2EXWD 2WXRA 1M6OB 2PP9A 2MNJB 4N28A 5IB3A 3AXLA 4BCZA 5GGUB 4J3OH 3ETBF 2AQNA 3MGOB 4FZ8H 4PCSA 5DZOA 4PG2A 2HFFA 1MFNA 5DK2B 2RA1A 1CD8A 3G6JB 5HI4C 1P4BL 2XX0A 4Z7QB 2X87A 1ID2A 5KAQF 2GFBB 1EDQA 1EK3A 5F7NC 4LDEB 5DVMA 4POYA 5EEXA 1M3IA 3GMPB 4M6OH 3IJSA 2J5LC 2J1ZA 4LQFL 1CL7L 1N5YH 3LN5A 3UG3A 1ZK5A 3RNKB 2V5RA 4YHLL 3CBJB 4M43H 3ILQC 4NKOB 1DEDA 5LGHH 1UWXH 2ZSWB 2J25A 2NW2B 2AQQA 1Y1UA 1NC2A 5EZLB 4ZXBD 3M1BA 4NQCD 4K3DL 2BVOB 3RYMA 2Y25A 3ZE1B 3P9MA 3MRNB 1L3WA 1VGKB 3HBGA 3GMRB 2M26A 4GAFB 5I73B 1QYGL 3TJEL 5DJAB 2OQJA 4BKLB 5C0AA 1TO5A 3WOVA 4AQ8C 3OHMB 1NC4D 1Q1JH 3DRQB 5BQDA 3OKYA 4MXQC 3CIAA 5ADPL 3GJEB 3N0PB 1DYZA 4I1RA 2FK9A 1K6QH 3FOMA 2B2XL 4GAJL 3OB0K 3ZYIA 1NGQH 2QL1A 5HVGB 3LEVL 3RZCB 1X5AA 2XG4B 3S9DB 4YHOL 5JTWA 5BXFB 1QSEB 1ADQH 5K1NA 3CFKA 3MU3A 1BEYH 3MNZB 3ECWA 3VTMA 4X7FC 5DJ0A 3GIZH 2X4TB 5GGTH 2J5WA 1LXMA 3KR3L 1MLCA 5AFAA 1YMMB 3IDJA 1BV8A 1BFTA 1Q90A 3MOBL 2R1WA 5MI0B 1IB5A 3KDMB 5DFAA 1U92A 2MIZA 5SWSE 3NJJA 3ES6A 1IL1B 4R9HA 3GT6A 2ITDB 3HPJA 1JWUB 1NM9A 2X9WA 2J12B 1DCLA 4S11A 5E5MA 1TQVA 3FZUD 2CGRL 5EBLA 1LO4H 2VLLB 3R0MA 1KGYE 5IMKA 3E3QC 1IO4C 3IGAA 1XCQA 1E8YA 2AJ3B 3P3TA 2VE6B 2WUCH 5KS9E 4MA1C 2AK1L 5EU3A 5AZUA 1Z5LA 4Z7IA 4NQEB 1GXEA 3DX6B 4ORGA 4GXFA 4BV1A 4CDHA 5C6WH 1KJ2B 2W9EL 5TGBA 4D9LL 1AHWA 1FDLL 1P7HL 3A6CH 2DQEH 2W38A 1PD1A 4KKPA 5F3BA 3SCMB 4HULB 2GSGB 2OCCB 1P6WA 2HVKB 3QC6X 4JFWA 1GPOL 2ZKYA 5IMOA 1NINA 2IF7A 1JHTA 5IHBA 2GSIA 2H2PD 4R96A 2E7LC 4JG0L 1SDDB 1U3HB 3QEGH 4BYHA 4PJDE 3EG9A 4MNGA 4N0UE 4OZFB 2OR9H 4AKOA 4IBUA 4QGTA 1PEWA 2PWDA 3D0VB 4ALAC 1T21A 3NCMA 3L4XA 4OJEH 1OPOA 4CNIB 3Q8BA 4XZUB 1ZTXE 5E9NA 1A9EA 4AQ1A 1QD0A 3PP4L 5C0DA 1W8NA 3B7YA 1MFAL 4CJ1A 1DJSA 2EDEA 5JW4N 3RVXD 3VCLB 1IC7H 3ALPA 1KGWA 1RZ7L 1S5HA 3GBDA 4WLCA 5KVGH 2QR0B 1D5RA 1EFXD 4LSTH 1CXHA 4Y5XA 1KXQA 5KBNC 3F84A 2DKUA 4Z7WE 3R7QA 1AAJA 4JFFB 5GS3A 5C8JB 1I1AB 2FT8A 1JI2A 1RU9L 2FJFB 2NZIA 5GS0L 2ROXA 4LSPL 5AKRA 4HZLB 4NI3A 5HDQL 3WY4A 4P5TB 4R4NC 4V2CB 5FCSH 4IOIB 4R2GD 3VGBA 1P9MA 4DKEL 1WS7A 5ALBL 3UTPE 4XPGH 3ARDA 1OK8A 1B3JA 3SDDA 1HK6A 1NAMA 3BN9C 3KS0H 3KYMA 4DT2A 3T2PA 3U79A 4L5FL 2Y0SA 3ZDYE 1NFDB 2BSSA 4BZ1H 2Y7QA 4LFHG 3GB7B 5I9QB 1JK9A 1OXYA 5EZOH 1S78D 5H94A 1DBMH 3HI6H 4WFFD 1S9XB 4WO4C 3P0GB 1XF3B 5DJ8A 5C09E 1LE9A 4U3XA 2H2SD 5BS0B 5IWLA 5CJQL 4QHUA 4HIJA 4XBGB 3D9AH 4XRCB 3X3GH 1W9XA 1ZA6B 4G80B 3FO0L 4ZS6D 3VW3H 3BIAX 4XCEA 5B4MD 4XO3A 1J8HA 4YAQA 5LGYA 1K9TA 2D8KA 4PJEA 5I66A 5CD5D 1XCXA 2H8PB 3WEXA 1WBZB 4M7JH 1UYWH 3W81A 1FFOA 2FCBA 5D7IF 3KXFA 3ZIYA 4I48A 2WLMA 2Y5TB 4FGMA 3P0YH 4ZYKA 1G0DA 1T1XB 4PCTA 1AR1B 2FIKA 4OZHA 1IGYB 2D4DA 2IH3B 1FVCB 2G4GA 2Z31B 3FFCE 1F45A 1C5CL 5CO1A 1J0ZA 5B1KA 3RWGA 5CIPH 4Z77A 1OCCB 3CC5B 4K94H 1M7DB 3QG7L 1H6FA 4LK4A 4S1DD 1ORQB 3CVIH 4YDKH 5F1IA 5SWZB 1EAOA 2X6VA 1QLEB 3KLHC 2NNXA 5EZPA 5DK0B 5IF0B 5C7XL 5KSAB 4KZEL 5HHME 4KDTA 3ZE2F 2QQNL 2HB0A 3CZUB 1GZQB 1NCJA 4GG8B 4GI9A 2A74B 4NO5A 1FFRA 3BT2L 4XP5H 4K23H 4CGUB 1PY4A 3VI3A 1PPIA 1CG9A 1JF6A 4LCIL 5EU7E 1MVUA 3AB0B 3WKYA 4M02A 3UDWA 2X70A 3W3BA 3MLRL 5JHLH 2OSLB 5FYLL 4DZ8A 4QEGA 4QXGH 5TFSL 35C8L 5IJCC 4ZFZA 2AXJA 2E7HA 4M4RA 4ELKB 4OZGF 1AC6A 3FH7A 2BP0B 4F7TB 3NRFA 3PAUA 1K3ZA 4FFZH 1KJ2L 1OY3B 4WW1A 4B27A 3DLQR 3R06A 4DPAX 2DMCA 2ZYHA 2EINB 3VFPB 5I15H 4YQXH 5L7XL 4QRPE 1P4UA 4LCUA 2WNXA 1JWMA 1OP4A 2Q20A 3IBEA 4JLRB 1WFTA 4P57B 4R97C 4UF7C 4ABWA 4A68A 4FNLH 1E5ZA 1QFWH 2BDNH 3RZCD 5IREA 2CMRL 1F3DJ 4RAVB 2AJUH 5AD0B 4NUQA 3FCSB 2BZCA 3HC4H 3MJ6A 3IJ7A 2JKRM 4QRFA 4L4JA 1UURA 3UMTA 4Q56A 2LAAA 2WQVA 4BEIA 3X17A 1AYOA 4DO6A 3WIHA 3HI1A 2RQEA 1RZJH 1HYSC 4X9HA 1S7QA 1T3FA 1YC7A 2HLFD 1XMWA 2WVUA 1TLMA 5C0BB 2NRDA 4P23B 5DJ6A 5HDLA 3UAJA 2DEWX 1ZS8A 4BFEA 1RJYB 5J1TC 4WHTA 1BMZA 1XF2B 2LV4A 7CGTA 3MRJB 5FX3A 1D5ZA 1FZMA 3I02B 5K9JH 3EJRA 2J2ZA 3VFSB 2Y4SA 5IBLC 2ICWI 1BAWA 3LV3A 3VUAA 3UO8B 5C2BH 2CU9A 1NSNH 3OHXC 1RPUA 1F6AA 3B2XA 2P42B 3DSFL 2Q8BL 4NQED 4QYOB 1KJMB 4HIXL 4NJ9L 2VTFA 4X5QA 3U7YL 3ZL2A 4NT6B 5HHNA 3WE6A 3SCMD 5CS7A 1T7VA 2VWEE 4LSRH 1E3FA 3IRCA 3LIZA 3V4PH 1MJUH 4PRDA 2EUZA 1PSKH 1E4XI 1U3HD 3QZLA 1BGXH 1XZ0A 3M6DA 5C0RL 3PDGA 3LHPL 4NAJA 1MDTA 1MFMA 2OL3L 4FTDA 4PJ9A 4EZKA 5D2LB 4R0LC 3REVA 3VWJB 1GGCH 1KV7A 3D2TA 3D85B 2FE0A 1XF1A 5I8CB 4KX9A 4W9GC 1CK0H 5KOMC 3P02A 4Z9KB 2K9UA 4GLRI 4PP2A 3TBWA 2WIMA 3FB7A 1NANI 4G2AA 4N8VG 5HHXH 4RAUA 1QA9B 3MPCA 3IMSA 2V5YA 2WQSA 2J20A 4PJGA 4ISVA 5JW3L 1QHPA 5D1XC 4U1JB 2BOLA 4NQVA 5C08E 1S7TA 4GAGH 3BH8A 5EU6B 2BNQD 4JFFD 4NN7B 4QO1A 4Q9QH 4IU2B 1I1AD 3CXDL 3NJXA 4J3SA 2W95A 3JWNG 4FADA 5DD0L 1OLZA 1QPKA 3LQZA 3QIWC 4HA1A 4P5TD 3KBPA 1QATA 1TVDA 1RULL 3V7AE 3QULA 5A2CA 4P9ML 3UTOA 3CCHB 2WINB 3GYRA 1QLEL 1E2WA 5FKAA 3MRPA 3HFFA 4LLMA 1PCSA 3ZRCC 2E47A 3ZHKA 1G7LA 1WAAA 2AP2A 3KD4A 3CUPB 2OSXA 4ELMF 5F1SA 1FC2D 1GJWA 4X6CF 2QQLL 3KYKL 4ZFQA 4MXQD 1O7VA 1T03L 5ICXB 1D7BA 4Z5RA 1KLUB 3MV9E 2VXTH 4JS7A 4ENED 3U25A 4MMYB 1D6VH 3VNYA 1DVUA 2R2EA 1EJFA 1DVFA 5HHOB 3PABB 3L6FB 5BS0D 4ZFOA 1FNEA 1L9TA 2AW2A 2APWA 4MBOA 4NQSA 2MHAB 4GXVH 2UY7A 1R1CA 1NL0H 2NDGA 1NM4A 2HJLB 3MUZ1 1BVZA 4XGZB 1U4FA 1RKRA 2IEPA 5IG7B 2AQ3A 2OI9B 3KPTA 3N41B 3QUMB 5F6IC 1QI5A 5L0QC 3LXCA 3UJJH 2ZSVB 5AB0A 3PWNA 4AOFA 1OT4A 4HCRH 4ADGA 1KELL 2AK4D 1H5BA 5CJ5A 4UAOB 4ZFGL 2WMPB 1TQCC 3LEYL 1FL6B 1NDTA 5I24A 2XY2A 4NJAH 2BRRH 7FABL 3T0EA 4MZIA 2P3YA 4FHJA 4LLDB 4N87A 1RSYA 2I07A 4G8IB 4XT1C 3F7PC 3U36A 4IDJH 3HW7A 1SXBA 1MCQA 3GIVA 3KVQA 1V7MH 5CEZL 5SWZD 2EDTA 1SOQA 1JVLA 3ZN6A 3L3OB 4FQHA 4OFQA 2X0VA 4C56E 1U8JB 5EV7A 1U8LB 1GVIA 2Q8AH 5KSAD 2DWXA 2MTAA 1ZWIA 3HPLA 3FT4A 4RZCA 3TBSA 4QHPA 1WLHA 1GTFA 2ISDA 4RGMB 3TF7C 3S34L 1E43A 2EABA 2D7QA 3A6BL 1N68A