2BIOA

Human p53 core domain mutant m133l-v203a-n239y-r249s-n268d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
186
Chain Sequence
VPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRSPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 42
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bioA00
2ATAA 5AOJA 2RMNA 3IGLA 3TS8A 3D06A 3EXLA 4L0ZA 2IOOA 1EANA 3KMDA 3Q06A 5AB9A 2BIQA 4LO9A 3IGKA 2IOMA 4IBTA 3Q01A 2VUKA 2XWRA 4L18A 5LAPA 2J21A 2IOIA 5ABAA 2X0UA 2J1YA 4IBVA 2BIOA 2ADYA 4IBUA 2XWCA 2J20A 4AGOA 4IBYA 1EAOA 4MZRA 3VD0A 3KZ8A 3QYMA 1H9DA 2YBGA 2BIPA 2AC0A 3D09A 4A63A 4IBZA 3US0A 4IBWA 3EXJA 2MEJB 3D07A 1E50A 4QO1B 3WTYA 1YCSA 4AGLA 3ZMEA 1GZHC 2AHIA 2J1ZA 5G4NA 5AOMA 5LGYA 2H1LM 4MZIA 3US1A 5A7BA 2FEJA 1T4WA 2J6WA 3D0AA 1HJCA 1IO4C 1EAQA 4IBSA 2GEQA 3WTUA 3Q05A 1HJBC 4G82A 5G4MA 3WTXA 1GZHA 3WTSA 4LOEA 1TSRA 4LOFA 5AOIA 3WTTA 2WGXA 5ECGA 3WTWA 2X0WA 4G83A 3VD1A 4IJTA 3VD2A 3D08A 4AGNA 4GUOA 2J1WA 3WTVA 4L0YA 2P52A 1TUPA 4IBQA 5AOKA 2PCXA 4GUQA 2OCJA 3D05A 2X0VA 4KVPA 2BINA 5AOLA 3WU1A 2BIMA 1KZYA 4AGQA 2J1XA 1CO1A 4XR8C 4AGMA 3QYNA 1HU8A 1UOLA 5G4OA 4AGPA 1CMOA 4HJEA 1LJMA 5BUAA 5KBDA
chains in the Genus database with same CATH superfamily
4YR6A 3N85L 3UTPD 1JL8A 1YY9C 2ZCKL 3OKKB 4JFFB 1SOKA 4U6VL 2PXYB 4J3OH 4U1GB 3RNKB 3RVXD 4HUNB 1TKWB 2GJZA 1RI8A 3BQUA 4K7FA 4OZFA 1XZ0B 2VDKB 3CHPA 3U46A 4NO3B 4UV4L 5JZ7C 4MX7A 32C2A 4Q4EA 4TRPL 4ZS6D 4WVRA 2CHDA 4LKXA 1NDTA 4QRAA 2AZAA 2ZOOA 4QRSA 1B0RB 4YXLL 5BZZA 2HFGH 3B9KD 4JM4H 1JRHI 4EIUA 4JFXA 1JV5A 1MHPH 2DBJA 1QX1A 4ONOA 1NMAL 3GI9L 3RWGA 4O2CA 1QFHA 1TVBB 2DDQL 5C70A 3LEYL 4PLJC 4MMZA 2LU5A 3BN9D 4EAEA 1RZFL 2X2JA 4HS6A 1S5HB 4M6OH 5JQ6H 1FUNA 3LN9A 5C0IB 1HI6B 2AXGA 3O8XB 4QRPE 4Z78B 3IPFA 3D2UB 3BKYL 1R47A 2DDQH 4HZLB 4OFIA 1F45A 2GG1A 2HTLC 5A2BA 4BE6A 2B5IC 3V0VA 3EYOA 2P44B 1IEBA 3EFOB 3QBTB 3NPSB 3S36H 3LQMA 3GB7B 5DVOA 2CMRL 4IGBC 4QTIL 3IS0X 4Z1PA 3W0WE 3RU8L 3KPMB 4P99A 1BYNA 3OR7B 1K3IA 3VFVA 5IGXL 3GTVA 2QTEA 4U1IB 4WDIA 2A74B 2D4DA 2LU4A 4PP2A 4YPGA 1DQDH 4ANKA 4TPRL 5L4MA 3WTUA 4FQCH 4JO1L 3M8OH 5GZOD 3NIFF 2N4IA 3CBRA 5E2UH 5DD1H 3C5ZB 1DBJL 3FYEB 3HBQA 3FONB 5HHNA 5DURB 1MSPA 3SDCA 2XIDA 4W9LC 4Y5XA 2E7HA 4DH2A 5BUPA 4AEIH 1NCAH 5DZVA 3BDYH 3CZFB 5KS9E 3X3GL 1XGZA 4N8VG 3T3MB 2ZXQA 3JVGC 1T1ZB 2ZT9C 3QAQA 1FHNA 3KL3A 1MN4A 1ZLVH 3ULVE 1Q38A 3MLXL 1HS6A 4H20L 1J10A 4RGMC 4CVUA 1JGVL 4NN5B 4N1EA 5E6ZA 1E6OL 1FFPA 3WFEL 5F7LB 2MKLC 5EH1A 3EOBB 1P4BH 5L9DL 3BKJL 2FJSA 1DQLH 1CGVA 2KLTA 4LHUG 5EUKA 1LWHA 3QEHA 4XXCA 4NAJA 2XWDA 3FH8A 1RK7A 4X9GA 2Y2TA 1D6EB 2O5ZL 2VXQH 4LCWD 5INDB 2OQJB 4LEXH 5DUMH 2VITB 3NZ8A 4X4MA 2ZCLL 4FXLA 4LAJH 1TETL 5ISZB 1MCIA 1P84K 1UOWA 4MA7L 1KIUA 4GRWE 1MOEA 3V0DA 4KTYA 3V55A 4WUUA 3JWOL 3K1DA 4PGBA 3GBML 1S7WB 2OMWA 4U49A 4NJ9L 4FNQA 2AXFA 3SDAA 5FDYA 1FAIH 2HG0A 1V3JA 1MW1A 1W0YT 3JWNH 3QQ9C 4DPBX 4Q0XL 2QVMA 2MMXA 3HKZA 5E70A 1NFDA 1ZSDA 4QF1A 2BP8A 5J06A 3F7VB 4JFDA 1DEDA 2BIPA 2XWZA 3LKQA 3VNZA 4Y4FC 2L8AA 4U1KA 2FGZA 1MCFA 3FQWB 3ZIMA 3VB9A 5IROD 3PG2A 4MJ6B 5ABZA 1SLXA 4HIHA 4LAQH 1ZANH 1F6AA 5D4QA 5DWUH 3ZT7A 4Z95L 1RURL 5J6SA 1GZHC 2BIIA 5BVJB 4MQXC 1ES0B 1DUYA 1YDPB 5JMRA 2PPFA 1Z66A 3H8NA 3SJVE 1CGYA 3U82B 3B2UC 3VX1A 3MV01 5E2WH 5ETUB 4LU5H 1XD1A 4LSDA 2ATKB 3HE6C 1G1YA 2C1OA 1BFSA 3L7EB 1RD6A 1KV3A 2ZF8A 5KBLA 4JY4A 5C0BA 3MBWB 1JNNH 2Q2EB 2YEZA 3MV9E 2X89A 1T7WA 1FN4A 2LFEA 4WNJA 4I9XA 5GGSA 1BOGB 2XRAH 1MCWW 4ONFH 3QDJB 2QBWA 3VSVA 3DX0A 1Q9OB 2XXFA 3CVHB 1F0LA 5A6IA 5LHDA 3ULUH 5K9KA 4QRRE 2BM3A 1CVSC 2WVVA 1DVFA 1NGWA 3EYQC 3SKOB 1JPST 2YQGA 2OMVB 3FXIC 4MB5A 4OZFG 4ZMWA 3EOAB 3LS5H 4GT7A 3CDYA 3OB0H 3HI5H 2EEDA 5IFJB 4UTAA 3KPSB 4FNUA 3SGEI 1EZSA 1ZPUA 3OKLB 5T1KA 2HJFB 3HKFA 1TQVA 5F70A 3B7RL 5IVZB 5ESAB 1HNYA 3T3PF 4UQ9A 4ZRGA 5C92A 4MS6A 6PCYA 4NO3A 3WIIL 4HJEA 5EO1B 2ADFL 3S35H 2JSFA 4M4PA 4AYID 3U9PH 1CFTA 4JZOB 2G75A 3V0WH 3MRGB 4F8QA 3UO1L 4OCSL 3MNVA 1CE1L 1CR9L 5I16B 1OP4A 2HX9A 4MZ3A 1N7MH 1HH6B 1L3NA 4JQVC 1USZA 4LSPH 1KELL 4M8VA 4ICXA 2BIQA 1BFVH 4X8XA 3BEWB 3TTYA 1SHMA 1E4WH 2V8LA 4KRNA 5CFHA 5KZCB 3IGFA 5CR8A 1P1ZB 2IOIA 5GHWH 4KZEH 4PJ9C 2TRHA 4LMQE 4IU3A 1RZKL 3DROB 4WJ5B 1TJXA 1CIUA 4B9JA 4PWJA 2W0FB 3EH1A 1MJ7H 1SEBA 5GSRB 4JCMA 3X12A 4HP5A 1AKPA 1H0DB 2W0PA 1JRHH 1P4IL 1W8OA 1T20A 4DVBB 4PVBA 2ZUSA 2UY6B 2RALA 4C4BA 4IMLB 1NICA 3A4EA 1FGVL 2R51A 3QYMA 4HX1B 4KROC 3GJEA 3PABA 4MJHA 5FM5O 4OZGF 3KDMB 3U9UA 3VI3F 3S34L 3W0WD 3IE9A 2QGCA 2VB5A 1N67A 3VSQA 5BO1L 3U4EB 4EOWH 4N24A 1IGJA 1LHZA 2VQTA 4FHJA 2CALA 4KK5D 4YHMH 3TCLB 4HPHA 5I71B 3W11C 1HH9B 4C4UA 2A9ML 3RIAK 1CLOL 2Z8RA 4NQEB 4OGXH 3LMJL 3RJOA 1NGQL 3CFTA 5KUMA 1A14H 2YGNA 5IQ7L 3ZKXC 1DQJA 1E2VA 2XG5A 3VXNB 5ESQA 5DJ2B 1TJHH 4PEEA 3QEGL 4RFNB 4Y5XB 1OGSA 2FR4B 4YWGL 1II4E 4FI8A 4BK5A 1XF4A 4Z7WB 1D9KA 5I6NA 2HFFA 1MUJB 1PCXA 3CHXA 1E65A 2A73B 2FL5A 3GBNL 4N2GA 2VXVL 3AVEA 3FU5A 3OGCA 3TT3H 4P3CH 2R2HB 2EKSB 2P80D 3MRPA 3VI4B 1GS6X 5D93C 4NZUL 3RFRA 2VYRE 1NFIB 4GP4B 5FO7A 5M95B 1P5UB 4NHCL 4NHUB 1N9PA 5LNDA 3K72B 5C9KA 1G87A 4NQDE 2BPBA 4PWHA 5L8KB 5LXGL 3VD5A 4OLXH 2IGFH 5AVQB 1GC1L 2FBRA 3GUFA 4ZTPL 1ADQA 3TM6A 2G3ZA 2XBTA 3FYIB 3V0EA 4FI6A 2O26U 2V5MA 5JOPD 2F5AL 5HDBE 5D5MF 1OOAA 3M1BA 43C9B 3SQRA 4MNGE 1LDPH 2NMSA 4QGYA 1PGRB 3BEVA 4FADA 1SJEA 3F62A 3OAYK 4HFWA 4S0TD 3TBTA 1EHLH 2BVOA 4DKDC 1HEJC 5B1KA 4N9GB 4YSPA 3EF7A 3WLWD 5CU5A 3QGVA 2MWCA 3KGSA 4HJIA 1AI1L 4R26L 4GI6A 2C3WA 1JPEA 2VLLA 1TCMA 2APFA 4OW6A 1KPUA 1ZHKA 3IDIA 3NIFE 3EZ8A 3K5SA 4LGRB 1IJNA 2G60H 1URLA 4F15C 2JCCF 4GUPA 1PLGH 4OQ1A 2VC2B 1JZIA 5EORL 1P7KA 3HBGA 5DZAA 2A5UA 2OA9A 3BDYL 3OJMB 4TSCL 4Y5YA 5JDSA 4JG1L 4U1KB 4D8PB 5IB3B 2PXYC 4MJ4A 1XBDA 4ODUB 2GJ6B 3KVDD 4N26A 4PY8I 4YDVA 4E0RB 4RDQF 3HFMH 3QQ4B 5LN4A 1IKOP 3DSFL 5BV7H 1NIBA 5DSCB 4P4KC 1H3TA 4ZOEA 1BVNT 3B2PA 4YFEA 5BVJA 1S7XA 3EBHA 4OLWL 4NO2B 4L8CA 4O4YH 1BFOA 4G8FB 5D71L 2HYMA 4AC2A 1OKEA 3ZYOA 1IGTA 5HJBA 1G4MA 4B96A 2FH8A 3L7EA 2BNRB 4IRZH 3O0LA 4HWNA 4JK0D 3N41B 2YEZB 2XSKA 3CN4A 3MUZ1 1HQRA 4I3RH 1OTUC 3TBWA 1TTBA 5C71A 3PGCB 1NDGA 3LSOA 2AI0L 3QDJA 3WJLA 3UTTE 5T1LD 1OP5H 2AJUL 1CFVH 3RAJL 4F7PA 2OPCA 3AQDA 4BWUA 4N3TA 3NFNA 1SVBA 3NJIA 3QWRD 5FS5A 2XN9A 2AQ1A 4TLTA 1KN2H 1WFTA 1HC1A 3GT6A 2AJUH 3ARPA 5C0FB 2DIAA 3E2HB 4LCVA 5EC2B 2F19L 3T1WA 1RZ8A 2D3VA 1TQSA 2BSSB 2AFNA 3PHOB 2L7UA 4FLSA 1RZKC 3BKCH 4NN6B 1Q8MA 3PDOA 2D0HA 4Q6KA 5F9OL 1ET7A 2JK5A 1JUFB 1KTDA 1BGXL 3O3DA 1CO1A 2OL3L 4HWBH 4S10A 4DKEL 1I1CA 1WIOA 1F8TH 2BFGA 1DJSA 2C7UB 5C0CE 5ES4B 2ALWA 4L37A 1HHGA 5GZOC 4E41D 5SWSE 4X6CA 1TLMA 2VL4A 4K9EH 2KLSA 4PQXA 4DN3L 1E3XA 1DSWA 2OSYA 1AIFB 2RMNA 5DMIL 4IU3B 4WJ5A 4UB0H 1IGIH 3UABA 3KCPA 5CHNB 3NG5A 1YNKL 2IH3A 3CVBA 4W9IC 5DUML 2F54B 1S9YB 3QZWA 4JKNA 1Q0YH 1NCBH 3WNOA 4OGYL 1UM5H 1Q1JL 5T5NF 1PLAA 2FHBA 2HLAB 1JNHA 4M48L 4NUJB 4ES9A 2I9TA 5JHLH 3G5YB 4J5VA 3IFLL 1TDQA 1FYTE 3KDMA 5DHVH 4RISL 1GZPB 5EC1B 3NN8A 5D1QC 1T5WA 4LDOB 3PRZA 4KBPA 4NN7C 4FQHA 5L2JA 3HI1A 1UD6A 2FO8A 2WBJC 1MW2A 4EUPG 1YG9A 4PRAB 3IKCA 4R9HA 5JO5B 2EZ0D 3KDPB 5E4IA 4KGLA 3US0A 2VERA 2N7SA 4W68A 4OF7A 4PY8J 2Y1AA 2CRMA 3L9RA 2EIZB 3V4VH 1OAQL 4WV1B 2TSBA 1BVLA 3OKOA 3AABA 3BOVA 3DTUB 3NYKA 5CN3A 3LVEA 2LLNA 1OLZA 5C0EB 1EZVY 4EI5A 1F5WA 2DLFL 1T1XB 3TYGH 4AEHH 1DJWA 5GS0L 2R0WL 2A73A 2FL5B 1P84J 4QIRA 3QJFB 2QPEB 3QUYB 1RXLA 3F12B 3CVHH 1G6VK 2HJKB 4Y7OC 4JR9L 1TJHL 1CGUA 5DHVA 4WI9A 1TTCA 4ZO6A 2Y24A 3ARDD 1IBZA 3FO2A 3HN8A 5C0JB 4ALAL 2D7NA 2VW6A 2DS4A 4MXQC 5DJYB 2VLKD 5D6CB 4UMGA 1MEXH 3HG1D 2ESVE 4FFWC 2HG5B 3QJSB 2R59A 2KS0A 1SBBA 3ZE2F 3E2HC 3FT4B 3WXVH 4KDTC 5IB5A 4KX7A 5I2IA 5JIIA 2FHFA 3W39B 3N1QC 2EADA 3DOSA 1FO0B 3TXAA 3IDXH 1Z7JA 1E9PA 1ORSB 4MFHA 5IFAH 1FNFA 1MCJA 6FABH 5H4ZA 2ENSA 2CPUA 4UAHA 4PU2A 1FRGH 3CZJA 3ZZQA 2NNAB 4PJ7F 1IBDA 1R17A 3QUXD 4LSRH 3F7QA 1H3GA 2X70A 4ZMVA 1N8OE 12E8H 2VQ1B 3E9TA 3BW9A 5CJOL 4A1RA 1D2PA 4QHNB 4IRJB 4HOWA 1USQA 2OX5A 5FECB 2BOBA 1CZ8H 3OJVC 2WZ0A 4PTUB 3ZRFC 1Z5YD 3H56A 3A4DA 5IHZB 2SEBA 3D06A 4KHXH 3VJ6B 2XN0A 3FRPB 4TRPH 4LSQH 3FMGL 4LPCA 4GSUA 5L7XL 3I6LE 2V5SA 4JZJA 4FQ2H 2E47A 1Y1UA 1ESOA 1WISA 4JO8A 2CM6A 2ZPKL 1WJ3A 2EE3A 1UA7A 5IEHB 4YDVB 1TNMA 1LE9B 4NS0A 5GGUB 5F9JA 5E6IC 4MNHB 2EVFA 3GRWL 1JWSA 2MPAH 4Y2NA 1BZDA 2E56A 4XMKH 1X4ZA 4GBXA 1IBGL 3QXAB 1ZA6B 2VIRB 4HZAA 1SMDA 4PW4A 4EDWL 4MNQB 3DLQR 2EC9T 3KPRD 4DAGH 1BF5A 2K6YA 2C1PA 1JXKA 2EYTB 1NEZA 4I9WE 5DJCA 3BWSA 1W6LA 2VMDA 1E2WA 4FQCL 4K7PH 3IWUA 3WD5H 3BLBA 1KZQA 1E50A 1WBYA 2DLTA 2P49B 3AXLB 4G6MH 3VWKC 1E4KA 2WKLA 1NGPL 1JF6A 5HY9B 4K9JA 1KJ2B 5SX4I 4NQXB 2L04A 1MPAH 3QO0A 1Z5LA 3F85A 4N1CA 3DJSA 4TSBH 3N0PB 4IDJL 4QLWA 1H3VA 1MKFA 5HYEA 4QDGA 4UTCA 3ULVF 4PW9A 3W5MA 4G5AA 2W65A 5IQNA 1UM6H 3P73B 5DJDA 2BIHA 4R4FH 4LPVA 3UGUA 1RKRA 4HAFA 3F7YA 3D39A 4FQLH 5CU9A 1ITBB 3BPCA 4KNUA 3QDGA 3GRGA 2HX8A 3D85B 4BZ2A 4QYAA 4X5PA 4UAOB 3L95B 1OAUL 1KN4L 1RZ8B 4M1DL 4TUKH 5F8QC 4UI2A 4L05A 1C8QA 4Y1AE 4PLKC 3S36L 1JI1A 2YC1B 1SN2A 2DLIA 2XV0A 4HKJA 5JTWA 5H8DA 1HNFA 5AVVB 1S9VB 2O5XH 3QRGH 5IFHH 1DBBH 1NIDA 3LRSA 2Q7NA 1T7YA 2ZP9A 3MA9L 4P59H 4G8GD 3UTTA 1SDAB 3U0TA 2GITA 3WYRA 2JJWA 4WO4B 2C7UA 4PM1A 3UCRA 4LVEA 3DK0A 1THCA 2X40A 1GOGA 3JTSB 3PJNA 4I7ZC 5DRXA 4CC4C 1IBHA 1F6FB 2X88A 4ZMTA 2CH8A 2FSDA 4U1LB 1IGML 1MCOH 2WSKA 5HXMA 3QWOB 4H13C 1KLGA 4ORGB 3SSGA 4E5XB 3UYRH 1KJVB 3OZKA 1SGKA 1JXJA 4L8SC 1JWMA 3C12A 4FQQB 1TPXC 3TH4T 3HE6D 3QIWC 4OCWH 4RMUA 1SJVA 5DMYA 5I30L 4TNVK 4ODTL 4R3SB 3QHFH 4R4NC 4NUMA 4TNEA 3U6RA 2X6AA 4ZFOL 3PREA 1OD9A 2DYPD 3NACL 2VLJB 1JV2B 5IHUH 1A64A 4WTXA 4JMXA 3C8DA 4DSYA 5GRUH 1V7NL 1YMHB 2F7PA 4PRNB 5TDNA 2GSMB 1WC7B 2XZCL 3Q01A 4YSRA 3AY2A 1EWHA 2ICEA 3S3BB 4EPSA 5K33A 4C56E 3TZVC 1OAKL 3RUGF 3OGOE 4ZNEA 1DLFL 3U1SH 2CCLA 2E7BA 4IHBA 3WIHA 1DQLL 2MCPH 1FC2D 3NP4A 4PVNA 4M43L 4YFLF 4D0CB 4ZPTA 5ANMB 4DP8X 4JPSA 2JJSC 2JB6A 4AZUA 2NQCA 3DBXA 4TMPA 2H2PC 4WV1A 3LIZH 3V9EA 5EOCL 2XY1A 4GAGL 1FJ1A 1NCOA 5A2IH 1YEHH 3IMVA 4F8PA 3KVPA 1UWYA 4QJ5B 3ISRA 5C0EA 5T1DL 4EI5B 1YAIA 3UAEA 4QHLA 2GUOB 2NW2A 4MD0B 3ZHKA 1AY1H 2FATL 1LVEA 5FA3A 5FO8A 1FLTX 4F9PA 1TCRA 1P5VB 5D1XB 4PVMA 3ULVL 5DHVB 2ZCHH 3IMWA 3ZTNL 2IADA 4U6HA 4ZDHB 1UWXK 1OB0A 3X11B 3BN3B 3L1OL 1U8IA 3M07A 4OJCA 3L2LA 2XXCB 2Y7MA 5FGCE 5LKNA 1SQMA 2FZ3A 3HG1A 1HDMA 3ZZSA 2HG5A 3IAPA 2BCKA 4HC1L 1LEIA 4APQA 5IB5B 2CLVB 1A7RH 3E8UL 3IFNH 3WEAA 4TNWK 2D7TH 4GKSA 1QVOA 2FQGA 4UDTA 4UV7L 4XHQA 5IBTL 1CL7L 4G80B 4BH8B 3LH9A 4GG6A 1WWBX 1AFVH 3GSUB 5JA9A 3B37A 1AO7D 2H9GA 1KIPB 3UMNA 2FUQA 1HNGA 1KB5L 4M7LL 3CDFA 1NCHA 4L9DA 4LLUB 1BXXA 1BPVA 1HWHB 2C9QA 3G5ZA 1BEYL 4G8IA 3P9MB 1BBJA 3GEWB 4QHNA 1ID5I 4XPTL 3ECUA 1EGJA 3BVTA 4WTWA 3ERXA 5I28A 4UNVA 4WEBL 2WQWA 3C8KB 1IIKA 5G4OA 5I0ZA 2C9XA 3Q5YA 1CDGA 2DI8A 2OR8A 4GSDH 3CXHK 3QS3A 4U05A 1TNNA 2R0KL 4A55A 3THMH 4K71C 4CADA 4UIMB 2HH0L 4RGOL 3BZEB 3L48A 3RA7H 2Y69B 2Q86B 3T2QA 3VWKB 3IFPA 1L3WA 4WWKC 2OYPA 5IUSA 4P3CL 2A9BA 1Z0NA 3BVWA 4LXFA 2AQRA 2OP4L 4MAYD 3UGEA 5BJTA 4MHHI 1ZA6A 1FG2A 1XGQA 4BZ2L 2ZCKH 1MZYA 1A1MB 3GZPA 2ZXCA 4FTVD 4F9PC 2I32A 3LX9A 4FERA 4B7IA 4FABL 3FS9A 3HMXH 3MOAL 1EZLA 2C3XA 3FZUD 4PGEB 4H0HB 3BH9B 1IJ9A 1UH3A 3IJ7A 1EFXB 1BF2A 5JLZB 4A7TA 4P4KD 4YR6B 2MCAA 1NIEA 2OW6A 3SKJH 4Z7QB 1BBDH 4GMTL 4C83B 2L7QA 3V7AG 2YR3A 4A6YL 3WIIH 4MCNA 3T2OA 4K7FB 3BVNB 3B9KC 3SPVB 2G0LA 3MA7A 1TPXB 4ZW5A 32C2B 4G8EB 3ISWA 4PS3A 1PG7X 5DURD 4GRLA 1DSYA 4M1CC 3MJ7B 1MFMA 4FJYA 5CN1A 3RKPA 4A7GA 3QA3A 1HJCA 3IEAA 4R5VA 1Q9KA 5FYLE 4YHNB 4FQIL 3SGDH 4QCIB 1TVBA 4OJAA 4JPQA 5CZRA 2CJSA 5MEPA 4JFDE 1T7ZA 1FBIL 15C8H 2LW3A 1AHWA 2FX9L 3FCUB 2WUBL 3IMRA 4R4ND 2Z4QB 5B7FA 1FFQA 3QORB 1HJBC 5E8DH 3P4OB 1D5ZB 3CFIC 4KRPB 4OUUA 3PJSB 1WTLA 4BFIB 1KWKA 4F7MA 5GISH 5K1NA 3APFA 5L4JA 2CXGA 2EDYA 5J5EA 4XP9H 5AYQA 3D2UA 1YEDB 4G8GA 5C07B 4WFHD 2AV1B 3GHEL 1S5IH 1J8HE 1FZOB 1SOSA 2WCPA 4LLMA 2ZUQC 3DX9B 1T2QL 2QPSA 4UBDC 5CUSL 3BSHA 4MDIB 3NA9L 3CVCA 1VACA 1Q0XL 1KLGB 4E5XA 4UQDA 3VI3B 4GUQA 3UDWA 2CK2A 3OR7A 4DKTA 1E5CA 2LAGB 1SDDB 4FQQA 4H0LC 4WUKH 4YPGB 3OR6A 1EEZB 1JGDA 4KXAA 5KVDL 4KFMA 4PB9L 1F3RB 1XD0A 2RD0A 3OTTA 4AM0A 3PIQB 5BV7C 4NO5B 4Z7OE 4X80L 3IKKA 1WBXA 4K8RD 4OLUH 1NGYB 5IWLA 4NGHL 1KBPA 4NYLA 4PJ7A 3BP4B 1RUPL 4X8CA 1Q4NX 5HVHB 1O7DC 4FA8A 5E5UB 1J0YA 4FRWA 4B60A 1ZTMA 4OFDA 4J8RB 4HGMA 5J89A 2XWBB 3KPLA 4XP1L 1HE8A 3IFOA 1IC5L 3WMQA 5D7LA 4HA1A 4NZRH 1Y6MR 4GSRA 2F58H 3P3YA 1BAFH 2WB7A 1A7NH 3ROLB 3BJ91 3VGAB 4O02H 5F72S 4XCCH 4OLZL 2AJ3A 3T0ED 3B43A 1FIGH 3BE1L 4NRXA 4JREC 1FFPB 1KCSL 1YSOA 3ATFA 3I6SA 4L3FA 4MAZA 5F21B 2NZ1A 3LNEA 1Z5HA 4OQTL 2AK1H 4GRWF 1DVYA 2Z35A 3HUJA 2B1AH 2DMBA 2A83B 3NIDE 1NCTA 5JIQA 4F92B 3HB3D 1KLUB 2FRGP 4DKFL 4NQSB 1TCRB 2LFGA 2D0GA 1TTAA 3VMPA 1REIA 3NZ8B 5C6PB 4ZDHA 3U0PA 3AM8C 2A6IA 2XC8A 1TZGH 2Z93B 2YA1A 4YEFA 2ORBL 3D12B 2DAVA 1GYUA 4H20H 4KZDH 4RFEA 4MNQE 4YSQA 2P46B 5D7SL 1BWWA 3PGFL 1ZGLB 2HRPL 4WQOA 3AREC 4ZTOH 3RDJA 5FX3A 4B9GA 2LLGA 4G80A 4RGNB 1G94A 3D51A 3KNBA 3MBXL 1NBVH 3L4TA 3NEXA 2H9GB 2ZKYA 3G08A 1GL4B 2GHWB 1AC0A 5D1XD 5CGTA 3ARYA 1B3JA 1OF0A 3SB3A 3RB7A 2EDEA 1FZMA 3HFFA 4V33A 5E2VL 2DQCH 4G8IB 4NQUA 3OXSA 4OGAC 1JYXA 5I15H 3GMRA 4DCQB 1F6AB 5KW9L 1O5DT 4PRPE 4DUVA 1BQSA 1F8TL 1DVZA 3C60A 4QRSB 3E7JA 1OSYA 3R1GH 3OAYH 1ETZA 1JZ6A 1MI5D 1NMBL 4KVPA 2DPKA 4AQAA 4AQEB 4AW7A 3S4SA 1RZIB 1HTYA 3PV6A 4X5QA 3M7OA 3W0WA 2QVFB 1M6OA 1FVCB 1QTPA 4YSAA 3AXIA 1JNNL 5I17B 3IFPB 5KSAD 2K0RA 4G42A 5B1BB 1JYVA 2EDBA 2NY6B 3SYPA 4E9SA 3ULUC 2WD0A 2AW2A 1HL5A 1UZ6F 4PJHE 4XN9A 3TS8A 5J6HB 3MJ9H 3QVAA 1J1OH 2NY0C 1HL8A 4NQVA 3EFOA 2AP2A 1HAUA 2JKIS 3S98A 2VOTA 4PJDE 4PRPA 3BT0A 4O2EB 4XPHH 1NC2B 3MRQA 1TG8A 3CG8A 3QWRA 1B4JH 2DQUL 4DJMA 2YLHA 4NLHA 5IFJA 1GCFA 2JIXB 1B0IA 3GBEA 2YS4A 1I8UA 2VLRA 3QJXA 1G5AA 3BH4A 3QUML 3NTCL 1KSRA 4K5OA 4GXFA 3VFRB 3VA2C 1B88A 2HLEB 3B4NA 3MODL 3U30B 1EBAA 3RDTB 3Q8CA 3OSVA 4LCYB 2AJYL 2AVGA 4NFDA 2A4CA 1I8KB 4RETB 5KYXA 4K9EC 2NSMA 4P4RB 5EU7E 1HSBB 2ZOKB 3TIEB 2Z64C 3R0NA 5AYTA 2VMFA 1P6AB 3EYFA 2QMJA 3DJZA 2AQ2A 4M03A 1F02I 2QHRL 1EA9C 3ECVA 5EBMB 1FGVH 1OF2A 1P1ZA 2QTVA 1IC4H 1M2VA 2JB5L 2K4WA 2R39A 1WD9A 3A4AA 3DTDA 3N85H 4E41A 3LAFA 4PJFF 4RRPA 3G6AB 2H32H 2B3IA 4ILDA 3GC3A 1YEDA 4G8GB 5MEQB 2MNUA 4KZ0A 5D7IF 1KGCD 1AQ8A 5AZ2H 5GZNA 3I75A 3WAKA 2YRBA 3L3HB 4FD0A 1SBSL 5FGBC 3PABB 4MXVE 5EUOB 4GI8A 5I1HH 1OAQH 3JTTA 5CP3H 3FCGA 3ZMRA 4GUCA 1X5ZA 3QDMB 1X5XA 5E2TH 2ZYHA 2WVSA 2VDNL 2VDRH 1W0WB 3FUIA 2BH0A 1FVEB 3V0WL 3EJQA 3WD5L 4Z9KB 4OVUA 4ZD3L 4I4WA 4YZWA 1ZLSL 5I1HL 3P2DA 5C0CB 3QWQB 2VLJD 1MFAL 3PIQA 1PY0A 2IO5A 4YSOA 5JW3H 4J39A 3EG9A 4JFEE 3BGMA 2A99A 4PJ7B 1J8RA 4WUKL 2OZ4H 3GIVB 1QUNA 1KBBA 2ED9A 5AZEL 5CM1A 4XBGA 3QQXA 4TSCH 1XSIA 4D3CL 4JDZA 2J5LC 3TF4A 5IR1A 5HDQL 4JJ5A 3WKQA 3NA9H 3JBG7 4U6TA 3UYOD 5HGDA 3QHZL 3QIBD 3GPSA 5F1IB 5EZIH 3RWHB 4A67A 1A3ZA 1NL0L 3OGCB 3WKML 5EFIA 2R2HA 3MRPB 3O4LE 4H8WL 4HZ1A 5TE6L 2CO3A 4EZMA 5I1DA 4XI5C 4OD2A 2Y7QB 1AYRA 1XIWC 1T0OA 2H8PA 1NEPA 4L3EB 5CINL 2WTOA 1P5UA 3QRBA 4X9BA 4N4YB 2E6PA 4G6AC 3Q8EA 2EILB 1LD9A 1UT9A 3WKNA 2V0AA 2CLRA 2WQ8A 2IWGA 1H3WM 1RIHL 2ZWKA 3HUJB 5JXAL 4PJAE 4ZUWB 5F7UA 5IBLD 2PCFA 2SODB 3CC5B 3Q48A 1SOQA 1DVQA 2ITCA 3G5VB 2XKUA 1AG6A 2OV0A 4G5ZL 5CF3A 1CDCA 2DWSA 2CPCA 3ZVVA 5I24A 2X44D 2VM4A 1VFUA 4LRNL 4WWKB 3FUHA 3ZKMC 1J0IA 1MFCH 4ZSOB 2XYCA 4JN1H 3QJHA 4QRUB 2EH8L 3OM3B 4CN4A 1LEKA 4I0PA 4WI7A 3UZQA 1E90A 3AFLA 3DX7A 4XHJC 5KJRL 2DMCA 1UA3A 2YA0A 4YK4C 2JQZA 2V5TA 4JY6B 1K5NB 1DUZB 2EDJA 5IW1B 3CWGA 1RUPH 4YGVA 3GJFB 4K8RH 3CSGA 4EN3A 1I3GL 2CHZA 3HPJB 2K7QA 3PY9A 3IGUA 2NTFB 1INEL 3WUWB 2BRRL 1I9RH 3K80A 5I6KA 4X7DC 1HINH 5D1XC 2Z8SA 2G9HB 4K8RC 1OOWA 1AS8A 1YNTA 3GMRB 3IU3A 4DCQA 4QRRA 2QFRA 3BO8B 4YFLI 2XTJB 1FYTA 2YXVA 2E74C 3QG6B 2Y0SA 2IEPA 3H85A 4LSTL 4PP1D 4EXPX 1S7XB 1BG9A 3OAUH 4DK3A 3GSNH 4ZUSA 5K9QG 1KNOB 1R5IB 2X3AA 3AT0A 1BYPA 5BQDA 1T80A 3EUUA 2Y9RT 5E2VH 3ZKMD 1CURA 1NM9A 2FWUA 4NB7A 3WE6B 3MV7E 5ICZA 2HTKC 2WNGA 4LCIL 4DW2H 1CGSL 3BWUC 1GSMA 2AABL 4HKBB 4LLDB 1MRCH 4K3DL 1KXTA 1VCBC 1L0XA 2VMJA 2AVFA 3B3IB 2R83A 2UY7B 2YAEA 4DVBA 4MCZA 2WV3A 4N2DA 1CL7I 2P5WA 5D1QE 3HB3C 2KH2B 4LK4A 4ZAKD 4QD2E 5JHLL 1BJ1H 4XBEH 1CTMA 1UZ8B 1V8HA 5B3JE 3IJHB 25C8L 3QDME 4G72B 3CU1A 3NCEB 3RX9A 4V11A 3MRQB 3CFDA 2OJEA 2L7JA 5T3ZE 3VXTB 2CDFA 4BFJA 1IAIH 4QO1A 2P26A 1NC4A 4TQIA 1CL7H 3VGHA 4GAAA 1A7OL 5MENE 4FE9A 1XGUA 4DW2L 1TIUA 3PHOA 2IQAA 4MGXA 1KENH 2O93L 3RB5A 4Z7WE 4WGVB 5M7QA 2Z92B 3BQVA 3GUTA 3E6FB 4Z7UE 2R69H 2A1WH 5E2WL 2XG5B 2HKHH 4RBPK 2JK5B 3C6LC 1JD7A 3CHQA 3VNYA 4KH9A 3KM2A 3OSKA 4PLNC 1FNHA 2R23B 2FR4A 4DKEH 3QIUA 4YPJA 4FQ1L 4Z7UF 1DN0A 3T8XB 2AZUA 5LGJA 2HVKA 4O02L 4WUUD 4L1LA 2GYSA 1UXLA 3VGFA 1S9XB 3VFUB 2X4RB 5L4FA 3CCHB 2HMIC 3VW3L 4MMZB 3EJUA 4A37A 3AU0A 5F2FA 4HS6B 3K71A 1V7NH 3SQBB 2ITDA 3QR2A 3BH8B 3S96B 3K4DA 3FZUC 3BAEH 3GD1C 5BOZG 2FH6A 4XC1L 2VERN 4O5LL 2IH3B 2VSDA 5IBLC 2BXYA 3PYCA 4AT6B 3ZBMA 4ODTH 4PR5A 2M8XA 3DSNA 1JJUA 5CIPB 1I75A 2FECI 4NZ8A 2WGNB 4DPCX 3HE6A 1TVHB 3ARTA 1JPSH 2HLAA 1EGJH 1OSPH 4UZGA 2I60H 4Y5VA 4PBWD 2W9EL 5IMKB 4MJ5B 2R1XA 1GJWA 3G5YA 3V0FA 4J6IA 3GHBH 4P2OB 1DLFH 1T5WB 2WP3T 1EUUA 2X9YA 4NQCA 3WXWH 3VFVB 1FH5L 4AK2A 4F27A 3MMEB 1PD1A 2GJJA 3VACA 4K23L 4LP5A 4UQ3B 2X0WA 4X4KA 4RIRB 4OF8A 3ABLB 3MXVL 4Z7NE 4XC3H 3EH2A 3WHXA 4JHZA 5DYOA 3WI9A 1KC5H 3LB6C 1RZ7H 3NIGF 1CXEA 2WXMA 2UZYA 1F3JB 1T66C 4LQFH 4KMQA 5TDOA 3T3PB 2I24N 1SHXA 4QHKI 3Q9PA 5J13C 1ZHKB 4RESB 1G7MB 3QISA 1NKRA 2H32B 1GAFH 1MXDA 2X0VA 2P7TA 3VH8G 2VMEA 4MQ7A 1C7TA 3UXFA 2J57A 3S8FB 5CBEB 1T1ZA 2HT4D 2YJLA 3MUY1 5FO9A 1AZUA 3HE7A 3KLDA 3QJFA 1IGCH 3TN0B 1OZTG 1I7TA 4LCCC 1I3VA 1KB9K 2F1BA 4H88H 2GTZA 2K6WA 1EMTH 3O45B 4N0CD 1HU8A 2CO1A 3NCMA 3GXIA 1T83C 5TF1L 3QQ4A 4M8QB 1TOXA 2NR6D 4LBAA 1QSFE 1U92B 5D2LA 4EIBA 3NMEA 3S9DB 1EJ6A 5DJYA 1U91A 5DT1L 1D6VL 4MB3A 3RIAF 2NY5C 1N10A 4HGKC 4TM9A 4FXKA 4M56A 4XXDA 2CLRB 2EIDA 2XVBA 4PJFE 1TT6A 3KMDA 1YEKL 5I66B 3QC5X 4ZW3A 3ULAB 3QDGD 4XNXH 5HYIA 4L3EE 2LTQB 2VISA 2ENYA 4H5SA 5ILTL 5CSZB 3UP1A 5IVXA 5CD3A 2PYFB 3LV3A 4H1LA 2WINA 1KMGA 4XCFL 5EEXA 3MJ8B 5B22A 3M86A 3CVIH 4L4VD 2GBAA 3VFTB 3GXMA 4MQXD 2W0KA 1CFQA 2WSDA 2ZJSH 3CPLB 3FTZA 3OHXB 4U3SA 2QGBA 4CVZB 4ZOAA 2VQ1A 3LKOA 4JUSA 2YD0A 4TQHA 2OZ4A 1R5WA 1XEDA 4RRPM 4N68A 2XN9B 1GC1H 4MDRA 3AITA 2AGJH 3FQ2A 4RFOL 4ADGA 3VXUE 2OMZA 3UDWC 4JS7A 4ELMA 5I1CL 3BWAB 3HS0C 2Z7YA 1GR7A 3S6CA 3FRPA 4JRLA 4NZUH 3VH8B 2QGDA 4ZUUB 4HWEH 2H2SC 2BSSA 4XB8A 2NTFA 4Y2DC 4HF5L 1Y07A 4UANA 5AVXB 2QHLA 3KLQA 4GB9A 5T1MA 1DJIA 1IL1A 2LLLA 5EN2A 4EIZC 5CKAA 5JOPE 1X5GA 4JFYA 2WUCH 1F42A 5SWSB 5FHBL 4Z7NB 4MNHA 5DS2A 3UX9B 2F53A 2P28B 3TFKD 1NLBH 1OGTA 4BFRA 2QSVA 4PS4L 5JHDD 1BBDL 1DCLA 3GMMA 3K2MC 4R96A 2HT3C 4R6UA 1LDSA 4S0SD 1M7IB 3BSZA 1J11A 4IJTA 1BLNB 1BZOA 5F9AC 4OFKA 4AXWA 2LGNA 3I50H 5DUJA 1FNEB 1U2HA 1MG3C 1SJHA 1JXGA 1L4IA 2E59A 1BOGA 3B3IA 4H25A 1DQQA 5ID1B 1GYWA 4M1GH 5LQBH 4HKZB 4OKVA 2Y23A 4MCZB 4AY0A 2ARJQ 3WL9A 5GGTL 1NBZB 4JPIB 4XTRD 4KTGA 4POYA 4JCLA 1H19A 2B1AL 2NY7H 5F3BA 1VF5C 5F1NA 3E1F1 4Y4KA 4HK3N 1M42A 3U36B 3CFQA 2WVVB 5FV1L 3SD2A 4AVIA 3EDKA 2J1XA 3GMOA 5A40E 1QI3A 4J3BA 3CDZA 2Q10A 3VXTA 1UVQB 2P5WE 3ARBA 3HI1B 4KH2A 4P9MH 4XN7A 1I7RA 4V1DE 4OV5B 1MJUH 2F58L 3L95A 4M6NL 3X2QB 4NNXA 5T1KB 2A0LC 1O5PA 1XGRB 3OKYA 1PX4A 4I3RL 5DUPH 1AQDA 3BLPX 4LQ1A 4NJAL 3KLHD 4LEXL 5B21A 2EIZA 3O8XC 3PHSA 5KAQF 3HZKA 1DBMH 2YRZA 1QBBA 2CKBB 3SDXA 2ZKHH 5TE6H 2R23A 5D93B 4PJCE 1F4YH 4L8DB 2ILLA 3QSKB 3X1GA 1UM6L 1HH6A 3MTXA 4NKMA 2VH5H 2OYMA 1BMWA 4F7EB 4IBVA 1KGUA 1VZHA 3AC0A 5AKVA 3BEWA 3QORD 4GO8A 4GFXA 4J3VA 2WAHA 3IT8D 4M5YL 4M61A 3GO1H 4HDIB 3ARGA 3PWVB 4P5KA 3HFML 3S3JA 4IRSA 2X38A 3KPSD 1X9LA 2R56L 3S96A 2MFNA 2WXRA 1R4XA 2IJ0C 1FDLH 1UOVA 3KLKA 1IQWL 2CBPA 1AKJD 1KXQE 4PR5B 4JAMB 5GGRB 2NYZA 4PJXB 4JKMA 2WP3O 4OLEA 1PPIA 1S8DB 4BBWA 5I2IB 1LE5B 3VMNA 1SZNA 1KJMA 3RGVB 1IE4A 4LDCA 1YEFL 3BKCL 4MCYB 1EQWA 1L9OA 4OM0H 1MWAL 3UBXB 4IBSA 3QUZB 4JKPH 3UYRL 4BDVA 1IGJB 1KXQA 3PL6C 4A2EA 2HCZX 1KLFA 2P5EA 5E8PB 2AJXL 4JQIH 3C8HA 4M1CD 5D2NC 1NFDF 1KN2L 5E00A 5EA0H 1F3JA 2UZYB 3MLSH 1ZHNA 1ZKAA 1A0QL 1RJYB 3QUXC 1QFOA 3WV0A 3RAJH 1G7LB 3ARSA 5T8IA 1UZ6E 4I89A 2LAAA 4JJOA 4MQ7B 5DU7A 1TJGL 1R3HA 5I18H 1YLBB 2GUOA 1XF3A 2NW2B 2ZNWA 4WKZA 4XC3L 5JXED 2PWGA 3U25A 3FB6B 1XO8A 4X6CF 1TUPA 7TAAA 4L5FE 3SY0B 2PR9A 2GTZB 5IV2A 3VI4A 3P11L 1CICB 4KDTA 4IW4C 1DBKL 2HRLA 2XTLA 3RY5A 4JPVH 4XC1H 1FGNH 3TWCL 3H3PH 4XPBL 5IKCB 3GSRA 5HD8D 1RZJH 1JZ3A 1FFNB 4AYGA 5HYJE 5I66A 1LEIB 1A6VH 1T2JA 1CYGA 2JCWA 3VXUA 2EYTA 5DJCB 1AXTH 2FT7A 2NQ3A 3NQKA 5IVXB 3OKNA 4HHGA 4HPYL 1N5YH 3ZN6A 2R8SL 4U4BA 1SY6L 1TJIH 3S35X 2WLLA 3WJLC 1MCLA 1FAIL 1TEGA 3ABKB 4XI5D 5GIRB 3RPBA 5K59E 1H8OA 3LRMA 1G7JA 1SF3A 2XJLA 3CGTA 3PE9A 1U3ZA 3RI5F 4CVZA 2I7OA 1OP3K 5DHXB 3WJMB 3HAEG 2ZX7A 4U1HB 1FL3B 1HN1A 2W65B 3WIHH 2PW1A 1CGXA 5FUCE 3ELAT 4K55A 2WXGA 1JZGA 3B9AA 3H2WA 4ZO7A 5TJWK 3Q1SH 2W1NA 3VX0A 3DWTA 3MRIA 2NLJA 2XACC 3HR5A 1FFOA 3UP6A 1R0AH 4Y5YB 3QEUB 2C8NA 4P0DA 1NAML 2DTML 2Z1KA 1S3KL 2GJ6A 1EAJA 4KRPC 1KB5H 1TFHA 1S9VA 4M7LH 4E41E 1OARL 1VEPA 1N64L 4JFYB 3T0WA 4E0RA 1EV2E 1E27A 1MCPL 4XO4A 4UZUA 3ALWA 5HI4C 3IVKB 2DQIL 3RHWK 3SGDI 3EYVB 4KHTL 3BSGA 3DTXA 5AYUL 2YD3A 2OSLB 3WIHL 1ACXA 2OI9C 4QY8A 1QWNA 3BIKB 2BHFA 1YMMD 4PMEA 2VWEE 3FNKA 4XBPB 2OR7A 5E6RB 1PZUB 5DD0H 2EKJA 3Q05A 1MFUA 4XNXL 3BH9A 3F3HA 3MV9B 2WXOA 5FB8B 1KYOK 3N43B 1WAEA 2N1TE 4E9VA 4R2GB 3I6KB 2I07A 3QULB 2VDML 3SHSA 4HKZA 3DMMC 4KXBA 4OKVB 4UT9A 4C83A 1IEAB 2UXVA 3W3BA 1FF5A 2IQ9L 3L81A 4NUQA 3T0EA 4H8QA 1BM3L 1N68A 4X2UA 3MA7B 3EGDA 1ZT7A 4BZ2H 5HGBB 3N9GL 3C5ZD 1S7VA 3MUUA 1CDIA 2VLKA 1RUML 1U58B 3ZDZB 4ODHL 3S3CB 3T04D 3U4BH 3HLAB 5F97E 3MLRL 4N9OB 3WHE0 2E9WA 3ARBB 3NP3A 2ZX5A 4IMKA 1KIQB 1RFDH 4C58B 1IEHA 3L17A 4ZPTB 3M88A 5ANMA 4FJZA 1CDUA 3TV3H 1BF8A 1QWHA 1AQDB 4JDEB 2FK9A 2UXFA 2JJVA 1R75A 3ZOAA 1S7RA 4R7XA 3DJ9A 3AZUA 4TUOA 3UADA 1KTDB 3BKML 1QPPA 4S1SL 1QFWH 3HMWH 1MAJA 4L8DA 2AV1A 2OBGA 4IIQC 1KJ2L 1CU4L 1E3FA 3QXVA 4HIJB 1EHAA 3NCFB 4M6OL 3X1FA 3MV8E 3DYPA 5DK0A 2VLKE 1F4WH 4NZFA 2YD8A 1O6SB 4PJ8B 4FQLL 2Q5BA 1AO7B 3VFMB 4Q97A 5GZND 4F8LA 2CBQA 5D1XA 3N06B 5T5FL 2ZD0A 5ABAA 1J8HD 4LVNB 3P4MA 1S7QB 3ETTA 4WHDA 2QDWA 3FFOA 3QJTB 1S9YA 4X9IA 2NY2B 3LQAC 1W6WA 4FFZH 4KITB 4A04A 3ZTEA 1HHKB 1KPRB 3LPGA 3WKMH 4APQB 2WWMC 1HIML 2P8PA 3V4UL 1IC7H 4PN6A 4KK8D 1P4LB 1MI5A 3FTXA 2BO0A 3TJEL 5HDRA 5IHHA 1PKQE 2WWNA 1NWOA 3BP4A 3B6SB 4GKNB 5EB9A 1NCUA 1FE8H 3MLZH 3GS4A 2J8UA 2VN3A 5DWPA 3SDDB 3KPRA 1JIBA 3GHPA 3FUJA 4AGLA 2QELA 5GGSY 1E4XL 1M71A 2DH2A 3SDCC 1A6WH 3LTVA 3ZO0A 4S1RH 2ZYIA 5C6WH 4Y19A 5FGBA 4JM2C 1YAZA 5B7EA 5IESL 5J1SC 4NQQA 5DJ0A 5TDPA 4OT1L 4ZK8A 1VDGA 3QFJD 1LO5B 3ZL2A 4FXTA 3VI4F 1PTZA 3KPSE 1PZBA 4LOEA 4RMVA 3GSVA 4KZDL 1T1XA 4ZMXA 1DL7L 4JRXA 2EYRA 4A2MA 3GXFA 3Q8BA 2D31B 5FYLH 1AXIB 4LL1A 1ZTXL 2BNQE 3X14A 1GA2A 3FAXA 4N2LA 3L6FA 2BOCA 4J12A 3CTTA 2FX8H 2YMTA 4Z76B 5EEYA 3B7SA 3GK8H 3CJJA 2G2NA 3HS0B 1X5YA 4GQ9L 1CT8B 1JERA 3A5VA 4GBXC 4U2YA 3LKSA 3T65A 1IM9B 3MSPA 1G84A 2YGOA 4HUKB 1RP9A 1V27A 4B5EA 2NCEA 3FT4A 1NAMA 3NJJA 3GXUB 4QXGL 3U0WL 2MIZA 3K6DA 3PDDA 5BXFA 1HZLA 3W39A 4WWPA 4HMCA 2PABA 1NBVL 2MRYA 4CDHA 3DRQA 5FYKD 2L7EA 1E67A 4UT6H 5TE7H 3FFCD 4F7CA 2DJUA 2IFFH 3QT2A 1RZJL 3EF4A 1OTTC 3UZEA 2IDSA 2NUTB 3UBXG 5AL8A 4G8AC 4ZUVA 4I0KA 3UBGA 5ADPH 4WO4D 2EUVA 1OGPA 4G43A 5I1EL 3OXSB 4ACTA 3SPVA 2AF2A 2IDCA 5CIPH 1QYGL 2OX5B 2PW1B 5EV7A 4OGZA 3A4FA 5KSBE 2MQ0A 4POZD 4NJAH 3KGTA 2R1YA 4PTUA 7CGTA 3UJIH 4W9ZA 2FBJL 1T22B 1UA6H 4LHQB 5HJ3A 3WXWL 4CJ1A 1ML0A 4AEEA 4AZ8A 4WWID 4G8GE 3IRCA 1FFOB 5JHDB 3GMQA 3LN5A 4LASH 5MEPB 1RK0B 3GXTA 4XMVA 2FEDC 4R97B 1J0KA 1UM4L 1EJ8A 1LTXA 1P9MA 2C7FA 5IEHA 1FZJA 5J6GB 4NJ9H 4ZUTA 1P4UA 1GGCL 1TO5A 5F9JB 4R7NB 4KDVA 2V2TB 2P5PA 3RVVD 5D5ME 4BFBD 4AL8L 3ARZA 3QXAA 3I02B 1A3LL 3GSWB 3KBEA 4KKRA 3WEMA 5IMOA 4AX3A 1F97A 3A6CH 3CH1A 2DQHH 3JZYA 1WA0X 2WBJB 3D33A 1A4KB 3IYLW 2VXTH 1SXNA 4CC1A 4RGNC 2R0LH 3G6JF 4QHMB 4B9CA 1WBYB 1MH5B 2VO5A 2C9PA 3C6SB 4LOVA 3MRBA 2YQ2A 1MFEH 4XPGL 2VRKA 2YAPA 1GKEA 4DERA 5MERB 2F8XC 2AQPA 2TRYA 4DGVH 4Q14A 2WXIA 3ZDZF 1U3HB 1R46A 3EGDB 3IRZA 1S7VB 4AJ0A 2WSPA 4FQ1H 2ARJA 3LH2L 3NCYP 4NYLB 4ZS7L 3JWNG 4FTVA 5HHVH 1OP9A 1ZPLA 3D39B 4YBLC 4UDUB 1ADWA 1SHWA 1IZJA 3LRKA 2QGEA 3L1EA 4NM8H 2DLHA 1HOCB 5GS3A 3EYFB 2WPGA 5T3XD 3H42L 1DLHA 2XJKA 2EACA 2E7LA 2OTWB 1TU2A 1IM9D 3SGJA 3ILQC 4TTDD 4UQAA 4HJ0D 2BFVH 3TNMB 1PNDA 2XI9A 4I0PD 3QCUL 1MCPH 1UD3A 5IJKA 4P3DA 1PX8A 3ZO9A 5AZ2L 2EIKB 5E4EB 1YYLL 2Z35B 2L3BA 3UCQA 2EXYD 5JPNA 5DK0B 3ULUL 3I3EA 1A7BA 2A83A 3JTSA 5I8EB 2R29L 4ZX5A 1CXHA 4XNMB 2QSTA 4WI3A 3DIDA 1NCBL 4LCWB 5E6ID 1AACA 4U1SA 5FFLA 1W0WA 2DMGA 1S7TA 4U31A 2YFOA 4MDJB 3HC0B 2X4QA 3RX7A 3FUKA 1PVHA 3KS0J 5EU6B 2H3XC 3Q2WA 4LSSL 4FFYH 2G0KA 1JV2A 1VENA 2P8PB 2Y5EA 5DFVC 2V7NA 3FB7B 4ZFZA 1MI5B 1QLEB 5TDNB 3G9VA 2V2WA 2X6MA 2NY7L 5E24E 2VR8A 4MAYA 4XWOC 4C55A 1EEYA 4XN8A 4B97A 3IDXL 3NJKA 4KMLB 5JHDE 1DVUA 2FSEB 4OGXL 1P7BA 1H6TA 1RU9H 3ETSA 4NNPL 5IR1B 1H9DA 1NMAH 3SBWA 4HU2A 4JJ5B 4OIFA 1G9EA 2LU7A 5T33H 2WY3B 1NLDH 1CFSB 2VQUA 5IOKA 4M8RA 3QNYB 4NCDA 3P3TA 5I1DB 3HE7D 2DKMA 5D2LE 4ZMPA 1F90L 2X9XA 4FAAB 1MFDH 3ME0B 4ATTA 3LJ3A 5CCJA 3G6DL 1T7VA 4HOMA 4JCWA 3TA4D 3RUGE 3K6FA 4OSUH 2NR6A 4PS8A 5J9PA 1Z32X 1LO5A 1ZTXE 2ZQKA 3NSFA 4PAZA 3WLBB 4AQAB 4CW1B 1QLFA 3ASNB 1QSZA 4G1EA 4N2CA 3RY6C 3PV6B 4P2QB 2EYRB 4WK4B 1PZ5B 2J8HA 4ABUA 3QRGL 1KYOJ 3WBDA 3GI9H 3D6GA 3MGAA 3ZYZA 5D7LD 2X41A 5AOIA 3FCBA 2A6JB 3KS0H 5EZJA 4X7TA 3MRDA 2JELH 1YECL 3HS0A 4PWKA 3VFWB 1CT8A 4KKAC 1KTKE 2ZJSL 5KUKA 1A1NA 1VZIA 2X12A 1TZHA 3C9NA 5IEKA 5J6HA 3ECWA 1ZHBA 1T2QH 4WENB 4BQCA 1BIIB 1NGPH 4YHLH 5EZOL 3MLVL 2PR4H 1XX9C 3QNFA 5KVFH 3FU8A 4L0YA 3TBSB 3LY6A 3WFCL 2UUDH 2FX8L 3KCWA 1UFUA 5EIIB 2H6OA 2BRQA 3BAWA 2XCMC 2NXZB 1JZ2A 5E9NA 2ZWNA 3BP7B 1SXZA 4PHXA 4AH2A 3MGTB 5DRWA 3O0RL 4BSVA 3C2AL 1OO2A 1BAWA 3GSQB 1AD9A 4OLXL 1GZQB 1BQHG 5C0GB 3WFHA 4OZFB 3KPQA 3G9AB 3EH4B 1JZEA 1E3ZA 1LQSR 5AD0A 4HXBH 4M00A 5SV3A 3B7YA 5H35B 4JO1H 4WI5A 5HDWA 5DEZA 1AP2B 5KVGE 3TZVD 4S0HA 4EVNA 4WGWB 4E36A 3T0BA 1T22A 4BFGA 3JT0A 3MX0B 4JZNA 4ZMOA 4ZX6A 1UH2A 2G4EA 1A4BA 1DBML 4DGUA 2BY1A 5JHDA 4AYFA 4LF3B 4WEEA 3CPUA 4ZW7A 3DJTA 2X4UA 2VH5L 4OJFL 2GIMA 4BKLA 1ZXQA 2NY3D 2JWYA 2OKMA 4NWUH 3ZE2B 5C0IA 2EUXA 4F93B 1NCDL 4QLRA 3TO2A 1CK0L 5IB2B 1OK8A 1ORQB 5DQJA 1LQBC 4DPRA 2DI7A 3NOIA 5BVPH 4FI7A 1RPKA 5BJTB 1E9QA 1B2WL 5TGBB 4M7LT 1Z9NA 5GRVL 3JWOH 1Q1PA 4HWBA 3BPLC 3RWJB 4X5XB 1EJOL 5CWSB 5F7HA 4N8CL 5LNEA 1XH1A 4XAWL 4IBZA 3KPMA 1U6AH 3L5XH 4M5ZL 3MV11 3HVDA 3LQAL 4KJQC 4QO1B 2XZCH 4TUUA 5FW6A 3AG2B 4TS6A 4GJTB 4P06A 3O2WL 4AV0A 3PWNB 3OAUL 1OTSC 2WNXA 3LKNB 4FQXB 4LLQA 3VCLA 4BCXA 5DMGD 1OL0A 3ETBJ 1T4WA 5ACLA 2AANA 3BVNA 2J6WA 1KCRH 1U3HA 1LNUB 3A67L 4B50A 1L9SA 3CLFH 1X5FA 4QNPE 1AR1D 3N2JA 1N18A 2BJML 5CZVL 4HGWA 4XBGB 2JKTM 2OW7A 5KG9A 1DQIA 1P53A 1JI2A 2HRGA 5DZJA 3VFUA 3CCHA 1A7RL 3E8UH 3IFNL 5F1IA 3RVWD 1IAMA 3AT9A 4Q0XH 3RWHA 3SKNA 5C2BL 5E8EA 4J3SA 3D5OF 4AEFA 4BCZA 4OCYL 2VDPH 1ZIBA 2NDGA 1T1WA 4Y2LA 3RLSA 1CPUA 1EZUA 1A2YA 2YBRA 1MCCA 5CZXC 2H8PB 5KBPA 5FYKL 1CS6A 2IPTH 4LEEA 5AAMC 7FABH 3HNVH 3II3A 1VPOL 1DJGA 2H1PL 3PU7A 5EWIL 3S88L 2VR7A 2ISDA 4HJGB 3MCKA 4IMKC 1MRDH 4Q4IA 4CSPA 4LEBA 3WFBH 1Z1WA 3QUMB 2C9RA 4ZUWA 1QACA 2VR3A 4HWUA 3LXCA 4CNIB 4XCYB 3DX6A 3RNQB 2DYPB 3UACA 2F74A 3VFOA 1OGAE 1P6FA 4P2OA 3TBVA 1AGCB 2BZCA 1T2XA 2CRIA 1EEUA 1TZAA 2EDRA 4J1UB 4X0NA 3SCMA 4CU8A 1G7PA 1YYLH 4ZSOA 1FPTH 1LK3H 1S78D 3K6IA 5MP6H 1UXWB 3MFGB 5KAQG 3SDDD 3UZVB 4XNAA 2JI2A 2KLRA 2E27L 3ILPB 5EZLB 2XRAL 3QCTH 3AREA 4NM4H 3RVUD 5C0DA 1QHOA 3BI9X 4BELD 4XNYH 5TDOB 3IDGA 2MCPL 4BRJA 5DMIH 3PP3K 1NGYA 2XWRA 3H3KA 4IRJD 3NCBB 1U4FA 1K5NA 2BWQA 1JE6A 4HCFA 4ZJ9A 1INDL 5DD5H 4ZAKB 1NFDB 5G2NA 5C9JB 2BP8B 1QW9A 2EO7A 1QTSA 3EJYD 3MXWL 5DFAA 2Q8AH 3PWPE 5D70L 4GSQA 1EVTC 5FW7A 1U3HC 3DX8A 2EDOA 2KYIA 4NI6A 3UYPA 1YY9D 1UGNA 1DEEB 2P45B 5JNYA 5LWYH 3ME0A 4XOCA 3MLYL 2Q3ZA 2VDNB 3GM8A 3NSXA 2ZX8A 1DUYB 1YDPA 4LBEB 3ZJAA 1PIFA 3WLBA 1OARH 2VZUA 5FYJE 1TQWA 2K78A 4P5TD 2ZOUA 1KG0A 3QQ3B 4WFGE 5CILL 5CCGE 1HYRC 4XNQA 2W94A 4AIZA 2J7LA 4LEOB 1D5MA 5FAAA 2VDKL 3O2VH 1U8JB 3IXTA 3CNKA 3U7WL 5IREA 3QEQB 1VZGA 2FQDA 3KM1A 2JQAA 3A6CL 4LIQL 1H9VA 2ZAGA 1OIOA 2VR6A 2UXTA 1RMFH 1JFHA 1L7IH 1N0LB 2DI9A 2V9QA 2X9ZA 4OU3A 3MJ8A 2R2BB 5HVWA 3T1FA 5DLML 3C5JB 3D0LA 2XWTB 4JEGB 5DS1A 3ZE1E 4GMSL 1NA8A 5FW8A 12E8L 4LRIA 1KIRA 2EP6A 5LBSH 2A9MH 1MCSA 1UOKA 3BRFA 4PRIE 1U4EA 4PV8A 1OSZB 3TBSA 3MU3A 4NERA 3IJHA 4GFTB 4YE4H 4P2OC 1RAMA 3WY2A 1UHVA 2FNWA 4IS6B 1PS3A 5IT2L 5HHMD 2OMVA 2JJUA 4AKPA 5IIEA 1WFMA 1TQBC 2F5BL 1BEYH 4AH2B 5B8CC 5I1AA 3BWAA 3FL7A 3CIAA 2BDNH 2VDLL 1EXHA 2QVKA 1P6WA 5CEYB 3KPSA 2GIYA 1LP9A 2ZTBA 1W16A 3GSQA 3TPUB 3D48R 4DO6A 3CN2A 4KUZH 8PAZA 2EDLA 4XBMA 3WFHB 1RUQH 1LO3H 4AV5A 2NY1D 5EO1A 5CCHE 5DJ6A 5DI8B 5HGAB 4JZOA 3ESMA 5SWSA 4RAHA 1GHFL 4LE8A 4GRWB 4HQQH 2F18A 2W07A 2BHYA 3A21A 1JF5A 3VO0A 1RZIA 3V6OC 5I73B 5CLTA 1BM3H 2VN7A 2X42A 1KDIA 2ATPB 4MVBD 4MMXC 1ZVYA 4YIQA 3AS2A 1GS8A 3CFCL 5TK2A 1ETA1 3VFPB 5PCYA 3FN0H 4UINL 1J88A 5IB2A 3TP4A 2F7RA 3N0AA 1ZLEA 3MOBL 1NUDA 5CIPA 5DTFB 1RUKH 1U8HA 5JQHC 1Z3GH 3ASWA 4UT9H 4XN2A 4GG6E 1WBZA 5D96C 1GHFH 4MJ5A 4K5LA 1HL9A 5F1NB 1V05A 1SXAA 2IDTA 2A6DB 3RTQC 5IOPA 5D1XE 3PWUA 3BFQG 5J0BA 2R4RL 3F7RA 3FQRA 2K9UA 3GNML 4NSKB 4QRFA 5INCA 4F33A 2F8IA 4J6RL 2EINB 2F5AH 3C6LA 3D0VB 5AKSA 5GS1B 1A6WL 5J3HD 3RGBA 3HTLX 1QSEE 3QFGA 4PJHF 4Y7MA 3UBFA 1CGSH 1K6QH 1R3IH 2VABB 5LO7A 3RNKA 2NZIA 4FQ2L 5I8OL 4RMBA 1MIMH 5EZOH 4XH2B 1ONQA 4UTAH 3FAWA 3ARWA 1QATA 5F1KC 1CFNB 3U46B 4X8JB 2WXKA 3D25B 1NGXA 2P5WD 3HZKB 3V5KA 4HOXA 5CBAB 2H0JA 3UBHA 3BXNA 2ODHA 4HHAA 2XBZA 3FQTB 4CMMA 1HZHL 1I1FB 2VL5A 2KUTA 2VO8A 2I26N 3D18B 4EQ3A 4NKMB 3U1QA 3RFZC 2AQQA 2F15A 5E99H 4JQXC 1BZ7A 5CBEA 1EAPA 2UVFA 4KI5C 4M5YH 3SPHA 3R06A 1KBKA 3MPCA 3WS3B 4HJSA 2YBRB 3QXWA 3BZDA 1NOAA 1X5KA 2EJ1A 4LSTH 4ODSH 3MRNA 3VD1A 3QHFL 1YJDH 1KY7A 2YPKB 3Q8FA 1BZ8A 5D5MB 3ATDA 1P7HL 3ES6A 1OD7A 5HSFA 3V0VB 4APQD 1FYTD 3H9ZA 1AOHA 1M53A 2DBLL 4XCYA 3HG2A 2VISB 3NK3A 5EU5A 3FFDB 3RGVA 1YC8A 3L4ZA 4X98B 2DQJH 4FULA 4LSUL 4QXWA 4W9DC 4F2MB 2AMUA 1QFWI 4U1IA 4J1UA 3HRZC 3P2TA 4ZFGH 3GLAA 1OAUH 2YD4A 4K15A 4E68A 1E5ZA 4N2EA 3GLEA 3QNXA 4N5UA 4KVNL 3UZVA 1MIEH 3DGDA 3FULA 2NY0B 2UYLB 5ERWB 5EZLA 1SN5A 3OWRA 1NCCL 3BPOB 3L1GA 5C0DB 2H3NA 5BUAA 4IOFD 2VJXA 2AI0H 1MCKA 5EIIG 4ZBJA 1SM3L 5DJ8A 4FFVC 4HSCX 3IDIB 4BQBA 2EIMB 3DXAD 5AUMA 4AITA 3MO1A 5I0YA 1YEJL 4KPHH 4ZAKA 1R5VB 3Q06A 1OTSD 4TL5A 2JKRM 1R3HB 1EH9A 1V7MH 1ETJA 1VFAA 3FU9A 5GGTA 3LN4B 4L18A 1CDJA 1PNCA 4I18C 1ANUA 5SX5H 1JF1B 1BX2A 2JJTC 3AB0C 4HG4J 2Y7QA 4YDMA 1PSKH 4KXZH 4B0MM 1OE2A 5JORA 1NAKH 1E28A 4UZSA 4MXWH 1XCTA 1J5OH 3RFZA 4Z23A 1VCAA 4IBYA 4WHYG 1GCYA 4N1HB 2J12B 3ULVH 4JPWL 5I9QB 3KZ8A 4LIQE 3F00A 4YL4A 4XMLH 3T2NL 4BH7B 2QKIC 1YN7B 1JXFA 1SXCA 1W2KT 1ZHLB 3VB8A 1D6EA 3ZMNA 4L4TE 1LEGA 2GSGA 3OKNB 2Q7YA 1UWEH 1LK2A 5F7KC 4H25B 4TNFA 4XZ4A 4GAGH 4WWKA 2CO6A 2YPVH 1J0ZA 2HJLA 1KEMH 2Q6WB 4JY5L 2O1AA 4CSTA 3T3ME 5SWQA 4IHOB 3QJHB 4QRUA 4RX4A 4I2XB 4X6DF 4KO5A 4G6AD 2EDQA 1E4HA 5B4MD 3UZQB 4XN1A 1CI5A 3K8KA 2XVLA 2Y25A 3RQ3A 2RCSL 4YHZL 3Q6GH 4W4OC 1CF8H 4NN6C 4A68A 4AM0Q 4IS6A 2K7PA 5E2TL 1A6UL 3D2TA 1UVQA 4XP5H 1EHNA 4P23B 3AS1A 1FNAA 5IW1A 3X13A 3EIFA 3FMGH 4L8SA 3AGWA 4Y9EA 1C1EL 2RQ8A 3I6LD 5ITBL 1WAAE 5A2CA 1LP9B 1BECA 1AYOA 5I75C 3BUIA 3QEUA 2R27A 4ELKA 1HXYB 1G7HA 3P4NB 3A6OA 4KV5F 1SXSA 1N4XL 4ES8A 1CBJA 5LGHL 4JFPA 4DZ8A 2OYKA 5DLMH 3N1MC 3V4VB 1DDHB 2VLME 1VGEL 4NQEE 4OFVA 4M5SA 4TQPA 2XNAB 3LZNA 3QPQC 2HFGL 2OXGA 2AJYH 4W70A 1X5JA 3QZOA 1F4HA 2WO3B 4L37B 1CLYL 3UIYA 1VADB 4GO6B 3PWLA 5HYSG 5C7XH 3WIAA 3OB8A 4YUEH 4X6CB 1A6UH 4L9LB 3T2LA 3IM1A 5ICZB 4WSJA 2Q87A 1AIFA 2QFPA 1UCTA 4JM4L 5FUOH 3ZE0F 2HT3D 2H4EA 3BHBB 4M6MH 4WCYH 1BFVL 1UD5A 1WVZA 3SDAC 1ULVA 2NR6C 3EHBC 4O02A 3I9PA 4TLSA 4Y4HC 4YHKL 5GS2H 4YXHH 4IIQB 3ABZA 4H8WH 1TEYA 5EF3A 2IC2A 2FWOA 1S8DA 1UZ8A 3GSOA 4IIZA 2OK0L 4QOKB 1IUZA 1GY1A 1WUNT 1KJMB 4WU7A 4JRXD 3PPSA 3MZTA 3T2PA 3AM8A 5JUEL 1RJCA 5K39B 2JIXD 3CZLA 5LAXA 5AB1A 3WNNA 2BIOA 4M7JL 4KHTH 1XTLA 2HJFA 4PJBE 3TV3L 3KL5A 4N0RA 1QPXA 3CZKA 2Z92A 3GUTB 1CFNA 3C08L 4E42B 1S7RB 5E00B 2BSDA 5HHOA 4POUB 5J3HC 3CVIL 5KOVC 3MRGA 2FX7L 1AIZA 1OPGH 3MGOB 4UT9L 3DV6B 1A4JB 4PG9A 5EO9B 2HVKB 2WOBA 2XKSA 5ELIA 2WCSA 3C08H 1XMWA 3ML9A 2Z1PA 5GISL 4KJYB 1DN2A 3BC9A 4DAGL 4PJEB 3OLEA 4Z3JA 2HJKA 1XR8B 1G9HA 3PCYA 3KHOA 3DRTA 4TNWF 1WFOA 3NRQA 5JYMA 5K9JL 4DVRL 1A7PH 3NJMA 4ETYA 3SN6N 2VDQB 1BZQK 3GSRB 4OBSA 1MDAA 2HPTA 1A9BB 1KEGH 4D9RE 1HIMH 5I71C 5IMKA 5E6IB 1P4LA 2WANA 4E9YA 3SGJC 3D50A 3V95A 2HMID 4XNZB 3B8SA 3O0RH 4Y9GA 4BE5A 3IMBA 1AGBA 1FO0A 4WTZA 1VFOA 4G9DA 2NOYA 4GS7C 5EHFA 5E2UL 2J71A 3P2BA 4G1MA 4XMUA 5A6LA 3DUSB 3WTVA 1A6PA 3FQNB 1CUOA 5GIRA 4IRSD 5T5FH 4GRWH 3UTZB 4L4VE 3HIZA 3EO9H 5C0CD 3QO1B 4X4ME 2XN2A 1H3UA 3L4VA 1A5FL 4Y19B 1CLOH 2B7DT 4U1HA 5DHDA 1F4WL 2H3NB 1A6TA 1K2DB 5AOLA 3UJJL 5F89A 3P54A 3IMTA 4JG0H 5FECA 3KWXA 1HWWA 5DJ2A 1KZYA 1DJYA 1IBFA 3QQ9D 3T77A 1PY4A 3F58H 4LASL 4Z7VB 4K71B 2YPVA 1S9KC 1UB6B 4JRXB 3L3OA 4ELME 3V5DB 3K3QA 2C9AA 1GGCH 4OLYL 4A2LA 1JF1A 2CBTA 3B9VA 3HI6L 2XZQH 1QSFB 1UTDA 4ANXA 4TF4A 5BVPL 3UTOA 2K1MA 5C2BH 3QIWD 4QMEA 2NY0D 2VLMD 2WWOA 3SYOA 1MHEB 5I75B 4G3YL 1U91B 5D7JA 3WMSA 4QXTA 3ZTDC 5DK3A 3GEFA 2GIXA 3H9SD 4QY8B 1H6UA 1W15A 3D85D 3TF7C 2EDXA 4ZO8A 4DWHA 2BW5A 1G9NC 2VW7A 4UOJA 5BV7L 3ZKNC 4C8XA 2J88L 3K2KA 4U1NB 2ZXWB 3WN5A 2GSGB 4O5LH 1C5BH 2CHXA 1DZBA 2ERJC 2PYFA 4YQXL 5FC9A 2HUEA 4NNYB 4F7CB 1ICTA 3JWDH 2RR3A 3P11H 4N9GA 4Y9CA 2J2ZA 35C8L 3JZ7A 1CFQB 4P59L 1YPZB 4CBPA 4Z0BL 4RQQA 2NXZD 1FDLL 5C09E 1TJGH 3ZLQC 1ZT7B 4EBQH 4F58H 3B3BA 2AHIA 5CEXA 2NY4C 4LVOC 5FYJU 3CZUB 2R1YB 5E2JA 2H1LM 4FS0A 2XQYA 2XBDA 3REWB 5E56A 4GLRI 1UXSB 3ZRSA 4C4KT 1JNLL 5TH2B 4PJBB 2YUVA 3PNRB 1FPTL 2KQMA 5AW3B 3VYOA 5DQDH 3WO4B 3HBPA 2YC1A 3W38A 2HRPH 4AYBA 3HC4H 3FU7A 1QUPA 3S97C 4I85A 4YHZH 4C56D 1FZJB 4GQZA 4ATWA 4MLIA 4OM0L 1KGWA 3IJ9A 4BUQA 1P7QA 1TZGL 4FFYA 3ARUA 4FXGA 1E6JH 1VEOA 2WWKT 3L2NA 3O6FB 3QZBA 5KSVA 2AABH 2P4AB 4H4NA 2DWTA 3J27A 4OZIA 1JGLH 2YGPA 4NIKB 1O6SA 2H1PH 2Y06L 1KPVB 3R7RA 4L9LA 3CD4A 1KXVA 3BD3A 2VTFA 4UWQB 5I9QC 5AOKA 5I15L 4AVJA 3QPQD 2P8MA 4XMLL 4CSZA 1SBSH 4PJ9D 1YNKH 3RKDD 3VM5A 4GKZA 4NZTL 2FB4H 4GAYB 4FG6D 2FLBT 2N3JA 3PGCA 5LCVL 2Y7OA 4KWUA 1XIWD 2J55A 5EIVA 3B7UX 1A6VL 3F5WB 2VLJA 3P30L 2FHCA 3J8F7 5DJAB 1MVYA 4GRMB 4GW1A 4BQ6A 5TF1H 2LR4A 3NFNB 4Y4KB 3MBEA 3DPBB 4PV9B 4QOKA 3CDCA 4S2SB 1ADQH 4XP4L 9PCYA 1FGNL 1N2RB 1OAZL 3HHSB 4WU7B 1KC5L 1ZLDA 1MHCA 4HUMB 4B9KC 5B38G 1YMMA 1WH0A 1G9MC 1T21A 1N8ZA 5C0FA 1KCUH 2NY4D 4LAQL 2XZZA 1GAFL 4D0CA 4FMKA 1D9KD 1E7VA 1PAZA 3FKUS 2I9LA 4OD3L 4R7DA 5T3XH 2ZCZA 4I3GA 4BSWB 5JIHA 2AERT 1A14L 3CQQA 3DBXB 1LXMA 5LCVH 3V6OE 4AMKL 3C09B 1FO0L 2CGZA 2C3GA 2G9KA 3PXJA 3APDA 2ZWYA 2GFBB 2PCPB 3TEXA 3N1GC 4GSXA 1D7FA 4QKTA 5JQ6L 1C1EH 5FKPB 2I25N 5KS9B 4MD0A 5D7KE 3FB5B 5FCUH 4EKXA 5FA3B 5FO8B 3LNDA 2P48B 5BMFL 1TQUA 4OGQC 1IGYA 4AENA 3UG3A 1V54B 4Z76A 3ARFA 1PYWB 2PKDA 5GHWL 4U1SB 1EGJL 1OSPL 4KZEL 3A23A 4N0UB 3BYTA 3QRLA 1J1PL 1S7TB 1XEUA 4G5ZH 4W81A 1JGEA 3IJYB 3D52A 3GBLA 2WKOF 1UXMA 1JPFB 1NMCC 4CKQA 3NZUA 3L16A 1GRWA 2BVTA 4ICWA 3H9HA 3H42H 3S5ZA 1RUKL 4CGUB 4Z7AA 3T6QC 3FU6A 5ACMA 1LDPL 5I82A 3NN8B 2G2PA 4MYPA 5PAZA 5IW6B 1OE1A 3GSUA 4M4RB 3BAJA 4MCYA 4FQHB 1QG3A 3DETC 3BMWA 1NUGA 3QUZA 4ZT1A 2DKUA 1N0XH 5DFTA 4B27A 4GT0A 4B0MB 5CLYA 1I3UA 2B15A 4X0KA 3VG9C 4K7PL 3TA3C 1O7SA 4QRRD 1ZVNA 3QI9B 1I7UA 3FF8A 4GMTH 3WKPA 5F8RC 2WJ7A 4C57C 3OAWA 4QRTB 3TT3L 1IGCL 1IAII 3RZCA 3P9LB 1CIDA 3C8KA 3H2PA 2DN7A 3ZHFA 2FYVA 3L9YA 4JJHA 4MMZC 5CCKL 5D1QD 1HKLL 4NC2B 3MAWA 5HGHB 2PO6C 2DH3A 5BRQA 1YEIL 1MAKA 1GH7A 3U4AA 3QUYA 1A66A 4ZFQA 3CX2A 4IU2A 2Z0BA 1JWUA 3LPWA 4KKAD 3RZCC 1G1CA 1J05A 4OCMC 2A6JA 1UADC 1ZK5A 1BLIA 4X6BA 4J4PD 5JPMA 3ULUD 3VE0A 5GJTH 3VU1A 4OZHA 5A3IC 3PNWA 4OZHF 2R69A 1FG2B 1XGQB 3I02A 4YJZL 4W4NA 1BIIA 2VJ8A 5IB4B 5AB9A 4OZGA 4NX0A 5BPPA 3DOIA 3S34H 2CHNA 3BKMH 4OI8A 1CD0A 1PEWA 4PGEA 2CDEA 4XVSH 1AHMA 1XR9A 4JN1L 2MPVA 5DGQA 3F58L 1UASA 2WW8A 4ZXBB 4F5CE 2DBLH 1SVCP 3V9CA 2DQDH 3FBQA 2BNQA 2ARWA 4PJDF 4DESA 4YDLC 6FABL 3TBBA 1LM8V 4PJHB 1G7JB 4HETA 1IGMH 3CLEL 4NKQB 3T4YA 1I1AC 1M3IA 2XFXB 3KPNA 3QXDA 4IEFB 5EO0A 3RUGB 4X4YB 4AWJC 1H5BB 4X6EB 3MJGX 3PF2A 4HH9A 5A2FA 4N5ED 3MV8D 5TK4A 4OJFH 1JCKA 3F01A 1N6VA 4CC4A 3LYRA 2Z3FA 3F6IA 4AE1A 1BVKA 2K8QA 2NSQA 4IKNA 3MACH 2SEBB 1O9WA 3GJFH 2YGQA 3KYNB 2YN5A 1MCOL 4OI7A 4Z5RB 2WUCL 5D2NE 5FYJH 4PJFB 1YCSA 3HR5B 5ICYB 1Y6NR 4M62L 1L9RA 2NNCA 1QSED 4OIIH 1HZHH 1EVUA 3T0AA 1LWRA 4Q9QH 4PG2C 2IFFL 4OUUB 3V4PH 4OLYH 2Y5TB 3O6KL 4Q9RL 1P7QD 3TO2B 4BHUA 1ET8A 1F11A 1MRFH 4J8QA 3UG4A 3QS2A 4IKLA 4PW3A 4EE2A 3GZOA 4ZAKC 3L5JA 3HMXA 4AV4A 2LABA 1ZTXH 3O3AA 3SKUD 3UJIL 2LT9A 5BZXA 2Z9TA 1MNUL 3RWJA 5LGKA 4GEIA 2D03H 1XGTB 4LARL 3V8CA 2C3HA 5IMLB 1PCSA 4IJ3B 2HVJA 7PCYA 1PZAA 4RDBA 4FG4A 2I85A 2HA1A 1E4KC 2X4QB 3OJ2C 1KJ2A 4EI6B 3H6AA 1DVFC 3QFJB 5E7BA 4JDTH 2XX0A 1U8KA 4G6FB 4X6FA 1HKFA 3T0EB 2ETWA 1XH3A 4NO5A 3BP5B 4OI9A 4GRMA 4GW1B 3NIFB 3RVWC 3MBED 4ZFZB 2MHAA 1IGIL 4EN2A 1NDMB 4LCIH 2FQEA 1J9TA 4DETA 4JFUA 2J5LB 1N2RA 3HHSA 1MLCB 5JZ7D 4GW4B 2IPTL 4ALAC 7FABL 2AJZA 4BXSV 1Q0YL 3RWIA 5CMAA 3S35L 1WSST 3OHMB 1D7DA 4HAGA 5HHPB 2WZPA 2EDWA 3L1OH 1YUKB 2OL3H 4HWBL 2IALA 3EKCA 2WXNA 2N01B 4KGJA 1DFBL 1F56A 4YAQB 5HPMA 1PEZA 4JGMA 3OKEB 4TUOB 4NRYB 1QEWB 1U2YA 1L0YA 1VFBA 1YVLA 4JDTL 1D5XB 1KTLA 4X7CC 3X1EA 3P3UA 4HJGA 5FDWB 4WO4A 4HIJA 3K8MA 1BDYA 4BGLA 3QUMA 3JV6B 4ZMYA 4CGTA 3RY4A 3LPOA 3WGVB 4CC0A 3TO4C 1KCVL 5KVDE 1AE6L 3QUMH 2OLDA 1CLYH 2YMOA 3BWUF 4NQSA 1CD1A 4KTEH 4ONFL 2B59B 2DYRB 3TBVB 2AQTA 3Q1SL 4URKA 5LN8A 2UXGA 2BC4A 2IG2L 4GO9A 2V37A 4XB7A 3RVVC 1B4JL 1Z9MA 3FCSA 3PL6B 2R0KH 4HK3J 3N44B 1OWWA 3GRBA 1CI3M 3ULSA 1JPFA 3L9EA 3HLKA 2GBUA 3HNVL 1ZGLA 4XCNB 1S6NA 4WEBH 5CSGA 3WXVL 1EUTA 3EJYC 4FN0A 1K8IA 4S1DD 5B39B 2VZ3A 5KEZA 4MA1C 4DO4A 1AHWC 1DO6A 3H55A 2E7DA 2ITFA 2R29H 5DRWB 5G5DA 5MEOB 1F1AA 2J8UB 4Z77B 4OJEH 2RCSH 4KRMB 4BSVB 4M6ML 3HMXL 4MS8C 2CR3A 1M71B 4NZDA 2QPDB 4YDKL 4PWGA 3LDBC 1OHQA 1FZMB 2UZXA 3QUKA 3QEGH 3K7UA 4BHUI 3WTTA 3ARRA 3O2VL 3QFDB 5JPNC 3KXFB 1M9SA 3EOTH 2VDMH 2YEQA 2WZAA 1KUMA 5FCSH 2VZOA 4IDLA 3RGVC 3ZQ9A 2QMKA 1OTUD 2DJ4A 4L1HA 4ODVH 4JO4H 4N0YL 1O7DE 3NZSA 1QASA 2NX5B 2X1WL 4PB0L 2D31A 4U0QB 3QUYD 3SE4A 3LH2H 2X4UB 1TF4A 4NKDB 4IU2B 4QRQB 3T6WA 4ZYKA 3MRKB 3QJVB 2VZTA 5I17A 4XWGL 4QT5A 5CJXC 2N7AA 4U6HB 1U8PA 4KMTH 4L3CB 4LSVH 3U30C 2XWXA 4NO0B 4B95C 4GLRH 1KB9J 5DQJB 3C5JA 3D0LB 2QT6A 2ED6A 4L8BA 1U41A 4CRPA 2PYEB 1F4XH 1HDMB 1T1YA 1A7PL 3FW6A 4JMNA 1JVOA 4G7SB 4NQVB 3BCDA 2IAMA 2CK0L 4PRDB 2BCKB 2EVIA 2DYSB 1CF8L 2V3EA 1FH2A 4O2EA 3EGXA 2NUPB 2R2EB 3HA0A 5CGMA 2ZICA 1MREH 4HIXL 4XMZA 5E1HB 4MD5A 5E8DL 2AK4D 1BQUA 3QH3B 4LVHB 1SYSB 2OFQA 4Q8BA 1PD6A 1XZ0A 2X0UA 3GMNA 4X6EA 2O6FA 5DI8A 1PBYA 3REVA 3FQ4A 2XUWA 3SE3A 2DZEA 4MB4A 4NCC2 5A1AA 4C4KO 5D7LE 2H0EA 2KQNA 5H94B 3RU8H 1A9EA 1K72A 2J6EA 5JW3L 2Z6FA 1HHIA 1A3RH 1MQKH 4DGWC 2YUWA 1HXMA 4ZXBC 4P04A 1UT1A 4GW5A 1NUFA 3LPFA 3FT1A 4Y2OB 4YBHA 4YXLH 4ZD3H 1S5HA 1M2VB 4E41B 1MEXL 1RU9L 3ISYA 3R19A 1YJDL 4NNPH 3MDJA 2PMZA 1HI6A 1H8LA 3O8XA 5HYJA 4QHUB 4YHKH 5MEQA 4FG2A 2BVQA 5J56B 4PJIB 5IROA 1UKSA 5BCAA 3KH3A 1IEBB 2P1YA 1Q9WA 2YUXA 3ZIYA 4ETQB 2NY3C 4JM0A 2DYPA 4PJXF 2VR5A 1G7QA 2P9RA 4TULH 5HYQA 1A4KA 3JWOC 4LCCA 5AAWC 4PJIF 3UPRB 1YQ2A 3B9DA 1AGCA 1H6EA 3OF6D 1HK6A 1AZNA 4LSRL 2HVJB 5JLZA 4WDIB 3SCMB 3D0VA 4PP2B 1FVEA 2GBTA 2E4FA 3D8MA 1VB9A 2XDHA 3B5GA 4GXUN 1FIGL 1B4RA 1NCDH 2R29A 5CLWA 3BP5A 4X8JA 1NGXB 1DCEA 2B5IB 4OLUL 4G8EA 4MA8L 3SDCB 3SQOL 3LB6D 4G9FA 1JV5B 5K9QI 3GIVA 1MVUA 3NIGE 3B2VH 2WBJD 3R7QA 3CMGA 1KJ3H 5FWQA 3GSXA 3AUWB 2YZ8A 2XQYG 5TF0A 1Z3GL 5KTEL 1T7XA 5JNYB 3EDJA 4Z78A 5FLVA 3CUPA 5F44A 3PJLA 1DBBL 1ED3B 2YD5A 4JPWH 4P3DB 2RAMA 1ZA3A 1I53A 5E08H 4O00A 1S7SA 4LLMB 4LL9A 3EYOB 3AY4C 3DVNB 4RAVA 4WFHE 5AQ0A 3IGAB 4L0ZA 3NCJH 4ZTEA 4PJ8D 3GB7A 1N70A 4XNMA 2B4CC 3CC5A 1IQDB 1YEEL 2O5YL 3K5RA 1W72A 5EU5B 4F37K 3QEQA 4JW3A 5EBGA 2BMKA 1P2CB 2Y06H 3Q5TA 3VXSB 3CN3A 2IIJA 6CGTA 2YOAA 2JKNA 4N2FA 3GXNA 4XOAA 4OIAA 1UYWL 2W81C 4QEGA 3T1FB 1BQ5A 5FPIA 4PI0A 2J88H 1E6JL 4KRPD 1AS6A 1KIRB 3OQRA 1OZUA 4HHWA 4I0P