3NYKA

The structure of cobalt-substituted pseudoazurin from alcaligenes faecalis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin
publication title The crystal structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nykA00
3X2QB 3FQ1A 1KCBA 2DY2A 4PAZA 1HFUA 2Y1AA 5PCYA 1PLAA 4UAHA 2UXTA 1FFTB 4BXSV 1ETJA 1NPJA 3RYMA 4DP1X 1PZBA 1X9UA 2VN3A 2PCYA 3EF4A 5I6MA 4P5RA 1ET7A 1E30A 1ZIBA 4F2FA 3UACA 1JXDA 1DYZA 2JKWA 2FNWA 1HAWA 4KOBA 1JXFA 3AY2A 2QT6A 2DYSB 2HRHA 3ASNB 2VSMB 4BDVA 1QNIA 4DP8X 4YSSA 5B3SB 2B3IA 4DPBX 2BP0A 1WA2X 1JOIA 1L9OA 3SBPA 2PPEA 2A3TA 1E5ZA 2EIJB 3AW5A 3UGEA 2TSBA 4KO5A 3GYRA 2PPCA 4E9RA 7PAZA 5B7FA 5B1AB 2IDTA 1KV7A 3OQRA 4G72B 2VW6A 4G7SB 4G7QB 4N8UA 1GS8A 3H56A 9PCYA 1V10A 1A3ZA 4AZUA 4A2FA 2RACA 3ZDWA 5IY5B 2UXFA 3GDCA 2PPDA 3H4FA 4YSRA 4X4KA 2PP9A 3FU7A 1SFHA 4WKXA 1OCOB 1J5DA 2EILB 1KCWA 5EHFA 2DWTA 2UX7A 1SJMA 5TK4A 2OV0A 1JERA 1L9PA 2FQGA 1BYOA 2I7OA 5I5JA 1RZQA 1KBVA 6PCYA 3WNJA 3AG1B 3EHBB 4TXVB 3S8GB 1NWPA 1TU2A 4A2DA 3MX0B 4YVUA 4DP5X 4A2GA 3KW7A 5D4IA 4ZK8A 1ILSA 4NB7A 3IE9A 1NTDA 2CCWA 4GP4B 1AG6A 2BZCA 2PPFA 5I6OA 1NIDA 2BP0B 2P80D 1ZDSA 1OE1A 3TASA 4FA7B 5I6PA 1M9WA 4JKNA 2CBPA 3UADA 2HX9A 4DP9X 3EH5B 3ZX1A 1I53A 3QJVB 3ABGA 2YAHA 3OMNB 2FQDA 4YSCA 1A4BA 3FPYA 5I6NA 1OV8A 4G7RB 1WAEA 3IN0A 1UATA 4A67A 1OE3A 5F7AA 2ZWNA 2IWKA 2XUWA 2H5UA 3PLYA 2AZAA 4G71B 3NSCA 4QKTA 1ADWA 2XWZA 1CYXA 2W8CA 1AS6A 3FS9A 3KW8A 1BAWA 4KNUA 4BWTA 2XXGA 5B1KA 3S3BB 3T6VA 3SBQA 1XB8A 1GR7A 1GW0A 1N70A 4W9ZA 2YAMA 3S8FB 4A66A 1SF3A 1R1CA 4GP8B 2BP8A 2XYBA 3EH4B 3DIVA 5PAZA 1IBYA 2YQBA 1PAZA 2VW7A 2AANA 2J57A 2XX0A 4BXVA 1PLCA 3L45A 1ZPUA 3PAUA 5AKRA 1BQ5A 3ABLB 2J5WA 3DKHA 1SF5A 1L9RA 4M3HA 3UABA 2J56A 1KBWA 1NINA 1SHXA 5AFAA 1SNRA 3NP4A 1FWXA 2PCFA 2P80A 3CZUB 1JZFA 1CC3A 1L9QA 1PNDA 1KYAA 2IDSA 4AX3A 1PMYA 1KDIA 1J9RA 4M4RB 4BWUA 4F2EA 2CJ3A 1ASPA 3ERXA 4A68A 1URIA 4DP4X 4KO9A 1TKWA 1PF3A 1MG2C 3NJGA 2GSMB 3ABKB 1AOZA 1GY2A 1ILUA 1RZPA 4E9XA 4UF7C 1FA4A 1KDJA 2IDUA 4FAAB 2OJ1A 1VLXA 4RH4A 1J9QA 2PP7A 5LDUA 1E65A 2XX1A 1XMEB 3WNIA 3HEIB 3T9WA 2CALA 1AANA 2I7SA 1NDTA 2FT7A 1PCSA 1PNCA 1WS8A 1PZCA 2FT8A 4KNTA 3NSYA 1GS6X 4QLWA 2N0MA 2OCCB 3V9EA 3AG4B 5B1JC 5I6LA 3S3CB 5TK2A 3NP3A 2YAPA 3T6ZA 2BP8B 4PCYA 2XV0A 5D4JA 4GP5B 2MTAA 1OE2A 2IH8A 2YXVA 1AAJA 3H4HA 4HIPA 1JZIA 2XXFA 2HLEB 4A2HA 1OCCB 3DTUB 3V9CA 3QJQB 4KO7A 3FQ2A 3OM3B 1L9SA 4BK5C 1BQKA 3X1FA 4KNSA 1ID2A 3CVBA 2X87A 2XV2A 4F7KA 1AR1B 3ABMB 4GY4A 2CUAA 2IH9A 4YSOA 2BO0A 3WI9A 1GYCA 2ZOOA 3NJJA 1A4AA 1BXUA 1CURA 1MZZA 2WO3B 1W8EA 1SHWA 3IN2A 1MDAA 1XB3A 2IWFA 1IKOP 1E67A 1QHQA 1J9TA 4DPCX 3CVDA 2Q9OA 1NIAA 4A2EA 1BYPA 2VMJA 2QPEB 4E9YA 1JZJA 2YXWA 3T71A 2ZONA 4YSEA 1W6LA 4HALA 2HX8A 1AZRA 3C75A 2BWDA 4YSDA 1MG3C 4YSAA 4K9JA 4HCGA 3NJFA 3ZBMA 1GS7A 2B08A 3NSFA 4HZ1A 2JFCA 2GHZA 1M57B 2VW4A 5B1JA 1NICA 4DP0X 1J9SA 2YARA 4E9TA 2LLNA 2BHFA 4N4YB 6PAZA 1PZAA 3X1NA 2MRYA 3X1BA 2XVBA 3TU6A 1NWOA 3G5WA 2XLLA 1AZNA 3JT2A 1IUZA 2EIMB 1NIEA 3QQXA 1TEFA 2CAKA 5E9NA 1TEGA 3FU9A 3NSDA 4DP7X 4YSUA 1JXGA 3U25A 1NZRA 1ET8A 4L0PB 4NAJA 4ENZA 1AZCA 2HRGA 1JZHA 2JXMA 1EZLA 5B7MA 1OOWA 3TBBA 2DWSA 3HB3B 1IC0A 3FYEB 4YSPA 3OMAB 2GBAA 4KO6A 2HXAA 2Y69B 3PAZA 2FQFA 3PCYA 3QJSB 4DP6X 1ZIAA 2VM3A 4DP2X 2AVFA 3T6WA 3NJHA 3NJKA 3WG7B 2DYRB 4AI7A 1GY1A 1ET5A 1AZBA 1JZEA 1NPNA 2YAOA 4MFHA 5I28A 3CVCA 2XU9A 4Q8BA 3QJRB 1BQRA 3NT0A 2I85A 5AZUA 1ASQA 2XV3A 2DV6A 3CG8A 2UXVA 2GC4C 4KOCA 4JHVA 2R7EB 2YAQA 1AG0A 2H47C 2IDQA 1QLEB 1DZ0A 2WSDA 1SFDA 1JVLA 3ZIYA 3FPXA 4AKQA 3MBWB 2NRDA 3AG3B 1ZV2A 4E9QA 5B7EA 1WA1X 3S3DB 3PXLA 2BWIA 1M56B 1GSKA 3WKPA 3N55A 2FTAA 1V55B 2GB2A 1AIZA 3N2JA 1WA0X 1A65A 4YSQA 1NIFA 2IWEA 3EH3B 3GXUB 2HZHA 1WS7A 2VSKB 1F56A 2VM4A 1AS7A 1PY0A 3SQRA 3TBCA 4HHWA 5A7EA 2EINB 3UAEA 1SDDB 1EHKB 2ZXWB 1JVOA 2FWLB 2AZUA 3NJLA 2WO2B 5I5MA 1A4CA 5ANHA 2EIKB 4BWWA 2HX7A 2YAEA 3BVDB 2QDWA 1HAUA 4E9SA 3FT0A 1OF0A 3X1GA 1NIBA 1AQ8A 3NJNA 3NJMA 3FSAA 2IDFA 2J55A 1CUOA 2E86A 1BXAA 1RKRA 2PPAA 4E9VA 3UAAA 2FJSA 3BQVA 3CDZB 3NJIA 1OCRB 1V54B 3FYIB 5D4HA 3FSWA 4YL4A 3T6XA 2UXGA 2FQEA 4EF3A 3FQYA 5I26A 4Q89A 3OD3A 4CSPA 2BZ7A 5FC9A 1X9RA 8PAZA 1ASOA 2PP8A 2PLTA 3FU8A 1RCYA 3WKQA 1BEXA 4YSTA 3D12B 3FSVA 3JTBA 3SBRA 4AKPA 1ZDQA 2R7EA 3PAVA 2GC7C 4HAKA 4P5SA 4WTQA 3PPSA 3WIAA 2W88A 2GIMA 1IBZA 5I6KA 2TSAA 4BDVB 1AZUA 1T5KA 1YLBB 1AS8A 2BW5A 5B1BB 4GYBA 4HHGA 3TA4D 2GI0A 1XB6A 4HCIA 4NERA 4YVNA 4HCFA 4AKOA 3IEAA 2X88A 1A8ZA 2QPDB 2IAAC 2YAFA 1W6WA 1BXVA 1SDDA 4DPAX 3QJUB 4E9WA 1J5CA 7PCYA 2FT6A 1OCZB 1KGYE 3QJTB 1L9TA 1AACA 4W1TA 3QPKA 3ASOB 1B3IA 4GXFA 2Q5BA 4G70B 3NYKA 4CSZA 4JHUA 2QDVA 4UANA 2AFNA 2UX6A 3IBOA 2BW4A 1N68A 1JZGA 3OMIB 1PLBA 3CDZA 3FU7B 5F7BA 5I5IA 2H3XC 3AZUA 3X1EA 3FSZA 3AG2B 1E5YA 1CYWA 1MZYA
chains in the Genus database with same CATH superfamily
1HYRC 4L48A 2ZNWA 2VDPL 3DV4A 5A3IC 1EFQA 2GBUA 4LPWA 4YR6A 2LAAA 3WS3A 4B97A 2YQ2A 1C5BH 4J8RB 2WW8A 4QRBA 2BINA 2NMSA 2PXYD 4MRCA 5C0IB 2XA8L 1B0WA 1OGAE 3CIAA 5CEYB 3LOWA 2G0KA 2JJTC 1E30A 4OZGA 2XWBB 4PGJA 4NYLA 4TNWK 2DQUL 2FX8L 5CMAA 1LK3L 2EC9T 1KBPA 4N9GA 2IH3B 2MH4A 1U3HB 4EN2A 1KJ2A 3AREA 1NBQA 4FLSA 4XMWA 3W9EA 1NCCH 3HMXH 3FH5A 4I0PA 4L05A 1IX2A 1JCVA 3CVIH 2FE0A 3RTLA 4PJ8D 4KX8A 5EZJB 2PTTA 1ZHBA 3IGAB 5TE6H 3MODL 3JWOC 1U8KA 5DQ9A 3APCA 1WIOA 2RIKA 4KO5A 4QHUA 4Z7VA 4UIKH 2LU4A 7FABL 1OY3B 3D0LA 2Y7MA 1P7BA 5I8OL 5K9JH 1I31A 2JK5A 3NFNB 1HOEA 4M1GL 1MVFA 1OQXA 3H3KA 5EEWA 3RFZB 1SQMA 4JPVL 1J5IA 1PZ3A 2DF3A 3QEUB 1EWHA 2WANA 4A2FA 2EDLA 2XZZA 3O6LH 3ZL1A 1G0XA 2RB8A 1MOEA 1CDCA 3PGCB 1BVLA 4ICXA 2DKSA 1UZ6E 1GKOA 1P5UB 2Y06L 4MVBC 4U7MA 3ZTJH 4J4PD 4OLYH 2B3RA 5I8KL 2YQ3A 1VEPA 1QKZL 1YNTA 3H3PH 4RMWA 5D2LB 1FRGH 5LBSL 4BZ2H 1A9BB 4FLOA 3BRDA 3U9PH 3BC9A 3QJOA 3QI9D 1JERA 1KV3A 1TPXB 4XC1L 1RJLB 2R8SL 1RZQA 2VQ4A 3CMOH 1I8IA 4J27A 4XX1E 4JAMA 4MCNA 2IALA 3GSRA 3NEXA 3AB0B 1HHJB 4WEEA 4NYLB 5AW9B 1NCOA 5JO5A 1NAMA 3N1QC 5JPNB 1EPFA 4LL1A 4ZK8A 4F8PA 2CCWA 2Y07H 2HUEA 5FUOH 2CM6A 1DBKH 3CVHA 3H53A 1IC4H 4XH2B 3MOAH 2WVVA 4CU8A 2PTTB 1ETA1 3STBA 5C0RH 4M00A 5FOBB 3CZNA 4NZUH 1O9VA 3EDDA 3P77A 4WTXA 4ES8A 3KDPB 4PLKC 2DLEA 2XWJB 3JWNG 4NNPL 4AMKL 2IWKA 1AQKH 1QLEL 3BHBA 2C3XA 4RMRA 5K9KB 2R29H 4H26A 4AEIH 4Z3FA 4ONGL 4NENA 5GGUB 5AVRB 5DD3L 3CX5J 5HHMB 1MHEB 4N87A 5JZ7C 1HI6A 3ETSA 3A6BL 3T6VA 2H1LM 4IRSC 2YMXH 3L9RB 2C26A 3AT9A 5FHAH 1V3JA 4W9ZA 3B3IA 1R3HB 4LKCA 4A66A 2F5AL 5CGYD 3K4DA 4OCRH 2VXTH 3IKCB 1RUQL 4YXKH 3CLWA 3CH1B 4M6OL 1T7VA 1SXCA 1XIWD 4WNJA 2E6PA 3HC2A 2DJUA 4EDXA 4JAMB 4ZDHB 1TZHA 2IALB 5FO9B 3U6XS 3GSRB 3VM7A 3UAJD 2J56A 4PJ7B 1NINA 4ZTOL 2OQJA 2L4OA 4E5XB 3QPQC 1DVFB 1KPRB 3IDGA 5C3TA 4D9RD 2CRIA 3T0EE 4XWGL 1K3IA 3OJMB 4ALAH 3VTTA 2ED6A 2WQ8A 3A21A 4GB9A 5I16B 2YN5A 3EFOA 1ZLDA 2EYTB 1G6RH 3AUVA 4J28A 2O30A 2VE6B 3CVHB 3DARA 4A68A 4LBAA 2ZOKA 3HC3H 4P57A 5DMGD 4Q58C 2XPGA 3K6SA 5AOKA 3IXAA 2V37A 5IV2B 1AOZA 4NQEA 4JRWA 4UT6A 1GY2A 1ILUA 4LQ1A 5H2BB 2DQHH 1NBZA 3GMLB 3WTWA 2OJ1A 2PW1A 2WZPD 3V5HB 1GMEA 3HI5L 5C70A 5KSAB 2XX1A 4NNXA 1RZKH 1X5YA 4WFGE 1LVEA 1QSEA 1AH1A 1I8UA 1AGBA 3BHBB 5I0VA 3UMNA 3ZZLA 2AP2A 3VI4F 1BF5A 1CVRA 1NANH 1A4KA 1KULA 3LSOA 2TRHA 1CJYA 3R06B 4KNTA 4R8WH 1SHMA 1ZLWK 3QRFM 5DVLA 2N0MA 4XN8A 3A6CL 3LIZL 4X4YB 1Q9KA 4ZXBD 2DMBA 3B3IB 1PX8A 5FGBA 2P5PA 5DJAB 3NP3A 4TVPH 2V5YA 1NKOA 3WHE0 3SDAD 2C4FT 3N50A 3FSZA 2ZX5A 2ZG1A 4JR9L 1IBGL 2LFEA 3L3HB 5F7LB 3DTUB 3KG5A 4ZUUB 1NFAA 3KJ4C 3UGUA 3C8DA 1TZHB 1ZSDA 2EDYA 3ATBA 4MAYC 5E0FA 2W1NA 3HC4H 5E8DH 4QF1A 1LEIA 1SLWA 1EJOL 3O8XA 2BNQE 1BZQK 3KL0A 3IDGB 5IJCC 3QDGB 3NACL 2X4UB 5F2FA 2AVGA 2D7QA 5AAPA 3S5YA 6CGTA 3QO1B 2Y6TE 1QHQA 4I3RL 4M4RA 3WUWB 4LMQE 3G5XA 4M5SA 5E9DD 2ZOKB 4NRZB 4UYPA 2O93L 2KHAA 2XPGB 1PAMA 4V2BA 3T65A 1AD9A 2NTFA 3IXAB 3NOIA 3WY1A 4LDEB 4P23D 4YDKH 4BGLA 4YSEA 3ML8A 1NBZB 2RAMA 1CBJA 5E2VH 5C8JB 2PW1B 3SGKA 1I85C 5GS0L 4YSDA 2N1TE 4FQXA 5CSZA 1YEHL 3UPRB 4LMQI 4NNXB 1M7DA 4Y4KC 5IQLA 5I82A 1QSEB 3ALWA 5L4IA 4O58H 4DP0X 4E9TA 5JYMA 3VXMD 3VI4E 2EIEA 4PI2A 1A4KB 4Z9KB 4IGBA 3X3GH 3MBEC 4TPRH 5KYYB 4ZX5A 3TTSA 3HG4A 3ZTDC 3HMXL 4U1JA 4PGZA 3SPIA 2NY3C 4NEHB 3WJLC 3CVIL 4J5VA 1VFAA 1DFBL 4FNQA 5DLML 5IWLC 1K4DA 4HUNB 5LN4A 6FABH 4O5LL 3U6RB 2DH3A 2EDWA 5C09E 3R4RA 1QVOA 3IRCA 4PJIB 4RAUB 4UINH 1OOWA 1ZSDB 2Y1YA 4E41B 5K9JL 1LEIB 4GINA 3ZDXF 2XN9E 3HB3B 5DFVD 1HSAB 2VRAA 1F58L 1BMWA 3NCYP 1FHGA 3K4ZA 2GPZA 2Y69B 2YUWA 1XBRA 3PCYA 5IESH 2DM2A 3O6LL 3BYTA 1DL7H 3EUUA 3FB6B 1DQQB 2VR6A 2OJEA 5EZLA 2IWGA 4ANVA 4ENEC 1ZT1A 4MFHA 4C56B 3L3KB 4OLYL 4PP1C 3KWWB 1AD9B 3H3PL 4J3UA 4XT1C 1F1DA 4X7SH 3O6MH 2I85A 3U9PL 5D70L 5I5RA 4FL4B 4IHOA 4Z7OF 5EOCH 1JDDA 1PIFA 4FQXB 2BCKB 1PKQA 3M7FB 1KIUA 1M7DB 4XMTA 4XB7A 3CFNA 1MCOL 1XFPA 3KPTA 4OJDH 2WD0A 4X83A 1CLCA 2F08A 4X5WB 3CHRA 1AIZA 4OLZH 4TVPE 3U4EA 4QYOB 1AHKA 1XR8B 1ZXKA 4IGBB 5AKSA 2JIXB 1DQKA 1NANI 2Y07L 4P2QA 5FUOL 3K8LA 5ICYA 4LEXH 1DBKL 2MPAH 5EF2A 1FDLH 1IC4L 1WAAA 1LO2H 2E7HA 5D71H 4HHAA 3OJ2C 4L1DA 3WS6A 5C0RL 4OZFH 3B43A 4HW6A 3GBDA 4MD5A 3RQ3A 2NZIA 2WTPA 1BAFH 4WJG3 1K4CA 3CV5A 1KFGA 1MCJA 2CBMA 3KLSA 3FSAA 4LLUB 4N26A 1AQKL 1RKRA 2R29L 5BZDA 4AEIL 4LESA 4U0RB 2YUXA 4W9FC 1Z3GH 3NJVA 2JCCB 3VNZA 1TQCC 2BNUA 3EBGA 3HAEB 1IILE 4ZOCA 2YA1A 2KPNA 3V4VB 5CR1A 2BOBA 2FHCA 1VZGA 2YMXL 2UZIH 3FQYA 4UBDD 5KANG 1YMME 2YBRA 5FCSH 3LNHA 5T1DH 2Z7UA 4B53A 4GS7B 1E3ZA 1K72A 2P8MA 3F7PC 4JLRA 2H32H 1TQVA 2LVEA 4OCRL 2VXTL 3MV8D 3U9WA 2HTKC 4RMQA 4X80H 3VD2A 1VDGA 1BEXA 3WKQA 1PSKL 4A7GA 1B0IA 1WDAA 1WZAA 2KERA 3X13B 4AKPA 1YJDC 4WTQA 4Z7OE 1RUKH 4FQPA 3L3DA 4IIQA 3LZQA 1HXKA 1QP1A 3BAXA 4KRNA 5JDSA 2D3JA 4FJ6A 3JTTB 4L29B 3U4EB 5CZVH 1FZKA 1YNLL 5JXED 3ECWA 1VACA 4HEPA 5AB1A 1CBVH 1JZ4A 4Q9RH 4CDHA 5ICYB 3ILEA 4TSBH 4KUCF 5SV4A 2AW2A 4QT5A 4F7PB 5EA0L 1MCDA 1LDPH 1SJEA 4HHAB 3HE7C 3QJUB 2DQEH 2FCBA 5G4OA 3CC1A 4N8VG 3K3QA 2DQHL 2V5SA 3DVGB 2VMDA 1ZMYA 3FU0A 4N8PA 3V4PB 5IW1B 1XH0A 1JK8A 3LPOA 1Z1WA 3BSHA 4CUCA 5BMFL 3OKMA 3BUDA 1F6FB 4W9JC 3N1GC 2BDNH 3MA9H 4Z7QF 1WBYB 3QEHA 2Q6WB 3MHZA 1HHGB 5KVEH 1V3LA 5JNYA 3DURA 4GRLD 4R8WL 2BOBB 4P46D 1AHWC 3H85A 4Z23A 1PLAA 4O2EA 5IB5A 3UTTB 5C07B 2F53A 4F33B 4MNGB 3VXUE 1X9UA 1IGFH 4HWNA 3B7TA 2PXYC 3UZVA 3ETBF 3O4LD 3REVB 4ONFL 4I77H 1TYJA 3CXFA 4EUPA 2FJFA 3JUYA 2E74C 2BP3A 2J43A 5CFHA 4RRPM 2X6BA 2HG5A 4HQQH 4H25A 4LPCA 3S4SA 2ITDA 5LJYH 2JKSA 1XO8A 4XMPH 5E8DL 1G1CA 4RAVA 4AGMA 4OI8A 5B8CA 2EUWA 5AEAA 2OSLB 4A04A 1ZS8A 3CXHK 2H6OA 3AS1A 2V8LA 4PLJD 1HK6A 2XNAA 3VRLF 4FFVD 4M5YL 1CE1L 1TJHH 3EO9L 5KOMC 4K5OA 1LK2A 4PJ8C 3FRUB 3V5DB 4P5KB 3L6FA 2QPFA 3BLKA 1SGKA 1FAIH 3B9VA 4XOAA 3BH9B 4QRRB 1A7NL 1KLGA 1A8JH 5I1EL 1D5IL 4YDKL 3I6LE 3ULVD 3FU3A 4G72B 2F1AA 5BRPA 2AQSA 4R0LA 2GJ6D 1KIRB 2N56A 4FHBD 4WUUE 1DQTA 3NCBB 1HWWA 3FUEA 3PXJA 2K4WA 4W9GC 3NZUA 3TBWA 1UOWA 3X12B 3EJCA 4O58L 3ROLB 3T0BA 1HXMA 2NNFA 4Z7QE 3QEHB 4YSRA 4G43A 4BKLA 1N3NB 3DX6A 1I7UB 5GIRA 5DC9B 2M2DA 3K6IA 5E9AA 3DURB 1SXAA 3DIFA 5C0BA 1YYLH 3FB5B 3BVXA 4AUUA 4J4PC 3DJTA 4FFYH 2RALA 3IBEA 1UKSA 2B5IC 5TK4A 1NA8A 3CLFL 2N7BA 3ATFA 2BSEA 5TFSH 4N2FA 2AJVL 3TV3H 2R1XB 3V0WH 3QI9C 5EBLA 6FABL 5MENE 3SDXA 2DN7A 4FI8A 2E7LC 2BC4A 3JBG7 3S4SB 3DVIA 2GEQA 2OPCA 1TO4A 2EDEA 1UJTA 1U33A 4KI5E 1PEZA 5D4IA 4YHYC 2E47A 1OP5H 2MCPL 1FZMA 4GP4B 1T20B 3GS4A 4HJIA 1B2WH 2J8UF 1EHLH 3LZFH 1NEPA 3MRCA 2XNAB 3JV4B 2BSBA 3VRLE 5ID0A 4P2AA 3MAWA 3AXHA 4JKNA 4XPAH 5FOJA 4AY0A 3UADA 1DL7L 2C3VA 3B2VL 4JZOB 2VN6A 3ARBD 4M56A 4PJ5A 4PRDA 3EYUH 4UTAA 2EDMA 1WFTA 1DE4A 3D4ZA 4IRSB 1UURA 3BE1H 3MR9A 3P4MA 4JFQA 5GZND 4JFSA 1KLGB 3UYPB 1LO3H 1HL9A 2A9AA 3O6ML 4X7SL 2J1XA 4OGXH 4YQXL 1NCTA 1QO3A 2XUWA 3ZHLA 1IEAA 1YEEH 4KRPD 3P73B 4NKQB 5ALCL 3S37L 5KVEE 2OTUA 5EOCL 4E0RB 5IFJA 4GAGH 1N0LA 1G7HB 1U3YA 3DI2B 1K3ZA 2RTTA 3H1ZA 1P5VA 4PRIE 1C08A 4XVJL 2A1WH 1I3RB 2X4OB 3FFDA 3H2QA 2WKGA 4M8QA 3DX6B 4OLZL 5I6XC 1NFDF 3HNVH 5EC2A 2EE9A 4KK8D 3F62A 4U7KA 2DBLH 4G1EA 5IHZA 2XYBA 1T1ZA 5F0JB 1Q4NX 2R0LH 3HC0A 5CGYC 3KCWA 5BZWB 3TO4B 1KCLA 2E6JA 1FDLL 4HAFA 3A4DA 1LO2L 2Z1PA 4KDTA 2GW5A 1BQ5A 2N0KA 3CTTA 5EBLB 1XIWC 43C9B 1H9DA 3D51A 3NIDB 3QFDA 3SDXB 4M93B 5DVMA 1S7UA 2WYIA 5HD8D 2BC4B 3Q9QA 4XMLL 4LIQH 1NGWA 2XBZA 3BZFB 3UAJC 5IHUL 3LH2L 5MEQA 4DN3H 3MGAA 3BCFA 3ECUA 1S7SB 2D73A 2J6EL 3BFOA 3VWJB 1J9RA 2ED8A 3TM6A 5FUZH 5HHPA 3GKZA 2J8UE 2OS7A 2XPZA 3VI3E 2DZEA 4AL8H 5ID0B 5E5UB 2OYPA 1QG3A 3U7WL 1UUNA 4FHKA 4ABQA 1CF8L 1J8HA 1B9ZA 2UZIL 5DMGC 1QRNA 2GTWA 2VZTA 4K7FB 1W0VB 5DK0A 2J20A 3N40P 5TD4A 1UD6A 5BW7A 3P4MB 3PWVA 5J9PA 3Q1SL 2DMKA 3T8XA 1DR9A 3GIVB 3FMGL 3SE4C 1KXQA 4UI2A 4GBXA 5INDA 3U2SA 1SMDA 3FTVA 4Z3IA 2CGZA 4OGAC 4PGEB 4Y0GA 1UM6H 2PR4H 1RZ8B 3B2MA 3GLZA 4JFDE 2F74A 4J1UB 1P5VB 4MRBA 5J4MA 4OF5A 2F61A 3ZE1B 4L2LA 1KIQA 3NAAL 4M8QB 3LB6D 3L3IA 5EUKB 4BH7A 4LP5A 1NFDE 4U1GC 4FEMA 1TSRA 3ZDZF 3BPNC 2NY5C 4N0YH 1RQ5A 1CBVL 4ZXBC 4Q9RL 1RMFH 4ZX6A 2XIBA 5I24A 3EYVA 2LHAA 4JFPA 2XFXA 3CFIC 4MB4A 5DI8B 3VFVB 4TSBL 1MW0A 2YXVA 2WBKA 3DYMA 4XAWH 1BECA 4CC4C 2I07B 1LDPL 3BO8B 5EU7E 3EFDH 3DX0A 3S34L 3UTSB 1TTBA 1DEEB 2FBJL 1WFJA 2DQEL 2XY1A 4NRXB 2DLHA 1BIIA 3QFDB 5E2UH 3B2XA 2XWEA 1S7UB 3P4LA 4O02L 3ABMB 4JS7A 4GY4A 2P8PA 1SY6A 4TMPA 4HS6B 4KGLA 1V3KA 4DAGL 4XODA 4M5ZL 4FNLL 4Z7NF 4UMSA 1JK9B 3MA9L 2HPTA 1SJHB 3GQFA 2VLRE 1X3DA 2VERA 1UOKA 2EJ1A 2AEPH 4IDLA 1J11A 3ZHKA 5HHQB 2D9CA 3OZ9H 5CJOH 3F7YA 5DHYB 2B2XL 3BGAA 2E46A 4LXFA 2A99A 4NXSA 5IIEA 3MBEB 4BQBA 5CHNA 1FLTX 4P23C 3GZKA 4YSAA 2C1OA 4K9JA 2OULB 2WLLA 1IGFL 1FLRH 2JFCA 1H8OA 1S7XA 2HSIA 2NX5E 5CNHA 4K4KA 4HP5A 3O9WA 3VA2C 3ZU8A 5BPPA 1F1AA 4GBXB 5INDB 2Q2EB 5I2IB 2CLZB 2W0KA 4WFEE 4ERSH 4XOBA 1WFIA 4WWID 3ZTNH 4A1RA 1DQDL 2XVBA 4XMPL 1J8KA 1NGZA 1A6ZA 1IUZA 4BH7B 1FVEA 2FJHB 5DVKA 2EIMB 5DS8A 2LW3A 3KPMA 1KEMH 1R0AH 2IANA 3PP3K 4XP6L 3NIGB 4ELKA 5JDJA 4PS4L 1RD6A 4LIQE 2PW2A 3H6AA 5FA4B 2MNUA 1GYWA 4TQPA 1FAIL 1QEWA 2WBWB 2VR3A 3G5VA 5B7MA 1BIIB 3CFDA 3VMPA 4TUJA 4XPGH 3QWOA 5DFVC 2APBA 1X4YA 5IMOB 3IFNH 1BMZA 2W94A 2MJWA 4BK8A 1D5BA 4DP6X 4OZHA 4W9LC 1F4WH 4Z7NE 2HFEA 5GJSH 1HTYA 2RMNA 2AK4D 3L08A 1IGCH 4AZ8A 4H5SB 1ET5A 3G04B 3GFUA 1CU4H 1T7ZA 4AK2A 3DMMD 4APQD 1RZJH 4YDZA 2EUZA 5HHOE 4IMLB 4KZ0A 1N59B 4UQ2A 2BXYA 2X0WA 1N18A 1SFDA 3TV3L 1GJUA 1HL8A 3H9YA 3KPOB 3OG6B 4JM2A 5CUSL 5CZXD 3W81A 3SDDD 4PYHA 1HL5A 2E27H 3Q5OA 3CN1A 2ZX7A 4DEWA 2ZKXA 3U4AA 3U0TB 4KWUA 3RWHA 1CPUA 4OU3A 4KKZA 1EDYA 1NIFA 2QSVA 2KLSA 3MREB 1S9XB 2W91A 4H44C 1FVEB 4QXGH 1B2WL 3WNNA 4MQXC 5BUAA 1MI5B 1EHLL 1FFOA 1F13A 4UDTA 3KDMA 3KPMB 4LNRA 4YZFE 2WY3B 3Q8BA 4KVCL 5DEJA 4XPAL 1P0SE 1TZ8A 4X5XB 3VX0A 4HIIB 1LEKA 1TQCB 1X5GA 3EYUL 4K8RH 2A38A 1P7QA 4R9HA 2EO1A 1QEWB 1AO7D 3X1GA 2XBTA 1LO3L 1KXVA 4UDUB 1R3IH 3CFDB 2CGYA 2ORBH 2X4RB 1BXAA 4FZ8H 1VESA 4UM9A 2J44A 1HVXA 2X1PA 3QO0A 4M7ZB 4TUJB 4GAGL 5ABAA 5JXAH 4L37A 1SXSA 2YD2A 4I2XE 2HPOA 1AE6H 4K3EH 4OZHB 4WWKD 9CGTA 2VLJA 1FORL 2A1WL 2X0UA 3VXRA 4JFFD 3OD3A 4UBDC 4PTUA 3FHQA 2DBLL 5IBLD 2PP8A 2JKXA 2ATPA 5T1KA 3AXIA 3T3ME 2X41A 2ZSVB 1OB0A 4MMZC 3FSVA 1L0QA 2MOQA 4PGBB 5F7DB 2NUTA 1BWMA 2BIPA 3RPIB 2EDTA 1UENA 4CC1A 3RDJA 4ODWA 3V6ZA 4NFBA 2Y23A 4BFOA 1BG9A 2N4IA 3P3RA 4LFHG 2Q7NA 2V2WB 4XBPA 4ZW5A 3GJFK 1JP5A 1T5KA 2YD0A 3DX7B 4LIQL 5B1BB 5EU3A 1GOFA 1TQBC 5L2KD 1BX2B 2B16A 2GI0A 4P59H 1ETB1 5DVNA 2F18A 2KLRA 4NHUA 4DN3L 4KHXL 4QHNA 2YSTA 1XR9B 5JXEC 2CJSA 3SN6N 5FUZL 1E40A 3SB3A 1FFOB 3O3BB 5GS1C 3CDGA 5F7FA 4AL8L 4R3SA 5T3XH 2YAFA 4N0RA 1NAKH 1XT5A 5IJVA 1LEKB 4Z3HA 1P7QB 1L9TA 1P4IL 4G70B 1NC4D 4CSZA 3S36H 3FUNA 4JE0A 4UM9B 3FU6A 3KGSA 3N6YA 3BJ91 5E2TL 2GFBA 5IW6B 3GSXA 4GXVH 2VGLM 3IRZA 1FV1B 4L37B 1LGVA 2PXYB 1UM6L 3CDZA 2PR4L 5I5IA 3AZUA 3LQAL 4NQCA 1E5YA 1CD8A 3IJYA 5E6ID 2VLJB 2ADJA 1SBSH 4XVTH 5IJDC 1KCBA 1BD2A 4GRLC 5PCYA 2XN2A 4PSRA 1KG0B 4PTUB 4P46C 4DGIL 2BVEA 3GXNA 1OARL 4HJ0D 2ATPB 3LMJH 1RMFL 1UZ8A 3NZ8A 1WUNT 1MW2A 2H4EA 2DQCH 3RWEB 4JY6B 1BEYH 1F4AA 4R4BA 1SDYA 2ICEC 1TU2B 3GJEB 2JTYA 1A4JA 4PJ8B 4MBOA 1FZJA 2HJLB 4NZDA 3WYRA 1KYUA 4GAJH 4HWBA 4ODWB 3V2AR 3V6ZB 3LZRA 4X6CF 4WAFA 3QWQB 2GAZB 5HDQH 4NUGL 4Y5YC 1SJXA 4DP8X 4U6XB 2IPKA 4GKNB 1ONQA 1DVXA 1NPUA 5IEHA 4FOMA 4UNUA 3O2DA 4NHCH 3TXAA 2PWGA 1H5BC 3NDZE 4QHNB 1JOIA 5D6CA 1JVKA 5DC2A 4X5LA 1U8PA 4PLJC 4CADB 4R4FL 4FFVC 2FDBP 3JUZA 3HA0A 5C97A 1D9KA 4LT7A 2AEPL 3QWRA 1ZCRA 2BHUA 4QXTA 1CTOA 4X6FA 3UC0H 2F7RA 4I4WA 4LAQL 5CJOL 4MSWA 4WI2A 3P54A 1UWXH 4IU2B 4FQCH 3TH4T 4EKXA 1N5AB 1HNFA 2AI0H 3ULVC 1FYHB 2A0LD 4DH2A 1EFXD 2Y2WA 4Y2DA 2B5IB 3AU1A 1ZT4A 2GT9A 2K4AA 4NQVA 5FS5A 1CXHA 4F92B 4QJ5B 1FL3B 3HG0A 3ZHFA 3H4FA 4IMKC 1U2YA 1OL0A 2G3MA 2WXRA 4X4KA 1OVZA 4ERSL 4B6ZA 2LTQB 4NQCB 1O6TA 3N42F 4N2HA 3PU7A 4RZCB 2Q76A 1E2WA 4HUCA 3ZTEA 1NCAL 1BD2B 1I75A 2F9BT 3RPBA 3WN6A 4AEEA 5JUEH 3NRPA 4GQQA 1MWAB 2F58H 2A4ZA 2DLIA 1RPUA 1WGOA 3HFMH 3QFJA 3ECVA 2VDOB 3EH2A 3FUKA 4DO4A 3IDYB 3NZ8B 1YN7B 1CLZH 4MJIB 4JDTH 4U2YA 5IGXL 1B3JA 3ATAA 2PYEA 2P8LA 3ZL4H 2Z0BA 5IT2L 3VQ1C 2ERJC 4NO2A 4X6CE 4JPWH 4WV1C 2IBBA 1QFPA 5TTRA 4P3DA 3NESA 1QFWI 2V33A 1PVHA 5I6OA 5ALBH 5IEHB 5T3XE 3IFNL 4P04A 4FA7B 5HYJD 5GSVA 2X38A 2VM9A 4MASA 5GJSL 2IVFC 5JW4R 3POHA 1KXTA 5AL8A 5JHDE 4IW4C 5D7LE 1IAIM 4JFXA 4O2CA 4OD3H 3RWIA 4AV4A 2CKBA 4X6FB 4QXTB 3ARBC 4AQOA 1CU4L 5ANMA 1IT9H 1ITBB 4MSWB 1RZJL 3B8YA 1YHPA 3AACA 1OGPA 4LOFA 2H5UA 1KGJA 2P24A 1E6OH 3U36B 2A74C 1A7PH 3VJ6B 4X7TB 3HMWH 2OZ4A 4KRPC 2EKSA 3BDYH 1TG8A 1XH1A 5IREA 1ZT4B 2GT9B 2IPTH 1GTFA 5B1KA 3QULA 5F1OB 5KBMA 3VD3A 5FM5O 1XIWB 2CKNA 1B0RA 5TF1L 4JGNA 3IFOB 5TE4H 1IL1B 1XEUA 4I1NB 3UZEC 4XO4A 2JSFA 1Q72L 3U7YH 3KXFD 4KK8C 1IBYA 3IM1A 2VW7A 2Z91A 1EZUA 4JFOA 4MNQA 3HS8A 2EVFA 1HHKA 3QFJB 4ZPVB 4M7KH 5EIIG 3WFEL 4MAUH 1SF5A 1MHHA 4HUWA 2Y36L 4R7XA 4M3HA 5K33A 4K8RL 4LLVA 2PYEB 3NVQA 2P8LB 3BKYL 1BV8A 1JGUL 4ZUTA 5H37A 5AFAA 3VGEA 1UA6H 3ME0A 2VWEC 4OD2A 5J8OA 5HD8C 1R3IL 3KAAA 3L9EA 3BVNB 3DGGA 4KQ4H 4NBYB 3CVHH 3ZIMA 3GF8A 2BY3A 3ERXA 3FUDA 5JXAL 3IRPX 3NFPA 2JJWA 2X7LB 4F7MB 1A66A 3FCTA 4ELMA 3MOBH 5GZOD 1KXTB 5LBVA 5EIIB 3O6KL 2VL5A 4JFXB 1FA4A 1O7VA 3D06A 2CKBB 2IDUA 2W9DH 4J3SA 1HWGB 2RJMA 4TNVF 2OMBA 2PP7A 3CU7A 3ZHNA 2VLLA 4CL7A 4U1GB 1GAFH 1FYTA 4PCSA 2P24B 2DMHA 4WY7H 4TV3A 5CCKH 2A73A 2FT7A 1LO4H 4M62H 4P9MH 4L23A 2K1MA 5D2LE 3U2IA 4BJLA 3SO3B 1G5GA 2IAMA 5HHNB 4RX4D 3QCTH 5BVJA 2FT8A 2WP3O 5D1XA 1OGAD 3GMMB 3AS3A 3RL1A 3L4VA 4JGJA 2DTSA 3QISA 4P59L 5BV7C 2RFXB 2B4CC 2RGSA 2DICA 3ECQA 3KPNA 3LB6C 3OC8A 5DK2B 1LTXA 3T6ZA 2XV0A 2Y25A 2GTZB 2Y5TA 4U2ZA 5AAWC 1F3RB 2UUDH 4PJ7F 4QRSA 1CXIA 4B60A 1F41A 4K0OA 3P9WB 5EIQA 5JORA 2Z91B 1C8PA 1DSFL 4JFOB 1R3KA 3V4UH 1HHKB 2JXMB 5T3XL 1XSOA 2WWKO 3PWLB 3ARDD 3D33A 1NAKL 1AFVL 2OMVB 4BK5C 2DMGA 2PWEA 2EEFA 4W9DC 2X87A 2AJZB 4P2YA 2AJYH 4FMFA 3UPCA 3PP4H 4F7EB 4NJ9H 4HFUH 2RHEA 3PWJA 4P23B 4ANWA 3TVMD 3D05A 2IXQB 3ECBA 3FOLA 3HS0C 4GXVL 2WKLA 3NFPB 2JELH 4AYBA 5IJBC 3CFQA 3LQMA 5C2BH 3FO0H 1SM3H 1UGKA 4U1LB 3BD5A 4A2EA 3EGDB 4U6HA 1SBSL 4XVTL 1MFUA 3FB8B 3S3JA 2R2EB 4HJTA 4JUTA 3VXMB 1RUAH 5HHME 2IGFL 4EXPX 1Y1DA 1NCWH 4R5XA 4NQDA 1LE9B 1MFVA 3T1FA 1GS7A 3TWCL 3IWUA 1DTUA 1ORSB 2DQCL 3HJEA 2E9BA 2EDJA 1BEYL 4G11A 4LVNB 2A73B 3NCXA 2Y9RT 4HCRA 5EO9A 4FX5A 1GGBL 1ZA3B 1JG9A 1IGJB 2OCFD 4YBLC 4KX9A 5DVPA 4ZMOA 2MQ3A 4OAWA 4JKKA 2NR6D 1KGWA 3QORA 5K39A 2PETA 3ESNA 3MRGA 5E4OA 1DVUA 1RIHL 1CI5A 5HDQL 1XHHA 4FXTA 4F57L 1H3PL 4FI7A 2ATKB 5EBMA 4NHCL 3OLGA 2CIIA 1TEGA 1JNNH 3FU9A 4WI7A 3HN5A 1UD2A 4X9YA 5D2NA 2C7UA 1MLCB 1OSZA 2NUPB 1MFEL 1U8HA 4HIHB 4PJ7E 4QRSB 5E8OB 3ULUL 4IBWA 4W68A 1AZCA 1R3KB 3B2UD 3QZPA 5DZVA 5DRZA 1ULVA 3MRMB 3UC0L 3LS5H 1GJIA 4H0HB 4U33A 5ISZB 2HA1A 1OTTC 4WHCA 1R46A 1SYVA 1BVOA 4FQCL 2OMUB 4KJQD 1JBJA 2IFFH 4MD0A 3QXTA 2HT2D 2XV6B 2VJ8A 5G4MA 3FOLB 3PHQA 4G6FB 1FGNH 4YDIH 4KH9A 2M26A 2AXGB 3DRTB 2YKKA 4U6HB 4MWFA 4AYFB 1IAMA 2VMEA 4K94H 2XV3A 4W4OA 1G0DA 4APQC 3DMMC 1AGCB 2R7EB 2ZG3A 1V5JA 4XOCA 3VTMA 3HFML 4QTIH 1HIML 3LS4L 4X6DB 2VUOA 1LD9A 2FJUB 4UOQA 3U1SL 5EF1A 4M6AA 4UZUA 1P4LA 1XH3A 4JDVB 5CZXC 3ZL4L 2OL3B 4B9PA 5EO9B 2GB2A 5L6YL 5DJDA 5F71A 1S5IH 2UY7B 3WMSA 1F86A 2EZ0D 2H45A 2V3FA 1F5WA 4PJ9D 3QORB 5EWIH 1OCWH 4KX7A 4MKTA 4FNUA 4FFWD 1BHGA 4MD4A 2RQ8A 5C7XH 4PW9A 4Z8FL 4OUUA 1R75A 5FW7A 1NFKA 1PPIA 3P11H 3RLSA 2AJ3B 3U6XA 3SJVA 2G9KA 3QDGE 2AKRA 3TFBA 3LXBA 3O3UN 3TF4A 3FT0A 4ZSOA 4PBDA 4KPHH 1OQOA 2N7SA 3WO4C 5M94B 2E9GA 3JV6B 2P5EA 1A7PL 4F9PA 3OSVA 3HMWL 4Q7DA 1G9EA 1T5XA 2Z7YA 3BDYL 3N04A 3EJQA 4MD0B 4U1NA 3C9NA 3HAEH 5F8RC 5GRJL 4LLWB 2UXGA 4JB9H 1KB3A 4IOSA 4WFGD 3X11A 4YO0A 3VRJA 5JIPA 5TE4L 1DJHA 2EIZB 1QSEE 1XGTB 4GMTH 1UFUA 3U7YL 2CHDA 2F8IA 5IBLC 3VXOA 4PV8A 3C09B 3QT2A 1XGPA 5DS1A 3ZN6A 2FVNA 2ID5A 1ODAA 5IFAH 2DW5A 4M7KL 3CXDL 3UAFA 4NP4L 4PD4K 5D1ZA 2I9LA 3O6FA 5GS1B 2X42A 3WY4A 5E1AB 1AXIB 2I69A 1YLBB 1PX4A 4GYBA 2KLTA 3D3VD 2XWDA 3TA4D 2UYLA 2A83A 4ODHH 4P0DA 2X05A 3DX9A 5KYXA 1Z5YD 3I3BA 3QAZB 3K6FA 5DRXA 3C60D 4J8QA 4PJIE 2ZWLT 3LKOA 4MD4B 4I1PA 2MCG1 2GHWB 4PEEA 4NT6A 4YHIA 4E41E 4GKSB 1SDDA 4AYDC 3NZHL 1DJZA 3WNLA 4DVRL 4PBXA 1CLOL 3I84A 2NY6C 4P2OA 2OMWA 3QJTB 4QY8B 4NBXB 3V6OE 4ZSOB 3MMEA 3V0FA 2HP4A 2WZ0A 3CFTA 1KTRL 4ELDA 1B4RA 2AFNA 5ICZA 4YE0A 4G5AA 2P5EB 2OR9H 3CSPA 5DSCA 5DD5H 3R8BB 1L6PA 2BW4A 1LO4L 4M62L 2ZUQC 1YA5A 4P9ML 4YFLF 3GZOA 2WUCL 3EYFA 5IMKA 1W16A 3QCTL 1OPOA 2ICEB 4IU3A 2QV4A 1NOLA 3O4LB 2Z31D 3Q2VA 4Q97A 5E6IC 3X11B 4YO0B 5LUMA 3VRJB 1FFTB 3V5KB 1XF4A 3IPEA 1MAMH 2PF6A 1ETJA 3L3OB 2YRPA 3HHSA 5GS3A 3T0WA 4OLWH 2VQ1A 3L2NA 5I6MA 3WHXA 3BP7B 4HJ0C 5FDWA 3V4UL 1IQWH 5KW9L 1XGPB 2R2BB 1QSVA 1OWRM 1CK0H 4LHUD 3UTOA 5DZPA 3AXLA 1S9VA 3G7TA 1D7CA 4D0DA 5D1ZB 1E4KA 4A7SA 1LMIA 2CO7A 3LN5B 4K5MA 2MQCA 1WAAF 3BD3A 3GDBA 3MJ9L 2B3IA 4FTDA 3DX9B 1C16B 1DSYA 1BQHB 1UVQA 2BIIA 3OKOA 4JHAH 1OALA 2VC2B 5C09D 4HIJB 2L7UA 2JH2A 2N3JA 5DRXB 4KH2A 3MV7B 4ACPA 3GO1H 3TEZA 1JHKH 2FL5B 2GJ6B 2XN9D 4NT6B 1PZ5A 2DIEA 4PJEB 1SM3L 1FH2A 4YHIB 4XMUA 2WBJA 5C2BL 2DQ6A 4ZS7H 2F54A 4D0CA 5DQDH 3WIIL 1CDYA 3QVAA 4AIEA 2HFGL 3OQRA 2EC9U 4TLSA 1RUAL 4C54A 4UQBA 1CL7H 3MMEB 1HEZA 3VA6A 2J88H 3PDOA 4LNVA 4FABH 4GO6B 2A0LC 4RFOH 2AEQH 2CLVB 3D85D 5I1CL 5LHDA 5JHBA 1X9QA 3EYFB 2APSA 3F12B 1OCOB 3CDFA 3H6JA 1ZLUK 2ERJB 3IDJA 1PDKA 2QQNH 3JQOB 1EJ6A 1L9PA 5AW6B 1JNNL 4WV1B 5C3LD 5TDOB 2EP6A 1HNGA 3T4AA 4TVPD 6PCYA 5F9OH 2JMRA 2EDXA 4HLEA 4AXWB 3QA3B 2R2HB 4FFTA 2PCFB 2YZ1A 4FTVA 3WNKA 4JJHA 4PM1A 4G9DA 3IMVA 1AQMA 1KCVH 2QEJA 4FG4A 4PFEA 3FXIC 3CFKB 1NTDA 1WAAE 2BZCA 3MV11 4KQ3H 4RRPA 4N25A 3EHBD 4X4XA 5DS2A 4BD4A 3VXPB 1JGLH 1UVQB 3OKOB 4M9OA 2BOCA 4ZNCD 4WO4A 4ODXA 5I1DB 1FVDB 1ZPLA 5E1IA 2R23A 4RMTA 4DP9X 4KRPB 4WW2C 1UD3A 3INOA 4RGOH 1FGNL 4YDIL 4XI5D 1PZ5B 5JQIB 1KELH 4HJJL 2F54B 3NIFB 1N6VA 4K94L 3L8QA 3BISA 3BPLC 4GNKB 1ECZA 4E42A 2C3HA 2XWZA 4Z18A 1QUPA 2G5UA 1YMMD 2Z35A 3GMQB 3AWGA 4QTIL 4RGMC 2CUIA 1ESOA 5C6TH 4XXCC 4D8PA 3B1TA 2HKHH 5C07E 4MNGE 1JV2A 3P9MB 4TSCH 2G9HB 5AOJA 1I8KA 4GP8B 3VSQA 4IDJH 4GMSH 3SGJC 1OCWL 1MKFA 1UASA 3AY4A 4HXBH 3KVPA 2J57A 5C7XL 3IE4A 1YY9D 4UILH 5AKRA 3T4AB 3QC5X 3P11L 3RIFK 1RIUL 3VE0B 3UABA 5LGYA 5DRNB 2WWMD 3TESA 3LV3A 5C08D 5KSUB 4XNUH 3O3EA 4GW5B 5T3ZL 4G9DB 1JHLL 4RA3A 2Q7YB 4D3CH 1D2OA 4EZLA 4XPFH 3QS3A 2O6DA 5CP3A 4YDLC 3VXUD 2IDSA 3Q44A 4AQ1A 4BWUA 1GGYA 1JD9A 4X4XB 4QRRE 3QDJA 3G5YA 2H3NA 5DJZA 3KCPB 5D5MA 2BOCB 3U9UB 2DIAA 2P5WD 3AS2A 4WO4B 3V4VL 2CDEB 1UXSB 1ODUA 2WGNB 3IXTB 4L8DA 4JK0D 3N44B 4ZFOL 5I75C 4UTAH 4JN1H 4DO6A 1T1XB 3QDMA 4PPTA 5GZOC 3VFUB 2BZDA 5F89A 5FV1L 5IHWA 1I9IH 3PREA 4FZEH 3MXWH 1Z5LA 5IR1B 2CXKA 1M71A 3S35X 5BV7B 1F3DJ 2CALA 2QVMA 4NO0D 5C9JB 1U41A 5J6SA 3QAQA 1PCSA 1PNCA 3HNTL 3UC2A 5DHEA 4F5CE 2X3CA 1NCNA 4D8PB 3MRJA 1NC2D 1NSNH 1RH8A 3IDMA 1HL4A 2F53E 2WMPB 1D6VH 4N6RB 4Y1TA 1QSFA 5F3HB 3P1VA 3F7RA 5L8JB 5TK2A 3PF2A 2BMKB 2DWEB 2ZUXA 2B9BA 3NIDF 4JN2A 4O9HL 4MZRA 3SDXF 3OG4B 1OAKH 1H6FA 4EOWH 4EI6A 4Z0XA 3TYFA 2K6ZA 3P30H 3VG0H 4DZ8B 2XXFA 1R5VA 5LGJA 3CDCA 4N8VA 5E2WH 5ESAB 4GRWB 1MH5B 2OX5A 4MX7B 3HS0B 3PJSB 4PUBH 1I7TA 4Q52A 3N1FC 3ORJA 4ZFGH 3ARDC 4NFDA 2WXJA 4A7QA 1YEIH 3LV3B 2AV1B 3V4PL 3FJTA 4G8FA 2CUAA 4LVHC 1SUHA 4KUCD 4RWYH 3VYNA 2ZOOA 2H2PD 4XE0A 4UT9H 1NBYA 3OKDB 1SHWA 4M61A 4BFEA 2VLKA 5DD5L 2P42B 4HKXA 1GOHA 4LB8A 2VDKH 5JHMA 5T1MA 1HOCA 3I6LD 3G5YB 5DJZB 3TVMC 1E43A 1BZOA 1X5LA 2YGPA 1RK7A 4L8DB 3EYQD 4WUUD 5GGTH 5C2UB 4YBLB 5GRUH 2VMJA 4Y4HD 1QRKA 4HFWA 3MYZA 3TZVA 4HXAH 4MNHB 1MAML 2BWDA 3CHPA 3CFUA 3E2HB 3KJ6H 4XGZA 1ZANH 5EOTA 3CBJB 1Z5LB 1UFGA 5FO8B 4OLWL 3NSFA 4HZ1A 5B1JA 3ZE1F 1K8IA 4P06A 1ZEAL 3V7AG 3JWOL 1IQWL 3AADB 4KZEH 1CK0L 2ZT9C 5DC0A 3X1NA 2BSTB 2ICCA 2Y6SD 3QQ4A 1NCIA 3HCVA 3ZKXB 3MRJB 3CXHJ 2E9IA 1ETZB 1KTCA 4R96A 1Z7JA 4CAGA 1QSFB 4OB5L 2NR6C 5FIEA 4PJFB 5MEND 2GUOA 1TCMA 1G7JA 3P3TA 5AB9A 3BPCA 3NIDE 2C8NA 4H0LC 3SDXE 4RISH 1XF5A 2M83A 1CFNB 3GO1L 1DQJB 1OZUA 4PJHA 1H6UA 1JHKL 4RNRA 3V0GA 4AM0Q 4CN6A 5E08H 1UADC 4XP9H 5HTSA 1WD8A 1AD0B 5CM1A 4AEFA 4XP1L 4ZS7L 3Q6GL 4D94A 2BSSA 1KN4H 1HZKA 3PHSA 5BVPH 2AK4B 1CL7L 1SY6H 1XZ0A 3OMAB 2RA1A 3VWKD 2GBAA 3WAKA 3ZHDA 5ILTH 2J88L 4LCYA 4LEBA 4KJQC 3DMMB 2VR4A 4APQB 4RFOL 4LVEA 4YLBA 4DP2X 1G0YR 4F93B 1ES0A 1GHFH 5E6YA 3NJKA 2DYRB 2HT2C 1BW8A 4QD2E 4NCDA 3EJUA 5KZCD 3WMPA 4MQ7A 5CBEB 1Z9MA 1BQRA 3LKPB 1BG1A 3O0RL 1TQUA 1ASQA 1V8HA 2YKLH 3TF7C 1VRSA 4HFWB 3QCVH 1GZPA 4MA8L 5D7KE 4PRID 4Y8DC 4PVLA 5KJ7E 2E7BA 3CSFA 5EOTB 3ZIYA 3S97C 4HIXL 3WY3A 4PJDA 5BJTB 2DAVA 4LE8A 3ZE1E 3RWJA 1A7QH 1K8IB 3BKCH 2CDFA 2AQPA 5ELIA 2FZ3A 1WA0X 3V10A 4Z78A 3CQPA 5MP6H 5IOPA 3QQ4B 4N2KA 3NIGF 1KCVL 2KL6A 1WYJA 5A2KH 1DANU 5GISH 3RWGB 1FJ1A 2EZ0C 2QV2A 3UIYA 1JI2A 4PJ9C 4KJYA 3UTSE 1S78D 5IBUG 2UWEA 2GUOB 3GT6A 3R19A 3WO4B 3JYCA 1I8MA 2V17H 2CJUH 4FFWC 2CBTA 2WNXA 3ZO0A 2BVPA 4D7BA 4PJHB 4CKVX 1A02N 4N2IA 4RGOL 2X2UA 2QDWA 1HNYA 3QEQB 1GVIA 5GRVK 2EEDA 3WTXA 3X3FH 3LEVL 3QR2A 5AB2A 2UY6B 4DPRA 2VLME 2QLYA 1XZ0B 2CGRL 5SWSA 1BCIA 3RX7A 3EFFA 1P9MA 4X8JA 1GCFA 3CFJA 1J8HE 3UXFA 5D4HA 1EBAA 2JF1A 4EF3A 5FYJU 2HKHL 2QSCL 2Y3NA 3BGFC 4CMMA 5I0YA 4KI1A 1TVBA 3U4BL 2EAEA 2VR8A 1VHPA 4ABWA 3HRPA 2AGJL 3H3BC 1OLZA 3RY6C 5I73B 3L7FA 4IDJL 4GMSL 4AT6B 5EEYA 4JRYA 2PLTA 2MMXA 1KXQE 2WQWA 1DJYA 5LGKA 3CZJA 4HXBL 2Z1KA 4JFDD 3D12B 3RP1A 5L2KB 2HAZA 3CNKA 5I0WA 1NEZG 2RH0A 4RSVA 3MXVH 1UOVA 5H4YA 3NCMA 3H9SA 5EF0A 2WM0A 3MRFB 4PRAA 5DMIH 3NJXA 2FK9A 5EV7A 3DPBA 3QUYD 4QOKA 5HYIA 2FZ3B 3ARZA 1DBAL 4R7LA 5JOPE 2NY6B 2BVYA 4D3CL 3NIGE 1IJNA 4JO8A 4XPFL 5TH2B 4MJ5B 2IADA 2B39A 2A6JA 4HCFA 4KJYB 3UCRA 4NN5B 3IEAA 3LQZB 1JNLL 2QL1A 4GRMB 2PABA 3C60C 3VFMA 1NC4B 1I8MB 3Q43A 4IKJA 2J1WA 4PLOB 4KY1H 2ZWYA 1Z9NA 1FFPA 1YEKH 5ICXA 1DO5A 4H1LG 1N8ZB 7CGTA 1TVHB 3MRQB 1SVZA 4BM7A 5F44A 1INDH 4IRZA 1KC5L 4RQQA 4XRCB 3KS0H 3SPVB 5CLYA 2DM4A 3NFSH 3NK3A 4NO5A 3KYMB 4FZEL 4OZHF 4WJ5B 3GIZL 1HHHA 1ACXA 2QDVA 3IMWA 3LCYA 4ADIA 2MEJB 1JHTA 4G7VL 4YDJA 5CJXA 4X8JB 3L4XA 3VM5A 2V5MA 3GBML 3TBVA 1SHSA 1BVZA 1MZYA 1CYWA 3KYKH 4OLEA 3UZQB 5F7EH 1H8SA 1ZHKB 3FZUD 2XQBH 5HJ3A 1FQ9C 2J1KA 3QIBD 1DDHA 4OFKA 4QTHB 3BQUB 4AVHA 2Z31C 4JM2F 3KPPA 4WK0B 3UEZA 4Y2OA 4JRYB 2R27A 3PWNA 1E5CA 4C8XA 1OAKL 4I48A 3MLXH 2Q87A 4EOWL 1S46A 3FBQA 4NKOB 2AQ1A 1T7YA 4LPTA 4P5RA 2IFGA 5AW1B 1OM9A 2WXFA 3US0A 1JXDA 2A6DB 3NRQA 2JKWA 5E2WL 2QT6A 3H9SB 4PUBL 3SGEH 1UTDA 4ZFGL 4PJXA 3ASNB 3FQNA 5HGDA 3VCLB 4YLQT 3HR5A 1ZHLA 1TO5A 1EZSA 1M4KA 4W81A 5ESQA 5CAYB 4L8CA 4HBQA 2D31A 4UT9L 2JKLA 3L3GA 4OQTH 4ACTA 5DMJB 5C0AA 2A6JB 3PGDA 2B15A 3MRBA 3MPCA 3UL4A 1FL5B 3VFMB 1SRDA 4FERA 2X4PA 4UNTA 4ALAC 4D7PA 1EFXB 1B4LA 4HLJA 3ZR6A 4YWGL 3HZ3A 1Z2KA 2CU9A 5GGTL 1DUZA 5GRUL 4EVNA 3MCKA 5HBBA 2BVTA 5IVZA 4ZOAA 2BFVH 1ZLSH 4HXAL 1UB5A 3L81A 3KJ6L 3NRFA 3NGBC 1ZANL 4NM4L 4NO5B 5CBAB 4OZHE 3VFWA 1OT2A 4Y9GA 2FJGB 9PCYA 1LWRA 1NGPH 1NLDL 4LASH 1JZ7A 1MRDH 1JHTB 2FIKA 4Z77B 2JVUA 3FDWA 3IFLL 5KVGH 1E8XA 3WO3B 1TJMA 4KZEL 1MCPL 3MNDA 4UZSA 1J5OL 3LRGA 3ARXA 4LRIA 1RZKC 5HHOD 3X17A 3FU7A 3RVUD 2ZYHA 1FG9C 2C5DC 1ACCA 3PNRB 3TEYA 5B38B 2NOYA 3IETA 2ZYIA 3IYLW 1EA9C 2UX7A 4IBVA 4QDGA 1MWAH 3CZGA 3LN9A 1A7RL 1AZVA 2E3VA 1TEYA 2VDOH 1BYOA 4HV8A 1COBA 1KPUA 3MYJA 4OI9A 3VFNA 4R84A 5EU6A 2EVHA 4G9FA 3IWVA 4MJ4A 1OANA 4JQVC 2MPVA 3TBTB 1T3FA 3C5ZB 3RGVD 4HC1A 4XP9L 1CF1A 2JJSC 5IMMB 3C2SA 5INCB 5HYJB 3E6HB 1A3LH 1U8OB 3RHWK 1KB5B 4R7NB 4JG0H 4LPXA 4HDIB 1XGYH 3IE9A 4NB7A 3RUGB 4F15B 1TLMA 1TTCA 1WC7A 3O2DH 4UIMB 2W38A 4XCEA 4ZMLA 4A6YA 4L8CB 2LU5A 4W9KC 5DURD 3UDWC 4AQEA 3BPLB 4MCYB 2D31B 3VFTB 4KY2A 3EHBC 4QRPA 2YC1B 1JTPA 4GH7B 1S3RA 4HT1H 4YLCA 1BQLH 4RGMB 1EDQA 1QFWM 3F58H 2DJSA 2DWDA 4XI5C 1IEBB 2IPUK 4KZDH 1A6TA 3QIWD 1G7IA 5IEKB 2WXGA 3SKOB 5LXVA 5E8PA 5AKVA 3CSTA 5GJTL 3QCVL 4Z76A 2VCOA 4ORGA 2AJSH 2WXMA 1R3LB 4KK5D 2H1XA 2VLJE 1EMTH 5A2IH 4PWGA 1R9FA 1KTDB 2WP3T 4P2RA 4RSYA 2FIKB 2O5ZH 2YPLA 3L5HA 5JQ6L 1BREA 4ISVA 2C3WA 2W9EH 5IB2A 5DZAA 1IM9D 4OIBA 2K3HA 4ZMYA 3BEWA 5FYKH 3BUYB 5GISL 5AVTB 4GEJA 3MJ8B 4X98B 4L8BA 1PKOA 3WHE1 2YEZB 1PLCA 4IIZA 4PWKA 4X9IA 2WWKT 3VMNA 2BS71 4NN6B 5LNEA 3C8HA 1IZKA 2Z4TA 4JBSA 1N10A 4XPTH 1L9MA 3Q1EA 5G55A 5A1AA 1E0OB 4G9FB 4FP8H 1YY9C 1QLRB 2A77H 2ZSWA 2FLBT 2QBWA 5HY9A 1QPXA 4IOIA 5AZEH 1TTRA 5HGAA 4N68A 1T1WB 2WWMC 3SDCA 2X10A 5LCVA 3FHEA 2ARJQ 1FI8C 3SGEI 3K71A 4JY5L 3I6GB 3RTQA 2TRYA 2R9HD 4A6YB 4AQEB 2XPYA 2AQQA 3KGTA 1QR1A 3UCQA 3U30C 4KO9A 2R69A 4N2NA 2H0PA 2R1YB 3L5WA 2BSCA 3MKGA 2CKBH 1JWMB 2GJPA 3JTSA 4HA1A 1RSYA 5DR5H 5E94A 1F02I 2BVQB 2EYRB 3DDGA 4PWFA 5KVGE 2NY5H 4DW2H 4ILDA 2OZ4H 4ORGB 3OXRB 4NQCE 3ARSA 2WXQA 1VGKA 3MXVL 1AHWA 4X8GA 4P2RB 1BD2E 1ZGLM 1OW0A 4WGKA 4P5MA 4NKDA 1GS6X 1CZ8H 2OCCB 4ISVB 3AG4B 4I0CC 1D7DA 2L3BA 3FW6A 3I2CH 3VFSB 4WEUD 3LNIA 4MJIE 3TIEB 3BEWB 4LL4A 2EH7L 3Q8CA 3AWFA 2AMGA 1IM3D 3GJFB 3N3EA 3S96A 1CFSB 5KJRH 1F11A 2ZCLH 2PCPB 2QGBA 3FSOA 1UZGA 4KY1L 4KO7A 3FQ2A 2AXJA 2MNJB 1PCXA 1RJZA 1YEKL 4S10A 1F3JA 5LDSA 1W8NA 1Z9PA 2OSYA 3TVMB 3FC8A 1N5YH 2WKOA 1ID2A 3RX5A 2ALAA 3PWPD 1F6AB 3NFSL 4K8RD 5HPMB 3B83A 3EYSH 4NNYB 1XQ4A 3DO3A 4XX1G 4JJ5B 3JVGC 2O4EA 3TTYA 3CHOA 4FYRA 3M1BB 1I1YB 2BHZA 3QJHA 5T33L 1E67A 4Q9BA 4UT7L 3K1DA 3Q2LA 3RTQB 4KNQA 5J6HA 1NJ9A 2FX7H 1ZWIA 5A6MA 3DROB 3KYKL 2VZSA 3HRZA 5F7EL 2XZCH 4B0MM 3JTSB 1AKPA 1W8OA 3EYQC 4XO9A 4YHLH 3S5LA 5HGHB 2K70A 4Y4HC 1T4KA 3BW9A 5HYSG 1QWHA 2E76C 3WKML 3MLXL 1R5WA 1WH0A 3BYYA 5L9DH 5CEXA 5TDNB 4R2GD 1TZOA 4WUKL 3T3PF 2V2TB 2Y0SA 2LLNA 3BZ5A 1DHKA 4JO1H 3HPJA 2FEEI 2FB4L 1XGRA 3EOAA 1O6VA 2X4QB 4J4PA 5FYKE 1WFOA 3CU1A 2FUQA 4P5MB 2YUZA 3LRMA 1AZNA 2ZXBA 2MCAA 1YEWA 3QFJE 5T1LA 3D9AH 5A7BA 2AEIT 4L8SA 5AW4B 5G4NA 5LKNA 4OQTL 5ACMA 4DQOH 4Y1AD 2PYEE 1ET8A 3BP5A 3CZEA 1S7RB 3MUUA 1SLVA 3D18B 4DKDC 3MNWA 2DDQL 4QRUA 3MCLH 4Y16D 1HE7A 3MNZA 5IVOA 4EBQH 1RJZB 1EEZA 1BZEA 1M2VA 1R17A 2BFVL 3Q5YA 4XNMA 4YSPA 5B39G 2V9QA 3X14A 2J21A 3QYMA 1RUMH 4C83A 1KBGH 3D8MA 4ELMF 1GC1C 5D7LD 4YEFA 2DD8H 2E0PA 3VWKC 4L4JA 4IYKA 4LASL 1MLBA 1MRDL 2YOAA 1N4XH 3MACH 4AMWA 5KVGL 4O2FB 1OPGL 4U31A 4HJ1A 1H15A 2IBZX 3WG7B 1CMOA 4HGWA 5E8NA 1GGTA 5J6HB 5ANME 2DYPA 3LKQA 1N64L 2W0FA 1JZEA 2VXVH 3CPLB 3M17A 3VH8G 2F6AA 1AMYA 2JKRM 3WIFB 4F9LC 1J0IA 4QGYA 4OLXH 4YHZL 3G5ZA 3VVWA 3CG8A 4R5VA 3S5LB 1MWAL 2D7TL 3DK0A 2ZOTA 1JVLA 3BW9B 3GKWL 4PJ9B 1FGVH 3MLZH 4L3CA 5B39B 1IQDA 1F90H 3C5JA 5B7EA 1JWSB 4PS7A 5DUBA 3T3PE 2OL3H 2WYTA 4ATTA 4TNWF 5CCJA 2EDQA 1XF2A 3E8UL 3EOAB 4G8AC 4EKJA 2XWCA 1A3LL 1K5NB 1V7NH 3K2MC 4JG0L 1I3UA 1XGYL 5BS0A 2GBVA 4PRBA 4KUZL 2YIHA 3SQRA 3ZTJG 4Y5VC 4NWUL 4OJEH 1MQKH 5T1LB 3H8NA 1E9QA 2EINB 2ZZUT 1D5XB 1VIWA 1S78C 4ZAKA 2ED9A 2QQQA 4LARL 1G1YA 3BP5B 3RWDB 4HT1L 3TX4A 5JW4M 1BQLL 1KCKA 5FYJH 5ANHA 3V55A 3DBXB 1IC5H 2YAEA 3S36X 4KK9D 2HYMA 4KZDL 1EEZB 1T2QH 4GSRA 1C8QA 3C08H 5DFAA 2CLRB 2HUHA 5FLVA 1DN0B 2X9XA 1M2VB 5F0MB 1J0HA 3I02B 1NCJA 5KTEH 2AJSL 3N41B 4C83B 1WWWX 2HTLD 1MLBB 1AY1H 4OLUH 3MUHL 3VXME 1JAEA 4U3SA 5E8NB 1LNUA 2CHWA 2BZ7A 3LKQB 1SQ2N 2W0FB 4L0ZA 5L8KB 3M17B 2P47B 2J4WL 2VSDA 1IBDA 1SYSA 3JVFC 3N1PC 3SE4A 5FYKL 5JW4Q 1VCAA 1Q9WB 3S88H 5J6GA 1UM4H 1C5CH 3E1F1 4DSYA 1Q1PA 4JG1L 4NQTA 1ZDQA 3D3VB 4HAKA 4KKAD 4BFJA 1MVUA 1ZXQA 4I1RA 5BZZA 3NG5A 3WLWD 2K8QA 2AQ3A 3OKLB 4HUUB 4X0KA 2C9PA 5JW4N 2OA9A 2A77L 3DX4A 1KB9J 3C60B 1HILA 3PGFH 1AZUA 4ZJ9A 5SWQA 1XF2B 4JX0A 1WCQA 3D09A 5F6HI 1U30A 4Y9BA 1CCZA 4HCIA 2JNZA 2X70B 3SDAA 2Q86B 2A9CA 2W07B 2NYKA 2ZE0A 1UHVA 3ARED 5EU7C 3IU4H 4JCWA 3OWRA 1INQA 2QR0A 3QRGL 4I0PD 4N2GA 5ISZE 3VU2A 2J12B 3WN5C 2Q20A 1MEXL 5AG9A 3B9KA 2IQAB 5DR5L 3WLBA 1YN6B 1BOGB 3TA3A 3ASOB 3SKNB 5DT1H 1FZOB 3EXLA 1ZE3H 2PKDA 4JQXC 4HMDA 4NUJB 2NY5L 2Z31B 5FO2A 4JKPH 3FTGB 2IGLA 5J1SC 1IGYA 4HUVA 2G4GA 3D2UB 3VI4B 4KROD 5HHMD 3LEXA 1UM5H 3GSUA 1CZ8L 2CHZA 2HWZH 1HFUA 4CVUA 3MA7A 4NDMB 2UXTA 5CILH 4LHUB 3CCHA 3FZUC 1MJUH 1UUSA 2H6UA 3Q5TA 1SYSB 3QIBC 1PZBA 4K2UH 3OR7A 5C0GA 2NW2B 4ODUA 1SVBA 4BZ1A 1TTFA 4Z7UA 1R47A 5BCAA 2AXFA 2SEBA 1JWUA 1QQDA 3KLKA 2GSGB 1JD7A 3FONA 4MA1C 5KJRL 1DJSA 3KPRA 4KMTH 3ZQ9A 1GMIA 3KM1A 3INUL 4KKNA 4X0KB 5IKCA 1BGXH 5I1KH 5I1GH 2IH1B 2ARWA 2G30A 3P0GB 4J7RA 1Q0XH 1WZMA 3MNVA 4JFEA 4DPBX 5B3SB 5IG7B 2VC2H 1VFOA 4UUJA 3CX2A 5FYJE 4GLRH 2A3TA 4GJTB 3NGBB 1E5AA 2EECA 2TSBA 4ZW7A 1INQB 1UYWH 3A4EA 4PP2A 1MUJB 4CVXB 1RHHB 2ZWZA 3UH8A 2NNXA 2XZCL 3GD1C 1YZZA 3D85B 4HSCX 3AABA 4G7SB 4HYTB 4JKWA 4YHOH 1TQTA 4M1CD 2R4RH 3TA3B 4Q6IA 3CHXA 1AQDA 2GK0B 5L9DL 3B2DC 1M7IA 3QNZB 5AUMA 2UXFA 1JGIA 1P2CA 4JO1L 5A2AA 3RX9A 1Q94B 4CU7A 1YC7A 4MCZB 3Q05A 3F7KA 2QZQA 1I8LA 1U6AH 5H94A 2PP9A 1G7QA 4AW4A 4UTBA 3VGDA 2HVBA 3CPUA 4YGVA 3IPFA 3VD0A 3U0PA 3RVUC 1W72A 3MRDA 1SJMA 2OV0A 1M2OA 3ES6B 3V0IA 5C0GB 4RFNC 3AGWA 3FCGA 1VSCA 2QVTA 4HSQA 4PTTA 2AXFB 2SEBB 5GRYA 3EHBB 5FW8A 4X99A 3KPRB 1OTUD 4BUQA 3HR6A 4EBQL 3HE6A 3GNML 2ITCA 3IJHB 4JUSA 5DUPH 3CZLA 4HOWA 1ECYA 3IGLA 3QZMA 3NSJA 3ZDXB 2SODB 1MFCH 3OGOE 2R56L 2FWOA 2QJDA 2DD8L 3QDGD 3FO2A 4ABVA 4UUJB 3MACL 1N4XL 2CBPA 3R0NA 3GUFA 3ELQA 3O41B 4ZSOE 2DTMH 5EBWA 5HPOA 4QXVA 2AJUH 3FAWA 1QFHA 2E75C 3CN2A 4PP2B 1UATA 4LKXA 2P5EE 4UZGA 5DMKA 5F7AA 4OLXL 4U6TA 4NQED 4IBSA 2XIDA 4NAMA 3NSCA 3QIWC 1VKXA 1F2QA 3KEHA 4Q6IB 3HG1A 3REWA 4L9DA 2Y7NA 1FGVL 3TBYA 1AQDB 5EEXA 4GAAA 3KW8A 5ABDE 4IKLA 4KKCD 1UD5A 4OCLC 4KK5C 4NJAL 4XE5B 1QSED 2OL3L 5AUMB 4BE6A 1F4YL 4NIYE 3W9DB 4GKZB 4U0QB 5BO0D 3W56A 3HI6L 4MMZA 4CA4A 5CLXA 1CT8A 5TPWH 4MDIB 3I85A 5HVWA 3MRDB 3V8CA 5C08B 1MQKL 1P7KA 4QUOA 2K9UA 1B6UA 1S9YA 3K81A 3KPQB 4A38A 5JPMB 5GPRA 1KLUB 1I9JH 3SKUD 1IC5L 3FULA 3ZE0B 3IDXL 4OTXH 4YNYA 3BIAX 3HE6B 2P5WB 2FH6A 3IMSA 3C08L 3MV7E 1EEUA 1ORQA 2CPUA 2E9WA 5D1ZI 1XV8A 1KYAA 1BM3H 2GJ6E 4KXBA 1MCWW 1KDIA 4P4RB 3CZFA 2HKFH 4PJEE 4BFBD 1QBBA 2PYFB 1J87A 2QPUA 3NIFF 3FO2B 4H20L 3PUUA 4IS6A 3ZDYB 1S5HB 1UB6A 1AY1L 2AQRA 2R9HC 3UJIH 4OLUL 2GSMB 1T5WB 1IAOA 4BFNA 2XKNA 3EOBB 1BLNA 4JDZA 5DD0L 4GLRI 4NQQA 5EBWB 3JYBA 5EFIB 2NW3A 1VEMA 3FT2A 4AQ8A 4D9QE 4OZFG 4R26H 1NBVL 4LKXB 3QH3A 4B3VA 3S88L 2RCSH 1CGUA 1E65A 1LO5B 1C5CL 1UM4L 2GSIA 3HZMA 5HJGA 15C8H 3T9WA 2X2YA 5K9OB 4L5FH 4QCIB 4S1RL 1P6FA 4PD4J 3VFPA 5BO1L 4N0FA 4OCSH 3REWB 1NFIA 1RZJC 3I6KB 3FAXA 4FQXD 2AXHA 1T03H 2CBQA 3PGFL 4P46A 3QG7L 1PFCA 1MXDA 3K80A 1YEFH 1QA9A 4JHWH 4NLHA 4DIXA 4IBQA 1F3DH 2G2RB 4LU5L 4C59B 1YY8A 2YAPA 5CN3A 3OL2A 2G3NA 3ELAT 4G8GA 4PCYA 5EORH 1CT8B 1UJ3B 3QZNA 4IGBD 2JIXD 4UM8B 5J89A 4GP5B 3VFGH 5L8LB 1XWVA 4WI0A 1NMCC 1HX0A 1UKTA 3D48R 1AI1H 5F72S 3MLWH 3LZPA 2G4EA 4GRWH 2LV4A 3M46A 3ARGA 3M6DA 3OM3B 3O45B 4Y5YA 3LYRA 1ZHNB 4BCYA 4KNSA 4RETB 3SBWC 1H5BA 4XR8C 1ZTXL 2Y72A 3CC5B 2HH0H 2UZYB 3PQYA 5LG6A 5F7KC 1U93A 5CP3H 4PJBA 4BQ8A 4U4BA 5CZRA 1W8EA 1CFTB 4JKPL 4AV0A 4ZFZB 1CICA 1CIUA 5D96C 3WXWL 4NO3A 2F54E 3NIFE 4FQ1H 2Q2LA 3AROA 5FHBL 1DLHA 5GHWH 4CJ0A 2HG0A 3ETBJ 2GITA 3VFOA 2AHIA 5DJXA 2HWZL 4TTDD 4YXLL 5I1JL 2ZONA 4LLQA 1YYML 5EO0A 1HT6A 2H8PA 1MJUL 4U6YB 3SYPA 4GG6A 2HT3D 1PY9A 3O4OB 3MLPA 3QH3B 3IVKB 3HZMB 3ZBMA 3CLEL 2AC0A 2F8XC 2GSIB 3RNKA 1KENH 1M57B 2VW4A 1WFNA 3THMH 5I9QC 1NDGB 2APXA 2ADYA 2QKIC 3PS6A 1IAKA 1VGEL 1X6LA 3ARTA 5D55A 4KMTL 1A0QL 4R2GC 1PZAA 3UX9B 1QFUL 3QW9A 4FXKA 1BGXL 2VTFA 5I1KL 3G5WA 4U1MB 3L48A 1ZA6A 2CNZA 5I1GL 2BRQA 2OK0L 3DYPA 3CSGA 5D8JH 4YC2C 4BFKA 3DYOA 4GRWF 4YH6A 5E9NA 2V7HB 4G8GB 1KTBA 2ESVA 3ULVL 2M8XA 3U25A 4M43H 2VN4A 1CGVA 3ALXA 3VD7A 4BK4A 1UYWL 1RXLA 2KZ1B 1ADQA 2BCMA 4WWOA 1XEDA 3US9A 1HH9A 4OJAA 4Z3EA 5D6DA 2ZF8A 5C6PB 4IEFB 4RCAA 3BH8B 4Y16C 1FG2A 3AJ7A 4YHOL 4Z7IA 3PABA 4AG4L 5D5MF 3SKJH 4KBPA 4PRNA 3PQYB 2FHFA 1HH6B 2YPVL 3DJRA 3WELA 4PJBB 3FU5A 3UO1L 4C4KO 1NCHA 2I60H 4K7PX 3FQRA 3UBXG 3FCBA 1ZIAA 4F8TA 5EO1A 4F3FA 2AVFA 3ARBA 2YD5A 3ISWA 1ZK9A 2MKWA 3T77B 2QZ5A 5E8EB 4FDWA 3G6JA 1U6AL 4FD0A 3BP4B 1QLFB 2YAOA 3OKKA 4IBTA 1DLHB 3CVCA 1S7QB 5GZNA 3WNOA 4IBUA 4Q8BA 3W38A 4N28A 3T8MA 3BLBA 4L5FE 4KVNH 2KDGA 4LLQB 5CLTA 5EO0B 2UXVA 5EU4B 5J06A 1G43A 2R0ZL 1AG0A 3ARFA 4MDRA 2CXGA 3FT4A 5C07D 1NCBH 4XPHL 3WTYA 1OGSA 2WIIA 1DEDA 3WEXB 2K8MA 1ZV2A 3AG3B 3EBHA 2B8OT 3NABH 1A6VH 1XCTA 1NKRA 4PJFF 3UZEA 1KLFA 4TTGA 3C6SB 4TQEL 4ZNEA 4Z95L 4YSQA 3HLAA 3BIBX 4Z6AT 5DUPL 4NGHH 1ZA6B 4TLUA 4KTEH 5JOFB 5ITFA 3IDIB 1RZGA 4GRWE 2F7QA 4L3EB 3HKFA 5L7XL 1O0VA 2ESVB 4U6VH 3FRPG 3BZ4A 4OFIA 4ZUVB 5JIHA 2JLLA 3BAYA 3E6FA 4MJHA 4TKWA 4L4VA 5FR3A 5T5FA 2WVSA 2AJUL 1HH9B 1T21A 1JSYA 4FMKA 4QRRD 1E6JH 3I50H 1Q1JH 1A1NA 1CUOA 3AAZA 4KK9C 1PYWB 3OF6A 4WNQA 2B1HH 2Z4QB 2ZXQA 3FTZA 3QE5A 3PABB 1XTLA 3CUPB 4LCIH 3BOVA 4MVBD 4L1LA 3O2VH 1OCRB 5F7UA 3P4OA 1M6OA 1JF5A 1OTSD 3FQRB 5TGBA 1V3MA 4IBLT 3MV01 5JLZA 4FG6D 3A22A 2W0PA 3RFZC 3TH2T 1TITA 2HTLC 2J1ZA 4QLRA 2F68X 1U91B 3ESPA 8PAZA 2C4XA 3OX8A 1OB1B 1I1AA 1UOLA 2DQTL 2OMYB 1P5UC 1NCUA 3BAKA 4XCFH 4EN3A 3RY5A 3BSZH 3GMOB 2OTPA 2F53D 4CMHC 1X9LA 2CIKA 3FOMB 2WQUA 3QARA 4HWZA 1QSFE 4S11A 1XDTT 1I9JL 1FH5H 1TPXC 3WLWC 4BDVB 4PJFE 1KLFB 1CFBA 2WHVA 4AM0B 2KDYA 3ZZ1A 3BX7C 4OTXL 3M1CA 5ADOH 1DBJL 5DUJA 1XB6A 1OD7A 4PJHF 1Y18B 2XVLA 4PREA 1BP3B 1BM3L 4PLKD 2AJXH 5GGRY 1SN0A 1Q9OB 2CK0L 5ITFB 3PHAA 1RZGB 2W60A 1A8ZA 3L54A 5EZOL 1IKFH 1H3UA 3AREC 1BXVA 2EC8A 4G3YH 4LOUD 3BZ4B 1HCZA 2AK4E 2XTSA 4I0PC 4Q2ZB 2AV7A 3E6FB 1MREH 5IM7B 1FCGA 2FGWL 4JCMA 4P3CH 4BSVA 2P44B 4FA8A 5J1AA 4L4VB 1YDPA 3SOTA 1LE5A 2BRRL 1BYNA 4J6RH 5I0DA 3NYKA 3LY6A 1PY4A 1HCVA 5BV7L 2B4CL 3QXDA 4L5FL 3OAZK 2FLRT 1HJCA 4UOJA 1N68A 2OMZB 4OCSL 2Z7WA 3R7RA 2Z7ZA 1M6OB 3X1EA 1HDMA 2XSKA 4MA1B 1T03L 3DTXB 3I3DA 3WDJA 1LQBC 1T04B 4TULH 2V3EA 4AQZA 1UXWB 3WJJA 3WFHA 3I75A 4KROC 3L13A 3L7EB 5DQJB 4MMXB 4L2YA 1MCEA 1H3XA 5KUMA 3RURA 5EORL 4BFIB 2VN3A 2YSSA 2Z9TA 3FFCA 4K23L 3VFGL 3ZDZB 1FUNA 5C0BD 4BIKA 1AI1L 3TO4D 2ZOLB 2EADA 2BSED 5C0CB 4HEMA 1XCQB 3QNXA 4UQ3A 5GGRB 1TDQA 3E9TA 2OJZL 4JPIA 3F6JA 3TPUA 5ETUB 1OAQL 4L9LA 4ZG1A 2XBDA 1RPQA 2V7NA 3ZY7A 2FBRA 2ITFA 2VB5A 1CE6A 4PJHE 1LJMA 4XCNA 2DEWX 5CCGE 3FL7A 1XX9C 3GTVA 4MJJA 3VWJD 3F3HA 2GUYA 1A1OB 2XCMC 3QEQE 4FQ1L 4WI3A 2BFGA 3BXNA 2WXPA 1HXYB 2YGNA 1JPGA 2ZAIA 1EIBA 1KV7A 3OPUA 3TFKD 1IFHL 2CDGB 4GT7A 4KMLB 1Y6MR 2A2QT 4PJ5D 1XGQA 4I8DA 2CR0A 2NLJB 1LE5B 2VABA 4PY7B 4PBVC 2QADD 4MZIA 3EJPA 4M1CC 4W9IC 3THML 1OAXH 2H9GA 3QR0A 1XTMA 2P4AB 5ERWA 5FECA 4ZO8A 4X4MA 3WE1A 4JFUA 4RFNB 2NCEA 2ADGB 3CFBB 3QZWG 1TTUA 3KD4A 5I74B 5C0FA 4GUPA 2VERN 2XKSA 2YXMA 4JVWA 4OF8A 1PS3A 5D7KD 3GXIA 1OXYA 3MCYA 3VGAC 3T08A 4O51B 1S2EA 4TF4A 1ZJAA 1K8DA 3QIUB 5D8JL 4FCHA 3QUXA 5DEFB 1JUFA 3STZB 2QVFB 3TBSB 1AKJB 5FO7A 3MQIA 4IKKA 4M43L 2ZCKH 3SDDA 2MHAA 1S7TB 3CN3A 2K9FB 3OKNB 2FECL 2FWUA 5KYNA 1RERA 3KNBA 5CD3A 3MRPA 4W9EC 2JI3A 4NC0B 4K5LA 3UTSD 3MX0B 3PP3H 3QZWB 4YVUA 4DP5X 5ACZA 2EDRA 1OTUC 4TLKA 1F8TL 3BUQA 2HFFA 5TQ2L 4KTDL 3H42H 1XGZA 3NK4A 4ZYKA 4JO4H 3SHSA 4I2XB 4U4IA 3W57A 1KJVB 3V6BR 3A67H 3BKJH 1TZGH 2VLMD 3MUZ1 4OM0L 5C0EB 3RVTD 3L3JB 1AO7A 1PU0A 5L88L 2K7QA 2P7TA 1YPZA 5CSGA 5SWSE 4KVNL 1J8HD 4JGUA 1NGQH 1KT2A 3PLYA 1QRND 4G71B 1RU9H 3ESVF 3NQIA 4GXUM 2VABB 2AMUA 1NCBL 2H1PL 4I0KA 1IM9B 3ZRSA 3IGKA 2Y7SA 2H9GB 5GGQL 4WWKA 5FECB 4WHTB 4MA7L 3HG2A 1E2VA 4JFFA 4TUOA 4HK0A 4JY4B 4YAQB 4GBXD 4J3OH 2N7AA 1UWEH 1BPVA 1JPFA 1RULL 2YAMA 4JRYE 3R18A 1U8LB 1GSMA 5J13B 4N0UA 5KN5A 3EGSB 3B7RL 3EH4B 4NGHL 2W65B 1LYQA 3LHPL 4KTEL 3GXTA 4YS4A 3POCA 2EVIA 4FQQA 4JREC 2XDHA 3QUXB 4NNYA 3H9SE 3O3DA 3NTCH 3DKHA 4QEGA 4U6VL 3RUGF 2GTQA 5JOPD 3DA0A 5FGBC 3ALPA 3CMGA 2X0VA 2ZYSA 1I3VA 1U92A 2K45A 4X2UA 4HC1H 2ZX8A 5EPMA 5EU5B 3RE0A 1SHXA 5HGBA 4XCYB 5D7JB 3TCLA 3B9AA 1VB9A 3KYOB 1E6JL