3NYKA

The structure of cobalt-substituted pseudoazurin from alcaligenes faecalis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin
publication title The crystal structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nykA00
2BP0B 3OMNB 3WNIA 1ET8A 3ZX1A 1XB3A 1JZFA 1NTDA 1QLEB 5I6LA 1OE1A 3FU9A 2BO0A 1BYOA 3QJVB 1GS6X 1WAEA 1OV8A 1AS6A 5B1JA 2FQEA 4YSTA 1DYZA 3CG8A 1NIDA 3X1FA 5D4HA 3T6XA 1W6WA 2E86A 1L9SA 2B3IA 4HCIA 2YAOA 3SBQA 3SQRA 3V9EA 2TSBA 5EHFA 1KDIA 3NT0A 5B7FA 1E30A 3NP3A 1JERA 1CUOA 3KW8A 4UF7C 1T5KA 2XV2A 1BXVA 1TU2A 2ZXWB 3PCYA 5F7AA 3PPSA 3D12B 5AKRA 3UGEA 2IWFA 4A68A 4AX3A 3AG4B 3DKHA 2YXVA 1SDDA 3S3DB 3QJUB 5PAZA 5B7EA 3PAVA 3X2QB 1WA1X 4YVUA 2XYBA 1SF5A 4NERA 2GSMB 4BWUA 1JVOA 2UX6A 4DPAX 4E9QA 1BQKA 1PAZA 4A2EA 1PLBA 2QPDB 3HB3B 4DP8X 2HXAA 2IAAC 1PNCA 3T6ZA 3NSDA 5I6PA 2VW4A 2FQDA 2HZHA 2GI0A 3KW7A 3MBWB 3FU7B 3NJJA 1ET5A 3EF4A 4YSEA 2PPFA 1ETJA 1ASQA 2UX7A 3ABLB 2A3TA 4YSCA 2YAFA 1E5ZA 3GYRA 3X1NA 3PXLA 4DP1X 2DYRB 5AZUA 2QDWA 3DIVA 1GW0A 1NWOA 1ZDQA 1RKRA 4A2DA 1NICA 2R7EB 1J9RA 2IDSA 4KOBA 1M56B 3V9CA 5I6KA 2BW4A 1HAWA 1EHKB 1IC0A 4G72B 3CVCA 1CC3A 4AKPA 3FS9A 3NSCA 1EZLA 1NIAA 1AANA 3C75A 1OCCB 2Q9OA 2VN3A 3AZUA 3FSVA 4WKXA 2IDFA 2XWZA 4GXFA 1AZBA 3X1GA 1OCZB 1AIZA 2IWKA 2IH9A 3CDZA 1BAWA 3FPYA 3TBCA 1A4CA 1BEXA 2XLLA 2WO2B 4TXVB 4AI7A 3OQRA 2XU9A 1RZPA 3OD3A 3CVBA 4KO7A 4M4RB 1UATA 1AZNA 9PCYA 3CZUB 2J5WA 1FFTB 5I28A 1F56A 1J5CA 1NIFA 1YLBB 3NJHA 2CCWA 4QKTA 4CSPA 4DPCX 1NZRA 2BP8B 2GC4C 2MRYA 1XMEB 3GXUB 3EH3B 4W9ZA 1RZQA 1OF0A 2GHZA 3S8FB 4KO6A 1V54B 3UADA 3UAAA 4PCYA 4X4KA 3IN0A 3N2JA 1PZCA 2IDUA 4L0PB 4DP0X 2YXWA 4FA7B 1JOIA 2DWSA 1AS7A 1KCWA 2EIMB 4GP4B 4G7QB 1QHQA 3ABMB 1ID2A 1XB8A 2PPAA 2FWLB 3G5WA 4E9SA 1L9PA 1WA0X 3ZBMA 3QPKA 2BW5A 2GB2A 2DY2A 8PAZA 3SBPA 1PLAA 7PAZA 5LDUA 1AAJA 2J55A 2IDQA 2UXGA 3U25A 3FSWA 3NYKA 2VM3A 1HFUA 2HX8A 1RCYA 1L9QA 4BXSV 1ZIAA 2YAHA 4DP6X 4F2EA 1MZZA 2WO3B 1AZRA 1KBVA 3FYIB 4ENZA 1E5YA 2UXVA 1MG2C 2HRGA 2AVFA 1M9WA 5I6MA 4HAKA 1NPNA 1PMYA 2FQGA 2H47C 3PAUA 1V10A 5I6OA 1KGYE 2PLTA 3T6VA 1OE2A 1GSKA 4CSZA 3EH5B 1HAUA 3T6WA 2MTAA 4KNSA 3IBOA 4WTQA 3ERXA 3NSYA 2YQBA 4A67A 4AKOA 3EH4B 2XVBA 2J57A 3WIAA 2RACA 1FA4A 4YL4A 2W88A 1AR1B 5FC9A 1AQ8A 2LLNA 2FQFA 1KYAA 1WS8A 3S3BB 4W1TA 7PCYA 4DP5X 2EIKB 2IWEA 2GC7C 4Q8BA 2FNWA 2QPEB 2YAEA 4EF3A 1AS8A 1TKWA 4DP4X 3UABA 2VM4A 1KDJA 3X1BA 1CYXA 1PF3A 3OMIB 2H5UA 4YSSA 3NJFA 3PAZA 5B1KA 4QLWA 1FWXA 4RH4A 2OJ1A 1J9QA 2ZONA 4YVNA 1SHWA 3GDCA 4E9VA 2JXMA 3IE9A 2QDVA 1SDDB 5B1JC 2AZAA 1TEGA 4A2FA 4YSUA 1KBWA 2ZOOA 6PCYA 2OV0A 2XX0A 1TEFA 5AFAA 5PCYA 1JXDA 3AG2B 3TU6A 2FT6A 3IEAA 2YAMA 2BWIA 4GP8B 4HHGA 4BDVA 3QJQB 4G70B 1GR7A 3S3CB 4YSAA 1AOZA 3ZIYA 3SBRA 1AG0A 2BHFA 2H3XC 4KNTA 1OCOB 2XV3A 2X88A 1URIA 4YSPA 2DWTA 3S8GB 1GS8A 4K9JA 3MX0B 4A66A 4JKNA 1SFHA 2FTAA 2Y1AA 3UACA 1IBZA 2BP0A 2BWDA 4MFHA 1PZAA 3JT2A 4GY4A 1E65A 2VSKB 2W8CA 2EIJB 2X87A 3WI9A 3ABKB 3FT0A 1M57B 1ZPUA 3ASOB 1PCSA 1WA2X 4YSQA 2B08A 3FQ2A 4NAJA 3IN2A 1ET7A 2YARA 4DP7X 2Y69B 5I5IA 4DP9X 1GY1A 2FT8A 2J56A 4M3HA 5E9NA 3FSAA 5ANHA 2PP9A 1I53A 3CDZB 1AZCA 4G7SB 4Q89A 1NDTA 4HHWA 1PLCA 1E67A 1X9UA 2NRDA 5D4JA 5B1AB 1L9OA 2I7OA 5TK4A 3TBBA 2ZWNA 3QJSB 4G7RB 1JZEA 1VLXA 3NSFA 1JVLA 1BXUA 1KV7A 1ZDSA 2QT6A 1X9RA 3NJMA 2XUWA 3QJRB 1R1CA 2JKWA 4FAAB 5IY5B 3N55A 5B1BB 2TSAA 5D4IA 1N70A 4BXVA 2AFNA 1A4BA 3NJIA 3ABGA 1ZIBA 4HALA 4ZK8A 1NINA 3CVDA 4N8UA 2VW7A 1A65A 2FJSA 1J5DA 1NIBA 4E9TA 2N0MA 2PP7A 1AACA 1A8ZA 3WKQA 6PAZA 3BVDB 1OCRB 2DYSB 1JXGA 1JZIA 2YAQA 1SNRA 2PP8A 3FU7A 1SF3A 4BWWA 3JTBA 1L9RA 3TA4D 4G71B 2HRHA 3FQYA 2IH8A 2HX7A 2PPCA 3QJTB 2CUAA 1JZHA 4DP2X 1ASPA 3WNJA 3ASNB 1DZ0A 4E9XA 1AZUA 2R7EA 2P80A 3AW5A 1ILUA 4GP5B 3FYEB 3NP4A 4DPBX 2BZ7A 1MDAA 1KCBA 3AG3B 2PPDA 2GIMA 3HEIB 2P80D 1SFDA 2VMJA 1IKOP 1BQ5A 2CBPA 1GY2A 4JHUA 1NPJA 1IUZA 1GS7A 1MZYA 2DV6A 2I85A 5TK2A 5B7MA 5I6NA 1N68A 1JZJA 3NJNA 2UXTA 1ILSA 5I5MA 3WKPA 2FT7A 4AKQA 1MG3C 4A2HA 2XX1A 5A7EA 1B3IA 1PZBA 4UAHA 2HLEB 3FSZA 2YAPA 3FQ1A 1BXAA 2EINB 4KOCA 4HZ1A 3BQVA 1L9TA 4YSRA 4YSOA 2I7SA 1J9SA 3H4HA 3ZDWA 4E9RA 2EILB 1A3ZA 5I5JA 3H4FA 3AG1B 2JFCA 2OCCB 2WSDA 1QNIA 2BP8A 4HCGA 1IBYA 3H56A 3OMAB 1CYWA 4KO9A 4NB7A 1BQRA 1W8EA 1NWPA 2AZUA 4HCFA 3TASA 1BYPA 3FPXA 4PAZA 3T9WA 1ASOA 5F7BA 2PCFA 1A4AA 4UANA 4P5RA 1GYCA 2UXFA 3RYMA 3AY2A 3UAEA 2IDTA 1JXFA 2AANA 3QQXA 2XXFA 2PCYA 3FU8A 4E9WA 4HIPA 3L45A 1W6LA 2Q5BA 3NJKA 1PNDA 4BWTA 5B3SB 3T71A 1AG6A 1SHXA 2PPEA 1WS7A 3PLYA 2CJ3A 2VW6A 2XV0A 3DTUB 4JHVA 3X1EA 1ADWA 1JZGA 2GBAA 4A2GA 1J9TA 1ZV2A 4AZUA 4BK5C 1PY0A 2VSMB 4KNUA 2CALA 1NIEA 5I26A 2XXGA 1CURA 4F7KA 1V55B 2CAKA 2HX9A 4BDVB 3OM3B 3EHBB 3NJGA 4YSDA 3NJLA 4P5SA 4E9YA 3WG7B 1OOWA 1OE3A 1SJMA 4N4YB 2BZCA 4GYBA 4F2FA 1XB6A 4KO5A
chains in the Genus database with same CATH superfamily
2MEJB 3GSVB 3WCYA 3IXTA 2CHZA 3KYNB 3VMPA 1KY6A 1J1PL 5A2JH 1H5BB 3GK8H 4OTXH 4JG9A 3ULUE 1LP9A 1CL7L 3AS2A 3GLZA 5LCVA 3BXNB 5EEYA 2QQNL 5LGJA 1TT6A 4Y2DD 3D7PA 3Q2WA 2XWJB 4RBPH 3UTSA 4PJ8A 1QR1B 4K7PY 1AS6A 4ENEC 4YEFA 4LEOA 4N9GB 4ADIA 2VJ8A 4YHOL 5SWSB 1R5WA 1UT2A 4QNPE 2OYKA 4ZODA 2NXZC 5T1MA 1S5HB 3T6XA 2RFXB 1CZ8L 3GMPA 4HCIA 3HNTH 3V6ZB 4F8PA 4G1MA 5EHFA 2GSGB 4M6NL 3ZQWA 4CDGC 4HLJA 4PIRF 1FC2D 1OCWH 1T83A 4DNLA 2TAAA 5J6GA 1OHZA 3QJOA 4H25A 4MMZB 5KS9E 1KENH 5TE4L 1SEBA 3D12B 4LLDB 3AG4B 1KCVH 4O2FB 1YO4A 2AEQL 5D96C 1F2QA 4LPTA 2ZUQB 5EUKA 4IGBC 5BVPL 5TQ0H 2H32A 2X4SA 2EDLA 2XYBA 2XN9E 3CPLB 4HGWA 2CK0H 1KTLB 1IMHC 2UX6A 1FGNH 1IM3A 3MLVH 5C09E 1BQKA 1XL4A 1JGDA 3TYGL 3VXMA 3DV4B 3LN5A 3GIZH 3AT0A 3DJSA 3DRTB 4XBPB 3N5AA 4J4PD 5CLTA 1LO2L 2BPBA 2O1AA 3DPBA 1UWFA 3V8OA 4U1SB 2VABA 3AS0A 5FKAA 1UKQA 5D1QA 1I8IA 2VE6B 4L8BA 2H9GA 3BT2H 4GO9A 3APFA 3LEVH 1T03L 5F9DC 3CSGA 1VGKA 3SEPA 1KEGH 3BVXA 4DP1X 1JGEA 2CUMA 3FFDA 3LZQA 3MX0A 4OKVB 5K1VA 5B3JE 2NY6C 4PJXE 1P2CB 1OSPL 1BLNB 1NICA 2UUDK 5SWQA 2AF2A 2YFNA 5F72S 1Z9OA 2EC8A 4JFQB 4YPGB 1ZT1A 4FGMA 1IC5H 1HHGA 3NSCA 1F6AB 1DO6A 5E9DD 3W5MA 3FT9A 1E9OB 4HS3A 1O9VA 2E9GA 1YHPA 3N0PB 3RX7A 5HGHB 4QRSA 3VXUE 4F8NA 1K4CA 1KCSL 3NIFB 2J1YA 2JKXA 2KZ1B 3PHQA 5EZJB 5EULV 5FF6A 2CJTA 4IHOA 1F4XH 4IKKA 3ZVVA 4APQD 4AI7A 3OQRA 3OD3A 3RKDD 5LCVL 5IBUB 3AMKA 1RPUA 2FX9L 3OSKA 1GZQA 3B7TA 3BI9X 3V6OE 5I24A 1N7ML 5LBGA 1UXWA 4MB4A 2XJKA 4KTGA 4I4WB 4XNXH 2NT1A 4B9CA 4JO1L 5DWPA 2X1OA 1XMEB 2K7QA 3G5XB 2R1WA 3N85H 3WXVH 2RCSH 1RIUL 3I9GH 5E9DB 5GGRY 1KGCE 4YDZA 3R4RA 3BZDA 3FB6A 2CGZA 2R2BB 1MIML 4XN1A 4OCYL 4OIIH 4ERSH 1WBYB 3TL5A 4FKHA 5I76A 3IFOA 3KPNB 1NCOA 1P7QA 3JWNH 4G43B 2V5SA 2NZIA 2P8PA 3PWPB 3CUPB 5ICXB 3SJVA 4APQB 1FCGA 5I8KL 5CMAA 5T3XH 3QBTB 1BA9A 2DQIL 3GLEA 4G7VH 2CU9A 3U7YL 2Z4TA 4OCNC 1KPUB 4MX7B 2Q76B 5EC1A 4PRHA 1MLBB 2EZ0D 5A2CA 5E94B 5C6TL 3BPOC 1B0GA 3QHFL 2NY7L 3ZDXB 4N2OA 3TJHC 4OI7A 2EDTA 1NCHA 3U25A 3EYQD 1KELL 1BX2A 4JM2A 1MEXH 4ZNEA 4F7CA 3WAJA 4GQRA 1MNUL 3LEYL 3QFDB 1SY6A 5D6DC 1KYFA 1WWAX 2KS0A 2F8VA 4JUTA 4M8UA 1EFXA 2Z92B 5F7YC 2QVKA 4Z7UA 5CN2A 5I73B 3NCJH 4FP8L 5T3ZD 4BQ6A 1A6PA 3U2SA 1HX0A 3G6DH 4M5YH 3ZKXC 4KK5C 3RL2A 4U1KA 2DI7A 1TZIA 3MOAL 4QY8A 1Z5YD 1AGDB 3QUYC 4Y1SA 4OCMC 4BELD 2P5ED 4G8EB 3VD9A 1BZ8A 1LNUA 3MLUH 3FCSA 4HH9B 5FC9A 1AQ8A 4OB5H 1HZHH 4N9OB 1QSFD 4GG6E 2DTSA 1O5PA 3EIFA 5FCSH 1G7LB 4ODHH 1QASA 2X6CA 4QRRB 2J3SA 1LE9A 2WSPA 4HJGA 1FYHB 1DQJA 4F37K 5CD3A 3VTTA 5D1ZC 3CFKB 4JHAH 3NVQA 2O61A 3GEWB 2NMSA 4JCWA 1FZKA 2VUYA 4Z7WB 3NJFA 3FRUB 3R18A 4LHUA 1J1XH 1RJYB 4M43H 4R3SA 4DKEH 5I1HL 1EHLL 1GH7A 2EYSB 4DESA 4UT6H 5DK3A 1WFTA 3QZWG 2XIIA 5GXBB 4HXBH 3B2PA 4PJ8C 5KANG 1HQRA 1QSFB 5DVPA 3SDAD 2B4CH 3T0WA 3DIFB 5ALCL 1WBZB 1JPTH 2DTML 5AW6B 3SZ6A 3TNNA 1KBWA 4BSVA 1KTJA 3LOWA 5EU3B 4XPBH 6PCYA 3CX5J 4YMPA 1JNNL 1TEFA 1MCPL 1A4JA 4N0UE 3QDME 1MJUL 4DFHA 1UVQB 1KGXA 1A6UH 4C55A 4XNMA 2Z7ZA 4B7IA 4X7CC 2IGFH 1OANA 1T83C 2LU7A 2ICES 4FQHB 3PNWA 3D3VA 1YEEL 4YHZH 3TTSA 5CU5A 5KSVB 1IEBB 4XNYL 4M1GH 4ENED 1NL0L 4KNTA 1RVFH 5FO9A 4OH2A 1HXKA 2YN5A 3O9WA 4GOSA 3V5KA 3KNBB 1GS8A 2D2CC 2NXZD 4IOSA 4K9JA 2VB5A 2OMVB 4F33A 3W39A 2NY4B 3U0WH 1E65A 1QW9A 2Y7QA 3SDAB 3BZFB 5BRZE 4G82A 2DMCA 4LHQB 4KRPC 4GUOA 4E41A 1UGNA 4YSQA 3VD4A 4L5FL 4Z7NB 3KPSE 1P7HL 3RY6A 5JLZB 4P5TA 4NQCA 3VFSA 4DW2H 2O6EA 2FJHB 2D7TL 3VD3A 4TLUA 4OJDH 1PKOA 1DQQB 4BZ2H 5D1QC 5E9NA 2W9DH 4HSCX 43CAA 3F2LA 1Z3RA 1HOEA 1SN5A 2J2ZA 4XP4H 3MOQA 5KSBA 1SLWA 4IGBD 2Q87A 1NDTA 1XIWA 1BHGA 5E8PA 1CGWA 3LZOA 5DYOB 2FD6L 3QO1A 5BNXD 1X9UA 2NRDA 1IJNA 2HT3C 1SYVA 4FFZA 4FHJA 3BGFC 4N0YL 3LRKA 1T6WA 4KQ4L 2YPVA 4WFHD 3U1QA 4LPXA 5IM7B 1F41A 1QZ1A 3DTXB 2WSKA 4RAHA 1P7KA 4OUOA 1KV7A 2P49B 1MAML 1XX9C 3NJMA 4I0PA 1HCZA 2IXQA 3HI6H 4KROC 1R1CA 2Y7LA 4R9HA 4FAAB 3ESUF 5F9JB 4NN5C 3HHMA 4I2XA 2LAAA 5E2WL 2VYRE 1BGXL 5IUSA 1ZJAA 2W92A 4I1NB 1U8LA 4P3DA 1JGVL 5AAMA 3HG2A 1XVSA 2NY6D 5SV4A 5L7XH 1BF5A 1HEZB 2FJSA 1CFVH 3VACA 1X5HA 1PYWA 3MGTB 2YAQA 4WV1A 3O0RH 2JCCF 5C08E 1H19A 4X6CB 1F02I 4XP1H 3W1ZA 1AGFB 1MCLA 4DP2X 4N1HB 1DZ0A 1GYVA 1AZUA 3HZMA 5B8CA 4YDKH 4WHYG 5KOMC 1H15B 1WAAE 3LY6A 4LCUA 2W59A 1FV1A 4QI3A 4DSYA 1SMDA 4XC1L 3B34A 3IXAA 4TLTA 2X0UA 3REWA 3IE4A 2E46A 5CFAA 5D9SB 5J13C 4GKSB 5KVEE 3A23A 3NJNA 2UXTA 1T80A 1X44A 1JF1B 3O2VH 4QRAA 2GITA 4JBSA 1D5MA 4RGNE 1G9ML 2NCMA 3BD3A 1OK8A 2Y7NA 5EIIB 5H2BA 3KCPA 1OGAB 5A7EA 3GDBA 2KERA 2V2XB 4PD4J 2QGDA 2EINB 4AYMC 5HGDA 3V4LA 1NMAL 1GOHA 4JM2C 2XNAA 2CHNA 1U8OA 4LLWB 4B9YA 3QRGH 4GS7C 5KWYC 2K3HA 2B1AH 4PTUB 1QBAA 3KPRE 4HCGA 1W0WB 2VH5L 4UQ2A 1A8JH 4DK5A 2B8OT 4JR9H 3Q6GL 1E2ZA 4X8CA 2Y36L 4OIBA 1VADB 2GFBA 2KZWA 3C8KB 2AZUA 4DO6A 3QUMA 3QULA 4Y5VC 5HY9A 1KIPA 4G42A 3TJHD 3KXFD 5EOCL 2E8YA 2VDNL 5MEPB 2E6JA 1G7PB 2YPVL 3MRLA 2BVQB 4MNGA 5IUCA 3SD2A 3UYRH 3O3EA 2EDKA 2LVCA 1NM9A 3DGDA 3Q8AA 3OB0K 3DO3A 2Y6TE 2IBBA 1AO7D 5I15L 4L37A 2R15A 2C7FA 2YZ8A 1MF2L 1DBJH 3TNMA 5FOBB 1FORH 4KK5D 2GIYA 4QRTB 1NBZB 2N59A 2XV0A 3X1EA 1TENA 3H9HB 4C8XA 1U30A 4OLYH 4KGJA 2E74C 4JHWH 4OCXH 4PS4H 4N86A 1CGXA 3QUYD 4X7SH 4ZO9A 4G5ZL 3UDWA 1E5AA 1QP1A 2MIZA 3VA6A 2A6IA 2YBRA 1YUKB 3DYPA 3MNZA 3G6AB 4LVOC 1A1NA 2OZ4L 2DMKA 3BVUA 4WK4B 3KDMA 2DLHA 3M17B 3UG3A 2ODIA 3MRJB 4X5LA 5C0RL 2A83A 1QLRA 3D06A 4QJ5B 3NTCH 3M46A 4WJKB 5D7LB 2WZAA 3BSHA 3IDNA 1QYGH 4B9ZA 3CXFA 1G6RA 1UJ3A 5EORL 3BSZA 4JDZA 5D1ZD 2AGJH 1G7QB 3DX7B 3GBDA 3BDXA 1AE6H 4G2AA 2AV1A 4WNJA 3WOVA 3QO0A 4CDHA 2FB4H 4NOBA 5L2KA 2WO4A 4P23B 2BSDA 1RHHB 5E8OA 2PXYD 3PP4H 5FYJL 3UJJH 2FQEA 4KH2A 1LE5A 3G5VB 3HC4H 3KPMA 3LKQA 4XCCL 4ZSOE 1F4WL 1M3IA 3OAUL 4IU3B 3UTSD 3BPLC 3ALXA 1A25A 1CLYH 1L9SA 3CK0L 5HDBF 3RWFA 1GKEA 3MTXA 2ITCB 4WWPA 4RRPM 2PKDA 1G9MC 2H3NB 4F8LA 4PRPE 5J1AA 1KT2A 1BXVA 5D2NB 1UH2A 3UGUA 5D1ZB 3GUTB 4NOFA 5K93A 4HPYL 4HC1A 4P2YA 4YFEA 1FI8C 1MW1A 4FQ1L 2PXYB 1ZHKA 4PB0L 3RY6C 1CFBA 4P5TC 1I3RB 2A74A 5AVSB 4PRIA 2X09A 2OMUB 4R90L 1F3JB 5F88B 1JZ2A 2QBWA 4MJID 2VDKH 1L4IA 3T1WA 4XBEH 3NIDE 1QR4A 2OMTA 1T2QL 2AK4E 1OP3H 5CM1A 1XIWC 2QPDB 4XVOA 4X6FB 2YUVA 2VSCA 3LH8A 5EWIL 5K59E 1IM3D 4KRPD 1TFHA 4S0SD 2WXJA 3VWKD 3S97C 2G75B 1UEMA 1T22A 4YSCA 2JKTM 3HNVL 2HG5B 1S7TB 1S7QB 4I0PC 2GYSA 4Z7QE 1R34A 1ZDQA 4OM1H 1RZ7L 2YD9A 1J9RA 3HZ3A 4IU2B 1CT8B 2M2DA 2WQVA 5AAMC 1QUNA 3FUHA 4HJ0C 2F58L 4MD4A 4GQZA 4MJIB 1ZTMA 4XZUA 1CR9H 3HBQA 1T1YA 3SY6A 1C7SA 3OR7A 5E4OA 2OJEA 5D70L 2IDFA 2OR9H 4WV1C 2J12B 1OCZB 2OMXA 2VLJB 3RWGA 3VB8A 4F1SA 5CGMA 1J12A 4KRPB 1G6RL 3MJ9A 4KVCL 1EHAA 1FGVH 3VWKB 2WO2B 2R0KH 2WMPA 1RZPA 2IFFH 3CVBA 5H94A 3U6RA 5B8CC 1HILA 5DZJA 2ODHA 1R3LB 4P57A 2G30A 4QDGA 2EICA 3BAEL 4QCIA 1YYCA 4UDTB 1IGYA 3HI1B 3TBWA 1C12B 1JNLL 3ME0A 5KS9F 3GSNH 3CQQA 3BGFB 4RX4A 2UWEE 1OF0A 3RDJA 1MFUA 2E6QA 3BEVB 4KVPA 1AHKA 3S4SG 2XQYG 1JWMB 2W9LA 4NO5A 1PZCA 3FT4B 1Z9MA 4LU5H 3KLAB 4HUXB 1Q0YH 2XZAL 1RJLA 3V7MA 4AL8L 1CDIA 3SE9L 1S9XB 4HC1L 4PP2A 2BNQB 4LIQL 1WUZA 2JB5L 1SUJA 2JJUA 2Y25A 5A7BA 3QPKA 2BW5A 4BHUI 1KJVB 2M8XA 3GLAA 2CD0A 2HRPH 1P7QD 3SJVD 5DD0H 4AGPA 4WAFA 4NT6B 5SX5H 4JGNA 1DBAH 3MR9A 2EKSB 4TVPE 1CE6B 4JFWA 1A6AA 2OXGA 3BKYL 1MFEH 1NM4A 2DB8A 1NEZB 4PRHD 3DVGA 1PIGA 4PJXF 4QOKE 1MZZA 4QWWC 1UCBH 4DP6X 2RQEA 2XWDA 1MG2C 1T66C 4HK0A 4JM2D 1R47A 2DJUA 5EOQL 5JDSA 3GPEA 2B2XL 5J12C 4S0HA 4PU2A 1O75A 4M61B 3CFDA 1I3GH 4OJFH 4JE0A 1FC1A 3LN4B 1EFXD 1W0YT 2WQXA 1O7DC 1BBJA 4X5QA 1C5CL 5E2UH 3T6WA 3LB6C 1XD0A 5F8RC 1RZ8A 4R2GC 4BJLA 2VLKA 1OTUC 2PR4L 4HCRA 3CCHB 1ZTXH 2PO6A 4Z0BL 4QTIL 5AWNL 3KR3H 1XGUB 1KWGA 1A9EB 3CDGA 2HFFB 4UYPA 2EDRA 3SCMC 3UDWC 3APNA 3HOGA 5CSGA 2WLJA 4JM0A 1AD0A 2ERJB 4NNPH 4J1UB 1NMCB 3MJ9L 1JF6A 1MFDL 3PQYE 4NGHH 4ONOA 4XXDA 4KRMB 1D5ZB 2BVUA 4MKTA 1A6ZA 1UT1A 3LS4H 3WY3A 1CF8L 4UQIM 4RLDA 2DD8H 1E90A 4EXKA 3N04A 3KLKA 5IVXF 3W2DH 4UQDA 3UAFA 4K9EL 1M7DA 1UJ3C 5GGVL 4M9PA 2VUKA 4JREC 4JRXE 4Y5VB 4EUPH 3LPPA 4MWFA 3WUWG 4GSDH 1T89A 2XCMC 4LCWA 1TF4A 2WXIA 3BAIA 1VPOL 1XGQB 3MA9H 3NGBB 4LHUD 5DJAB 2EVFA 4CBPA 5EO0A 2VDMH 4JFZH 4WCYH 1OM3H 5GZND 2XG4A 2XKNB 4X0KB 2EE9A 4A7GA 5BV7H 1D3CA 3H3PL 3RAJH 2L04A 1IL1B 1OAXL 3CSFA 5FO8A 1K2DB 3Q44A 3JQOB 4KBPA 5KYWB 3A6BH 3V0HA 4ZXBA 1MAJA 4A39A 3L9YA 1MCQA 1I8MA 2Q6WA 2QZQA 5IOPB 1EPFA 4NENA 4TQIA 1SOKA 4PJ7A 4AL8C 5DQDH 4BHUA 2YS4A 4FFYL 4N2GA 4EEEA 3F64A 5FM5M 3EBAA 2WZPA 2VLRE 5BJTB 5FHBL 3D3VD 1N3NB 3GWJA 3V0WL 3OZ9L 5E2JA 3F7PC 4HS6A 2A74C 5M7QA 1QLFB 2UZXA 1YQVH 4MAUH 5DMYA 1JAEA 2QADB 2VC2B 5GISL 5M95B 4HP5A 4WO4B 1IBBA 4IOSD 3VXQB 1XR8A 4BUGA 2C9PA 5DR5H 2WBWB 3ASOB 1FVCB 4UNVA 3R1GH 1AGCB 2FX8H 1DVSA 5E4EB 3DXAA 4S1QL 1NANI 5I1EL 1SLVA 4IRZA 2EVIA 4E41D 5EN3A 1NBQA 1E4JA 2PP9A 2A77L 4HCRL 5CP7B 5CUSH 2NYKA 3PREA 2J8UF 4NQCD 3ZUCA 3W3BA 3BPCA 3V0EA 3FMGL 1R4XA 3HC0B 4MJJA 1NGPH 4JFPB 4XC3L 2PYFB 1EA9C 1E8WA 5GS0L 1SMAA 1TO4A 4G1EB 4MB3A 1M2VA 5B1AB 2R9HC 2GJRA 3CJJA 3WNKA 3N40P 1XIWD 3LQZA 3O45A 4H20H 1TTCA 4HEME 3EFDL 4LO9A 3DGCR 4PSPA 4UT9H 2VR5A 1T6VN 3NSFA 4YEEA 4ZJ9A 2AJSH 2D0HA 2C4FT 3DK0A 4DEWA 5TD4A 1AJ7L 3OXSB 4H8QA 3V4UH 2C9XA 4GSXA 4RAUA 5ERWA 3VFOA 5L2JA 3DYOA 3VRJB 2NW3B 2EIZA 4I0PD 4U4IA 4U1GC 1YEDB 2VW7A 3CZJA 3VI4A 5FO2A 3TS8A 1A8ZA 3R0NA 2FEJA 3WKQA 3AFLA 4HIXL 4OGAC 4LSRH 4WO0A 3SB3A 4PR5B 2FSDA 2JIXD 3WDHA 2W60B 1JDCA 1XGTA 5DJYA 1ORSB 5HHPB 4K9EC 4L29A 3U1SL 1IQDB 4AUYA 1HHJA 2IH8A 4PJDE 3EDKA 1QI5A 4UI2A 4HJSA 4JFFE 4ZPTB 3STLB 4AG4H 3LPGA 1MHPH 2IH3A 3OR6B 5E6YA 1NBYB 2VDNB 5TDNA 3CHRA 4OZHF 1OGSA 1I7ZB 4HULB 5KVFL 3MO1A 1Y1UA 1HIMH 1BOYA 3F5WA 4R97C 3MV7A 5JUEL 4NAQA 1TETH 3NIGF 5CJQH 4CVXA 2P52A 3BISA 4PCTA 3SE3C 4GRWB 3TYFB 4AZ8B 1SYSB 3VFPB 1FFQA 1L5GA 1NUNB 4P9MH 3ZRSA 3A0OA 1ZKAA 1A5FL 1KB5A 2K78A 2VZVA 4GG8A 1Z3GH 4WGWB 2BDNL 2XX1A 2JIXB 5HYJB 4NLAA 4Z0XA 3GM8A 1DL7L 3G6JE 5C71A 1M1SA 4PS7A 2F8IA 5EZPA 5CCJA 4UIMB 4OJEH 3WS6A 1BEYH 3MV9E 2TRYA 1KJ3H 3WKYA 3FCUB 4R4BA 3FT3A 3FO9A 3MRMA 2PWEA 4B9GA 4N5EC 3MKKA 2F54A 3HS0A 3EYVB 3KPOB 3CLFH 4KTDH 1HOCA 3EYOA 4KMQA 3H4FA 5AAPA 4IRZL 2KDYA 1J1OL 1MRDL 3OAYK 3JWOH 4G59C 1V5JA 5GZOC 3VXPA 3L7EB 3I6LD 4KHTL 3OMAB 4LOEA 3QXDB 2A6JB 2VDOB 3FO1A 4JAMB 1OT2A 3RWHB 3O3BB 3QCTH 4G9DA 3CN4A 4OCSH 4EIBA 4QRPE 4HUKB 4ZOEA 5JHBA 3MYZA 3IT8D 1A4AA 1A7OH 1ZVHA 3FT1A 4UANA 1GYCA 3TH3T 1AIFA 2UXFA 5JA8B 3DUUA 4QWWD 4XVJL 4GQPH 2CWRA 5F96L 2IANB 4E9WA 3BW9B 5JMRA 3EG9A 1T66D 1NUDA 2X4RA 3F84A 4M6OH 1VACB 3TBSB 3PV7A 2ZCLL 5GS0C 4N0FA 4TNVF 1KOAA 1WAPA 1PNDA 2YPLB 3NJKA 2XZQL 1UXMA 4MD5A 3NCFB 1JPFA 3FTVA 3ZE0B 4TNEA 4ZRGA 4FEMA 3DTUB 4UNIA 1MQ8A 4JFDE 4YGVB 4MBRA 3LB6D 2Q7AA 4R2GD 4M7LH 1I1FA 3V52L 4A2GA 1OTUD 4U1IB 3MROA 5CBEA 4S1SL 3E3QC 2VSMB 3UC0L 3LEXB 1D5IL 3V0IA 5I26A 3WTVA 4J12A 1ZHLA 3F7KA 5IB2A 4FTVE 3QNYB 3DX6A 3SCMD 3L54A 3OM3B 2PWGA 4X0NA 3K6SB 3BKCH 1XCQB 3QDJA 3ZKMC 1LK3L 5F6HJ 2M83A 1Y6KR 1IILE 2G4GA 2BRQA 4WHCA 4DKFL 5JNYB 2XWTB 1A02N 1E4KA 3NPSC 1TYRA 1XB6A 1K8DA 3FT2A 3G3LA 3WTUA 4UQEA 3LH9A 1HVXA 4WNQA 1DE4B 3QH3A 2EACA 2W07A 4KKLC 1JZFA 4R2GB 4OZGB 1HDMA 4LKCA 1XGZA 2D9CA 3C60B 5JO5B 1BVKB 1KB5L 4WUKH 4ZXBC 4YHNB 4L3CA 1MWAH 2EEXA 5L2KD 3AU1B 4JG1L 2CDEB 4LLUB 2CLVB 1JK8A 3R0MA 4LF3A 1SDYA 3SCMB 5KYXB 5H4ZA 5KG9A 1AC0A 3ARSA 3FTZA 4KX7A 1ACYH 4J6IA 4B50A 2HN7A 1IGCH 4YDJA 5IBTL 4NRYB 1MI5D 2ZP0T 4A6YL 4MLSA 5DJXB 4Z5RB 2E5EA 1EAJA 1UWXK 4KJYB 3FQWA 2C4FU 1PX3A 4UF7C 3IDXL 2YUXA 4FQJL 4JPVL 5TTRA 1HJCA 2OSWA 5EFIA 4UM9B 1ACCA 1X5XA 1OY3B 3ISRA 4Y5XA 4ZFZA 1O6VA 4J3OH 3F12A 1YEHL 4AEHL 2OX5B 5IFHL 2ZNXA 1CBVL 1S7VB 4JREB 2XWBA 2H45A 1U8QA 2COVD 3WL9A 1SF5A 4UUJB 2EECA 4GKOA 4RRPA 3QNFA 2ZUXA 4G6KH 5JHLA 1TQCB 1NFDE 4FABH 4PRID 3LPWA 3WO4C 3VYNA 3LAFA 4P59L 3FTXA 3MBWB 3LDBC 1MI5B 3FU7B 3O2WL 3QEQE 5D2LE 5ADPH 4M00A 4M4PA 1I7TA 4KZEL 2ATPA 2C9QA 3V4PA 3PYCA 1PZ5B 1MREH 3BEWB 4NNYB 4PJAB 2ZX8A 1C08A 3BKJH 3GIVA 2Z93B 2QDWA 5AZUA 1KF9B 3BFOA 5SWZA 3DJ9A 4NZRH 4RIRB 1OARH 2AQRA 4TSCH 3GBNH 1CFSA 4JY4A 4N8VG 4UILH 3UBXG 1XTLA 3PNRB 5C3IA 4FFWC 2AQ3A 1FPTH 2FATH 4UB0H 1TTUA 3T8XA 3KEDA 4Z3EA 4W9KC 1ZMYA 4M5TA 5F6IB 2DWDA 5C0AA 1X7QB 4AKPA 1Q72L 1NGXA 3PIQA 3Q2LA 1BMWA 2R9HD 1TPXC 1TTGA 2C26A 3EYSH 5L4MA 1FDLH 2YGVA 1UH4A 1YDPA 3LYRA 4M29A 4WI0B 5FW6A 1RURL 2WCGA 2XWZA 1HK6A 1OAUL 2Z31A 2IADA 3CDZA 3IWVA 1N5AB 5BS0A 2YFOA 3HAEH 4N2EA 1I9JL 4ZYKB 3C5XA 3UBHA 4XO5A 4PREA 2G9HA 4L8DA 1QUPA 5EEVA 1KGUA 3LVEA 2BSCA 4JFEB 4KO7A 1L9MA 4WTZA 5TGBA 1A7PL 1QQDA 3SHSA 5DYFA 1MCWW 1NIFA 3FAWA 3O4LA 3V0VB 4OGAD 1T5WA 1CFQB 3F04A 2FJGA 3HZKB 3U4BH 1G4MA 3IDYB 5CJOH 3WJMA 5BO1L 3SQBA 2ZOKA 3VE0A 1SM3L 2ZSWA 1F6FB 2KH2B 5FUZH 1J5IA 4BH8A 1YMMB 3ARFB 2JCCA 2VQ1A 3TT3H 3CN1A 3MHZA 2P28B 1U8MB 3WMSA 2E7DA 1ZT7A 4XE5B 4C54A 4PJIF 4RMWA 3VNZA 1QATA 1JMZA 2PW2A 3WS6C 4MHHG 5EBLB 4C83A 3WIHH 1R3JB 1OSYA 5BQ7A 3HS0C 4ORZC 3WYRA 3WY1A 4H8PA 5BOJA 4RFOH 1CGSH 4PJBB 3Q8CA 4PVMA 2X38A 5DJDA 2RMNA 4R6UA 3RTQB 4O9HH 1NC2B 4XNZC 3JTSB 3NJXA 1GGCL 1IFGA 5JHLL 1QEWB 1G1CA 3NQIA 4NIYE 1ZIAA 2D0GA 1UZ8B 3MA7A 1DDHB 1ZVSA 4Z7QF 5D7SL 5DHVA 3RDTC 3F85A 1A3QA 2Y3NA 1BCIA 5HGAB 3EW3B 1UM6H 5BXFA 2A4CA 4P2OA 3I85A 4M5SA 1D9KA 3GXTA 4N5ED 1EGJL 2WJ5A 1HQ4A 4X98B 3V4PL 4KY1L 1QFWH 2AQTA 3P30H 4WY7H 3SDXE 4RZCA 5E51A 5EDXA 5AZEL 4R97B 3QNZB 5GZOD 3BD4A 3RHWF 1N0LB 3CXDH 3EH5B 2QR0B 1G7MA 2OA9A 4NQVA 3RBSA 4LT7A 5D7KD 4JW3A 3HRZB 3QB7C 4WTQA 1TYEB 1NCBH 2DLTA 3MMEA 3OKKA 1V3LA 1PX4A 2ROXA 1T5XB 2XTJE 3GSQB 3TBYB 3EJJX 5FXCH 4JPIB 4X4YB 5BPPA 5FECB 3DHUA 5A16B 4W1TA 4NZ8A 5F7DA 1PZ2A 3NRPA 4WWKC 2Y7OA 3D6GA 1KBGH 4GBXA 4F2MA 4EF3A 1IEAA 2QSCL 3P4LA 5GS0D 4M1CC 1OWWA 2C3GA 2QFRA 5GJSH 4KPHL 2VM4A 5F7EH 3LQMA 1CGYA 4XX1E 5IHWA 1PF3A 2AS5M 2YMOA 3APCA 2BP3A 4Z78B 5EOTB 3GO1L 3DVIA 3H6JA 5IROA 2EO7A 5AKTA 4YC2C 1DUZB 2R29H 3BX7C 4LQ1A 4U1LB 3BN3B 3REVB 4C56E 5C2BH 4I1RA 1FWXA 3OGCA 3WEXA 3B4NA 2CR6A 5EZIH 5EG6C 3GB7A 4D9RD 2VDQH 5CEZL 3H55A 5DI8B 4CN4A 3IE9A 2EDEA 1XCXA 2Y3AA 2VXTL 4QHNA 5DRWA 3ZKMD 3BH9A 3GMMA 2J4WH 1VZGA 1TEGA 1WFMA 4IJ3C 1MFAH 4LCWD 2I9TA 2YK1H 3L5XL 5CZKA 4XCEA 4P2AA 1JV5B 4XB3A 1HWWA 1KEMH 3VGGA 4XNQB 4LFHG 3ZHKA 4AQ1C 2PYEA 2NNFA 1A1MA 3CZNA 4GO6B 4ZFOB 4IEFA 5IT2L 5DJ8A 2DF3A 3I2CH 1DP0A 4GP8B 4KKLD 1JTTA 5EU5A 1GHFH 1A3RH 3FO2A 3WEMA 1TQWA 5I8EA 5IESH 3QZWB 2ZJSH 3CX5K 4ODSL 5CZXC 1OF2B 1OCOB 4X7FC 3V9FA 4YHYC 1R3KB 2BOCB 3GEFA 4XVSH 3JYBA 1J8KA 4YSPA 1F00I 5CSBA 5FCUL 2XC8A 1L0QA 1P4BH 1L7TL 4D8PB 2FTAA 4P9HH 4F58L 2P7TB 3BSGA 3TWCL 3QWOB 1DEEA 1DQDH 35C8L 3JT2A 3MCYA 3VXOB 4ZX3A 1L3NA 3ZL4L 4G8GE 1MHEB 3NABL 4XO3A 3KGTA 2A73A 4HX1B 3S34H 1T7ZA 3CMOL 2FLRT 2YD7A 3HCVB 1YMHB 1YEIL 2Y69B 3GJFK 4FERA 3KM2A 3L9RA 1B6DA 3BZ4B 1IM9B 1MOEA 1AKJA 2WUBH 3TV3L 1S7WA 1LD9B 1NCJA 3S88L 1WWBX 3DXAD 4WZ9A 4JFTA 2OW7A 1QVOB 3EDJA 4Q4IA 4ZMAT 2NX5E 1WSST 3RGVC 3HG1A 3KYKH 3O2DL 4N2IA 3CV5A 3VG9B 3OKLA 4OGXH 4LZKA 2MNJB 2X9WA 5J9PB 3D2UB 5JHDB 1WZ1H 2V3EA 3MREA 2EYRB 5T3ZH 4XGZB 1FYTA 1EDQA 4XMVA 3EBIA 4L1SA 4G83A 4JQIA 3DX1A 4L3EE 5IEHA 4DN4H 2K6ZA 1N59B 3DUSA 4LRIC 4BXVA 1BFOA 2FL5A 1EAPA 4OT1L 2Z31C 3QI9A 2ZPKH 1NINA 5D1XC 4JGJA 1A65A 1IC1A 2ZYIA 4FFWD 3EJYC 6TAAA 3BVDB 2O6FA 4JFHE 4TULH 5JYMA 1EXGA 3P11L 3S5YA 1T6BX 1Z2KA 4L4TD 5LNEA 5CP3H 3ZSTA 3P2TA 3JTBA 2GAZA 3S37L 3ZTDC 3M1BB 2HRHA 5DMGC 1XF4A 1RH8A 1GYAA 1ONQB 1OPGL 2XFXA 4UV4H 4EVNB 12E8L 4GRLA 3SGKA 2JK5B 3DI3B 4XMLL 4IW4C 3D4YA 4PV1C 4HA1A 2B14A 4EQ2A 1BM3H 5GSVA 1VGEL 3T3PE 1N19A 4OFQA 1QMUA 1YA5A 2V37A 2GIMA 3HEIB 1UJTA 2QPUA 2I9LA 3VXRE 3QDAA 1EJ6A 4MS8C 3N6YA 2ZX6A 3VG0H 4X6BB 4ZMVA 3MV7D 4DOHE 3K72B 3QJHB 3MPCA 4LVEA 1T1XA 4EMZA 4NBYB 1Y6MR 1C16A 3PU7A 3D48R 4L4TB 5I8OL 1AR1C 5E5RB 1TPXB 5GRZA 2Q10A 3GSWB 3FQ1A 3DSNA 2GT9A 4P99A 1OOAA 2A9MH 1IBDA 5KS9A 3D05A 2BFVH 3ES6B 3G5YA 4F91B 4U1MA 5AOMA 4CILA 5HXMA 5J1TC 1KC5H 1IAKA 2WXKA 1U6AH 3V5DB 3OZLA 2JFCA 2VDLL 4HKZB 5HGBA 1D9KC 2V7NA 1WC7B 2MJWA 4PD4K 3MUZ1 1AD9A 2F54D 3AXIA 3P2DA 2XN9A 4ZUTA 1TZOA 2HKHH 4TQ8A 4CNIB 5SWSE 3TEWA 2FO1A 4X8JA 5C09A 2YEZA 1HC1A 4IRSA 3E1F1 2EO9A 2W9EL 3S36L 2Y2TA 3WHXB 1YYMH 4PGBA 3DOIA 1UD2A 2OI9C 3E0GA 2X3AA 4H4NA 3RDTD 2AANA 1AMYA 1R3IL 3B6SB 3DSFL 3UBXI 1W6LA 1FQ9C 1N9PA 1OQOA 3BJLA 4JQIL 4L2LA 2Y2YA 5LO7A 1U8KB 4EI5B 5HPMB 4Q9QH 1TQSA 3W9EA 4L0YA 4PJXA 4BWTA 5LAXB 5TE7L 1Z5HA 3ULVE 4AXWB 4PJDF 1M3JA 3PLYA 1YN6A 4ELDA 1ADWA 4A6YB 3KPPB 1BXXA 3CZSA 4JGUA 4ABUA 3D34A 3TH2T 3X14A 4TSAL 1O5DT 2CA4A 2CHDA 4XWGH 3ZMRA 4Y19B 1NIEA 3QHTC 2FK9A 3PJSB 3VXUA 2VZ3A 5IROC 5JTWA 3ZKQD 4AV4A 4H88L 2ICEA 4WWKD 3RDTB 4BSJA 1QEXA 3VJ6A 3U0TA 1KIUB 4JANB 2V3FA 2BNRB 4LDCA 4M1CD 1MCHA 4YBLB 5GRJH 4MZ3A 1AQKH 3V6OA 3LS5L 3QDJD 2BP0B 3OMNB 1T04B 3KLLA 1I3UA 4DN3L 3DA0A 5C0FB 1XB3A 3UJIH 3MCLL 5TDOA 5I6LA 3EAKA 1GS6X 2B9BA 3P9MA 1HS6A 2CBOA 1TMQA 3EFFA 3LKPB 3O6LH 2IOIA 3ZTJH 5LG6A 2APXA 4HT1H 5CEYA 3A67H 2O5YH 4GAFB 1D5BB 3T3MB 4OLVH 3O8XD 4J2QA 4WWKB 2K4AA 4NZTL 3TZVD 1GYWA 3CGTA 3PY9A 1ZWIB 1UACH 3ML9A 3E6FB 3D51A 3NP3A 5LGHL 1QO3B 4ZW5A 4R4NC 5MI0B 2G0KA 2Z0UA 4HUUB 2PF6A 1CI3M 4WRLA 1A0QH 4Y5YB 3FH7A 4XCYB 2WNXA 2WQWA 4RVBA 3UMNA 2AHIA 1PSKL 1NBCA 3MQIA 4MXWL 3HA0A 1W8OA 1ZHNB 3FB7A 4P8QA 4K3EL 1J1PH 1XR9B 5CZXD 5T1LA 3US9A 4AEFA 1XF2A 4YK4C 5AYTA 4AYDC 2P8MA 2QQNH 4AC2A 1GIGL 3DJTA 5E9DE 1OW0A 3L3HB 4G8IA 1FNFA 4YO0B 1VDGA 4E9QA 1HJBC 5AW0B 1G87A 3LD8B 3ZYZA 3O8XB 2KKQA 2FHBA 3TZVB 2WKLA 2WANA 4JDEB 3CDYA 1Y0LB 4N8VA 3PE9A 3FC8A 1I1YB 3PWPE 1DANT 1HKLL 1N8ZB 5MEQA 4AQ1B 4LNRB 5CIPB 3UTQA 1NGQL 3J27A 1RIHL 3PDOA 1TCRB 5DHYA 5DQ9A 5C0CB 3P69A 2BS8A 5TE4H 1YY9C 3LRSA 4NO0A 3SKMA 1FSKC 2DM7A 1DZBA 4JLRB 2W0PA 2DJMA 3FCTB 4U33A 4AGLA 3E38A 4YHYB 4GG6A 5B1CA 4IOIB 3RGVD 2ZF9A 3QI9C 2X3BA 3QFJB 4BV1A 1CC3A 3QR0A 1E2VA 1NMBL 3GMLA 3CFEA 5IBLC 4AWJC 3ATAA 4ZUSA 5BVPH 2W95A 4PRDA 5IIEB 2F74A 3MLTB 3KWUA 1KYOJ 4I18B 2XN1A 1KXTA 4WEMB 1BFVL 3TYGH 4F7MB 2GCYA 5BUAA 1D7CA 1LO2H 3LQAH 2OQJB 2OP4L 3QHZL 4GW1A 2K3TA 1PG7L 4H7VA 2XVKA 2HFGH 1U95A 4GRLC 1NAML 3SGKC 3X3FL 4AYSA 3HR5A 4KH9A 2QEJA 2Z31D 4ZMWA 4D0DA 5D1XD 5BS0D 1T03H 3MGOA 5K9QG 4KWUA 4ZMPA 2XQ0A 3EJYD 3GMQB 3QXAA 3K71A 3PWLB 3BGMB 4QHLB 1OSPH 2NLJB 3RGVB 1GOGA 1ZANL 5IR1B 1HHKB 2GHZA 3O4LD 5FDYA 2NY2B 3RPBA 4DHLA 3BFWA 2NTSP 1SXCA 2O6PA 5ECJE 3VI3B 4N0UA 2HB0A 3QDMA 2Z4QA 4OFKA 5GRWA 2F5AL 1E0OB 2AV7B 1WD9A 3DX8A 3K0WA 4HUVA 5T3ZE 1KACB 2EDXA 3EZJB 1HXYB 5E70A 3RWIB 4AJ0A 1KCSH 5CEZD 1F11A 1AZVA 3ILQC 2RTTA 5I71C 1XF5A 2X6UA 1JI2A 4EPSA 4Z7WE 1MN4A 5CNHA 3WNNA 5FB8A 4MDJB 2DY2A 5D1XB 3Q8FA 4ISVB 4CVZB 5JORB 4ODBD 2P5EE 5E8EA 3OX8A 5LCVH 1PLAA 2FX9H 3CFJA 4AYID 4U6YB 2J55A 2A0LC 4QXTA 2R8SL 3POHA 4KI5E 1AR1D 5BRZA 4QAWA 1QSFE 5DVNA 3S4SB 4L4JA 4IMKA 4BSWB 3ZSSA 5KYUB 2C7UB 3WLWC 1HN1A 4JO1H 1H9DA 4KKRA 1QW8A 2N4IA 4Z76B 4L3AA 3KPSA 1YY8A 3M1OA 3O3AB 1XH2A 5IK3A 1XSIA 4OV6F 4PGCB 1CD0A 5I6MA 4FYQA 4S2SB 4NZJA 1NFKA 2QQLL 2KPNA 4V1DD 3VGAC 5I6OA 1NGZB 5IJVA 2BVOB 1D9KD 4KDVA 1GSKA 4DGYL 2CJUL 1FL5A 1WK0A 1WBXB 3HFML 4B9IA 5D7IB 2Y5TB 4Q56A 1ZLUH 5DDHA 2VKXA 1N6QL 2GHWB 2EYTB 5I8KH 2DQIH 1FVEA 3U7YH 3WIAA 4P2QD 2HMIC 2Y06L 1GZPA 4K7FA 3U9UA 2XBZA 4BH7B 2H32H 1AR1B 5C6TH 3C9NB 4XB7A 3QUXA 5FR3A 1QWUA 1KELH 1N2RB 2AP2A 5IB1A 3ZT7A 3IKCA 2FNWA 4KKAC 4XCNB 3UP1A 1KLUA 2A6DA 1ZY9A 2YAEA 5E8DL 4Z7NE 1MNUH 4F37F 1ITCA 3LEYH 3TP4A 5IMKB 1K72A 4D9QD 3FTWA 5J8OA 3TEXA 2ICEC 3QA3A 3IMVA 4V1DB 3GSXA 1F5WA 2R1XA 4ZPVB 3UPRB 3OHXB 3KS0J 5A2IH 4FP8H 5KYYB 4JFOA 3BESR 2VL5A 1LQSR 5C08A 1WWWX 2AERT 3JSSA 3R06B 3RQ3A 3V6OC 5B4MC 4WHTA 5J11B 3TO2A 4AYBA 3MOAH 3MODL 4P2QB 1ZV9A 2OJ1A 4RH4A 3VXNB 5IROD 1XFPA 2YWZA 1J0YA 4NPJA 3L1OL 2HUEA 2EDQA 3GDCA 2WINB 2A9CA 4HW6A 2V2TA 3PWNA 1K9TA 2Z91A 1SDDB 2OTUB 4LBEA 1WAAA 1KIQA 4TRPL 4R7LA 3CFQA 2HJFB 3HE6A 2ZF8A 2ZP9A 1MCWM 1Q9KA 4GXUN 5F89A 3U82B 1COBA 3B5GA 5TE6L 1T7YA 1JXDA 1PLGL 1WE5A 1DANU 5DTFB 3TJEH 5DZVA 2YZ1A 3ALPA 5E2VL 1S5IL 4MA3B 1HKFA 4HGKC 3F01A 3WUWB 1LEIB 3T2PA 2PYED 3OXRB 3HMXH 1VA9A 1GAFH 1MVUA 5DZNA 1LDSA 3OWRA 4MQTB 1E4XI 1URIA 5E56A 1GSMA 3FSOA 4A2LA 1R46A 2DQFA 3F58H 4X6CE 4EN3A 5I1HH 3FQNB 3A21A 4JKNA 2QVTA 2Y1AA 4IOFC 3HPLB 2B16A 4WEUD 2VIRB 4AYEC 2Y2WA 3ABKB 3GQFA 1PFCA 3KPRA 4JFXB 1DQTA 3CLEH 1OW0C 3L3OC 4FLOA 4H8HA 4P2RA 4YDLC 1PCSA 1OSZB 1OP5H 4D0BB 3TJPA 4J6RH 5ALCH 1ET7A 3DETC 2DTMH 4G80A 4XMKL 2R69L 4EJ1C 5IG7A 5TDPB 5I5IA 1MJJB 2FT8A 1JNNH 2ZX5A 5GGUB 1MCPH 2ADFL 4FJZA 1CE1H 2K8QA 2VL4A 3RUGB 2I26N 3BIBX 3T08A 5F3HA 4RFEB 1RQ5A 4QRQA 2CBTA 4JGMA 4HKBA 4I0CC 4XNYH 7CGTA 1ZHBA 1ZS2A 1NL0H 1O6SB 3EFOA 4HZLB 5CLZA 5AG8A 1CYGA 4MCZB 2ZWNA 1KCRH 1VLXA 1Z9SB 1HI6B 5IB4A 1I7UA 1H6FA 3HG1D 3QC6X 1ND0B 1AHWC 1ZDSA 3HE7A 5DD6A 1JV2B 3L2LA 4LSSH 4MDIA 4NWTL 5CSZA 4DKAA 2XUWA 1C5DA 1MKFA 1KCVL 4AE1A 4NO2A 1U93A 4XP6L 3BP7A 4PGEB 4UOW1 4KQ3L 1A4BA 2JJSA 4L5FH 1EUTA 4MA1B 5JOEA 3C6LB 3HC3H 5IKCB 2AXFA 2BOBB 5HDBB 1SGKA 1FGNL 3GSRA 1AGEA 1YY9D 3MLVL 2AKRB 2BHUA 2D7TH 1WF5A 1L3WA 4OKDA 4ELKA 1AACA 1T2XA 1J0ZA 5E0FA 4Y9BA 2IIJA 1OCRB 1FNGB 3MNVA 4GQQA 3QI9D 4Q97A 4TVUA 4HJEA 2LFGA 3KGSA 4QR7A 3IB4A 4HIQA 5IBLD 3IXTB 1X4ZA 3UZEC 3P9LB 5GS1B 2C3WA 4JL1A 2FD6H 2HX7A 3HKFA 3SGDI 4AV0A 3LEVL 1LGVA 2OCJA 1KEGL 4J5VA 2P8LB 2D9QB 4YHML 4KMTL 1A4KB 1SVZA 5FFLA 5AB0A 3AW5A 3QWRA 2BSBA 5TPWL 4B97A 5KVEL 1MAMH 4GRLD 4Y8AA 4QYAA 5FA3A 5HJ3B 4OFYD 1U8PB 2ARWA 4KMLB 2BCKB 3AG3B 5AD0A 3AMLA 3IFPB 5AENA 1AHMA 3IJHB 3QORD 3WDJA 4ZSOA 2Q86B 1BF2A 5E1IA 4A55A 1FSKB 5DMIL 1JGVH 1XXDC 3ULAB 3CMGA 3FTGB 3DVFA 1V3KA 3SKUD 5J1SC 5BZZA 4B3EA 4PSRA 1M7IA 3D39B 2DEWX 4H8VA 4DVRL 5JQIB 1CFNB 2VC2H 3I9AA 5D7LE 1N5YL 1VZHA 4C4UA 4ZTEA 3D85D 3SO3C 3CFMA 1P6WA 2DQDL 1MFVA 4WQOA 4EO5A 3AY4A 3O6ML 4EDWL 1EBPA 4LCYB 5EBGA 3ILQD 5ID1A 2OCCB 5JR1H 2BP8A 4LLAA 1IBYA 1CD8A 1ZCRA 3H56A 3MRFB 5FGSA 3UL4A 4TLSA 1ED3B 3QEHA 4UT6A 3IAPA 5EU6B 5LWYL 1BD2D 3QORB 1TVBB 3RNQA 5E5MB 2RCSL 4IS6A 4NB7A 3FQRB 1D7DA 4XC1H 2AK4A 1U3ZA 2CKNA 4QTHB 4J7RA 4Q2ZA 2A0LD 2J88L 2XN9D 4MQ7B 4NBXB 2OULB 1QFHA 4P5RA 1B9ZA 4HGMA 2F9BT 3WLWD 5C09D 4AT6A 1ZGLA 1MVYA 5HHXL 2CR3A 1G9MH 4PWJA 3D85B 3TCLB 1HL5A 3GSOB 2D4DA 2FDBP 3QUXC 5D2NE 2ZYHA 1ZT1B 4OZFG 5LQBL 4I8DA 3DMMA 3IRZA 4UIKL 2A9NL 1NMAH 4XP5L 2UV3A 2UY7B 5H37H 1AG6A 5ESAB 5C0GA 1KV3A 1DJZA 4G6ML 4NQED 4PWFA 5C1MB 1BD2B 1MCFA 1J9TA 4F8OA 4ZO7A 3HKZA 5D6CA 2HMID 3FUKA 5DHDA 2Y36H 3UTSE 4F7KA 4Y16A 3T3PF 3WO3B 4B9JA 1OHQA 4N90D 3L2MA 4N2HA 2KUTA 4ECNA 2QGCA 4XH2B 5EOCH 3NCJL 2VDNH 1CGVA 4KKAD 1ZA6A 5FYKH 3RFRA 1A22B 2YPVH 3LRLA 3VXUD 3G6DL 4M5YL 1HZKA 2WIMA 5AAWA 3ZE2B 4FQQB 2AABL 3L5WB 3V8CA 1Q1JL 5EN2A 2R1YB 4X5XB 4BZ2A 5L4FA 1R3HA 5BZWB 1SUHA 4NUGH 5DHEA 2X41A 4GRWH 3MLUL 3GMOB 3EYUL 3PGCA 4LCCB 4CU6A 1MF2H 1CLVA 1G5AA 4NQEB 3GGWB 4OB5L 5B4MD 3HZYA 1JFHA 3QZMA 4MJIE 2YMXH 1L6XA 3ESOA 4YXLL 1E4XL 3IFOB 3K74B 1TVDA 5I1AA 1R33A 4CL7A 3EHBC 4RGNC 2P8PB 4P05A 2SODB 2YBGA 5ESQA 5AW7B 5IJCC 3ZTEA 3GMNA 2OZ4H 3KHOA 2IPKB 3WAKA 3KZ8A 1F42A 1KDIA 4J3WA 5TH2B 4DGIL 2DDQL 4JHAL 4EN3C 5FPIA 2FBJL 1SVBA 1B0GB 1HH9B 4M03A 3H9SA 1RUML 3HZVA 3MBXL 1TU2A 4DKEL 2VDOH 5D55A 4Z8FL 4IBWA 2HRLA 3RGBA 4F7CB 2IWFA 4AX3A 3SBWA 4ZDHB 3DKHA 3W0WB 4JRYB 1FZMB 2ZOLB 3FQUB 3GXPA 4Y8DC 1WA1X 4IDJL 4QOKA 4UMGA 1NAMB 2A4ZA 5DXWA 2EH8L 2HP4A 4PLOB 4AEIL 3ULVF 3BD5A 1JN6A 1GJWA 5E00B 1PU0A 3ROOB 2B5IC 4IOFD 3L4XA 4Y4HA 4EKXA 2IFGA 1RUAL 4JKLA 4N22A 4XCCH 3OAUH 5IVXB 3NCYS 2BJML 4ODWB 3NCMA 3CK0H 5A2LH 4AGMA 1TZHB 1UA6H 3T77B 1ZLDA 4ZS7H 2BNQE 3DETD 4RA0C 4F24A 4YHZL 1S7UB 7TAAA 3QS3A 2WIIA 2A3TA 4M1GL 5JW4R 2Z7UA 3HE7C 3BP6B 1Q9LA 3OLGA 5FGBA 3QIUB 4JQXC 3KPQA 1DVQA 1NUGA 4OCWH 4HPYH 2DH2A 1ECZA 4FQ1H 3Q9PA 4PB0H 4RMBA 4CKVX 3F7QA 4WK2B 1AFVH 5DJ6B 1KBKA 5JOFA 4DVBA 3RIFK 2HVJA 3NFNA 4WWNA 2PCPA 4R90H 3PQYA 3VRLF 2MPVA 1GRWA 1F6LL 2IPUK 3W9DB 5K5YA 5INCB 2AXGA 1XHHA 2G9KA 1AIZA 3L3OB 1SJEA 3VU1A 3BUYA 3LPOA 3S5LG 2A9AA 4BZ2L 1N18A 2V0AA 1FN4A 1ADQL 3UAJA 2WLMA 1XH3B 4JRXA 3HR6A 3NIFF 2NNAB 3U46A 2C3VA 3UBXB 3G08A 4QEGA 4WGKA 1AQDA 3I6GA 3LX9A 1W2KT 3CH1B 4XX1G 4OVUA 2XN0A 1ZE3C 3EF7A 4OAWB 3HNVH 5KSUB 1R0AL 4MRBA 3RJDA 2WCSA 4MNQB 4EAEA 1DQLL 1RZ7H 1XAKA 4GKZA 4K71C 4PRHE 2V9QA 2GC4C 4ZOCA 2OBGA 3O0LA 2W0FB 1FL6A 1UD4A 5I8CB 3VD2A 3F7YB 2FH8A 2F58H 1UOLA 5IW3A 3G04A 2RIKA 3DBXB 2IDUA 1AHWB 4JFUA 2NY5L 2K6YA 1VEOA 5D70H 43C9B 2PCFB 2J8UB 5LNGA 4B3VA 1JOIA 1T1WB 1KCWA 3TIDA 3L3KA 4PG9A 1G6RH 2BSSB 2ZXEB 4TVPL 4UDUA 1ID2A 1XB8A 3UEQA 3HBPA 1L9PA 3IPFA 4H0GA 2VLRA 3AY4C 1IGIL 1XF3A 2EDJA 4XPAL 3SKNB 3FQXA 3K1KC 1FFNB 5J4MA 2JKNA 2WZ6A 4TM9A 4UQ3A 4HU2A 3H0TA 2IDQA 5CWSA 3GMRA 1KGWA 3FSWA 5IW1B 5DQJB 4W9HC 4ANWA 4X5WB 1MCRA 1JNLH 2X4QB 4Q6IA 4FKEA 1EXUA 3ZDXF 2KLSA 2N0KA 1RZKH 4X6EB 1WT5A 2J2ZB 2YD5A 1G9NL 2AJ3B 2FQGA 3T0XA 4A2MA 3KPSD 3QO1B 5A1AA 3MRQA 2XQYK 1D6EA 1TZGL 2XZAH 2D7MA 2B77A 4AL8H 1HWGB 3T2OA 1SMOA 3PWJA 4YHKL 4N87A 3ZR5A 3A4EA 3SE9H 4N24A 4LIQH 2JB5H 3NSYA 2PETA 4NPYA 2YQBA 4W9CC 4DJMA 4HEMA 3ARGB 3T0DA 4DUWA 3C8DA 2W80C 4OZHB 1KYAA 2FQFA 2O6CA 3HN5A 3QRGL 1RERA 7PCYA 3FOLB 2B1AL 2EIKB 3WENA 3BKYH 3SO3B 4Q8BA 3QJFB 3NIGB 4ONHB 3VQ2C 3EGDA 4AM0Q 3QUXD 1TTRA 4NO3A 1TVHA 1CD1B 4JR9L 2UY6A 4S1RL 3TLRA 1UB5B 4FXKA 2CMRL 5EOQH 5AAWC 3ZO0A 1CYXA 3D1MC 4B6ZA 4HIEA 2K6WA 3AREA 3IVKA 3B9DA 2R0LL 2H5UA 2WTRA 5C70A 1OXYA 3T65A 1BV8A 1BPLB 4FE9A 4LASL 4XWOD 5FGRA 5F9AC 4TQEH 1C5CH 1CLCA 1E40A 1PQZA 3CXHJ 3D3VE 3LVTA 4PJDA 1T0NB 3RI5K 1J9QA 4JFFA 1H0DB 2PR4H 4Z7WF 2FO4A 1E8YA 4YOKA 5FLVA 3M7OA 5FO7A 3WUZA 3ZZ1A 4QTIH 4XPGL 5CGYC 1SJXA 5E7BA 5AWNH 3REWB 1BAFL 1JGLL 1KLGA 5F7LB 4LFHD 1FG2A 5ITFA 4KI5F 3W5NA 2ADYA 3HMWH 4X7SL 3MJ9H 3KCPB 3G7TA 4A1RA 2BWIA 5FV1L 5F7NC 2UZYA 1CF8H 2NY5C 1GR7A 2VO5A 4LLMA 4HWZB 1FVDB 3G6JA 5DFAA 2V7HB 2YD0A 3E9UA 4K9EH 2BSTA 3K6IA 5GGVH 3MV9A 1DQKA 4RGND 3SBWC 5KSBE 3CSTA 2V5MA 1I3VA 1FJ1B 4JZJB 3H3BC 2LR4A 2MMXA 2Z8SA 3BC9A 3GBEA 4UQ2B 3D2TA 3I02A 1VPOH 3C6SA 3OKOB 4FMKA 4URTB 2YD1A 5FYKE 3FT0A 4EN3D 3BYYA 3TO4A 5JIIA 2DWEA 4PTTA 3IJEB 5K69A 4Y4HC 1WA2X 4GUCA 4P49A 2ARJB 1FZJA 4AYFA 3H85A 3V79C 2DM3A 2Q2EB 1J5OL 1YG9A 4HDIB 2DQEL 3H3PH 5I74B 1ZK9A 1HESA 2H8PA 4QRPA 5GGSA 3PFQA 1OAXH 4P2RD 5CJBA 2NQ3A 4GRWE 4HFUL 1ZS8A 3SKOA 1YPZF 2MOVA 1G9NC 1INEH 4F9PC 3THML 2WP3T 4DEPB 1BBDL 3V5HB 3D0LA 2WW8A 5FGBC 4LVHC 4QO1A 4FFYH 3AS3A 2YOAA 3CFBB 1U4EA 3VCLB 1FHNA 1KMGA 1PZDA 3QDGB 5FHBH 3L1GA 1BZ7A 2VR4A 3V0WH 2APTA 4PRBB 4Y7OC 3QUZC 3Q3GB 3RY5A 4JFDA 1XO8A 2VXUL 4DQOH 5GISH 4BQBA 3F6JA 1DVXA 4WI9A 2TSAA 1QFWM 4EN2A 3HE7D 3QQDB 4KKCC 4MGXA 4PY7A 1ZXQA 4EOWL 2Q20A 4XMUA 5I1EH 4FTVA 5I0XA 4J27A 3UAJC 5JPNC 3L7FB 4RNRA 2OPCA 3P2BA 1TDQA 3RX5A 2A77H 4HCRH 4QF1A 4RMVA 4J8RA 2YSSA 1EDHA 3FOMA 1L9RA 1NH6A 2IANE 3I74A 2AV1B 3FMGH 3WU1A 3QO0B 1WICA 2VWEC 3KYMB 4ILDA 4XC3H 3AITA 2WXHA 4JMNA 4UQAA 4X80L 5GS0H 5E9AA 3L5IA 3MGAA 2YPLE 5DJ2A 8FABA 1JYVA 1CICA 3EFDH 3T6QC 3MLXH 1A2YB 2HSIA 2R7EA 4OM1L 4TMPA 4ZMXA 3ZE0E 2C9SA 4GQ9L 3NP4A 4AK1A 4U7SA 4FADA 5FUCC 1A7RL 3I6LE 3ZQ9A 3BYTA 2BS71 4AMKH 4JFYA 1AJ7H 4UU9B 1YCSA 3ECBB 3S7GA 5KEZA 4PGDA 5FYKU 1SFDA 5ID0B 1IKOP 1M9SA 2DWXA 2ITDA 3QWRD 3IK2A 2LE9A 4ZQKA 2MCG1 1CR9L 3P0GB 4DEUA 3UZQB 3MV8D 2VDPL 4NZFA 3ETBF 2V3DA 5BUGA 2OR9L 1Z9PA 3GKZA 4E0RB 5FEBA 4N3UA 1UM5H 1A6VL 4O2EB 5IQNA 4BK4A 5FWRA 7FABL 4ZS6C 3PHSA 3T0EC 3GS0A 1U3HA 1L9TA 4NUPA 4YSRA 3U1SH 3TA3A 2I7SA 4BFIB 1LEGB 3WJLA 1NCDL 4JY6B 4Q6IC 2WBKA 1DJSA 1EFQA 1O7DE 3CVHB 4LKXA 5CEXB 1WT5C 3BVVA 1SJVA 1NJ9A 1JIBA 5IBUG 4NQSA 4OZGE 4YLCA 5KVFH 1IAIM 1NGYB 1V05A 3NCBB 3WTSA 3KPTA 3MV8B 4DGUA 1NFDA 5HHMD 1WUNT 5I0VA 3T2NL 2ZKMX 4OZFA 5I0ZA 2E9BA 3QEQA 5D2LA 2AK4D 1LEKA 1A5FH 2BDNH 3DRQB 4ZO8A 3BAYA 2P5WB 4BGDA 4H5SA 1DL7H 3L45A 2EC9T 5H35B 5A3IC 2VR3A 1FL3A 2X4PB 3KPLB 4R0LB 4KHXL 4Z77A 4NC0B 1T3FB 3Q06A 2HRPL 3DROA 4Y4FB 5DUBA 1ERNA 4Q9BA 3VTAA 2AQQA 3HC2A 1WS7A 4D0CB 2ATKB 3QIWA 2Q8AL 2HWZL 5E08H 1BJ1J 3BT0A 4IRZH 4Y2OA 1J1OH 1MRDH 4OFIA 5B38B 3UH8A 4FXKC 4KHTH 2Q1EA 2BVEA 2P24A 1U8IB 2OKMA 4PJIB 5DZAA 1P84K 3UZVA 1MFBH 5F1IA 3BP5A 3NJGA 1REIA 2HVKA 4JJ5A 3RWDB 3TBVA 1CXHA 3D08A 4F57H 1MI5E 4F15C 3EYFA 2GK0B 2ZUVA 2I32A 3R8BB 1GMIA 1OE3A 1SJMA 4QCIB 5F96H 1KTRL 4IBTA 5I9QC 4NXKA 5E2UL 4PJAE 4U6XB 5BCAA 4KO5A 5JW3H 3BDBA 3TFKC 3MLSL 4ZX6A 1JP5A 2L3BA 2VDRB 4LB8A 3X12A 2Z1PA 2NYZA 4J3BA 5SX4H 3FL7A 1OE1A 1MRFL 3FKUS 1FZOA 2JQZA 2H26A 4LIQE 2OXHA 4UT9A 4UCFA 5F3BA 3L3GB 4U3XA 1VCAA 3FQTA 1P5VA 3O81A 4KZ0A 4S1SH 3RWEB 5HYQA 2WLNA 3UC0H 4I89A 1D5IH 1O9WA 1W6WA 2YGPA 2B3IA 1RK0A 3H2QA 4WHYH 5CGYD 1DLFH 3CC5A 2VCOA 2IV8A 4CC1A 2JKIS 1FLTX 2DD8L 4E42B 4TTGA 3J07A 2L7JA 4XVUC 5B7FA 2PWHA 4ZO6A 2E7CA 4OZ4A 4RISL 2OXGB 1KN4H 1KPRB 4JFEE 3SGJA 3T4AC 1MHHA 3UYPB 4DKFH 5LXGL 1E28A 4MAZA 2PNDA 3H9SD 1WHOA 4FA6A 2XY1A 3O6KL 1Z9NA 1E3ZA 1NCCL 3QYCA 4TVPD 3G9VA 4WW2A 5CLXA 4CKQA 1TG8A 1R17A 4LAJH 3DX9A 2HAZA 1JXJA 5DJ0A 1I7RA 1YMME 3HB3B 4H26B 3IPEA 1IEHA 5JW4Q 3SDXA 2VW4A 2FQDA 2VLKB 3P73B 1QSVA 3FRPG 4XCFL 1DTUA 4Y4HD 1EVTC 5IBTH 4HF5H 4A6YH 1GGBH 1P1ZB 3PPEA 5I75C 3MBEA 3IDXH 4PJBE 4FQJH 4JPVH 4XP9H 4DZBB 5ICZB 1NANH 4E68A 4HAGA 3Q01A 3L6FB 5G4OA 5I6KA 1BQHB 1YEHH 3Q6FA 1YQVL 4MAUL 1UD5A 3CVCA 5IFHH 3VFVA 1CBVH 2G3NA 2FJUB 5EPMB 5JQ6H 4Y9GA 2BSRB 3K5SA 3QQ4A 1G7IB 5K9JH 4LNVA 1A1OA 4EIGB 1HEJC 2P1YA 1PZUB 3QUZD 3U2IA 4GXUM 4JFSA 3E2HC 3GRWA 4W9LC 1U3JA 3DHJA 3FPYA 4P59H 1HHIA 4RAVA 2DQUL 3O2WH 1S9WB 2C1PA 4C56A 4KKCD 1RUPL 4KZEH 1NOFA 1CICC 1CQYA 1KYOK 3GZKA 4ZFFB 1I8KA 4G6AC 1Y07A 3AB0C 3NJHA 3UAJD 5IEKB 4H20L 5D7EA 2VZSA 2VITB 4UT9L 2DYPB 5ITBL 3MFGB 4PJ9B 4M7JL 3MRIA 4PBDA 4FQLL 1G0YR 5CAYB 1BECA 5DRZA 1Q9WB 2WVUA 3MRCB 4X4KA 2Q8BH 4R5VA 2FRGP 4GKNB 1TCMA 4CJ1A 4CSTA 2HTLC 4U1HB 4PRNB 3MCKB 2YIHA 4XPFL 4L0PB 3QUZB 4IKJA 1TJGH 5CR8A 4AJWA 4KZDL 1U8HB 4FA7B 4QHUA 2EC9U 2B1OA 1EDYA 1BVNP 1IVLA 3V10A 1N10A 1JD7A 2EIMB 1OAUH 1QHQA 4HLZG 2ZCHL 1UD6A 3VXSD 5DJCB 1T0MA 4ZUVA 3TA3C 4X6DF 1I9JH 32C2B 2XBDA 4WKZB 3X13A 3WJLC 1BZ9A 2F53B 2VXSL 3NEEA 5HSFA 3N1PC 3HJEA 5JPNB 5ICYB 3AABA 3RNKB 5DEZA 1A7PH 3JWNG 4ADGA 5KYNA 3DVNB 4AG4L 2YD2A 4X8GA 2ADJA 4G8GA 4O02L 3B3IA 2EE3A 3LJ3A 4P46A 3MRNA 4FX5A 4CAGA 4ZS6D 5DSCA 1AZRA 2H0EA 1UOKA 3IDJB 3T0ED 1WGVA 4OLZL 1DUYA 3MUGB 1VSCA 5CIPH 4PW3A 4EI0A 1SM3H 3UXFA 1TETL 5CJQL 4YNYB 3MFFB 5DK0A 4WHDA 3VXSB 3SZKC 2NY0B 5AB9A 1MJ8L 5BVJA 3E3QE 2R2EA 1ORQB 2VJXA 3IM1A 4B95C 5IJKA 5AZ2L 3RWJA 3IJ8A 4ZAKD 1QACA 1BEYL 2CO6A 3BVNA 5CKGA 5C0IA 3MSPA 3WE6B 4U05A 5ETUA 4K5LA 4BUQA 1WLHA 3EGSA 5HYSA 4L3EA 1GGCH 2X6AA 4FI6A 3WLBB 3ZT5A 5JHLH 3P4MA 3EJCA 3T0EB 3EO1A 5AOLA 5HI3C 3D07A 3JWOL 3GRWL 5DS8B 5A3ID 3Q9QA 2JJVA 5I5RA 3UPCA 4ZMQA 1OAZL 1ZA3A 3FFCB 3PABB 1NDMA 1UASA 4IRJA 1HL4A 1S9VA 5DMKB 2WTPA 1EGJH 5DHMC 5I17A 1ZSDB 3V4PH 2BXYA 5HDWA 5K9OB 4KY1H 1OB1B 4HBCL 2DAVA 1J05B 4U1NB 4LL1A 4ZFQA 4U1JA 2D7OA 2BVYA 4K4KA 2V5TA 3BWUF 3C5SA 1U36A 4ZAKB 5F3FA 1MRCL 2VERA 3QAQA 4AV5A 5JHDE 2BIPA 1UXSA 3N0AA 5EDSA 1QFWI 2I60H 3OJVC 4XRCB 4JFFD 5JXEA 1TQBC 2Z0BA 3HJ0A 4G11A 1LILA 1NSNH 3IAGC 4L23A 2HPTA 1BDYA 3PWVB 2JB6B 1U92B 3NK3A 4Y1AA 5KSAA 5JZ7C 4M7LL 5I82A 3VXRA 4DIXA 3NA4A 5ACZB 2AQ1A 2YPKA 3TFKD 2F2HA 2WKGA 2C9RA 1II4E 4X9HA 5DFTA 4W6YB 1XEUA 1HHHA 1CLOH 3L48A 3QNXB 3QZOA 2RGSA 2Y7SA 1MXGA 2BIHA 4KPHH 2AAAA 3ARDA 5EU4A 3UROR 5I66B 3KL0A 3SBRA 2YO3A 2BHFA 3GO1H 4XOAA 3BKCL 1GPOH 2X88A 1FO0B 1UYWL 3PUUA 4PYGA 1ML0A 2BSEA 5DO2C 3R7QA 2O72A 2H2SC 4Z7OF 1IQWH 2BWDA 3GSVA 1PZAA 4MFHA 5DD5L 1YEGL 4QGTA 3KYNA 4KJWC 4WW2C 3AWGA 1H5BA 3MV9D 4NN7C 2YGOA 3BXNA 3DNKA 4XVUD 1RUKH 2VXTH 2CO1A 2XWJA 3UTTB 1QR1A 3TIEB 1H8NA 3HLKA 3IN2A 3MJ8B 4N9GA 5SWSA 2K7PA 4WUKL 3VM7A 3OAWA 1S5HA 3L9EA 2RFXA 3FSAA 1T0OA 1NOAA 2FGWL 5IV2B 5IT2H 4E36A 4RESB 4L4TE 5EIQA 2GSGA 3VMOA 3MVSA 3EOBB 5GSRB 2H2PD 3BIKB 2NW2B 3LNFA 4ODSH 3MAWA 5CXPA 4O2CB 3U7AA 3NZ8B 1IIIA 1IIKA 4MMZA 1IX2A 5FCUH 4LLDA 1JVLA 2LAGB 5DHVH 1L7TH 5B39G 4LOVA 3TWCH 4O2FA 1IAII 35C8H 1D5XB 3IRPX 3ZL4H 3WIHA 1YEKL 4I9WD 3OL2A 4XMXA 2BOLA 1PKQB 3NABH 3T4AB 1RJZB 3CPLA 1X9QA 3X11B 2LTQB 5I2IB 4P4KC 1KTLA 3CMOH 3LXUX 4HALA 3JWOC 4JFDD 1E9PB 1YEIH 4U0QB 3DV4A 4XBPA 5AVQB 3DRTA 4FG6C 5T1KB 4V33A 4HJTA 1EEYB 4U1SA 3VWJB 2NOYA 3S88H 2PP8A 3RRQA 2VE6A 1Z1WA 4FTVD 3ZHLA 3QAZC 3ISWA 4M7ZB 3G9AB 3O2DH 1S46A 5DZ9A 1Y18B 4OKVA 1P2CA 2X9YA 5E6ZA 4KXBA 1BLNA 4RQQB 1QHOA 3DO4A 4TSCL 4YPGA 4JFQA 1UFGA 2F54E 2N3JA 5GGVY 5K39B 1CICD 1CLZL 1F6AA 1RZJH 2Z7WA 2XG5B 1E9OA 3NK4A 4G6AD 2NUTB 3HBGA 4Y19E 4J4PA 4OT1H 4UTCA 5HGHA 1FDLL 1HE7A 5KVGL 1BMGA 5I5MA 1EO7A 2MFNA 3WKPA 2R27A 1IGFL 2VT0A 5EZJA 4A2HA 4AQEA 1PZBA 2CIKA 4HEPA 1JZ6A 1IVTA 3P11H 3A22A 3ZZSA 2APSA 2HTLD 2BNRE 3F7VB 3S37H 3BQVA 3L95B 2ZXBA 4P46C 1OPGH 2BVTA 3UYOD 12E8H 5I5JA 4OLUL 3AG1B 4I4WA 2WSDA 3VFNB 4XMLH 2R29A 3TA3D 5DVMA 3G5XA 1LO3H 1XCTB 3FH8A 5E9DA 2VN5A 1TKWB 1OD9A 5JHAA 2R2BA 4Y88A 3QEUB 1WBYA 2QMKA 4KK9C 2NY1B 1FP5A 2ATPB 3T3ME 5EF0A 4UTAA 3KPNA 4ZTOL 1M6OB 1FF5A 4G43A 3PWPA 5ICXA 3CUPA 3IMBA 4APQA 5SWZB 3HVNA 5IJKC 5I8OH 3ULVL 1B4TA 1L0XA 4HIPA 3QPXL 1BZEA 2BY3A 1KPUA 3I3EA 2Q76A 4MX7A 2KZKA 1S9YB 1PVHA 5E94A 4LSUL 2YUZA 4I5BB 3I6KB 3UTZB 4EZJA 4ZTPL 2VW6A 4HV8B 3AXLB 1JZGA 4N2FA 2VDLH 4Y4KB 2GABA 3F65A 4G9FB 5GIRB 4AVJA 3GTNA 1QTSA 3QFDA 4IRJC 5L88L 3OKMB 5EEZA 3GPSA 1UQSB 2WV3A 2XTLA 3SGEI 3FQ4A 3IMSA 2Z92A 4W6XB 1SN0A 2OL3B 5DC2A 1NEZG 3S36H 3U79A 4F7TB 1QFWL 3OGOE 1OIOA 5HI3D 4Z3HA 3MRGB 4FFTA 1VENA 1AGDA 4A7QA 3MACL 1C5BL 1R3IH 1X6NA 3DSFH 4FN0A 4FYRA 4F2FA 4G8EA 4BK8A 4JQIH 1MPAL 3CAFA 5C0CE 4HH9A 5JXEC 4CN1A 4ZMLA 4FF9A 3DK2A 1ZXKA 4LOUC 2ZSWB 3WEAA 5KSAC 1M71B 3LRMA 3VSTA 3J2PA 4FYSA 4Q58C 3OC5A 1G7LA 3ZYJA 2R59A 4WDIB 5JIQA 5JW4N 4QRRA 5I6XC 4G3YL 5IJDC 3B8YA 3U36B 4ANUA 4BCXA 3CZLA 1T7XA 1LO4H 4TSAH 1JGIA 5EUOF 3X1FA 3B7SA 4OZGF 1RI8A 2WY3B 3CFKA 4YDVB 3BE1L 1CO1A 5F7EL 2BY0A 4JB9L 4Z7WA 3FRUA 1RJYA 3PDDA 5JZ7D 2X70B 1F8TL 1HCFX 1T5KA 2EYSA 1GGIL 2P5EA 2R29L 2QSVA 1H5BC 4H1LG 4ODVL 2BC4B 5K33A 3LS5H 5EZIL 1QSFA 4DN3H 4HIIB 5CP3A 2IGTA 3K8KA 3NAAL 3DIFA 4ETQB 1WBZA 1X5FA 2Z8VC 1CTNA 5C3TA 2J4WL 2FEDC 2BMKB 5DO2D 5EU3A 4UTAL 2YK1L 1KULA 2Z1KA 3VI3E 2H2SD 1T1ZB 1B0WA 1UVQA 1PLBA 2Y4SA 3UG5A 2Y22A 3K2UL 1KEML 3MLRL 4KJWD 2XKUA 2XIDA 1TQBB 5E6UB 4CU8A 3KW7A 3MOBL 1IAIL 4FQHA 3O6FB 4NZTH 2KLRA 1ET5A 3GSUB 4IIQC 3IAQA 1IEBA 5KSVA 4MMZC 1G9HA 2LU5A 3EH2A 3K4ZA 4U6TA 3A47A 1ASQA 3RWCB 2GUOB 1NCWL 5D1XE 5LGHH 3ULVC 3KNBA 4HBQA 3SYQA 3KWVA 2OMVA 1RKRA 5AVRB 5GGRB 2WLZA 2I27N 3SDAA 3BZFA 1TJMA 1JWSB 1PSKH 2H3KA 4MXWH 4PJCB 4K3EH 3S9DB 3NH7L 2Y24A 2FEEI 2R56L 3LKNB 2ENJA 2H0FA 1ETB1 1OCCB 2PUQT 3SE4A 1GIGH 5JLZA 2NDFA 1SXBA 2FJHA 2CDFB 5EO1B 3VQMA 3VFUB 3X1GA 1FIEA 1DQQA 4TOYL 4NCDA 2ICWI 4O02B 1IC4H 4FNUA 3QE5A 4ZZFA 5D7IE 5AW3B 2AI0L 4P4KD 1HKLH 4ZW7A 4FXGB 2WXPA 3LKSB 1NGQH 1RIHH 1GA2A 4FG6D 4TNWK 5GRYA 1J5CA 4PV9B 5IM7A 1N0XH 1IAMA 3CZFB 3DTXA 4C56D 3ZQXA 1R19A 5I1KL 2MRYA 1RHFA 4JX0A 1UC6A 2QLYA 4WIQA 4HOXA 4LSPH 4IEFB 4UQCA 5F9JA 3S8FB 1X6LA 3A4AA 4LDEB 4I3RL 2VR9A 1AOHA 4BKLB 1GZHA 1KJMB 2WYHA 4ANVA 1NMBH 3S5LB 2NZ1A 2YA2A 1M7UA 4ZUWB 5FDWB 2XRAH 1HEZA 4V1DE 2YXWA 3KVPA 3MGTA 1BFVH 1JYXA 2GG1A 1QPPA 4Z7IA 2CKBB 4PWGA 1WITA 1PG7H 4QJ3B 4H0LC 4X6CA 1NAMH 3X3FH 4P2QE 1MCNA 5F1NB 1AGFA 2K1MA 2FZ3B 4FMVA 1DQML 3B9AA 4UV4L 4OIFA 3AQXA 5DA4A 3AM8A 1H15A 4K3JL 1RCYA 4PJBF 3KLHC 4KKNA 1AKJB 4F2EA 2WO3B 2HLAB 5A2AA 3LXAA 1FHGA 4D9QE 2UXVA 4G8GD 4PJFF 5D9SA 4P46D 3L3JB 4GKSA 2O6DA 3ATBA 3FB5B 1V10A 2YWYA 4FA8A 1JF1A 1I82A 2Y1ZA 5EIIA 2OTWB 5DVLA 1FBIL 1OGAA 4URKA 3I50H 2V2XA 1HE8A 1OSEA 3S37X 1YUHB 2EXSA 1YJDL 1JHKL 2RACA 1HCVA 4LLWA 2K9UA 2A6KB 4HKXB 4F80A 2QQQA 4PTUA 1EAPB 1FE8L 1U6AL 2R8SH 1W0WA 1J10A 2J6WA 1IE5A 1QX1A 4FULA 4IMLB 4MB5A 4N5UA 2COQA 5LN4A 1U91B 5I73C 4OJYA 1VADA 3KGUA 5AYUH 4DP4X 4BFKA 1TITA <