3NYKA

The structure of cobalt-substituted pseudoazurin from alcaligenes faecalis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
molecule keywords Pseudoazurin
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nykA00
1BXVA 2GHZA 2OJ1A 1NPNA 1PZCA 2GB2A 4AZUA 1A4AA 6PAZA 1EZLA 2DYSB 2CAKA 1V54B 3PAUA 1N70A 4KO7A 4E9VA 4YSQA 2LLNA 3IE9A 2FT7A 3HB3B 3QJTB 4E9RA 2B08A 2QT6A 1OE2A 3WKPA 1W6WA 1TEFA 1PMYA 3WI9A 4YVUA 5EHFA 1L9PA 1GY2A 2ZONA 4KOCA 1PLBA 5I28A 1FA4A 1ASOA 1NPJA 1KBWA 1L9RA 2YAEA 3X1FA 4BXSV 3NJLA 2BHFA 5I6OA 1ET8A 2XVBA 4YSSA 3FQ1A 5B7EA 4E9QA 5TK2A 1AS6A 4BWUA 5B7FA 1NDTA 3NJMA 4QKTA 1ZIAA 3T71A 3HEIB 1NIFA 1SFHA 1RZPA 2BP8B 3PLYA 1ZDSA 2IWFA 3QJVB 3N2JA 1M56B 4HCIA 1E5YA 3ZIYA 4A66A 4KNUA 2BZCA 4ENZA 1ET5A 3GDCA 1KDIA 4P5RA 1IBYA 3NSYA 2EIKB 4A2HA 5I6KA 1NZRA 1SHXA 3IN2A 1ETJA 4A2DA 3H56A 4KOBA 3AZUA 2WO2B 4A67A 4HHWA 5F7BA 3ABMB 2WO3B 1CURA 2EILB 4AX3A 4G72B 1TKWA 2FQFA 1MZYA 3CDZB 1AS7A 1M9WA 2UX6A 2GBAA 1MG2C 1ASPA 1BXUA 2IH8A 4WKXA 2PP7A 1YLBB 1RCYA 2IDQA 5A7EA 5IY5B 1E5ZA 3CG8A 4DP7X 1IUZA 3ZDWA 3CVDA 2PPCA 2EINB 1F56A 5B1JC 1PAZA 4YSPA 4PCYA 2MRYA 6PCYA 2QPDB 5AZUA 4F2FA 2IDTA 4UAHA 5I5JA 1KCWA 3FPYA 3FS9A 4YVNA 2DV6A 2TSBA 4YSTA 5PAZA 3ABGA 3CVBA 3FU9A 3X1BA 1WA0X 2HX7A 1GYCA 2VW4A 2BWDA 3GXUB 5TK4A 3S8GB 2XV0A 3SBPA 3X2QB 5I6MA 2B3IA 1VLXA 1WS7A 3FU7A 3IN0A 1ZV2A 1AANA 3QJQB 5I6PA 2H5UA 3OM3B 5F7AA 4A68A 4BK5C 4G7SB 1WA2X 2NRDA 5D4JA 3CVCA 2BWIA 3UABA 4BDVA 2CCWA 3FYEB 1QHQA 1IBZA 2HX9A 4YSOA 4AI7A 1W8EA 2H47C 1A4BA 1DYZA 2IDUA 1J9SA 1J9QA 2I85A 2PP8A 3CZUB 2BZ7A 4JHVA 1SF3A 1IKOP 1BAWA 2CUAA 4KNSA 4N8UA 2IAAC 3NT0A 2PPEA 5AFAA 4M3HA 2FT8A 4BWTA 2R7EA 5I5IA 1PZAA 4HALA 2A3TA 3PCYA 4QLWA 2HRHA 9PCYA 2VN3A 2FTAA 5I6LA 4HHGA 2BO0A 1JVLA 4HZ1A 5B3SB 1SFDA 2Q5BA 1XB3A 1GS7A 2YAPA 3DKHA 3WNJA 2VW7A 1A4CA 2VSMB 3QJSB 4E9SA 2FT6A 1MDAA 3X1NA 1HFUA 3ASOB 1AZNA 3AG3B 3FSAA 3TBBA 2FJSA 4BDVB 3FYIB 1NIDA 3AG4B 1X9UA 1M57B 2IWKA 4P5SA 5E9NA 1JERA 5D4IA 3UGEA 4DP5X 2IH9A 3RYMA 2BW4A 4JHUA 4W1TA 4KO6A 1J5CA 1JVOA 2W88A 1N68A 2YXWA 4GP4B 1NINA 4GXFA 3S3CB 1V10A 3FQ2A 3T6ZA 4YSRA 5B1AB 4DPAX 2Y69B 2PCFA 1R1CA 1DZ0A 2WSDA 1PNCA 1QNIA 2AZAA 3D12B 3EH3B 3T6XA 1PY0A 1E67A 2FQEA 2GI0A 2YAFA 1L9OA 5B1JA 4DP8X 5FC9A 3KW7A 3UAAA 1QLEB 2FQGA 1WS8A 3BQVA 1CYWA 1GS8A 2H3XC 1MZZA 4GP5B 4FAAB 4RH4A 1OF0A 1A8ZA 1JXGA 4N4YB 1EHKB 1JZEA 5I6NA 1SHWA 2PPAA 1AG0A 2J55A 4EF3A 1OCCB 2J5WA 2I7SA 1URIA 4HAKA 4F7KA 3PAZA 4FA7B 3OD3A 4G7QB 2QDWA 3NJHA 4DP9X 4M4RB 1MG3C 1FFTB 1NWPA 1ET7A 2HZHA 1JZGA 2FQDA 1SNRA 4YSEA 7PCYA 3BVDB 2JFCA 3U25A 3C75A 2XV2A 3FSWA 2UXFA 1GY1A 2CBPA 3S8FB 2ZWNA 1BYOA 3UAEA 3AG1B 2I7OA 4HCFA 1AACA 5B7MA 2X88A 3FQYA 1SJMA 2XUWA 1SF5A 1OV8A 4E9XA 3AG2B 4KO5A 2J57A 4AKPA 4DPBX 1NIAA 2E86A 3OMIB 5B1BB 1T5KA 2XWZA 1BYPA 1ZIBA 4E9WA 2JXMA 2VM4A 2BP8A 3PAVA 2PPFA 3NJKA 4WTQA 1JZHA 2XX0A 1E65A 4HCGA 2EIMB 2YARA 4TXVB 3OMNB 4BXVA 3JTBA 3IBOA 4DP2X 2UX7A 1NWOA 2IDFA 3EH5B 3H4FA 8PAZA 1ZPUA 4KNTA 1OCZB 2OCCB 2GC4C 1PF3A 1E30A 5I26A 3V9CA 3EF4A 1BEXA 4E9YA 2N0MA 1A65A 1AG6A 2PPDA 2AZUA 4GY4A 4Q89A 3X1EA 3FSZA 3ABKB 2P80A 2AVFA 1J9RA 1PCSA 1HAUA 1KGYE 3OMAB 1V55B 1AAJA 1GW0A 2GSMB 1GR7A 2CJ3A 4K9JA 4DP4X 1PNDA 3NJJA 4UANA 2VMJA 2GC7C 2HX8A 2DWSA 4YSCA 3EH4B 2J56A 4BWWA 5D4HA 1ASQA 3PPSA 3G5WA 4X4KA 3NSCA 2AFNA 1KYAA 4YSUA 1JZIA 1CYXA 1AZUA 4AKOA 3NSFA 3FU8A 3FT0A 3IEAA 1NTDA 3SQRA 1UATA 1XB8A 3NJNA 3WIAA 1AS8A 1TEGA 1ADWA 2RACA 2OV0A 1AQ8A 1JZFA 4E9TA 4W9ZA 2FWLB 1A3ZA 1FWXA 1SDDB 2TSAA 2ZXWB 1KBVA 4F2EA 4L0PB 3WNIA 2FNWA 4Q8BA 2XU9A 3ASNB 3N55A 1L9SA 3ERXA 3TBCA 1NICA 4YSDA 2BP0B 2YAOA 2YXVA 2BW5A 4JKNA 4DP0X 4ZK8A 5LDUA 4CSZA 1ILSA 2UXGA 3ZBMA 1ILUA 1AZCA 1J5DA 4PAZA 5I5MA 3NYKA 1OOWA 1OCOB 2VW6A 3WG7B 2UXTA 2QDVA 3QPKA 1JXFA 3KW8A 3MBWB 2XX1A 5ANHA 1JOIA 3T6VA 4A2GA 2GIMA 2PP9A 3NP3A 1L9TA 1TU2A 1WA1X 2MTAA 2PCYA 2XXFA 1GSKA 3TA4D 3S3BB 1JXDA 4AKQA 3OQRA 1X9RA 2Y1AA 4MFHA 3S3DB 4A2EA 2UXVA 2XYBA 1OE3A 4G7RB 1OCRB 2DWTA 5AKRA 3UADA 1SDDA 3AY2A 1I53A 2HLEB 3TASA 1B3IA 4NB7A 1AR1B 7PAZA 1BQKA 1AZRA 2IDSA 2XV3A 2YQBA 1J9TA 3NP4A 4GYBA 1OE1A 1CC3A 1RZQA 1RKRA 4DP1X 2EIJB 1AIZA 4GP8B 2HXAA 4KO9A 3NJGA 1L9QA 1PLAA 1W6LA 1BQ5A 3JT2A 3T6WA 2AANA 3AW5A 3DIVA 2R7EB 3DTUB 1PLCA 5B1KA 5PCYA 1AOZA 3ABLB 4HIPA 1BQRA 1PZBA 3NJFA 1KV7A 2DY2A 2YAQA 4DPCX 1IC0A 2PLTA 4NAJA 2YAHA 2X87A 2QPEB 3EHBB 2CALA 4CSPA 4DP6X 3MX0B 1WAEA 2VSKB 1HAWA 1XB6A 2ZOOA 3PXLA 1KDJA 3QJUB 1BXAA 4G70B 3T9WA 1CUOA 1GS6X 2P80D 2DYRB 1ID2A 3UACA 1JZJA 3FU7B 2HRGA 3X1GA 1AZBA 2XXGA 2W8CA 3WKQA 3ZX1A 3L45A 2IWEA 3NSDA 3GYRA 1NIBA 1XMEB 3H4HA 4NERA 1ZDQA 1KCBA 3QJRB 3V9EA 4G71B 4YSAA 2Q9OA 3TU6A 3SBQA 2YAMA 4UF7C 3SBRA 3NJIA 2BP0A 3FPXA 3QQXA 3FSVA 4A2FA 3CDZA 4YL4A 2XLLA 1NIEA 2VM3A 2JKWA
chains in the Genus database with same CATH superfamily
2QQQA 4AQEB 4WJ5B 5DJCB 1XEDA 5ICXB 2E76C 1S5IH 5J12B 2ZXDA 4OZGA 4MCYA 3VTAA 1UA6H 1WUZA 4OFYD 3IDXH 4H8WC 6PAZA 3UZQA 3QWNA 4UMSA 5AB9A 1S9VA 5HJBA 3BVTA 3JV4A 4JX0A 5SWSD 1TENA 2FT7A 1MJ7L 1E8WA 2B08A 4PM1A 5FHBL 5LWYL 1NGPL 3F2LA 5LGYA 5FW8A 1KELL 3LKOA 1QWHA 2E47A 4XMZA 4OV5B 2VH5H 4YVUA 2NQCA 4RIRA 4Y4KA 3PDOB 2GEQA 1E5BA 1D9KA 3LZFL 5DC4B 5HDLA 1KXQE 2AXWA 3DTXA 1GAFL 1L9RA 3T0VA 3BUBA 4XMVA 4O2EA 4B96A 4R0LA 2EDXA 1Y18B 3GZKA 3Q1SH 5DD6B 5E6ID 2MPAL 1HHHA 3MX0A 3E0GA 2UWEF 4HWZB 4BCXA 2NOYA 3E6HB 3QUZA 3KYNB 4LAQH 1IC1A 4PWEA 3VFWB 3UC0H 5CAYB 2EUVA 3C8HA 2VLME 4YGVB 4CC1A 3MNVB 1OGAD 5E2TH 3ZIYA 4HPYH 3I9AA 4MVBC 3B8YA 3EJRA 3AGVA 4IGBC 2EDQA 4A2HA 3KNBA 3B1TA 2CU9A 4LBAA 3TC9A 3WY3A 4GI8A 1MFMA 4Y16D 1GZHC 2SEBA 4M1CD 4K9EC 4JG9A 3ULVL 4GS7B 4J3XA 4OCRH 5FM4A 5GQBA 3ZDXE 3U9UA 4F33A 2A6DA 2FQFA 1HCYA 4IDJH 2HRPH 3N3EA 1P5UC 1M71A 3ULSA 3OLEA 3ZKQD 1XAKA 1FHNA 1ASPA 1OGTA 4IIQB 4RNRA 3ZQXA 4EVNB 1WCQA 3QRFM 2ZUXA 5GS0D 3QZMA 3C5JB 3ZO0A 4L4VA 1OO2A 2BM3A 5K9JH 3CG8A 5KYYB 2OW6A 5F21B 2C7UB 4IJ3C 3DLQR 3IMTA 1G6RH 5HY9A 1C08A 1P9MC 3MDJA 4LSSL 2BCKA 5AZUA 1ORQA 4IU2B 3W39B 5HHXH 4IGBD 3FS9A 3NIGB 4EZJA 1M1XA 1N59A 2OZ4L 5DSCA 3UG4A 1N6UA 1C5BL 1O7VA 3HE6C 4QTIL 3V7AG 4MHHG 5DJXA 2W0FA 3KPLB 2HX7A 3O45B 1EDHA 3QNXB 2FL5A 4EN3A 3HAEG 3HC4L 1FZJB 2C9XA 2IJ0C 2XV0A 4LPYA 2KPNA 3V7AE 5I6MA 4HP5A 2B3IA 4JRYA 2AEQH 1XMWA 3II3A 4F9PC 1KV3A 1EAPA 4FGMA 1AR1D 4A7SA 4DF9A 1MJ8L 4F2MA 1A1NA 5D1XA 3MCG1 1AXSB 4PWKA 15C8H 3OKEB 3S5YA 2CBOA 1QPPA 4OFYA 4YBQC 4AI7A 5FM5M 5TF0A 4QYOB 2Z31D 4NJ9H 1DQDH 3CZUB 3ESOA 3KPQB 4HSQA 4N5EC 1TZOA 3DX3A 5DD3L 1SF3A 2AK4D 2HCZX 4FC3E 3QI9B 4ZOCA 3GSXB 5J13C 4H8UA 4AYDC 5JA8B 4IJ3B 2NMSA 3GSOB 4ERSH 2FX9H 4S1SH 3CZEA 3QB7C 1E5UI 4HU8A 3N06B 4Z7QE 3H9YA 2F6AA 6FABL 43CAB 3GI8H 4XN5A 4RRPA 1JK8A 1LDPL 3MRMA 3NA9L 4NC1C 5EF2A 2RTTA 5EFIA 2O5YL 3FQTA 1UVQA 4R4BA 3O6FA 2BO0A 3WSQH 1KB5L 4KI5D 4P2RA 4PRPD 4K23L 1OT4A 1YNTF 1CZ8H 1ZKAA 2FO8A 2CK0L 2J4WH 2NQ3A 4E5XG 1BZ7A 1YNLH 4XAWL 4FQQA 4NP9A 4RLDA 4O4YH 3DSNB 1G1CA 4JQVC 1JWMB 1OAUH 3EYQC 4Y88A 3WE6A 4AUYA 5IWLA 3NTCL 4XMLL 1T04A 1TQCB 4MXQD 3U48A 2H3NA 5F7EL 2DH3A 4AGQA 4OUUA 3GT6A 4ZX4A 2WW8A 2Z4QB 3BPOC 2IH9A 5DMGD 4Z76A 4JHUA 5GRJH 4HGWB 5C92A 1XEUA 3AS0A 3R19A 1D6EA 3A6CL 1J86A 4EIZC 5F6IB 2HMID 1KN4H 4Y4FB 5CN1A 5EF3A 1K4DB 2H2SD 4FQXB 4QHKJ 5CR1A 3GTTA 3T6XA 1CYGA 1IC5L 1WD8A 3K4DA 5FKPA 2GI0A 3CUPB 3RURA 3PHOB 3D18A 5J12C 3WMSA 3CHOA 3GXNA 4FOMA 1QLEB 2FQGA 1WS8A 2NCEA 4U6VH 1CBJA 5EF0A 4PTTB 1QMUA 4GP5B 3VI4A 1MFDH 4HG4K 3LS5L 2WCGA 2MKWA 3RWDA 4XBPA 1IE5A 3GMLA 5DK0A 1AG0A 5LAXA 2GT9B 2VDOL 4O00A 4G42B 1ESOA 2XRAL 1KYOK 3B7SA 2NW3B 4FULA 2M2DA 2QDWA 3MRBB 2NLJA 5EIVA 1ET7A 3VDBA 3UTSA 3TONA 3UC2A 3A24A 3F85A 1IAOA 1U2HA 3II1A 7PCYA 3GLAA 4QRTB 3BVDB 5DS8A 2YEQA 3U25A 4HUNB 1EEYB 5CXPA 3IPEA 5E95B 1CF8L 3Q3GA 4Y2DD 4OIAA 1NBVH 4HOMA 4NZUH 5AAMA 5IUCA 1M7IA 3AS3A 1CFNA 1RSYA 1EZVY 2Q7YA 3FUIA 3QGVA 4B9KC 2KQMA 5L4JA 1MREL 5AW1B 2JQMA 1MXGA 2X4OA 3HA0A 3FXIC 5ACMA 3AT8A 5TTRA 2HJFB 2XWZA 5ERWA 4E9WA 2VM4A 1E40A 4OKVB 4PS4H 4NNPH 4XVJH 2JE8A 1Q38A 3FFCA 4NENB 3NJXA 4JFZL 4K94H 3KWTA 4NNYA 2MIZA 2NNAB 2WCPA 3BXNB 3N6YA 4HIJB 2VXQL 4U3CA 1XGTA 5B1CA 5DYOB 5C0BA 1MW0A 5MEOB 3CN4A 3NZ8A 2GJ6B 2WN2A 4I2XB 4TLUA 4BUQA 2VYRE 1HHJB 1QSEA 3AMLA 1BEYL 4HUXB 5EN2B 4DEPC 3CZJA 2YR3A 3CZKA 3IFLL 1KLUA 2N0MA 4XCFL 1SQMA 1W72A 2XNAB 1T0OA 4N0CC 4U49A 4ESKA 1G6RL 3DXAD 1LYQA 1G9MH 2XVKA 5HGDA 1F3DH 4O5LH 1PCXA 4LLWB 2GBUA 5DFTA 2D9QB 4G6JL 4KMTH 2IQAB 2YXFA 3GEWB 2EDYA 2J56A 2QKIB 3OJ2C 3GWJA 3ARDB 3BQUC 1RQ5A 3PPSA 4XMPH 5DGQA 2ZOWA 4XC1L 2Q6WA 3BRDA 1YN6B 3BFWA 2VRKA 4APXB 1NCTA 1LVEA 5C9JA 1CXIA 1VADB 3PWLB 3F7KA 2F8XC 4KQ4H 1RZ7L 4R26L 3QI9D 4XNMB 3BVNB 5JDJA 4KZDH 3QJHB 4JDVA 3VXQA 4LDOB 1S7UA 3BP6A 1YMMD 4WK2B 5A7BA 1JZFA 1EA9C 3HG1B 4N3UA 5INDB 4LSTL 1RZFH 1TJXA 4P5KA 1I4FB 5ICZA 4P46A 5ITBL 1A3ZA 2ZXWB 1E3ZA 3DUSB 4Y5XA 5DWPA 4F2EA 1KTLB 4NQXB 4EOWH 1JCVA 2OMXA 3N44F 2W9DH 1WWCA 5D7IA 5E99L 3EOAA 1OP9A 1RMFH 1G9HA 3HPLA 3TO4A 5JHLH 4OM0H 2A38A 2YGOA 5D2NA 1SEQL 4HULB 3KR3H 2BW5A 4P2OB 2PYFA 5DJ0B 4XAKD 1WIOA 1JNLL 2ZXAA 4JR9H 3MUGB 3S88H 1YAIA 1MCWM 3QXWA 2KH2B 1QR1B 3QORB 4KKCC 3CFKB 4NZFA 5IOKA 1OWRM 2VMEA 4PRPE 3KMDA 3KHQA 1PG7X 3W9EA 5CZVH 1J5DA 3FB7B 3RNKA 3SN6N 4F7CA 1WC7B 1E4HA 3QRGL 5DVMA 2IAMC 2VERN 4HS6B 1ZOXA 5BJTA 2X9WA 3PIQB 5BRZB 2DM7A 3NIFF 4HWEH 4WWKC 3MBWB 1M53A 4OF3A 1JOIA 3QUMH 1BWMA 3C09C 4BQCA 1JV2B 1O5PA 3UBFA 1TSRA 3BUYB 1ZLWH 5KSVB 3PABA 4DJMA 2DI7A 1MFCH 4L8SB 1XXDC 4PSRA 3GKZA 1A6WL 3EYVA 3RTQA 1Z2KA 3ILEA 3RILA 3NEOA 1DBMH 3MBEC 3ZR6A 2H1PH 1SMDA 2I32A 4I3SL 1WUNT 4J3UA 1TFPA 5I0DA 3KM1A 4LAJH 5DEFB 3F05A 5C0CD 1QSZA 1UWEH 5HHNA 1IM9B 4GFTB 3UCRA 7PAZA 2IFGA 4RMSA 4HD9A 2VSDA 3G6DH 3VW3L 2VLLA 4AEEA 3PPEA 3DROB 4Y5YB 1OK8A 4KC3B 3P2BA 3QK0A 4MJ6B 4HPOL 2WVTA 1KCLA 1SVZA 2G75A 2XHNA 2LTQC 1UH3A 1IAMA 2VL5A 2AQ1A 5C0IB 5J9PB 2ICCA 4ZAKA 2OM5A 5KAQG 2OYLA 4J3OG 1JGEB 1ND0B 3SPGA 15C8L 3AW5A 2XPGA 4X6EB 2OQJB 1ZRUA 1IGTA 2BNQD 3GIVB 1ZLEA 4X4XA 1SLUA 3M1BB 5E5RB 1RZIB 2JKRM 3BP4B 1AJ7H 3KPSD 4KXZH 3P9LB 1OT1A 3H2WA 4FHJA 1WGVA 3WAJA 3MRCA 4IEFB 4ICXA 3ATAA 3I3DA 5ECJE 1BX2A 4XP9H 1I8AA 3KBPA 4FMFA 1EQWA 2J6EA 1H5BC 4KK6D 4HH9B 3FQUA 4F7EA 3QJUB 4XN4A 1CUOA 2ITCA 3MA7B 2YHGA 4MQ7A 1DANT 1GJIA 4X2UA 1NANI 2WVVB 1ID2A 3CQQA 3LIZA 4HXAH 1I3RA 5CN3A 3ULUF 2EXTA 2CUMA 2IWEA 1GJUA 2WYHA 3OSKA 3I6LE 1DDTA 5G5DA 2DH2A 4LHUA 3GUTA 4OGXH 4KZCA 3IFOA 3WNPA 3IM1A 3JWNE 1DP0A 4FLHA 4UQAA 2X05A 3VRJA 1E3XA 2O1AA 3RWGB 3Q2CA 4WY7H 2JB5L 3PE9A 4QRSB 2X1OA 3JTTA 4K3JL 3TCXA 4X5XA 3VYPA 2CKBA 1DUZA 5IFAL 1MQKH 1FRGL 1T7VA 2NR6A 1NIEA 3FT9A 1CLVA 4Y2OA 5F1KC 2VM3A 3REWA 3ARBC 3VFUB 1YEFL 5GSRA 1MFCL 4F8NA 4LP5A 2CGYA 1XR9B 3FUHA 4X7FC 2WVSA 4KQ3L 2UZIH 1M2OA 1PG7H 1R4XA 2JKJA 2RFXA 5JXAH 4K3JH 4HUVB 1JHTB 3A47A 1KNOA 3DGGB 4WEMB 5T3XE 1FYTB 1KG0B 3GSNL 1JGVL 4TOYH 4LDEB 3DRTB 4E9VA 5DLML 4M29A 3HI1A 4OW6A 1GYWA 1ZTXL 1M7DB 1UWEL 4NQDB 2NX5A 4Q2ZB 2QT6A 2XACC 3NFPA 5JDSA 2YN3A 4LIQL 2FGWL 4PLJD 4MCNA 4A7GF 2CDFA 1J18A 2LQRA 1U33A 1XCWA 1Z3GH 4HJJH 4NQQA 4UM9B 1MY5A 2FZ3B 2DM4A 1A9EB 3LZPA 5FX3A 1RIVH 1FFOB 5FYJU 3RVVC 4B41A 1T5XA 4IOFC 1BFVH 3RHWF 5A6IA 3PFQA 1WFOA 4XO5A 3U1SL 3DARA 3QCTL 4MQXD 4H8VA 4BXSV 3NJLA 4KH9A 4PB0L 3I74A 4I87A 4LRIA 4M7LH 1T0MA 1J8KA 4M8RA 3RG1C 4PLKD 1RZFL 1F3DJ 2Z93A 3ARSA 1JGLL 3MRRA 3VSQA 1PKQE 4F24A 1CCZA 2N7SA 2VN6A 2BY3A 2O4EA 3VWKD 3ECBA 4BCZA 1QA9B 3C2AL 3WAKA 3CDGB 1I1RA 4HCIA 4A66A 1EHNA 1ZLVK 4LSRL 3IETB 5IG7B 2QKIC 2DQHL 4ENZA 4N6RA 4R3SA 1GGTA 4WWKA 3BN9C 3PS6A 2J6EL 2Y7QB 4FYSA 5MHSD 1ETJA 4HFUH 4XOAA 4F9LA 2CLRB 4KOBA 3RHWK 1IIIA 5CMAB 3AZUA 3T8XB 3GBLA 3P02A 4WTZA 4YHZL 4YE4H 1Y0LB 4H7VA 3HC4H 1W16A 1CURA 4P99A 1F4YH 3PHQA 3CHPA 3DO3A 4MCZA 4X6CA 1P4IH 4BRJA 3H6AA 1S6NA 3PXJA 3BC9A 5E6IC 1B0RA 3REVB 3ISRA 3SQBB 1AGCB 4OCWL 3WIFB 4Y1AD 3O4OC 4HKZA 4IOSD 4BUGA 5F7UA 4MA8H 3WIHH 5H4ZA 1PBYA 1R5VA 4WKXA 5C08A 3VXTB 2D03L 2IDQA 4AVIA 1P7HL 1O6SA 3Q01A 4PJHF 4IBSA 4XO4A 3EBGA 3HE7A 1NFDB 2LFEA 1KBBA 3LKRB 4PVNA 1HILA 1PX3A 4J28A 2BIPA 4YQXL 4RAVA 4P46D 1DVFA 5PAZA 2NW2B 5KWYC 4JL1A 5H94B 2FJHA 3PWPB 4YX2H 1J87A 1N12A 1N9PA 1OIOA 1NC2B 3MNZA 3HZYA 5DUPH 3BLBA 5GPRA 1J1OH 3O3BB 3ZHKA 3IMWA 1CO1A 2ZG2A 5B22A 4CVZA 1E4XH 2FHCA 4P9HL 4BK5C 1K4CA 2KHAA 3U9PH 3EJJX 2NY7L 5K1VA 1PTZA 5GGVY 5D4JA 2ORBH 1GHFL 3UABA 4YS4A 4I13B 5KVGH 3EOTL 3FBKA 1JZ7A 2IALA 4IK7A 1WPCA 1U3HB 1ZVSA 2XQYG 3GD1C 1DVXA 4PLKC 2ZOLB 5E00A 3ZO9A 2B1AL 4XPFL 4X6BB 3DX9B 3BHBB 1YJDL 5F3HB 1UD5A 3VFOA 1ZTMA 3B2DC 2CUAA 5A40E 5JQ6L 5C71A 1TFHA 3LV3B 3US9A 3GZPA 4S1QL 2F7PA 4O2FB 4BZ2A 4UIMA 4P5MB 4XMXA 1MCFA 3NEXA 5DURB 4QLWA 2WSKA 4ZS7L 3FUJA 1GSMA 2JTYA 5CZVL 3TVMD 3LQMA 2MOQA 1YUHA 4RAUB 4QOKD 2OAAA 5T3ZD 2NCMA 4HW6A 3SE9L 4HZ1A 4OSUL 2MQ3A 1FVCB 3DTDA 3DBXB 4XBEH 5CJOL 4XCCL 1NMCB 1TR7A 1EHXA 1HJBC 3SE6A 2CKNA 5E1GA 1EHLH 2P5WB 4QO1B 4UQ3A 1RFDL 3KPTA 1IAIL 4A2LA 1TQVA 1HFUA 2IVFC 5F7YC 5DQJA 4TUJB 4P5MA 1EJ8A 4O2CA 3RX8A 1TQTA 3TXAA 5E9NA 5FUZL 5D4IA 3EHBC 2P5EE 4WDIB 4WJKB 3PNWA 3KDMB 2EE6A 3DMMA 3RYMA 1G7JB 4W1TA 4U3HA 4KTEL 4OGZA 4XMKH 5CSBA 3IDJB 2FB4L 3FT4B 5JZ7D 2HRLA 4M7JL 3M1CA 4NIYE 5F7DB 3ARBD 3V0HA 4UT6L 4WUUB 2UZIL 2WSDA 3B2UC 3DSFL 2OMZA 1K4CB 5D5MB 5JMRA 4DP8X 1I1CA 3KYKL 3BD3A 3J27A 5C09B 3DI3B 3CTTA 3LAFA 3P40A 4XVSL 3GKWH 1OF0A 2Y7OA 4N4YB 1NCCL 5JA9A 1R9FA 4ZD3L 3HJ0A 4MNQE 2CLVB 1URIA 2FBOJ 2ROYA 1T3FB 3L5HA 4ABQA 2X1XR 3BEVB 2OL3H 1ITCA 5F96H 3EFFA 1MN4A 1FNLA 1O7SA 2EH7H 1EUTA 3M86A 3SDXA 1FFTB 5CWSA 4B9YA 3O8XD 1U91B 4QRUB 3FB8B 2XV2A 3KYMB 5KS9A 1OOAA 2WD0A 3GSQA 1H0DA 1R47A 1XF4A 5C08B 3GQFA 4X7DC 5DRZB 4DZBA 4L8BA 5CJQL 5E9DD 4GBXD 5G2NA 2G0LA 4I48A 3SQBA 1SF5A 1NDGB 2CHWA 2OI9C 3B9EA 5L2KE 5F7LB 5ID0B 4PGJA 3FN9A 2CHZA 1FI8C 3D0VA 4DPBX 1H3PL 2ARWA 3VH8A 3N1FC 2UWEB 1LO2H 1K8DB 4YK4B 3KPSB 5DRXB 5IFJB 3EYFA 5I8EA 2VZSA 2YEZA 3BEWB 1SMOA 1CDCA 1S9WB 2A6KA 2XX0A 3MOAL 3NCYP 3UPRB 1QBML 2GBTA 4BM7A 5DGRA 1AXTL 4PJHA 3QFDA 3MRFB 3CC5B 3PDDA 3LMJH 3UZVB 3TO4D 1E0OB 3FL7A 1MQKL 2YGVA 2R0ZH 4PJDB 1WG3A 5TE7L 1NWOA 4XPGL 4WFED 5AEAA 4F91B 2JIXD 3QIBD 1E30A 4RSYA 3WTXA 2XFXB 1T66C 4W70A 3DGCR 4AGOA 1OSYA 3WKYA 1CFSA 2OP4L 2PYEE 2D03H 3KCPB 4GY4A 4X9YA 3V0GA 5GIRB 2YUVA 1KJ2A 3TN0B 4Z8FL 1PCSA 2CA3A 1SY6A 1S7SB 3FO9B 4FNLL 5T1DL 2FYYB 4L8SC 5D7IF 5KZCD 3KPOB 2WB7A 3PV6A 5EZIH 5DEGB 3RI5K 3LEXA 1V7NL 3CFCH 2NZIA 3C09B 4G7YH 3EH4B 1EGJL 4E36A 1OARH 1WHPA 4X4ME 3F7YB 4YFEA 4OJCA 1Z9SA 3T4YB 2Y3AA 1RIVL 3L4TA 4NQCA 5I66B 2EKSA 2YOAA 5F89B 2MHAB 4OB5L 1JTPA 3O6LL 1KXVA 2P48B 4R90L 1AS8A 4JG0H 4M02A 4RFEB 3SGKC 4W6WB 4HUVA 4OBSA 1AGFB 1G7PA 3ALWA 5EEZA 2HUHA 3RGVC 1F00I 1T6VN 4QRPE 1CL7I 1XD1A 1HKLH 1SXAA 5DZPA 4IDJL 4OB5H 3VD4A 3I84A 4HKBB 4Q8BA 2AJUL 4ONHA 1OSPL 2F68X 1JF6A 2QTEA 1IM3B 4RQQA 1L9SA 3NCJH 3WXVL 1XGYL 2A6JA 1MI5E 1QI5A 3CFEB 3I6SA 1TSHA 3MMEB 1ROCA 3JT0A 1HESA 1SDYA 2VCOA 4QRSA 4HIXL 2OMYA 3ILDA 1LNUA 4N0FB 1UFUA 5HGBB 2D0GA 4HIEB 1FFNA 1J8SA 4CSZA 1YEEH 4TYUA 5IBTH 2R2BB 3H9SB 3OG4B 4J3OD 3UJJH 2NY5L 5LQBH 4J5VA 3N44B 1JNHB 1HYSD 1MJ7H 3IRCA 4WFGE 1KTRL 4FJZA 5F7HA 4WTXA 2WCSA 3HRZC 4YOKA 4PRAA 3O11A 3OKYA 4I18C 2XX1A 4PJ7A 5DQDH 1BF5A 1RIUH 2A99A 4K9EL 5KTEL 4GAFB 1JXDA 5DEJA 3VGAB 2AJZB 1VIWA 2IV8A 3ARRA 3LIZL 3S3DB 3GDBA 3ARWA 1H3TA 3G04B 4G7RB 1S7XA 1WD9A 2DWEB 4X9HA 2K4AA 4IIZA 2EYTA 3FB6B 5IJKA 3MZTA 2V7HA 4U6XA 3OR7A 1Z9MA 5FYLE 5EEVA 1A6UH 1AC6A 1B0GA 1SOQA 1SOSA 2Z4TA 3PRZA 3VGAC 5L8LB 4X6EA 4Z8FH 3K2UL 2EO9A 2CK2A 2WVUA 3KE0A 3KGUA 1UD4A 1BQKA 1QWUA 1AZRA 3G3LA 4UDTA 3VFTA 3W1ZA 5L2KB 1R0AL 4L8CA 2VL5B 1IC4L 5C0IA 1ACZA 1E43A 2KT6A 4GSQA 4RRPM 3VNZA 1TITA 2DQIL 1NMBL 1MEXL 1RPQA 5SWZE 2ADJB 2TAAA 3IXTB 2F53A 4S0TD 4LCIH 5JQIB 2WZAA 2O93L 3HW7A 4JZNA 4FTDA 3FONA 3JVGA 2JKXA 3QIUA 3UL4A 4HIPA 2WLZA 3MRJB 2X6MA 2FYVA 2VIRB 3N1MC 2JCCA 5AVRB 1HI6A 2VGLM 4OZHF 1I1AA 1A22B 2EYRA 4K7FB 3FCUB 4RX4D 2G3ZA 3FFDA 2AQ2A 3C12A 3CFMA 5J3HC 4GRWF 4I1NB 4ZW6A 1R5WB 3K6OA 5E4IA 2AP2A 4RMTA 1GJWA 3MLVL 2GTZA 2X70A 3LB6D 4XCNA 3QIWB 4XCNB 4TMPA 4ONGL 4X98B 4YH6A 2MWCA 4PRPB 4KROD 2PN5A 1HZHL 1R5WA 4WI4A 3CHRA 2QHLA 2XKNA 5KUMA 2XXGA 1UG9A 4B60A 1WC7A 1JK9A 4YHMH 4X80L 2EYRB 1I1AB 3G6JE 2ZP0T 5IVOA 1KTKE 1XO8A 1UM4H 3F7LA 5F8QC 3WUWB 1NFIA 3QNYA 4J6IA 5LHDA 4GT7A 1DSYA 3F6JA 3T04D 5T3ZE 5BO0D 5D2LE 5FUZH 1XT5A 3ILQD 2H45A 3AU1A 4HJGA 4I18A 1KXTA 5SWSB 1W0VB 2BP0A 5BZWB 3QWQB 3WEOA 2OTUB 1RHHA 1YEJH 4TPRH 4FTVE 3TO4B 3IXTA 5TDOA 3FZUD 3EJZD 2Y1VA 4M7LL 2JKIS 4DFHA 2ADYA 2MTPA 1HINH 3QG7H 1P0SE 2YKKA 4XVTH 3UX9B 4KZ0A 3RY4A 2ZUQC 5BUAA 4XNMA 4R0LC 2CIIA 4QTFA 1BM3L 4NC2B 1VGEH 3OKNA 9CGTA 1E9OA 1NCCH 1C16A 2BVYA 2BDNL 1QOKA 1Q1JH 1NCUA 4U1KA 4UQDA 3SYQA 3GJFH 3WI9A 4E42B 1MH5B 1RZKH 4KOCA 3FO1B 5CEZL 4IBWA 3GTVA 3P4LA 5BXFA 3FTXA 3ESVF 2QFRA 1IGIL 4JFUA 5J56B 1QP1A 4FMKA 4ZMPA 4IBZA 5J11B 5E24E 1B2YA 3FU6A 3V5DA 3BWUF 5A16B 3PLYA 5I30L 1CJYA 4L4VD 4AH2B 4LVHB 3N2JA 2IGFL 2JB6B 2MEJB 1JAEA 4AQ1A 4ENED 5FS5A 3L48A 4MKMA 4KKAD 1OD7A 1UYWH 2C1PB 5IW3A 3ZW3A 1FFPA 2MCPH 3AXIA 2Q8AH 2E0PA 3CFBA 1QYGL 1ZLUK 2WOYA 3FFCB 1Q0EA 2A6JB 1IC5H 2BLFA 4MAYA 2J8UA 4ODBD 4NENA 4Z95L 4EQ3A 4LEOA 4CW1A 5D2LA 3E3QE 2VITA 2FX7H 4HKBA 4Q9RL 1C16B 3ES6A 4MHHI 5DMKA 5FDWA 3AQYA 3KXFB 5KVFL 4AW4A 1TKWA 4FQJH 1CIDA 4D7PA 2XG5B 4ZPVB 4L4TB 2XT1B 4HSAC 5AOKA 5HDWA 2MQ0A 5FLVA 4AVKA 4YDKH 3SGDI 4KVNL 3T2PA 1J0KA 1DQML 3KL3A 4TSCH 5FO9A 1JXJA 1T1WB 3UTSD 1F3RB 1ZA3B 4ANKA 5F72S 1MFEL 4W93A 2Q3AA 2WLMA 5A7EA 4U31A 3ZYIA 1IAKB 2WMPB 3O8XC 3QUMA 1ERNA 4KXCA 1N6VA 5DS8B 3CLFH 3K7UA 4NKMA 3QQ3A 1MCJA 1SBBA 3DX6A 4UWQB 5DD0L 4PEEA 1NEZG 3QISA 4ZUVA 4HH8A 3UDWA 4AV0A 4YDIL 3WFBH 5E03A 2G0KA 2FR4B 4YSTA 5ACLA 3M8OH 4QLRA 4R8WH 4M5ZH 3U6RA 5CEZD 3ZMRA 4BFEA 3JVGC 4CC4C 1S8DB 4K94C 2EDHA 2CO3A 4Z0BH 3ML9A 1V8HA 1ZY9A 4QF1B 2J3SA 2UY7B 1K6QL 4YDZA 2PF6A 4APQD 1L0QA 4BFIB 2YUZA 1KBKA 1X5ZA 1C1EL 3D2UB 3DJ9A 3BPOB 1K4DA 3QFDB 1QHQA 1DJGA 4FXTA 1VJSA 2OL3A 1OCWL 1Z7JA 4A6YA 1MLBB 4WRLA 2YEZB 4ZYKA 3QNFA 1FSKC 3RLSA 1PYWB 3BH9B 3QDGA 1KGCD 2YD1A 3EDEA 4TF4A 3WLBA 2QPUA 4PW9A 1BLNA 1MRCH 1O7DE 3D0VB 4L2LA 4OT1L 2IAAC 1X7TA 3FH8A 4Y89A 1N18A 2H8PB 2GTQA 3PJSA 2E27L 2IMMA 4BWTA 4JDZA 3QHZH 4UQIM 3HBGA 3RY5A 4XO3A 5KEZA 4X6DE 1A14H 4BV1A 5GZND 1CDYA 1AO7A 4FQQB 3WFDH 3FNKA 4AQOA 4LPWA 5DRZA 1ZV9A 3LB6C 3VFPB 1M05A 3RPBA 1YYCA 3K8KA 3L3DB 3N5AA 3SB3A 1B4RA 3FB8A 2NDFA 5L4FA 2IOMA 2P5PA 1BFVL 4FLQA 4TNVK 3MRIA 3SCMC 4HVBA 2ZF9A 3RZCD 1U8NB 4XMPL 2WXRA 3X1NA 2VQTA 2EVIA 1CG9A 2VWEE 1Y1UA 3CSYA 3TEYA 2APSA 2JJTA 3ARTA 3NPSC 4DKAA 1NJ9A 3CGTA 3ARDC 3H85A 4J7RA 4LL9A 5E9DA 2GVYA 1QBAA 3I6GA 2V9QA 2XKSA 4ABVA 1S3KL 4RX4A 2ATPB 1JGIA 3AM8A 3LPWA 2W88A 1XGRB 1CXFA 1N68A 3AS1A 5D5ME 1GMIA 2QVIA 3C6SB 3RGVD 3SCMB 1DUYA 3QUYC 2B7DT 3T8VA 4P2CG 4BFOA 3OKEA 1BQHG 4L1LA 1BGXH 3BZ4B 5DUBB 5LCVL 3BP7A 4RFNB 3OC5A 4OM0L 4PS7A 1Q0XH 4WV1A 1U3HD 1P7QD 1CYWA 4JPIB 1HJCA 1AVAA 4FAAB 3AWEA 1ZD6A 1RURL 4CL7A 4LCCB 5SX5K 4ZNCD 4WGKA 2ZKXA 5E23A 2R2BA 3KDMA 2V2WA 1CFVL 4P05A 2XIIA 3GMNB 4WHYG 4NBZB 1NGZB 5F7NC 4AM0B 4O2CB 4PJ8D 2MPVA 2VLKA 2CDEB 4EDXA 1ZGLM 3LVTA 3RGVB 3VO0A 3U0PA 1BM7A 1QHOA 1KT2B 2PYED 3KGRA 3MTRA 1A6AB 2YIHA 2JFCA 5DWUL 2OMVA 3ARGC 2CQVA 1K72A 2O30A 4MSWA 4MSWB 1TZHB 4OZFA 3MCKA 4F5CE 2UXFA 2CBPA 5FF6A 4QDGA 4WLCA 4D2NA 4N8VB 4OD1L 2VMDA 3VXMD 4IHBA 1VACB 1I75A 3VYNA 2AKRB 4QOKE 2APFA 3HB3C 3ULSB 5D71L 2EXYD 1YY8A 5T1MA 4F33B 4KXBA 2CIKB 3HBZA 4FI6A 5EEUA 2LT9A 3FO2B 3IJEA 4Z7QF 4WTQA 4AEFA 3BPCB 1JWSB 1QSED 2C9PA 4OD2A 1EXHA 1BBJA 3IYLW 2YARA 4V11A 1P69B 1YPZF 1DSFH 3GLDA 2OJZH 1FC2D 1F3JB 4BXVA 1CICB 2FYYA 3BZ4A 2IH1A 5IVXA 4JZOA 3HNTH 3QFJE 2IANA 1XGUA 4GW5A 2GUOA 2X2YA 1RAMA 4JDTL 4UM8B 1HHHB 5BRZE 1D5MA 1KGYE 2L7QA 3ARGB 3OMAB 4JW3A 4N24A 3VRIB 3N91A 3CPLB 2XY2A 2B77A 4MLIA 4PP1D 5EO1B 1LEIA 1U8QB 4PJHB 3LKRA 2GCYB 3IDIB 3SDYL 1CG9B 2DWSA 1ZT4A 3ZXAC 3NVQA 3IVKB 2YKLH 2BHUA 1RUPL 4WHTB 5I8EB 5EIIG 4NNPL 5LG1A 1JF5A 3RKDD 1F5WA 1Q0XL 3HLAA 1L6XA 1TTCA 5KBNC 3SGEH 1DANU 1A8JH 1U6AH 3FT0A 3FTUA 1H3UA 2R2CA 3TX4A 1U21A 1ZLUH 1YHPA 1HH9A 1HOEA 2CPUA 5KANG 4AMWA 1OD9A 5I0VA 4ZAKD 2KC0A 4AJYV 5KSUB 4PJ7F 3ABZA 5HGAA 4U1HB 4ZTPL 4XODA 1TQSA 2VDPH 1UACL 4MCZB 4APQC 4E9TA 3P0YL 1JGDB 1TCRA 4LSQL 2CDGA 1P5UA 2E5EA 2EC8A 2WWKT 4OCNC 5C6TL 5KS9B 3EFOA 1GRWA 4QRUA 2NXYD 5GS0H 5CCKH 3C6LB 4ALAL 4JFVA 1NCNA 2RCSL 4HGKC 4KVCH 4XXDA 3ULVE 4RGOL 4YDJA 1DFXA 3Q2NA 4HX1B 2ZX8A 4FNQA 4ZW5A 1IE4A 2B1OA 1V05A 2NXZB 3QR1A 4P23B 2YRLA 5AW8B 1GOHA 3WO4B 3WEAA 1ILUA 1WHOA 1YRKA 3MV8A 4PN6A 2APTA 2KKQA 1OCOB 4DGYH 4W6XB 4KHTL 2LV4A 1KN2L 5CD5C 4J1UB 4HJEA 3BAWA 1YCSA 4L3AA 4HOWA 2IH1B 2ISDA 5JIIA 4KVNH 4HUUA 2Z0BA 2MTAA 2WYZA 5AG8A 3AXHA 3S3BB 1OXYA 1X9RA 1S7QA 3LZFH 3UTTB 2I9LB 1UTDA 1RV6X 4NPYA 2FZ3A 4IRSC 1OE3A 4EOWL 3UO8B 3AXLB 3RDTB 2DL9A 5CJQH 5GGRB 5AD0A 3T77B 3PNWB 4GRWB 3OAWA 4WO4C 2PWEA 1NAKH 4YN3A 5BV7H 4ODHL 1FL5B 3CSTA 2HLEB 1KEMH 1BZDA 1EMTH 1X5XA 2W95A 4Y1AB 1UURA 2E3VA 1T7WA 3EDKA 5AOIA 1ZT1A 4XNAA 1BGXL 5HJ3B 1FYTA 4FHBD 5FWQA 1DVSA 2B59B 3VXUA 1UGNA 1LO4L 4UOW0 4AMKH 4BKLA 3IDYB 4AE0A 5I8KL 1NAKL 3NP4A 1XR9A 2Q7AA 4R5VA 3HVDA 4CBZA 3ZSTA 3CH1B 1YUHB 5CS7A 1X5MA 1KT2A 2YUXA 3GXIA 3T6WA 2AANA 2PW1A 3M46A 4YE4L 1G6VK 4KWUA 4V1DB 4AGNA 3S8WA 3V5KB 4HC1H 4Y1AA 1AOZA 4XXCC 2IBZY 4MMYA 5J8OA 3RX5A 5L7XL 1KB5A 2ADIB 3ZHDA 2JB6A 3BUIA 3ETSA 5GJSL 2Y06H 3LQAH 1G4RA 2EC9U 1WGOA 4NO3B 5IWLC 2ZOLA 1CIUA 3BZEA 4DP6X 3HE6A 5C8JA 3KEDA 1I9RH 1EFXD 4WWID 5K9QG 1YQVH 1E6JH 2OYMA 4ZO9A 3ZHFA 3O0RL 2BVEA 3BUQA 1OGPA 4PRDA 2AEOA 2ENQA 2Y06L 3MA7A 3NESA 4ANUA 3QYMA 2XQ0A 1NOLA 3PL6D 3AUVA 1KJVA 3CX5K 3K72A 4LO9A 1CTNA 3MLTA 1KGCE 4RGOH 4MJIB 5JPMA 1YEIL 1AOHA 2HRGA 4B9PA 2A1WH 1KBGH 3MXVL 3D4CA 3TYGH 5A2BA 2D2OA 3O4LB 1TYEB 2PTVA 1IGYB 1S7RA 3V9EA 3UG3A 4XNQB 4XP6L 3OKOB 1KZQA 3C6LC 4Z7QB 3HZVB 3C5SA 4LLUB 3GS4A 3TYFB 2DLIA 1FHGA 1HYRC 3CDZA 3RWIB 4TVPH 5IUSA 3TESA 3NRFA 2HKFH 4PG2A 4J23A 1KY6A 1W9XA 2IGLA 4FABH 2GHZA 1UZ8A 3WEMA 1E6OH 4QRRB 5EBWA 4NN7C 4HKZB 1TLMA 1MAJA 1KXTB 5SWSA 1JHKL 3IPBA 5I8CB 4A1RA 4PRIA 1INQA 4NUJA 4LSRH 1SVCP 3QQDB 4X6CB 1DR9A 3ZGHA 3C08L 2WINA 2FBRA 1P1ZB 3Q8AA 4E41A 5D70H 3UIYA 4GRMA 3BH9A 1MELA 1W6WA 3QDGB 3QZOA 5DYFA 1LO4H 5LBGA 2QQNH 4PREA 4NWUH 2X2IA 5D2LF 5CCGE 1AD9A 5B8CB 2OL3B 2XKNB 1ZT4B 3IVKA 4R4ND 1GY2A 4TNEA 4OF5A 4JY4A 1Z5HA 3BZDA 5DVOA 5AOLA 1YNLL 4P5TC 3TH3T 1J0IA 3UH8A 4H8HA 1QX1A 3KPPB 4G5ZH 2PTTB 3PV7A 3IRZA 2R29L 1MW1A 3FT2A 3X1FA 3WY1A 1ET8A 5C2BH 5KSAC 1JPEA 3QIWD 3RGHA 5HDBF 5FOJA 4ODVL 4J3SA 2F0CA 2FSEB 4NKOA 1CFQB 4YIQA 3NJMA 2BNRE 1U2YA 3M7FB 2ZCKL 3DX1A 4UOW1 4JHAL 3CFKA 3MRDA 4X6DA 1KYUA 2YD9A 2Z35B 3WU1A 4IK6A 1CDBA 2FHFA 2R9HD 4LKXB 4M3KB 4P8QA 5CEZE 3ZTDC 3QPQC 3FONB 4ZMLA 3UBXB 3F7VA 4OY9A 5D5MF 5I6KA 3ELQA 1OAKL 3H56A 1JWSA 3AFLA 3M8OL 3N41F 3IFPB 1E7VA 5F7BA 4X99B 2CIKA 5E2TL 2WO3B 1F58H 3E8VA 2WXFA 1C12B 3G5YA 3SKOA 5I71C 3TLRA 4KV5E 3B9VA 3UEZA 5INDA 4QJ3B 4TQIA 4TQEL 5C0AE 4P0DA 1HNFA 5JORA 2BC4B 1TJIL 2EP6A 4DW2H 3BVNA 4L4TA 3K91A 1Y6NR 4NSKA 3V5HA 4P5TB 2R1YB 4IMLB 3DMMC 5F96L 1D5IH 1WAAF 2DQDL 5C9JB 4OZFB 3S3JA 2EYTB 3FB6A 4DIXA 2YD2A 2Z6FA 4NBXB 1SJEA 5LAPA 4QGTA 4R90H 2A7BA 3ZDWA 3EXJA 1QTPA 3G04A 4ZS6D 1HXYA 3BAEL 3B2XA 1G7MB 4JQIH 3MJ7A 1YG9A 3ZKNC 3ROLB 4GSXA 1FFPB 5JQ6H 4D3CL 4MD4B 1A7RL 4UAHA 3MQIA 3F7QA 4OQTL 3FDWA 2VDKL 4ANXA 1YEWA 5JNYA 4I2XE 5LBVA 2KLRA 5HYJA 4PJFB 4QAWA 2ZKYA 4LCCA 2ERJC 1YECL 3SBPA 3BZEB 4NO5B 4FADA 3B9KD 3E9UA 3D0LB 5AVXB 4HUXA 5EN2A 2ETWA 1I3RB 3LRLA 3SOTA 4WV1B 4F37F 5AAWC 3STLA 2HTLD 3G5XA 5ELIA 2EACA 3CN3A 4KY1L 1XGTB 4PJ6A 1MI5B 1YQ2A 4PJBF 3W56A 1OLZA 1CXEA 1F6FB 1LNUB 3MR9B 4OGAD 4PUBH 4MD4A 2J21A 2PCFB 5DJ6B 4Q6KA 5KJ7E 1GCFA 4O02L 4TLTA 4E42A 2EDNA 3ULUD 1NM4A 1ZHBB 1L6ZA 2ATPA 4ONHB 1XR8A 3QUXD 3X3GL 2RCSH 4KVCL 4JFFD 3MRLB 1BAWA 3LN4A 5GXBB 2O6PA 2X4OB 5IJBC 1H6TA 2VN5A 2ZKWA 2FO1A 4BKLB 1D7DA 4HWUA 3D9AH 3CBRA 4NN5C 3PCYA 5JORB 2BDNH 4HSCX 5T8IA 5MP6H 4ZAKB 3QZPA 1QEWB 2VRAA 1ANUA 2MOGA 2F8IA 4U1NA 3WGVB 2VC2B 4BSVB 4I0CC 3JWNC 5J6SA 3QCUL 2HYMA 3QXAB 5AQ0A 4JFTA 2VSMB 2Q10A 4E9SA 5IIEA 5KVEE 5A2AA 5BZWA 2YSSA 4KY2A 2I9LA 2R2EB 3P30H 3UTTA 1YEDB 3ZKMD 4GRLA 5KVGL 4OCXL 2VR8A 1I85C 3QXUA 2RJMA 4ZAKC 4HUUB 4P5SA 1G0XA 3IXAA 1G6RA 4Y9EA 1NMBH 2FD6L 2EABA 2K6WA 2BRRH 5LAXB 1PYWA 4WI7A 3TN0A 3UOAB 1RUKL 4EKXA 5DVPA 4JN2A 2YXWA 5L8JB 5FK9B 4GP4B 1BFSA 2N59A 1FORL 4PJCF 3MV8B 4D9QE 4JB9H 4Z6AT 2IPTL 2Z92A 4X98A 3U1SH 4YEFA 1E9QA 1EK3A 2BRRL 3SJVE 4N25A 2YAFA 1SEQH 4I9WE 2D0FA 1JL8A 1LEGB 2VQUA 1GS8A 5HD8D 4XBEL 1A7OL 1JS4A 4NM8H 3SDDC 2R51A 2ATAA 2F5AL 4K7FA 3BEWA 1A8ZA 4JN2B 4HQQH 3EHBD 3V0VA 5L9DH 3WJJA 4K7PX 1GGIH 3QS2A 3HFMH 4TULL 4HAKA 4KK5D 1TCRB 4NFBA 1P1ZA 2FWOA 2W9LA 4TSCL 5AVYB 5DJ0A 5IROA 4N2AA 1OPOA 5K59F 1NAML 1SOXA 1YEDA 2R2EA 5IK3B 1JZGA 4KUCD 4N28A 3B2UD 3DSNA 4X80H 3HPLB 3QQ3B 4L8BB 4L1BA 3S36X 3QXAA 4JJ5A 3HFML 3AB0C 4MZ2A 3TA3C 3IGLA 5ITFA 2WLHA 3GSQB 1H15A 3I9GL 5IHUH 4YDIH 1G84A 1FGVH 2A4CA 5IKCB 5E70A 4GIPD 1ODAA 1XSJA 4ONFH 1DBML 3UAEA 3ORJA 2YPLE 2G60H 3LN5B 1TQCC 2XUWA 1E28B 5I1GL 4MNQB 4ZPVA 2EDRA 4HPYL 4WI3A 5EO1A 1N3NB 1BQLL 3V9FA 3ZL1A 3QI9A 3C6EA 1I9JH 2NY2D 1T2QL 1Z0NA 4JPWL 4MJHA 5FDWB 3VRIA 3IMSA 1XTMA 3CXHK 3MRHA 3CNKA 4N2MA 4F8PA 1FCGA 4NN6C 4QYOA 4H0IA 2HB0A 4CW1B 4Z7VB 4LEEA 1MCOH 2IG2L 1USQA 3QDME 3POHA 2IQAA 3OMNB 4JZOB 1RUMH 5F6IC 1CTOA 5D1ZI 4TQEH 2F53E 3OC8A 4D9RE 2D3VA 2UX7A 2J8HA 2Y2WA 4FEMA 3KPSE 4PRDB 3O3UN 3QJFB 4MGXA 1BMGA 2HPOA 2OPCA 1TCMA 1BBJB 2XIDA 1IEAB 1JPFB 4NZTL 4Q89A 3SGJC 1BAFH 5KJRH 3QNXA 5ISZE 3ABKB 2PWHA 3DMMB 2AVFA 2VSCA 1I8LC 3H9SA 3NGBB 4X9FA 1V55B 5JNYB 4E5XB 3VG0H 1PL3A 2GAZA 2WY3B 1OAQH 5HGBA 5BXFB 1EV2E 4MMYB 4P2QD 3C08H 2NY2B 1PNDA 3QWOA 3FTGB 2CBQA 2DLTA 3DUHA 4UMGA 1HXYB 2XWRA 1IEHA 1UM5L 5JHMA 1R17A 1GC1H 4FXLA 4X4KA 4NAQA 3VI4E 4AKOA 5AWNL 2FEDD 2CJTA 4IKJA 2HPTA 1KC5L 3RIFF 3RWCB 3ZL4L 4GINA 4PJ9A 4Q74A 2XN9D 1UATA 4EBQL 1XB8A 3N43B 3LN5A 1ZT1B 3J2PA 4PJCB 2XRAH 2ODHA 5KTEH 4AYBA 2FWLB 5F89A 2IF7A 3KPRD 5HI5C 4AYSA 1L4IA 3F64A 4L0PB 4PHXA 2FNWA 5GGRA 5AD0B 2V5YA 4N0RA 3RDTA 2IQ9L 5C0RL 1WT5C 1W0VA 2BP0B 2HLFC 3ZDYF 4I18B 4Z7NE 1EH9A 5IP4A 3K0YA 2APWA 3LKSA 4G7YL 3TZVB 3F65A 1QRND 4J12A 4CVZB 1JYVA 4J1UA 3Q8EA 4EEEA 1KGJA 5FM5O 2AJVL 3X3FH 2P52A 4HWZA 3MNZB 3QPKA 5BS0E 1NC2A 1JXFA 4H8QA 1LEGA 2DEYX 4ZFQA 4H5SB 3D18B 4F1ZA 4JHBA 3SZ6A 5IBLC 1QSFD 1E9QB 2G30A 3HIZA 4P23A 2GITB 1MCSA 3KPRB 1Q1PA 5KBPA 3TA4D 1ZK5A 2HKAA 4G80B 1DLHB 5B3JE 3CSYB 5HHVH 4EJ1C 2GY5A 5CJ5A 1OAYH 3A67L 2VDQH 3R8QA 2J25A 1OW0C 4GMSH 3QXDB 3TJHD 4OUUB 3VH8B 5EZOH 2VIRA 3UGUA 3IXAB 3SDXE 4E41B 3ZE2E 1A7RH 3F7PC 5JYLA 2K3HA 3ATFA 1AO7B 4J8QA 4OIIH 5KSBA 3RBGA 3UZQB 2IGFH 2LFGA 2X1QA 4WJG3 4QKXB 1BP3B 4DZBB 1VERA 3TZVC 3PJSB 2P4AB 4OTXH 1BZOA 2E7HA 3KYMA 4DP1X 3HLAB 3LZNA 2EIJB 1I82A 1Q8MA 4M6ML 2CLRA 4LLUA 1HHGB 3O3EA 3RB5A 2YA1A 2OSYA 2HG0A 2XN0A 4HPOH 4NRXA 2ZNWA 3ABLB 1BVZA 2GITA 3M88A 1PZBA 3P69A 1JNNH 3GSXA 1CI5A 2YBRB 1GXEA 2CLVA 3ECBB 2F8VA 5D72H 4EIBA 1J8HE 4KRMB 5DK3A 3IJ9A 3L4XA 1S7XB 1A25A 2DWEA 3A23A 1DL7L 3EGDB 2F54B 5C2UB 1I7UA 2CMRL 1E4WL 4HV8A 2RHEA 3OZ9L 3D9AL 5IVXB 3MR9A 4N8CL 2K0RA 1A1NB 5D1XB 5H37A 3W5MA 2KZKA 3Q1SL 3RQ3A 2WJ7A 4JRYB 3JYCA 3LQZA 1A9EA 1B2WL 4AK1A 2NY4B 3L45A 4JMNA 1I9IL 1SXCA 3B6SB 4XAWH 4FXGC 4JG5A 5IHWA 1KCVL 1QFOA 3A6OA 1YSOA 4WGVB 3P30L 3FQWB 2GJRA 5DSCB 1V7NH 3CFCL 4OFDA 5EH1A 3L5XH 1PG7W 3C5ZC 3ILPB 3SBQA 1UB6A 1B2WH 2D3NA 4CSTA 1OM3H 4QRPB 2FBJH 4JO2L 3CFEA 3QEQE 4OGAC 1UOWA 1J1XL 5CCKL 3RWCA 1P84J 3V4VB 4XPTL 4YL4A 4BKSC 2CCLA 3S5LA 1CTMA 5DZNA 4X83A 3L5XL 5AVQB 4CA4A 3TBWB 1HU8A 3LJ3A 5D2LB 2NY3C 4DGUA 2BY2A 3QDGE 1DUZB 1T89C 1V54B 2CAKA 4Q4EA 5EB9A 4L4VE 3CFBB 1OPGL 3TV3H 1WV7T 3UXFA 3VWKC 4PCTA 4CJ0A 2X2JA 4K5OA 4F8TA 3HB3B 3LV3A 1PZ2A 1C12A 1FL5A 4M5YH 4ELMF 3DVIA 3MV7E 1AP2A 1OE2A 4E5XA 2XZCH 4RGND 3EJQA 2SEBB 4G3YH 3ZE1F 1MCQA 4QXVA 1V7MH 2DPKA 3AXLA 3B6SA 3U79A 1QZNA 2WHVA 12E8L 4XOCA 1FNGA 1BPLB 4R4FL 1PKOA 3UBXA 3STBA 1FA4A 3M17B 2NYYC 3R06B 3EO1A 2PYEB 5CINL 4QTIH 1FUNA 3QWRA 3H55A 1DJWA 1B88A 1KJMB 2BHFA 1AGDA 4YGVA 5ESQA 3B5TA 2XVBA 4JY5H 4UAOB 1KJ2B 5FYJH 3VG9B 5KYXB 3BPNB 1T6BX 2VDNL 3EGDA 4H88L 1NKRA 4B97A 2HVJA 4YHIA 3U82B 1MW2A 2NW2A 1PLGL 3KPPA 4CN1A 2N1KA 3OKNB 3SYCA 5E4EB 3GNMH 4U1SB 1MREH 1CR9H 2YD5A 3CC5A 3GIVA 4JY4B 1TTGA 2VKXA 3CXDL 3L17A 5DU7A 2ID5A 4OV6F 1L7TL 1RUQL 1S9WA 4OD3H 4LCWE 2WO2B 4XHJD 4HXAL 1R5IB 2WLNA 3QUKB 1JGDA 3LHPL 3V4PH 4HHAA 2BRQA 1MIEL 2F08A 4JJ5B 3JV4B 1NDGA 2D2CC 3PGFL 1D9KC 5KSAD 3OPZL 1VFMA 2A9NH 2W59A 3VD3A 1KFGA 5HHNB 2PW2B 4RWYH 1LQSR 2F1EA 4TRPH 4WJ5A 4XCFH 3FU5A 1E5ZA 3V0VB 3DOHA 1CDUA 3BWAA 3QUYA 4Y4HD 2P49B 1PFCA 3VD0A 3NCFB 5CIPH 4YSPA 4PCYA 3FH5A 5HI4D 4N6RB 3D2UA 4MAYC 5GRZA 1RIHH 3KPRA 4KH2A 3BZ5A 4IGBA 2LLLA 4M1GL 1QA9A 3ABGA 3N9GL 4PI2A 5E6RB 5HDQL 1B6UA 3OAYH 1KTDB 2YQGA 1OP5K 3VRLF 4HS6A 3MRRB 1M4KA 3U9WA 4MA7L 4UM8A 5AOMA 4H25A 1VLXA 5JW5A 4H1LB 2VWEC 3FU7A 4N2GA 1O75A 1HI6B 3WD5L 3QQ9D 3MC0A 3LDBC 3ROOB 2FATH 2WXMA 3CVCA 3QIUB 3M17A 4GRLB 1ADQA 3IS0X 5K33A 3FT4A 4KHTH 5D2NB 2ZZUT 2W9EH 4I1PA 4YHML 5A2CA 3DX6B 1SDAB 5IIEB 5HXMA 3TWCL 4NQXA 4HC1A 4JE0A 4L5FH 4XNUL 4JHVA 1JHKH 4LGSB 3OAYK 1LHZA 3QZWB 3MBEB 4NIKB 4R2GB 1X5AA 1HE8A 3QORC 4UDTB 4MAYD 4PJCA 5I1KL 1UASA 4ZXBB 5I5IA 2DYPD 3ZRFC 4C47A 2AKRA 3APNA 3WN5C 2HFEA 3C87A 1BVNP 4Z0BL 4EN2A 1OGAA 4K71C 3PWLA 4LDCA 3PUCA 1CR9L 3MCKB 4M1CC 1I7RA 1P4UA 2A2QT 1A6AA 1SBSL 1NBVL 4LOUD 1NBQA 1EAQA 2ZG3A 3T2QA 4M4PA 3L3IA 2CKBB 3DNKA 4X5XB 1RHFA 2IPUG 4OCRL 2ALWA 2UZPA 1OB0A 2UUDK 3DOSA 3GMNA 4PJ7B 4DTGL 3G5XB 3K6IA 1FLRH 3FFCE 4NZDA 3FUKA 3H9SE 4X6BA 5G5DB 1WFMA 5DZJA 3V5DB 1J5CA 1JPFA 3D05A 1DO5A 5F7FA 4B27A 4ORZC 1D3CA 1HNGA 4J4PC 3T6ZA 3OG6B 4JPIA 1HKLL 1S7QB 3BAJA 3G6DL 2O6FA 1QNIA 3EH3B 4V2BA 3VXNB 5JXAL 4MQ7B 3AVEA 5DMYA 1PY0A 3BP7B 4KFMA 2AQQA 3MACH 4Q56A 5KVGE 2NNAA 2ENSA 1BECA 4KKLD 4A04A 2OLDA 3FO1A 4PI0A 1IEBA 3HZYB 2DMKA 2R0LL 2DTSA 1T2QH 5I6NA 3JYBA 2PPAA 1WIPA 3RY6A 4PH8A 4G83A 5T1KD 2JJTC 2HJFA 1DTUA 3I6GB 2C9QA 2DQGH 3CLWA 5MENA 4NSKB 3GZOA 3UTPE 5J1SC 1CFNB 5AOZA 1EHAA 2XWTA 3O3EB 1C5DB 5GGQL 4Q9QH 4W9IC 4NUGL 5IFHH 3M07A 4EN3C 3SSGA 5I1LB 2K1MA 3SY0B 2G75B 4XP6H 4MASA 1MFBL 3B4NA 1B90A 2BJML 2RH0A 2Y1YA 2ZWNA 1T66D 5FYKL 1IAOB 2DMBA 2NY6D 3DROA 3UERA 5KSUA 3K6DA 2OTUA 1M2VA 1ETB1 1MLCA 1QHPA 4JFDE 3VX0A 3LEXB 4N8VG 4CC0A 4AUJA 4MXWH 5DEGA 2OS7A 2J73A 2PWGA 2DLGA 1YC8A 3TBYA 2DRUA 5B39G 4AWJC 3SDYH 5B1BB 5C0CE 3QXDA 4LQ1A 3G08A 1Z5LA 3OKKB 4GKLA 4XBPB 4A6YB 1IC4H 4GLRI 1JZ3A 1U3YA 3E38A 2JB5H 3HFFA 1O6TA 3LS4H 4YHLH 1LEIB 4PRPA 3FT2B 2LAGB 1VZGA 2PTTA 3RFRA 3HG1D 5HVHC 4LGRB 5GS2D 2X5PA 3ISYA 1ZPUA 3ARGA 3UZVA 3RFZB 3TJHC 4E9YA 3FFDB 1AG6A 2BOBB 3NSXA 4HUKB 5LBSH 4KJYB 3AITA 3BI9X 2Y6SC 5EA0H 1G6RB 2R29H 2X6BA 4JQVA 3HRZB 2DD8H 1IJNA 2H6OA 4BZ1A 3DDFA 4XP5L 1YQVL 1MLCB 3LPOA 5D6CA 5HI4C 3GIZL 3TJPA 3E1F1 1CLYH 4AQ8C 1V7ML 2ICWB 1EEQA 5IVXF 1KTLA 2WMPA 2DD8L 5KBKA 1XH0A 1YEIH 4U1NB 4KMLB 1XTLA 4DGVL 5ICZB 1LJMA 2YA2A 5FO9B 2R0LH 1U91A 4IKIA 4L8CB 4RFOL 3U0WL 3TYFA 2A6IB 4NKDB 3EG9B 1C5DA 2ILLA 1KG0A 4UT9L 3U9PL 2BOLA 1VACA 1UCBH 3BT2L 5JOPD 2V7NA 4A7GA 5DZAA 4W4OC 1J48A 3K8MA 3ZMEA 1VADA 4U6XB 4FMVA 2V7HB 1QG3A 2QLVB 3MOQA 3LN4B 4URKA 1KLGA 2CG9X 3MRLA 3P3SA 1OEZW 5CGYD 1JHLH 4ZO6A 3MBED 3IRPX 3HLKA 1T0PB 2GW5A 2VM9A 3N55A 3DJTA 1QABA 1TJIH 1DLFH 2W0PA 2CRYA 3FTGA 5DJ6A 3K72B 3BSZA 3QWOB 2G2PA 4OF6A 3O6KL 5C0BD 4MZ3A 4PW3A 2AEWA 1V3JA 2F5AH 3KVPA 4OIIL 1WZMA 3HUJB 4HA1A 3ZBMA 1A3LH 5E2UL 5H37H 1IIKA 5F7DA 4JPVH 3D0LA 2RB8A 4JM4H 1IEAA 4K3DL 4TUKL 4U4BA 4XP4L 2VW6A 2EDWA 3WG7B 5I8KH 5AKSA 3PGFH 1QSEE 3QJFA 4D8OA 4P59H 5ANHA 3TIDB 1Q1JL 3WBDA 1QFPA 1FFNB 1PSKH 3NP3A 3ZRSA 2D73A 2VDRH 5D1QA 4JKWA 4NNYB 4IU2A 3W39A 4OZIE 2KPWA 2X10A 3KJ4B 4ABUA 1G7MA 1FSKB 3P2TA 3L3IB 5HY9B 3HN8A 4JO4L 1OCRB 4U1KB 1IGIH 2DWTA 2C9RA 4AGPA 4OGXL 4OZFG 4QOKA 1KCSL 4HS8H 4L4VB 3UADA 1W2KT 4A39A 3EYOB 2R1YA 4IMLA 2Z64C 2EDOA 4NZRL 4DPRA 2R83A 1FRGH 2N1TE 1BQUA 2Z7UA 5E1HB 1C7SA 1VB9A 3A4FA 1P6AB 1M71B 3B34A 4O02B 2J1YA 2IDSA 5D1ZC 2PR9A 3V8CA 4YHYB 1WVZA 5D93B 5IKCA 3WV0A 3HOGA 3G5YB 4FKHA 3EJPA 1IV8A 4GYBA 4S2SB 4Y5VA 1EEYA 5F3HA 3L3DA 4TVSa 3IFPA 1CLYL 1LO0H 4Y5YA 1HQRA 3NCYS 2APBA 3K2UH 4TOYL 5AW0B 4PCSA 2GK0A 4PY8J 4Y7MA 3MRBA 3ZLQC 2QGDA 1F2QA 4FQJL 4AEIL 2FWOB 2AXJA 4NGHH 5D93C 2JKNA 4NS0A 2LU5A 43C9A 1KV7A 1IQWH 3I2CL 1MEXH 2DY2A 3G9AB 4UT9H 6TAAA 3IKKA 4DPCX 3G6AB 4JCWA 4QHUB 4H25B 2ZG1A 3QUZB 5D6DC 5CSGA 5AOJA 4DUWA 2ZKHL 4PYGA 1KTDA 4L1TA 1Y18A 3QE5A 2YSTA 4PIRF 4FF9A 1KDJA 3ULVD 1MCEA 2BFVL 2XVGA 4U1JA 4IGBB 2P5WE 2YJLA 3MV7D 1BF8A 2UY7A 4N0UE 2DYRB 4TSAL 4B95C 3MJ9H 3ZX1A 1NCDH 1MNUH 3HE7B 3LRMA 1XHHA 2VDKH 4PJEA 5FK9A 4PREB 5D70L 3G08B 5DO2C 3W9EB 1P5UB 1ZDQA 3HG4A 3EZ8A 4G71B 1YYMH 1SN2A 2WQVA 1INQB 2J6EH 5HGAB 2AMUA 4DUXA 2EUZA 4FTVD 4UQBA 4GSRA 1B0RB 3L9BA 2I27N 3ZT7A 1HH9B 2MSPA 3HG5A 4PUBL 2XLLA 3CK0L 4Y2NA 1UM4L 2OMXB 1K85A 1XF4B 1IAKA 3QUMB 1H0DB 4MRBA 4E2OA 1MF2L 4LPVA 1S46A 1R5IA 2OJ1A 2ZYRA 1NPNA 1UVQB 4P5KB 2C8NA 4R4BB 4P3CL 1FNFA 4WI9A 3VFTB 1E5CA 3SY6A 2WGNB 4DH2A 4BFKA 5EDXA 2JI3A 3OB0H 3BOVA 3QJHA 1BZQK 1RZKC 4WWKB 1U8QA 3NIFE 3NAAL 2AITA 4C56D 3QJXA 1AHWA 3MREB 3KXFA 4ZX5A 5LNGA 1HL5A 3CDGA 1T3FA 5DO8A 4ZI8A 4LB8A 3QAZC 1D5XB 3DGDA 1QKZL 2ENPA 1DQIA 4W4OA 2LOEA 1BD2E 5B38B 2K78A 4OM1H 2OL3L 4DSYA 5C09A 5ADPL 1UFGA 1XL6A 5E51A 1XGUB 3T0EE 1KJMA 4LCYA 2AEPH 3NRPA 4AQ1B 1F3JA 5E8OB 3STLB 1AGBA 2LU3A 3PHAA 5CBEA 3OJDB 2XNAA 4PRAB 4Z3FA 5TK2A 1AS6A 4U6HB 5DC0A 1F90L 1YO4A 1OTSD 5K9JL 2MCG1 1KENH 1ZDSA 4MJ4A 4W9CC 5HYQA 4GXVH 3AWGA 1KB5B 5T1MB 3MLWH 5T3ZH 1OAZH 1OGAE 2NY5C 2WLYA 4I88A 5I9QC 3GO1H 1ORQB 3IFLH 4P2RE 5DQJB 2YLKA 1GYUA 4V1DA 3O6KH 3MV9E 2OW7A 2XIBA 3LZLA 5BNXD 1DVTA 1MRDL 1C5BH 1YEEL 4NQDD 4HHWA 1J5HA 4LOUC 1QRNE 3BGFC 2WZ0A 1EMTL 5H37G 3S34L 1FG9C 4P5TA 4MDIB 3EBHA 2MCMA 2GBAA 2VLKB 3NACL 2BC4A 3L81A 1JZ2A 3PP3H 2OMWB 3QRBA 2WLIA 3JV5A 4O2FA 4OSUH 3F7RA 1NGZA 3LH9A 3TN0C 1JN6A 3MBEA 1H8LA 4ZPTB 4XXWA 1WIUA 3BHBA 4KTGA 1Z9SB 2J1WA 2BIOA 3DX9A 3T4YA 3W11D 1W91A 1LWRA 4LOEA 4C57C 5LWYH 2MMXA 4FNLH 5AALA 3CVDA 4Z7UE 3AQXA 1RHHB 2BY0A 4JG1L 4NPYB 1N5AA 1SRDA 2OMTB 3PFUA 5IGXH 5AENA 1SN0A 1JGUH 2IDTA 2EECA 1R34A 3GIZH 1KCWA 4LKXA 4YVNA 4XVTL 1BG1A 2DQTH 1O9ZA 4NQED 4MAUL 4G6FD 4XAKE 4Y4KD 3ZHLA 1I7UB 4HV8B 3SYAA 4H1LA 2F54A 3P0VH 5AYUH 3RWDB 1EIBA 3L4UA 1CFSB 2FB4H 3QZNA 1SOKA 2FSEA 4NKOB 4YHYC 1QFWH 5BO1H 2IEPA 5GGTL 1NOAA 2FJHB 3PWPA 2OI9B 3OM3B 5F7AA 1S4IA 1KOAA 2VABB 4NLAA 2XN1A 4B9GA 1OAUL 4YDJB 4DOHB 4YSOA 1T03L 4FZEH 1JGEA 2A6KB 2H47C 5L0QB 3UPRA 5JYMA 3MRIB 1DYZA 2DLFH 4X7EC 5GGTH 3BWAB 2FD6H 4GH7B 5I76B 3ZKXB 1PAMA 4GRMB 4MXVE 3ZTEA 4F7PB 2CDGB 1G1YA 3BE1L 3HC2A 4QRFA 1R5VB 3EZJB 1QRNA 2I5YL 3E7JA 2WTRA 2X9ZA 3MLVH 4OBRA 1PZAA 1I9EA 1BAGA 1IM9A 2HTLC 4JPVL 5BPPA 1U4EA 3W38A 1COBA 4MA1B 4Q14A 3WLBB 5AAWA 1HE7A 3IGKA 3VFRA 3A6BL 1MRDH 4OLEA 5CMAA 3T8XA 5C0BE 5L2KA 4WHTA 3TTYA 1PU0A 2WXJA 2XKUA 1KB9K 1GGCL 2JJSA 2KLTA 1AZNA 1JBJA 1B0GB 3APCA 2XOTA 3HZVA 5SX4I 3HKFA 2BSBA 4U1SA 3GSOA 2A9BA 4K3EH 1UWGH 1IGYA 2ZXQA 4H5SA 4NO0D 4XWOD 5K59E 1SVBA 2DDQH 2VQ4A 2PCXA 4HS8L 4KO6A 1NINA 3VXPB 4KROB 1ACCA 3FB7A 2AJZA 5B1AB 3DA0A 4KTDL 3MLTB 2IANB 1PEWA 3ARXA 1KJVB 2HFGH 4ODTH 4XXWC 4LFHG 5ESQB 2AZAA 4Q97A 2R59A 2ZUVA 3DXAE 5FUOH 2OMZB 2D7QA 4MRCA 2YXMA 2PYEA 1M6UA 3LKSB 3CVHL 5A6LA 4RISL 2DN7A 2OP4H 4ZUVB 3HE6B 4MXWL 3MYZA 5C8JB 1FNGB 5I73C 1F0LA 1FZJA 3V4UL 4XCYB 3POCA 4X7CC 1JXGA 1KEGL 3KHOA 5AW2B 4NO3A 4NJ9L 2Y3NA 2EDDA 4Q2ZA 4ALAC 5M95B 4HIEA 2ADIA 5F3FA 1D6VH 4ANWA 1T1WA 1U0QA 4YHLL 3QI9C 1RVFL 1C9SA 2HZHA 4JREB 2PW1B 2OR9L 1TJHL 5LO7A 4Y8DC 2EJ1A 3K3QA 3Q43A 3PJLA 4PJ5D 3FU3A 4QXUH 2RFXB 3D30A 3HTLX 3TBTB 3LY6A 3BIBX 4OFVA 4KPHL 2VE6A 1DBJL 1ZEAH 2V6HA 4PWFA 2OBGA 3REWB 4Y2OB 3VFUA 3TEUA 1GY1A 4NZTH 4MMZA 2XCMC 2FBJL 2B16A 1OGTB 2ZYIA 3PXHA 4TLKA 4RFEA 4B53A 2QKIA 2X88A 4WQOA 4I8DA 5DZVA 4R2GC 1MFVA 4EDXB 4PG2C 5E5LA 4QRPA 1OV8A 2ZCLH 4NCDA 4ODHH 5AYQA 4NBYB 4XNZB 1R19A 3KWXA 3BFOA 2AQRA 4AC2A 1D2PA 2PKDA 3LKPA 3FQWA 3OMIB 2HJKB 3SGJA 1T80A 1WWWX 3TCTA 1ZIBA 4LHUB 4A2MA 1X5GA 4X8CA 3CLEL 1CWVA 3SPIA 3B3IB 1SJVA 4CUCA 3RI5F 4PJGB 3TA3D 3CVHB 4OZIA 3ISWA 3N04A 5KZCB 4AV5A 4FG2A 3ZK0A 3OJDA 1ZTXH 4HCRL 2KMWA 3NZ8B 3RJDA 4XPBL 5IW1B 4Z3EA 5DC9B 3UPCA 1J5OH 3K46A 4LCYB 1S7SA 3FQUB 1P6FA 2NY5H 4KNTA 1UT1A 2JJSC 3I75A 3WS3A 2GEEA 3E6HA 4XGZA 3F6IA 1U3ZA 2MOVA 4M03A 5D72L 4AJ0A 4H20L 2OJZL 2C7FA 4Y9CA 4R0LB 3Q1EA 5DD6A 5H94A 5ERWB 1E9OB 4BFGA 1A3RH 3MREA 1AHWB 1CXLA 2V0AA 4RAVB 4X4XB 4UANA 4MNQA 3GBDA 4M7ZB 3EJSA 3SJVD 1FH5H 1ND0A 3E2HC 3LPFA 2ZCHH 4KJQC 4UNIA 2YWZA 4XX1E 3C6LA 1XH1A 2NNFA 1MVUA 2ICWI 1SYSA 4QHMB 2ZX9A 1WT5A 1KYAA 4YSUA 1CYXA 3UTTE 1IAIM 4WEEA 4FQCL 5ITFB 2AJVH 2HWZL 3X3FL 1H6EA 1J0HA 4JO8A 4DQOH 5ID0A 3VGHA 4BA8A 4UZSA 4KFZC 3QQ9C 1DBBH 3OX8A 3SO5A 4KK8D 3D85A 3REVA 1N6QL 4JDZB 3FRPB 2ICEA 5ICXA 1QSFA 4N8PA 5DJCA 3D3VB 4QMEA 4G42A 5BQDA 1BLNB 2EH7L 3WUWA 1VENA 3EUUA 1A7PH 1CDHA 4FI8A 7FABH 1OCWH 3KGTA 4NYLB 3L7EB 5DI8B 2ZPKL 4JO4H 1MLBA 1JK9B 4QXUL 1IFGA 3K6SB 3SBWA 3VNYA 4MNHB 4IYKA 3EDDA 4JRXE 2Y7QA 4L8SA 1G7LA 2NT1A 4ODXB 4G80A 4GSDL 3WTYA 4X5WA 2KL6A 5FKPB 1BHGA 3P54A 2GTZB 1ID5I 3FC8A 1I8IB 5BJTB 4PAZA 5I5MA 2UZXB 3E8UL 1ZSHA 1KJ2L 3HVNA 3LNGA 1IM3D 1GGBH 1GKOA 1T0MB 2OA9A 4HGWA 3RNKB 5B38G 5IQNA 2BERA 3C5ZA 2QQNL 4RMWA 2E46A 3H42H 4YHOL 3EYQD 2PCYA 2LR4A 3TZVA 1G9ML 4FI7A 1FFOA 1EGJA 1JWMA 1ZXKA 2O72A 2WBKA 2I24N 1HQRB 2OK0L 4UM9A 1BZ7B 1G7JA 1T2XA 4ZODA 1FDLH 1NM9A 4BSVA 1O0VA 5GS1C 3T4AC 4TQPA 4S2SA 4Y5VB 2NX5B 3CFNA 4H0LC 2JLLA 1M7DA 1I4FA 5F0LB 1T89A 3FZUC 1YY8B 4H2AA 2J20A 4O02A 2CZNA 1WBXA 2C4FT 4JMXA 3BP6B 4AYEC 1CD8A 3QZBA 1YEJL 3IGAA 4PJ9B 4DO4A 4F8LA 3K6FA 5FF6B 3IGFA 2J8UF 4IBVA 4LSTH 2MCAA 2QADB 3NCBB 5C09E 3S35H 1R24A 1YN6A 5IVNA 5FFOA 2Q6WB 3KLSA 2VITB 2ZCHL 5E7BA 5JLZA 3V4UH 3WFEH 2KZBA 3OGCA 5FR3A 5HJDA 2E7LA 1Q0YL 5I1HL 3CMOH 3BMVA 2XICA 3SOBH 3V0AC 1HL4A 4MB3A 2CDEA 3UAJA 1JPGB 3DIVA 1RULL 3CE1A 3V52L 3BO8B 1WH0A 3RWGA 3VRJB 4LLWA 5I74B 3GMPB 4P9MH 5DD1L 3BESR 4B0MB 1MI5A 2ITDA 2BCMA 3Q6GL 1U8JB 3RE0A 2AQPA 3TIDA 3VFOB 2Y24A 3EO9L 1IC0A 3QDJA 3NA4A 4Q9BA 4CGUB 1AKJD 5A16A 4RWYL 1IVLA 2BIQA 4DNLA 4RGMB 1JNHA 3W11C 3F62A 5LXGH 4XB3A 4PJFA 2C9VA 2DM3A 3IJYA 4HEPA 1KXVC 2GJ6A 5KSBF 1R33A 4OCLC 5F7EH 2P80D 3FN0L 3L3HB 1JGVH 1SLVA 3QSKB 4F7EB 3H3PH 5CEXA 4JO3L 3ROLA 5EUKA 1LGVA 3SE4C 1ROWA 4R7LA 2ZWZA 2OZ4H 3CWGA 1HYSC 1XGRA 4ODUA 3KJ6L 2D4DA 4IEFA 5KYYA 3MRCB 4PS8A 4G6FB 3NZUA 4O5LL 3MCLL 3T2NH 3U83A 3K6NA 4JRYE 1JNNL 4B6ZA 3HBPA 2LHAA 1E28A 2QKSA 3VXOB 4ZMNA 3TEXA 2Z7WA 3FCGA 2BSCA 5D1XE 1I1AC 1WFJA 2HKHL 3JWOL 1O6SB 1TF4A 3JV0A 2CO7A 1BXVA 2QLYA 1E4WH 1EVTC 1BVKB 3KS0H 1UA3A 3MUZ1 1VCAA 3O4LE 5SV4A 2XZAH 4KNQA 3QJOA 5TPWL 4KO7A 4GXVL 4NQCD 2D7PA 2QSVA 5GS1A 3NIGF 3D39E 4E9RA 5J0BA 1HINL 1RPUA 3IS1X 1KEGH 4X6DB 3HPJA 2IC2A 1NCBH 4YXHH 2WKOF 5FYKH 4NO2B 1P1VA 1RUPH 2ICEC 1BDYA 3KCPA 4ES9A 1CFQA 1IT9L 4DKFL 3NABH 1W72L 2FJGB 5E7FA 3C60C 4N2CA 1OLLA 2GI7A 1RI8A 5AUMB 4LL1A 2Z92B 5I6OA 2BMKA 2JJWA 3VWJC 4M93B 1ZLDA 3UAJC 1YVLA 4RIRB 2VOTA 2XWXA 1HC1A 2FX8H 3GS7A 1AD9B 5B8CA 3ZE2B 4QKTA 1CK0H 2ZQKA 2VO5A 1S8DA 3B7TA 1K8DA 1NFAA 5DHYA 3GXFA 5DRXA 3T3PB 4BCYA 5F71A 3D25A 1DEDA 2WQ8A 4X4ZA 4F58L 3MRJA 5E56A 3QQDA 4NUJB 1F4XL 8FABB 1E6JL 1KDIA 5CU5A 3WJJC 1BV8A 4FDWA 3WE6B 1EJOH 4LOFA 4CMMA 4G1EA 4TVPE 4OZGB 5IROC 2CDFB 2ADFL 2I69A 2O26U 1VCBC 5HHME 1SXZA 4NQDA 3O6FB 4AX3A 1ZA3A 1EANA 2IXQA 1D2OA 3CDZB 5ICUA 4ISVA 1UC6A 2H41A 4QR7A 4HKJB 5DLLA 3MRMB 5C0GB 5L9DL 1S7UB 4JVPA 3UTOA 2ZWLT 4R83A 1JP5A 3CSFA 3C6LD 5FYJL 4OGQC 3MCLH 2C26A 3H2QA 3BEVA 3UJIL 1TKWB 2ORBL 3LZQA 4XNQA 2V5TA 4UDUB 4Q6YA 3W0WE 1B0WA 3OB8A 4M93C 2CNYA 3MKKA 2FGWH 4J4PA 4L9DA 4X9BA 3DXAA 4OI9A 2DBJA 4WW2A 3FUNA 1FAKT 4JPKL 2VDMB 4HWBA 2XTJB 4AQ1C 5JPMB 2DYPB 2X28A 3V6FB 2QQLH 1KEML 2VLJB 4R2GD 1KPRA 3MPCA 5D96C 5A2IH 5TQ2H 3VXNA 2EE3A 3GUTB 1S2EA 3O6ML 1WA0X 3O11B 3ZE1B 2Y25A 2C3GA 5EPMB 2EXSA 3S8GB 3QAZB 3T5WA 4JGNA 5DK2A 1OAXH 2I07B 5HYJB 1EDYA 1T1ZB 2WVVA 2F7RA 5F93C 1DDHA 2H5UA 5DEZA 2R23A 5CSZB 3FRUB 3THML 3DOSB 3BKYH 3BXNA 1RULH 2OMYB 4TUJA 3SKMA 3WL9A 4F7TB 5JOFB 3H7LA 1LWHA 4P3CH 1IM3A 1OZTG 3HHRB 4KK9C 4QO1A 4RQQB 4W9HC 4XN2A 4XCEA 1HHKA 2HT4D 1FVCA 3JUYA 1OGAB 3VTMA 4QCIA 3M1BA 3FUDA 4RNRB 2VRQA 3VXUB 2R1XA 3N9GH 2IADA 2KDGA 4CKQA 3KLHC 4UYQA 4NFDA 5FXCH 1PS3A 1KULA 4UIMB 2IAMB 5GZNA 4YZFE