3NYKA

The structure of cobalt-substituted pseudoazurin from alcaligenes faecalis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Pseudoazurin
publication title The crystal structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nykA00
1CYXA 1E5YA 3WNIA 1GY2A 1AZUA 1URIA 2PPDA 2QPEB 2YARA 2PLTA 3DIVA 2IDQA 4AKQA 4DP8X 2HRHA 4L0PB 3T6VA 2IWFA 2XUWA 2P80D 1GS8A 3NT0A 4YL4A 3X1GA 2CJ3A 3UACA 1MZZA 1ADWA 2HZHA 2W88A 3BVDB 1IBZA 1JXGA 3HEIB 4E9YA 3NJKA 4MFHA 2H5UA 5D4JA 2GHZA 3ASNB 2IDTA 1AIZA 5I28A 3PAVA 1E65A 4YSUA 2EIKB 3TU6A 1A8ZA 3FYEB 4G72B 4QKTA 1AS8A 4CSPA 2J55A 3MBWB 3FSZA 4E9TA 4TXVB 5I5MA 4NB7A 1ZPUA 5D4HA 3N55A 1FA4A 1SF5A 1A3ZA 1NWPA 3OM3B 4DP4X 2GI0A 1PLAA 2FWLB 1W6WA 4ZK8A 4A2HA 4HIPA 9PCYA 2ZOOA 3WNJA 2FJSA 3GDCA 3AY2A 3EHBB 2XV0A 4A66A 1AZCA 5AFAA 2HX7A 4WKXA 3SBQA 1AQ8A 1KCWA 1OCZB 1X9UA 3ERXA 3TBCA 1A4AA 2Q5BA 3X1BA 6PCYA 2PPAA 1AG6A 3NJNA 1EHKB 2UXGA 2BWIA 2VMJA 1ZDQA 3ASOB 3WG7B 3OQRA 5B7FA 4EF3A 2YAOA 1WS8A 5B1JA 4A68A 4CSZA 2IH9A 3GYRA 2QPDB 2JXMA 4E9SA 1A4BA 2DWTA 7PAZA 2UXFA 4M3HA 4PAZA 1SFHA 1AANA 5I26A 3UABA 3NYKA 1KBVA 1ZIBA 1M9WA 2DYRB 1GY1A 2DY2A 1CURA 1J9RA 5PAZA 4GY4A 1MG2C 2H47C 3CDZA 2HLEB 2N0MA 1J9SA 3TASA 1HFUA 1L9OA 1PNCA 3WKQA 2PCFA 1AAJA 4E9VA 4YSCA 1JZFA 5D4IA 1E67A 4DPBX 4G71B 1HAUA 3NJLA 5B7EA 2DWSA 2HXAA 4HALA 2FT7A 3EH5B 1FWXA 3WKPA 3DTUB 4HAKA 5F7BA 1J5DA 3ABMB 2GC4C 2IDSA 5PCYA 1BXUA 1XB3A 1J9QA 4HCFA 1SJMA 3UAEA 3QJSB 1YLBB 1QHQA 2IWKA 5I6NA 1WS7A 4F2EA 2WSDA 1BQKA 2B08A 2ZWNA 3T6XA 3ZX1A 1IC0A 2BP0A 4KNSA 4HCIA 3UADA 3NP3A 3WI9A 7PCYA 4JHVA 1NDTA 4YSPA 1XMEB 3IE9A 3AG2B 1AZRA 3S8FB 3S8GB 1TKWA 4BWTA 3BQVA 1L9RA 2XX0A 4AI7A 1W8EA 3SBPA 3FYIB 2VN3A 1ASOA 2R7EB 4Q89A 4KO5A 3S3BB 1PMYA 5B7MA 2X87A 3JTBA 3AG4B 3X1NA 3ABKB 5I6PA 3PLYA 4ENZA 3NSFA 3FU7A 1HAWA 1RZPA 4YSEA 1MZYA 1KV7A 8PAZA 1L9SA 1NWOA 2YXWA 1PY0A 3X2QB 1ETJA 3ZIYA 3QJTB 3NSYA 2YAPA 2P80A 3NJGA 3FS9A 3QPKA 1KBWA 1WAEA 2XV2A 4UF7C 4FAAB 1JXFA 4YSOA 3C75A 1BYOA 4W9ZA 3H56A 2WO3B 1MG3C 2LLNA 1ASQA 2RACA 3OMAB 2QT6A 3NJJA 2UXVA 2XXFA 4UANA 5A7EA 1AOZA 1IKOP 3G5WA 2VSKB 1GR7A 4DP7X 1SFDA 3H4FA 2H3XC 2OJ1A 2XVBA 1L9PA 1SNRA 4AX3A 1SDDB 3IBOA 1VLXA 4W1TA 3N2JA 3NJHA 2GSMB 1L9TA 1GSKA 2WO2B 2ZXWB 2Q9OA 4DP5X 5E9NA 3FSWA 4BWUA 5IY5B 4YSTA 3EH3B 2PP8A 1EZLA 3SQRA 4PCYA 5ANHA 4KO6A 2EIMB 1JZEA 4DP2X 4YVUA 2B3IA 5B1JC 1SF3A 2VM4A 4KOBA 2I7SA 4BXSV 5EHFA 1OE3A 4HHWA 1V10A 4RH4A 2AANA 2AZAA 2FQFA 2VM3A 1V55B 1PAZA 2BP8B 2GC7C 3FSVA 3X1FA 3NSCA 5I6KA 2VW7A 1M56B 2IH8A 4A2FA 1ET8A 4KO9A 2GB2A 4AZUA 4DP1X 4BK5C 5I5JA 1OF0A 2XU9A 1JZGA 2J57A 3T71A 6PAZA 4F2FA 2YXVA 2FT6A 1PLBA 3KW7A 1ET7A 3HB3B 4N4YB 4F7KA 2JFCA 5AZUA 1BEXA 2X88A 1ID2A 2BZ7A 3AG3B 4JKNA 1XB6A 2FNWA 4GXFA 1JZIA 3FQ2A 2XWZA 3H4HA 2I7OA 3EH4B 1WA1X 2FQDA 1NIBA 1F56A 1BQ5A 4DPAX 2TSAA 3CZUB 4M4RB 3AW5A 1ZV2A 1AS7A 2IDUA 4P5RA 1KYAA 3V9EA 1J5CA 3PXLA 2FQGA 2PP7A 1AG0A 1JVOA 1NIFA 2HX9A 2XV3A 4GP5B 3T6ZA 3S3DB 1JXDA 5LDUA 1N70A 3CVCA 2PPFA 4G7QB 1WA0X 2OCCB 1ILUA 1OCCB 1JZHA 2EILB 3AZUA 2FT8A 2CUAA 2BWDA 2FQEA 3OMNB 3FPXA 1W6LA 3ZDWA 5I6MA 1TEGA 3OD3A 2PCYA 3FU8A 3CG8A 4BXVA 1NIDA 1X9RA 3QJVB 3U25A 1OE2A 1I53A 3PPSA 2UX6A 1PZAA 1J9TA 3CVBA 3NJFA 1MDAA 1FFTB 2AZUA 2IAAC 4KNUA 1IUZA 4WTQA 1TEFA 2PPCA 1BXVA 3IEAA 1QLEB 2HRGA 1QNIA 2MTAA 3QQXA 4G7RB 2I85A 4KOCA 4E9WA 3IN0A 1XB8A 1NIAA 2XX1A 1A4CA 4A2GA 4E9QA 1NIEA 1ZDSA 2PP9A 1WA2X 3QJRB 1NTDA 2W8CA 5I5IA 2Y1AA 2AFNA 2YQBA 3GXUB 3ABLB 3EF4A 2BP8A 3JT2A 4GP8B 2YAMA 3QJQB 2A3TA 5TK4A 1L9QA 1PZBA 2NRDA 4HZ1A 3OMIB 3WIAA 3V9CA 3KW8A 4KNTA 4YVNA 3UGEA 2VW4A 2XLLA 4G7SB 2BW5A 2QDWA 3UAAA 3QJUB 2E86A 4A2DA 3FT0A 4N8UA 2BP0B 1OV8A 4YSRA 4A2EA 1IBYA 2TSBA 2IWEA 2GBAA 1BQRA 4BDVB 1GYCA 2XYBA 4BWWA 2XXGA 3L45A 4K9JA 2VW6A 1A65A 1GS6X 1GS7A 1GW0A 1TU2A 2BO0A 5I6OA 3IN2A 3FPYA 1PLCA 3TBBA 4Q8BA 4JHUA 3FU7B 1AS6A 1RKRA 2YAEA 3CVDA 3PCYA 4HHGA 4YSAA 1NINA 1AACA 4HCGA 4G70B 4DP0X 1DZ0A 2CCWA 1KDJA 3NP4A 4FA7B 1JERA 2CBPA 2EIJB 2Y69B 1ZIAA 3D12B 3NSDA 4QLWA 1PNDA 2DYSB 4YSSA 2YAFA 5B1KA 4DP9X 2UXTA 3DKHA 5B3SB 1ILSA 1ET5A 2J5WA 2R7EA 1AZBA 1V54B 2YAQA 1NPJA 4A67A 1OCOB 1NICA 1SHXA 1JVLA 1PCSA 4GYBA 5F7AA 3X1EA 2BZCA 4UAHA 4YSDA 4X4KA 5FC9A 4YSQA 2AVFA 1BXAA 3RYMA 1E5ZA 2YAHA 5B1AB 3FQYA 1RZQA 1SHWA 1KGYE 4GP4B 1AR1B 1NZRA 1T5KA 2VSMB 3FU9A 1PZCA 2HX8A 2ZONA 1UATA 4DP6X 5B1BB 2OV0A 1E30A 1BAWA 4E9RA 1OE1A 2MRYA 4P5SA 5AKRA 3ABGA 1CUOA 1RCYA 1R1CA 4AKOA 2IDFA 1AZNA 3FQ1A 1JOIA 2JKWA 1PF3A 3TA4D 1B3IA 3PAZA 1KCBA 2J56A 3NJIA 3SBRA 2CALA 4NAJA 2EINB 4AKPA 2BHFA 5I6LA 2BW4A 3NJMA 1SDDA 2QDVA 3T6WA 1BYPA 1NPNA 4E9XA 2FTAA 3S3CB 3ZBMA 5TK2A 1KDIA 2GIMA 1M57B 2UX7A 2CAKA 3MX0B 2DV6A 3T9WA 1N68A 1CC3A 1JZJA 3FSAA 1OCRB 1DYZA 4NERA 2PPEA 4BDVA 4KO7A 3AG1B 1OOWA 3PAUA 4DPCX 1ASPA 3CDZB 1CYWA
chains in the Genus database with same CATH superfamily
4M00A 4XB7A 2FEJA 1LL1A 3OAWA 4G9FA 1KNOA 1XGPB 3U36A 3LKQB 1GKEA 1XCQA 1DDHA 4XHJC 4JO2H 4PH8A 2R9HD 5KS9E 3IFNL 3O45B 3X1GA 2JB6A 4LDOB 4WO4C 4MMXC 4CC1A 4NOFA 5FUOL 5EEWA 1F0LA 4X4MA 2XV6B 1AGFA 4X0KB 1PKOA 2NY6B 3K5RA 3H42H 3VTAA 5KTEH 1IEBB 3WFZA 4FE9A 1T21A 3OJVC 1GGCH 4NJAL 1T83C 4G8GB 2GSIA 4DGVL 1NCDH 5I1KL 4AIXA 2X1WL 4IBUA 1CICA 5F1OB 3GSRB 3U6XS 1EEUA 1NCAH 3CHSA 2CJSA 4NLHA 3D4GA 5DVPA 3G08B 4WO4D 5IB1A 3DRTB 3HAEB 5TPWH 2PXYA 4NB7A 1QHPA 1JP5A 2B14A 2NCMA 3GZQA 4Y9BA 3SY6A 2WXJA 1WDAA 1WFOA 5EA0H 3BKCH 3QCTH 1XF3B 2R0WH 2ORBH 4MCNA 4ZXBC 4AE1A 3E1ZA 3QUZB 3D0AA 4HKXA 4MCYA 4ZMOA 4BFJA 2AEIT 4XMVA 3GNMH 4Y5YB 5HYQA 1HH9B 2OMWA 2W9EL 4LVHC 5CSBA 2E4FA 2R56H 4HK0A 3BHBB 1YY9D 3TBCA 6PCYA 5I18H 5ADPH 1JXKA 1E4XL 2Z91A 1UJ3A 4PMFA 3BZ4A 5CEXA 3PV6B 3A4AA 2HA1A 4Y4HB 4A68A 4I77H 4OZGB 2B4CL 4XOEA 1AY1H 2H9GB 2DWEB 5FF6A 1MCLA 2H0PA 2XICA 1FFPB 3D2TA 4M3HA 5D96B 1DBKL 2E46A 4MWFA 2DW5A 1COBA 2VKWA 5IW6B 5EEUA 1N64L 3PFUA 4K23L 1LP9B 4V1DE 3FCBA 2YKKA 5D7JD 3WMQA 3VU1A 5HHNB 1E6JL 2V9UA 4P9ML 2UY6B 2HLEB 3CIQA 2Z4QA 1HFUA 3ZHDA 2F1BA 4KZCA 2Q6WB 1KYUA 2VDMB 4M93B 3KYKL 5DUPL 5I74C 5HTSA 4ZW3A 3VI3A 1A8JH 3L5HA 1U8HB 2PW2A 3QDJE 5EUKB 4D9RE 4BKLA 5LXVA 3TN0B 1BBJA 2HJFB 1KTRL 2J6EH 2AXWA 3GEFA 3F64A 4UM8A 5CEZL 3GO1L 1XB3A 4NX0A 3WFHA 4F8PA 1G6RB 5F1IB 4H8WL 4XBEL 1IIIA 5CR1A 3EYFA 1QBBA 4M7JL 4WW1B 2FBJH 3AAZB 1FZJB 5I17A 1RUKH 4LCCA 5JHDD 4KNSA 35C8L 4G6AC 5GS3A 5CGBA 1R9FA 3OZ9H 1FJ1B 1OLLA 2XJLA 1BJ1H 3HS9A 4XNZB 4OAWB 3F7VB 3FQWB 5KYUB 5L4IA 3WKNA 2W07B 2FX9H 5IGXL 3DO7A 1XFPA 3OKDA 4MASA 3VE0A 4L5FL 4EI5A 5D7KD 5DLML 4U0RC 1EEYA 1HL5A 1IB5A 5B7MA 1E7UA 4LL4A 3IDIB 3HFFA 3BSGA 1T2QL 3NSFA 4NI6A 3V4VA 4XP4L 1RMFL 3D30A 4LFHD 3EBAA 5IBTH 2JIXB 5K9JH 5FYJH 5D71H 3U6XA 4TN9A 3ZE1E 2PYEA 3NTCH 4PCKA 2G5BA 1MNUH 1UOKA 3ZR5A 3V95A 4TTDC 1FPTH 2H8PB 3E3QE 3LXCA 4PHXA 1VF5C 1QUNB 4PR5B 1MG3C 2RACA 3NJJA 1MOEA 3FQXB 2NY2B 3GI9L 4I13B 2Q7YA 5ESQA 1DUZB 4O02A 1QMUA 2CRIA 2N7AA 4XXWA 3WXWL 3GIZH 4AYEC 2ZT9C 2BSSA 4DVRH 5FKPA 2X7LB 5JZ7C 4WFFE 4DPRA 5C3IA 5EU5A 5KTEL 2WLNA 3PWPD 3QFJA 3V6OA 3MZGB 3W82A 1KWKA 2VDLB 4QNPF 2PN5A 4U6XB 3NJHA 4HIJA 2HH0L 3UTSA 4DP5X 4QRSB 1NCAL 5ECGA 3GKWH 2Z35A 3ARED 3SPJA 2Z0BA 3DNKA 2WY3B 4GKZB 5KANG 2XA8H 3FQTB 1R5WB 3QZPA 2O5ZH 1TQSA 5DJCA 5GS1B 2X2UA 4NCC2 4ODHH 3BKCL 3RB5A 3QCTL 4HD9A 2ORBL 3L3OB 4AQOA 5LXGL 2YBGA 1Y18B 2EO1A 4MLSA 4KX9A 2E74C 2H4EA 4JFTA 5IMMA 4FABL 1SY6H 5E6IC 3GNML 1BM3H 2AZAA 3C5XA 3SE9H 3C8KB 3VGDA 5KSBB 1JRHH 2MMXA 3QIUC 3NSCA 2XNAA 3V0VB 4DF9A 4L0YA 3EDJA 2CSPA 1MXGA 1N6VA 4KV5E 1VEPA 4MXWL 3ZE0E 1MW0A 2XN1A 4BK5C 4F9PA 5IMOA 4ES8A 1BIHA 4U6VL 4L1TA 5JOEA 4DH2A 5LBSA 3HG1B 1PLBA 5FGCB 5IESL 4X5PA 2BVTA 2BNUB 4WW2A 1IL1B 4F7PA 2HWZL 3HZMB 3N1FC 5KJRH 5JMRA 1P84K 4ZFZB 3QIUD 1TETL 1CXKA 1WHPA 3ARRA 2B39A 4OW6A 3U0PB 3QHZL 3QZBA 4FQHB 1N5AB 1F42A 1Z7JA 4FMFA 3R0MA 3NEEA 3PDDA 1MJJB 1TU2B 1Q9WA 4H44C 4MD5A 4M6OL 3B9KB 1OZUA 2IDUA 1X9LA 2BC4B 5BZZA 4B9FA 3KPLA 2XZAL 1J86A 2FWSA 4WJG3 1MVUB 2E4TA 3QYNA 2GJZB 3BKMH 1QRNA 4LLWA 3AGVA 2J6EL 4L05A 4MZIA 3RNQA 2AJ3A 2QQLH 3RX5A 2FT8A 1OF2A 3OAYK 2FQEA 1T2XA 3CZJA 2QKSA 2W9DH 4WEUD 2A0LC 3FPXA 1M1SA 1H9DA 2FBJL 3LKPA 3BAKA 1NFDE 1NIDA 1X9RA 5JHDE 3UBGA 1RUKL 3LHPH 1EUTA 2X4UB 3PPSA 4J3VA 1ZJAA 3UBXI 3T2PA 3VH8B 5FYKU 4UNVA 5DJYB 2AI0H 3FHEA 3NJFA 4MBRA 5DGRA 2GIXA 4UAOC 1FZKB 2WYTA 2HRGA 4U2YA 2PTUA 2CK2A 5E4EC 5D7KE 4NKDB 3MJ9L 3NCEB 2A9BA 4MJJA 4L18A 2ZWYA 1OSPH 4KRPD 1A4CA 4PJEE 1OSEA 2ZYRA 4UYPA 5DF0A 2A0LD 8CGTA 1RUPL 3Q5OA 1TCRB 5D1QD 32C2B 4PUBH 2MCG1 1KBKA 3Q0HA 2AFNA 3AWGA 4ELMB 4AGPA 1L0PA 4O00A 1KT2B 5C2UB 3JWNH 3UCRA 5JOPD 1UB5A 5FYJL 5D71L 2X1OA 4KROB 4YHLL 2NRDA 1EK3A 1NGWB 4N8VA 5DRXB 4N2DA 3CBJB 3U83A 4B9PA 1IQDA 4Z77A 3BGMA 3C9NA 2V5TA 1NGQH 5BMFH 5CAYB 3VAEA 4YEEA 4NENA 4NAMA 4I48A 1FPTL 1HXMB 3BCFA 4OCWL 2A9ML 1MHCA 4LP8A 1E3FA 4C58B 1A47A 4LBEA 1PD0A 3ILPA 1JZ5A 5CSZA 1ID5I 3P3UA 5EEZA 3G04A 3OKNB 3PY9A 3UO1H 4A2DA 5AW2B 5FM4A 1C08B 4DVRL 4HJIA 1DVFD 3PWPE 4TLKA 4AENA 2TSBA 1BLNA 3NRFA 4MVBD 2VISA 3HUJA 4JFFA 1WT5C 2NCEA 5DZOA 1HJCA 3KYOA 3LDBC 1O5PA 3RIFK 1OAUH 1GS6X 4XB8A 1M1XA 3Q2WA 1MCDA 2CLZA 4AK2A 1RHHA 1MHHA 4KZ0A 1A9VA 1G1OA 2GBTA 3F8UB 1G7MA 3HMXA 3KPRA 5AL0A 5AOIA 1YEHH 3WGUB 5ITBH 3BVNB 3GKWL 2CO6A 3TJEL 4HISA 3QNYB 4LMQI 5CGYC 3HS0A 2N7SA 1A6WH 2BSED 3CVDA 3BVWA 2O5ZL 3PCYA 4KQ4H 3MKGA 4JFHD 3FOLB 4ODHL 4Z0XB 2QQNH 4KJYA 1AKPA 3MJ8A 4JDTH 4LSDA 1DN2A 2J4WH 2RMNA 1M7IA 5HPMB 5AW9B 4YSSA 5C3LD 5C97A 3TGXA 3LD8B 4YDVB 1FL3A 4RBPK 1SY6L 3P9LB 1R24A 1NC2A 1BFOB 1R3LA 1BM3L 2B7DT 1VFAB 3WUWB 4B3VA 4EN3A 3OXRB 1AZBA 1S6NA 3L1GA 5C07A 2WJ7A 3B3BA 1GC1H 1JV2A 1OCOB 3S2CA 3VFVA 5E9AA 2I25N 3L3HB 5EUOE 5HSFA 3L7EB 2FZ3B 3OVUB 5ISZA 1TZAA 4ANUA 2XY1A 4B9KC 3U48A 1YMMD 2ZE0A 4MDIA 1XAKA 5E2WH 4WSJA 1G5GA 4W9KC 3COOA 4ZW6A 4CC4A 3Q8FA 1N0LB 1AGCB 2EQDA 4OIFA 4C55A 3IAGC 2WLYA 5G55A 1F58H 5FLUA 1UVQA 4KH2A 1JZ8A 2KPNA 1R6VA 2ENQA 3GBNL 4YBQC 2J8UA 1G7QB 4APQC 1BVOA 1K2DA 3CH1B 2R2BA 3FQ1A 3QUYB 2Y06L 1XF4B 3CU7A 3FH7A 2F7IA 3HJ0A 1B3IA 5K9OA 2EO9A 3QQNA 3C2SA 3QNFA 2M2DA 3FCSA 2EINB 3F65A 1HNYA 2IBGA 4NNXA 3QULB 1EUUA 2ITFA 1SDDA 2QDVA 1P7KB 1XX9C 2ZWSA 4P2OC 3TF4A 2D4DA 3BKML 3TBVA 2LTQB 4MXVE 2BLFA 4FKEA 2X3AA 1JNNH 1S46A 2P24A 4XPBL 1AE6H 1YUHA 4E0RB 1M57B 2VWEC 3SGEI 2V2XA 4AJWA 1CDHA 2OXGB 3ECUA 5K39B 5IVOA 2P4AB 1QBML 2Z3FA 3DURA 4MA3B 3R8QA 4BDVA 4KO7A 4MHHI 3RFZA 2PF6A 3N85L 4N24A 4AITA 1YEJL 4HSQA 3ZSTA 3F7YB 4AVIA 1CYXA 3NGBC 3ELQA 2X9ZA 3RDTA 5T5FH 2AI0L 1YECL 2Q3ZA 3OHXA 3I02A 3BWAB 4CL7A 4ZUUA 1R5VA 1OP9A 1AP2A 3BXNA 1KCRH 3NACL 5SWZD 5GGQH 3ULUH 2EAEA 4FNSA 4U1NA 5IMLA 3GMMB 1OSPL 4JO8A 1E5UI 5D1QE 3SKOA 5BW7A 3TL5A 1FBIL 1S9XA 5HI5C 5AKTA 1P1ZA 3CCHA 1N2RA 1N0XH 4H5SB 2EEBA 3GSVA 3WS3B 2OMBA 3MCG1 2NX5D 5E4OA 1RZ7H 4DZBB 1ORQA 1I1YA 3N44B 4W9CC 4IBLT 2R2EA 1YEIH 4KXZH 4PSPA 5TDNA 3O9WB 2XCMC 1G7PA 4JJ5B 2HT4C 2VNCA 1H8NA 2HTKC 4NWUH 5BMFL 5AW7B 2WCSA 2I69A 2QBWA 3VI3F 1CGYA 2NPLX 3Q48A 4XPHH 2YZ8A 2MH4A 3WNPA 4LZKA 4YBLC 5JW4N 5HI5D 4LSPH 4GAGH 1T0OA 4IU2B 5A7BA 1YMHB 4DN4H 2B9AA 2VZSA 1UWGL 3CUPA 1WBZB 3ULVF 4Y2OA 5HGGS 4KKCD 5I30H 4J3OC 5D7SH 4AXWB 3KPQB 4LDEB 4WI0B 5DHVA 5L8JB 2RH0A 1H5BA 3UP1A 1CFTB 1UT2A 2FJSA 1J9CT 4LF3B 4DIXA 3ZOAA 3FTZA 3H9HB 2XT1B 5KSAB 1T80A 4P4KA 5E5RB 3D08A 5ADOH 2X09A 4R84A 5ERWB 1BWWA 2VQ4A 3MLRH 3FUJA 5ITBL 1HEZA 3UBXB 4OZIE 2A74B 3GJEA 3PWLB 4M7ZC 4U1JA 3ZDZB 4JFHE 3AQXA 3KS0H 4F7TB 1A6WL 4DERA 4MAYD 4ZNCD 4CSZA 4J3OD 2X6AA 2QQNL 5BNXD 2V3DA 3QEQE 4V1DA 3GSQB 3DV4B 3CZNA 4FYSA 5HHQA 1S8DA 2VLJD 1SFHA 3LPWA 1MCPH 1P6WA 4O2EA 3U4AA 4IGBA 1NGYA 4YLBA 2VE6A 5IIEA 4FKHA 4PLJC 2APTA 3LQAL 3RGVA 1GC1L 3FQNB 4JFEB 3JTTB 2CXKA 3TIEB 1CTOA 2FL5B 2QHRH 1SM3H 4O2FB 1MELA 3QDJA 1YMME 4NKOB 5FK9B 4G5ZH 4X4YB 4G71B 4Z7NE 2DWSA 2CHNA 2FGZA 4IIQA 5HGDB 1KLGA 3FXIC 1ROCA 1B0RB 2ZUYA 4C59B 3IDJA 2B16A 1F97A 2HUEA 5DYOA 4KRNA 5LQBL 2A4ZA 1E8WA 1WFMA 3BWUF 1MCWW 3IRPX 4G8IB 3EAKA 5C0BB 4R7NB 3SGDH 1H6EA 3FT4A 4PLJD 5KSUA 4XMTA 1DQQA 1A6UH 3KLDA 2V9RA 2OMUB 1UWYA 3DHJA 1G9NC 1P5VB 3I9AA 5DURB 4X6EA 1JFHA 1B3JA 3X3FH 3HE7C 1Q94A 5KWYC 4MCMA 4FXGB 5GS2D 2WNKA 4K3EH 3WI9A 2I9LB 1I7ZB 2O61A 4W6WB 2CUHA 1AQKH 3VVVA 4AGOA 4XPAH 1E2VA 3EUDA 2APVA 2YLHA 3OHMB 4WK4B 1HOCB 4DKFH 3LZOA 3NSJA 3S3BB 1JNNL 2X3CA 2X87A 3J2PA 5IQ9A 1AE6L 3RWCB 3DMMB 1INQB 3WFBH 1KTDA 4AL8H 4HIHA 2QSTA 1A0QH 3ENEA 4LSQL 4YSEA 5C92A 3PQYD 3MR9A 5DJ8B 5DRWA 2DEWX 4XMKH 3MRRB 4MKTA 2WOYA 4IKLA 1IQWH 1T5XA 5C0DA 5HDBE 3PGDB 3A5VA 1NGPH 2X4SB 3QPKA 4JO3L 4CC0A 3GFUA 5T5FL 1IAIH 3VW3H 5SWZE 3I2CH 1MHEA 1KEMH 1SRDA 3ULUL 5E5LA 3RNKA 3SOBH 1MCNA 4KUCF 1WTLA 1MIEH 5EZLB 2Y23A 4A7GA 4KY2A 2XSKA 1HJBC 4HOZA 2VSKB 3MRCA 4IDJL 5DU7A 2EDMA 4G1MA 4IRSB 4K8RC 4N2IA 2NX5E 5C6TL 1F4YH 1ZOXA 4L9LA 2OMXB 4WO4A 4Y4KB 3APCA 3SKNB 3CJJA 2YUXA 3UPRB 4DQOL 4QF1A 2V7HA 3DECA 4M1GH 3BKYH 4HWBL 3U7WH 3LSOB 4NWUL 4HJ1A 3IJSB 4GQ9L 3W37A 2GTWB 3DX7A 4RMVA 3DGGB 5ANMB 1T83A 3FW6A 4U1SB 1HWWA 4HD5A 3VI4E 2G9HA 3FRPA 1VEMA 5CN1A 1EO5A 2BRQA 2HJKB 1KOAA 4F15C 5HGHB 2R0KH 3D39D 1NCBH 3VFSA 3IRCA 1Z9SA 1QFHA 3B2PA 5LJYH 1XCQB 1DDHB 4KJQD 4URTB 3DYMA 2R0ZH 5ADOL 3VX0A 4XPGH 3ZE2E 4KO9A 4PJDB 4PBDA 1PBYA 1AGFB 1CFBA 3HG2A 4ZW7A 4XOCA 4AEHH 2MJWA 3EOBA 4ZOBA 1T21B 3KW7A 5AL8A 1AMYA 5D7JA 1FNGA 2VLJE 4PTUA 2AJZA 4HS3A 4K7PH 4XB3A 1V05A 2H0EA 3PL6D 1MCPL 3UCQA 1O9VA 5DTFA 3L2NA 2JB5H 4NQQA 4X8JA 2FB4H 4X8GA 2FQDA 4AT6A 5EOTA 2I60H 5DD1H 2EDYA 2RQ8A 2DYPD 2NY5H 2QHRL 2NR6C 1MREL 1SM3L 2W80C 3VFOA 3LS4H 1P4BH 1YQVH 4G5ZL 2FQGA 4CMMB 4FZ8L 4GG8A 5GGUA 3H7LA 1CLCA 3DX2A 4R2GC 4KRLB 2OMWB 2XTJD 4P46B 3ZYZA 5BO0D 4HK0B 3QK0A 2EILB 1BZOA 1EEZA 2W1NA 3K91A 5AVZB 2F7RA 3RLSA 4S0HA 3GK8H 1NFDA 2PR9A 5JHDA 1FDLL 4PJAE 3UTTD 3WDJA 4AJVA 1CLZH 1IGIL 3BZ4B 4GAJH 4NBZB 2J1WA 4A39A 4G6KL 1THAA 3QXWA 4RFEA 4AMKL 3VSQA 2DJUA 3GLEA 5IJVB 4UT6H 2UZPA 2ZKHL 3F5WA 3DUUA 4PREA 4K3EL 3L5XH 1J9TA 5FF6B 4F3FA 3CVBA 3MLUL 4R97B 1SN0A 1FFTB 5J56B 2GVYA 1AQKL 3LEVH 4PJEA 1YHPA 1BXVA 4XPAL 3MXVL 5DZJA 4YIQA 3D34A 4ZMPA 4N5ED 3MGOB 3IDYC 5F9AC 3HI5L 5T33H 3DOIA 1P7QB 4AGNA 2Z4QB 4YFLF 1QA9A 1QABA 5EORH 2X4RB 5IJKA 5GZOC 2OMYA 2AEPL 4AL8L 4DKTA 1I8IA 1QFWI 3PQYE 3QPXH 3UH8A 4S1RL 3HAEH 4ESKA 3KHQA 2XPGB 4JG5A 3VI3B 1AOHA 2PW2B 2ZUVA 1IQWL 3UJIH 4UM8B 5TE4H 1RVFH 4YVNA 3WFHB 1IBFA 5AVWB 3VW3L 4B9ZA 1HCZA 4JM2D 3I2CL 3SPVA 1G7IA 3QDMB 3SOBL 5J89A 1AZVA 3PWPA 1HI6A 3TURA 3O4OB 2Z92A 4N8UA 4YQXL 2KS0A 4XO9A 2VIRA 2J8UF 1VJSA 3WCYA 1F4YL 4XCFH 4OQTA 3AROA 3AREA 1IFHH 5GRUL 3L3JA 3DIFB 2N3JA 3V6BR 4WUUD 1D6EA 2MNUA 2WV3A 2OYKA 3DO7B 3OKDB 3VE0B 4HJSA 4EI5B 4G8EA 4UV4H 5F9JA 2F8XC 3BT2L 3RTLA 4L1SA 4UMGA 1EEYB 2VZUA 4LVOC 4YFLI 5HGBA 3FB7A 1NCWH 3VCLA 1HYRC 2A38A 3UOAB 3I50L 4G1EA 1D5XA 1KIUA 1IJNA 3FCUB 4PJHE 3V4VB 2CO1A 2G60H 3TCXA 4MRBA 3AS0A 2J88L 5I15H 2PYEB 3IDMA 2EDNA 1AKJB 2Y3AA 3GLAA 2G5BB 1NCBL 2VDMH 4K3JH 4FP8H 1TQTA 4NUGH 5FYJU 4FNRA 1UHVA 1H3TA 5SV4A 5EUOA 4HK3N 7FABH 3L5WA 2WUCL 4XAKD 5BQ7A 2CA3A 5DD5H 3ZHKA 2OQJA 2R0ZL 4UILL 1CGVA 3LS5H 3OKOB 1EJ6A 4KH9A 4X5QA 5ESQB 2Q7YB 4O02B 1G6RH 2AVFA 5DZ9A 1XF5A 2P46B 4AEHL 1UCBH 5EU5B 3V0DA 5BRPA 3P4OB 4NHUA 5FYLL 3QIUA 1HESA 3CV5A 3VFUA 5CLWA 3QFJB 3K71B 4FNPA 2G0LA 1JMXA 1WFTA 5IB2B 4HIJB 4K71B 4PJ8D 3UTSB 1D5IL 3GXPA 2FJFA 2E56A 2JKLA 3BP7A 3OKKA 5CP7A 2WXIA 1L5GA 2FB4L 2G9KA 3B3IB 2FSEA 2ZNWA 4NZFA 3SDAD 5DD1L 5DJCB 3K74B 1AHKA 2CBMA 3PAZA 3T08A 2HLAA 4P23D 4DW2L 1P4BL 2AQTA 1YQVL 3PIQA 3CLWA 4FXKC 5E08H 5IMMB 5J6GA 2XKUA 2XTJE 3OGCA 4FA6A 4YDKH 2OYPA 3BGFB 3RILA 4A7TA 1RSFA 3GHEL 4WHCA 5E8OB 3UG5A 3UTTE 2YPVH 4M1CD 4MQXC 2LU4A 4M29A 1NDGA 3CZSA 3N1GC 1IV8A 1CLZL 5DJAB 5IMOB 5KG9B 2PPEA 4JY5H 4TQHA 1H3XA 1JGUH 4GQPH 4XP1L 4ELKA 2WQWA 2C4FT 4ZO9A 4NGHL 4UT6L 2DM7A 2HVKA 3MV8D 4WW2B 3T77B 4P5TD 3WD5L 4JQIH 4F7PB 1PEWA 1X44A 5BUPA 1GYVA 1DN0A 1C5CL 5D1QA 2RR3A 1O7DE 3K0YA 1HXKA 1WFJA 3R4DA 4PP1D 3THML 4KFZC 1GGYA 1MCFA 3GHBH 4ZO7A 2VDLH 3N5AA 4L1HA 4QUOA 1MRDH 2AAAA 1AVAA 4TF4A 4LGRB 2O5XH 5T33L 3ARBC 4HW6A 1HYSD 1KB5L 4ZTPH 2FNBA 3HEIB 4MD5B 4NDMA 2L3BA 3ZYIA 2FGWH 1X7QA 3KPLB 4YHOH 5I28A 4BZ1H 1E65A 1KCSH 2H0FA 2XQ0A 3UJIL 1BV8A 1D7FA 3RNQB 2AJ3B 4OF5A 3KDPB 1V3MA 5TE7H 3V0HA 1OF2B 5DJ6B 1DVFA 2NNFA 2WZAA 5ICYA 2HSIA 3HCVA 3LYRA 2EUVA 2R15A 3MSPA 3L3DA 2FWLB 4HULB 5I71B 4YX2H 2OI9B 4DN3L 2WVVA 1I8MB 2O4EA 4HU8A 3J27A 4L4JA 4YHPB 4ABWA 1K5NA 2WXKA 3IS1X 5EZIH 4KWUA 1I7RA 4XCFL 3K1KC 4WUUE 3OJMB 3HZKA 5K5YA 1H3GA 3EHBB 3ZZSA 1GJIA 1E40A 4L3AA 2VN4A 4LKCA 4AQAB 4IK7A 3L95A 5KYXA 4F58H 4OZIA 2BSEA 4JDZA 3BH8A 3Q3GA 4UV4L 4HC1H 1UFUA 4RFNC 3CTTA 2Q5BA 1OTTD 2BMKA 5AEAA 2JF1A 3SD2A 3KGRA 3UAJC 2DKMA 2VR3A 1R3IH 3FMGL 2IH9A 4RRPA 5I15L 4HIXH 3VD1A 3O3EB 2P48B 1TJGL 4E9SA 2EUXA 3SE3A 2DF3A 1IQDB 4Z77B 3FO2A 1V7MH 3BGMB 4FP8L 1QW8A 3C9NB 4OBRA 3WJLC 5DHEA 4XAKE 4DJMA 4FLHA 4NENB 2COQA 4I48B 4TNFA 7FABL 2F54D 4ZSOB 4HZLA 1YMMA 5DD5L 3QNZB 4JRFA 3ILPB 5CSZB 3QG7L 4RAVA 4Z7QE 3G04B 3GRWA 1FN4A 2V9QA 5K9QI 3QXVA 4ZAKD 2F53D 4AENB 1BLNB 3KLSA 3CD4A 2QELA 3EH5B 3HUJB 4L8SA 5JO5A 4JZJA 2C7UA 3QAZB 4G7VH 5F7BA 4B60A 2GC4C 2HN7A 5A1AA 1M1XB 2CLZB 5E8NA 1C8QA 1RHHB 5LLIC 1G7MB 3CFDA 3S34H 1EVUA 1X4ZA 5EIQA 4LCVA 2OCFD 1T04A 3VXMD 5DVOA 3HS0B 2ITCA 4JGNA 3GZKA 3JWOH 1UA6H 2R4RL 4HPOL 5AOLA 2H3KA 1N3NB 4KJYB 1UADC 4Y1AB 4GSUA 1AFVL 3Q1SH 7PCYA 4BHUA 4JCLA 1M7IB 1XCXA 3GRGA 1VGKA 3PS6A 1CFQA 5E08L 3S8GB 4M1DL 1FL3B 3VFTA 1BD2D 2WZ5A 1NC2B 4QYOA 5FA4B 4EN3B 4YLQT 5C07B 2F5AH 2YFNA 3FTVA 3VFVB 5DO8A 2YPVL 2CBQA 3AG4B 4K5PA 3MAWA 2XIBA 5DC2A 1BG1A 5ISZB 4KV5F 3X17A 3ZE0F 1U95A 1NFKA 1A2YA 4XN2A 4HIIB 4JY5L 5F1KC 4DK3A 2KMWA 1Z0MA 5CMAB 1ETZA 4MDIB 4PJIF 5SWZA 1PY0A 1PZ5B 4U1LA 3HB3C 5ICXA 3O0RL 4UOZA 1NQBA 3IF1A 5D1XC 5F3HA 2XV2A 4PJ9B 1CI3M 2Y7OA 1S7SA 2XQBH 3MRQB 1JNLH 5AVYB 2G75B 1UVQB 4KKPA 2EUWA 5GIRA 3LNGA 3U2SA 4J5VA 3GHBL 4FFZH 4O4YH 3QZOA 1FVEA 2NX5A 1KY7A 2TRYA 4HJEA 2O5XL 3T4AC 4MMZC 4ZTPL 1T1WA 2Y0SA 3G5WA 5K9OB 1A4JB 3B7UX 3K2UH 3FCSB 5EBMA 4IBVA 2FGWL 1TPXC 4TNWK 1FV1A 4YHOL 4NNXB 3ETTA 1SDDB 1J0KA 1JUFB 3D4ZA 1KCSL 3EGDB 3ECBA 3TEUA 4LLVA 1Z9OA 1NCCH 1XR8A 3TBVB 4QTIH 4X6CE 5H2BA 3Q01A 2V2XB 4IKIA 5TE7L 1D5RA 1IKNA 4UWQB 1OAYL 2N1KA 3QR2A 2X0WA 3VG9C 2F7QA 4EZJA 2ZUXA 5CCKH 4L3CA 2BSCA 2CQVA 3RFZB 1JZEA 1JPTH 4YVUA 1KENH 1S7TA 1A1OB 1IFGA 4FFWC 4W4OC 4XH2A 5DUMH 2YEVB 4AQ1B 4HLEA 3ALWA 4GJTB 3MHZA 4MYWB 3RDTB 3STZB 3RL1A 4C83A 5KS9B 5GJTH 1GTFA 5IQ7L 3OHXB 3I02B 1VKXA 1FQ9C 4ZUUB 5FO9B 2CKBL 2COVD 1AP2B 3BXNB 4X7EC 4WWNA 3V7MA 3SDYH 4Z7WE 3D4CA 3VA6A 4F58L 5IMLB 4GI9A 1ET8A 4MAYA 4WWKD 3RWFA 5D6DC 4QOKD 3SKOB 2NDFA 3ZZQA 2CHWA 1S9XB 2C4FU 1P1ZB 2DKSA 5F3BB 4AEIH 3Q5TA 2R0LH 2VLJA 3F84A 3NIDE 4NCC1 4J28A 3T8XA 3UPAA 1R3IL 2FT6A 1A5FH 2X4QA 3CPUA 5CEYA 3VGHA 1KJ2H 2LQRA 2D31A 1I1YB 4P2QE 2R2EB 2X88A 4GSQA 5TDNB 1G7PB 2X1QA 4BSWA 4ACTA 2F54E 2FNWA 3W56A 3EO1A 1Z5LA 4TNVF 3MV9D 4XAWH 4Y5VA 4OZFG 2O6PA 1WGOA 4YEFA 2Y07L 3B1TA 2MEJB 5ITFA 3O41A 1FG9C 1MVFA 1BQ5A 5DD6A 5KN5A 4HLZH 1IU1A 1GRWA 2M26A 4K2UH 4N25A 2BWQA 4X6FA 4Z3JA 2DIEA 2WB1A 3CUPB 1J5CA 3M86A 4HKJA 1LILA 5DHVB 2HUHA 4GI6A 2KPWA 5I8CA 1JVOA 3ARDC 3T6ZA 4R8WH 1JXDA 4QXTB 1TQUA 2YN5A 4LSRH 3O0LA 4PJAA 4JK0D 4P4KB 5K59E 1OALA 4GW5B 3CFIC 4JVWA 1F2QA 3PRZA 3BAYA 2XN2A 1X4YA 4FI8A 1YAIA 1XL6A 4IRZH 4Y5XC 5EDXA 1TMQA 5A2BA 1HSBB 3S34L 5MEND 1LO3H 4EI0A 1N7MH 2RGSA 2V7NA 2K6YA 1GYAA 4Z95H 4HYTB 3IETA 1UA6L 5I6XC 3K6OA 1U36A 2XZQH 4EZMA 3RA7H 5BOPA 3MGAA 5EIIA 1JYVA 1CVRA 3QORC 5HHQB 4O2CA 3IB4A 2IAAC 5ESAA 1BD2E 1THCA 1WQVT 5AOJA 4O2EB 3UGUA 3W2DH 1ZKAA 4UQ2A 2A9NH 4IGBB 2PCPA 3L4VA 4M8QA 1N10A 2GCYA 2VE6B 3PQYA 4D0BA 5IIEB 1LK3L 3HPJA 2F5AL 4NRXA 3RGVB 5IBLC 5J6SA 5F2FA 3H3PH 1OP3K 4F7MA 4LP5A 2WNXA 1U3HD 4L4VE 4R4FH 1JVKA 3LV3A 5KAQF 4TULH 5FM8A 1C5BH 2ZAIA 1B9ZA 3EF4A 1HDMA 3PWNA 4IIQB 4KDTC 1KLGB 4JL2A 4KAQL 3SYCA 3IXTA 5E8PB 4BK8A 1KBPA 4YDJB 2FX7H 2APSA 3IYLW 5BZWA 3C09C 3L4YA 3HHSB 3B8SA 3BUBA 4P2YA 3FT4B 3WHE0 5KSUB 4FKKA 4ANKA 2X42A 5F71A 1HKLL 1ML0A 4FFZL 5DHYB 3FO1A 4X6EB 3FZUC 4U3HA 3S35X 3S36H 3QDGD 4OQ1A 3FT0A 1OV8A 3KLAA 1PPIA 1MCWM 1WWWX 4A2EA 1IBYA 1TMCB 3K2UL 5EC2A 2O61B 1TZGL 3JVFC 5F7LB 4X7FC 4OJCA 3N1PC 3TNMA 3MV11 2IPTL 1LGVA 1IARB 3HBGA 2VW6A 4ADJA 2HKHH 5GSRA 4CJ1A 1NCCL 4PJHA 4ANWA 5HD8C 4QTIL 2A6IA 2GABA 4AVKA 5ACLA 3BAEH 5HYSA 3TBBA 3MGTB 2EICA 3D39A 3ZE1B 4LCWB 2Z31D 1KTDB 5EU3B 2EE2A 5D1ZC 5E24E 2Z6FA 4QO1A 4MD0A 1MN4A 4GMTH 1KCVH 1J1PH 2VDOH 1FH5H 1JPTL 5DRWB 5E2VH 3FU5A 3HI6H 3CFNA 1KENL 3WSQL 1QWNA 5DUML 1T5XB 2EIJB 5KOMC 5C0DB 3CFMA 4L23A 4A1RA 4UTAH 2PTTA 2DYSB 4MB5A 4OM1L 2ZSWA 5GJTL 3BPOB 5C0AD 1MHEB 4FEMA 3QRGH 3TOPA 1JWMA 3QCUL 1T0NA 3Q1EA 1G6VK 2YAQA 1MFDH 4NJ9L 3RNKB 4QOKE 1U2HA 2P43B 5GS0C 1P4LA 1MFBH 4M6ML 3ZRSA 2FUQA 2VC2L 5KJ7E 2AC0A 1NLDH 1KUMA 3QUXC 2YPLE 4G1MB 4PJ7E 4B3EA 3PL6A 4L9LB 4N0CD 1FFRA 4AUJA 3LOWA 4ZW5A 1KJ2L 4JKMA 4XP6H 4QF1B 2V7HB 1KYDA 4OJDH 4PI2A 2DYPA 3MV9E 5ESVA 5GS0D 4FQXB 1CE6A 3KXFB 4JG1L 3C12A 4XAWL 4GBXC 3JWNC 1CN4A 3QHFH 3HN5A 1U8CA 4UCFA 4P9HH 4JUSA 3GSOA 5I1HL 4NQED 2G9HB 3TFBA 2JK5A 3FUIA 1O5DT 5DJ2A 5JW5A 1XH0A 5J9PA 3NJMA 1Z9SB 3UTTA 4R8WL 4UZUA 4Z1PA 5F9OH 4RQQA 4XNQA 3KPTA 3ZE0B 4M5ZH 2DQJH 2VXQL 1DFBH 4LLQA 1WZ1H 2P45B 5GRVL 5KUMA 5MENE 3N06B 1NFIA 2DV6A 4GBXD 4WDIA 4IBZA 4JRXD 1LO3L 4NZTH 3CN0A 4XCEA 3EOBB 3SDDB 1YDPA 3M46A 2QGCA 5FIEA 4N0RA 2IQAB 5D7JB 1FNGB 2VL4A 2VDNH 4Q6KA 1FGNL 4NPYB 4LPTA 3ESPA 1CYGA 3PWVA 4DEUA 2AJZB 2QPEB 4XOAA 4LLMA 1G84A 5DTFB 4LRNL 1USZA 3QJOA 5H37H 2VM9A 2QSCH 4NN5B 2M83A 4X7SL 4AT6B 3QS2A 4WK0B 1XH1A 5EOTB 2F19L 2HFTA 3RX9A 3V4UH 2AQ3A 1BIIB 1NEZA 2PWEA 2EDJA 3H3PL 3KNBA 3KEDA 4NFDA 3SY0A 3MLTA 5JA8B 2P8PB 3DI3B 4K7PY 4R4FL 1T6WA 2ESVE 2QZ5A 4JFUA 1H3WM 1U8MA 4NQCD 3WY2A 1C5BL 2IDTA 4GG8B 1PLGH 4JM2A 2WQVA 3PAVA 5GGUB 4QY8B 1ROWA 2E7LC 4UTBH 3EJTA 5B8CC 2FX7L 4TNGA 2AK4E 2H2PD 1SMOA 4I3SH 1EEZB 3MBWB 4EJ1C 2LR4A 1NFDB 5JPNA 3SGEH 5HBBA 1XZ0A 3IKCB 2NYZA 3QDGE 5I73C 1FA4A 1WD8A 3MACL 3S36L 1TSRA 3SKJL 2YSTA 4WUUA 3T65A 4LHUD 2BVUA 3DUUB 2DBLL 3F5WB 4PREB 4D7PA 2C26A 4HIPA 2XKSA 3EDDA 2EH7L 4F3FB 5DK3A 4ABUA 4ISVA 1FL6B 3AXHA 2ODHA 4BQBA 1BF2A 4JO1H 4PJEB 2J2ZB 3LH8A 4OCXH 3P4MA 2K9FB 1IAOA 4YIQB 1DHKA 4G3YH 2HKHL 2ZG3A 4M62L 3L3KA 1LO4L 5FPIA 3CSGA 5CJ8A 2EIEA 4GXVL 4LHQB 1CFMA 5F9WC 3VWKC 1DQLL 3ZZLA 3DVFA 3HS8A 1XSOA 2YS4A 4JVPA 4N8PA 1PZDA 3KVDD 1KCVL 4X9YA 2VDOL 4MA1C 3D2UB 5FX3A 5T1KD 4Q9CA 2XQYK 3NUKA 3HI6L 1AC0A 3EZJB 4GSDL 2AABL 2CJUH 7PAZA 5J06A 4WAFA 5HDBF 4ICXA 2WPGA 1VAHA 3SPVB 2NXYC 1WJ3A 3QRGL 1G7IB 5C0JA 4WV1A 1GGBH 1MFDL 2NXZC 3LRKA 2X6BA 1YEKH 2H47C 1EHNA 1NGXB 1HI6B 1AQDA 3PWPB 4FN0A 1MFBL 5AVTB 2Z92B 3EJUA 3SE8H 2CCLA 2DIBA 1C1EL 4TUUA 5H8DA 1M2VA 1NLDL 2VIRB 4BQCA 3QZWA 4PJ8A 1HAUA 1B0IA 1S2EA 4XCNA 2D2OA 2Y9RT 4HCRA 1URZA 4PWIA 3L3JB 5CJQH 4D8OA 5FKAA 1D6EB 3U30B 3JWDH 3MJ7A 4G8EB 4BHUI 3SDAA 5F9JB 5EZOH 1J1OH 2UV3A 5DVNA 3QI9D 4Y2NA 5F0JB 5HGBB 4U7MA 3FB7B 4ZO8A 1X7TA 2BIQA 3ET9F 4P23A 3E2HC 4GRWE 3FNKA 1KIUB 3PJSA 3T6XA 2YD9A 2P5WD 1SOKA 2BINA 4NQEE 1RZGA 3ZX1A 1PCXA 2A9CA 2FEDD 4P9HL 4RFOH 5HI3C 5EC1A 3T0VA 1S3KH 5FHBH 4JY6A 4LP4A 2VLMD 5FWRA 3T0EC 1VDGA 3AG2B 3RZCD 4KKLD 5C08D 3S8FB 2XG5B 5EUOB 1S7RB 3L5WB 5F9OL 1X4XA 4U0QB 3SDXE 1SVBA 2DQJL 2OQJB 1DFBL 2F61A 3QWOB 5JIQA 3O3DA 4KXCA 3HRZC 4KVCL 3QIBD 4KK5C 3MV8A 4JRXE 2CIIA 3W3BA 3ZE2F 1J0YA 4P5TA 2OJZL 3OC5A 2KZWA 4TL4A 1XF5B 2KL6A 2DL9A 3KGTA 2BXZA 4NZTL 3RU8H 3U7AA 3RWIA 8PAZA 1L9SA 3VFUB 3H9SD 4J3OF 3X14B 3OAZK 5AVVB 3A0OA 2EDDA 3OG4B 2HKFL 1KBWA 3NSXA 2LT9A 4HV8A 1UD4A 2FJFB 4LLYA 3BP7B 3OKKB 2LLNA 1XGUB 2OTWA 1H6FA 2ZP0T 4X8CA 4PRPD 4M5YH 1L5GB 4B5ZA 2QSCL 4ODWA 1FNEA 1T22A 3V4UL 3S97C 2FR4B 1HOEA 1WZAA 2ITDB 4N2BA 5I76A 2K3TA 4GEJA 5CGMA 4FULA 4X6CA 3V4VH 1BPVA 3PIQB 1L9PA 4F57H 1DP0A 1R75A 1OTUD 3HKZA 2VDPH 3OGCB 1FHNA 4OCRH 1RP9A 1L9TA 1PSKH 2X9YA 2JLPA 3AT9A 3FSWA 1KCKA 2AQPA 4I3SL 1DVZA 1NDGB 4X83A 5CLZA 2HT2C 3IMWA 1W15A 4PJAF 3ZKXB 2Y1YA 2PETA 1JPGA 3VTMA 5CUSH 1MQKH 1SYVB 4MNQD 4X9FA 3KL0A 2NY1D 2YWYA 2HVKB 3Q9QA 4O02H 4O5LH 5E5MA 3T3PE 4KRPB 3PWUA 1DN0B 3QUMA 3MLPA 4GPVA 5D1QB 4RLDA 4WUKL 4JO1L 1CS6A 1MCOH 5CHNA 5MI0C 2YD8A 4OCXL 2VW7A 2CZNA 3CBRA 5CSGA 1NLBL 2X3BA 1XDTT 2BZDA 3CZFA 1KIPB 2PO6B 3BD5A 1FNAA 2Y5TA 3DHMA 4NDMB 4OI8A 3S5LA 5K33A 4ODTH 1F13A 4QI3A 5JMOC 3ECQA 2DLHA 2VC2B 2F54A 1Q38A 1I8UA 2CJUL 5ILTH 4Q52A 3UROR 1FSKC 3L9BA 3QVAA 4JE0A 2MNWA 4ZAKA 1BDYA 2F53A 1DVFB 4AQEA 1VZGA 3NMEA 3ALPA 1YEKL 3HCVB 2WZ0A 2R69A 4WFGE 1NFAA 3L3DB 3SE8L 2JKJA 3MBEC 2WVVB 2MHAB 3PXLA 5EULV 1BECA 3B7YA 2EIZA 1K5NB 4HSAC 1NIFA 5I0WA 1I7RB 3F6IA 3CVCA 3BWSA 3E1F1 3HZKB 1KG0A 5LBSH 4W9IC 4G7QB 1UURA 3VXMA 1RZFH 1TVHA 1NAMA 3L95B 4LKCB 1PFOA 5KYXB 3JWDL 1Q9LB 4OZIB 4JDZB 3BH8B 3GSWB 5FXCH 5G4MA 2DQIL 2OS7A 2OL3A 1FYTB 1TJMA 2BMKB 2ILLA 3P73A 2P5WE 4RGNC 3C5ZC 5KBPA 3QEQB 4PJHF 5EBLA 3QIWC 1UUNA 1OAKH 1BD2A 3ZYOA 4CVZA 4JG0H 2KUTA 4ORGA 2VLME 1ZTXH 2APXA 5FHBL 4ONOA 5C08E 1FYHB 3FO2B 4Z7OF 3DI2B 1MIML 3CIAA 5J1SC 2XWJA 5E6YA 5GISH 5TGBB 2FD6H 4LRIC 2ZICA 1H6UA 3TJHD 1P5UB 1BREA 4KTYA 3TFKC 2XX1A 2IV8A 3CFKA 4RGND 2K4WA 4Z7NB 5JHBA 1Y0LA 1CF8H 4K3GA 1FN4B 1M7XA 3F01A 1JG9A 3S3JA 4M4PA 3ULVL 3EJCA 3C6LD 5FLVA 3US1A 2BVOA 3ABLB 3RU8L 1PY9A 2R2CA 1QR1A 4L8SB 3GZOA 1UQSA 2C7UB 4JZJB 5DHXB 5EU7E 4I3RH 2FK9A 2X53A 2G2RA 2Y5QA 4LEOB 3EO0A 3NZHH 4L2LA 4YHIA 4JRWA 1U33A 4AOFA 2NW2A 3CFDB 1QACA 4PRPE 4XVUC 1I8KA 3WY4A 4XN9A 1B2YA 5E6UB 2P5EE 1T04B 2BK8A 1J0JA 3HNTH 3ARGD 3MRPA 2ITCB 4IOIA 1J5OL 1PZ3A 1L7IL 3WO4B 1IM9D 2XKNA 4ZQKB 1BOGB 4IYKA 3RIAF 3MRHB 2EKJA 4LT7A 1H19A 4YHYC 2ZPKL 4W6YB 5GGTA 3BPNC 3E8VA 4F57L 3SE4C 2VDPL 5E6SB 4QYOB 1GS7A 4U6YA 3VXNA 5JNYA 2BO0A 2YGPA 1PSKL 2VQTA 2XVLA 1CD1B 3H2QA 2NY3C 2FJHA 2NY5C 5GRJH 2XXCB 1U8PB 3BPLC 1V3KA 1NL0H 1U95B 1V7NH 4MNQE 1A2YB 3EFOA 3VWJC 4ZI8A 1QFWH 2GJJA 4YSAA 4OGQC 5CUSL 1MQKL 5L0QC 1MH5A 4D7BA 1HKFA 4HEME 1WC7B 1W0YT 2VUOA 4U1LB 1B4TA 3EOYG 3HOGA 3ZDXB 3D12B 1TQWA 3BSZA 3IF1B 1KPUA 4WWKA 4ZMLA 1X5MA 4QOKA 2OAAA 1EJFA 4AIOA 4XOBA 1ONQA 3V0WL 2VJ0A 1MCOL 4XMLH 4Q2ZB 5GIRB 3BH9B 3B43A 3MROB 3BE1H 4U4IA 1YAZA 4PJ7A 1NICA 1SHXA 1JVLA 3DX0A 1R19A 2DQFA 2NX5B 4FI7A 5IHHA 3QXUA 3QDHA 5DZAA 5KBNC 3QNXA 4HAFA 4NI3A 1I9RH 4CNIA 3HMXH 1T1WB 1A6TB 2NY6C 4QLRA 3FQYA 1CT8A 1KGYE 1FV1B 1P6AB 4WKZB 3MV9A 3DXAD 3GXIA 3VXPA 1ACYH 4Y4FD 5EBWA 3ECBB 4LLVB 1KMGA 2X38A 3Q2LA 5AKRA 5H2BB 5ILTL 1OPGH 2ALWA 3D48R 4OR1A 3VI4B 3IXAA 4R4BA 5KBKA 1UGKA 3BVUA 1JYWA 4PJBE 1SJXA 2XQYG 3PJNA 5J0BA 1SEQL 3GF8A 5D5MF 1SXZA 3AITA 2EE6A 2ZXBA 3NPSB 1XGYL 4L3CB 5CZRA 4Z0BL 2NY6D 4HJ0D 4NFBA 1G7LA 4AKPA 1DQMH 4C83B 3QUZC 5LGJA 2KBGA 1VIWA 3UGXA 3T0AA 4EXPX 3OAUL 4N0UB 5I75B 3CFCH 1ESOA 1VFOA 5MENA 1VKXB 1RZFL 2NW3A 1INDL 2IFFH 1N5YH 1J88A 3DUSB 2Z1KA 5TFSL 3RWFB 2V5SA 4JDEA 2UZXA 3MX0B 1JZJA 4NO0D 5HDQL 4XZ4A 2Y6SC 3SB3A 2VLJB 4OFYD 4OCYH 4PQXA 4Y4HC 3T8XB 4HUWB 1F6FB 2X4QB 3L3IB 1ZEAH 5CEYB 3WL9A 2C9UA 5HHOE 1CE1H 1JCVA 2IJ0C 3QUZD 2D31B 4X6DE 4JG0L 2PCFB 1ZV9A 4PJ5B 2C3GA 2VWEE 2X4OA 4GB9A 5I8EA 5D96C 1B2WH 2KH2B 4MMYA 4BSWB 1U3HA 5C0GA 3IGFA 5GJSH 3X12A 5BJTB 3AUWB 2EZ0D 4Y5VB 2ERJB 2AXHA 5ITFB 4N2LA 3GSNA 3NCMA 3WELA 2BP3A 5KN5B 1VGEL 4QJ4B 2IEPA 5C9KA 1AGBA 4X6FB 1CF8L 3NJKA 3WNLA 2V33A 4M93C 1E8ZA 4GINA 5LNEA 4DVBA 2Q2EB 3VD9A 1CMOA 1O0VA 1HZHL 2L4OA 3HZ3A 4BCYA 1ADQL 3L3GB 3ISRA 3P2BA 2R29L 2GK0B 1DVYA 3BLKA 4PJAB 3P77A 4I3RL 1JI1A 2YPKA 1H8SA 4YDZA 5HYJD 3QDGA 4QKTA 3NZHL 2FBRA 3WJJA 3QEHA 2EDTA 4RMUA 2W38A 1CXFA 4DZ8B 3UEZA 2WCPA 3EKCA 4PTTA 4BFNA 1KYOK 4YE4H 1ZLVK 4OFPA 4ZUWB 2YA2A 1DO5A 3HNTL 2AMUA 4DP4X 1S4IA 1DANT 5DJ0A 3VUAA 3BZ5A 5TJWK 3MCYA 2J3SA 5ABZA 5C0RL 4N9OB 1CO1A 3L9EA 2HG5A 4O2CB 2XOTA 3TN0D 3WDHA 3EGXA 4XNZC 5ESAB 4PWFA 2XV0A 2Z31A 1OEZW 4U1MA 4UQ2B 4Z7AA 2ZKWA 2HX7A 2QV2A 3KHOA 2GCYB 3PQYB 1OCZB 3HPJB 2VDQL 3TBWB 1PD1A 5HYEA 3KPNA 2FX8H 3K4AA 5D7LD 5GRJL 1E0OB 4WU5A 3BIAX 2BNRD 3LV3B 3OQRA 2VOTA 2B3RA 3OXSB 2FLBT 2XYCA 5B1JA 5C0AA 1RZKH 1HDMB 1I9JL 3PWNB 4BCZA 3IXTB 1LEGB 2NSMA 2NY7H 4FXLA 4Z76A 4NQUA 5KVDE 1AANA 3HZYA 4GXUN 5I26A 5FR3A 2Y2YA 3E8UL 3QP3A 4N8CH 4TPRL 3FJTA 4XMLL 4UQBA 1WCBA 3HC0A 4PVBA 1GY1A 4GKSA 3BE1L 3GI8H 5TQ0L 2V2TA 3FO1B 3EDKA 3TASA 1S7QA 4JUTA 2NY2C 3OWEA 2R1XA 1KPVA 4Z23A 3IPBA 3PGFH 4LPVA 5D4IA 5C7XH 4NNYA 3HMXL 1RIVH 3ZQXA 1CLYL 1O6VA 2DN7A 5EC2B 3DXAE 4YOKA 3KLKA 1X5IA 4HAKA 1ACYL 5JW4Q 1H15A 5GSRB 1Q0YL 4PJHB 1BFSA 5F97E 2A6IB 3G6DH 5DMYA 5KVFH 2FLMA 4TTGA 4NQEA 4J3BA 3ZKND 1OPGL 2D3JA 1NOLA 1HN1A 4OCMC 5HYSB 4YAQA 2AXGA 2WSDA 4K94H 4NWTL 5J5EA 4I87A 4HOWA 3MRKB 1ZGLP 2QFRA 4MD0B 2RCSH 2EXWC 3VXOA 1IILE 4N6QA 4FHKA 3FFOA 5DO2D 5GS1C 5IP4A 4S1SL 2UYLA 3CVHL 3QUKB 3SDXA 1OP4A 2PTTB 3IJEA 2ZSWB 5I2IA 4EOWH 4GBXA 2DQUL 3GJFA 4JRXA 4KVNL 1YNLL 1JWMB 4P05A 3FYIB 3SBPA 4FX5A 1W0VA 3QB7C 5M95B 3P02A 2IFFL 4NQDD 1P4LB 4AIZB 1IBHA 4M3KB 4NLAA 1FH2A 4WFEE 4BE5A 4NC0B 3PPEA 4L37B 5GGSA 2L8AA 3IDUA 3LIZA 1HEJC 1N6QL 1MZYA 3F6LA 3V0AC 3ZKMD 1L3NA 4F7EB 3PL6B 1KTLA 5AW6B 4BA8A 3NIDF 3X13A 1E6OH 1ETJA 4D9LL 5CFHA 3NSYA 1CE1L 1P4IH 4LXFA 3MLSH 2BS9A 5AB0A 1IT9H 4N1EA 3B2XA 2I9TA 1NUDA 4WK2B 1TNNA 3D0LA 2OBGA 2DYPB 1J8KA 5D2LA 4YWGH 5ESVB 4ZG1A 1CE6B 4NQCA 2QT6A 2HTLD 1AR1C 1U8CB 4Z7VA 2ZOLB 3GSOB 4G9DA 4HWZA 1CR9H 1MRFH 3B9KC 2XTJB 5DJ2B 3ETBJ 3RBSA 3V5HA 5JW5B 4WWPA 3H4FA 5A2FA 2GUYA 1QPPA 3OPZH 5KVEE 3UTTB 1ERNA 5E9DD 1PFCA 4RQQB 4HFWB 4XNQB 2KZKA 5HYJE 3IMRA 5ETUB 3HI1A 3QJZA 4LLQB 4LIQE 1F6LL 2R27A 3V6FB 4LHUA 4UYQA 1FRGL 5DQJB 1Q9KA 3ZR6A 3EJSA 3LAFA 4XCEB 3QXTA 1YDPB 1BVZA 1TJIL 2B3IA 3UZVB 2MKWA 3R8BB 4TVPL 5I19H 2VN6A 1AIFA 4PG9A 2GJRA 4M6NH 1N67A 2GPZA 4LLMB 2Q8AH 1SXNA 3IM1A 1CXLA 3RY6A 2BP8B 4JPVH 2GEEA 4OBSA 4F9LA 3D18A 3SO5A 3TA3C 1KTKE 4AZUA 4K9EL 5D7LE 3JWOC 5T1KA 1MKFA 4M9PA 4G82A 1NEZB 2BNRE 2ROXA 3KNBB 5AWNH 1DJWA 4HKZB 3SY0B 4ABQA 6TAAA 3HG5A 3U0WH 1Z9PA 3L2MA 3TO4D 2D7QA 2FBOJ 4WI7A 1U8MB 2JKSA 3WIIH 2J1XA 3ULSA 3ULAB 3RPIB 3VQ2C 4JM2B 3OJ2C 2D3VA 4BZ2A 4KROC 1JHKH 2XTLA 2NY7L 3NAAH 1F8TH 4GG6E 1AYOA 1U4EA 4N8CL 3B9AA 5JPNB 3UMTA 3ROLA 1XZ0B 1OW0C 3GI8L 3CZUB 1R3HA 2WWMD 2OJEA 4PY7A 3AW5A 4BINA 4WUUB 2AK1H 3T65B 3PGFL 1SEBA 3KMDA 1DBMH 4TOYH 3HVNA 4JN1H 4AW7A 1KN4H 3QI9A 4ISVB 3ZHLA 4AYBA 1UA7A 5TQ2H 4S2SA 4LCYB 3RHWK 4NM8H 2XC8A 4FNQA 3VXRD 1AHWA 1C9SA 3P4MB 1IAOB 1BMZA 2P5WA 2YD6A 4L8CB 1BMWA 3CNKA 2KQNA 4IRJD 4PRDA 3L3KB 4U1IA 3G6DL 5KVFL 5DWUH 2BDNH 1A1NA 5FOJA 4H4NA 1JV5B 1DANU 3DX8A 3ME0A 1FC2D 4X5XA 1T20A 2OR9H 5L4MA 2PCYA 3EADA 2R39A 3BLPX 4JHBA 5C08A 3RZCA 1RUQH 1OE2A 5J8OA 5DS1A 2J25A 4OD3L 3D69A 2WXHA 1M7DA 4QJ3B 1DVTA 4YGAB 1MDAA 4MD4B 1IUZA 4WTQA 5TDPA 3QIBA 4LQFH 3II3A 3LD8C 4EOWL 4Z7QB 2OMVA 3FONA 1EANA 4NQDE 1LO5A 4WV1B 2E8ZA 1I3GL 4QRPB 2OTUA 4G2AA 1AQDB 2R2HA 3H9SA 4N2EA 3TT1H 3ZRFC 1F90H 2W8CA 3O3BB 1EERB 3DVGA 5E94A 3P2TA 2GY7B 1M2VB 4H8HA 3RUGE 4Y89A 3M7FB 4PJ8B 4I3GA 3WN5A 1ZPLA 3K6IA 3O2VH 1UZ8A 4PJ7F 4XCNB 5AZ2L 3RIKA 5CFAA 5IT2H 2HT3C 4YZFE 2VRAA 3M8OL 4HZ1A 5AOKA 5L8KB 5F3FA 2OX5A 1E5AA 1P4IL 2X4TB 3OMIB 5DMIH 3SYOA 3FTUA 2FHBA 2Z1PA 1BM7A 1RZJH 4PRPA 2YWZA 3MJ7B 1PJ9A 2JJVA 1OTSC 1NPUA 4Q0XH 4KITB 1T7ZA 4XRCB 4N0FA 2EDHA 4M48H 1BEYH 4YWGL 2I5YH 4GO9A 3GS0A 5DRZA 5IVXF 3P11H 4KVPA 2CR6A 3QUYC 1B90A 1FL5A 1YA5A 1RZGB 2NY4D 1I82A 2GHWB 2A5UA 2CD0A 1SBSH 2CR3A 3KJ6L 4HMCA 4TV3A 3KCPB 2WIIB 5EOCH 1ZLUH 2C3WA 1MRFL 4NHCH 3CZKA 3CSTA 5EC1B 2DICA 3WTYA 4JY6B 4BSVA 1TTUA 4F37K 5DS8B 3F7RA 2L7EA 5E9DE 3T6QC 2XXGA 2ICWA 4RWYH 3H6AA 1FLRL 1MWAL 3Q8BA 4Z7UB 1X7SA 1AYRA 3BKJH 1B4RA 2V2WA 2VXSH 2MKLC 2LTQC 3IN2A 4MNQA 1W16A 1BQHA 3O3DB 5CEZD 2CIIB 1D9KD 3JV5A 4HEMA 4P5TB 3CQFA 3F05A 1HE8A 1AACA 3BLBA 3TJPA 5CZKA 3ZDYE 3CXDL 1DZ0A 1YY8B 2A1WH 4JM4L 2Q86A 2D7OA 2ZSVA 2CBPA 4JHAH 3BO8A 1ZIAA 2BS8A 2FYYA 4HV8B 5B1KA 4ETQA 2LHAA 4DWHA 1UYWH 2Q8AL 1ZE3C 4OQTH 4LLYB 1NMAL 1O7SA 3QE5A 5L2JA 2OP4L 3EH1A 4F5CE 2A6KB 3MRJB 5EDSA 3DX9A 4X4ZA 1PCSA 1JBJA 2BZCA 2GTZB 4ODWB 1FNEB 1T22B 25C8L 1QX1A 1YRKA 2BXYA 5AWNL 4R96B 3U0WL 5BVPH 4UBDC 5I76B 2VZ3A 4RMBA 3AT0A 5JPMA 1SHWA 3N42B 1HL9A 4E36A 4X6CB 4PLKD 3WIIL 5DFAA 5IW3A 4WTZG 1DJZA 4OLXL 3BI9X 4TSBL 5HHVL 3W9DA 4U7SA 1SYSA 2NZ1A 2ZONA 3NAAL 3RKDC 3PG2A 3O9WC 1F8TL 2ATPA 3ABGA 3KVPA 2HFEB 3ZL4L 1HHHA 2NZ9C 3L6FA 3FDWA 4XTRC 1KXVA 4Q9RH 43CAA 2WN3A 3V4PB 4AV5A 2ZG1A 4EUPB 1MI5D 1HCVA 2Y7MA 5D7IF 4LOUD 1BVKA 2FRGP 1MCBA 4TUOA 4XNMA 4X9HA 4Z7WB 1KXHA 5E5MB 1FLTX 1DBML 1EJ8A 1GYUA 3LH2L 3BVXA 3NN8A 3PWUB 1KN4L 4JN1L 3RVVD 3U46A 3VXRE 1NPNA 1T03L 1QLEH 2WQAA 2IALB 2MPVA 3O6MH 5ALBH 4W9LC 1XGRA 3RAJH 3HRPA 3Q7JA 2BJML 4J27A 2WP3T 4XTRD 4UB0H 4P0DA 1NMCB 2BDNL 4JKKA 4W81A 5DWUL 5EH1A 2E75C 3CZFB 1MEXL 4WY7H 2Y5TB 1PKQE 4X6DA 1TR7A 4P2QB 3EJRA 2OR9L 5LCVL 3S5LB 5D2NE 4NRZB 3PAUA 4YGVB 3MNWA 2J12B 4MZ3A 3P54A 4KNQA 3FQUA 1LEIA 4LSUH 4JPQA 1WTGT 4F1ZA 2JKXA 4GI8A 4L3FA 2IDQA 5KSAD 3D87B 3P9WB 4KHTL 4LQFL 3PP3K 1HT6A 1CD8A 2P80D 5DK2B 3C6LA 4ZAKB 4FQIH 3UACA 4OLZH 1ZHKA 2D7TL 1FVCA 2NNCA 9CGTA 1U0QA 4G8FB 4IMKA 2MIZA 4PJCF 1HXYA 3WMSA 2NYYC 1A7NL 3MCLL 3EYUL 4M43H 5HY9A 1DQJA 4LRIA 5IVZA 3O2VL 5IT2L 5AAMA 4YSUA 2X0VA 2JELH 5EPMB 1KFAL 2G3XA 5DMIL 1TVHB 3ARGA 3U9PH 3FYEB 3EDEA 1UM5L 4ALAH 4Q0XL 2SODB 4CSPA 2OL3B 5H37G 3NEOA 2O6CA 1BEYL 1NCOA 3BIKA 2I5YL 5B39B 3GMRA 3GEWB 3OM3B 4BV1A 2DQ6A 1XGTA 5EBLB 3G6JE 4NP4L 3KWTA 1BD2B 1SBSL 2W92A 4FXGC 5AW5B 5EOCL 3IAQA 3VYOA 1KJMA 3E0GA 3DVNA 4NXKA 5F0PB 4KK8C 3QO0B 3CMOH 2XWJB 5DSCA 4RWYL 1JTPA 1V27A 1QFUH 3U79A 1AZCA 5AFAA 5J11B 3AXLA 5EO9B 4L4VB 3BKJL 2VXSL 1J0ZA 2ZUUA 5IREA 2ZXGA 5CEZE 2HJLA 2SEBA 3HZVA 4JQXC 2BVPA 5KVGL 4FI6A 1D5BA 3DMMC 1C7TA 5DURD 4PS7A 1TLKA 2J5LB 4MHHG 3ASOB 4PN6A 1IX2A 1Q0XH 3U1PA 3O2DH 4A37A 1TZHA 5DR5H 3VFWA 1QR1B 4D9QD 1CL7L 4UQ3A 3N50A 1UQSB 3OLGA 2P5PA 3V52L 2G2RB 1U3NA 3JVGA 3MODH 4U3SA 4YHIB 4PJFF 2ZOUA 1S9VA 1S7VB 3QQ9D 2NW2B 2CHDA 4FZEH 2OSLA 3WY3A 3UZEC 3DMMD 1JFQH 2BIPA 3MRPB 4L5FE 4IOIB 3DXAA 4Y4FA 5IB4B 1XGPA 1DSYA 1AD0A 4KK6C 5D2LF 5BVPL 4YH6A 4KRMB 2Y1VA 3HC4L 3OV6A 5B7EA 1F3JA 2XWBB 3BP4B 1TYEB 4UNIA 3SGKA 4Y4KC 4Z7VF 3GBMH 5F93C 2ZXAA 4U6YB 5JNYB 1VRSA 3DROA 4X0KA 3VGAB 1J5HA 1U9KA 4H88H 1FIGH 2R4SH 1CDCA 1SLVA 4GAFB 4CVXB 3D05A 3CFUA 3MBXL 4CN6A 5CCJA 2QLYA 2IF7A 4MJ4A 1SMDA 2FHFA 3SDCA 4DUWA 3S5YA 3EFOB 1RI8A 1MI5E 1RPKA 2QR0A 2X44D 5I0VA 1ZY9A 3LXAA 1MH5B 1XZWA 4JLRA 5IFHH 3J7HA 5TF1L 4IRSD 4YLCA 3CQPA 3GSRA 4OKVA 4CU7A 1WFIA 1GMEA 3VFRB 3G08A 2ZX9A 4Y4KD 4QOKB 1AZRA 4AUYA 4OZHB 4C47A 4JFWA 1SN5A 3FT3A 3LNHA 4NC1E 4NO0A 1ONQB 4A7SA 2WC7A 5JXED 1QLEL 4AI7A 4JO5A 5BPPA 1ASOA 3K5SA 4Q89A 3RAJL 1KELH 4OFYA 4HBCL 4OKDA 5DD0L 4PJ7B 2YPLB 5F1SA 1CXIA 5HJBA 3BESR 3K6DA 4UB0L 3RP1A 1L9NA 4ZQTA 3QNXB 4UINH 5LAPA 1ZV5A 4WY7L 1HINH 4Y5YA 1CT8B 1NCTA 1EGJL 1LYQA 4P4RB 4O58H 3TX4A 3MV9B 3NJGA 5FUCC 1GH7A 2K7QA 3EGSA 4KKBC 1RZIA 4YSOA 5A6IA 2YKLL 1NA8A 3APMA 1CICC 4Q9QH 1P53A 5LGHH 4B96A 5C8JB 3IXAB 4R4BB 4PS4H 3OMAB 3SCMD 2AEWA 2UXVA 4FQIL 3H54A 5IW1B 5I1IL 4OLZL 2H9GA 2GSGA 2EC8A 1FFPA 4J2QA 2X9XA 4L1DA 5HYJA 1PZUB 1IC5L 3DX1A 3MUGA 4U05A 3V0EA 4Q58C 3II1A 4XNAA 2XWEA 2JELL 3L1OH 1Z32X 1Z9NA 4E5XG 5MENB 3TCTA 1OAQH 2E59A 2A4CA 2NW3B 4NEHB 5DCCA 2Q6WA 4AYGA 3U9PL 4UT9A 2LAGB 2DRUA 2UY7A 5ALCH 1LQBC 5BRQA 4POUB 4JDEB 1IC4H 2UZXB 2Z8RA 5EFIA 4ENEC 3JQOB 1UJ3C 2MFNA 5KBMA 3TN0A 1XEDA 2HJFA 1TZ8A 1RJZA 3WL9B 1YSOA 2KHAA 4R4ND 4JFYA 5F1IA 3MA9H 5FA3A 1CK0L 2WW8A 2WXFA 4R97C 1UM6H 1FO0B 2VZTA 3K80A 5I8EB 2FIKA 5IROD 5D7LA 5JIHA 1U3HB 5C0GB 1Z9LA 4EDXB 4P46D 2DQTH 1IJ9A 3CMOL 2BNRA 1FZJA 1QFUL 1OY3B 2Q10A 4X9GA 4A2FA 3VFMA 3ESNA 2ESVB 3GSNB 1VFMA 5JQIB 2VO5A 1RL1A 1AGBB 4LHJB 4BZYA 2AHIA 2J57A 1LM8V 3GZPA 3L8QA 1Q0XL 4DVBB 3MV01 2W07A 2YXVA 4D9QE 3O2DL 1OGSA 1CGTA 3V5DA 4GG6A 2AK4B 5DR5L 1T1XA 4WHDA 5I24A 1W8OA 1A7RH 4A63A 4JL1A 3CXHJ 4L8BA 2YPKB 2HFGH 4NQVA 4MJ2A 3MODL 2HLFC 1JYNA 2N4IA 3QDGB 2OKMA 4LSTH 1JL8A 4URKA 4OH2A 2QADD 2H41A 5IBUB 3QEHB 3H4HA 3EYQC 1GHFH 4W68A 4PTTB 1WA1X 2D0FA 3VX1A 1D7DA 1P7QD 2VXVL 5A40E 2QHLA 3DIDA 1JFQL 1AJ7H 4XNDA 3O4OC 1FGVH 4DKAA 1ZWIA 4J3OH 4YPGA 4LCCC 1XIWD 4QXUL 1SQ2N 3CLEL 4W70A 4HWEH 2ED8A 2PP7A 1EDYA 1A3RH 1JF5A 2HG5B 4RETB 4RMQA 1QUNA 4GP5B 5KANI 4PR5A 4PP2B 4N26A 3EGXB 2PPFA 1KSRA 2Z31B 4U1MB 5FYJE 1MCRA 4ZS6C 4YHML 4EI5C 2DQGH 3N9GL 3QDAA 3UMNA 4H88L 3MLXH 3QDMD 1RK1A 1U91A 4XC3H 43C9A 1I85C 4OTXH 3E7JA 5I1JH 4HUMB 1HHJB 2A9DA 4E41D 2X2JA 4K5MA 1O7VA 4YBHA 1WLHA 4KMTH 4Y9EA 4S11A 5DC4B 4DFIA 5IFHL 1W0WB 1XXFC 3B37A 1KGIA 3UTPD 1BAFH 1J11A 1WO2A 2JTDA 4NQDA 3ZL1A 2CM5A 3QUGA 3N91A 4AV0A 3B5TA 4IKNA 3H9ZA 3HZYB 2YQ3A 3IJHB 3FQTA 3W0WD 1R5WA 3DBXB 4XNYL 2E76C 1CF1A 1F1DA 1WCBB 3HC0B 3OB0H 3DYPA 4KOCA 4U31A 5GS1A 1GIGL 3O2WL 4GKSB 4FQPA 3RVWC 3RUGA 4A2GA 2V2TB 1K9TA 3L3OA 1S7QB 5E4AA 1NTDA 3WAJA 2R1XB 1KPVB 5LBGA 4FQ1H 4XXWC 2YQBA 1HE7A 4NNYB 5GS2H 2KT6A 4MQTB 1S78D 3BWUC 3AY4A 3QJQB 2WLIA 1AKJD 1NUNB 2FUTA 3V6OC 4Z3HA 5I74B 2Z7YA 5EZJA 1JF1B 3LKRB 3MRIA 1H15B 4GRWB 1AR2A 1JNJA 4K71C 2X12A 2WUBL 1IC7H 4NQEB 1G9NH 1KGCD 3N1MC 4PJDE 4PW9A 2Z9TA 4X7CC 2AXGB 4YAQB 4PS4L 1CIDA 3RVWD 1SHMA 3S37H 3NA9H 2WQRA 3MFGB 2VMCA 5E9DA 4JPWH 3VXOB 2L0DA 3HZMA 2LGNA 4YHZL 1OARL 2WZ6A 5E6RB 5T3ZH 4ZFZA 1C16A 1E90A 2UYLB 2XBDA 4YE0A 5IV2A 1G0XA 3SDXB 4ODUA 3EXJA 3U0PA 5I2IB 3CX5K 2EYRB 2YUVA 3T1FA 1J10A 1BBDH 1NOFA 4E42B 1M9SA 2V8LA 3DETC 1MJJA 3GJFB 1TU2A 3BGFC 4JRXB 4N3TA 5L9DL 1E2WA 4L1LA 4PWKA 5B4MC 2BC4A 5ALCL 3RVUC 3RVTC 1UGNA 4UOQA 4FG6C 4MNHA 4F9PC 4GUCA 4HT1H 5GGSB 5IK3A 4D0CA 2YA1A 1OK0A 4KY1L 4DP0X 4XBGB 3P69A 1ZGLA 3X13B 4Y1SA 4R7DA 3NRPA 2CJTA 1XSKA 4WW2C 1JPSL 3F7QA 4LE8A 4F5CA 5LNDA 3WU1A 3NCCB 1OQOA 4DGIH 2I9TB 3D0LB 4N8VG 5B3SB 2R7EA 1V54B 2DQTL 3TO4A 3BAIA 3RVUD 3F12A 5CZVH 2VT0A 3H3BC 4IBWA 1AO7E 4HJUA 1F4XH 5DJYA 2YQ2A 4WFHD 4HWZB 2D03H 3BX7C 4EPSA 1R4XA 2MWCA 3ZGIA 1FZKA 1CIUA 4HUXB 1OOAA 1BZ9A 1PZCA 1WICA 4JPKL 3LB6C 5HI4D 3APNA 5DA0B 1A7RL 1FF5A 2NDGA 3QQ4A 3HI1B 4E9RA 4G80A 2HFGL 3AMKA 1GOHA 4KXAA 1RCYA 4LSTL 4GRLD 3O4LD 3MUJA 1SN2A 3QARA 4PLOB 3ZKQD 2QQQA 1GHFL 2EVIA 3TV8A 4S1QH 1Q9KB 1UT1A 1KBBA 4LPYA 2TAAA 4L8DB 3T3PB 4KKZA 5DRXA 1BX2A 4G43A 1AJ7L 3ULUD 3JV0A 3IMUA 1CDYA 3VXRA 2XPZA 1AIFB 2BW4A 2P52A 4IRJA 4PG9B 3FU3A 4HWEL 1J05A 3GSXA 1R33A 1HTYA 3SGJA 4KZDH 3ZGHA 4YDLB 3U0TA 3EHBC 4EUPG 1OAZH 2F1AA 5F7YC 1PKQA 3D18B 3MN8A 3LRLA 3MLXL 3HNSL 2WLKA 5T1KB 4XC3L 1CC3A 3FSAA 3P9MB 4E41E 2ZKYA 5I1JL 3W5NA 2RJMA 4GFTB 3VA2C 3UXFA 3RGHA 3ULSB 4PEEA 1P9MA 2E7BA 4JKPL 4KMTL 4P2AA 4TUKH 3UTPE 3GLZA 3K6SB 2X1XR 5JW3L 1YNTF 1BAFL 3BVNA 3W0WE 1TT6A 1KXQE 3H9YA 3QNYA 3AM8A 3AS1A 3FK3A 1JGLH 4TSAH 3NT0A 2QPSA 1N4XH 3FOLA 3GXDA 3PXHA 4I0PD 4Z0XA 3ROLB 4K7FA 4B9CA 3RI5K 3OGOE 1R3HB 4U1HA 2O6DA 2OJEB 3ESMA 4PY7B 4CAGA 3BZEA 5BZDA 2H5UA 1SEBB 1YNKH 4YDVA 1CDUA 4FFTA 2NQ3A 3WENA 3NFPA 1B0GA 4EIZC 4MS6A 3QI9B 3AS2A 1JZ3A 3QAZC 1BFTA 1AHWB 1MY7A 2AJXH 2Z64C 3KD4A 4JFOB 2P5WB 2VMEA 3L7EA 4PRNB 4TQEL 3TNNA 4PRDB 1IAKB 1YC7A 3ML9A 3T2QA 2EVGA 4ZS7H 1KGCE 2WVSA 3LEYH 1I31A 5E2TH 1IC7L 2CRYA 3FSZA 4OI9A 4A6YL 3DTDA 3EFDL 1G9NL 1GTNA 7CGTA 3F83A 3DX8B 3ME0B 1FORL 5BRZD 1U4FA 3WKMH 4TNVK 4Z6AT 1T20B 5ACZA 4NPKA 1JK9A 3S37L 3HS0C 3NA9L 3RZCB 4ATTA 5F7WC 1W6WA 3VSTA 5CJBA 15C8H 1CG9B 3BUYB 4MRCA 3D69B 5T3ZL 1M7DB 2BNQD 2LAAA 4OT1H 2BY2A 4ZD3H 5B39G 2RQEA 4MJ6A 1G7QA 5TDPB 3CH1A 3QIBB 2GKIA 1U93A 1D9KA 4X9IA 2WIMA 4A66A 2OMVB 3FONB 1UACH 1BMGA 4RX4D 1LO5B 2A99A 2P9RA 4EN3C 1RPQA 1AQ8A 3ZO0A 1G1KA 2OTUB 2PPAA 4Y19D 1GZHC 2R2HB 2XVGA 3IMBA 4K07A 1SPDA 2WBXA 4EZLA 3DVGB 5E94B 4PB0H 4EF3A 1QSFD 3QG6A 1BZ7A 3LZQA 5D70H 3NCJL 1W72B 1UZ8B 1JGVL 1EZUA 4Y1AD 3UG3A 8FABB 4WQOA 4CC4C 3FHAA 2UXFA 4PRPB 4GW1A 1WBXA 2P5EB 4DGIL 1RJLA 4MA3A 4Q74A 4N0FB 1ZIBA 1G7JA 4OVVA 5FYKL 2XFGB 5HHXH 5DRZB 5JA9A 4GY4A 4F2ME 3OR7B 4RCAA 5CZVL 4XZUA 4HS6B 1FL5B 4WFHE 2CK0H 3PHAA 3U4KA 4K8RL 2D03L 3KZ8A 1NC4B 4S1DC 2VXTL 3HNVH 4BSVB 1SGKA 3W9EB 3UERA 4JMXA 2ICWB 4PJ9D 2IDSA 1BXUA 3UAEA 2V2WB 3VTTA 4MNQB 4H5SA 1HC1A 1LP9F 3O4LE 1MI5A 4ZOEA 1O75A 2NY1B 3QWQB 5SWQB 1A66A 3MRLB 4DZBA 4S1QL 3ULUE 3RWJB 2IGLA 1T89A 1P1VA 3RFZC 1WAPA 2OMTA 4N5UA 3EYSH 3UADA 2Q86B 3DSFH 5B3JE 1Z2KA 3BO8B 1BVLB 2ARWA 3RDTC 2FYYB 1XMEB 2NUTA 3UIZA 2IC2A 5C2BH 3OHXC 4OLWH 4R0LA 4KZDL 3CZEA 4XWOD 3UJJH 1M2OA 1RJCA 4HCRH 5HHPA 5L2JB 1OAZL 1PX3A 4Q4EA 1YMHA 4OJFL 3D52A 3DX9B 3FT9A 1QRKA 4NC2B 1WYJA 2GJ6D 2YLKA 4AXWA 3KPQA 5BW7C 4WI0A 4ENZA 1CFTA 2CLRA 2YK1H 4LF3A 3AB0C 1NKGA 1RZPA 4D0DB 1BF8A 3ARTA 3H9HA 4BH7A 5JPMB 5KSAA 3GBDA 4WJ5B 5IM7B 3B4NA 1NWOA 4OD2B 2Z8WC 4TUKL 4ZZKA 2P80A 3W9DB