3NJGA

K98a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTAFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 19
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njgA00
2BO0A 1MZZA 2IAAC 3X1NA 7PCYA 1GS6X 2R7EB 1XB3A 1PLCA 2BP0A 4E9YA 1KBVA 3S3DB 1A65A 1NICA 1OE3A 3T71A 4A2GA 3FS9A 1HAWA 1PAZA 3PAVA 2BP8A 3EHBB 1NWPA 4Q89A 1QNIA 2VM4A 3IN2A 4HHWA 3V9CA 1SF5A 1JXGA 2CCWA 2GB2A 1AZRA 1PY0A 1NDTA 3SBPA 4DP6X 4G7RB 1N68A 2PCYA 2YAOA 1N70A 5E9NA 1PMYA 1J5CA 1PCSA 1ET7A 2VN3A 3BVDB 2ZOOA 2P80A 3NSFA 1KCWA 1ID2A 4KNTA 2DWTA 2UXFA 2VMJA 2PPCA 1NIDA 1CYWA 1T5KA 3C75A 2A3TA 4HALA 2XX0A 4ENZA 1OV8A 4KO9A 1XB6A 3OMIB 3WG7B 1V54B 2J5WA 1AS8A 1V10A 4A67A 2PPDA 1M57B 1IBZA 3OM3B 5B1BB 3TASA 3UGEA 2BZ7A 5B7EA 1IC0A 1EHKB 2YQBA 1NIAA 1XMEB 2H47C 2Y69B 2HX8A 1OF0A 1J5DA 4YSAA 1ADWA 4L0PB 1GW0A 2UX7A 2B08A 3GDCA 1NIEA 1NPNA 1WA0X 2FQGA 2YXVA 1AS6A 2DY2A 2X88A 2PP7A 5D4IA 3ZIYA 4G72B 2IH8A 5I26A 4DP4X 3N2JA 5A7EA 3FSVA 2GC7C 4HZ1A 1ZDQA 4HCIA 2R7EA 3UADA 1DYZA 1E5ZA 4UANA 1HFUA 1JXDA 3H4FA 4NAJA 3JTBA 2VW4A 1BQKA 1ZDSA 2QDWA 2JKWA 4QKTA 3KW8A 1PZBA 1GY2A 1PZAA 3NP4A 1E67A 2FNWA 2WO2B 4YVNA 3UAAA 5I6PA 4GP8B 2BW5A 3ABGA 4GY4A 1A8ZA 4FA7B 3FU7A 1TU2A 3QJTB 3FSAA 3EH4B 1TEGA 4KOBA 2I7SA 3U25A 3CDZB 1J9RA 3EH3B 1AS7A 1AZNA 1ILSA 1OCRB 3D12B 1JVLA 4GP4B 3S3CB 5I5IA 1KYAA 7PAZA 3OMAB 1L9QA 3KW7A 8PAZA 2NRDA 4KOCA 1BXAA 2IDUA 2XV2A 5B1AB 2XX1A 3WNJA 3NYKA 1ILUA 3DTUB 1MZYA 1QHQA 3AW5A 4BWTA 2H5UA 2CUAA 2HRGA 4E9TA 3AG2B 3DIVA 1PLBA 2GHZA 1CUOA 1JZFA 1IUZA 4G7QB 1RZPA 4QLWA 3TA4D 4FAAB 3WI9A 4UF7C 2QPEB 3FQ1A 3AG4B 1NWOA 2DYRB 5F7BA 1KCBA 4A68A 2YAMA 4Q8BA 2BWIA 3QJSB 2XV0A 3ZBMA 4DP8X 1I53A 1FA4A 1SFDA 1W6LA 1AANA 1GR7A 4YSQA 1R1CA 3ERXA 4DP9X 1SJMA 1ZIAA 2AVFA 1OE1A 1OCZB 3QJUB 2TSBA 2EILB 2XXFA 1CC3A 4W9ZA 2EIKB 4DP7X 3DKHA 6PAZA 4DP5X 1PLAA 2BWDA 2EIJB 1L9SA 2UXVA 2E86A 2PP8A 1UATA 3CDZA 3ABKB 4AKPA 1BQ5A 1SHWA 4A2EA 3AY2A 1L9PA 5B1KA 3WKPA 2UXGA 4M4RB 3PAZA 3JT2A 3NSDA 5I6LA 1AIZA 2XXGA 3FYIB 3L45A 1AZUA 4AZUA 2B3IA 1X9UA 4GP5B 1L9OA 4ZK8A 1GYCA 3PCYA 1J9TA 2OCCB 5I6OA 2ZONA 4GXFA 3X1GA 3FPYA 1NINA 4G70B 2N0MA 2AFNA 5I5MA 2XU9A 3NJJA 3T9WA 4AX3A 3FU9A 3AG3B 2DWSA 3FQ2A 3T6XA 1WA1X 2AZUA 2XYBA 4BDVA 4BXSV 1SNRA 3SQRA 2AANA 3FSZA 4BWUA 3UACA 2VW6A 2DYSB 3ASOB 2PPFA 2YAFA 5ANHA 1W6WA 2QT6A 4NB7A 5EHFA 2GIMA 1AG6A 1KV7A 1JOIA 5I6MA 3OQRA 1PNCA 4GYBA 2FTAA 2J56A 4A66A 1AOZA 2XV3A 4G71B 1JZGA 3H56A 4DP0X 1ZIBA 1E5YA 4RH4A 1WS7A 2MRYA 4KO7A 1WAEA 2IWEA 4EF3A 2FT8A 2EIMB 3QQXA 1RZQA 3WNIA 2HX9A 1MG3C 4NERA 9PCYA 1EZLA 2GC4C 3PLYA 2HX7A 1BAWA 4P5RA 1X9RA 1RCYA 3S8FB 1FWXA 3CVDA 4G7SB 1J9QA 3PAUA 4BWWA 3TBCA 5AZUA 4AI7A 2RACA 2YAPA 1ZPUA 2YAEA 2ZWNA 2FQEA 5D4HA 2DV6A 1FFTB 2XUWA 3IE9A 1V55B 1SF3A 2VW7A 5I6NA 1GSKA 1OCCB 2YARA 1CYXA 1L9TA 3QJVB 3OMNB 3N55A 4X4KA 4A2DA 2I7OA 2QDVA 4M3HA 3T6VA 1A4AA 4P5SA 1JZJA 2W88A 2UXTA 3MBWB 2FQDA 2MTAA 3MX0B 1PNDA 2AZAA 3FU8A 3CZUB 3UAEA 1B3IA 1NIBA 2FT7A 4F2EA 1TKWA 2FWLB 4F2FA 2UX6A 1PZCA 1IBYA 1AZBA 4YSDA 4AKOA 4E9WA 4YSSA 3BQVA 2VSKB 5LDUA 4YSUA 1VLXA 2VSMB 2GI0A 3HEIB 4BK5C 3NSCA 3IN0A 1ET5A 1BEXA 2IWKA 1MG2C 2PPEA 1W8EA 1JZHA 1M56B 1URIA 2TSAA 4YSCA 2FT6A 5D4JA 3NP3A 3NJGA 5TK2A 1AACA 1PF3A 2OV0A 1M9WA 3NT0A 4WTQA 2BHFA 4PCYA 3IBOA 3H4HA 2Y1AA 4A2FA 1AQ8A 2HRHA 1JZIA 1OE2A 3NJKA 1BYOA 5PCYA 4YL4A 2BW4A 1KDJA 1BQRA 2X87A 3PXLA 3FSWA 1ETJA 2I85A 2WSDA 4JHVA 3TBBA 4TXVB 3V9EA 2FJSA 1A3ZA 3SBQA 2HXAA 1MDAA 3IEAA 3GXUB 2Q5BA 3PPSA 4DP1X 1GS7A 1RKRA 5IY5B 4DPAX 2WO3B 4YSRA 4AKQA 1WA2X 1A4BA 4E9VA 3X2QB 1ZV2A 1WS8A 3X1EA 3CVCA 1KGYE 3NJHA 1JZEA 3WKQA 4BXVA 2J55A 4YSEA 5B3SB 1A4CA 3HB3B 4KNSA 2PCFA 1YLBB 3FU7B 2CBPA 4KO5A 1ET8A 1E30A 1F56A 4K9JA 4E9RA 1BYPA 1SDDB 2CAKA 2IDTA 2W8CA 3T6ZA 3ZDWA 5I28A 3ZX1A 2VM3A 3G5WA 2BZCA 5B1JA 3X1BA 1ASQA 3ABMB 1IKOP 1NZRA 4F7KA 2HZHA 1NTDA 2IH9A 3X1FA 5AFAA 1AAJA 2YXWA 3NJLA 1E65A 3FYEB 4YSTA 1QLEB 3EH5B 4CSPA 4A2HA 6PCYA 3RYMA 3NJFA 1TEFA 1SHXA 2QPDB 2IDFA 2HLEB 1HAUA 4UAHA 4KNUA 5TK4A 2XWZA 1GY1A 4KO6A 3AG1B 1ASOA 5PAZA 1L9RA 4N4YB 1XB8A 2PPAA 4YVUA 2J57A 1AR1B 1J9SA 3QJQB 2BP0B 2OJ1A 2JFCA 2LLNA 2IDSA 3NJNA 2PP9A 3NJIA 3SBRA 3FQYA 5I6KA 2CALA 2EINB 2PLTA 4N8UA 4DP2X 2BP8B 1JVOA 4HAKA 1NIFA 1SDDA 1KBWA 3CG8A 3T6WA 4YSPA 3QPKA 1BXUA 1JXFA 4E9XA 4JHUA 1NPJA 1BXVA 2IDQA 3UABA 4DPCX 4HIPA 2GSMB 5FC9A 1AZCA 3S3BB 3FT0A 4YSOA 2XVBA 2ZXWB 4JKNA 4W1TA 5F7AA 3NJMA 1OOWA 3S8GB 1DZ0A 3ABLB 3WIAA 3OD3A 1AG0A 4HCFA 4HCGA 2H3XC 5B7FA 2Q9OA 4PAZA 2JXMA 1ASPA 1JERA 2YAHA 3GYRA 4E9QA 1KDIA 4MFHA 1CURA 5AKRA 4E9SA 4CSZA 2FQFA 3FPXA 4BDVB 2CJ3A 2GBAA 2P80D 1OCOB 4HHGA 3EF4A 3QJRB 3AZUA 1GS8A 4WKXA 5I5JA 4DPBX 2IWFA 3CVBA 2YAQA 3TU6A 3NSYA 5B7MA 3ASNB 1SFHA 2XLLA 5B1JC
chains in the Genus database with same CATH superfamily
2ODHA 4LGSB 4YQXH 1RU9L 2FO4B 4FJ6A 3OTTA 5C9KA 1ZLVH 1WTLA 2HPOA 3SDDB 4XMLH 1OE3A 1TPXB 5DYFA 4I85A 2ITFA 3LKOB 4CKQA 4HPOL 3FF7A 1QNIA 2VM4A 4YHPB 1AIFA 1A21A 2VQ1B 4LHUA 3AAZB 3SBPA 5DFTA 3N42F 1UADC 2GG1A 3RZCB 1R3LA 3MLYL 4N87A 4RAUB 1NOLA 2ALWA 2WCPA 2H2SD 4H1LG 1NFAA 5FA4A 5AVSB 3NSFA 1ROCA 1QWUA 1WWBX 5T33H 4OJEH 4WV1A 4JFOA 1P4UA 2PPCA 3MMEA 2JVUA 1BV8A 3C6LC 4Z7UE 2BDNH 3FKUS 1QLRA 1I8LA 3AREC 2KMWA 4EKJA 4QJ4B 2E7CA 5F1OB 4KKRA 1T4KA 1QRKA 5I8CA 4DAGL 2GAZA 5LG1A 5IR1A 1R3JB 2C5DC 3OJVC 2NXYC 2XG4B 4EZLA 2FVNA 5GS2D 1AMXA 2ADYA 3V52L 2APTA 1KOAA 1WZLA 1MQKL 3QXTA 4YSAA 1PG7H 3IJEA 4ZFQA 5CS7A 2HLAB 2AS5M 1Z9PA 4I1NB 4ONOA 4Q7DA 1HH9B 5KJ7E 5D4IA 1UWEH 1U8JB 4F58L 1U95A 4PGDA 5C09B 4DP4X 4RNRA 4U0QB 4YAQB 3RAJH 5K69A 5IJKA 1QUPA 2FHFA 3GSRA 3OR6B 4HCRL 4HFWB 5BS0B 4MB4A 1JHTB 2BERA 5MENA 4QRPA 4JR9L 5EORL 2VMDA 4I4WA 3TBTA 1ZHKA 4QXTA 4KMLB 5CHNB 4LL1A 5I8OH 2A6JA 4L0ZA 1H5BB 2ROYA 5TPWH 5I1HL 1PZBA 3T3MF 3B7SA 2ZE0A 4JZOA 4NJAL 5EIIG 2WO2B 2XHNA 3UAAA 3AY4A 4S2SB 3K2KA 1CJYA 5D2NC 3SOBH 1WHOA 1GOFA 5MEQB 3SDCD 3IPEA 2FZ3A 4ZUSA 1TEGA 2YA0A 3F64A 1M7DA 2A38A 5HHPA 2PCPB 4OIIH 5CSZB 3EH3B 2VDNL 4JPSA 3REVB 5IFAL 3SKNB 3RVUD 3FFDB 5FKPA 2B4CH 2CQVA 2V3FA 1DHKA 3VXRE 4U2YA 4OSUH 3FQUB 3LZOA 1EFXA 1ZTMA 4NPJA 3SYAA 4FNLH 1F1AA 4DF9A 3JWNG 7CGTA 1NGXB 3HBPA 3RIFK 1AQKH 4Z7WB 5T1DH 5A40E 3AW5A 1E4XH 2F53E 2BOCB 3CN3A 3F01A 3B9VA 3E1ZA 3ML9A 3OAUL 4JFQB 3TONA 4K9EL 4QRQA 1C5DB 3JZYA 3TVMD 2COQA 1J1OH 2K4AA 4LHUD 4B9CA 2YPVA 2WIMA 4RSVA 2EE6A 4FXLA 4LOUC 3T77B 5E08H 5CZXC 1PDKB 2V7HA 4GEJA 4QRSB 4APQC 3BKYH 3LXUX 4CMMA 3U4EB 5IFJA 4PJBB 5ACZA 4S1RH 1QRNA 2ZCZA 5LBGA 1YVLA 4GB9A 4HWEH 25C8H 4EDXB 2J6EL 1AO7A 4FI8A 2M8XA 3OL2A 2ZUVA 1FYTB 1QO3B 4E68A 5EA0H 2XWJB 1UQSA 1W6LA 4HU8A 5G2NA 3ERXA 4ODXB 1R3KA 1INDL 2BS8A 4XNQA 4YN3A 3WHXB 4ACPA 4HXAH 1CGXA 3IMRA 4QAWA 1KCLA 3LNDA 2AGJL 4KKAD 5SWSE 3FT2A 1F6AA 2VLKB 4UDTB 4DP5X 1MHCA 4NUMA 5KBMA 4YZFE 4EN3B 5GSRA 4OT1L 5IG7B 1RUKH 2Y6TE 1TETH 1ZGLB 2D7PA 2BFGA 2ZYSA 5C08E 1AGDA 1SHWA 4YDJA 4X6CB 5CD3A 5A7BA 5T5NG 4AYBA 3VRLE 1J7VR 4XNUH 4DKAA 4N1CA 2NY2B 3B2PA 5IJCC 2DEXX 3UFIA 3KBFA 2OXGB 2ZSVB 2ITDB 4ALAL 3VXUE 3GFUA 4XB7A 1Q0XL 5CLTA 4D9QD 2K9UA 5I17B 5IMMA 4GXFA 5BRPA 1NINA 2JLPA 3HE6A 1J11A 3OKDB 1FZMB 3P11L 4PJ5A 4BFBD 3UPRA 1FVCB 4YBLB 4LOVA 4G42B 1J9CT 3FN0L 3GD1C 4PJCB 5HJ3A 3FOLA 3ZE1F 3OAZK 4LVHC 1P0SE 3B34A 1INQB 3AADB 4GRWB 5FGRA 1IGCL 4KTGA 3QDHA 5AOZA 3HIZA 1ZS8B 2WXMA 3PWLA 3L3JA 4HFUL 1MCRA 1DN0A 3TFKD 1Y18B 2C9RA 4FQQB 4JPVL 4PB9H 4G83A 4FLHA 4P23C 2DYSB 3LNHA 5CJOH 5TDNB 3HMXA 2DEWX 4KMQA 3K71B 5H2BA 1F42A 3KLLA 4AXWB 2JF1A 4HIHA 3BQUB 3W0WB 3O11A 3O8XD 4QRAA 3HBZA 2ZKHH 3AXIA 4ZT1A 3H56A 5KSVB 4Z0BH 1WAEA 2EDYA 2NW2B 3JXAA 1AGFB 4XMKL 3D0AA 4BRVA 4BYHA 1VA9A 4AVKA 4E5XB 2Y23A 4G43B 4NO3A 4RFEA 1DLHB 4LCIH 4PJ7A 3NIDB 2DTSA 1AGCA 5CILL 4ICXA 2YOAA 3CFDA 4ZAKC 4U6XA 4ALAC 2X1OA 3PWPD 3RVXC 1R34A 1WP6A 1KC5H 3C87A 2A73A 2MSPA 2Q7AA 2ZUXA 4KVCL 5EO0B 4LAQL 3V79C 3LNEA 1QRND 4L4TA 1L5GB 3ARPA 4OGYH 1RSYA 1XR9A 3PHSA 1CO1A 2IPKA 1BGXL 3PP3K 4RRPA 2EDMA 4IOIB 4AQOA 2W0KA 3OMNB 2OK0H 3K72A 2H41A 2VABA 4OV6F 1UT9A 4R6UA 4UM9A 3W57A 4P5SA 1QABA 1KIRA 3HS0A 3PHOB 1XGQB 2P8PB 1HOCB 2X4NB 3CSGA 2X4PA 5I1AA 3JWNC 5FGBC 1G5GA 4YC2C 1X4ZA 4M6ML 4PLNC 1AP2B 1G4RA 2FUTA 1SN2A 2PW1B 5F8RC 2PETA 1AZBA 4JJ5B 1KZQA 5CKAA 4HKJA 1E90A 3MBEA 4PRNB 4U3CA 5DHDA 1J18A 4Y16D 5GGSA 3W3BA 3QEQB 3ZTNH 4K3GA 4AQ1A 3VXSE 3L5WB 3HE6D 5FF6A 3SB3A 1HSAA 2ZTBA 3HA0A 4Z18A 3P40A 4PG2A 5HJGA 1A6TB 5AG9A 2WNKA 1UOKA 3K6IA 5D7SL 4PJDF 5B3JF 4IYKA 5GGVH 4LQFL 3TPKA 5IW1B 3FQTA 4UM8B 2V8MA 5JYMA 4U1GB 4X99B 2CO4A 3O6KH 2OMNA 1G9NC 2J3SA 1H9DA 5F6HI 2ZUUA 5C0JA 4W9CC 3SGEH 2G60H 1JZIA 2VXUH 4K7PY 5E6RB 2WCSA 3R06B 3BPOC 1BYOA 3T0VA 4LEOA 4OZHA 2WSDA 2YXMA 3TBBA 5HYQA 2FX8H 3IFLL 4O4YH 4BZ2L 2YN3A 3J2PA 3HRZB 43C9A 2C9XA 2WO3B 2ZAHA 4MKMA 3MACH 1JWSB 1CD1B 1DE4A 1GC1C 1XTLA 1ZWIB 1TSRA 2V4LA 3IJSB 4AGNA 3ZE0F 4LSVH 1KENL 4JANA 2BVPB 3B5TA 4RGNB 4KTDH 4YO0A 4R7LA 2PCFA 3LRLA 4PJXE 3EFDL 2R29L 3I6GA 3H9HB 4OFQA 4XPTH 4U1HB 4ESKA 1H9VA 2NDFA 4DGVL 3ES6B 4OFYA 1N0LA 4KKNA 1UWGH 1I9JL 4R2GD 4UIMB 1MIEH 4MRBA 4CDHA 2ROXA 3QXAA 1FJ1A 1QP1A 4KHTH 3VGBA 3G04A 1JNNH 3IRCA 1NCHA 2UYLB 1QA9B 4U1IA 4F7CB 1CK0H 4JW3A 1NFDF 1HQRB 3L6FB 4JPIA 3SQOH 2BNRB 1QFWL 4HHAB 4U1MA 1E2WA 1KXQE 2W95A 3DBSA 1FFNA 3NDZE 4Y5VB 3ARBC 3BN3B 4TUOB 5EULV 1HT6A 3B2XA 4LCWE 1IE4A 2ZKYA 4UM9D 5DEFB 4EI6A 3RFZA 2CLZB 5FYKE 2WLIB 2HAZA 3FUMA 3VSTA 3B6SA 1QLFA 1T89A 4UBDC 3TO4A 3FO0L 4B9KC 4YHML 4KV5E 4C56B 1TZGL 5SX5H 4MB3A 2I24N 4UMGA 4XB3A 3CVHH 4JM2A 2O6PA 4QWWD 4O00A 1E6OH 3KNBA 4GO8A 3F7PC 4LOFA 1TT6A 5HHXL 3SE3C 3R0NA 2EEBA 5IB3A 5IHZA 2IPUG 2V17L 4FA6A 1XQ4A 2ID5A 5D1XE 3VGAC 5HP5A 2EINB 2PLTA 3N0AA 2R1YA 2RB8A 3S7GA 3TLRA 1JF1B 1SN0A 3QAZC 1EUTA 5TE7L 1SDDA 1VJSA 3CG8A 3QORA 4QUOA 3DBXB 3L17A 3CU1A 1KLFB 3PFUA 3WOVA 1LEGB 4GEIA 3BWAB 3TBSB 4BA0A 3NGBB 3HR6A 5F0PB 1T0NA 5DXWA 3IGFA 4JHUA 2Q2LA 1NPJA 1CPUA 4IIQA 4B9GA 1CI5A 1F3DJ 2FLBT 3RU8H 5FXCH 4PWHA 1OAYH 4RQQB 3DRTB 1Q9OA 3MRDB 3DV6A 4OW6A 3QR1A 3ZOAA 3KYMA 4KQ3L 4XNBA 3LB6C 5F96H 4XMVA 1KTBA 5SX4H 3SO5A 4V1DB 1ASPA 1O6TA 4KXCA 3QG7L 3U7AA 2XVLA 4QR7A 2J1ZA 1DSFH 1CMOA 3VSVA 3FUHA 2GSIA 5AUMA 4FYQA 3RQ3A 1R47A 4X5RA 3DROB 2ZT9C 5I5JA 4B9FA 4XP5H 4NNPL 4B9IA 3CVBA 3PWNB 2EUVA 3BVNB 2DMBA 4PVBA 2FSEB 5B7MA 3AT9A 2BO0A 3OLEA 1P84K 2R7EB 3UTTB 2HH0H 2DQHH 5T3ZL 4Y4HD 5JHLA 1BQHB 5HYFA 3M1OA 1HL8A 4KXZH 5K9QI 5MHSD 3HC3L 3JBG7 2VLRB 3ETBJ 4Y1AD 3BAEL 5INCB 3WEXA 1PAZA 3BEVB 1IAIM 2APSA 4HHWA 5E8EB 2AEPL 4FMFA 1CICB 1F8TL 3AITA 5CBEA 3P0VH 1C8QA 1X6NA 4PN6A 5D1ZI 1IL1B 2PCYA 3ZL4L 1OWWA 3LQAL 3FRPG 4JFXA 2IAMA 2IFFH 1T3FA 4ZFGH 3D08A 5BRZE 1G7IB 3GIVA 4PRID 2CRZA 1B2WL 1LK3H 2A9NL 4OCRL 3C60A 2OCJA 1VCBC 3IDGB 4YLQT 3QNXA 2E76C 1NUNB 1P53A 2J71A 3MRLB 1MI5B 4IRJD 3EGXB 1KBGL 1ECYA 1KPUB 5DSCA 4KDVA 2CR6A 4OH2A 2W65B 1S7UA 4X8CA 4FZ8L 3WDIA 3NPSC 5IHWA 4UB0L 4HX1B 4IQHA 1KB5L 4K8RL 4ZFZB 1JGIA 2K8QA 5CEZE 2AQ1A 2WTRA 2X4QA 3O8XC 1NCWH 5EH1A 1RFDH 2H47C 2XQBH 4RAVB 4KJQC 3WLBA 1WJ3A 4UAOB 4NM4H 4YXLL 4OLUH 3NEXA 4U2ZA 4N2KA 3LKSA 2VKWA 2DB8A 5K39A 5I19H 5D93C 2JKSA 3SGKA 4RMRA 4JL2A 4UQCA 5A7EA 3UP1A 5FO7B 3VFUA 1IM3B 1WZ1L 4L3EB 2B59A 1C5BL 2CJSA 3MRJB 5KANG 2AEIT 1NMAH 2EZ0D 4N6RB 3CLFL 4G80A 1S7VA 3O4OB 1S7SB 1RUQL 2O6FA 4H8HA 3Q0HA 5GRJH 4YIQA 1RERA 2UY6B 3V5DA 4OZFG 3T0DA 4U6YB 2X7LA 1JPEA 1P4LA 2XXMB 5B8CA 1V27A 3HNTL 4DESA 2BW5A 3QUMH 3FSAA 1SDAB 3EH4B 2YGNA 4LCYA 3U25A 4PJFA 2XPZA 1J9RA 5AD0A 2VWEE 5F9JB 3ECQA 3HNVL 5DVPA 4ZOEA 3EOAA 1SUJA 4B3EA 1DQVA 1NH6A 1MCQA 1SMDA 4FI7A 1AJ7H 5EU6A 4WUUB 5D9SA 1K4CB 2GIXA 4XGZA 3E9UA 3CLEH 5E9DA 5G55A 1KYAA 4JB9H 15C8H 4NKOB 4G2AA 4WSKA 1CT8A 4NJ9L 2VDNH 5KAQF 2ZOKA 3US1A 4X98B 2MQCA 3N44F 2I32A 1U8LA 2DMGA 3L1GA 5DYOA 7FABH 1U3HD 1PZ3A 3UH8A 2Y1VA 4ZQKA 1L0QA 1YMMB 2CLRA 5TE6H 2CDGA 3RA7L 3TA4D 2QPEB 4ANXA 2IBZY 3U9WA 3MGOA 1A1MA 4H1LH 1JE6A 3QQ3B 3OAUH 1A6PA 1KV3A 1ZE3C 2XQYK 3SKMB 5HHQB 2GJ6A 4NZTL 2XTSA 2JCCA 4XXCC 5AVUB 1I7UB 1AYOA 1DCLA 3GLAA 1F4YH 4MS6A 1X7QA 3EJJX 2VC2L 1CGSH 4IBUA 3D05A 1JI1A 1HILB 3MFFA 4HUCA 5D96C 1XXDC 2B20A 5E6IC 5C09E 3UJTL 2J1XA 1MRDH 4M43L 5BS0E 1H15A 4JKWA 3FT1A 3L3KA 3M45A 3QJHA 1VADB 4XX5A 3FAXA 2N59A 4DP7X 3IETB 5HVHC 3KLDA 3KLQA 1M3JA 2W9DL 4H0HB 3QPXH 4FQPA 3HE7B 2E7LA 3V4PH 2GBUA 1G7QA 4G8GB 1INDH 3QNYB 2NTFB 4UQ3A 3V7AE 2K7PA 3NSDA 1LMIA 4UV4H 2AGJH 4WWKC 3B7RL 4DKTA 1EXUA 3QEGL 4LDEB 4QXVA 3G6JA 2OTPA 4GP5B 3NA4A 3FTVA 3D0VB 1GZQA 3GNML 3RHWK 3TA3B 3T8XA 2XTJD 1T1XB 1W16A 2FJHA 1CFMA 3FB5A 3TCLB 1BXXA 2OMWA 2ZUYA 4W6XB 1OGPA 4ALAH 5I0XA 3WTTA 3FXIC 2CPCA 2KZBA 2R69H 2W94A 2VRAA 3KCPA 2DWSA 1AI1L 4ZUWB 3IJHA 2YC1A 4N0CD 2GEQA 1X5MA 1AGEB 1E42A 3FQ2A 3PF2A 4QRUA 4Z7WE 5FKAA 4K55A 4F5CA 1D9KC 3P11H 1XIWD 3SQRA 1SHMA 4RCAA 3TNMB 3FN0H 2GBTA 4NHUA 3X14B 3UACA 3MLTA 1L7IH 2J88L 3CFJB 4FXGA 1CGWA 1IGCH 2UZYB 1KV7A 1EGJA 4S11A 1NKRA 2KZWA 1E8XA 5J11C 1NAML 4PY8J 4H13C 4JG5A 4XAWL 4DN3L 1NGWA 4FC3E 2HFGL 4PJBE 2L0DA 4G5ZH 4A66A 3RWDB 5KYXB 1S9XB 3EO9L 1IEAA 5KVFH 3JWNH 1K4DA 4IEFB 1FYTE 2BVOA 4IKNA 4LBEA 3KG5A 3Q01A 5E8PB 3VWKD 1P5UB 5AWNH 4GSDL 3LEXA 4J1UA 3WNIA 1PQZB 4EBQH 1ES0B 1NCCL 3AUVA 1CTMA 3GQFA 3LSOB 4IBZA 1FE8H 4OM1L 4AQEB 4PR5A 1X9RA 7TAAA 3S8FB 4JHAH 4DQOL 3DOSB 1YEJL 4YE4H 1UUSA 2VLKE 3FMGL 3IFPA 1ADQL 2RQEA 2L3BA 3OQ3B 4NKDA 2FQEA 1M42A 1V7ML 2IH3B 4XE5B 2GJ6D 2R23B 3KE0A 1EBAA 3QS3A 1WIUA 3K0YA 4X6CE 2Q6WB 1LHZA 1LQSR 1GOGA 5DEJA 3N1GC 1EPFA 3C12A 3ULUF 4PTUA 1A3QA 4ODTH 2DIJA 1RUAL 4G1MA 3OKNB 4JCMA 3IDXH 4NWUH 3US0A 4IGBC 1JRHI 1XV8A 4GKSB 3H3KA 1G9NH 2I7OA 3FU5A 1SJXA 3GXFA 4LPCA 4XC3L 4N2MA 2VCOA 1WH0A 3KPQB 5BMFL 3MXWH 2AVGA 2IOMA 4BKTC 4OFIA 4PJCE 2X4TB 4NQXB 1YN6A 5KVGH 1MJJB 2ZUQC 4GRWE 4NZJA 3VXMA 2N3JA 3TEZA 1NIBA 3K2IA 3G6AA 3N43F 1NDGA 1EQWA 2OMZA 1GTNA 1Y0LB 4F2FA 1IAOB 2UX6A 5TFSL 5I23A 2F54D 1GC1H 3AS1A 4E9WA 1JZ2A 4KZDL 3VXPB 2X4OB 1UUNA 1QW8A 4LKXB 3A4FA 3HEIB 4M6MH 4B50A 1YEIL 1HEZA 1EDHA 4XT1C 3CFTA 4CU8A 3W0WE 3ROLB 4LSTL 5HDOA 5CBAA 3TT1H 5FFLA 3QUYB 4X7SH 1CE6B 1JYVA 3QO0B 4X0KA 1FIGL 3MV9A 5GS0L 3O0RH 4CGUB 1TYJA 1JF6A 1Z5LA 1CLZL 3HHSB 5KYNA 2A1WH 5TE4H 3FOMA 1MWAL 2LV4A 2MNWA 3ZDZF 4UDUA 5E2VH 4WKZB 1DJZA 3NIDE 3J27A 1T5WB 5E2UL 3SCMA 2BSTB 4YPGB 4OV5A 4PWKA 1WFJA 3VG9C 4N3UA 3V6OA 5LUMA 4JX0A 2KZKA 1SJHA 1IGFH 2Z8RA 3SBQA 4AT6A 2ADGB 3KLHC 4Z1PA 2X2IA 1RKRA 1VF5C 1WITA 5DFAA 4BFOA 4CADB 3GMOB 4IRJC 1RV6X 3RL2B 5HHVL 4XI5D 1N5AB 4YX2H 1BP3B 1I8AA 3VFSB 5E6ZA 1XSJA 4H8WC 1F4HA 1KCVL 5F9OH 2JH2A 1DDHB 4R26H 4KK5C 1QEXA 5C0ND 4R3SA 4N2EA 2W8CA 4E41B 4W70A 2OR9H 5AVXB 3ZDWA 4L05A 3MNMA 4OLZL 1Q9KA 1XCXA 2V9RA 4LDOB 2FJFB 1ASQA 4DO6A 2JB6A 1AQMA 2QZ5A 2BRQA 1MUJB 3IPBA 4ZW5A 3VRIA 4F7KA 1Y6NR 3LRMA 1NTDA 2QV2A 3EADA 4YDMA 4TULL 1HDMA 3QDGA 4JHBA 3BUIA 4X83A 3L3OA 1QFOA 1WRFA 3VYOA 3WGVB 3A22A 2AITA 2QLYA 2RA1A 4DNLA 5DD6A 2BNUB 4FERA 3AWEA 4LF3B 3QEQE 3VQ2C 5E94A 4PWJA 4F7PA 1YC7A 5B21A 3QDJB 1UKTA 3OGCA 4FL4B 2Z8WC 2IDFA 1BBDH 1QBMH 2Z35B 4KDWA 2D31B 4LEXL 5KVEL 1S9WA 2ZAIA 1I1AC 2K3HA 2HTLD 4YWGL 2AJVH 1KN2L 2Z1KA 1L6PA 4N26A 1TQWA 1ASOA 1EX0A 3FCSB 1P1ZA 3HG1B 4N2OA 1WAPA 1D7BA 1R5VB 4TMPA 1DBML 3AREA 1KZYA 4PWFA 4YDKH 5JW3L 2IMMA 4JE4B 3CFMA 1AKPA 1RJCA 1N64L 4LLYA 3CHOA 3I75A 3VD2A 5AYUH 1OM3L 2NW3B 1HWWA 4Y2DC 1S9YA 2F19H 1TZGH 3F7QA 3TJEL 2XJKA 3TZVD 5IOKA 2APFA 2WBJB 3MA7A 1J5OL 2R8SL 4QY8A 5C0BB 2NY3D 4J2QA 4IM8A 1Z9OA 4DCQA 1JGVL 3HN3A 1NIFA 3MV9D 4CDGC 2RFXA 4G11A 2R1WB 3FT4B 3CIQA 3O9WA 4UQ9A 1CCZA 3QJFB 4RGNE 3ZKND 1JXFA 4WJ5B 1RXLA 4RMUA 2CNYA 5CD5D 1JJUA 3SD2A 3LZFH 3QBTB 1P2CA 4WO0A 1MH5B 3N04A 1AZCA 3KJ4B 4PY7B 2AXJA 5IUSA 1X5GA 2OJEA 5DVLA 1F6FB 4QYOB 1M6UA 4YHNA 3BJ91 4QOKA 4G8EA 3CD4A 5KSUA 1OOWA 5DS1A 1FG2B 3GJFK 4XVSL 2X9YA 1E4WH 4MJJA 5D7IF 3NRFA 3QXVA 4EE2A 4NZRH 3DHUA 1Q1PA 5IJVB 4MFHA 2BNRE 3FTYA 3QA3A 1KGWA 2VSDA 1OSEA 3CDYA 1D5RA 1OF2A 2R2HA 1I4FA 3QJRB 4UU9A 4P2OB 1FORL 3V0GA 4FYSA 5BVJA 5KSAB 2C7UB 4UNVA 2YAQA 1W72B 3MREB 1MW3A 3QWOA 3G5YB 5IREA 2H0FA 2DYPB 3BH8B 4TUKH 4LCUA 5LGHH 3DI2B 2FYYB 2DBJA 3HN8A 4R5XA 4C56E 2AV7B 3WFDL 1IIIA 1LGVA 3L9EA 1HKFA 1I8KA 1W2KT 3GXMA 4LASL 4CA4A 4OM0L 3QDGD 3DGGB 1XF3B 1F90H 3MLRH 1IEBB 3CFCL 2E47A 4WHCA 1R75A 3D85B 1RZJC 4XBPA 1MLBB 4GKOA 1I7ZA 3LEVH 4ZMYA 4XMTA 2QPSA 1AD9A 2F7OA 1CL7I 1TU2B 1CFNB 4Y5XB 5AKTA 2WLLB 2V5MA 1XIWC 1OTUD 1CF8L 1FH5H 3EJTA 2ZD0A 2EYSB 4L3CB 2G3ZA 5IVZB 5JMOC 2WM0A 1IGYB 5ADOL 3Q5YA 2YA1A 1JWMA 1T1YA 3TASA 2WLNA 1FLRL 5AW2B 5BZDB 1ZGLM 4I3RL 4LLWB 4YHIA 5D1QD 3G5VA 4J39A 1UCBL 3ARZA 3S2CA 4AWJC 1HHGB 1DEDA 1NMBL 4K7PL 5CJQH 3KWWA 2E6PA 3MLSL 3D4YA 4QJ5B 2UX7A 3WFCL 1B88A 3VWKC 4V1DE 1RK0B 4OGXL 4XN1A 2PXYD 2JELH 3O9WD 1A7PH 2IH8A 1IGMH 3CHRA 2OQJB 4OQTL 1SBSH 2BIPA 2DI7A 1OPGL 4FQHB 5DZ9A 3G9VA 2YZ1A 4WFGE 4UANA 1BM3L 3NH7L 3DOHA 1HZHH 4MA7H 2W60A 2GTZA 3QI9B 4NNYB 3MBXL 1JZ5A 2OP4H 4TV3A 4GINA 3RNKB 3NQIA 1VFUA 3UTTE 3E80A 5DMGC 4UUJB 1T5XB 2CKBH 3KGTA 1ZE3H 4DO4A 1EA9C 1AHWC 5I6PA 1AQHA 4GP8B 2VLRE 3SPVB 3V4VL 2DQIL 1XH3B 5SV4A 1ESOA 1ACCA 2J6EA 2XQYG 4K94L 4YXKH 4P23A 4ZMQA 5DMYA 1N6VA 3VGEA 5EEZA 4G9DB 1S7XA 4IBLT 2BNQB 3V4PA 4L9LA 1KMGA 2Q8BH 1T4WA 4H2AA 4G3YH 5AZ2H 2NX5D 2DLGA 3MODL 1CR9H 2CR0A 2CSPA 4OU3A 4HGKC 3SZ6A 1KJMB 3FUJA 1JBJA 2NPLX 3O3DA 1OIOA 4RZCA 3TH2T 5F7UA 2KC0A 5C7XH 5EBMB 3VXOB 1ETB1 2DQMA 1E9OB 1S5IH 4WNQB 3T1WA 1MI5E 2X38A 4PJ8A 3O6FC 5KBDA 4E36A 3U1SH 5JLZA 5K1NA 4HPHA 1MAMH 4HEMA 5IVXA 5LCVL 3ZDXF 4JJOA 5I18H 2NQCA 4G7QB 3N1PC 3LY6A 2QQNH 3H7LA 5IK3B 5F7FA 3LS4H 2DYRB 4JFTA 3QH3B 1H3GA 3ARUA 3DIFB 2VXQH 4BFEA 1ZK9A 4JAMB 2VDMH 1U8MB 4OZ4B 4KKCC 4GW1A 4ABWA 1YYLL 3RA7H 5HYJD 1O7VA 4JREC 5ERWA 1JG9A 4ZFOL 5HD8C 2HJFA 2PYEA 4L3EE 1DBKH 1NCDH 4YDIH 5I30L 4J27A 5JO5B 3NJXA 1OE1A 4ISVA 3GGWB 2RHEA 2TSBA 3BCDA 4WW2C 4NENA 4AOFA 4AYGA 1JNHA 2YFNA 1QFUH 4JNXA 1URLA 4FXKC 3VFTA 2R0WL 3LD8B 3SE8H 5FGBA 5I1KH 1BQ5A 4HS8L 3TOPA 2DDQH 1J8HD 2QHRL 4I2XB 5B1KA 3WKPA 2QKIC 3ELQA 1DFXA 1V3JA 5C2BL 3O3BB 3C09B 2P7TA 2QMKA 1ACYL 4JY4A 5ESAB 3RGVB 3NVQA 4EI5C 2ZJSL 4KMTH 4U1SA 4KI5D 2B3IA 4MVBC 3T1FA 3L13A 4M5ZH 3JWDC 2IQAB 3PL6C 2CM5A 1BBJA 3EYVB 3ATBA 4KH9A 4JZNB 3S36L 2Y24A 4MMXA 4RIRB 3MRIB 3HZMB 1ZLSH 4WUUE 1ZSHA 1X4YA 3MJ6A 5L2KA 4OZFH 5ENWB 4FFWD 5T1LA 4WFED 4OI8A 3MV8D 5FB8A 4R90H 4IBVA 5KSBF 3D1MC 1THAA 4YUEH 3I3BA 5I76B 4QHMA 1Z3GL 4DERA 2AANA 3RLSA 1MFDL 3NA9H 2V2TA 3HAEB 2VW6A 3MRCA 2PPFA 1MNNA 1CFQB 1YMME 3WFBH 4PTTB 1KN4H 2ZWSA 3TN0D 1TYEB 3MLVL 1QI5A 2XPGB 3P77A 4MBRA 5FYKU 3ZR6A 3BESR 4IS6B 3LX9A 4I5BB 4CRPA 4X8JA 4G7YL 1GHFL 1TZ8A 3BSZH 3OHXA 4JLRB 1MY5A 3MLUH 3UTSB 3VW3H 3BEWA 4X6DA 2F9BT 1F1DA 3SIKA 1WCBB 1TENA 1YN7B 5DRWB 3RUGB 3QZBA 1RZQA 1XGTB 4X6BA 5LAXA 4PJGA 4NWTH 2VH5L 2QVIA 1SZNA 4TM9A 3WMQA 1PY9A 4KZCA 3ROOA 3TZVC 2DJUA 2DL2A 1ZHNB 4WI5A 4TVPE 4X4MA 3JTSB 4KU1A 1X7TA 3QIBB 5EIIB 5E70A 3QARA 2MTPA 2RACA 2VDPH 5K9OB 4O9HH 1KACB 2BXYA 2YAEA 1DQTA 3ZZ1A 4KRPB 4TVSa 3QXWA 3MDJA 4G8GE 3EJUA 4HXBL 5ITFA 1LEIB 4R7DA 1ZT4A 5HGDA 3RWIB 4CL7A 3SDXF 5F88A 1HCFX 4LEEA 5A2BA 3NSXA 5GS3A 3WFHA 5CD5C 1VENA 4HLZG 3NFSL 5L88H 4JO2L 4AIEA 1JZ4A 2IADB 2PYED 3AT0A 3BWUC 5CIPB 5C0GA 1OCCB 2YARA 2DQGL 3G9AB 2IV9A 3IU3A 1WFIA 5JUEL 5L9DH 3IPFA 3OAZH 1KJ2L 4NIYE 1RIUL 4WI0A 4YEEA 1IZJA 1JZJA 1VEOA 2AXGA 4RBPH 2FX9H 4XXWA 4W4OC 2YGOA 2MTAA 2Z92B 3FB8B 3HHRB 3HRPA 4UQEA 2VXSL 4MASA 2QVFB 1IB5A 3ESUF 2XOTA 1EDQA 4H25B 4OFKA 4TL5A 5DMJB 3H9SA 3SBWC 4MYWB 4BZ2A 4O51A 1T21B 3KXFB 3JYCA 3LXBA 4MXVE 5E5MB 3ZTJH 3V0WH 3J7HA 2XN1A 3U0WL 5A6IA 5J6GA 1JFQL 3LHPL 1PFCA 5DFVC 3B1UA 1HHIA 4S0TD 3SE3A 3UTPD 4H8WH 5TF1L 2G2PA 5FCUL 5IQLA 3MGTB 1R3HB 1YECL 4NC1E 4AEFA 2X6MA 2F1BA 2R29A 3VXNB 5CEXA 3KH3A 4BSVB 4R96B 5L2KD 2H0EA 4LKCA 5C0CB 2EH8L 3BGAA 4YSCA 4L5FE 1LWHA 4HWZA 1FAIH 3ZVVA 1AACA 4U4IA 1WT5C 4HK3J 3OKLB 2D7TL 4ZOBA 4LARH 4RFNC 1VEPA 2AEWA 3VWJC 1FL5A 4D9LH 4EQ2A 5JQIB 5TDOB 4WUKL 5FFOA 4QHNB 1QNZL 3VG0H 1IBGL 1HN1A 2QMJA 2CUIA 1CBVH 4M7ZC 3QYMA 2ZWLT 2FHCA 3C8HA 4GG6A 4AM0Q 4PY8I 1NGYA 3OF6D 3TIDA 3FO9B 3DX9A 1FCGA 4CSSA 3PP3H 2VDRB 3NFPA 4JE0A 3EFOA 2YD3A 4OFDA 4E9VA 3KWTA 1LO2L 3GBEA 3EG9A 1ZV2A 3HPLB 3UOAB 3NJHA 1HXMA 1ED3B 1AZVA 2V5TA 2J55A 4N0UB 5BJTB 4WIQA 5CJ8A 4LSPH 1D5ZB 1YPZB 3FU7B 3KR3H 2DQFB 1I9RH 4O5LL 5DU7A 5D1QC 5F1IB 4HC1H 4P2YA 5L7XH 2LFGA 2NDGA 5FGCB 5HHVH 3T6ZA 5T1MA 4Z7VB 3RWFB 2HG5B 4PJAA 1U8IB 1JD9A 1EUUA 3SGDH 1QSEB 1ICTA 4FGMA 2ICEC 2LU3A 2HSIA 4X6EB 3X1BA 4H0GA 2PXYC 4LU5H 2DWDA 3D25A 2HZHA 2LTQC 3R4DA 1RJZB 2YRLA 5CEYA 5I71C 3KPSD 4NUPA 2Y1YA 1XEDA 2BPBA 4NUQA 1FF5A 4KVNL 1NGQL 3DARA 3DV4B 2HJKA 3TH3T 4YSTA 3ZMEA 3B2MA 3QT2A 4K2UL 5T3XL 4A6YB 1RUPL 4ATWA 4TNGA 2ZXEB 4J8RB 3SDAA 4MZ3A 1N59B 3BMVA 1LNUA 3T3PF 4OZGB 2C9SA 2O5YL 1AKJD 2WVTA 5C9JB 3SDCB 2HLEB 1A7NH 5IBTH 1DR9A 5HYSG 1JGEB 4NHCL 3BH9A 2NY6D 3TBYB 3TWCL 4GSXA 3ARGD 5FYLD 2P42B 3QGVA 2OTWA 1NJ9A 2JIXD 2QHLA 2EICA 3ARYA 4PBVC 1IFRA 4JZJB 4UTCA 4PJEB 4I9WE 4LIQL 3S5LA 3GTTA 4POZD 2YBGA 3FQXA 4BUQA 1D5IH 2EDBA 4L1TA 3QFJD 1QHOA 3KYOA 3QO1B 1FFRA 4FKKA 2YJLA 1H8NA 2XN2A 4M5YH 4ZW7A 5L0QC 3EXJA 2FUQA 3GXIA 3ALPA 4HA1A 5I6XB 3TVMB 1AIFB 4I3GA 4LHUB 1FZJA 3VM5A 1JYNA 1KTKE 3L4VA 1F13A 2VUKA 1R19A 4PJBF 5J13C 2EXYD 1H8SA 2WXJA 4PS4L 1GOHA 1HHHA 1CFVH 2BH0A 3CXDH 3NCYS 5FUCE 4AGPA 4P57A 4WV1B 5EBLB 2WY3B 4DEPB 2HKFH 4PGZA 5HHMB 4IRSC 5DI8A 1M4KA 4O02H 3WXWL 1MCBA 3FF8A 1MKFA 4E41E 4XPGL 4AQAA 1TQTA 2FECI 1RZJH 3ATEA 1BM7A 3GMLB 1NSNL 1ZTXL 2YPKA 1QLRB 4O2EA 1O9VA 2BSRA 2PWFA 1V3MA 2IOOA 5DJ2A 3JUZA 5I8CB 1IM9A 1P84J 1T4KB 2NNXA 4NZUH 4OF5A 4JFDA 1VSCA 3BFOA 3U46B 3HG0A 2WUCL 2AK4A 1YEEH 3U1PA 2E7DA 1WEJH 5ALCH 3OXSA 3BZ5A 4Y2NA 3IJEB 2DQUL 5E56A 1Q0YH 1QBLH 3QDJE 5DRZA 5AB2A 4JO5A 1BJ8A 4X5QA 4BEIA 1U95B 4E0RA 3D4CA 3ZKXB 3SY6A 2YUXA 3ME0B 1PZSA 1KB5A 3KWXA 2HWZL 1BW8A 1N9PA 1RZGA 3GSRB 2BXZA 4IKIA 2GK0B 3ZZSA 3RL1A 1ECZA 2BZDA 5MENB 1NLBH 1BOYA 3EJCA 4KI5C 1RUML 3HG1E 4I4WB 3TBTB 1ZHKB 3FS9A 2VZSA 3EYQC 2A6JB 3EHBB 4ENED 3DXAD 3X3FL 4P07A 1KSRA 1Z9MA 2D3JA 4ZXBC 2XNAA 1XCQA 4UNIA 2E0PA 2CKBA 2CUMA 5C0BE 4ZMLA 1DBJL 3MRBA 2FZ3B 4ZUSB 5IB1A 1C16A 2UXFA 3AWGA 2EDDA 4NO2A 5DLML 3VMPA 5HHPB 3K2UH 3NUKA 1CYWA 1TQUA 2A3TA 2DMKA 3K4AA 5E6IA 1J10A 3AB0C 3CN2A 3C5ZA 4Y2OA 4BFKA 3W11D 4A67A 4P4KD 1DN2A 3CV5A 5CFAA 5DUMH 3G6DL 3HCVA 1EFXB 2ZYHA 3P9MA 1RQ5A 2G2RA 3WEOA 1QW9A 2DQEH 1VFAA 4HSAC 3F58H 4NAMA 2TRHA 43CAA 4KBPA 1NGZA 1O9WA 4G6JL 4CVZA 4FMKA 1R3IL 4WK2B 2CO3A 2EDQA 3MQIA 5ADOH 1NIEA 2DKUA 5L6YH 3LKNB 1INEL 4WWKA 1SXNA 3PWPB 2V7HB 1V7NL 3B37A 5T3ZD 1PBYA 2ARJB 1YEHL 3JYBA 4CMMB 4CSTA 5IFJB 3H3PH 2F53D 4Y4FD 5AAWA 5AEAA 1NMBH 4D8OA 1Q72H 1DYZA 5ACZB 1QRNB 3QYNA 2VXQA 1EO8H 1HOEA 1OCWL 2CBQA 2Z91A 3GTVA 3L4YA 4P06A 1AO7B 4RGOL 2VN6A 4XNAA 5JQHC 2HRPL 1ZA3A 5JDSA 2EYTB 4M7JL 4ZO8A 2YD0A 4CKVX 3PG2A 4NQEE 1I1FA 3EOTH 4YHLL 1R3KB 3SYQA 3M8OH 1LDPL 3HFML 4XNQB 3NTCH 1BIIB 1MFEH 2FNWA 1BM3H 4OZIF 2AK4D 5EO1A 4WHYH 3MV7A 3FT2B 1XF5A 1F6AB 4A04A 4KTEL 1MHCB 4MMZC 3BKCL 4W6WB 3GMMA 4N2DA 2IMNA 5DDHB 2VJ0A 4PM1A 2EE3A 4DETA 1AGDB 5J6HA 5CD3B 1PVHA 2IALA 5DS8B 3H8NA 1OLZA 1XF4A 1N0XL 2ZCKH 3GI9L 4PWEA 5DJCA 5EOQH 1IT9L 4K8RD 4KUZL 4HVBA 2FEEI 3MRRA 1A9BA 3NZHL 5GRVK 1EJOL 4DEWA 5DEGA 2EABA 2NRDA 3H7BB 4Y16B 5IMMB 2ZXDA 3PP4L 4P3CH 4NT6A 5D4QA 1E2ZA 1TDQA 1U2HA 3HE6B 4GBXC 1MZYA 4JFWA 4PV9B 4XCFL 3RVVD 2E3VA 3RWHA 1N7MH 4NP9A 2EDWA 2VKXA 5HJ3B 3FOLB 4F8QA 1RK1A 2EH7L 2HT2C 3GBML 4TSAL 3QUXD 1M7IB 1OLLA 4M00A 1IFGA 3L3JB 1G7HB 2D3LA 4OZFA 5KEZA 2CJTA 3JWDH 3ZR5A 5I0VA 4JFFD 3HFFA 1WO2A 1MFVA 3CX2A 4HV8B 4M02A 4OLXL 5E8OA 5EUOA 5EUKA 4N8VG 2J5LB 4DTGL 3WU1A 3S98A 2BRRH 4MJ2A 2KUTA 4PP1D 2DH2A 5H2BB 4CN4A 1YQ2A 4D7PA 4NBXB 4MQXD 3BVTA 1T03L 1EIBA 4IGBA 2KDGA 1KTLA 4U3SA 1ZLDA 1GH7A 3OKKA 4NRYA 1YYLH 2ORBL 2NSQA 4D0BB 3ZSTA 2E86A 5IUCA 2JJSA 3GSNH 5JW4R 4HDIA 1DVSA 1N2RB 4JDEA 4NO3B 1DTUA 6FABL 1NAMA 2UXGA 4KZEH 4JN1L 3QHZL 3CFDB 5JR1H 4U6XB 1VFBA 4L1SA 4F15B 3FT3A 5EIQA 3IJYA 4R2GB 3FRPB 4JFYB 3UC0L 4AZUA 5H4ZA 2A73B 1KWGA 3HOGA 4JN2A 1BFVH 3PCYA 4JKMA 4FABH 2OCCB 2BNQE 1U8QA 5EWIH 4GXUM 1XR9B 2FNBA 3S5ZA 4DZBB 1GCYA 1KB9J 2CRMA 1DQQA 3STLA 2KDYA 3ARXA 3SODB 4NLHA 4F27A 3ARDD 3GO1H 1MF2H 2QFPA 4HIIA 5JIKA 2P5ED 1PL3A 1ADQA 2RIKA 4D0CA 1HXKA 2FWOA 4UM9B 5FO8B 3QRLA 4ZS7H 1KIRB 1WA1X 3HS0B 4ORGA 4YR6A 4BDVA 1F45A 2D9QB 3LAFA 3HKFA 1GJUA 3S36H 4LVNC 1GGCH 4P0DA 5I1AB 1M71A 4EPSA 3DO4A 3RIAF 4NQUA 3WN5A 3UBFA 4OLWL 4WK0B 3V0FA 3UAJC 3ARFC 4HH9B 4MX7A 3VFGL 4DT2A 2NY6C 4AUUA 1FRGH 4LE8A 3MBEB 4AG4L 5IHBA 5FO9B 2NMSA 2XV3A 3LQMA 3S5YA 4AY0A 1IO4C 1A47A 4JFPA 4JPWH 2MRYA 1KIPA 4AQ1B 5FF6B 1HSAB 1A7RL 1LO0H 4POZC 1HCVA 4ZDHA 4KK9D 3ULUL 3WIHH 1T2JA 4RA3A 4TOYL 4XVJL 4B96A 2ITCA 2HX7A 4WO4A 2GITB 1OP3H 3S88H 2FJGA 1RCYA 2CGRL 5IFHH 2B1AH 1CLOH 2ZYIA 2D2OA 3FQTB 2H32B 3HUJF 2OYLA 3LS5H 5F93C 4MHHG 3FB6B 4XP1L 3U6XA 3CDCA 3VAEA 1YJDC 3QZWG 5C0JB 2R0ZL 3QNZB 2A77L 4I2XE 5IB5A 1GGIL 1LD9A 1YDPA 5T1JA 4LEOB 2J4WH 4OZHB 1B0WA 2V9QA 1NBCA 3VRJA 5HYQB 2ZUSA 3FFCD 1ZT7A 4J3TA 1A14L 1QTSA 1BF2A 4MAZA 4CJ1A 4N0FA 1MWAA 1DE4B 1GGBH 2W88A 5AW4B 2OI9C 1RZ8B 4JANB 1RJLB 4PWGA 3FCUB 4ANVA 5JQ6L 4MDJA 4YO0B 3CZUB 1BVNT 3D4GA 1FO0B 1I7RA 3LPPA 1IJ9A 1YAZA 3OWEA 2XIDA 4JRYA 2WXFA 2WYIA 4J6IA 5SWZA 5AVWB 3F65A 4UT7H 3MRKA 2A6KA 5DD5H 1QQDA 1VHPA 5DZPA 3EOYG 3G04B 3E1F1 3B9AA 4Y4HB 2GUOA 3IN0A 4LNVA 3NFNA 1MG2C 2BJMH 4JO4L 4ODHL 1SOXA 3W39A 4JPIB 3GHBL 2OCFD 1I31A 5LXGL 1M56B 1URIA 2DTMH 4U1MB 1W8NA 3GEFA 2HFEA 3UTSE 3IS1X 1G7MA 3LPFA 4PJ6A 1DJXA 3RFZB 4F7MB 1NC4D 1TQBC 3SKJH 3RUGE 5EU4A 3DMMD 2HJLA 2WTOA 1M7UA 4Q56A 4ZOAA 1KGCD 1U8CB 3FQNA 4JM2F 3RPKA 3TO4B 4ZO7A 4KQ4L 4PRIB 4MCNA 1A3LH 1OO2A 2Q7NA 4F7EA 3IU4L 3RDTA 1JPFA 4G5AA 1KDJA 2X12A 4LCWD 1U91B 1ETJA 2I85A 4F3FA 2W81C 3KPRA 1MJ7H 2K9FB 4IOSA 5F0MB 4FN0A 3PPSA 3GXUB 3LKQA 1FGNL 3WJLC 1IBGH 1W0WB 4L3FA 3UZEC 3RTQC 3VI4B 3E8UL 4J6RH 2R83A 2X9WA 4P4KC 3X2QB 3L4UA 5IHZB 3CVCA 1DVFD 4PJHF 1JZEA 1K8DB 3L3IA 4YSEA 4OR1A 2X6AA 1HZKA 4QD2E 1MJUH 2R1YB 4LCCC 4GJTB 1KIQB 1ET8A 2H7WA 3V7MA 4XNYH 1SDDB 3POHA 5JPNB 3QORB 2H4EA 3BLBA 2Z7YA 2EVIA 1QWHA 5FHBH 3PQYA 5LGYA 1T0NB 5AKVA 1E5AA 2F5BL 1DQLL 1J05A 4H0LC 1XF2A 2P8LA 1MPAL 3KXFE 4Z3TA 2WWNA 4ZUUA 3LRGA 5IVOA 1H0DA 3IDJA 3DV6B 2UZXA 4ZW6A 1PSKH 5GS0D 1FHNA 3SDYL 3KYMB 4R4BB 4IJ3C 4BJLA 2CHZA 1TLKA 4L8CA 3B7TA 3NACL 1VGEL 5E1HB 5DTFA 5AW5B 3AXHA 5CZRA 3RYMA 4HOZA 1KYOK 3V6ZA 1WFOA 4LLMB 1TTFA 4DW2L 3IM1A 1E6JH 4GQ9L 4UAHA 5C0CE 4JRYD 1NC2D 5AUMB 3BP7B 1RH8A 2AJ3A 1DQML 2HT3D 4LLVB 2NQ3A 4QXWA 4LP5A 4MCYA 4Z7NF 2I60L 2AKRA 4PPTA 1UXSA 5I1DB 3QJQB 4YK4B 5FCSH 5BUPA 1Y6MR 2VO5A 3BKML 4TLKA 4BQ8A 3INUH 5DD0H 5ELIA 2LU4A 4P2QA 5M94B 3AQYA 1UFUA 1D6VH 4BFIA 1AXTH 3SN6N 2Q2EB 4N8UA 3QIWD 1A7OL 3WEXB 2NOYA 4AH2A 3BO8B 3BYYA 4LIQH 1U3HB 2VLLA 4X6FA 3EUDA 4JFZL 4X50A 3RVVC 1YUHA 5CBEB 1Q90A 1L4IA 5BZZA 5FO2A 1TIUA 1JSYA 1SMAA 2VQUA 2DI9A 4JFXB 4LVEA 4N0UE 4Q0XH 1T3FB 1YPZE 1IBHA 4PRPA 3C60B 5FGCE 4HJ0D 1DUYA 4UCFA 1REIA 4Z7VE 3D18B 4YSOA 5DWUH 5EBGA 1QSEE 5DSCB 1G7LA 2IVFC 1K6QL 5BV7L 3BZ4A 1ZLUK 2GJJA 4N2GA 5BRZD 1MFCH 5D6CA 2JXMA 3WXWH 1AHWA 4HEPG 2VERA 3ZDYF 5KYWA 2WTRB 2X4QB 4I48A 3WLBB 1ZVYA 2VDOH 4N2CA 4O58H 1R4XA 4CSZA 3LKSB 2G3XA 2ADFH 4LPYA 5GGSY 1P7BA 4L4VA 4NN7C 5KYUB 1ZGLP 4F7TA 2VXVL 1HKLH 1BHGA 3KLAB 3VI3A 5CEZD 4OZGE 4ZI8A 3ASNB 1SFHA 4ETQA 4JGNA 2P43B 4D8PA 4K3EL 2B59B 4J12A 4R7NA 4LOEA 3OZ9L 1ZA6B 5GGUB 2WMPA 2BP0A 2OSWA 4F33A 2EDFA 1RSFA 2VITB 5C0EB 1S7VB 2XTJB 4HJSA 2APBA 3LKPB 3O6FA 2WZAA 4WNSA 4ODWB 3U82B 3FJTA 4PJEE 4Q89A 4XMWA 4YIQB 4D3CL 4Z78A 1BZ9B 3UO1L 2CBTA 3BPLC 2X7LB 3K1DA 1XT5A 4U7KA 4DP6X 4OQTA 3ILQD 1P7KB 1RUMH 1X5LA 4NDMA 3ABZA 2VN3A 4FRWA 4HS3B 1Z9SA 3NSJA 2VDQH 3F7YB 4XNZC 4DN4H 2A6IB 5IHUH 4LCYB 4PJFB 5CCKL 3OPZL 3SKUD 5SWQA 3LH8A 4K7PX 3PXJA 1Q38A 1F86A 5HDLA 3EOAB 2EEXA 4B9JA 4WVRA 2J5WA 2VR8A 2Q76A 4U6TA 3MLWH 4J28A 3SKOA 5D9SB 2ATKA 3GJFH 5HHME 4LEBA 2J8UB 3V4VA 1HL4A 3BP5B 3UGEA 1CT8B 4H20L 2ZOKB 2HX8A 5JXED 1X5YA 2CIIA 5MEOA 2AAVA 4YDVB 1ADWA 1WUNT 3CSBA 2CR3A 3MCKA 2QKIA 2CLRB 1AS6A 3A4AA 3U30C 3HC4H 2HVBA 2PO6C 3L3HA 4IDJH 3ULVE 1T7YA 3DUUB 4W93A 1TMQA 3MGOB 1WAAF 2C3VB 1J8KA 2ZXCA 4JKKA 1MFAH 2GJ6B 2CWRA 2VGLM 4PRPD 3PL6A 4XPBL 5GRWA 2Z4QA 1X7QB 3TF4A 2BC4A 3N40P 4UT6H 4M6NL 3C5JA 3MUGA 4N5UA 1JXDA 2O5ZL 5LCVA 4W6YB 4OLVH 5D72L 5CF3A 4ZS6D 2WVUA 3ECUA 5E7FA 1H15B 1ZDSA 2JKWA 3L3KB 4QKTA 3W9EA 4D9QE 1U92A 2CHXA 2R1XA 3N85H 4OUUA 5MENE 2NQDA 2O4EA 1E67A 1JAEA 4YVNA 1OCWH 4X42A 3FZUD 1JGLH 1XGPA 3WELA 4RGOH 1HCYA 1E40A 2HUEA 4GY4A 5FYKL 3U4BH 5C09D 2OKMA 1SOQA 3LKRA 4JVUA 8CGTA 2F61A 4O2FB 5CWSB 1G7QB 2VDKH 4K3DH 5GQBA 2G3MA 2DQCH 2IQ9L 2FX7H 1CLYH 1YEWA 5CLYA 2WXNA 3GSNA 1CQKA 3MUHL 3Q1SL 3QJOA 5DZOA 5DJ6A 4AMKL 3PDDA 1WK0A 4NRZA 5GXBB 4FHJA 4M7LL 3CSFA 3RX9A 2C26A 1EXUB 1AR1D 4CU6A 4NC0B 2F54B 5LGKA 4HJJH 2J21A 3VFRB 1I82A 1C1EL 1CLCA 1GZQB 1M1XA 3WS6C 3RNQA 3KW7A 8PAZA 2OX5A 4PB0L 3T8XB 2QADD 1JV5A 3F5WA 1U8OA 4XH2B 5DR5L 1F4XL 1P5VB 2JI3A 1ILUA 2VXTH 2XG5B 2OMWB 2VLMD 4C54A 1RZIA 2H1PH 2H5UA 3NZSA 3CK0L 1IT9H 1KEGL 2HVJA 3SE9H 3KCPB 1E8WA 1T20B 3QUZD 3CTTA 3NDYE 4FQXA 2YC1B 4NM8L 4U1LA 4H40A 2Y5QA 3I9GH 4YDNA 3O2VL 4XCFH 4BZ1H 4XBGA 3WTUA 1GGUA 3W38A 4YHKL 5JNYA 4A68A 4NHUB 3MLTB 3K5RA 2JQAA 2QQLL 4FXGB 1GYWA 2YRBA 3VJ6B 4AQ8C 1I53A 1FA4A 3PWPE 4BSWA 1TZIA 4PQXA 2OJZH 4M93C 3C2AH 1NGWB 2AVFA 4FFYL 2I9LA 1QRNE 2YPLA 1NANI 2XTLA 3T4YA 1GXEA 3H42H 4Z5RB 4WI8A 1IEAB 4K07A 1AO7E 4P4RA 3SOTA 1K4DB 4KJWC 5SV3A 2BVOB 3VQ1C 1FQ9C 2F8IA 5ADPL 3U6XS 2PP8A 4JO3L 3WNNA 2CNZA 2CO7A 2F6AA 3MR9A 4HPYH 3LEXB 4J1UB 3DX7A 3QUGA 3ABKB 4AKPA 3HC0A 4OCYL 1DVFC 3D3VA 5E4EC 3SBWA 3S36X 4RGMB 5KYYA 3WIHA 3MROA 1N4XL 2E6QA 4N0YH 3IFPB 5FYLH 3WS3A 1VACA 1CXEA 3WY3A 1X9UA 4JM0A 3B2DC 2BCKA 4X7TB 1IC5L 3IFOB 1FL6A 1EEQA 1UGKA 3D51A 2DWEA 5D1XC 4M1CD 5DMKA 3LH2L 2DMCA 2N0MA 5ESVA 3MOQA 2WN2A 4M1GL 4MDRA 1KULA 3BKJL 2XICA 2XU9A 3D69A 1U6AH 1IU1A 4QRTB 1IX2A 2FD6H 3QHFL 5I8EA 1K8IA 1UTDA 1YJDH 1WT5A 3S96B 3CXHK 1W15A 4XO3A 3P1VA 2FEDD 3W37A 3VWJA 2VAJA 5H8DA 3U0TB 1FL3A 2NR6C 3CVIL 1YN6B 2ZPKH 5FV1L 2AJSH 4L8BA 2QGCA 2BFVL 3G6AB 1NDGB 4JG0L 5IMKA 4LAJH 4U7SA 4Y5YA 2WXIA 3LEYL 1OW0C 4YS4A 4Q9RH 2MFNA 5H4YA 2J56A 3F2LA 4S0SD 2B9BA 4NCDA 4NN5C 4RH4A 5JW4M 1IGIH 2DS4A 2FLMA 3OGOE 1N26A 3VFGH 1T2QH 2NY3B 1MG3C 3ARVA 5CBAB 1MFBH 4FHKA 5IT2H 4ZYKA 5TQ2L 4R4NC 1KTRL 1ZHBA 4PD4K 2L04A 3CZFB 3PAUA 1LEKB 4PI2A 3MV9B 4WW1A 1AFVL 4RFOH 1ZPUA 1A7RH 3N6YA 4QO1B 4WEUD 2ICEA 5GIRA 3FOMB 3BQUD 3N41B 4UDUB 3QPQD 3IE9A 2MEJB 3MNDA 4L48A 4NO5B 4Y1TA 4Z23A 3VGGA 5F9WB 3V7AG 2OL3B 1LO3L 1S4IA 3L4XA 3B3IB 2Y7MA 4BFNA 1FUNA 5BZXA 4BELD 4OV5B 4DKEH 5FECA 2B7DT 2B9AA 1JP5A 2ZKXA 2VR4A 4NIKB 1RL1A 3AU1B 2XWCA 3DJ9A 4AVJA 2VTFA 5FYJE 3WSQH 4L29B 4F91B 2JKNA 3GSWA 5LGJA 2UUDK 2UXTA 1PX8A 1HHJB 1PNDA 4KFMA 4HUXB 3AXLA 3MNWA 3VYNA 4W68A 1MRFL 2VZTA 3L9YA 4GIPD 5F7DB 4AEIH 4N3TA 5F7EL 1Y07A 6TAAA 4Q2ZA 1Q9KB 5J12B 5J7CC 3BQVA 1RIVH 1VLXA 4PIRF 3VRIB 3QRFM 4LO9A 3TT3L 1JV2A 3QISA 4PUBH 1HDMB 2Z6FA 1NFDA 4ODUA 5DHVH 3QDGB 5HDQL 5B3NA 3L3OB 1LO4H 4NP4L 5ISZA 4LVOB 2LLLA 5KVDL 1JDDA 4LB8A 5DD6B 4IBTA 4GG8A 1YEKH 4XMPH 4R7XA 2QQQA 1RI8A 4F7PB 5JYLA 1M9WA 3OGCB 2A9CA 2KI6A 5KJ4A 4AYMC 2C3HA 2R2EA 3ILQC 4PV8A 4GRMA 3WD5H 4A2FA 1S9WB 4XCYB 5DJ0A 5GRXG 1NFIB 2Y07L 3QZMA 4IRSA 2EXWD 1J8SA 3NJKA 2F7RA 4PRAA 3VA6A 4ZX3A 2O5XL 3WJJC 3FRUB 1MDAA 4N2IA 1EAOA 3LXCA 3SDDC 4HSCX 3I75B 1TPXC 4GO9A 2Y36H 1S9YB 1GYVA 2XZQH 4OZHE 3PV6B 3MA7B 4KH2A 1KGYE 2F7IA 5GRUL 3SQBB 4ZNCD 3IGAB 4U6HB 2VWEC 2MQ0A 3RZCC 4HIEA 5M95B 5JXEC 1E30A 1G9ML 2WZPA 3MV11 3GTNA 2RFXB 3MRMA 4TUUA 5GGQH 1AZZC 3O9WB 4XO8A 3FO1A 3ZX1A 5C8JB 1OT4A 2DJ4A 3G5WA 3PS6A 1VFMA 1A3RH 5I66B 2OMXA 4XB8A 4EAEA 4LPUA 3D07A 4X9BA 5IIEA 1II4E 4WEBH 5IB4B 1I1YA 2MCAA 4HKZA 1BEYL 2E7HA 4NO0A 2MH4A 1N19A 2D7NA 1EANA 4G8EB 4RGND 1OAXH 3NN8B 3GC3A 4WU7A 3WIIH 5JORA 2EO1A 3WBDA 2CMRL 4PLKD 3VCLB 3C6SA 2FGZA 4CSPA 4ZS6C 4A2HA 3B8YA 4XNXL 4KK6C 2R59A 2B5IB 4HQQH 1NBYA 3QA3B 2OSYA 3L1OL 2H1XA 4L23A 1PX3A 4HIXH 3FZUC 3VD1A 3SDYH 1JPSL 1OF2B 1T7WA 3GRGA 4GI9A 4XWGH 4FNPA 1BVOA 1KYUA 1L9RA 4TYUA 3WTXA 3QWOB 3IDUA 1UEMA 3V8CA 1XB8A 3OSVA 4F57L 3BMWA 1OHZA 3FO2A 1J9SA 4DW2H 4E5XG 3LJ3A 4LCUB 4PRIE 2NNCA 3JV5A 4KK8D 3BJLA 3OKEB 1I8KB 1K9TA 2PYFA 2JJTA 4I18A 1IAIH 5GGVY 1H5BC 2PP9A 5F1NA 4TVUA 4ZNEE 4X2UA 1HXYA 1MHPL 5AALA 3QUKA 3S35H 1NEZA 2F8OA 4TSBH 3RKDD 1QFHA 2AW2A 4XBPB 5DJDA 4JFED 1QSVA 1SJEA 3BKMH 2DQTL 4XNMA 3HZKA 2XZCL 3GLDA 3WO3B 4C56D 1I7ZB 4NXSA 3VI4E 3W5NA 2KLTA 1VRSA 5D2LA 1DCEA 1JZ6A 2ZWZA 4HKXA 4WWNA 1BWWA 4XP9L 3SJVA 5A2FA 2DQDH 4QCIA 3U9PL 4DKFH 1J8RA 4XWOC 4FA8A 1GAFL 3OD3A 4UZGA 2CK0L 3EO0B 2Z31D 3D50A 2VB5A 2VR6A 5HXMA 4MA8L 1BZQK 1JK8A 2ZCHL 5EC2A 1CURA 1TJIH 4MMZA 4Y0GA 2ZYRA 3VB8A 1XH0A 1E4KC 2A5UA 3KWWB 4BFRA 4F2MA 3LXAA 1J8HB 1YEGL 1FNAA 1Y7VA 2ARWA 3P4OA 4OJFL 4S1QH 3NSYA 3IF1B 3MJ7A 3U7WL 3UTQA 5MERA 3LNFA 4XPAL 3VDBA 3TV8A 1KJ3H 4JDVA 2G4GA 3BE1L 4V1DD 4GBXA 1TCRA 2NYKA 4U0RB 2R0KH 2W60B 3ZRFC 2C3WA 4NO0D 4AM0A 1CFBA 1HAWA 4PRHA 5C3IA 5I16A 2HA1A 1TJHL 2AP2A 2FEJA 4LZKA 1NDTA 1KXVC 2WVSA 3MV8B 4WFGD 4LPWA 4CAGA 4EN3C 3I2CH 1J5CA 1MCFA 4M03A 2YPVL 1SEQL 5FS5A 4N22A 2NY2C 1WWAX 1S7XB 3SPJA 4KJYA 3TN0B 2XX0A 1ETZB 3AM8C 3VD0A 3OMIB 4IBSA 2HB0A 4XCCH 2R2BB 2YEZA 4IU3A 3TJHD 5ACLA 4G8FA 1V10A 5I9QC 2C9UA 1CICD 1MW1A 3LNGA 3VTMA 4YBLC 5FWQA 3MOAH 2H6UA 4PJ8B 1ZLWH 4UOJA 3REWB 1X5FA 1HL9A 4XVTL 5JLZB 4LNRB 4HOWA 1AE6H 1RP8A 2F0CA 5DVMA 5E8DL 1GW0A 3VD5A 2B3RA 1P4IL 1NPNA 2P8MA 5EOTA 2X88A 3JUYA 3NIGF 1SOKA 3DVGB 1UACL 2VDLL 1KCSH 3GMQA 1GMIA 4HCIA 3JV6A 3V5KA 6CGTA 1ORQA 3O3AA 5I1JH 5LNDA 4GAGH 1AHKA 1TNMA 4Z7QB 5HYSB 3DTDA 1KLUA 3DURA 3RKPA 3ZL2A 5BXFA 3WLWD 3BQUC 1F1GA 3D6GA 3QPQC 1U4EA 4FG6D 4KAQL 1N8OE 2WBWB 2HJFB 2WXKA 1FFOA 2EC9U 2PYEB 1I7TA 4EZJA 3BSHA 1BQSA 1J0YA 5ID1B 1CDUA 4ISVB 4NPKA 1A8JH 1IQWH 3GSXB 4NENB 1A6WL 1KF9B 1FV1B 1I85C 3NRPA 2XTJE 1WE5A 4TQIA 4M6NH 4ABVA 4XOEA 4PRDA 4TQEH 3AC0A 3O3UN 3VFTB 3CDFA 1LMKA 3GIZH 4L3ED 3NCWA 3IDMB 4IK6A 1I3GL 3Q9QA 4MJID 1AZNA 1BLNB 1RVFL 3RPIA 5J0BA 3UAJA 3ARFA 4GQRA 3QNFA 4JY4B 2ADIA 5FYKH 3W9DA 3ZY7A 1O6SA 2MPVA 3CHXA 3S3SA 4FP8L 3VTTA 3LMJL 4PJFE 4ONGH 5DJZA 5GGTH 1H6FA 2ZZUT 2JLLA 3BZFA 5FW8A 2PR4H 5BQ7B 5J3HC 1FZKA 4A37A 4MMXB 1NBVL 5LQBH 3AG2B 1IFHH 3X11A 5L2KB 2GHZA 3S37L 2J8UE 1RZPA 4QLWA 3TP4A 5FB8B 3WI9A 4X5LA 5BQDA 1RZ7L 2O72A 5LNGA 1XZWA 3ZE2B 4QHMB 3N1MC 5I1CH 1KUMA 5IROC 5T5NF 3EZ8A 4Q6IB 2BWIA 3MRCB 4OB5H 1ULVA 3FK3A 4MD4A 4AEEA 1YMHB 4UTBH 4JY5H 2J44A 4L2LA 2G5RA 2ZOTA 4DP8X 2EKSA 2UY7B 1T6BX 3P77B 4X6DF 2V7NA 1YNTB 4C8XA 1SM3L 5E0FA 4L1DA 3N0PB 3JVGC 5EG6C 2GJ6E 5IEKB 2XXFA 3OHXB 4PJGF 1R5WA 1UA6L 4G6MH 2X2JA 2EIKB 3A23A 3BEWB 1YPZF 1JGDA 2ICES 2EIJB 2UXVA 4ODSL 1JHKH 1CD0A 2XWBA 4FFYH 4HWBH 1N5YH 4K5LA 3ROOB 1L9PA 4FE9A 1VZIA 1XGUA 3RI5K 1JZ8A 4G9FA 2CRYA 2I07A 3BN9C 2EVJA 2PWGA 3EW3B 5C0IA 3L45A 2JQZA 2XFXA 5HPMA 3RWGA 2EIBA 2ZX9A 1E0OB 1EO5A 5G4OA 1N6QH 4EUPG 4XP6L 1K5NB 4JO1L 1ZT4B 2QGDA 5HGDB 1EH9A 4PBXA 4PREA 5E99L 3DWTA 3WFHB 2ZXGA 1TJGL 2VIRA 3HRZC 3LTVA 3NCXA 4UQBA 2F54E 2AQQA 3MRQA 4P59L 4AX3A 2QZQA 3IU3B 4G8GD 4GFXA 4M6AA 3ZTDC 4AIZB 4LSRH 4KGLA 1MREL 4WI0B 4LSDA 4RGNC 1RPUA 4PLKC 1HINL 2BOBA 2CH8A 3ZTCC 1MCNA 1AKJB 5CN3A 2JK5A 5E2JA 2WC7A 4MTMA 3IMVA 1S9KC 5ANHA 2QT6A 1H3WM 3K2MC 2NT1A 1OAQL 1PTZA 2IOIA 3BXNA 4O51B 1RY7B 2D03L 3ARGB 3GINA 5HYIA 1XMWA 3MYZA 2JIXB 4OCSH 4Z0XA 3LN5A 5J6GB 1VAHA 2FTAA 3DPDA 3WJLA 5E00A 3KL0A 1BMZA 4UILL 1JTTA 1TCMA 1HHIB 1QFWI 2GJPA 2HKHH 3QFJB 3RTQA 4WGKA 3UZEA 4DP0X 2WAQA 2ATAA 1UG9A 3MA9H 5C71A 1JN6A 4Y5VC 4I77L 4U49A 3BLPX 1EAPA 2NCMA 5CEXB 1GIGH 5DHVA 1UOVA 3GWJA 4ZSOB 5EZOL 5LBSH 4P5RA 1NUFA 4NQVA 5DJ8A 1MRCH 4G7SB 4MB5A 4HWZB 1G7PA 5GHWL 4Y9BA 4R8WH 4U1JA 3VXRA 5CEZH 3RKDC 4KNQA 1BLIA 2CLVB 1CQYA 1FL5B 1I9IH 4XOBA 3US9A 4QXGH 1JGUH 3VH8A 5CGYC 1NDMA 5J6SA 4MD5A 4NYLA 4GG6B 4PCKA 1F4AA 1NGYB 1CYGA 1NBQA 3TIDB 3ZMNA 4QF1A 4AL8C 5JPMB 3DX9B 3PJNA 3GHPA 2HFFB 5F7HA 4U3XA 4X6BB 4D8PB 2FIKB 3D06A 3NFPB 3GRWL 4QTHA 3T6VA 2NY5C 4PYHA 4ZUVB 3G7TA 2Z7ZA 4GXVL 3EG9B 2F5AH 4G6KH 4XAKE 2YQ2A 1HXMB 4HUVA 5HY9A 1C9SA 3D30A 3IFNH 3MRHB 5AVYB 1U58B 3NGBC 2NYZA 1H3VA 5E4OA 5T1MB 2XQ0A 1FNEA 4MJ5B 4BH7A 1OSZA 4UQIM 4WTZG 2OW7A 4FKHA 3JSSA 2IC2A 2AI0L 2DWDB 3QEUB 2YGVA 5SWSA 5FHAL 3D25B 5J9PA 3DSFL 1A5FL 1R0AH 3NSCA 4YFEA 4F93B 5CEYB 4MLSA 5DD1L 1W8EA 2Y5TA 4HBCH 5C08A 1GL4B 3GMPB 1IBBA 2H3NA 2XBZA 1G4MA 4HIJA 4YQXL 1QKZH 2HJKB 2TSAA 4KDTA 3DXAB 5LVEA 1NQBA 1J0JA 1G7JA 5TK2A 1AR2A 4ES8A 1JMZA 1UA3A 2YRPA 3SDAB 4XMLL 1FP5A 2BHFA 3TBWA 4PH8A 5ETUA 4ZMWA 4TTDD 1OANA 3DJSA 3RJQB 1KLGB 3QR0A 5JHDA 2NY1D 3BH9B 1FYHB 5PCYA 3MV9E 4JS7A 1EHXA 5C0FA 1C7TA 4FTVD 2OTWB 4JMNA 3FQRA 1CDYA 5H37A 5T33L 3FQXB 3QUYD 2D3NA 2RBLA 1WGVA 2YD6A 5D5MF 3KYOB 1C7SA 2VL5B 5TGBA 4ERSH 5E1GA 4YHYB 3V6OE 1WS8A 1RMFH 1CICC 3B7YA 4JFVA 2BDNL 5EN3A 4BXVA 4AEHH 1KEMH 5F71A 4H5SA 2P9RA 4QI3A 4PJ9D 4Q58C 4ODVH 3O2DH 5EOCH 1FPTH 2R15A 3BRFA 1FZJB 4XP4H 1A6UH 1EVUA 3EYUH 2ED9A 4UI2A 3P73A 1XZ0A 4UZSA 1KYOJ 3NRQA 2IDCA 5KS9F 5DS2A 1PG7L 4Y4FB 5FAAA 2WIIB 3WEBA 5DI8B 1NFKA 3ZTEA 3VD9A 4I7ZC 1P4BH 4AQAB 4MHHI 1UWEL 1M6OA 1YYMH 1CU4H 2NZIA 3C08L 3DIDA 4O2EB 3ARTA 3RAJL 3WNLA 3ZKSD 3F12A 4FG6C 1QLEB 1IM9B 3EH5B 3GI8H 4UYQA 5D7IA 2G5BA 4UAOC 1C12A 3S35X 1GA2A 1Q9LA 2AK4B 4UQAA 3QDGE 1MWOA 1QSFD 2QPDB 4NQDA 1A9EA 1OAJA 3OXSB 5FUOH 5I8OL 3L3GA 4PEEA 3FB7A 2XKNA 5TPWL 1PAMA 4P5TA 4LRIA 3VD4A 4XNXH 2E6JA 5DRZB 4GSQA 3SOBL 1HE8A 5B1CA 2XWTB 1KB5B 4GI8A 1RZGB 2H6PA 3QZWB 3O4OC 3GSVA 1TO4A 4KVPA 3RL1B 3ET9F 5CXPA 2GTWA 4DVBB 2AXFB 5FR3A 4HMDA 2B4CL 4PGBA 3I6KA 2O61A 2PTUA 2Q20A 4OSUL 1ZCRA 4CVUA 4DGIL 3AS2A 5EU3A 3L2LA 4FNLL 3QUXB 4MJ6A 1R9FA 2PO6A 2PABA 1Z6JT 1XCQB 2EVGA 3QPKA 1BXUA 4JFFB 4P46D 1TR7A 5T1DL 1E4XL 3KPMA 4I0PA 1C16B 1FH2A 1D3CA 4IMKA 4L1LA 3UABA 3VXSA 4NO2B 1J1OL 1E9QA 1E3XA 3S3BB 5E08L 1TVDA 2B14A 2XVBA 5DLLA 1QFPA 1TVHA 3IB4A 2WBJD 3QXDA 4MDIB 3NIFF 3BKYL 3AABA 3C5ZB 4QTFA 4Y2OB 5ANMB 2NY4B 4QRFA 1LE5A 5KN5B 5LWYH 4S1RL 4ETYA 4F37F 3HCVB 5EV7A 5H94B 3EJPA 2EXSA 3P9MB 4KQ0A 2G2RB 2YD4A 4HWEL 2EDEA 1JIBA 25C8L 4U1KB 4LHJB 1KDIA 4JG1H 2Y06H 3I74A 5EA0L 4M56A 3UBXA 1MCSA 4WNJA 4CVZB 2W07B 2P80D 4BK8A 2YMXH 3AZUA 4HXAL 3T4AB 5E2WL 2VQ4A 3V10A 3K0WA 1GVIA 2VR9A 4XCNA 3U9UB 3DX4A 2R4SH 3DPBB 3GZKA 2VM9A 1IMHC 1RUKL 3WS6A 1MCHA 1TETL 4PGEA 4X9FA 3CUPA 4GRWH 5AW9B 4PCSA 5AZEH 2Z91B 1NICA 2WCGA 4XNUL 1YO4A 4JBSA 1OQOA 3ZZQA 4WTWA 3WNKA 1I1FB 4B3VA 2VERN 3OKOA 3QR2A 3ARDB 3PYCA 1U2YA 3UEZA 5EZJA 2P5EB 4AV5A 3QIUA 1SDYA 4MJ4A 3HE7C 3MV7B 3S2AA 1XF5B 1WBXA 5LN8A 1OSPH 2A9DA 4OLYH 3NAAH 1DJGA 2VC2B 5GISH 4MS8D 2DYPD 4NQED 1BA9A 2A6DA 1AY1H 4AQ8A 5J6HB 1T5KA 1SYVA 4C4KO 4BK5A 1XF4B 3WG7B 3TA3C 1T66C 3QQ9D 4NNXA 4PB9L 2TRYA 1A9BB 3MRRB 4DZ8A 3KPOA 5CJOL 5DEGB 1GGTA 3U4AA 2X5PA 1G9HA 3LPOA 4LBAA 1VERA 5TTRA 3FCBA 3HB3D 1B4JH 3LPGA 3PGFL 4UOQA 3RWHB 3ZO0A 3BP6B 3QAQA 3QDMD 5HI5C 5FV2A 2PW2B 5JHAA 1QI3A 1QWNA 1UXWB 1RK1B 4H8UA 2WVVA 1AC6A 2ZKHL 3BIKA 2R27A 2DH3A 2QSQA 1EHLH 5EEUA 4LLQA 2BSEA 4Z0BL 2QBWA 2C4FT 4BH8A 1GJIA 4WI9A 1X44A 2BSBA 3GK8H 5E8OB 4HH8A 4KTYA 2PNDA 3EUUA 4LCIL 1P4IH 4NC1C 1J8HE 5EUKB 2EDOA 4EDWH 1JK9B 2W59A 4ANKA 5ICXA 3BUBA 3H4FA 2YK1H 1BF5A 3LV3A 1KC5L 3FFCB 4WJKB 4U3SB 3KPPB 4FJYA 4NUGH 1FNGA 2WNWA 4MAUH 4MGXA 2DL9A 2Q87A 4AK2A 4OGYL 1P5UC 5IW6A 4NRYB 1A2YA 3AMLA 1EZVY 2FJUB 3UXFA 1UD2A 3VE0A 5I1EH 2QPFA 1CDGA 4HDIB 4JDEB 1NCAH 1T2XA 1CI3M 5E24E 1HNFA 4WFEE 1NAMB 1R5IA 3FONA 3K91A 3MV8E 4PLJD 1OCRB 1AOHA 4FFYA 1UB5A 1EEYB 1VFBB 1GZPA 1WC7A 5EZLA 3QI9D 4FFVD 2PTTA 3IJYB 5CGTA 5F7MC 4GP4B 3V0JA 3MVSA 3FHEA 4JN2B 2W0LA 1VCAA 3VSQA 1DVQA 4PJXB 1BXAA 2P5WA 2XV2A 3HI6H 4YH6A 3V5HA 3T0EA 2GCYB 4X4XA 4WSJA 4L8DB 1DQQB 3STLB 3BFWA 3NCFB 4F20A 3DIVA 2AC0A 2AMGA 4BZYA 4HIIB 2W9LA 2XBDA 4M5SA 3TCTA 3ZTNL 4QRRA 2FWOB 1MIMH 2V6HA 5KSBA 4RX4A 2G75A 3WIFA 4XX1E 4ORGB 1NC4B 4YHOL 3U2SA 2Z3FA 3DMMB 4HEME 3WKMH 5GGVL 3WN5B 1OKEA 1B3JA 5JA8B 1Z7JA 3MRFA 4LCWB 3M17A 4JHZA 1RZ7H 5HYEA 4U1NB 3O6KL 1TTGA 3IGLA 1NGPH 1ZIAA 3PV7A 3QQ4B 3MUUA 4N9GB 5DT1H 1ZKAA 3KD4A 3DHMA 2G60L 2Y2WA 5TH2A 4Z7QE 2FCBA 2VXUL 1KIPB 2G0KA 1JWUA 5E1AB 1P7QA 1N8ZA 2CIKA 4XVUD 3QUYC 4EJ1C 2PYEE 4NSKA 1SM3H 1UA7A 4O4YL 3CDZA 2EC9T 2ITCB 4C83A 4WO4B 2XJLA 3WCYA 5IF0A 3ZU8A 3BDXA 3MACL 2FBJH 5J06A 5TDPB 3CXHJ 2GSGB 4LSVL 4ODSH 4I13B 5I2IB 3IMTA 4JQIH 4KTDL 1DEEB 1FLTX 1JPGA 4PG9A 4XPTL 2Q3AA 4PVLA 1TO5A 2D0HA 1XSKA 2ZONA 2NLJB 3FPYA 1OGAA