3NJGA

K98a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTAFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 19
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njgA00
1BAWA 2MTAA 1OCOB 4GP5B 2UX6A 3OMIB 1AANA 1HFUA 4YSUA 1NPJA 1JERA 4YSTA 2BW5A 2YAQA 4CSPA 1PCSA 5EHFA 1PF3A 3CZUB 5B3SB 1ZV2A 3GDCA 4MFHA 3CDZB 4DP6X 3FSAA 3AG2B 4YSAA 2VMJA 2XX1A 2XLLA 1SF5A 2IDSA 3X1GA 3JT2A 3NJNA 1OCCB 2XWZA 3H56A 3GXUB 1KDJA 4E9TA 4KO7A 3FU7B 2J57A 2GHZA 2IH8A 2J55A 3IEAA 4HHGA 2GC7C 4P5RA 2FQDA 3CVCA 5AKRA 1X9UA 2IDFA 1SDDB 1JOIA 3CVDA 3WG7B 3FSZA 3NSFA 2H47C 1AZCA 2ZWNA 1OE2A 2YAMA 4RH4A 4EF3A 1E65A 3PAZA 3N55A 2GIMA 5B1AB 4UAHA 5B7MA 1AR1B 2AFNA 4F2EA 2XVBA 2JFCA 3L45A 3GYRA 3PLYA 4YSSA 1SJMA 1AZBA 1AS8A 1IC0A 3NJLA 1TEGA 2ZOOA 2QPDB 3X1BA 1ET8A 4BXVA 2FWLB 1CUOA 4KO5A 4AI7A 3TBCA 2IWFA 3IE9A 2BP0A 7PCYA 1GSKA 2CCWA 4K9JA 4DP8X 2YAHA 1PY0A 2YAPA 4QKTA 4NERA 4DPBX 2N0MA 3UADA 1SNRA 1KBVA 2YXWA 2HLEB 3IN0A 3AG4B 2VW7A 4KNTA 1CYXA 2VSKB 2VW6A 1I53A 2JXMA 1CYWA 1WAEA 2WSDA 1AZUA 2FTAA 4HCGA 3HB3B 1NINA 3HEIB 2HX8A 5B7FA 1ILUA 1GY2A 2VM4A 1A4BA 1PZCA 2BP8B 1BXUA 3QJQB 2BZCA 1PLCA 2DYSB 4YSCA 9PCYA 1KCBA 5PCYA 4BXSV 2BHFA 2AVFA 2UXGA 5B1JA 1N68A 2ZONA 1BEXA 1GS6X 1NPNA 1NTDA 2YQBA 4E9YA 2X87A 1NZRA 2J5WA 3PCYA 4KOCA 1A65A 3T6XA 4AX3A 1AZNA 1PNCA 2PCFA 3BVDB 4DPCX 2FT8A 3C75A 1L9RA 2YAFA 2FT6A 4BK5C 1J5CA 3ABMB 2MRYA 5AZUA 1BXVA 1SFHA 4NAJA 2XXGA 5B1KA 4G7RB 1UATA 2PPDA 2X88A 4FAAB 1AG0A 4BWWA 4HIPA 1V54B 1AZRA 3WI9A 3X1EA 2LLNA 5E9NA 3KW7A 8PAZA 4DP4X 3D12B 4KNUA 3NJGA 2WO3B 1JZGA 1E67A 2FT7A 4DP1X 2H3XC 4QLWA 1ZIBA 3TBBA 1L9SA 3MX0B 4WTQA 4TXVB 2P80A 5D4IA 1HAUA 3UABA 3T71A 4X4KA 7PAZA 3PAUA 3RYMA 5A7EA 1RZQA 4DP5X 5I26A 3U25A 5D4HA 2I85A 1A4AA 3DIVA 1R1CA 2DWTA 3N2JA 5I6KA 1YLBB 3FU8A 2YARA 2XU9A 1KGYE 1L9QA 2I7OA 4A2FA 1KV7A 1ZDQA 3AG1B 4PAZA 3KW8A 1N70A 4KO6A 3NJHA 1MDAA 3FYEB 3SBPA 3OQRA 2EIKB 2TSAA 3FT0A 2Y1AA 3QJRB 2IDTA 3NP4A 1ET7A 1JVLA 1J9SA 1NIEA 1AS7A 2DYRB 3FYIB 4G70B 3NSYA 4E9SA 1B3IA 1WA0X 2BWDA 2VM3A 3ZBMA 3PPSA 5B1BB 2FJSA 1GY1A 2YXVA 4KNSA 3SQRA 4NB7A 1AOZA 1WA1X 1J5DA 4G72B 4W9ZA 5AFAA 3V9EA 1NIBA 3IBOA 1T5KA 3T6WA 1L9PA 1DZ0A 1GS8A 3NYKA 3DKHA 3OMAB 3OM3B 4DP2X 4GY4A 4N4YB 2EINB 1MZYA 1TKWA 2GC4C 2GB2A 1FWXA 2BP0B 2EIMB 3FQ1A 1WA2X 2CJ3A 1BXAA 1MG2C 2IWEA 5PAZA 4DP7X 2XV3A 1V10A 1OV8A 4Q8BA 4YVNA 5I6NA 3EF4A 1J9QA 2PPAA 1BQKA 1ET5A 1HAWA 1JXGA 1WS8A 1ZIAA 1A3ZA 1ASPA 3OMNB 4YSRA 3TASA 3EH3B 2XV2A 1NIAA 5LDUA 1PNDA 3G5WA 1M56B 1NIDA 1NWOA 4HALA 1JZIA 1JZHA 2PP9A 3WIAA 5FC9A 4HAKA 2XX0A 4AKPA 3QJVB 4JKNA 2CAKA 3X2QB 1BQRA 3FSWA 1DYZA 4FA7B 1AS6A 4HHWA 3T6ZA 2TSBA 2PPCA 1WS7A 4KO9A 2IAAC 3S8GB 4YSEA 3FPYA 1EZLA 4E9WA 2VSMB 1VLXA 1OE3A 6PAZA 4YSPA 1AIZA 2PPFA 4AKOA 3UAAA 4HCFA 1JXFA 1CC3A 3PXLA 2HRHA 2ZXWB 2A3TA 5B1JC 4A2DA 1SHWA 3EHBB 1QHQA 5I28A 2HX7A 4A2GA 3V9CA 2DY2A 2HXAA 3X1FA 2R7EA 3UACA 1W6WA 1JXDA 1J9TA 2H5UA 1KDIA 3NJMA 2PP8A 3PAVA 2OJ1A 3EH4B 4YSDA 3TA4D 1NIFA 2PLTA 2FNWA 1PAZA 2OCCB 3FQ2A 4BDVA 1OF0A 2J56A 3OD3A 3ASNB 1L9TA 1IBZA 1NWPA 4BWUA 2AZAA 3AW5A 4KOBA 3WKPA 3DTUB 4P5SA 2IDQA 3FU9A 1BYPA 1ZPUA 3NSCA 3NJIA 1GW0A 4F2FA 1RCYA 1GR7A 2QPEB 1W6LA 4GP4B 4L0PB 4E9XA 3QJUB 1ZDSA 4CSZA 1ID2A 5I5JA 4ENZA 2UX7A 2JKWA 2PPEA 5I5IA 1NDTA 5TK2A 3T6VA 1SF3A 4YVUA 4BWTA 4DP9X 5I6PA 3NJFA 4YSOA 3AZUA 1XB8A 3H4FA 3TU6A 1URIA 3MBWB 3NJKA 4G71B 4A66A 4M3HA 2DWSA 2B3IA 3ABGA 1AG6A 1KYAA 4PCYA 4GP8B 3S3DB 2CBPA 4HCIA 3CDZA 1PZAA 1TU2A 3SBQA 1ASOA 5D4JA 1J9RA 1OE1A 2P80D 3WNIA 4E9QA 5F7BA 1ILSA 2IWKA 1A8ZA 2XUWA 3ABKB 4E9VA 3FU7A 3JTBA 1PLBA 4DPAX 2HX9A 1JZFA 4ZK8A 3FS9A 1MG3C 1OCZB 4A68A 3FPXA 1E30A 1SDDA 1SHXA 3ABLB 3BQVA 2NRDA 1ASQA 2BZ7A 1IBYA 1AAJA 2BW4A 2E86A 3ZIYA 2BWIA 2XYBA 4YL4A 4AZUA 3UGEA 4A2EA 3WNJA 3WKQA 2FQEA 1A4CA 1IUZA 4UF7C 2AANA 1IKOP 2HZHA 2GSMB 2W8CA 1BQ5A 5I5MA 2FQGA 1QNIA 5ANHA 4AKQA 1ADWA 2IH9A 1XB3A 1MZZA 2VW4A 3NT0A 2GBAA 3ZX1A 4GYBA 4G7SB 4WKXA 2Q9OA 5I6MA 3UAEA 4Q89A 4JHUA 2Y69B 3NSDA 1FA4A 1E5YA 5F7AA 5TK4A 2EILB 2FQFA 2Q5BA 1AQ8A 2B08A 1GS7A 3ERXA 3IN2A 1SFDA 3FQYA 2QDVA 3AG3B 2W88A 2WO2B 1XMEB 2QT6A 2RACA 1OOWA 3QPKA 3AY2A 1M9WA 1QLEB 1W8EA 1L9OA 1XB6A 2CUAA 2EIJB 5I6LA 1CURA 1RKRA 4G7QB 4DP0X 2BP8A 1PLAA 3FSVA 2CALA 1RZPA 4E9RA 3X1NA 2PP7A 1PZBA 2I7SA 4F7KA 3QQXA 2R7EB 3NP3A 3CVBA 3SBRA 1F56A 2BO0A 4GXFA 2YAOA 2AZUA 1JZJA 3S8FB 1E5ZA 3QJTB 1JZEA 6PCYA 4BDVB 1OCRB 2XV0A 5I6OA 3H4HA 2IDUA 2DV6A 1JVOA 4UANA 5IY5B 2PCYA 1M57B 2YAEA 3T9WA 1TEFA 1ETJA 2VN3A 1AACA 1GYCA 2UXVA 4N8UA 4A67A 4JHVA 1NICA 3ZDWA 1EHKB 1KBWA 4M4RB 3EH5B 2GI0A 2HRGA 3ASOB 4HZ1A 3NJJA 1V55B 2XXFA 2UXTA 4A2HA 1BYOA 1FFTB 4W1TA 3CG8A 1KCWA 1PMYA 3S3BB 1X9RA 3S3CB 5B7EA 2UXFA 2OV0A 2QDWA 4YSQA 3QJSB
chains in the Genus database with same CATH superfamily
1U95A 3JBG7 3OF6A 4OUOA 3W82A 3EUDA 1B4TA 4X6DE 5GRJH 1OAKL 4P3CL 5C8JB 3T1FA 3TFKD 1Z6JT 4PJ5B 4MDIA 5B3SB 2FECL 1I3GH 2RA1A 2VZTA 5DFVC 1K3IA 4J27A 2ATPB 4FZEL 3J8F7 5IQOA 3SGDH 5EH1A 2NX5E 1ODAA 1A64A 1Q9KB 2UWEB 5CIPH 1PYWA 3GDBA 1W9XA 1ZK5A 4HJUA 1RP9A 1J8HD 5MEQA 1Z9PA 4ONGH 1IZKA 3MROA 3P30L 4F8LA 4F9PA 5JPMA 4KHTL 1FLTX 1ZKAA 1CFNA 1A6AB 1T20B 2IOIA 2MEJB 2A9NL 4M9PA 4MD0A 3VQ2C 3JT0A 4FZ8H 2DTML 1OVZA 1WFNA 4WNJA 1SN2A 3HOGA 4NN6C 5C6PB 3O6KL 1GVIA 4JANB 3I74A 3L6FA 4FG0A 4M48H 1L5GB 3L7EB 4DF9A 5KYXB 4U6XB 2J43A 1YMMA 5IQ7L 4H0LC 2WSPA 3BP4B 2N3JA 1D5RA 3QDMD 2P46B 4Z7NE 3V4UH 3B8SA 3WEBA 1M2VA 1CFSA 1QWUA 2UZXA 3MLWH 4ZFGH 1MQKH 4X6FB 1Q8MA 2XETA 4NUGH 4JDVB 1WUZA 1RZ8B 4IBYA 5EEWA 3C8HA 4IBSA 5I1LA 3BSGA 3ZL4H 4ZPVB 3AQXA 3US0A 1JF6A 2XJKA 5DJ0A 1UHVA 3IGUA 4CVZA 2LABA 3DTXA 3OHXA 4R4FH 1TYEB 4QRRE 5CBEA 4YLQT 3DROB 3GS0A 5B39G 1MFUA 3IN0A 1CGWA 5DRXA 1S2EA 3SJVD 3BEVB 4WUUB 1WEJL 2VW6A 5AW1B 4FEIA 2EE9A 4YO0A 5KW9L 2BH0A 1TCRB 3MLTB 3MLSL 2NX5D 1BZEA 2MNUA 1A9EB 4M7JL 3GXFA 1QRNE 4HDIA 5AVTB 4FXKC 3II2A 5C0CE 3P4LA 5CJXA 2OSLB 4UMSA 1YMHA 2R0ZL 4GQ9H 3RTQB 1A3RL 4BXSV 1TUPA 1UM4H 3HMXH 1P1ZB 3MFFA 3Q3GA 3VFWA 5GZND 1F8TH 2G0LA 4BK5A 3W0WB 2D8KA 3TO2A 2VWEE 1LO5B 2NY1C 1AJ7H 1MEXL 3LXUX 3RX8A 4P8QA 4YWGH 4FS0A 4HJSA 1GZHC 2V2TB 1S7RB 1VHPA 2FT8A 4PGCA 2X70B 2Z4QA 3DWTA 2CO3A 3WXVL 4BFBD 2GJRA 5DD6B 2YJQA 4LK4A 4Y2DB 4YDLC 3CFTA 1OTSD 3FB5A 1NCAH 2ERJB 3V5KB 1GC1H 1T04A 2WBJC 2ODHA 1FJ1B 4LSSL 4JFDA 5DJYB 3VXSD 2R1YB 1KC5L 1OGTB 5E9NA 4JPIA 4WJ5B 1CDJA 1QBML 2O4EA 2HUEA 2WO3B 3ISRA 3KNBB 5F3HB 4EI6A 2H1XA 4DP1X 4FQ2L 1FORL 1N4XL 5BZWA 1WTGT 3MPCA 4NIKB 5IEKB 5G2NA 2YFOA 3G5VA 5E23A 5KSAD 3RWIA 2Q2EB 4JFTA 2QADC 1HQ4A 4OD3H 5E5UB 4MNGA 2JJWA 1B2WL 1LEGB 4L5FH 4AL8H 1ZT4A 4LHJB 1VB9A 2WWOA 2O1AA 5C0CD 1U8LA 1T6VN 3BJ91 4NSKA 3FQTA 1PZ5B 3K6SA 2KDGA 1HJBC 3FU8A 2AJXH 2P8LA 3CXHJ 2I7OA 4MS6A 4ZS6D 3S34H 3KJ4C 3SPVB 2GTZA 1LEKA 1G9MH 5B4MC 1YY9D 5C07D 1OP5K 2UZIL 4LLDB 3ZYIA 4HIEA 4G6FB 3QA3A 1XF2B 1I4FB 4B7IA 5EMYA 2ZWSA 5HGBB 2IGLA 3SGEH 4QWWD 4OF8A 1A9BA 2NY3D 2BVQB 1AS7A 2DYRB 4HIHA 3NSYA 1GKOA 4RDBA 4P9HH 1I9RL 3CPLB 3CCHB 3MV7E 3ZBMA 1JPGB 5FR3A 3CTTA 2WBKA 3HE6B 2YKLH 3T8XA 4UT9A 3RUGA 1W8OA 2L04A 3Q43A 1GY1A 4L8DA 4LSQL 4MDJB 4TVPL 4X2UA 3QIWC 1WA1X 5HYJE 5DUPL 4GW5A 5C3TA 3U9PL 5B21A 1AGDB 1J5IA 5IHZB 3C6SA 3RNQA 4D9LL 5DSCB 4GO6B 3OM3B 4V1DA 5IFJB 1MZYA 1TKWA 2DTSA 1U9KA 4OZHA 1GL4B 2P8MB 1NGWB 1IFHH 3F7LA 3SYPA 2EIMB 5HD8C 4JE4B 4QRQA 5EIIB 3PFQA 2D7PA 1NAMB 2Y7NA 3NEEA 3GZOA 2HTLD 3U36A 1XSJA 3H3PL 3P3RA 1I9IH 5TQ2L 1P1VA 3HJEA 4YHZL 1ET5A 1ZOXA 3W56A 2YD6A 4L5FE 4ZW7A 5DLML 4F91B 2CHDA 2XWTA 3CN1A 5F7MC 3EH3B 3UFIA 3MOAL 2D7TH 3FFCB 4PBWD 3D25A 2XACC 4FJYA 4OD1H 2DMCA 4NENB 3LKPB 3CUPB 5MHSD 1KJ2L 2DQTL 1INDH 2CO6B 3TVMA 1KZQA 3DTDA 4LLWA 3QYCA 2F1BA 3CK0L 5EU6E 3ZT6A 1WSST 3T6ZA 3IRCA 2VLRD 2YJLA 1BMGA 4ZMZA 3VFSB 3O81A 2Q3AA 3DJSA 4PU2A 5CZKA 3BN9C 1HHKA 2NY6D 1AO7D 1SOQA 2VSMB 4HG4K 4WEEA 3VFUA 5CN3A 4P5MB 3ULVL 3TOPA 4YAQA 1D5ZB 1P7KB 2IALB 3QAZC 4L37B 4NNXB 4PRBB 4DKDC 1LD9B 1J1XL 5F1IB 4LSUL 4XVUC 4UDTB 2X9ZA 5F7KC 2LV4A 2X9YA 2ZUQB 5GS1C 3EHBB 1TXKA 3I6LE 4NUJA 3WIIL 3JWNC 1AXTH 1S7VB 1CTMA 2MTPA 1CG9A 4Z7WB 2X4SB 1DVYA 4MQTB 4MAUL 5FPIA 3RL2A 1E27B 3UDWA 3BVTA 4PJBE 3BUTA 1ZT1A 1FC2D 4XAWH 3DX4A 2XXMB 2Z7YA 3EBAA 3G6JF 1OM3H 3HNSH 2EH8H 4LESA 2EO7A 5EBGA 3W81A 5IBLD 4ADIA 2A1WL 2ADIB 2IDQA 1KXHA 3QI9A 5DDHA 4I87A 4M5SA 2E3VA 2VDKB 4U3CA 3EO1B 4F2FA 4YPJA 4PJCA 5FO7B 4J8RA 1WAAF 1PBYA 5JORB 2B9BA 1O7VA 1P4UA 5BS0A 4JM4L 4WI0A 2P1YA 1MWAL 1MCCA 3BVXA 5DTFB 1HINL 4P4KD 5IMMA 2B1AL 2XTJC 4UQIM 4ZAKA 3EZ8A 3RX7A 2A38A 3E9UA 1HE7A 3T6VA 1YYLL 4DP9X 3LNGA 1IAKB 3JUZA 1TCMA 3E1F1 3CSPA 3RWEB 2XNAB 2Y0SA 1SYVB 3PV6A 5F89A 2A6DB 2R1WB 2W92A 3S96A 4BZYA 2B20A 1DQDH 4O51A 1INEL 2I69A 4U1KB 3TBTB 4KY2A 1BQHG 3BRGC 4MJ5B 1TLKA 3WTWA 1L9MA 1Q9OA 3PWNB 5L88H 1HZHH 1NMBL 1FNSL 3RX5A 2CH8A 3PWPA 1JK9A 3F8UB 3K2UH 5DMGD 4IKNA 3FQWA 4BV1A 3FOMB 1GGBH 1LM8V 5EZPA 5EO1A 2XQBL 5CEYB 4U3SB 4HUUA 4UIMA 4DUXA 1WH0A 1JMZA 3F5WB 4HXAH 4R7NA 4DZBB 3ALXA 5D7HA 4HX1B 4EDWL 1R3LB 4G8FB 4JCLA 1RPUA 3NESA 3LZQA 1T5WA 2YSTA 3U6XS 2FAUA 5EORH 5CCHE 5A40E 4HK0A 4PJ7A 2BW4A 3D0LA 4OZIF 1FFOA 2IPUK 5K9JH 4LARL 4HUNB 4A2EA 3ULUD 2GSGB 3G08B 3WKQA 4Y16C 2XC8A 3ARTA 2AJSL 4PLOB 3PG2A 1G7QB 5HYSA 1NCWL 4DO4A 2O61B 3KPNA 3CSYA 4P3DA 1PAMA 3O6FA 4BIKA 1VACB 4R4BA 1HHIA 1YEHL 2QPUA 2AEPL 1R5VA 1QNIA 4Z3EA 4K5LA 4L9LA 3QUKB 2W81C 2ED7A 3WJJA 5KOMC 1XSOA 4QRTB 2KS0A 3TO4A 5AG8A 4G7SB 5E8EA 1HVXA 1CIUA 1CE6A 1H15B 3SE4A 2HB0A 3DRTA 3FULA 2N7SA 2OXGB 3R06B 4HJGA 1HEZB 1DBKH 4PREB 2R4RL 1FA4A 4HC1L 2A5UA 2IFFH 4PJGE 3B9KA 1URLA 5C0BB 1FG2B 5C1MB 5IT2L 1JUFB 3X3FH 3VFRA 4K7FB 1GAFL 3MBEB 4HW6A 4JFFD 4R4NC 3GT6A 3KLLA 3CFCL 4NKOA 4NX0A 1MI5E 2CXKA 1X6NA 2OJEB 5CZVH 3RNKA 5AAWC 3FRPA 2NY2B 4EZJA 1R24A 4FI8A 3ARFC 3BP7B 1R4XA 3I75B 5D2NA 5FGCE 1QSFD 2A74C 2WJ5A 2WJ7A 3PXHA 2AJZB 4JK0D 4OLWL 5K9OB 4NO2B 4RMTA 1RD6A 1BGXH 5EU5B 2ICEC 4X6EA 2MH4A 4WKZB 2CJUH 2QZ5A 1ZVSB 5GRVK 4NGHL 5JIPA 5KG9A 1CDHA 2VISB 5CP7A 4DW2H 3UG3A 3K1DA 3LZOA 4OCRL 3CZFB 3N43F 4NQQA 4OCXH 5TDNB 1TENA 5DK0A 2Z65C 1IEHA 2MIZA 1U8JA 2KUTA 4EZLA 4XOAA 1DSWA 3ATEA 4RFOL 1E4WH 3OWRA 5DO2C 1L6ZA 1NANI 2G75B 2WXJA 2W59A 4C47A 3RJOA 5I6OA 4JO1H 4HVBA 3BD5A 3MJWA 1BQHA 4P9ML 4XO4A 4UM9B 2VAJA 1KB5L 4AENA 3FO0H 4MRBA 5C0FB 4PJAA 1U4EA 1ES0B 1IGML 4K07A 5IVXB 2VN3A 3UEZA 3EO0A 1O0VA 1RH8A 1SQ2N 4FQXA 1UM6L 5A2IH 3L95B 4MGXA 1EHKB 1MCRA 1E2ZA 2D0GA 2QGEA 4UTBH 5DHVA 2GI0A 2OMUB 3MRPA 4J23A 5T5NF 3WV0A 1EXUB 1T83A 2XXFA 4XNUH 4LQFL 4L8SC 4D7BA 3UZQA 3N1FC 3S3CB 2DQCH 5AVUB 2ZUUA 3LOWA 4FFYH 2X4QB 5FFOA 5E1IA 4YDKH 3QUYB 3GBEA 5DURB 2XZQL 1FGVL 1KB9K 5KN5B 1HFUA 4YSUA 4KGLA 4KQ4L 4BZ1L 3MV01 3RIAK 1ZLVK 3UPRB 5DJZA 1FL6A 3FCGA 2ZSWB 1MKFA 3HG4A 5GS0C 4MA1C 4N1EA 4X50A 1YEFH 5GGRA 3IFPB 4JLRA 2EEBA 5F96L 3PQYA 1J0ZA 2APBA 3ZKND 1K8DB 3GXUB 1ZLSH 2CBMA 4LQ1A 5CS7A 5I17A 4J39A 4LCCC 1F3DH 4CN1A 5BQ7B 4I9WD 2VC2B 1A6PA 3BAYA 1NKOA 2WOBA 2EXWD 4NZTH 4RGMC 1ZPLA 2JKNA 2MNJB 4N87A 4NLHA 3LMJL 3ZTNH 3GRWL 3MFGB 3UO8B 1OW0C 2ENJA 1E65A 1PG7L 3BJLA 4IBLT 3VFMB 2E6QA 4MJJA 5CINL 5ICZA 2P5EE 1TQTA 1BBJB 3RVTD 4AQ1A 3BGMB 4Y19A 2JFCA 4OLZL 1D5IH 3WS3B 4H20H 3HMWH 1S9WA 4HIXH 4XPGH 1U6AH 2Y72A 2C3HA 1KT2B 3PL6B 2APWA 4X80H 2EIZA 4XBPA 5EA0L 2ZOOA 5LXVA 3N1MC 3F2LA 1TEYA 5HGGS 2WLIA 3F85A 2JSFA 3PP3K 1SBBA 3CNKA 1GSKA 3O3EB 1KCUL 3TPUB 4K3DH 4YX2L 3ROOA 3ULAB 4DPBX 1NCHA 3CSBA 1IGIL 2D0HA 5E03A 2VXSL 4PBVC 2NTSP 1JBJA 1W2KT 4Y0GA 3KWWA 3N6YA 4I89A 3ARWA 3QCVH 5C7ZA 5LDSA 4K9EH 4PP1C 3TJHC 4AYMC 1P7QA 1XFPA 1WFIA 3QJFB 4PMEA 2O5ZH 4QOKA 4MQXC 3VTAA 5C0EB 3S3JA 3DGCR 5B7FA 4M7KL 4WW2B 1YCSA 2J5LB 1P7HL 2VE6B 3QXDB 2FEEI 2QSCH 4YSCA 4KXZI 1X9QA 4O2CA 1FNEB 1AY1L 1MFEL 1ULVA 4X6BB 4RQQB 4PV9B 4MJID 5BZDA 1PIFA 5AD0A 1N68A 1D6EA 3BPLC 1NPNA 4QY8B 2K0RA 3QZNA 3VAEA 4EBQH 2G4EA 3FB6B 4GI8A 4UNVA 5CUSH 2I26N 2SODB 3UAJD 4PRHB 3V4PB 4D9RD 3V0VB 2VDLB 2B0SH 1PL3A 5EUOA 1X5FA 2L3BA 3BVDB 4UOJA 3BPNC 4U2ZA 2PW1A 2VXTH 2NW3B 2P3YA 1ZCRA 3FCSA 3QRGH 3NZHH 1NOFA 4IOFD 5IR1A 1S9XB 1XGUA 3MRQB 5JHLL 3I6KB 4HK3N 3RGVA 4AM0B 3D0VB 2OJZL 5IW1A 3WO4C 5D7JC 1XF5B 4HIPA 4DERA 4BUHA 2DKMA 3KW7A 1HL5A 4JKWA 2JB6B 2X1XR 1DVTA 3F05A 4DVBB 1E67A 3DRQA 4X7TA 4OI7A 2AK4B 4OSUL 4Y4HD 3UZEA 1FH5L 2X4TB 3NCEB 2P80A 2P5WE 4CW1A 2GIXA 3QC6X 3ZHLA 4CKVX 2DQUH 1HHJA 2DWEA 4JN2B 5GZOD 4FQHB 1QACA 1Y6KR 1CXLA 2EICA 3L9RB 2RQ8A 4HFUH 4NM8L 4DH2A 7PAZA 3HZVA 1A7QL 3KPQB 2R29H 3VGDA 3QXUA 4NQEB 4YK4C 5I71B 4AYGA 3HRZB 1DN0B 3KR3L 4XN5A 4KTGA 5I6KA 4OFKA 3A47A 5DHYA 1N59B 4KZDL 3VNYA 4MNQB 4NN7B 1I85A 3UJIL 1AQKL 3MRMA 5CNHA 5DFAA 2EIBA 3PNRB 4PGEB 1U8OA 4GEJA 3FRUA 4M7ZC 2V5SA 5F1NB 3CQPA 2PXYA 4L1DA 4OJAA 2QQNH 1ZE3C 5ECJE 1M71B 3PWVA 2C9UA 1V3MA 1JVLA 2JCCB 2R69L 1SMDA 3G6JE 2OZ4H 3FYIB 3L3GB 5L2JA 2ZP9A 5IF0A 5KBLA 3WDJA 3L5HA 4J3BA 3KBPA 1MHEB 1FZJA 5EBWA 4N0UA 2W9DL 2PTUA 2BVOA 1CFTA 1A02N 4N2HA 1NAKL 3ZPDA 1WAAE 3IU3A 5I19L 3DUHA 3ROLB 4Y4FC 4NP4L 3CX5J 5DC0A 4GQRA 3RY5A 3V9EA 1RI8A 1NIBA 5B38A 4YBQD 4YHKH 3NYKA 5AW2B 3D85B 4M02A 5E8DL 4F7EB 4Z3GA 1G7LA 1NC4B 1TNMA 3F62A 1H3XA 4RIRB 5CZXD 4ZFZA 4JM2A 3ARYA 4M5YL 1HILA 1MG2C 3IFLH 4L8BA 5FA3A 5PAZA 3TCTA 2CUMA 2JI3A 5D7SL 4Q8BA 2J21A 3FONB 1OLZA 1BQKA 2APFA 3CZEA 2DAVA 2F7PA 2VDNH 4GAJH 4GBXD 1YEDB 5EU7E 3PDOB 4GIPD 5CR1A 2XV2A 4M93C 4YZWA 3GIVB 1KZYA 4WDIB 2OBGA 4MJ2A 1MCWW 2OM5A 3HI5H 4U1GC 1TZIA 2BNQB 2DI7A 2EACA 5AAPA 3DMMC 1NGZA 3WGVB 1LMIA 1MCOH 4ZDHB 5L9DH 5D1ZB 2WZPA 1BQLH 1CBJA 2J8OA 1DR9A 4X7FC 5JOEA 3J07A 2EYTA 3HE7C 5HI5D 8FABA 1CQKA 5LNGA 3ZDXF 4LKXB 3BCFA 3AABA 2AVGA 1OPGH 2JQAA 3N5AA 5IQ9A 4UOW0 4HKXA 3HVDA 1Q0YH 1M05A 1AVAA 4R6UA 3S5LA 4R96A 4FTDA 4OZIE 3U7AA 1DEEB 1RULH 3W2DL 1JXFA 3SD5A 1KGJA 4C56B 5JYMA 1OAXH 4JG5A 3OHMB 1DDHB 1CTNA 3UTTB 1QA9B 4KI1A 5DK3A 2ORBL 5F0LB 3VWKC 2X4RB 5EIIG 1KJ2A 4XN7A 2D31B 3O41B 2OJ1A 2GK2A 2PABA 4DUVA 1BFVL 4PJ8B 2NY5H 4QJ5B 4B9IA 1OF0A 1F6LL 4MAYA 3OSKA 4PJFE 5HHPB 3QO0B 3SDYH 2DIEA 1RPQA 3GBNL 4P5SA 2BJML 4MXQD 2QKIA 2VLLB 1QSED 4XNAA 4JRXA 4B0MM 1GW0A 3OZLA 1WZAA 5JMOC 1JV2A 3PWJB 5GRVL 5C0DB 3BUYB 5GGSA 1JIBA 2PYFB 4WO4A 2W9LA 2CIKA 2B39A 3WCYA 5DS2A 1SJEA 3HN8A 5F7FA 3RWDA 4JZJA 5DD1L 2CHXA 3QDJE 4KZ0A 2V7HA 5GGTH 4WHYH 3DO3A 4JHWL 2FBJH 3S35L 1G6RB 2CPCA 2N4IA 3NK4A 5T1LA 1TQCB 4IBZA 2RIKA 1JNHA 2ZG3A 1WGVA 1EHNA 2Q7NA 2W9EH 2BWQA 3ME0B 1MCKA 3O6LL 2ATKA 5IHHA 1OSEA 3GSVB 3AREC 4JQXC 3T2NL 3MV11 1KIRA 3ZQXA 5CD3B 1F0LA 4GG8A 4F7CA 3HNVH 3LIUA 2RBLA 3ESVF 2Q8AL 2CHZA 3RI5K 1K5NA 3WDIA 1MWAA 3JTBA 1CGTA 3DNKA 3ZQWA 4DPAX 2R0WH 4HEME 1MG3C 5I18L 3LIZL 1N7ML 4M62H 4I4WB 4XVSL 1E30A 1SDDA 2IH3B 5JOPE 2FHBA 4GO8A 3EG9B 4J3VA 3BQVA 2Q20A 1QI3A 1NBYA 4XBEH 2Y5TB 3NFNB 1A7NL 3MV8D 2I25N 2B1OA 2JV6A 4KI5C 3VFNA 4B9FA 4BGLA 1ETZB 1DJXA 3GHBL 2IVFC 5E4EC 4H8QA 1P5VB 4Z7VE 4PGDA 4PRPA 3C8KA 3GKZA 4RDQF 2CA3A 1PFOA 1QFWL 4U1SB 1F58L 4AIEA 3FMGL 2ICWI 2C4XA 4QXUH 5I1DA 5ISZE 4KAQH 1JTPA 1FO0B 2WM0A 3IMTA 2IH9A 1KLGB 3KLAA 3E0GA 5HHQA 2FK9A 4FHJA 4WKXA 3GLAA 5I2IA 1OCWH 2W0FB 2OK0H 2Y69B 3FUDA 1AMYA 3N3EA 2CRYA 4AXWB 4QRUB 2BOCB 2DKUA 3QIUA 3VB8A 5C6WH 3IE4A 2WBWB 3MLVL 4KK9C 5DJ6A 1MLBA 4IRSD 5HDLA 4HH9B 4BCZA 4EN2A 4ACPA 4GG6F 1G1KA 1ZA3A 3CFMA 3VI3F 4X6CE 4F5CE 2B2XL 3DUSB 2APXA 1X5XA 2FJHA 4N2LA 4OV6F 5CFAA 2Z3FA 2QELA 4AOFA 1LE5A 5F93C 2V3DA 4JGJA 4XCFL 1YECH 2NYYD 3QQXA 5D7IF 1J86A 3CVBA 3BHBB 3KVPA 4Q9QL 2BO0A 1RUQL 1KFGA 4GXFA 3SE3A 4ELKB 1S7QB 4LIQL 3DJTA 2F54B 4KQ3H 5GS0L 2QQLH 2K6YA 4JCWA 4NQDE 1DCEA 3M7FB 4HC1A 4GKZA 4P2RB 2HLFD 4DN3L 4GRLB 2DV6A 4P2QD 2ICWJ 2J8UF 1IM9D 3WTVA 4TTDD 3KL3A 1N6QH 3J2PA 2WN3A 3NCJL 4C83B 5J1AB 1OY3B 3H3KA 1FBIL 1TG8A 2FEJA 4A7GA 5KYWA 2VDOL 1TDQA 1A1NB 4X4ZA 2EDMA 1GOGA 2IQ9H 3ECQA 4PS8A 5IP4A 3MNZA 4R7DB 3KD4A 2DEWX 2WMPB 1XXDC 5F7LB 1NQBA 3TONA 3AMLA 3CZKA 2GITB 2UXFA 4GUCA 3QUML 4IMLA 3I3DA 4OCSL 2R9HD 3P40A 5I1JL 4A37A 3G04B 1T2XA 3VFVB 1GGTA 3PGCB 2H1PH 3QDMB 4MFHA 2F58H 3P2TA 3FN9A 5JYLA 4LSPH 4MZ3A 3AG2B 1KB5A 1MSPA 2CU9A 4JDTH 2IDCA 1OF2A 2WVSA 4Z7UB 2WYIA 3H1ZA 1CI5A 4OCWH 5CCKH 2BY0A 1NGQL 1IC7L 4Y5VC 1DFXA 2JVUA 3HG1B 4Y8DC 2WLJA 2ZT9C 4OFVA 3WHE1 3U82B 1OARH 5DD5H 5DHEA 1H5BB 2E75C 1H19A 2BVUA 2I07A 2SEBA 4NQDD 4ZPTB 2CDGB 5E2WH 1TT6A 4JFXB 4CU8A 3SJVB 5AVWB 2DJSA 3JUYA 4NRXA 3N55A 5T1JA 2H3KA 2F53A 4X7SL 1UM5L 3KG5A 4LPTA 2NX5B 3GMQB 1VADB 1JZ7A 1MREH 5GGSY 4LAJH 1HXKA 4MX7B 1PZSA 3B5GA 5KSUB 3EBGA 4A2LA 2HKFH 2A7BA 4YFLF 3KGSA 4URTB 3X1BA 1VF5C 4WV1B 5FECA 1NCDL 3LV3A 2PWDA 4R0LA 1CB4A 1IARB 4GPVA 5J11B 2GBTA 2D0FA 1FL5B 1SMAA 4BSJA 4K9JA 4HMCA 4DEPB 2B9AA 4L8CA 5FGBC 3THML 1S8DA 3C6LD 5IESH 5DZVA 5MP6L 4MB5A 3P0VH 2XKNA 5C08D 4G8GE 3GRWA 3LEVL 3WE6A 5TF1H 1CTOA 3FUHA 3NTCH 4Z7NB 2VLJE 3QDGA 4G5AA 1EPFA 4HGWA 4NN5B 1UA7A 2WSDA 1AZUA 2FTAA 3H9HA 5FHBL 5LBSH 3G6DL 3U4BH 1NKRA 4NQCD 3VXSB 4QT5B 4XN9A 4HAGA 1K4CA 4JG0L 2EDFA 2V9RA 2IQAB 1IGYA 4HD9A 3UAFA 1YN7B 5E6ZA 1T03H 3W11D 2VLKE 4CC1A 1LO0L 3QEQE 4I85A 1GZHA 2AVFA 3ZZSA 1XCWA 2IC2A 1BF8A 3VD4A 1BFOB 2Y6TE 5KSAB 3IDIA 4EUPB 2WXKA 3WDHA 2ZZUT 4U1HB 1YNLL 5GGQH 2FGWL 1JL8A 1XF4B 1FQ9C 5ICYA 2WBJA 3EFFB 4AEEA 4HCRH 5JW3H 1A47A 5C0CB 3DJRA 3HAEB 1L0PA 3ABMB 3WY2A 3HUJF 1YJDC 4F7PB 4NAJA 5HJDA 3OX8B 5L6YL 5AZ2H 2HFEA 1FVDA 5EUKB 5KANI 4YBLC 3CFDA 2ROYA 4FTVD 4PWJA 3EYOA 1Z9SA 5TFSH 3QJZA 4NKMB 5ACMA 5I1IL 4D0BA 5F7EH 1UQSA 4KNUA 3O0RL 3OZ9H 2Z8VC 3LPOA 4Y2DC 3KYMA 3MNWB 4XWOC 1Z3GH 2X2JA 4JFYA 5I0WA 4J6RH 3KYAA 2ERJC 4OQTH 4XBMA 1WFOA 3B8YA 3BT2L 4G9FD 5H37A 5F3BA 3D3VE 5DD0L 3ZDXE 1K8IA 2EDWA 3L2LA 2PCPA 2EE6A 5L7XL 5FKAA 3IPBA 4BINA 3MJ8B 3TC9A 3IJHB 1G9NC 4BHUI 4XODA 3CN4A 4DVRH 4E0RB 6FABL 2ZXGA 4RMVA 3VXRA 4A2FA 4G9DA 2MHAA 3QEQD 1IQDB 1CGSH 2B4CH 1YHPA 3SBPA 4L29A 3K0WA 1DVFD 2AKRA 3OKDA 1JK8A 4MA3A 1MRFL 3GHPA 2KPNA 1JGVL 4CC4A 5FW6A 2Y7QA 4R9HA 2JF1A 1DLFL 3MACH 3QIWA 4IHOB 1YYML 5FS5A 4ZJ9A 1AHWA 3MNVA 4HOXA 4G70B 2EDEA 2BHUA 3VD3A 2OTUA 1WA0X 2Y5QA 5KSVA 2F74B 3UBXA 4U1NB 3CFEA 1ZGLB 1EEZA 4RMQA 1XCQB 2XY1A 2BXZA 1NL0L 1JHTB 5D1XE 1J5DA 1CLOL 2CSPA 3VXPB 4GAAA 5AFAA 4CILA 2ITDB 1GRWA 1Q4NX 1F6FB 4LCWA 1TTCA 3OMAB 1P4LB 3VWJA 2NY6B 3WU1A 3ZR6A 4N4YB 5T5FH 5C0RL 2GB2A 4LASL 4HLZH 1EO8L 3L9BA 4JG1H 2COVD 5HVGB 2C9SA 4OCMC 4AJWA 3GMMB 5EOCJ 5F72S 1I1AC 3NRQA 3QFDB 4XP4L 2R69A 3PHOB 2ALAA 4E68A 5MEOB 3TWCL 15C8H 3BKCL 1H0DA 5ALCH 3H7BA 3PABA 1NIDA 1TTFA 2X6UA 1RZJC 4P5KB 4XHJC 3RWFA 5DJ8A 1CLZL 2R8SH 3L5XL 2F19L 3QJVB 5D2LF 1MHCB 4PN6A 5IM7A 4XMZA 4P57B 5AB9A 4MMXB 1ZEAH 4EN3A 3DARA 2OMBA 4HS6B 4MVBD 2HMID 5DR5H 3K6IA 4ONOA 3H42H 4ETYA 5EZJB 5GS1A 3EFDL 1RAMA 1OSZB 3N40P 2KLRA 2IO5A 4HD5A 5DQJB 1M3IA 1IBDA 3KPRE 4IEFB 2ADFH 4MKMA 2E7LC 2WYZA 4KY1H 2XVLA 4MS8D 4S2SB 4HBCH 3Q8FA 4XNXH 4PIBA 5DMKA 1J18A 1YY8B 2HRHA 1DBBL 4YQXL 4BQ6A 4P4KB 1IAMA 1JPSH 5F8RC 2ESVA 2KQNA 4HHAA 5I28A 3ZSSA 1XAUA 3TBSB 1BMWA 2Q86A 3FQXB 3DV4B 4MQSB 3FJTA 1IB5A 2WXIA 3AQZA 1I8MB 4EKXA 4HOZA 1NIFA 5DS8B 5C7XL 3UTQA 4FQ1L 1E9QA 4BDVA 1JGDB 4OB5L 2Z31C 3UTZA 2F1EA 2ZWLT 1JF1A 2X44D 3MDJA 3PHAA 5HDQL 4M1CD 3X3GH 1NCGA 2DIAA 3QCUL 3U6RA 2YPLE 1UCTA 3IF1A 3FO9B 1VRSA 3HZMA 1KFAH 1PKQE 2OPCA 3VVVA 4JMXA 3IXAB 1YEIL 1UASA 3FBKA 4PJBB 5I5JA 1SXZA 4FNLL 5D72H 4FG2A 4M4RA 3MMEB 5IVZA 3VI3E 3R8QA 4JPVL 1H8LA 2CO2A 2ZPKH 4OF3A 2XFGB 2LQRA 2B77A 4P2OD 4NNYB 1NGYB 3N85L 3L4CA 3V55A 3NJKA 5ETUA 2GCYA 4AE1A 5D7IE 5C0NC 2GTQA 1MNNA 1EUUA 1FDLH 2ZSVA 1OAQL 3GSOB 3LQZA 5K39B 2PR4L 1W8NA 1KGCD 4XNMB 5DYFA 4FMVA 1J0YA 2K4AA 1UD6A 3SY0A 3D8MA 4LEOB 3WL9A 5F9OH 2E27L 5CXPA 4ZYKB 1F4XH 3VVWA 1PZDA 3BAXA 5F7BA 1SJHA 4ZX4A 1ILSA 1GIGH 4JGNA 5DI8B 4OCYL 2J8UE 1AH1A 1P6WA 1A8ZA 1NGXB 4OGYL 4U7MA 1JDCA 3T0EE 3DVGB 4ZUVA 1A2YB 5IQNA 4M6ML 2H1LM 4Z23A 3FPXA 4OIBA 1MY7A 2EKSB 1RZKC 2HJFB 2EUXA 2ZYIA 4JFUA 4WTZA 1AZZC 2E86A 2JKIS 3KPSE 5EIQA 1N3NA 3GSNA 5CGYD 3BGAA 3LH9A 3GXIA 4YXHL 2DM3A 2OTWB 4HPOL 2FQEA 3WFBH 1CXEA 1EAPB 1S9VA 2R27A 1UD8A 5TF0A 5IKCB 4HT1H 1LO3L 4WI8A 2XRAH 3S36X 2WVVB 5C0AE 3Q9PA 3REWA 2VQ1A 2C9PA 3IJSB 4M61B 4HV8A 2BLFA 4FMKA 3GXDA 3L3KB 4X0KA 2WNGA 4P5TA 3MLYH 1LK3L 3EDKA 3AB0C 1FE8L 3H0TB 1BIIA 4QGTA 3LIZA 3UAEA 4K3EL 2BRQA 4P23D 2EVIA 5BXFA 5J3HC 3PGFL 2P24B 3ARFA 1F4WH 1B3JA 2IPTL 3BXNA 2IFGA 1XCTA 1CDYA 2B08A 5K9KA 1NGPL 4NUPA 4CADB 1AQ8A 3GEWB 5F7HA 1J11A 3MXWL 3AG3B 4FXGB 1DJSA 3VXNB 5GJSH 4ZMWA 3U4KA 3SQOH 1P2CA 3Q6FA 4JFEA 3PIQA 3OVUB 2ICEA 1YEKL 1KWGA 1Z5YD 1WFMA 4M5ZL 2EABA 5E8OB 4Y5YB 3LEXB 3POCA 3GO1H 1S3RA 4QYAA 4XNQB 3SO3B 3MRHB 2FJFA 1YEEL 2VQUA 2XQYK 4Y9FA 3SY6A 1IGFH 3T0ED 1EEYB 4H44C 5EN2B 2I7SA 4TVUA 4OM1H 4PJGB 3KEHA 3NP3A 2YD2A 1A6VL 4J4PD 4MA7H 4PY8I 2Q8BH 3WIFB 1KGXA 4X5WB 1R3IL 5K69A 2AZUA 3TYGL 2WQ8A 3ZRCC 4ZMTA 1F6AA 4JPKH 1RJYB 3MO1B 1I8KB 2CDEA 3H9SE 2X6BA 4ZD3H 1OAYL 2WKLA 3QFGA 1TZ8A 5IVOA 3OAUL 3I3EA 4O02H 4XRCB 3CN2A 5EF2A 2Y06H 3TEYA 4RWYL 3OB0H 4XE0A 3PGDB 4GLRH 4AW4A 4FLRA 4FP8L 2NNFA 4A55A 5E24E 1HT6A 1ITBB 4WU5A 3E38A 3ZK0A 4DGUA 1JV5A 2OQJA 2RQEA 4H1LB 4TM9A 1GCFA 4N8UA 3ULUL 2VGLM 2C3XA 4HUVA 3ALPA 4DGVL 5DMYA 2D3NA 4KVNH 3O8XD 3GM0A 4M4PA 1SM3L 4BFIA 5MEPA 4LLQB 2ZXAA 4EVNB 3KGTA 3UJJH 1RV6X 1SXNA 1BVLA 1J05A 1AYRA 3C5ZD 3G6AA 2BM3A 3HHSB 3VYNA 3WFEH 4Z3FA 1PLGL 5ADPH 2DZEA 4NCC1 4KROB 4GRWB 1S7UA 4NZUH 4ONHB 2B7DT 1UKQA 2WLLB 1UH3A 4LCCA 1J8SA 1IKNC 1WFJA 2OL3B 4B41A 4BSWA 2LOEA 3NFSH 5HPMB 5EZOL 5IMOB 4BM7A 2IXQB 1N5YH 4JR9L 2H2PD 2XLLA 3X1GA 4B9KC 3TPKA 1UWGH 2VLMD 2AI0L 4CGTA 2QGBA 1AGBA 3VXUE 1M6UA 2DPKA 2D3VA 4E9TA 4PY8J 3HUJE 4G8IA 5I1KH 1YDPB 2EH7H 3IEAA 4LF3A 4ODHL 2GC7C 4D9QD 1EUTA 3CVCA 4PJHF 2Q2LA 5F88B 4TL5A 4XCNA 5JHBA 1JE6A 1G0XA 1T1ZB 4KX9A 4DNLA 4WW1B 1XGPB 2H47C 2HKHL 4P59H 3P3UA 4JAMA 1F02I 4XP6L 5JR1L 2FX9L 3JV0A 4RH4A 2C9XA 5C0IB 1BOGB 2V2WB 3QUMA 4U6HA 2H32A 1FNGA 2IANA 3HG2A 4OIFA 5SX5K 3QFJA 5EZIL 4F2EA 2ZUWA 2VH5H 2ADJB 3FT3A 3A6BL 4EZMA 4FULA 4YLBA 1COBA 1E4KC 5DJ2B 3QQ3B 4JN1L 4TUKL 2DQDL 4ZXBD 1T3FA 1RSFA 2J1YA 4QHKJ 3BRFA 4I0PC 1CFBA 3ZDYE 2VXQL 2MQGA 1JD9A 5EU3A 4AI7A 3BKJH 1UC6A 3FU6A 4E5XB 4YZFF 1FZMB 1HNFA 4UZUA 1ZGLP 5FB8B 5BVPL 1VGKA 1C5DA 1PZ3A 3PL6C 5MENE 2QMKA 4N8PA 5JO5A 4LLYA 2F15A 3LXBA 1RLBA 1P4BH 2VDMB 3EO9H 3QG7L 1MFDH 4AT6A 3ZMRA 1BJMA 4ABQA 4UAOC 3LHPH 2AJ3A 2EDXA 3MJGX 2J88H 5BCAA 2O5XH 4ODWB 4JX0A 1BWMA 5CCGE 1ONQA 3DGGB 2FIKA 3NSXA 3R1GL 4M6NH 2Z92B 4PJXB 4J2QA 5E0FA 5KS9B 2G9KA 1ETA1 4WWOA 5LG6A 4PTUB 2APSA 3KCPB 5EC2B 4AIOA 5JXED 3DX9B 4PJEE 2C1PA 3V8CA 5D1QE 2H9GA 4TUJB 2ZTBA 3GSUA 3D9AH 1E0OB 2J20A 1SUJA 4XVTH 1QBAA 3GTTA 3OKOB 5EEXA 2KL6A 2DYSB 2JB5H 2QQKL 3O4LE 4N9GB 4NC0B 4P2AA 4WK4B 4MMYB 4BKLB 1T7VA 1AXSB 2QJDA 2UXGA 2EC8A 3CN0A 4WW2C 1XGQB 4B9CA 1PDKB 1G9NL 2DQJH 1G4RA 3PCYA 1IE4A 1U3YA 3I3BA 5AW9B 3EXLA 1KTLB 2XG4B 3V4VL 1PNCA 2GJ6A 4PTTA 2R4SH 3PWLA 4GRMA 3MA7A 2BRRL 5CD5C 1REIA 1AQHA 3VFPB 5KVMC 2NT0A 2CCLA 1DFBL 1ORQA 4TQEL 2K9FB 4J3UA 1UATA 1JFQL 2OI9C 3GC3A 4KZEH 4HWBL 1V54B 2QGDA 4RX4D 2XT1B 3QO1B 5CAYB 4L4TE 3QUXD 4I3GA 3EJSA 3TH2T 2ZYHA 3K5SA 3APNA 4PCTA 2C9AA 4BQBA 5D2LE 3W9DA 3B5HA 4PJ9D 1SN5A 3VQMA 2AGJL 1QHOA 1Q1JL 3BWSA 3QQDB 4FNSA 5E95B 4XCYB 2DOCA 4B9GA 2RFXA 5E8NA 3GJFK 4AK2A 5A3IC 4JRLA 3ZY7A 1UD2A 3T3PF 2OFQA 3TL5A 3U25A 2N59A 2V6HA 3IU4L 2EVHA 5GSVB 3TTSA 2VT0A 5JIKA 2BDNH 4HUXA 1YLBB 4WSKA 4XMPH 2BFVL 1KGYE 3U6XA 4A2MA 4EUPG 3OG6B 4JRYD 1E6OL 1ZDQA 3BD4A 4MXVF 5AYQA 1N70A 4EEEA 5MI0C 5LBGA 1FUNA 1DDTA 2FATH 2YPVL 2IH1B 3IDNB 1M2OA 4KUCD 2Y1AA 3HAEG 1RZJL 3QZMA 4Y9BA 2VN4A 4LNRA 1T7XA 4UU9B 3GFUA 2WLZA 4X0NA 3L3JB 1SOSA 1RK7A 2QPFA 2FDBP 3GI9H 4Y4FA 2R23A 3MXVL 3MGOB 2LAGB 3HPLB 4FLHA 2GTWB 3OF6D 4PUBL 3MNMA 2YZ8A 4PJDB 3EUUA 4JZOB 3MU3A 3F12A 5EDXA 2Y1VA 3HZ3A 3NFPB 3EAKA 1BZ9B 3GMOA 3HBGA 3OL2A 4TNWK 4CVXB 2E74C 1QLRA 3LQAL 4HISA 2CA4A 3EBIA 1U8KB 4MZ2A 3T4YB 3VFTB 4I48A 7FABL 2G60L 3MRNA 5F6HI 5FYJL 4OZGF 4F8QA 4LSVL 5GGVH 5KBMA 1O9VA 3G5ZA 5TQ0H 3WUWB 2VSCA 3BX7C 4HLJA 3BZEB 3HA0A 4QAWA 4DP7X 4C8XA 2PTTA 4PLJC 1USQA 2FUTA 2FEDD 3K80A 4LRNL 1D2PA 4H4NA 4Q6KA 4RAVA 4F1SA 4KKCC 2F7RA 5FK9B 3IETA 3TASA 1DJGA 2HTKD 5IIEB 1NFKA 4G6ML 3A4DA 1WITA 4JO4L 5CM1A 5IW6A 4TOYL 2B3RA 3HE7A 2HN7B 4A38A 5FC9A 3WEXB 3BH9B 1K6QH 3MCLH 4P4RA 1AYOA 1YMMD 2ARJB 5D5MF 3FCTA 1UEYA 2CAKA 3LSOA 1VPOL 3DVNB 1ZLEA 4BUGA 4FA7B 4Y5XB 1AGFB 3SKMA 5CMAB 3I02B 2LFEA 2PPCA 4L4JA 2Y2TA 5J6GB 3U9UA 2AXFA 2L7EA 4UB0H 2F5BH 2MFNA 4JFDE 1E6JH 1OE3A 5D1ZC 1ROCA 1YQVH 2HG5B 5FYKL 3HC4L 3EYSH 4TNFA 5CSZA 2ITFA 2YQGA 2XWBB 2IV8A 3CMGA 1HXYA 3VWKA 3HPJB 3AUVA 3EDDA 4MSWA 4ZTEA 3DX1A 4LE8A 1ZXQA 2KQMA 5I1GL 3H2WA 1H8SA 4QHNB 4DGWC 1JWMA 1KELL 1CR9H 1DBAH 4QCIB 5AOZA 3WFDH 5IFHL 1G9EA 3VFGL 5I6XB 1A66A 4MNGE 3A6CH 1FVCB 1OK0A 4FXTA 1PVHA 4UT6L 1R5IA 4ZODA 5F6HJ 5I16A 3HB3D 4JO3H 3ZKXB 3E8UL 4ICWA 4NKIL 4E41A 4FNTA 3QPQC 3ASNB 3PJSB 1OT4A 3EOAB 2EZ0C 1SDAB 2FRGP 1ACXA 3NZ8A 2BVPB 4HGMA 5H94B 5CCJA 1KYOJ 5GRUL 1WT5A 3MI6A 3DHPA 4BFOA 5CLZA 5KEZA 1OWWA 4LB8A 4Z76B 5FF6A 2Y24A 4PJ8C 5AAMC 3PP4H 1Z5LA 1I7RA 5DVMA 1RZKL 5DZLA 2X4NA 1OSPH 2RGSA 4HXBL 5DRNA 3QWOA 1IC4L 3LNDA 5BV7C 3KPOB 4FI6A 3O11A 3CZSA 2HH0L 2PPEA 3DDGA 4N2NA 1V3LA 4JB9H 3APDA 4PJFB 1PJ9A 4XI5C 4PRIE 4MDRA 4Y2OA 5AB2A 4JQXA 4G1EA 2WZ5A 4XWGL 3MV8B 3UXFA 4QYOB 3DVIA 5ITFB 3LS4H 3NH7L 2J1XA 4UBDC 2VDNB 3F58H 4IOIB 4X8XA 4JFDD 2AITA 1DHKA 1QG3A 1HKFA 3GPEA 2OSXA 4GP8B 1K4DA 3U79A 4ODVL 4V1DE 4NPYA 4GKNA 4HWZA 1U8MA 1TZAA 3UJTH 3SDAA 3QDJB 4W81A 4Y9GA 3W57A 2YMXL 4H8UA 2CLVA 1PEWA 4ANWA 1OGSA 1XZ0A 1KPUB 3DUUB 4I8DA 4PPTA 4W68A 5JXAH 3W37A 3VRIA 5T33H 2HSIA 1TR7A 3D52A 3FO1B 2PYEA 1N0XH 2GQHA 3ABKB 3WBDA 3O3UN 2G9HA 4U0RC 2XN9E 2Y6SD 1G5GA 3IFOB 4XCEA 3FOLB 2CKBB 4G80B 5FYLE 2ZWYA 1JN6B 5HHMD 5EF0A 2RALA 4OT1H 1MCEA 3ES6A 1NLDL 3UGXA 3ZIYA 1MCWM 3QULB 5KAQG 4KXDA 4ETQA 5JNYB 2F5AL 3L81A 1I1CA 4YL4A 1SXCA 3L4TA 1DEDA 1JPFB 5AVRB 3WNJA 4IGBD 2MKLC 5HHOE 3QR2A 4HJ0D 1JP5A 4YHYB 2AANA 4PHZA 1GGCH 1OXYA 4OLEA 2UZYA 4G42A 4ALAH 2WGXA 1ML0A 4Q0XL 3OG4B 2AV1A 1YO4A 4DKFL 1AO7A 2DQMA 3NT0A 3AU1A 3W39B 3VW3H 4PI2A 5FCSH 5AENA 1FYTE 1FSKB 5A2LH 4Y1AD 2YA1A 1CICC 5HYEA 3TESA 1M6OA 2K1MA 1LWRA 4Z7VB 4Z5RB 5J5EA 2W60A 4UNTA 4DOHE 2X53A 1OZTG 5AWNH 2P26A 4Z7AA 1UOKA 4K8RH 4LLUA 4XNYH 1MCSA 4JL1A 5J1TC 4P2QB 1WBXB 5F9JA 3VXME 3KM1A 1U30A 1IM9B 3AQYA 3FQYA 5IUSA 4GUPA 1MFCL 3DXAE 4OFQA 3RVXD 2Y1YA 3KXFE 3NA9L 4JKMA 5FO8B 4JFVA 5KBDA 4GMTL 2C3WA 2UWEF 4XZUB 3ZHKA 2E4FA 5L4MA 4RSYA 4OD2A 4PB0H 4PYHA 4QHMA 4JMNA 1B9KA 1JXKA 1PLAA 3IGLA 3WY1A 1ZGLM 2B59B 3X1NA 2I24N 2WWMC 4J1UA 1OB1B 1IGCH 4F7KA 3RZCB 2ADGB 4JJOA 2VR9A 1S7TA 2EO1A 3LKOA 2C3VB 4YIQA 5TE6H 4DEWA 1XBRA 2EUWA 2D7NA 5GRYA 2CO7B 1QHPA 2PWGA 5D4QA 2LU5A 4YZFE 3SPHA 3TV3H 3QCTH 3TVMD 1L3WA 4F58L 1T1WB 3RVVC 3WIHL 2ZIDA 3F65A 4AQAB 4X6CB 1KLFA 4CRPA 5H35B 5D7LA 4MWFB 3SIKA 3DO4A 1UWEH 4IDJL 4ZSOB 4WUKH 5LQBL 3CVHA 1OTUD 3CX5K 3LRKA 4N90E 5AQ0A 3U30C 3U1PA 1TQBC 4W4OC 3ZL2A 5K59F 3MLZH 5LGJB 4GRLC 3WFCH 2DI9A 2CPUA 4A67A 1T0OA 1T21A 2HT4D 4JHVA 4KJQD 2O5YH 4QTIH 1SYSB 1MIMH 5DMIL 3L1OL 4ODTL 4S1QL 2FX8L 3TZVC 4G3YL 4QXTA 1NMAH 4NQDB 3AWGA 3NJJA 4OZFB 1V55B 1MH5B 2UXTA 1HKLL 3ECBA 2B8OT 3EZJB 4W1TA 5ESQB 3GK8L 4TRPH 1FFPB 4NKDA 5KBNC 5EOTA 1KTDA 3MRKA 5G5DA 1U4FA 4R5XA 1P9MC 3BAKA 3IDUA 5IJKC 1R9FA 2YS4A 4BUQA 3ZR5A 4TSBH 1N67A 1TJXA 4F33A 2CQVA 2K70A 3P3SA 4HS3B 1IQWL 1BZ7B 1EDQA 2BW5A 4PJ5A 4Y5VA 3V6OE 4D8OA 3NOIA 4HWNA 5T1MA 1JDDA 2A9DA 1ZSHA 4RAUA 4Z8FH 3QI9D 1Q9KA 3KYOB 1CJYA 4KWUA 1OCCB 3R7RA 3MCKA 1RZGA 1Y07A 4HKJB 3G5XB 4TMPA 4UQ3A 2NLJB 2VN6A 4KVCH 1UJ3B 5D9SA 5BS0D 2J55A 5IB1B 1NPUA 3LHAA 3PYCA 1E5UI 3BKYL 3C6LB 4IJ3B 2CLZB 2YOCA 4J28A 1U8HA 4ZAKD 5JZ7D 3US1A 2KC0A 1HWHB 3WG7B 1CPUA 2C7UB 2ZWNA 3JZ7A 4N8CL 4BD4A 3BVVA 1RIHL 3TIEB 1HXMA 3E6HB 4NWUL 3ALWA 4H1LG 5DHVH 1WYJA 2FSEB 3V6ZA 2Z7WA 1L5GA 2V3EA 3BISA 3FTXA 2AV7B 4OF0A 3GTVA 3U2IA 2V2XA 1KEGH 3TBWB 5KYXA 3HC2A 2G3NA 1F4HA 3PLYA 1YN6B 4N6QA 4D7PA 3B7TA 4PJIA 4LLMA 4NKQB 4NJAL 3H55A 4L2LA 5DUML 5FGBA 3PWPD 3HCVA 4U1JB 1ZAGA 4WAFA 3T3PE 3UBGA 1RXLA 4PG9A 4FCHA 4XPAH 2CCWA 1FZOA 4K5MA 4FQJH 1F1AA 1KJVB 4WV1C 3SKJL 4MXVE 2J72A 3UADA 2ZWZA 4CSSA 2W38A 3UZVA 5CJOL 3DROA 4LCIL 1EQWA 5J11C 1B0IA 3AG4B 3V0FA 4I0CC 5CILL 5B8CC 3MHZA 5IJVB 4DEPC 1N8ZA 5KVDH 4B6ZA 3Q1EA 5A1AA 4WY7H 1TJIH 4ZMPA 4B3VA 1AR1D 4FTVB 1GZPA 2R2HA 4DGYL 1S78C 4LMQI 1HI6A 2AABH 4ZTPH 5K1NA 3O6FD 1E8XA 2KPWA 1NBVH 5CBAB 3UP1A 2WINA 2NXYD 2ZG1A 2VXQA 1OAKH 1IE5A 4DKEL 1U91B 3ML8A 4ZQKB 4Q6IC 4Z95L 1RUPL 4GAYB 4G9FB 3PWUA 3D69B 3KYNB 1YPZA 4G8GB 5CJ8A 3TO4D 3UIYA 2QR0A 1YUKB 2ZAHA 3BSZH 4FZEH 1CDBA 3O9WC 1QQDA 4OZGE 4Y9CA 4Q9RL 1JYWA 1E3XA 2VDRB 3B9KD 3BIAX 5KJ4A 1A7RL 2NUTB 1OGAE 2ZJSL 4UQDA 5D7KD 4E5XG 5DD6A 3LNIA 3H3BC 2DMBA 1T5XA 3QNYB 3QEQB 2DTMH 1EA9C 1MJ8H 2YIHA 3O6KH 4AV4A 2YLKA 2R1YA 4HSCX 4GW4B 2LLNA 4G8EB 1DVFB 4QO1B 2D03L 4ZS6C 2WZ6A 3DX7A 3SBWC 3F04A 5E8PA 5D5ME 2ZX6A 4W6XB 2MSPA 3EFOA 3RILA 5IQ7H 5ID1B 1YY9C 3HI1B 3DX6B 3WNNA 4LKCA 1DZBA 4IU2A 5KVDE 2VWEC 4I2XB 2WC7A 4Z1PA 1G1OA 1KTBA 1L7TH 4K7PY 2RAMA 2QLYA 4FE9A 4M8VA 1LEGA 4LRIC 4L3EE 3UC2A 3VH8A 4R90H 3CU7A 1Q0EA 4GKSB 3LZLA 3NAAL 4K7PH 2P7TB 5HGHA 2BNRA 2YARA 3AUWB 4ZW8A 3BCDA 2WKGA 3VTTA 4BZ2H 4Y19E 2CHNA 3JTTA 1HQRA 4HWBA 4IOSA 4PAZA 3SPVA 3ZGIA 4NIYE 1WEJH 5F9WC 4AY0A 4YL9A 5BVJB 2J3SA 4FQXD 2BOBA 3HFMH 2R59A 1XF2A 5FA4B 1J0HA 3MLSH 1CI3M 4KKNA 5TDPA 2CE6A 3TYFA 3DETD 1T66D 1BD2A 5C6TH 2NTFB 1X4XA 2WNXA 3CCHA 4ENEC 2VM3A 1SRDA 5IMKB 1A3RH 3GEFA 3GSQA 2X40A 5HDBB 2GUOB 3ABZA 4Z7WF 1J0IA 2BIPA 4CMMB 3MRJA 1A1MA 4EJ1C 2HT2D 5A2CA 4W9ZA 5J89A 3IDJB 3EGDB 1MEXH 4ZUTB 5K1VA 1E8ZA 1PY9A 4JHAL 4X5XA 1CIDA 2PUQT 1I1AA 1WWWX 4PV8A 2XVGA 3PQYD 4ZFOB 3T4AA 1HCZA 2DEXX 3V6BR 4BSVA 3ARBA 4YHOL 3TH4T 4YXLL 3WXVH 3OPZH 2YPVA 4JFWA 1V8HA 3HW7A 5DEJA 4ZFFB 2YEZA 3GS4A 1J9QA 3PF2A 1Q72L 5FCUL 5C3LD 1IZJA 3IMUA 4G5ZL 4YFLI 4IMKC 4RGOL 3DBXA 1XTLA 4KH9A 1SUHA 4TNVK 1QBMH 3G5WA 4I88A 2OX5A 4KJYB 3T65B 2H8PB 4FQ2H 1FORH 1N4XH 3FQNA 2DS4A 2QPSA 5BRQA 5AUMB 1GC1C 1NEZB 1IKFL 3OLIA 4HPYH 1HCFX 3SKOB 5IROA 2FWOA 2OW7A 4G7VL 1MCPH 3L16A 3SODB 1D7BA 4HHWA 5D96B 4JUTA 5I0YA 1KG0A 3IRPX 1GYWA 2XIIA 4AZ8A 5I8OH 2OLDA 5BV7L 2WIIB 2XBTA 2DMHA 3NIGB 3O3AA 1A0QL 2VM9A 4OJEH 5C09E 1P7KA 2XFXB 3TNMA 4H8WH 5F1IA 3HBPA 1XEDA 1JZDC 2FR4A 3F6JA 4XAKD 1NA8A 1UZ8B 5TH2B 4AL8C 1S7VA 2EVFA 4F27A 3UTSE 1NDGB 3BEWB 2Z31A 1MF2H 1HOCB 3UACA 1P7QD 4LL4A 1QEWB 1ZSDB 4P2OB 3WUWG 1EJFA 3CBKB 4QOKD 4JKLA 3TLRA 1G9MC 5DJXB 2FEEL 1HIMH 3KPRB 1D7FA 4RNRB 4EQ3A 1I9RH 3GSWA 4GAFB 4Y8AA 4U1MB 4DQOL 1CD9B 1VFMA 2ITCA 4XXDB 3TNNA 1Z3RA 1NWPA 3UBXI 3C08H 5I1CL 1QW8A 3U9PH 4L4VE 3NPZB 5I66B 5FO7A 4NUMA 4P9HC 1RCYA 5JORA 5EFIB 4DFIA 2IBZY 3WSQL 2OMVA 4F8TA 3MODL 4N85A 1BZ8A 3U7YL 2CXGA 2UWEE 3C8DA 25C8H 1UKTA 4BWTA 3RWCB 1DSFL 1R6VA 1HESA 1G9HA 1T4KA 2DQIL 3RGVD 4JL2A 4UT6A 1CBVH 2P28B 4N24A 5DLMH 3BKML 3RWEA 1PD6A 4F2MA 5DEGA 4W9CC 4YDVA 1N9PA 2Q0ZX 3MOAH 1F13A 2DWSA 2WBXA 3DA0A 1GJWA 3ABGA 1JZ5A 1KIUB 4MJ5A 8CGTA 1KJ2H 5TGBB 4FYSA 2XQYA 4KKQA 3UG5A 3CDZA 3MRRB 3T5WA 3BVNB 3CK0H 2P80D 3FQUA 4DKTA 2X89A 3EYQD 3NABL 3V0HA 2MPAH 5EULV 5LUMA 3JV5A 3FU7A 1T2QH 4X9FA 1PLBA 4U3SA 4ZK8A 2YUWA 4UYPA 4WTXA 1M53A 5LNEA 3FT4B 4P23B 4FG6D 4HX1A 1SHXA 1M1XB 3ABLB 4QXGL 1UD5A 2NRDA 3IDGA 1J1XH 2X1WL 5A2JH 4LSUH 2YMOA 4GBXA 4TPRH 1IBYA 3TT1H 5LXGL 2OR7A 3P9LB 3WIIH 3HR6A 2YSSB 3CLWA 3MRCB 2AXGA 1DBJL 1GPOL 3G08A 3H7LA 4GOSA 3TN0C 1PX3A 2AEQL 2UV3A 4KMTL 1QRKA 1QUNB 1G7QA 1IUZA 3ULSA 4ES9A 1O5PA 2V7NB 4APXA 3V6FA 2PXYD 1BAFH 2F8XC 2RMNA 1VACA 4GXVL 4WUUE 5IVXF 5E7BA 3T0EB 3OXRB 3BO8B 1UTDA 2HCZX 3MYJA 5HJGA 1HYSC 1NSNL 2AQ2A 1IX2A 4XGZB 1RK0A 3ZX1A 1H3UA 2WWKO 3WKNA 1AI1H 3H2QA 4GYBA 2A1WH 2AK1L 3FT2A 2DD8L 5IW3A 1WUNT 5M94B 3LRSA 2EP6A 2A9CA 2FB4L 1LO2H 4PREA 1C5CL 3IB4A 3AT0A 3FNKA 3HRPA 1NCJA 5E00B 4DCQA 2BIOA 2XICA 1T2JA 2V9QA 1A14L 2Q5BA 5FUOL 3GXTA 3W0WE 1QLFB 2A83B 2B1AH 3BPCB 1BVKA 4JM2D 1YYLH 4N2OA 4Y4KC 2EKJA 2CRZA 4AMKL 1GJIA 1OLLA 2CZNA 2EIJB 4NLAA 1KIQA 3OKMA 2L4OA 3FUMA 4HUWA 2AJZA 2BP8A 3O8XB 2BCKB 2QTVA 3TV8A 4UINH 3WNKA 1A4JA 3EOYG 3VG0H 5EU5A 3C5ZB 1U93B 1F56A 2P44B 2EE2A 1QSEA 1NMBH 1FNSH 5SWSA 4TVPD 3Q13A 1MRDH 3HC0A 2VAAB 5EO9A 3KPLA 1E5ZA 1FAIL 3FDWA 3FHEA 2NY0D 2WZPD 4KMQA 3DURB 4MMZC 5EF1A 3CIAA 3LN4A 3SOBL 2X6MA 2GIYA 3BAIA 4UM9A 2DM4A 1NAMH 3Q01A 4HEPA 1RUKH 4EDWH 2FL5B 2ZE0A 1ZD6A 3Q5YA 3WO3B 2H4EA 5IG7B 4F93B 5I8EB 1CZ8H 1WTLA 1IVLA 1C12B 2EXYD 3MUHL 1EX0A 4LARH 5JUEL 4JFQA 1I8IA 4KUZL 3QP3A 4KTDL 1NCWH 3GSXB 3VGAB 4HSQA 4PS4H 5DEFB 3M8OL 4FOMA 3CZNA 5EIVA 1AMXA 4TN9A 3WLBA 1YEHH 2QV2A 2AEPH 3LYRA 4B95C 2J6WA 5ACZA 4AH2B 4H0IA 1JD7A 4XPHL 3CVIL 3S37L 4WJKB 3CLFH 3HZYB 4NQSA 1RHHA 1U58A 1DSYA 1WF5A 2MQ0A 4MAYD 1PZUB 4F7TB 2EUVA 2B1HL 2OSWA 2ZSWA 4ZXBB 4XP1H 4NI6A 4AJVA 4BH7A 1UT2A 4DP6X 1IEAA 4XCCH 4KROC 3MGTB 1AC0A 3L3IA 2FYVA 1WZ1H 5EWIL 5FUZH 3ULVD 4JRXD 2HRLA 2XWZA 5IT2H 3NEXA 4XC1L 1GAFH 1KLUB 1NFAA 2CR3A 2HJKB 3CFCH 4WO4D 4P5RA 2WQSA 1H3PL 1KN4H 3IMRA 2FE0A 3QRFM 4YE4L 1DQQA 3M86A 3RHWF 3QS2A 1RP8A 4OKVA 4U4BA 5HYQB 5DJCB 5F7WC 1E4KA 1QFWI 3T77B 5TPWH 3C9NA 4D0DA 3UTPD 4YUEL 4E36A 4I0PA 2GIMA 1B4JH 1WK0A 3I50L 2IG2H 4QI3A 1U8CB 4UAHA 3SO5A 1GMIA 5TE7H 3KS0J 2JJSC 1PSKH 2YQ3A 4OZFG 1SJMA 3PL6A 5DQDH 3V0EA 1IC0A 1AKJA 3HBQA 3QXWA 2Q76B 4H8HA 1KN2H 3FFCE 1UUNA 2FWLB 2D7OA 1IAOA 1CUOA 3FK3A 3IJ7A 4KK5D 1ZT7A 4IRSA 4XTRD 3BPOB 3FTVA 5CKGA 5C0JB 5CLWA 1MW2A 3NN8A 1TQUA 2X6AA 4B9JA 3RE0A 5K9QI 1I3GL 2BP0A 4PP2B 4A6YB 5AL0A 7PCYA 2YAPA 3CFKA 1N5AA 3GJFA 4JFOB 4YPGB 3OKEB 1SNRA 2AQTA 1KBVA 4N2MA 4NRZA 2Y36H 5E4IA 4CDGC 3KWUA 5J9PA 2BSTB 1A7OH 1O9ZA 4TNGA 1F1DA 1KB9J 3ZDYB 1TPXB 4PRPD 3QXAA 3OSVA 4FZ8L 2FO8A 2BC4A 2YGNA 4L3AA 3KDMB 4I18C 5MENB 1QEXA 4WW2A 3QUXB 3WD5L 2XJLA 1JYVA 3GSRB 3N42B 2G0KA 2YPKA 3OXSA 4LGPB 4Z7WE 3TS8A 2XWEA 1JPST 4KQ4H 1SJXA 1WG3A 4HWUA 1HC1A 5FFGA 4BZ1H 5F3FA 4HWEH 4PJ9B 1I7UB 3K2KA 2FGZA 4M56A 3NCYP 3FB7B 3IXTB 3K4AA 4QY8A 3VCLB 4DWHA 4TQHA 2JCCF 5D6DC 4WSGA 5FAAA 3MRLB 4ZFGL 1DLHB 3MLWL 3O45A 5EBMA 1MQKL 3CSGA 3RPIA 4QTFA 1DANT 4NUGL 3V0VA 1MFBL 1QYGL 3GRBA 4XP5L 2WY3B 3QIUD 4KKBD 3C5JA 4MLSA 4PJEB 3U46A 1NCBH 1KF9B 3BAEH 1V7MH 1OQOA 2WTOA 1WHOA 1IT9H 4HQQH 3I6KA 4AM0A 4JRYB 1IAIM 4X98A 3S36L 3LMJH 2ZP8A 5HI4C 1XF5A 4Y89A 5DHXB 1AZRA 1WCBB 3QBTB 5FM8A 3X1EA 4L1LA 2NT1A 4QRSB 5FV2A 4L1SA 2JB6A 4BKTC 2VXUH 1JZGA 2YQ2A 2BY1A 5ICXA 4MB4A 5SWQB 5DUBB 1XVSA 4OLZH 2OMXA 1E50A 1ZIBA 1OP5H 3P77A 3PDGA 2X4TA 1UZGA 2N7AA 5EA0H 4LHQB 5B22A 4WFEE 4HIJA 1NFDB 1U95B 4OLYH 3STBA 1UXLA 1JGLL 3W9EA 3GXPA 3T1FB 1UM4L 3HMXL 1RPKA 1BEYL 2QVFB 3EJTA 5EB9A 1DE4A 5EPMB 5A7EA 4MDIB 1F8TL 3BWUF 4MQ7B 3U0WL 4L4TB 1A4AA 4ANKA 2E9WA 2F0CA 1IGIH 1AJ7L 4B9PA 4N1CA 3ZZLA 2VXSH 3MLUL 5D2LB 4YWGL 1PYWB 5DQ9A 1F5WA 4MNQA 3KW8A 1NBZA 4UT7H 2YEQA 3MROB 1UWYA 5JPMB 2J25A 2Q10A 3MCG1 1CFNB 4NUQA 4MD0B 2IPKA 1HWGB 5HGDB 2IDTA 1NCAL 1ET7A 3QNXB 4KH2A 4PQXA 5DFVD 1C5BL 4K9EC 4O2FA 3LDBC 1UB5A 3L6FB 3R18A 2ZCHH 1AY1H 1P84J 3PS6A 2J1KA 1DP0A 3OC8A 4XO9A 1YMMB 2YXVA 4PLKC 2DF3A 1EJOL 1G7PA 5GHWL 5L4FA 1Q90A 3QDGE 1CFSB 1RZIA 2UZXB 1ZS2A 1AD9A 1S5HA 4R7LA 5E2JA 5LCVL 3SKUD 2IAMC 4AYEC 3W38A 3WE1A 4ABWA 5I1LB 2CLRA 3ET9F 1DL7L 3AM8C 2WXLA 4UV7L 2CCVA 4X5PA 5DJ0B 5HI5C 5JHLH 5F71A 5ACLA 5C0BE 3L4VA 3KWVA 2AJXL 4CVZB 1JHKL 3ZYJA 3KPMA 3OHXB 4HS8L 4KTEL 4AEHH 1MAKA 2BVYA 4UNIA 5CBEB 4YEFA 4K94H 1S7WA 3PDOA 3B4NA 1V7NL 4TLSA 3B2DC 4YO0B 1EAJA 1JZHA 2Q7AA 2F53D 2J4WH 3LXAA 3IJ9A 3ARDB 4HDIB 3DX3A 3EJYC 5D1ZA 1FYHB 1WICA 5F7DA 3X2QB 3QIBB 1S7XA 1AS6A 3PNWA 1YMHB 4P9HL 5LG1A 3AXHA 3RURA 2WLHA 1XR8A 4R3SA 5F7UA 4EIGB 2VC2H 3AITA 3Q3GB 4LOUC 1MFAH 2MCMA 3BESR 3KR3H 3TO2B 4H88L 5FEBA 3TT3H 1BM3L 3L9EA 3UAAA 3IVKA 1U3ZA 4JFHE 4KZDH 3JV4A 2XOTA 2ZXWB 1BJ1H 2W5PA 3UTTA 4PGCB 5EU7C 1IFHL 1R17A 2Z4QB 3LZFL 1IEBA 3V9CA 4X4YA 3TP4A 3U7WL 3NCMA 5IVXE 4R84A 3JXAA 1JXDA 3E7JA 5CHNB 3O3DA 4R8WL 2IOMA 1D9KC 3L2NA 3OKYA 1T04B 2PP8A 3O41A 4MD5B 4JFDB 1AHKA 3NCXA 5AAMA 3IJEA 2LTQB 4JPIB 2JKXA 1FFNA 2H6PB 3VMPA 1TITA 4UIKH 4OM0H 3M46A 2NY1D 4EI6B 1IBZA 3DPBB 2JJTC 3AW5A 5BZWB 3L4ZA 3AS2A 3M45A 5JHDA 4I1NB 5I19H 1KBGH 4DETA 1AGEA 3ZKXC 4NP4H 1CFVH 4JZNA 3RWIB 2LT9A 3VE0B 3KMDA 1A6ZA 2PYFA 1ZDSA 4MNGB 1MRCL 2AEIT 2M8XA 2NNRA 3RU8L 1RK1A 3OKNA 2UX7A 2FVNA 1ZT4B 1VZGA 2WBJD 3L4UA 3N50A 2F8OA 5J57B 4FGMA 4JNXA 4AYSA 1U8LB 4M5YH 5HHMB 4NSKB 3FQTB 3K6SB 5D7SH 3DC0A 3GB7A 2P8LB 4WFFE 1G6RA 4MCNA 2Z1PA 1U2YA 5SWZA 4JDZA 1YG9A 4P06A 4ZMXA 1LEKB 1F11A 1URIA 4MBOA 4P0DA 1AXTL 3D39A 4JJ5A 3ME0A 4HIEB 3FZUC 1A21A 2QADD 2I9TA 3IGKA 3QA3B 1T80A 1F90L 1GGIH 4KKAC 3M6DA 2DI8A 1TOXA 1TNNA 1A9BB 3BW9B 5D4JA 3ZIMA 4HIHB 4XAWL 3WNIA 1H9DA 4ZS7H 2VDLH 1OM3L 5JHAA 4FLOA 4PRIB 2EH8L 1B0RA 3T8XB 3G9AB 2O6FA 2XUWA 4OGQC 3RUGB 3DHUA 4L8DB 2HVKB 2HX9A 2BMKA 2XQ0A 2EDBA 4FJZA 4I4WA 4NYLA 3EOTH 5B4MD 3B43A 4GW5B 2A0LD 1ASQA 4LAQL 5E5MA 4DUWA 3MOQA 1I1FA 2ETWA 2DBLH 3C6SB 5A7BA 3VXRD 3B34A 4V1DB 3UROR 4OZHB 1TKWB 3N1PC 2VJXA 4P3WA 4J3TA 4QRQB 3TJEH 5E1HB 2ORBH 3U36B 1KGIA 4GSUA 2EXTA 4OCLC 3RVUC 3VGGA 3B83A 1T6WA 5AB1A 3U1QA 1CICA 3QIWD 1BFVH 2XWTB 5ANHA 5GS3A 5AYTA 4Z0XA 2UY7A 3NZUA 3CXDH 4YHYC 3D25B 1TZHA 1WFTA 3VU2A 2F6AA 2BJMH 5L88L 4ZW5A 3TVMB 4LLWB 1DQKA 2NY5C 4AMXA 5HD8D 3HNTH 5E2TL 4BCXA 2BOCA 5IQLA 2GBVA 3G3LA 4LCWD 4PYGA 4K4KA 2TRYA 1GGBL 1GZQA 1H6EA 4AE0A 1HHKB 5DD1H 3VI4A 1CLVA 3MYZA 4MA8H 4UDUA 3R8BB 4HXAL 4JHWH 4AG4L 1KV3A 4GS7B 1M7UA 4YAQB 3S35H 4PRHE 3WEOA 5CGTA 3K7UA 4Z7UF 5EORL 3DI2B 4ODSL 2NPLX 2LLGA 3OMZA 5BRZE 1FYTB 3AJ7A 4OJCA 4ESKA 5K9JL 3A22A 3DIDA 2PP7A 5JQ6L 1D5BA 2DLTA 3O6LH 2EEAA 2XG5A 4S0SD 5E9DA 4ZFQA 2BSRB 3BHBA 4WENB 3RL2B 3NCYS 3BN9D 1ZT1B 1U3HC 2YD3A 4JKPL 4YDIH 1S5IH 3HC3L 2UUDK 1XD0A 1BV8A 4ZI8A 4P2RA 5C2BH 4W4OA 3RZCC 2AK4E 2Q8AH 4GRLA 3P3YA 4EN3D 2KZKA 3CLEL 3RQ3A 1I8LC 4XVUD 1BVOA 4PRNA 4XVSH 1FN4A 3GGWB 3QI9B 5DDHB 3TZVA 1HK6A 5AYUL 1YNTA 1ZLVH 5I82A 4J8RB 1KNOA 2E7MA 3MQIA 1EV2E 2UXVA 4NQEE 5BS0B 1A7NH 2FBOJ 1A1NA 1NICA 4FNRA 1ND0A 4WI0B 2AXHA 3GHBH 1P9MA 5IJKA 5IMMB 5FOBA 2ESVD 4ZAKB 3UC0H 3ZE2F 4FN0A 2QVIA 1T7WA 5CZVL 2AQQA 2VDQL 1FCGA 1NOAA 1F58H 5DS1A 1KEMH 3WFHA 2VB5A 3QXTA 4ELMA 4EE2A 3AROA 3PV6B 5F89B 5DZAA 3S96B 2XI9A 1RERA 4Z7NF 1BREA 3G04A 4O51B 3FQ4A 4PSRA 1BGXL 2JCCE 3GF8A 4G1MA 2JK5A 5JW4N 3D06A 3RI5F 1XSKA 3WMSA 1P5UB 5DHDA 4DW2L 3PWPB 4OCXL 1JK9B 1RJLA 2BS9A 4GQQA 2XTJD 3V9FA 4ADJA 1SEQH 3FQWB 5E6UB 1GYAA 3IRZA 1E4WL 3MLVH 4K3JL 5A2AA 4LO9A 3IS0X 5EO1B 4HHGA 1Y7VA 3UL4A 4E9LA 4HUUB 3E3QE 4UIMB 4R7NB 1KCVL 1L6PA 3MUGA 5L2KE 2IDFA 3PP3H 4RRPG 4X6DA 5EOQH 1JOIA 5FO2A 1GMEA 3HLAA 1T5WB 4JFXA 1E42A 2X4PB 3MKGA 3CV5A 4PJ7B 3SZ6A 3D0LB 1G5AA 1Q9LA 4EI5C 1FFOB 3PAZA 1E28A 5HVWA 4IJ3C 3SQBB 1RJCA 1JS4A 1XL4A 4XCFH 2AFNA 1AR1B 3L45A 4XNUL 3ZHNA 3KPNB 4ILDA 4Q9QH 3GHEH 3CSYB 4P3DB 4FERA 4LIQH 2DQCL 3O6FB 4AQZA 2CMRH 3B9DA 4NFCA 1HHIB 2NXYB 3C5XA 3JWDL 1R5VB 2CK0L 3V0AC 3LX9A 2CGRH 4WV1A 4CAGA 4L9LB 2X3CA 1J48A 4WI7A 1SLUA 5KSBA 3ZE1B 3ELAT 1EZVY 4DN3H 3V95A 3PPEA 3TO4B 1KYOK 5B8CA 4N3UA 5E8EB 1CE6B 1QI5A 3ILDA 3NSJA 3DRTB 5T3XH 4ZMQA 2GK0A 4HJGB 4QKTA 5AW5B 1QFOA 3VFOA 1YEFL 3NCJH 3K71A 3L7FA 3RY6C 3B9KB 4R7VA 1ZLSL 4C58B 3MLXH 2VDOH 5D71H 5IOPA 3DO7A 3VFRB 4NKOB 1I53A 2JXMA 4F9LC 2MNWA 3K8LA 4K5PA 3PHQA 3C2AH 3RNKB 3FRPB 4Q6IA 1R24B 4HK3J 3MR9A 5HY9A 5E6IC 1SEBA 3B2MA 3F64A 3NCFB 3O2VH 3FQRA 5GS2D 2VR7A 5D2NB 5A43C 2A4ZA 1YN7A 1JZ4A 3O9WA 4EIUA 5GSRB 2X42A 5D93C 3C60C 1FAKT 1KCBA 1RUMH 2V8MA 4OAWA 5PCYA 4QRRA 1P4IH 3BGFB 4H20L 3HMWL 4R5TA 4X6EB 4YXKH 3X13A 3D07A 4LSTL 4HIXL 1BEXA 4XPGL 5KG9B 4N22A 4P5TD 2Q3ZA 4X80L 3OZKA 1ORSA 2KERA 4R4ND 5CP7B 3LD8B 3RWJA 2MPVA 3HG3A 2P52A 5DK0B 4F8OA 3WY4A 3K4DA 1U8JB 2R1XA 5CIPA 1IC7H 1AZNA 1QRNA 2PR9A 3ARFD 2OP4H 3ECUA 1L9RA 2FT6A 4LIQE 4G83A 5T3ZH 1BQHB 1FL3A 4F7PA 2AS5M 2W94A 4AENB 4PCKA 4PJAB 4XXWC 3PE9A 3SBWA 4JFED 5F9DC 2ICWA 3EO0B 4NKMA 4ZX5A 5T3XE 1FO0H 4GEIA 4OFYA 5DHVB 1ECZA 1UM5H 4M8QA 5FWRA 3ZTCC 3QZBA 1UXMA 2O5ZL 2DH2A 4LRIA 1WJ3A 3UZQB 2XWJA 1X9LA 4AQOA 4WTQA 5DO2D 1Y18A 5HHVH 3LAFA 3GJEA 3HS0C 2O6DA 1DVFC 3US9A 1YYCA 1NEPA 1YC7A 2B5IB 1QNZL 2QSCL 1KPRA 5CSGA 1A6TA 2WAHA 3D34A 2WQXA 1LP9F 2YD0A 5DF0A 4N2GA 1AP2A 5DJZB 1FL6B 3MJ8A 4N5EC 3ISWA 3QZWA 1TJHH 3THMH 5FUCE 5J12C 3D2UD 3BUQA 5GGRB 4HU8A 4L05A 4JLRB 4UNUA 3S4SA 3PQYB 4XH2B 3MRBA 5I17B 3K6DA 2AXJA 3LEVH 1VZHA 2NY4D 3EH1A 3FUIA 3MBWA 1DN2A 2V33A 1ZHBA 3QRGL 1NUDA 3NZHL 4LSRL 4C4UA 2XSKA 5FHBH 3G6DH 2K7QA 1GA2A 4JS7A 1KCRH 4JGMA 1JYNA 4JG0H 4AK1A 4C4KT 4L3EB 3K46A 5T3ZE 4FX5A 5J4MA 3LN9A 1EAQA 3L4XA 2F74A 4RRPM 4N2AA