3NJGA

K98a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTAFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 19
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njgA00
2BO0A 2GC7C 1XMEB 3PXLA 3H56A 2IWFA 1AS6A 2PPFA 3FT0A 3S3BB 3T9WA 3NP4A 1A4BA 1GS7A 3SBQA 2XX1A 3OMAB 1GY1A 1NPJA 1KDIA 3FSWA 1KYAA 2UXGA 1L9RA 3NSFA 3FQYA 1JZEA 2EINB 3H4FA 3NJKA 3ABLB 1ID2A 1A4AA 2P80D 2CCWA 2WSDA 4YSDA 4F2EA 1GS6X 1BYOA 1AZRA 4KNSA 3NSCA 1HAUA 4KO7A 2H3XC 1N68A 3X1NA 2CUAA 2VMJA 3FPYA 1PLBA 1X9UA 4GP8B 1JVOA 1W6LA 5PCYA 4DP4X 1ZDQA 1PF3A 1MZYA 4YSCA 4A2DA 2IDQA 1SHWA 2J55A 2GSMB 2XV0A 3DKHA 4UANA 3TASA 1NIBA 2QDVA 1HFUA 3FQ2A 4YSEA 3KW8A 2HX9A 4CSZA 1A3ZA 3EHBB 4FAAB 1MZZA 1ILSA 3PCYA 1M57B 1L9TA 2YAHA 3T6ZA 5B1AB 2BWIA 1JOIA 1JZJA 1J5CA 2XU9A 1CC3A 2CAKA 4G7SB 1AAJA 3AG3B 2FT6A 2VM4A 3IN0A 1ASPA 1PZAA 3FU9A 4Q8BA 1GR7A 1NPNA 3ZX1A 2XWZA 3MX0B 4MFHA 4HIPA 3IN2A 1URIA 1JZFA 3PAZA 2PPAA 2IAAC 2YQBA 1AIZA 2PPEA 4GYBA 2EIJB 1T5KA 1WA1X 1GW0A 2XV2A 1SDDA 1XB3A 4DP9X 3WIAA 1AACA 3UADA 1CURA 1ZIAA 4E9RA 5I5JA 1RCYA 1MDAA 1JXFA 2Q9OA 1E5YA 5FC9A 2BP8B 2W8CA 3NJGA 4E9VA 1MG3C 3OM3B 2YAPA 1KDJA 2FJSA 1GYCA 3WI9A 1NICA 2FTAA 3QJTB 4L0PB 3IE9A 1TU2A 4FA7B 1BYPA 2GHZA 1L9QA 1RKRA 1BEXA 2PP7A 3EH5B 3FU7B 3U25A 1JXDA 4PCYA 3NJFA 3OMNB 4ZK8A 2GI0A 4BDVB 2GB2A 1CYWA 3AG1B 5I26A 3KW7A 1L9PA 1PAZA 2TSAA 4A66A 5D4JA 1AR1B 2BW4A 1E30A 3BVDB 2H5UA 3QJRB 2PP9A 2R7EB 5F7AA 2FQGA 5IY5B 2DY2A 2XUWA 3PPSA 2AFNA 1E67A 3JT2A 1IBYA 3S3DB 3N2JA 3N55A 5LDUA 4YSAA 3X1GA 3SBPA 1J9TA 1M9WA 1PZCA 2BZ7A 4BWUA 4DP0X 1OV8A 1PCSA 4A2HA 1ASQA 1NINA 2AZAA 1AS7A 1TEGA 2PCYA 3QJVB 4A68A 1KCBA 1M56B 2VM3A 1ET5A 2UXVA 2OJ1A 2PCFA 2FT8A 2Q5BA 3FSZA 3MBWB 3ABMB 3S8FB 3NJJA 3GDCA 3WNJA 4E9TA 1PZBA 3D12B 3GXUB 3UABA 2EIMB 5B1KA 1FA4A 3ABKB 2GIMA 4TXVB 2I7OA 6PAZA 1BXVA 3ASNB 4DP7X 2HXAA 2JKWA 1TEFA 4YSRA 1AS8A 1IC0A 1ZIBA 4G7RB 1SHXA 3UAAA 1SF3A 2A3TA 3G5WA 4QLWA 1EZLA 2W88A 2HZHA 1NWOA 2VW4A 4KOBA 2YXVA 1PMYA 4E9YA 3H4HA 4WKXA 2B3IA 1F56A 1NIAA 3UAEA 2DYRB 2GC4C 1J9QA 3FU8A 2BP0B 4KNTA 2ZWNA 1BQKA 4M3HA 2Y69B 2FQFA 4QKTA 1UATA 4ENZA 1BXAA 4G70B 2YAEA 1OOWA 1FFTB 1RZPA 3NT0A 5I6PA 3TBBA 3AZUA 4KO9A 5D4IA 2XLLA 2YAFA 1PNCA 2JXMA 4DPCX 3NJHA 1NIEA 3TA4D 5AZUA 3X1FA 2ZONA 1AG6A 1SNRA 3FS9A 3FSVA 1N70A 4YSQA 5I5MA 1WS8A 4HCFA 2QPDB 4X4KA 2YARA 5D4HA 6PCYA 1OE2A 1HAWA 3X1EA 3ZIYA 1AQ8A 4NAJA 1BQ5A 5EHFA 3FU7A 4G72B 4N4YB 2J56A 4KO5A 2MRYA 3CZUB 4HALA 4E9QA 1NIFA 3PLYA 2IH8A 2OCCB 3NJMA 3WKQA 5B1BB 3EF4A 8PAZA 3ZDWA 2OV0A 2IH9A 2J5WA 1JXGA 4YSSA 1NWPA 3AW5A 4JKNA 1SDDB 1A8ZA 1ASOA 1RZQA 2BHFA 4UAHA 3CDZA 2DWSA 2HX8A 4YVNA 2ZXWB 4BXSV 2PP8A 3T71A 3NJIA 5AKRA 3CVBA 3NP3A 1AZUA 1BXUA 4E9SA 3UACA 2I85A 2DYSB 1AOZA 2YAMA 7PAZA 1BQRA 4DP2X 5E9NA 1PLAA 3CDZB 2DWTA 1OE3A 2BZCA 1NTDA 1FWXA 2I7SA 2IDSA 1V54B 4W9ZA 3FQ1A 1KBWA 1GS8A 3CG8A 2RACA 3UGEA 3AG2B 4AKPA 3WNIA 1AG0A 4A2GA 1OCOB 1DYZA 1I53A 3AG4B 3NJNA 4EF3A 3S8GB 2CALA 2PPCA 4G7QB 5AFAA 1DZ0A 1ILUA 2QDWA 1MG2C 3V9CA 2XXGA 2BWDA 5B1JC 1IBZA 4JHVA 4GP5B 3CVCA 2HRGA 1ETJA 4HAKA 3S3CB 4YSOA 3X1BA 4N8UA 3GYRA 7PCYA 2XYBA 1NZRA 2UX6A 4HCGA 3WG7B 4DPBX 3EH4B 1X9RA 4RH4A 4DP5X 5I6NA 4E9WA 1OE1A 2NRDA 4A67A 2VSMB 2UXTA 2VW6A 4BXVA 4CSPA 1AZNA 4AZUA 5F7BA 3L45A 3PAVA 4A2FA 1ET7A 2UX7A 2MTAA 3QJQB 1ZPUA 3OD3A 5B7FA 1ZV2A 5B7EA 4HHWA 2IDFA 4M4RB 1SF5A 3SQRA 2PLTA 1EHKB 1W8EA 5B1JA 4F2FA 3BQVA 1QNIA 2VN3A 3X2QB 1AANA 5A7EA 2QT6A 2EILB 2XVBA 2DV6A 4PAZA 2EIKB 3NYKA 4NERA 4E9XA 1GY2A 1XB8A 2Y1AA 1WS7A 4AKQA 1ADWA 2E86A 2LLNA 1SFDA 2AANA 1BAWA 2YAQA 2P80A 3T6WA 5I5IA 4G71B 3PAUA 4P5RA 2GBAA 4GY4A 1YLBB 4WTQA 2FNWA 4AKOA 2XX0A 4DP6X 2HX7A 3DTUB 1VLXA 4P5SA 1ET8A 2CBPA 1XB6A 1WAEA 1PLCA 4YL4A 4DP8X 4K9JA 1IUZA 1SFHA 1QLEB 1J9SA 1JVLA 1NDTA 1L9OA 3AY2A 3FYIB 3T6VA 2JFCA 1KGYE 1J5DA 2TSBA 2J57A 3OQRA 3NJLA 1JZIA 2WO2B 3IEAA 2H47C 3OMIB 3FPXA 2CJ3A 2BW5A 5I28A 1CYXA 1JZGA 4HCIA 1JERA 4NB7A 4YVUA 3T6XA 1KCWA 4AX3A 4BDVA 5I6LA 5TK2A 4DP1X 1A65A 2YXWA 2BP0A 3QQXA 4KNUA 4DPAX 2XV3A 5ANHA 2N0MA 2WO3B 1A4CA 4YSTA 5B7MA 2XXFA 4HHGA 1IKOP 3SBRA 2ZOOA 3JTBA 2AZUA 1E65A 2QPEB 4HZ1A 2IDUA 4JHUA 2BP8A 3TU6A 4AI7A 5I6MA 4BK5C 1E5ZA 2YAOA 1B3IA 1PNDA 2FT7A 3ASOB 1OF0A 4A2EA 1NIDA 3HEIB 1SJMA 1L9SA 4UF7C 1KBVA 1ZDSA 3NSYA 3QPKA 1PY0A 1QHQA 2HRHA 1OCCB 1AZCA 1OCRB 4YSUA 2B08A 1CUOA 3HB3B 3EH3B 2IDTA 2X87A 1WA0X 2HLEB 2X88A 4GP4B 4KO6A 1KV7A 1OCZB 3V9EA 1J9RA 5TK4A 2PPDA 2VSKB 3QJUB 3C75A 4KOCA 5B3SB 1GSKA 3WKPA 4BWTA 2FQEA 4Q89A 3NSDA 3ERXA 4GXFA 9PCYA 3QJSB 5I6KA 2FWLB 3IBOA 3DIVA 3CVDA 3ZBMA 3TBCA 5I6OA 2AVFA 1JZHA 2FQDA 3FSAA 1AZBA 3ABGA 3RYMA 4F7KA 1WA2X 2R7EA 4BWWA 4YSPA 1V55B 1R1CA 1W6WA 4W1TA 1V10A 2VW7A 5PAZA 1TKWA 2IWEA 3FYEB 2IWKA 2UXFA
chains in the Genus database with same CATH superfamily
3EZ8A 3WIFB 2P5WD 1E9PA 3X12B 3E6FB 3ZQWA 3PXLA 5IGXH 1DR9A 1GHFL 1LHZA 2EC9U 1AS6A 3V6FB 5KJRL 3FTGA 3KPNB 4ADGA 4OJFL 1G1YA 4N6RB 1YQVL 4YMPA 5IHBA 1KTDA 1Z3GL 1S9VA 4C58B 3EOBB 4LT7A 4NQDD 4KI5E 1ZMYA 1H3GA 4AMXA 2X4NB 1XSKA 4ZAKC 3TT1H 4G8IA 5EF1A 1TNMA 5C8JA 5E5MB 3QR1A 1FV1B 1OTSC 4DK5A 4GKZB 3EJCA 2ZAHA 1U6AH 3L1OH 4Z7WE 3F3HA 4KNSA 3BQUB 4PRDA 5H8DA 4KO7A 2Q3XA 1YQVH 4D8PB 3DYPA 3VRJA 4JQXC 4OCSL 1JVOA 3AREC 1VENA 4UIKH 4NQCE 4MA7L 1F2XK 1MZYA 1VACA 2WVSA 1G43A 4I89A 4PJAF 4MNHB 4P2QE 1X5XA 5ICYA 1IZKA 2G75B 3VXOB 4A7GA 4NRYB 4QT5A 4XB3A 4DT2A 4DIXA 4QF1B 35C8H 4OSUH 3RFZC 4R83A 1ITBB 4ZX6A 5L4JA 1BIIB 2R4RH 4BQ8A 2OXHA 3MV9D 5LVEA 1YPZB 1FZJB 3ZZLA 4UINH 3WY1A 4MJ5B 1S7QA 3D05A 3I6LE 2XSKA 1QRNA 3MTXA 3WFEH 1WUNT 1ZA3B 3SODB 5IIEA 1TFPA 2VZUA 3IJSB 4C54A 4RMSA 1CE1H 2YBGA 4ONGH 2JKJA 5BRPA 2MJWA 3K72B 4LFHD 1UM6H 1DFXA 2X38A 5F9DC 5C1MB 35C8L 3EJSA 5ILTL 3TPKA 4PS3A 2FO4A 1PX8A 4PLOB 3QFJA 2WXNA 3CC1A 3KYNB 2X1WL 1RERA 5E1AA 4C47A 4EUPH 3DV4A 5DD0H 4HKXA 3VRJB 1GZQB 1ZV5A 1G9HA 2HN7A 2CJUL 3K6NA 3WS3A 5BJTB 5I1HH 1Q9KA 5IHWA 1XF5B 1ORSB 5F70A 2WTPA 3ATDA 4HT1H 5FC9A 2W8CA 4PV9A 3BIKA 2XA3A 4X4MA 4L8BB 1OGTA 3K74B 4FL4B 3L4XA 3J27A 3N3EA 1KTDB 4GAFB 4IMKA 3IE9A 3RG1C 1TU2A 5FYLD 1DDHA 5HYSG 1K5WA 3DIDA 4JJ5A 4PJGF 3WLBB 1BEXA 5ICZB 4ABWA 1AZZC 2VN7A 3D25B 4L3EB 4Z3JA 5F9JB 1NCHA 2GI0A 3HRZB 3NGBB 4UQAA 4X9GA 5TH2B 3DTDA 3TCLA 1U3NA 3K6DA 3GT6A 2BW4A 4XGZB 5DVOA 1IEBB 2ZYHA 5HHVH 1RSFA 2HCZX 2YWZA 3GXDA 4PW9A 5CLTA 3UBXG 2HYMA 4PW4A 2B2XH 3MRJA 1QUNB 4JREB 2VXTL 5E00B 3N2JA 4KH2A 5FGRA 5GPRA 5HP5A 4NENB 5MENA 1TJIL 1EJ6A 2XWEA 5HHMD 3UTZB 3KPLB 2W65B 4M56A 4X9IA 4WSKA 4D0BA 3LMJH 3BP5A 3LEVH 4XPFH 4G3YL 3DXAD 5DQDH 5DJ0B 3KCWA 3NACH 1DBKH 2ATKB 1BBJB 2ED8A 3HS0A 3SGEH 4ZAKB 1B90A 1FPTH 3PWVA 4YWGL 4K23H 5IJKA 2NNAB 5B1KA 1JZDC 5GGQH 3TEYA 2K70A 3WFBL 3WE1A 6PAZA 1NBYA 1BYNA 1SVZA 4NI3A 1VFMA 4N25A 5MEPB 1IEAA 1A5FH 3C5ZC 3UAAA 2HTLD 1SF3A 3SDCC 4AEHH 4KKLC 2DMCA 1A6TA 1H6FA 1JWSB 2LFEA 4GKSB 1E2VA 4U4BA 3V0VB 4PG2A 3KLQA 3H4HA 3LZOA 4L3AA 5KSBF 5F1SA 4KKZA 1TYJA 1J9QA 3ZXAC 2XFXB 5INDB 3ILPA 1S7SA 1XH3A 5I2IB 1U8OB 1PX3A 2YAEA 4TL5A 4AENB 5E08H 4AEHL 2YRZA 1QUPA 3PHAA 2QHRH 4BUHA 5IREA 1NGXB 3DX2A 4CMMB 5I0VA 3EJUA 4JZOA 2I5YH 3MV9A 1EGJL 1UXLA 5D7SH 3HZMB 4TVSa 3X1FA 2NYKA 3B7TA 3X13A 1AC0A 1HSAA 4H26B 3NEEA 5DHEA 3NZ8B 1U33A 4YHKH 1TSRA 5L8KB 2NW3B 1NC4B 4W9EC 1H3UA 5T1JA 3AU1B 2P49B 4AUYA 3GSOA 3VXMB 2J25A 4ODWB 2QADC 4DGYH 4NAJA 3O45B 3KJ4B 4I1PA 1KIPB 2EYRB 1SYSA 1ZHLA 2X70A 4ZMVA 3CIQA 1YDPA 4P2QD 3GBNH 3KH3A 4HWNA 4P48A 3GO1H 3R8BB 2BH0A 4EUPB 4LOFA 3F5WB 5B1BB 2XQBH 5JW3L 2N59A 2ATPA 4CW1A 1L5GA 2IPUG 1TITA 5K1JA 1MHCA 4MXWH 4X6DA 1PIGA 4F91B 1S8DA 3RZCC 3NSXA 3NIGB 3QUZD 3AW5A 1UD8A 2P8PB 1SEBA 3I6KA 4IBQA 5F0PB 4K94C 3WY2A 2OMNA 1IM3A 4PJIF 4R7NB 3DNKA 4OI7A 3J07A 3ESVF 1FFNB 4QTIL 2DQEL 1XSOA 4DKFH 2NQ3A 5C09A 3GO1L 3VXUB 3UACA 2ZCHL 4K3DH 5FF6B 3UTSA 1AVAA 5HDBF 4DZ8A 4UQ9A 3BP6B 2WD0A 2Y7NA 4QHPA 1R34A 3IS0X 4TOYH 2W9EL 3P9MA 1BQRA 5L7XH 4U2ZA 5FDWA 1QEXA 1T5WA 5A2CA 3BLPX 2WO4A 4FLSA 4WUUD 4G6JL 4MAZA 1QLEH 4KMTL 3VQMA 3QDMA 4YBQD 3ZO9A 3QAZB 4DKFL 5G4NA 2EKJA 1K8DA 1Q0EA 3IDIB 4AG4L 2WKOA 1BZ9A 4QXUH 4RFOL 4RGNB 1XZ0B 2JKXA 1KG0A 4PLKC 1EZSA 1N2RA 4EUPA 2NNCA 1F3JA 3QQ3B 3EIFA 2DQUL 5ACLA 4F7MA 5FOJA 2CALA 1FFOA 3PFUA 4IKKA 5EOCL 2R0WH 4L2YA 3ROLB 4H20H 1E5AA 4G8FB 4XN2A 2CKBH 4NNXA 4YDIL 5EN3A 2ZICA 3MHZA 4Y1AD 3FO2B 3EFDH 4QHKJ 1UCBL 2BXZA 2FR4B 1QSEA 4L9LA 4MNGE 5JXEA 1KTLA 4NPJA 1HSAB 4MAYC 4G8GB 3E3QE 5E03A 3V4VL 3MRGB 5BCAA 4S2SA 2WOYA 3KPRB 3BKCH 5SWQB 3QZLA 1NCIA 2JXMB 3L45A 3PGFL 4N2NA 1NDMA 4RSVA 1DBBL 5D93B 2OXGA 3VDCA 5D1ZA 2CBMA 1U8JB 4ICXA 3KM1A 4NBXB 4GEJA 2P5EA 2FNBA 4L5FH 2Y4SA 4UB0L 5IVXB 3IFOB 4JO3L 5I16A 1RIVH 4JB9L 1SEQH 3U9UA 1P7QA 4PRPA 1QNIA 3Q3GB 5FECB 4IDLA 3TA3D 1Z1WA 2AJSH 3ULUL 5EIQA 2IGFL 1GYVA 2DV6A 2XBZA 4TYUA 4NQEA 4UT7L 5IVXE 4ANWA 2N4IA 1X7QB 2EP6A 2VABA 2WLZA 3DTXA 1JAEA 5D96B 4UB0H 2PCXA 3G7TA 2XZZA 4PJ7B 3DC0A 5KW9H 1JGDB 1SEQL 3S34L 1D2PA 3CSGA 3JWDH 3QHFH 3RGBA 5L2JB 3FT4B 3GHPA 4PMFA 4GY4A 1RUKH 2WV3A 4X7CC 4HIJB 1R46A 1YLBB 2VWEC 3MC0A 4NHCH 2NY5L 1K5NB 2J8HA 2BVOA 2RGSA 4HJGB 3OZ9L 2XN9E 3HI1B 3GC3A 2OLDA 1GCFA 1HWGB 5CZXD 2R2EA 4UT6L 1CU4L 1Z3RA 2QQLL 4L1HA 2AJYH 2PW1B 3B2UD 3MGOB 3RGVA 3S34H 4D0BB 2QL1A 2VL5B 5LN4A 3L3GB 1RJCA 1XR8A 3VRIB 1JSYA 3QUMH 1G0DA 5AALA 3MXVL 2AS5M 1J0IA 2FWSA 3FUJA 4DGVL 3FFCB 2ETWA 1UB6A 3ULVE 3EGXA 3ULSA 3GSNB 3KAAA 4WHTA 2QPUA 4JHZA 3Q1EA 3RBSA 3QXUA 4HKBB 1MJUL 4XWOC 1TQSA 2OJZL 5B39A 4PWJA 4HDIB 4UMSA 1NUDA 25C8L 2LU4A 5LBSH 2F68X 3M1CA 2A6IB 2HT2D 1EXUB 1YCSA 2BFGA 2E6QA 4NUJA 1JK8A 4X42A 4DP1X 5CZXC 3BJLA 3MGOA 1KGCE 4LCWB 4LL1A 1P2CB 4WVRA 4U1MA 3RGVB 4F15C 2UYLB 2R29A 4UZSA 5E2TL 3OR6A 1A4CA 4JK0D 1I9RH 2QVTA 3EGSA 4V1DA 1LL1A 2VO8A 3B9KD 3GIVA 2J71A 3QUYC 4G6KL 1UADC 4I4WA 4IDJH 4HXAH 1JYNA 5DMGC 1I8IA 5HYJB 3ULSB 4Z7NB 1OF0A 5JOPD 4JFOB 4KZEH 4M5SA 1RL1A 3UTPD 5JYMA 2WBJA 4HKXB 2WUCH 5CP7B 3DJ9A 3CPLB 1LE5A 3C8KA 1WFNA 2H6UA 4YSUA 1KLUB 2DQIH 3EAKA 4UQIM 3AXLA 2IDTA 3MUUA 4FXGC 3Q01A 5CZVL 4CGUB 2PCFB 3TBYB 3DI2B 1N4XL 5CJBA 4XO4A 4Q14A 4LQ1A 1HINH 3HBPA 4O5LH 4FTVA 3US1A 3QUKA 2AJZB 4JM4L 5AVZB 3UZQA 3EADA 3GD1C 4HWBL 3D4YA 5E2UL 3MA7A 5IVXA 4OZFG 3HZYB 3CZFB 2FL5A 3DIVA 2MKWA 4QEGA 2GJ6B 2OMUA 2R2HB 4Y16C 1KBBA 3OZKA 1E8WA 2NZ9D 3UJIH 3C9NA 4MQSB 3QR2A 4O5LL 4KMQA 2F54A 3FO0L 3IXAB 3KDMA 4MJ2A 4P9ML 3TLRA 2VW7A 4EI5B 4HH8A 1NWPA 2Y6SD 4OD3H 2GC7C 1A7QL 1MY5A 1NBCA 4G7YL 2I60H 2J4WL 2X9WA 2WJ7A 4Y1AE 5ESAA 1Q0YL 4AYEC 3IDXL 2FJGB 2ZUWA 1YYML 2HJLB 3KWWB 4RA0C 5F1OB 5IF0B 3DX8A 3NP4A 1A64A 5AYQA 5J12C 2CSPA 2FHCA 3KXFA 3CFJA 2QGEA 1JYWA 4LHUB 1IGCL 3ULUD 1IFHH 4OLEA 4KAQL 1KDIA 5DJZB 3SO3B 4ZDHB 3HG0A 1MHPH 3B3IB 3NSFA 3CQQA 2DQFA 1A9BA 4OAWA 1OCWH 1ID2A 3L08A 1F4XL 1W2KT 2DWDB 3IRPX 4XPHL 2ZX8A 2XG4A 4QNPF 3S5ZA 5I71C 1VGEL 4RNRA 2NUTA 2FEEI 2WQVA 2AJXH 4J6RH 3KNBA 1NCAL 3HHSA 3UMNA 5PCYA 2B59A 1ZDQA 4G8FA 5JQHC 1MFCH 5HGHB 3NK4A 2D0HA 2I26N 5A2AA 5H4YA 2Q87A 4JN1H 4U6TA 1E40A 4PRBA 1AZVA 1TOXA 4EDWL 5D1QD 3SQOH 3TN0A 1CLYL 3H53A 4HJ1A 3QZWB 1FNGB 1ILSA 4ZODA 4FL4C 1HXMA 3DX0A 1FHGA 4Q6IC 1N6QH 1ITCA 3QDMB 1JOIA 4N0RA 3MYZA 1QATA 4PGBB 2CAKA 2E7MA 3F05A 4G7SB 4U1JB 3ULVL 4XVUC 2H4EA 5CN1A 4S1RH 1CBVL 2ESVA 1RZIA 2XN9D 1OF2B 2DQ6A 2G3MA 3G08B 3ECWA 3V79C 2XQYG 4TNVK 4J4PA 5KYUB 1PZAA 1UKSA 3KPPB 1GR7A 2WKOF 3ZX1A 4F24A 1OB1A 1AOHA 3FCTB 4K8RL 3RTQB 1NANH 3EYOA 4WWPA 3CHOA 3ZMRA 3ZYZA 1VFBB 5C07A 1S6NA 4TUOA 1DQDH 2JI3A 2VE6B 3RWJB 4UV4L 1SDDA 2WP3T 1URZA 3K2UH 4WFHD 4JPWL 4AIOA 5BRZD 4OZFH 1C8QA 1NOFA 4ZO6A 4NM8L 3RFZA 3FKUS 4NPKA 1PYWB 4OZ4A 2YEVB 3UG4A 4TSAH 1OAYH 3MBXL 2FATH 3N1FC 3UEQA 4BFFA 2JCCB 2V8LA 5GS0D 2CRMA 3L9YA 5BMFL 1MF2H 1UXWA 3BVWA 4HKJB 3VYPA 2FTAA 3D3VB 2Y1YA 4PP1D 4LCCC 4EN2A 3FU7B 2R23B 2CJUH 5AW3B 1INQB 4PCYA 2A5UA 3DUSB 5F6IC 5IB4B 1C16A 1YNLL 4TQPA 4EZLA 3QEGH 3APMA 3STZB 1MCWW 2ZAGA 2X4SA 1HL5A 1FGVH 1RK0B 5D4JA 4ONFL 1E30A 1KJ3L 3QIWA 2QTEA 5EF0A 4OFQA 3SE6A 5J6HA 4QRRA 3MO1B 3QISA 2X6UA 5CJOH 4EIZC 1QHPA 3FCGA 1YEIL 3H9SB 3II3A 4GO8A 1SBBA 3FO1A 2X44D 3TZVD 3GB7B 1CO1A 3JT2A 1IBYA 4NWTL 4JFWA 4G6FB 4MA8H 1LQBC 3LZFL 1QBBA 2YPVL 4XWGH 4KHTL 1OV8A 2GTWA 2W07B 5KSAC 1GRWA 3S6CA 3GJFA 3HR5B 4X5RA 3PS6A 5DVMA 3C09C 4K7FA 4M6AA 1NCWL 2G4EA 4JL1A 2YZ8A 4JFQA 1KJVB 5DD5H 2B2XL 4M5ZL 4IEFA 2A7BA 4OGAD 4JDZA 2K8QA 4L9DA 5MENB 4TPRL 4U6YB 5FCUL 3JUZA 3KLDA 1JJUA 5HGDB 1JD7A 2X53A 1P6WA 4LBAA 1I8LA 4P23B 4AW7A 3TO4C 3QQNA 4FFWC 1FORL 1BIHA 4E68A 1PZ5B 3HS0C 4RAHA 4UTBL 2ZX7A 3PFQA 4IRJC 4PVBA 5L2KB 1CB4A 4LVNB 3QORD 4MJJA 4OGYL 1IVTA 5FAAA 1U2CA 2GI7A 4G82A 5GGRY 2XTJE 5AQ0A 4DN3L 4F57H 1NIAA 3FTZA 3K91A 2OTPA 4R2GB 2EKSA 5AB2A 2R56L 2VL4A 4JPIA 4PRIE 4YXHL 4BZ2H 2H3NB 2Y69B 4YHKL 5HHXH 1AP2A 3DYMA 1AIFB 2JJTC 2X2IA 3BMWA 4OQTA 1KGUA 2D7TL 3UIYA 4N2CA 2FSEA 4L4VD 1ZE3C 3TBBA 3MLZL 3MLUH 5GS2H 1MCRA 4DPCX 5KSBA 3T2OA 4NZDA 3WKML 3TA4D 2YA1A 5CXPA 5JW5B 1IEBA 1FFRA 3MBED 4FQJL 3O3DA 3GLEA 3MUZ1 2K4AA 4PJCA 3FS9A 4CGTA 1X5AA 1JCVA 5HBBA 3BGFC 4XMKL 2VKWA 5DZVA 4R4BB 5ISZA 2YARA 3RL1B 2LU7A 2WQWA 2VL5A 3SE9L 5H37G 1V05A 5FIEA 3BP4B 2QTVA 4N3UA 3GI8L 5BV7C 3V5HA 3EO0A 1FZKA 1EGJH 1XMWA 3H6AA 3MV11 4KKAD 1J86A 1RHFA 2OCFD 1P0SE 3LTVA 8PAZA 1M6UA 1E90A 3AMKA 2ITDA 5BS0D 4WW2A 3H0TA 4PGEB 2B20A 3U4KA 4DQAA 5EEZA 1YY8A 3DROA 3MRHA 5D2NA 2WWKO 1YAIA 2UWEA 3ATEA 4W4OA 4N2KA 1SDDB 4OY9A 1T1YB 4YVNA 1NM9A 2LTQC 1WV7T 2VABB 1OY3B 1QLEL 1Z9MA 3NIDE 4R5TA 1Z7JA 2EYSA 3CVBA 4UU9B 5AKRA 3QWNA 3VXOA 3ZTCC 4YR6A 3UTTD 5IHZA 2XWBA 4YAQB 2MOVA 1NCBL 3U2JA 5LG1A 5BO1H 2GIXA 4FG2A 2ENYA 3HG1B 5CCHE 3SJVE 15C8L 4FQPA 3V0GA 2E74C 3FRUA 1EEUA 3G5XB 2AABL 4AQAB 5K9KB 4K3HA 2OXGB 3DVGB 1V3KA 1JHKH 4FHBD 4O02L 3CK0H 5GGVY 4HIQA 2BVUA 2VAAA 3VXQB 1JZ4A 2ZOKA 2EVGA 1CICB 5D6DA 4F8OA 1MFDH 3EUUA 3B2VH 3F7RA 4P5TD 3CFBA 2VJ0A 3E3QC 1T7YA 4TLUA 4WKZA 2ZXDA 4Z0BL 4AYDC 2B7DT 1Y0LB 3KCPB 1IZJA 5T3XD 2AKRA 1JGVL 2VDMB 4KGJA 3V5DB 4FYTA 3S3CB 4AVJA 4H8WL 3HNSH 2WQSA 4CADA 4RX4D 1BD2A 4UOW1 4M1GH 4MZIA 4N8UA 3O8XC 5C0ND 3FH5A 1JS4A 1UOWA 2C9PA 2NX5B 3BZFA 1EHAA 3MRDB 3RWFA 3BMVA 1WAAA 4HK0A 2IAMA 5I6NA 4Z0BH 1EWHA 4KXZH 2ENQA 5EOCH 1LO0L 4N8VG 3F2LA 5CSGA 1AZNA 3BKJL 5FYKH 1IMHC 1T0OA 3VH8G 5D71L 1AYRA 3IE4A 2BX5A 4ABQA 2F19H 2UX7A 3IMWA 4KROC 5HHNB 3W0WE 4Q4EA 2QGCA 5T1MA 2FJGA 4XB8A 1JRHL 5EEXA 2ZYIA 4N0FB 3ROOB 3VYNA 4H88H 5HVWA 5DJCA 4BIKA 2XVBA 2JB6B 1JNLH 3UTSB 5FF6A 4DFIA 1QKZH 2H6PB 1UJ3B 2KHAA 1UC6A 4ODSH 4E9XA 1W9XA 3DETC 3T0VA 3LRKA 5FLUA 5I1IL 3AUWB 3AAZA 4UTBA 3EW3B 3U7WH 5I5IA 1XF3B 1A9VA 2JF1A 5EBGA 3J2PA 3NFNB 3GMMB 3VXSA 2XX0A 2W92A 5I19H 5JXAL 3QUKB 2B3RA 4Z77A 1CDBA 3ZKND 3CFNA 1RJYA 5HSFA 4J3OC 2GT9B 3QIUA 3U46B 1KGJA 5J9PB 1WTGT 4MMZC 5IROA 4PRID 1WAEA 3AXLB 3FRPB 1FNSL 1BBDL 3FB7B 4FZEH 2HFEB 5CCJA 3FHQA 1BF2A 1N10A 4F1SA 3DA0A 1S78C 1UA6L 1RZGB 3K1KC 4YE0A 2NMSA 4L4TA 4Y4HC 3WEXB 1A25A 5CHNB 3N0AA 5L9DL 2QEJA 5C0BA 4AV0A 4N2EA 2CLZA 3R4RA 4HMDA 1LEIA 1IJNA 4WFFD 3HBZA 3WD5L 2PYEB 4AH2A 3OMIB 3FPXA 1IQWL 4KXCA 2WZPD 1ZGLA 2YLHA 2BM3A 3BPNC 4KRLB 1CYXA 1GVIA 2CGYA 2WSPA 1U8OA 3WJMB 1N26A 2OCJA 2F61A 2Q86A 2ZKYA 4AEFA 3HG1E 5FYKU 4AX3A 5I6LA 1FO0B 4Y7OC 4NAMA 1OGAA 1WFJA 3HAEB 2YPLE 4AXWA 4NUJB 4G80B 4TVPE 3P4NB 2YGQA 4XVUD 4G11A 1YJDH 1T2QH 4HSQA 3RFRA 3VXNA 1ZHBB 3CFMA 5E6ID 3FQXA 5ES4B 3D3VD 1J5OL 2EDRA 2ED7A 2IH3A 3KBHE 2B5IC 4MZ3A 4Z95L 1T2JA 1FYTB 1OTUC 4N0UB 3MLTB 5BRZA 1R0AH 5LGHH 2YQ3A 1S9KC 4J3OH 4ZNEA 4LSUH 4A7GF 4KXAA 5HYQB 3T5WA 2DYPA 4PIRF 2YO3A 4HQQH 4AYFA 4XBEH 3L95A 1DVXA 1M05A 3LSOA 4HPYH 4CN4A 2L8AA 2P44B 3HB3B 5ISZD 2NLJB 4U3HA 4JFQB 1WWWX 2X3AA 2P9RA 5T3ZD 2OMZB 5DR5L 5LWYH 5LGHL 2YC1B 1FRGL 3HI1A 5K33A 4P9MH 2HT3C 5ESQB 2O6FA 3QUYB 1GSKA 1J0HA 5EU6D 2OQJA 1UEMA 1TQTA 2A77L 4Z7VE 1UTDA 1D5ZB 2FB4L 5FWQA 1OGSA 9PCYA 4N8VB 1ADQH 2PN5A 3KEDA 3A3YB 3N1QC 3PDOB 1P1ZA 4RAVA 4FG6D 1YYMH 1KY7A 4TTDD 5E9DA 2FQDA 2R4SH 5IB2A 3W11D 3AVEA 4UTCA 4JKMA 5GS1C 5EBLA 5LWYL 1AXTL 5F71A 1FDLL 1MCOH 4Z7VB 4R3SB 3J7HA 3O4OB 4HJJH 4Z3FA 4HIEA 3LYRA 4HOMA 1QBLL 5FECA 2ZXAA 1JPTL 4POZD 4FADA 4XC1H 4QUOA 4ZI8A 3BDYH 4XHQA 2JIXB 5KZCD 4RFEA 3ZYJA 4F5CA 2R8SH 2R4SL 4X5XB 4XPGH 3BZEA 1TU2B 3UJIL 3L13A 2EE2A 3HI5H 1IIIA 1ZA6A 4NFCA 5T3ZH 4JY5L 1U8CA 4X7SL 2Y9RT 5DRZA 2W95A 3ABZA 1A4AA 2WHVA 4MCNA 2WSDA 3MJ6A 3MVSA 1J8RA 3X14B 4XC1L 4N6QA 4KI1A 4UIMB 4ENED 4OZIE 3OXSA 4GUOA 2A9NL 5JHDA 1XFPA 4OQ1A 4PRNA 3IJYB 4GRWH 3NSCA 4TTGA 1LO5A 2VMJA 1GGUA 5BPPA 1ZKAA 3VI4B 1YYLH 1FSKB 3G6JE 4IBYA 3N40P 3RDTD 1OAKL 1DJWA 3V6ZB 1G9EA 4UANA 4IGBA 1K2DB 1PD6A 3PP3K 1NIBA 4KKLD 1HFUA 5DRWB 1MJ7H 2BIIA 3CUPA 3CGTA 3HG2A 1SVBA 2A9NH 4S1DD 5IHHA 4NLHA 3IJSA 4K8RH 2EQDA 2F7QA 1RPUA 3M8OH 3K8KA 4OCSH 3RVWC 2KH2B 4KX9A 1JPFB 2CJTA 2EDJA 1F3RB 1BHGA 2F7RA 4U1HB 4H8HA 4LCCB 1OANA 4QOKA 4KDWA 1NMCB 3D85B 4WFGD 4JN1L 2F5BH 3QZPA 3KDPB 4WWNA 1REIA 4EDWH 1SXZA 4BM7A 2R2BB 3BP6A 3Q5YA 1IKNA 1T22B 2FGWL 1NLBL 3MNVA 3QCTH 5ITBH 1J1XL 3IDGB 5TPWL 4FLHA 5F9OH 3TPUB 1PKQB 4NQCB 1V3JA 3FOMA 1DUZB 1DHKA 2EDOA 2QQNH 5DS8B 4WEBL 3HC4H 2K7PA 5LJYH 3CV5A 1XB3A 1TDQA 5L4FA 1VA9A 2F5BL 5I8EB 1DQLH 3ZKXC 2DQJL 1B3JA 4MXVF 4JPKH 5IEKB 5CD5D 4RGOH 5I5JA 1L5GB 1RVFL 2BSDA 2WWNA 3PGCA 3U0PA 3B3IA 1FL6A 4RSYA 3KPSA 3W3BA 2DQHH 4YDMA 2NXYD 4L0PB 5KVDL 3TBVB 3JTTA 4JAMA 1A3QA 3N43B 3P9LB 4HX1A 4Z8FH 1T83A 3BAXA 3CSYB 2CO1A 5KTEL 2V2XB 3ARDA 5FV1L 5CEYA 3QEUB 2YEQA 3BPCA 4MQ7A 5T5NF 5D7LA 1S3RA 4PJXA 5CEZE 1M6OB 3WNPA 4C56A 1UWEL 5HPMB 4ZUWA 1FVEB 3P4OA 1ODUA 1CE6A 4GO6B 4MRBA 1BFSA 4HUNB 3WKYA 5KVDH 5CZKA 2Q8AL 5IY5B 2APVA 1HYSD 2DY2A 3WFDH 1THAA 5F9WB 1QTPA 4PUBL 4F58L 2AFNA 3LH2H 4EOWL 3MRLA 5DUBB 4HC1A 4WV1A 1MFUA 1W8OA 3N55A 4HOXA 1J9TA 1XH3B 4XAKE 2ADJA 4TPRH 2GTZB 2JJSA 2NX5E 2W9LA 3RB7A 1KB3A 2XTSA 3BN9C 5DLMH 1T3FB 5M7QA 4BFGA 4ONFH 2WWOA 4PRPD 1VADA 5EZJA 3VG9B 1ET5A 4KZDL 1QFPA 2H2PC 2OJ1A 4QRQA 4HCRH 5DD6A 1AO7D 3S4SG 3KEHA 4Y2DD 4E9TA 5KN5B 4M5TA 3P69A 4YC2C 3S3SA 5FO9A 3MBEB 2BNUA 4Q7DA 4ZNCD 4XWGL 4QLRA 1XT5A 1UD5A 3TYFB 2L04A 4I77H 1BMZA 5I8CB 1OSPH 5HHXL 3TGXA 4BZ2L 1TCMA 3ZE0E 1ACYH 3H7LA 1QMUA 4G3YH 2YRLA 3KWUA 4HKZA 5HYJA 1A3LH 2NDGA 1I85A 1BQUA 1D2OA 1XH1A 3NRPA 5K59E 2NQCA 3ECQA 1D5IH 4YPGB 4Q4IA 1FL3B 2VC2B 3DGCR 2VDPL 2NUPB 3OXRB 5EZJB 1IC4H 3UAEA 3SYOA 3ROOA 1S9YB 1O7DC 3SKOB 1Z66A 1F6AB 4LAJH 4W9LC 5SV3A 1S9WA 4YIQB 4TNWK 5LAXA 2AXJA 4GAJH 3QK0A 4MMYB 5MI0B 3NT0A 4XX1G 3W9DA 3PRZA 2VAJA 3EO9L 1F4WL 3Q2CA 1DUYA 2AGJH 4G9DB 4NOBA 4IQHA 4UT9L 2H32H 1NIEA 1SMOA 3V4VB 4HUKB 4QD2E 5C0JA 5CU9A 4GAAA 4EDXB 4ELMF 4GBXD 4XXCC 4A7VA 1DJIA 1EEZA 1LEGA 4DEPB 3TVMC 3LS5L 2F74B 1RULH 4C4BA 2I27N 2WXPA 3RX5A 2AJUH 4PTTA 1KB9K 3K2KA 3H85A 3U79A 3WLBA 5EUKA 1DVQA 4ZX3A 2XQYK 2DM2A 4FXKA 4L8BA 2BC4A 1E7VA 3E1ZA 2NNFA 4UQEA 1BJ1H 1IGIH 2ITCB 5I74B 3V4UL 2IH9A 4LLVB 4N2FA 4ONHA 1YEDB 4OZHA 1JF1B 1IL1B 1SBSL 5EZLA 4WK2B 1GTFA 3QNXA 3X3GL 3CDZA 3SE8L 4N1EA 1SOSA 3V6OE 4N3TA 2P8MA 4D9QD 2J5LB 3NP3A 1AI1H 4LLUA 3B5HA 3VFGH 1TPXB 2IFGA 5F7HA 3LD8B 1T22A 2DYSB 2ZSVA 1QFWI 2RA1A 3L1FA 4GIAA 4Y19B 2ROXA 5JIIA 4XB7A 4IBUA 1GOGA 2AK4B 4LRIC 5INCB 1BXXA 4ES9A 4YN3A 1N0XL 2XTJB 4J8RB 1MEXH 5FGSA 4ZMTA 1NM4A 1R3LB 3G5VA 4FJZA 4DCQB 1C8PA 1UWFA 2P5EB 2VQ1A 2BCMA 2MHAB 3DO3A 5CGMA 5FYLH 3RGHA 4AQOA 5JHDB 5EZIL 4MJ5A 2I7SA 4Z18A 4PV8B 4XXWC 4Y4KA 4HG4J 3HZKB 3VFGL 5TF1H 5ADOL 1J0YA 4S0HA 1CLZL 5DYFA 1VFAB 3WNIA 4YHYC 2VXQL 3SDXE 4EF3A 3O2VL 1SLXA 1KTKE 3AWGA 5LNDA 3MREB 4NHUA 4OGXL 4ZO8A 3D09A 1AQKL 4I9XA 4J4PC 3GJEA 3ULVF 1B4LA 3FO9B 2XXGA 4ZTOH 1IBZA 1R3KA 4YHPA 2XJKA 1JGUH 4G5ZL 2CO7A 4ES8A 1UZGA 3OX8B 3P0VH 2LVEA 2XN9B 3UTQB 4WI6A 4HIEB 3CXHK 3LNIA 1RIVL 2XNAA 1I9JH 3KXFD 4JB9H 5FW7A 3U7WL 1JRHH 4YGVB 3CQFA 3O3DB 4MB5A 1Q9WA 2XHNA 4J7RA 1R3IL 2GHWB 2DD8L 4QO1A 3TBTB 3ZK0A 1F4HA 2VSMB 3JWOC 3MCG1 4M8QB 4BFOA 3VSQA 1K8DB 3IDIA 5IOKA 1SJVA 4PJDE 1R5WB 3T77A 2Y5EA 2A73A 2EDTA 1OL0A 4QRPD 3MRQB 1NL0L 1ZPUA 3P3TA 1S7RA 3MUGB 5KW9L 3RI5K 2ITFA 3KPNA 3M17B 4X4ZA 1S5IH 3JWDL 1LO2L 3QCVH 1USZA 5EZOL 4JY4B 3QI9D 4Y4HB 1ROCA 3PWNB 3S88H 2VR9A 2WXLA 4B9YA 4JRXB 4LLYB 4NUQA 1N18A 1LXMA 2BP3A 5G4OA 3VGHA 5L2KA 1W8NA 3RWEA 5E5LA 4AKQA 5FKAB 2AJYL 3F12A 4JVWA 2EVJA 1K72A 3GGWA 3GFUA 3VFRB 3CSFA 3WFHB 4YDVA 3HG3A 4DP6X 2IBBA 4UNTA 5D1QC 4LF3A 1A14H 1HI6A 4UBDD 3LHAA 1GC1C 2XN1A 3TT3L 5MHSE 3RGVD 3KJ6H 1MHHB 1ET8A 5JIMA 1PLCA 4HWUA 1JTTA 4K3EL 4P2RB 1INDH 1SYVB 3G5YA 4KXBA 4HUVB 3MMEB 4RDQG 2JFCA 2EO7A 1WFOA 2NW2B 3ET9F 3INUL 3O11B 5E5RB 2NXYC 1P7KB 2GY7B 4MD5A 4TUJA 5KSUA 1HZHH 3REWB 4JFPA 2NSQA 2AQ3A 4NO3B 4P5KB 3H9SA 3K71B 1CFBA 1L7IL 4NGHH 1OXYA 1FAIH 3U9WA 2CLZB 4BK4A 3Q6GL 2QQLH 5ANMA 1KIUB 4WJG3 1QBMH 4S1DC 4MZRA 3THMH 2EH7H 1EUUA 2YK1L 4NKMB 1RZGA 3LKNA 3WN5C 3WAJA 3EBGA 3HPLB 2CUHA 1E0OB 5H94A 4FI6A 5A6IA 4XCEA 1BEYH 4JNXA 3O8XB 1LMKA 3GI9H 3IU4L 4RZKA 5IVZB 5F1IB 3K6OA 1IQWH 4NQVA 1A6TB 3EXJA 2VLJB 3TT1L 1AD0B 5GS1B 2EUWA 3R4DA 2ENJA 1NAMB 3HPJA 1GOFA 1XWVA 2YK1H 1B3IA 2VR4A 3QZBA 4IRSB 4IIZA 4OUUA 5G5DA 1L9SA 2VT0A 1KBVA 4PBWD 3U0WL 5BVJB 2OA9A 2ZF9A 4WU5B 1I1YA 5HPOA 1X3DA 1RUPL 3WDIA 5J1SC 5D1QB 3U2SA 5AW5B 3VQLA 5IJKC 2X4RA 2VXVL 4BCZA 3G6JA 4YQXH 3B5GA 7FABL 4ZS7L 1MIEL 1IFRA 1PQZA 1RIUL 5K9OA 1OT4A 2AVGA 3HFML 4QY8B 4IIQB 2DLFH 3D52A 2ZKXA 5BOJA 2MOGA 1NSNL 3PUCA 3RRQA 1NGWA 3K5SA 4ODTH 5IQ9B 5E00A 3CVDA 3DUHA 4M9OA 5DUMH 4JG0L 4D0CB 5KJRH 4JPSA 5DC9B 1ZSDB 3LV3B 1QSZA 4S0SD 4F27A 4L8CA 4TNGA 4D9RD 3SDCA 3U7AA 4HK0B 1GGBH 2CA4A 4JRXA 2F8XC 2O5YH 3HMWL 3FCSB 3C5ZB 3ESMA 2AITA 1ZGLM 1I82A 2VDKH 1O6SA 5IBUG 3PWPB 5F9JA 2G2RA 3CHQA 4J39A 2P8LB 1KGIA 3O6FA 2IWFA 3QFDB 4KGLA 4CC4A 2BWQA 4F1ZA 3WEMA 1IVLA 2DEYX 3KXFE 2IFFL 4EBQH 2VC2L 3L3HA 2MTPA 3PWJB 4XN1A 4JRYD 2NY6B 5FUZH 4UDUB 6FABL 3G9AB 1WIUA 2Q76B 3NJKA 3O6KL 2H0FA 1CXIA 1B9ZA 1XCTB 2AAVA 5D72L 5T1LB 4F2EA 4G7YH 4U1NA 3P30H 3WFCL 1QRKA 3VXTA 1BG9A 1CLYH 4ZFFA 4HC1L 5K9QG 3E9TA 4APQB 2V17L 4PB9H 1T1WA 1KENL 2CMRH 5C09E 4DP4X 3IJ8A 5JQ6H 3CBKB 3ARXA 3KCPA 1EZVX 2J55A 4C56D 2V5TA 4ONGL 3FRPG 5CGTA 3TASA 3U7YH 4WW1A 3QW9A 4Q9CA 4QHNA 4CSZA 1FG2A 3QXDB 1M57B 2YN5A 5IIEB 2XG5B 1L9TA 2CIIA 3BHBB 4FLOA 2R1XA 1C5DB 4R7LA 3OKNB 2VR8A 5I17A 4NCDA 4AC4A 5TDOA 3K2UL 4J8RA 4NRYA 2OKMA 5F6HI 2J5LC 2NY3B 5MHSD 4JFDE 1D6VH 1EDHA 3LVEA 5EWIL 3EJRA 4WI3A 9CGTA 4TL4A 2ORBL 3BP4A 2ZWLT 1N9PA 2DQHL 5E7FA 4JUSA 1T5KA 4D8PA 2X89D 5DHDA 5HDBE 4XMPH 2NOYA 2QQKL 1CE1L 2QGBA 2YOCA 1YSOA 5IP4A 3U4AA 4ONHB 5E9DD 3H2PA 5JYLA 1FH5L 2KZKA 3H0TB 4J3TA 5IB1A 4PGEA 5J56B 2B1AH 1E5YA 1I8IB 4E9VA 4UDTB 4ABUA 2VDKB 3IXTA 1MIML 4PJBE 4H0IA 2VDQB 4HSAC 3WI9A 1QFUH 2IV9A 4NJ9H 1HE8A 4XMWA 5B8CC 5DYOA 1BYPA 4HOWA 2RBLA 2AXFB 4YHMH 5IROC 3FB8A 3JWDC 2F08A 4AE1A 3OMNB 1U2HA 3LNGA 2I69A 4GQQA 3DOIA 5JIPA 5DZOA 1JDCA 1WBXA 5DEZA 3RWHB 2A6DA 3LMJL 4K9EC 4LHJB 4GW4A 3SDXF 3CXDH 1OWRM 1VIWA 4DWHA 5DO2D 1M7IB 3VX0A 4L1LA 3P77A 3A5VA 4KKNA 4NZRH 3RZCB 5F7EH 2QVIA 2ADGB 2EE6A 3R18A 2YKLL 4J1UA 4OF6A 4WZ9A 2VZVA 1TPXC 2BZ7A 2NNXA 3KHQA 1V3MA 2O5NA 3ZDXF 4A2HA 3LAFA 2HLAB 2IADA 4MTMA 5CINL 1TEGA 3HRZC 3IFPA 2PCYA 3NGBC 4N2OA 3RZWA 3UTSD 5C9JB 4QYAA 1KJ3H 3VFTB 4CNIA 2R2EB 2QV2A 2UXVA 3PXHA 4PJ5A 4KRPC 5G55A 3H3BC 3D39A 3NZUA 4MDJB 3VI4E 2E4TA 2NY6C 5IW3A 1YEGH 1ZXKA 1CN4A 3DX7B 3D12B 4HIJA 1X4ZA 1HCYA 3OLEA 1XIWA 3IDYB 3US9A 4E5XB 4K71B 4P3DA 5KBPA 1UWXH 4W9DC 2DLIA 3UP6A 2QMKA 4OJAA 3ASNB 3F7YB 3EFFB 3EJPA 2WNXA 3QH3A 4KKBD 1H6UA 5IQMA 3GQFA 5C0AE 4U31A 4H2AA 1DVZA 4M5ZH 1T1ZA 5E8NA 3QEQD 4XPAH 5IV2B 1U8HB 4F7PB 1PMYA 1AFVH 1Z9NA 1D6EB 4BKLB 4PRAA 4N1CA 1HHHA 5DEFA 4PRIA 1E5BA 3BUYB 2YBRB 3PHQA 5TE7H 2EDXA 3LVTA 3ZL4H 2IC2A 1WCQA 4LLQB 4OJEH 3ALWA 3LQAH 3LN9A 3OKEA 5J11C 4XBMA 4W93A 5DJXA 5E99L 3MV7D 4HWEH 4Z7OE 1I7TA 3FO1B 1GKOA 3OGOE 4KKQA 1A6WL 2A4ZA 4P23D 3NJHA 2Z35A 4WJ5A 3GBNL 5I9QC 4A39A 3BXNB 2GJPA 4M43H 3NZHH 4NN7B 3REWA 4TUJB 2Q6WB 4EN3B 4XN5A 4G7VL 3F84A 2X4UB 1A6UL 4JS7A 5GSVA 2H3KA 3BVVA 4BZ1H 4EN3C 3WNLA 4OJYA 3GTTA 1DO6A 4X0KB 4HCFA 1BZEA 4V33A 1AQ8A 2B4CC 3JWNC 2E47A 1BQ5A 2ZXBA 3AM8A 5FFLA 3FU7A 3E1F1 2QHRL 4JFHD 1V5JA 3EYVB 1FVDB 5TE6L 3QWOB 2X0VA 4HS8L 4KJQD 2I5YL 1QG3A 1Y18B 1Z5LB 5AW1B 3WOVA 3ZE2E 3GPEA 4PJHF 1WQVT 5C0IB 2X6VA 4QXGL 3UCQA 1HOCB 4BSVA 4JZJB 1BREA 4NAQA 5BO1L 3D2TA 3GRGA 1I3GL 4HPOL 4RMVA 4WDIB 3RVVD 1CICD 4YDNA 2X7LA 2Z3FA 4JKNA 5F72S 3PWUB 4AVIA 1R33A 1SXSA 1UOLA 2GW5A 4WY7L 2R1YA 4BXSV 1EXGA 1MVUB 2QADB 4Z7OF 1XGYL 1Z9LA 5C6PB 5EA0H 3BYTA 1EA9C 2BMKA 3SJVB 1CXLA 4CU7A 3QAQA 2ZX9A 4LU5H 3AFLA 5KANG 5ADOH 1KWGA 4QXUL 1CL7H 2R2BA 4FQ2H 5IFHL 2VTFA 3BH8B 1VDGA 3SJVA 2O93L 2FAUA 2CLRB 4PS4H 2ESVB 1LJMA 4N0YL 1QLFA 2F8IA 1PLAA 2AJ3B 3FU5A 2DAVA 2NUTB 1NLDL 4WNSA 5EZPA 1I9IL 5KUMA 3HA0A 1WWAX 4IS6A 3FQ1A 3H9HB 1GS8A 5IB3B 2C4FU 3FL7A 2OR8A 3IPBA 3II2A 5I76A 1DSFL 3ZSTA 1OCOB 4PCTA 3QUHA 3ZYOA 1SN5A 3HHMA 5IEHA 5AFAA 2BIQA 2OP4H 3BWAA 4K3JH 5ID0B 3QYMA 1BX2A 3K0YA 3BAKA 2D03L 3PDDA 3VB8A 4EI6B 1QABA 3VXMA 3EYSH 4MGXA 1VZGA 4GQ9H 1CF8H 2BSCA 2CCLA 2PTVA 3CU1A 3D39D 1WVZA 2R51A 2ZSWA 3EDEA 1JE6A 3IBEA 4DPBX 1MFAL 4LNRB 1S7VA 1QA9A 1AMYA 1XDTT 1WEJL 2PO6C 4OLXL 1J10A 3P4LA 5BV7H 2JKSA 3HZKA 5LQBH 4XP4L 3SDDC 3H9SD 3ZE1B 2FX8L 5AVXB 5CBEB 3P0VL 3Q1SL 3QIBD 4JRXD 4RMTA 4OUOA 3WGUB 3ZL1A 2ZUSA 3T3ME 1XF4A 1Z2KA 2VLRE 3UTSE 1YN6A 4ZUTB 5GSRA 5GS2D 1WICA 3I3BA 1QR1B 3I9AA 5E70A 4GXUM 4B6ZA 1WJ3A 3BOVA 5IBUB 2WP3O 3QG6A 4JM2C 4F7PA 4KDTC 1U8HA 1DSWA 1KY6A 1CD0A 3NYKA 4MNQA 1GY2A 1EH9A 1QFWM 2PUQT 2F19L 1ZV9A 3AREA 3GEWB 4ODBD 4UT6H 1L7TL 4WSJA 3WKNA 5CCKH 3E2HC 2Y07H 3L3JA 1BAWA 3RTLA 1ED3A 2DKUA 2J8UF 3LNFA 4G71B 1QASA 5D2NC 5CFAA 1D5ZA 2GBAA 4N2LA 2JH2A 3HVDA 1DDTA 2X4OA 4WTQA 5CNHA 3OKLA 4BH8A 1WAAF 4RMWA 4AKOA 3WFZA 4MJHA 4NDMA 4R96A 1QACA 5HY9A 3VFTA 5EUKB 4P0DA 3CZGA 3S5LB 3PU7A 2ZKHH 3ILDA 5AUMA 1HC1A 3VWJC 4DP8X 5LN8A 3IFPB 2P7TA 1T1XB 4X8XA 4LQFL 4HZLA 5MERB 1DBAH 1YVLA 1EXUA 3FYIB 2FHFA 2NY3D 1KGYE 1J5DA 2WBJB 4LPXA 1KXTB 4NHCL 5SV4A 4B9ZA 1BVKA 2RQ8A 4ODUB 1QPXA 3C6LB 2OR9H 3OZ9H 4HKBA 2BRQA 4AVHA 1VPOL 4K07A 2V7NA 4N5ED 3B6SA 4R9HA 2DIJA 2ICEC 1NA8A 4XMTA 3GMPA 3NK3A 4IDJL 5EIIB 5FS5A 3QJHB 3PF2A 3TJPA 2Q7AA 5ELIA 3VXNB 3GXFA 3NEOA 1UA6H 1MH5B 5J6GB 2UYLA 1MCPH 2XI9A 3JTSB 4N2HA 4XNAA 5DO2C 2XY1A 2D2CC 4KNUA 2YD0A 2PW1A 4DGVH 3ARGB 2AAAA 2DH2A 4YOKA 3GMLA 3N9GH 1UOVA 4YSTA 3CVHH 5D4QA 4IKLA 5TGBB 1MJUH 1I7RA 4PJBB 3N1MC 2CH8A 2IDUA 1U8LB 2BP8A 1ORSA 1HHJB 4FC3E 5AKVA 1KV3A 1M53A 4A7QA 2ZD0A 8FABB 2HKHL 1Y1DA 5L2JA 2YOAA 2YZ1A 4DERA 1GW6A 3K6SB 1JGDA 4CC1A 2EXTA 2BNQE 3TV8A 1CDUA 5EB9A 4GINA 3RWGA 1QHQA 3DV4B 5IR1A 2XN2A 4XNMA 3MR9B 3WIHH 2JQMA 2CK0H 5JZ7D 3KWVA 2Z7WA 3WHXB 1MHEB 1AO7B 2CPUA 1DEEB 5FYKD 4JCMA 5EBMB 3M46A 3FQUB 1KV7A 2N1KA 3L54A 3K72A 2VSKB 2EEDA 2P24B 2BFVH 5HDLA 3JV0A 2P5WB 3POHA 1TG8A 1YN6B 5GSRB 3D85D 4WU7A 4Q89A 2V5RA 4GUQA 4DK6A 1NMBH 1ZT7B 1XEDA 4YK4C 3ZT7A 2YIHA 1GHFH 2XACC 4L29A 2N01B 3IDXH 4U4IA 2YMTA 4XXWA 1GTNA 4OJFH 2X09A 4LSDA 2EDHA 2HJFB 4XR8C 4M7KH 3B3BA 5IB5B 3F62A 1A1OB 3MV8B 5JIKA 3I75A 3TO2A 3HI5L 3OHXA 4F5CE 4ZFGL 1ORQB 5FUZL 4C56B 5HPMA 4CMHB 1DVTA 1F4XH 2FO1A 1NMBL 2ARJB 3W38A 1IGMH 1Z0NA 3IKKA 3WFCH 3RDTB 4XP9H 2HAZA 1BD2D 4GW5B 4W6XB 3OC8A 1ZGLP 1MRCL 3JTTB 4YHLH 1E4XH 2VUOA 2XX1A 3HVNA 4JJHA 5F89A 3IVKA 2EUZA 2QR0B 4JFED 4ZFQA 1FFOB 1ZLUK 3O2DA 4MLIA 1TCRB 3VFVA 1NDMB 3VVWA 2DMKA 1MFCL 3AU0A 3ESNA 3FQYA 1JZEA 3ARED 1OAKH 3U0PB 2BHYA 3NJXA 2H2SC 2P80D 2NY6D 4YO0A 3ZTJG 5IGXL 3JVGA 5I75C 1Q0YH 5IBLC 3BT2H 3BZFB 4NN7C 1N5YH 1QSEB 2AQQA 5IVOA 2EH8H 4BH7B 1J1OH 1T20A 1X44A 1P4IH 4H4NA 3U4BL 3X1NA 2EDBA 2OMVA 4GP8B 4H8WC 1W6LA 2J3SA 2V3FA 2JELH 1HILB 4S1SH 3A21A 2K78A 4ELME 3QXAA 1MHPL 4NQCD 3IDGA 4XC3L 1DVYA 4X7SH 3E0GA 3O9WA 1UKQA 4S1RL 2N3JA 4U1LA 4ZTEA 1NCGA 2YD8A 2MQ0A 1WZMA 3VFPA 2NZ1A 2APTA 1D6VL 1KG0B 4RIRA 4L8CB 4FAAB 3QDMD 4DHLA 5C0DB 3FUKA 3O2DL 3DPBB 5BZDB 3FQTB 1CGTA 1SEBB 3IMBA 1E3ZA 1DQDL 5IQ9A 3F65A 3F8UB 4HJSA 3QWRA 1AQMA 4JZJA 1QVOB 3MGTB 1HHGB 3C8HA 4UT6A 3ZSSA 2YSSB 2E7LA 2ZCKH 2VDOH 5AKSA 5FKPA 2IBZY 3U0TB 1D7FA 4LCWD 3ZKMD 1HQRA 4F37F 1KIPA 4M6OL 3NFPB 4YFDB 1TIUA 1VFOA 2AI0L 3L7EB 5JDSB 4AGMA 2NW3A 1K4DA 5DQ9A 1IT9H 4A6YH 5DHVB 3VFUB 1XF1A 2ITDB 5FW8A 4FERA 4BFEA 1FGVL 5FO7A 4M6OH 1VEOA 3FU6A 4J3OF 3QULA 3O8XA 3BPLC 4GT0A 3QJTB 3HJ0A 4J23A 4PWIA 2OTUA 1Q8MA 5INDA 1IAMA 1ZTXL 1D5XB 2IQAB 1CFMA 1KGCD 4L8DB 4F2ME 1NH6A 3I3DA 1UG9A 3UGUA 2ZP0T 1XCQB 5E4EB 2VIRA 2IBZX 1JXJA 3SDAC 2FJHA 4LIQH 4R90L 5EO1B 4X9FA 5EOTA 5FYJD 3BVNB 4XPFL 2EZ0C 3HZMA 3ZDZF 2GSIB 2D3VA 4FP8L 5LBVA 4MD4A 3G5ZA 4B27A 2OW7A 1Q1JH 5FA3A 4ENEC 1PSKL 4MD5B 5KSUB 3VXPB 2J12B 5KTEH 3UAJA 3S35H 1AIFA 2X6MA 3WTSA 5HJGA 1PAMA 5KVEL 4WAFA 1C5BL 1H8OA 1QQDA 3QJVB 5DMKB 3BUDA 2FT8A 2GBTA 4OW6A 4GKSA 3LOWA 4HJUA 5F7EL 3BEWA 5FK9B 2YRBA 2RD0A 4Y2DA 4L2LA 3LZLA 4GKNA 2UY7B 4BE5A 2XA8L 1R9FA 1FZOB 1GCYA 4AGQA 3VFRA 5HYQA 1E4JA 4QWWC 1U93B 3LQAL 2ENSA 3SDYH 4PJ7E 2J6EL 3HAEH 1P6FA 3CC5A 2LVCA 2AV1A 3HE7A 1MW0A 5FUCC 3KVPA 5LG6A 1INEL 3MLUL 2A6DB 4UM9A 2YPVA 1W72A 3SPIA 1MCFA 1XAKA 2EUXA 3HUJF 4PVMA 1FN4A 2XKSA 5F96L 2CIKA 1UACH 4AXWB 2E27L 3EOAB 3L4TA 3TEZA 4G7VH 5HYFA 2HLFC 3BE1H 2MNWA 4G70B 4N9OB 4NQDE 4PJIA 4EI5D 5L88H 1FFTB 2AJUL 1FYHB 1EFXA 2XYCA 3QULB 4M7ZC 1T03H 4LCIL 1KTJA 3H2WA 3U36A 3PUUA 4PFEA 1M3JA 5AZUA 2Q8BL 4AGNA 4W9HC 4AL8L 3QZWG 1YMMB 2WBJD 1SNRA 4PPTA 1NFKA 5KG9A 2IALB 4PWHA 4OB5H 1IJ9A 4YUEL 3S4SB 5D7IF 2C3GA 2ZXQA 4X4KA 6PCYA 3N41B 4N0CD 1WGOA 1T04B 2PTUA 1DQIA 2W60A 5TE4L 1J0ZA 2RR3A 3S36L 5DURB 3BESR 2J56A 3KLAA 4ZOCA 3WKMH 1BF5A 2MRYA 3FCUB 4QTIH 2IH8A 5KVGE 1FFQA 2UV3A 5D1QE 2P28B 5K93A 1PG7L 4LU5L 2WZ5A 2A6JA 5TDOB 2FEJA 2IPTL 3WNMA 1GGTA 1LTXA 4UQ3A 2OSLA 4XNZB 4Y4KB 1XF3A 4QTFA 4MDIA 1PZ2A 3R8QA 1HS6A 4JRFA 4QMEA 2HKAA 3E6HA 3BHBA 4JFFD 1YPZA 2O5XH 1BOGB 4I0PA 3WL9B 4L48A 3BVTA 1KCKA 4Q9QL 3MXWL 4PRHE 4HUXA 2PABA 4JRLA 2X2YA 5A40E 1MOEA 2H6PA 4QXGH 5KYWB 2H2PD 2CRYA 2C1PB 2HFGH 5HYSB 2CGRL 3A22A 2DL2A 1RMFH 1IBDA 1KCVL 1IGYB 1ZK9A 4K3JL 3S48A 3FNKA 3GMOB 1U8NB 3CDZB 1NOLA 5GISH 4H0GA 3JWNG 4JFFB 3OKDA 3CQPA 1QRNB 5EA0L 2VZTA 1FZMA 1KOAA 2XBDA 4W9ZA 3C08L 2Z93B 2ZCHH 3EYSL 4K3DL 5A2KH 4UTAL 1XCTA 4AV5A 4Z78B 2W94A 3PV7A 3PL6C 2KL6A 4ZSOE 3TF7C 2QVFB 3KPMB 3GSQB 3GLAA 4TUKH 5AVRB 1SM3H 3QEQA 2AW2A 4U1LB 4ZMWA 2HKFL 4ZFZA 3QARA 2D4DA 3T8XB 4YBQC 4FQHB 5LKNA 2BWDA 4WGVB 1WDAA 1KULA 1ZT1B 3LNEA 5F3BB 3O6FB 1AQDB 3VFWB 4OCMC 2CBQA 4Q2ZB 3A6BH 4DN4H 1XGTA 2OAAA 2WGXA 1CLZH 2XYBA 3B9DA 5F21B 5AVSB 1NCDL 4BFRA 4JE4B 3KPMA 4J5VA 4YO0B 3GRWL 2XPZA 2EECA 1ZT4A 4OGXH 5DJ2B 3CN3A 4XP5L 5D1XC 2QSVA 2ZOKB 2CHXA 4F7CB 4ZTOL 4QRSB 4D0CA 2BIMA 5AAWA 3KBEA 3HNTH 3RL2B 1S9VB 3NMEA 4H25B 1IB5A 4DKEL 2ESVD 1NCJA 2BNRB 3OJVC 5B7EA 1UCBH 1YNTA 3VU2A 4FA6A 3RWCB 1U3ZA 4IBVA 1U3YA 4D7PA 5GRXG 1W8EA 3DXAE 2OPCA 4CJ1A 5GZOC 2CKNA 5AKTA 3F6IA 2VCOA 1YUHA 1WK0A 3U6RA 1JUFA 1VZHA 2Y2YA 2EILB 2J1ZA 4JG5A 1Q0XL 5I19L 2X4RB 4F20A 4PI2A 3OAUL 5I1GL 1FL5A 4XZUB 3AADB 2JCCE 3QFGA 1MCBA 1I8AA 3QORB 4MB1A 2LLNA 1OP5K 2WXMA 5K9QI 2AANA 4LARL 2OMUB 5C3IA 4OLVH 4LQFH 4M00A 1DCEA 3DO4A 3TYFA 1YY8B 3DROB 3GZOA 4N28A 3ZJAA 3X11A 3IJHA 1JPST 5SWZD 5EU4A 1NAMA 4ZUVA 4I18C 5A7BA 2PR9A 3FZUD 2GABA 3JBG7 5C0CE 5MEND 1THCA 2BSRA 4KTDL 2P24A 3Q8CA 3KLLA 3SE3C 5HXMA 5TGBA 4JKWA 4MCYA 2HVJA 5AAMA 4MJIA 4R0LC 3WN6A 2J8UA 1QBML 3WY3A 5FPIA 4RGMC 4F33A 3MU3A 4N90E 3RJDA 3TN0D 2EH7L 1J9SA 1JVLA 5JIHA 1BM3H 5E1QA 4NKMA 2OBGA 4MJ6A 1S7WA 1A3RH 2XWDA 3FONB 5KVGL 3OC5A 3SKMB 2GTQA 3Q8EA 3L5HA 1E3XA 4GSDL 4TM9A 4F8LA 4MA1C 4L37B 4IRSD 1BEYL 3C6LD 3CNKA 5EG6C 3WJJA 4OFYA 1I7RB 5DC0A 1SJEA 1OKEA 1E27A 1ES0A 3VGBA 1NAML 2FSEB 4HCIA 2PETA 3GMRB 3D69A 3FC8A 5DMGD 2CO6A 1BSIA 3UTTA 5ACZA 4BDVA 5GRWA 2A99A 3MOAL 3SPCA 2WIIB 3SCMA 1O7DE 4L3EE 4RVBA 3JTSA 3HI6L 2VLLB 5F0JB 5I1AB 4R2GD 4OD2A 4ETQA 1GGYA 1E3FA 3M86A 3TBVA 3WUWG 3MA9H 3HC3H 3FQNA 3U9PL 1I9EA 4IKIA 4AEIL 3E80A 4Y2LA 2YGPA 3LS4L 3SPHA 5BS0E 2AZUA 2APFA 3FTYA 4Q0XL 3PGCB 3B7YA 2QKIC 4LLMB 2Y7QA 4GUCA 4PB0L 4WUUA 3WFHA 5LBGA 5CIPA 1UD2A 3FFCA 5D7EA 2X0UA 3E9UA 1T4WA 3ZHLA 4RISL 4ZNEE 3WSQH 5HGDA 1AY1L 2HFFB 4CILA 1M3IA 3MCYA 2YUWA 3JSSA 3N85L 4JANA 1XX9C 5E8DH 2FB4H 2AJVL 3QEHA 4XOBA 4FMVA 4Q97A 2ZX6A 3CVHL 3BEWB 1KFAL 1QSFB 2B08A 3VQ1C 2UWEF 4MNQB 1MAJA 3PQYB 1IILE 2EIZB 4Z95H 3BKML 1B4JL 4ZTPL 3PWPD 1OZUA 4WW2F 1NKOA 4MXQD 3BWSA 5TK4A 4QHLA 2IIJA 2DS4A 3T0XA 2BHUA 4PJHB 1BCIA 4RMQA 3MJ7A 1CXKA 4XCNB 3U0WH 4O02A 5F7FA 1QBLH 5A2LH 5KYYB 3EBAA 3D48R 1RUPH 5C0BE 4HJEA 1EO7A 3DJSA 4LSTH 3SIKA 5IHUH 1ED3B 5B3JE 1HJBC 4LVOC 4ZS6C 4F3FA 4KKRA 3ABGA 3BSHA 3BKMH 3LXUX 4NSKA 4AIXA 1CLOL 4M6ML 1DN0B 4NJAL 4XP1L 1UGNA 4LNRA 2EZ0D 2BFVL 2IPKA 3BGFB 2DLFL 2D2OA 5AEAA 1YEKH 3ML8A 2QLYA 1UHVA 4F8NA 5KVDE 5KZCB 2IH1A 5DEGB 2UZYB 3IGUA 2H41A 2JNZA 1W91A 4EI6A 3N44B 4PJXE 2VJXA 2X9ZA 3VXRD 2J8UE 3SGDI 4ZMXA 2WVUA 2H1PL 3SBQA 4LSRL 2C3XA 3FUNA 3MFGB 5CBEA 1ETA1 3RJOA 4JKKA 3TVMA 3FO0H 3X14A 2K1MA 5ECJE 3GXTA 2KI6A 4LASH 4QYOB 1RZ7H 2GBUA 3DGGA 4IRSC 2VDKL 2ADFL 4UOQA 4HV8A 5D70L 2D0GA 3A0OA 5DHVA 4JQVC 4LVHB 3SY6A 5HYJE 4FZ8L 3LRSA 2VDOB 3SQOL 3L5WB 4OLYL 3WU1A 4FLRA 2HJKB 3BP7B 2CUAA 2MCPH 1I1AB 1E4XL 4X7EC 2DB8A 3ZDYB 1PLBA 1HTYA 1YEJH 4TUOB 2P48B 4AYMC 3V0EA 4EBQL 1N6QL 1U91A 1IFHL 2G3NA 1NQBA 3ULVH 1G9MH 3S5LG 1MCQA 4CC4C 4JFDB 4ALAH 3PWLA 1P9MA 1EDYA 3QBTB 5E6ZA 4OZGE 1LO4L 3NFSH 4OD1L 2Q0ZX 2J7LA 3MV8D 1IC1A 2ZCKL 1KLFA 1N5YL 1A3ZA 3MUY1 3DK0A 1CZ8L 1T6WA 4LFHG 4HIIB 1KPRB 4DGWC 1RK7A 1CFVH 1UD3A 5F9OL 2WCPA 4BQCA 4LCVA 3TCXA 4QTHA 2DWXA 4R4FH 3BH9B 5DZPA 1YYLL 3EH2A 2H6OA 1HXMB 1P5UC 2I9TA 4GSQA 2CBOA 1KEMH 2DQCH 4MZ2A 2QQKH 1IT9L 3DO7B 4PJAE 4IK7A 4LSSH 1IE5A 5D7JB 4HPHA 2WN3A 1WISA 3GSNH 4FQXA 3LY6A 1JZ2A 3MX0B 1MCEA 5FGCE 4JN2A 1G7MA 1IAOB 1MIMH 4FQCL 1W0WB 3RLSA 4L05A 4XHJC 3VXUA 1KZYA 3FTWA 3MOQA 3WFEL 3ARFA 3MACL 4P5TB 2G0KA 2EIJB 5E8OB 5L4MA 3LN5B 4LEEA 2D7QA 2Z7YA 4WWKB 4F7EB 2X5PA 4ODHH 1XGRB 4NWUH 3TV3L 3QDGD 3WUWB 5KSAD 3OJDB 3ULVD 3DX9A 4WFFE 5L4IA 4KFMA 1YQ2A 1O7VA 2YQGA 1S7XA 1U30A 4URTB 4ZO7A 1UWEH 2Z8WC 1MG3C 1R17A 2C9AA 4PCSA 4KJPD 4JHWH 3FQXB 2XT1B 3GSRB 1MCJA 1Q94A 2GHZA 1LNUB 3T0DA 1UFUA 2GJZB 1A47A 1YN7A 3T08A 1E6OH 1KB5B 1SN2A 3IGAA 2G5BB 4NM8H 3RUGF 5GZNC 1SJHA 1NC4A 2DPKA 5CMAB 5SX5H 4IRJD 2Y1ZA 1T1ZB 5E8NB 5IV2A 4K9EH 4PP1C 4UAOC 5CM1A 1EJOL 5C08B 3BXNA 1D9KA 5KS9F 4AYID 3PDGA 3ULVC 3EFFA 4CVUA 2VDLL 4BFBD 4Q9BA 2GJ6A 4NIKB 1A8JH 4ZX4A 1RJLA 2YD3A 2NR6C 5HI5D 2VDNH 3IRCA 4W9KC 3IU3B 1CVRA 4XCCL 5BRQA 4P4RB 4JFYA 1ASQA 5ISZE 3UZQB 5GRUH 3NPSC 1L6PA 4B5EA 5DD6B 3B2UC 1EJOH 1HHHB 5I24A 4PJ5E 5IFAH 2VM3A 5IMLA 1DEEA 2PCFA 2DBJA 3TBYA 4N26A 2W59A 3LKPB 4DAGL 3O4LB 3WO4C 1G1KA 1WLHA 4F58H 4PUBH 4KTEH 2NY1C 4WO4A 5HI3C 4OLZL 5EU4B 3UPRB 4MB3A 4Q9RH 4KHTH 1RJLB 2PO6B 12E8H 4KQ3L 2ISDA 4GAJL 4ELKA 4MWFB 4Z7NE 5I0ZA 1J8KA 1TEFA 1F4AA 4L4VB 3P77B 2OMYB 2YEZA 4LMQE 2BDNL 1YJDC 4X6CB 3W39A 1JVKA 4G7RB 3VH8B 3KJ4C 1EIBA 4JMXA 4I2XB 5E5UB 2EO1A 1ZLWH 1QEWB 2NTSP 3IK2A 2OSXA 3VRLE 4HD5A 3L4CA 2OYPA 5CJQL 3O4LD 1WC7A 1N5AA 1F56A 1JGIA 4ZPVA 2R29L 5D8JL 1X5HA 4DO5A 4N0FA 5KVFL 2DI7A 3PXJA 1M1XB 3NZHL 4U1GB 3T04D 3VMOA 4H0HB 4QKTA 5JORA 1F86A 3VXUE 1G7PA 2VLRB 1NJ9A 3MV7A 3HR6A 3VW3L 4P2CG 1MCCA 1OOWA 5JHAA 4GRMB 1JWUA 1A22B 2FJFA 4GMTL 4HUWB 2GPZA 5D4IA 5JPNA 3GI8H 4P4KA 1HX0A 5IKCB 1U3HA 1VKXB 1KCUH 2DKMA 2WWMC 5IOPB 4O51B 1HYSC 5J1TC 2IAMB 5KVFH 1CQYA 5FO8A 2YN3A 1AXIB 1UM5H 2J20A 2HVBA 1N70A 2EVHA 4X4ME 3NPZB 2GK0B 1XGTB 3GBDA 4PJAA 1BD2B 4Y5VC 1U58B 2IANB 2GQHA 3PJSB 3X1EA 1CBJA 1S2EA 1SOQA 2AXFA 2V2WA 5ALCL 4FMKA 2NYYD 4MB4A 2OYKA 2FH8A 1NIFA 3QUZC 2Q8BH 1RUAH 4LCUB 3NVQA 4Y5XB 3KPQA 2YUVA 3WELA 4BZ1L 2OV0A 1N0LB 2CG9X 4RA3A 2J88H 4DVRL 4GXUN 1CXHA 2CGRH 4MRCA 4NP9A 3VSUA 1G4RA 2HN7B 1F4YL 1Q90A 4PJFA 5EU7C 3VJ6A 1KCLA 4NP4L 4YHIA 1TFHA 1KLFB 4RDBA 5EZIH 4M6NH 1BXUA 3KYNA 4PVLA 4MHHG 2P42B 5D5MB 5DVPA 3ZGIA 4E9SA 4J8QA 5TF1L 1SVCP 3UTTE 4IIQC 3A6CL 3ZUNC 3PAYA 4HLEA 4Z7IA 4IMLB 4WI0A 2WY3B 3HAEG 3IJEB 4POYA 4TUKL 4NYLA 3I6SA 2X9YA 4PJ8B 1S5HB 1GYWA 3LHPH 5DZNA 1ACZA 3D33A 2J73A 2WW8A 3L17A 2B1HL 4PJFB 4PJGA 3VJ6B 4ZFFB 4LSPL 5GGSB 4AL8C 3HNSL 1KMGA 1KN2L 1CICC 5AZ2H 5ABZA 4PEEA 5I9QB 5B22A 3WNKA 1JWMA 1E7UA 4OT1H 4QYOA 2YD4A 4A2GA 4I9WE 2AQ2A 4PWGA 1JL8A 3V9FA 2BSEA 2PPCA 4MNHA 5L7XL 4N0YH 5EH1A 2XQYA 3KLSA 4JRWA 3WO4B 5BV7L 4CSSA 2QVKA 2UZPA 4OZFA 5B1JC 3C5SA 4GI9A 1LP9A 2CLVB 4HAKA 5KS9E 1PZ3A 1QFWL 2NY0C 3VXMD 1VRSA 1NBQA 4ODVH 3GMNA 2R0KH 4JQIH 4MSWA 4PW3A 5GGVL 4Z9KB 3WMQA 1BV8A 1L9MA 2C9XA 3QPQD 4S1QH 4XCFH 4XBPA 4DP5X 2O61B 5F7MC 3LZPA 5BQDA 2HKFH 4IOFC 3DJTA 1OE1A 1AQKH 2E0PA 4A67A 5I1CL 5KSBB 3WY4A 2Z6FA 3TZVB 3BSZH 1JNLL 4NQTA 1JGVH 1PDKB 3NUKA 4D3CH 1JGUL 3L3HB 1ET7A 1JWUB 4TNEA 2P5EE 3SYAA 2EDYA 4LLDB 4POUB 3V4PB 1NPUA 3DECA 3BUIA 4Y4HD 3D30A 4NN6C 1AHWB 1DBJH 1NCDH 4PRPE 3BQVA 4X8JA 4S1QL 1AD9B 1RZJL 4F2MB 2UZIH 1XHHA 5I1LA 3MRRA 4NCC2 2PWGA 3BKJH 3L9RB 2G60H 2EIKB 5KVFE 4ZX5A 3TJHD 2VWEE 3HE7B 2Y1AA 3IF1B 2K3TA 1HKLH 3L3IB 5CZRA 3B9KA 5L2KE 2FBJL 2RCSH 4GFTB 3O3EA 5DWUL 4AJVA 1FNSH 1BWMA 3T6WA 1INDL 4IOFD 5CWSB 4LK4A 3QO0B 4WUUB 5DD3L 3SO5A 5JLZB 5KBKA 1TZIA 1CDIA 1NCNA 3LZQA 4AIZA 1U4EA 1YMHB 2AJSL 3ULUH 5IFJA 2HMID 2H8PA 5DI8A 2DEWX 1BZ8A 3W82A 4QGYA 3P4MA 2OTWB 3CH1A 3O4LE 4GXVL 5ERWB 1VLXA 1FNAA 3X3FL 1RP9A 4P5SA 3WD5H 4J2XA 4IOIA 3Q6GH 3P11H 4OFIA 4M3KB 5H94B 2VISA 4OLVL 5SX4I 1MVYA 3GSOB 3QHFL 4YZWA 2DWEB 1Z9PA 3IS1X 5LHDA 1DVFD 2CO6B 5E6UB 4UBDC 4FQQA 4MMXA 3WTVA 3ES6A 4IKNA 4JKLA 4U6HA 3GB7A 4UT9A 1CG9A 3OQRA 4Y0GA 2F1AA 2HH0H 3NJLA 4RZCA 3TZVC 4AH2B 1LD9B 3N9GL 4F9LC 3DSNB 1Q72L 4LOVA 4MQTB 3QDJE 3FCBA 4KROB 2ZUQB 2XXMB 2EUVA 4FNPA 4HLZG 1B0GB 2FLMA 1PGRB 4NQDB 5CMAA 5ACMA 4XH2B 3V4PH 4DGUA 4TF4A 1I4FA 3QUML 1JK9B 3NSJA 1H3TA 4PJ9A 2ZX5A 2FUQA 2H0EA 3T4YB 2EIEA 4GG8B 2NTFB 4JDVB 3FOLA 4HQQL 4UV7H 1EAPB 2ZUVA 2WQXA 2YPLD 3N85H 4JZNB 2EIDA 4KHXL 4E42A 3WJJC 5AD0A 4U49A 4KJQC 1UXWB 4HKJA 2ZKMX 2CK0L 4LKXB 1IKOP 2OTWA 4FFZH 3R0MA 4HW6A 3EHBC 1BLNA 2JI1A 3LEXA 4FNRA 1S7XB 5L8JB 3I2CL 1WYJA 1QW9A 3SQBB 3BPOC 4I3SH 3ASOB 4P5KA 2J6EA 5CWSA 2PCPB 5F93C 4MA1B 3RY6A 3K71A 3VYOA 3NZSA 1A4KA 3GGWB 2K6YA 3H6JA 4O2FB 1OW0A 5DGRA 3SDDA 2FD6H 2NY1D 3BISA 3HC3L 4H1LG 3IU4H 8CGTA 2BS9A 2F58H 3T2QA 3K6IA 2YHGA 2R15A 2X87A 3QP3A 4OIBA 1CLOH 4M6MH 4F15B 4MX7A 1G84A 1KBGL 4GP4B 5GS0H 2RMNA 3SJVD 4YK4B 2WN2A 4UI2A 1OF2A 3G08A 4JFVA 4NQQA 2ICES 3H2QA 3MRFB 5E8DL 5LAPA 3VVVA 3ERXA 3WCYA 4UYQA 4MQXC 4Q6KA 4RGNC 5K59F 3W5NA 2LLLA 5JNYB 4HBCL 5F1KC 4QRSA 4E41A 1O75A 4QCIA 1BGXL 3MCKB 5ICUA 5KVMC 3RYMA 1KPRA 3WMSA 4F7KA 1KPVB 2R7EA 1M7IA 5FXCH 3IF1A 1KBGH 1ZLDA 4MDRA 3CVHA 1ZANH 1C1EH 2VDQH 5T3ZL 4JDTH 4LVHC 1KGXA 4DPRA 2C5DC 4L1SA 5E2UH 4YFEA 2XN9A 4Z3EA 4KJYA 5JHMA 2ADFH 2C9SA 2MIZA 3QXAB 3EJJX 3RWDA 2P26A 4YX2H 1ZT1A 4FQXD 5F3BA 2YMXL 4XXCA 5DFVC 1A21A 2AF2A 3RWIB 3T9WA 5GRZA 1E4WL 1QZNA 4IBTA 4ZOBA 1MFEH 4RNRB 4DUXA 5F8QC 4LPVA 2PKDA 5JQ6L 2X6BA 1GGBL 3P0GB 3P9WB 4LOEA 3QB7C 4ZW3A 1MQ8A 3T1WA 4DVBA 4X9BA 1RU9H 5D1XA 2CCWA 3Q2VA 1BJMA 1QWNA 2VZ1A 4YSDA 3RVTD 4ZDHA 1XF5A 1ZJBA 2CZNA 4LDOB 4ZZKA 4XBGB 1P5VA 3ZYIA 4E2OA 3FU3A 4X5PA 3MNZA 5IVNA 1ZVYA 4G2AA 3DX8B 2KERA 4ZQKB 1X9UA 3H9ZA 3WJLC 4PG2C 1TJXA 3MRNB 4PJ7F 5GZOA 1ZTMA 2IH1B 3AS1A 3MZTA 5DEGA 4YSCA 5AAPA 5MEOB 2IQ9L 2FECI 4FFVC 2AEPL 1BLIA 1ND0A 1TENA 1NAKL 1SZNA 4UILL 3F85A 2EYSB 2BZDA 3LEYH 1VGEH 3O81A 2EH8L 3UERA 4P46C 3RU8H 3OF6A 2WZ6A 1YUKB 2PXYC 3H3PL 3E6HB 3UL4A 2MPAH 4F80A 1XV8A 3MNDA 3LKSA 2JJTA 1SY6L 1LILA 1T80A 2P46B 4ODHL 3TV3H 3RKDD 1EJ8A 1NAKH 2LFGA 2VM4A 2DIEA 3O41B 2B4CH 4HOZA 4IMLA 2KLSA 5E6YA 1RVFH 2BS8A 3FMGL 1T89C 1KXVA 2AQRA 2FATL 1VACB 4OF5A 3QI9B 4PJ9D 4HWZB 4EZKA 5HDQL 5L0QC 4FTVD 1T04A 1SJXA 3AABA 4NKDA 4OLWH 3UBFA 3L9BA 4ZQKA 3OG6B 1GW0A 3RWGB 5HI4C 3GRWA 4CDGC 1X7SA 2F74A 3MDJA 5BRZE 3SGDH 4YHML 1W0YT 1XF2B 5IT2L 1ZIAA 3M7OA 2IOIA 4LLVA 4E9RA 1I8MA 4O51A 4EIBA 1T0NB 5KSAB 4E41E 1NCTA 2BP8B 3HB3C 3NRQA 4Q6IA 4YE4L 5T3XL 3H54A 3RKPA 3MACH 3NCYP 3NCJL 2DMHA 2Y7MA 2QELA 4ZUUB 2VLRA 5A16B 1UWYA 1RKRA 2PP7A 2UZXA 2XTLA 5F7UA 3KYOA 1DQLL 1RIHL 4P3WA 5B3JF 5I1DB 4U2YA 1H9VA 2NUPA 3OXRA 4NT6B 1TJIH 2ILLA 2XXCB 4YEEA 4XCYA 3O2WL 3Q8FA 5E2WH 5CF3A 3T4AA 1AR1B 4JG1L 2DIAA 5EU6A 2MFNA 2PP9A 1JTOA 1E9QB 1MNUL 3C2SA 2D73A 4APXB 1KEGL 4X99A 4NO5A 3I50H 3SBPA 3TIEB 3MBEA 4Q9RL 1WSST 1OP9A 3IKCB 5D6CB 3MUHL 2R1WB 2HT2C 2BPBA 4FA8A 3VGAB 3L9EA 1W72L 3SKOA 1AHWC 3GHBL 4CKVX 5T3ZE 3VWJD 4MX7B 2C9VA 2GAZA 1OAUL 1U8IA 3HBQA 1PD1A 4R7DA 4Y5YC 4BFJA 1OD9A 4GBXC 4NKOB 3UX9B 1IGFL 1UJ3C 1GH7A 1V7ML 5D1QA