5IMKA

Nanobody targeting human vsig4 in spacegroup c2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imkA00
2V9TA 4FMFA 5FYJL 5JDJA 2VZTA 4MB5A 4HX1B 3RTQD 1NL0H 3Q6FB 1JF5A 1IC4H 1MEXL 5HVHC 5HXMA 1CGSH 4H1LH 3T4AA 2OM5A 1AGDB 4LCWD 4GUPB 1S7XA 2XZQH 3I75B 1INDL 4H25B 4D9QE 4TUKL 2MQCA 5JHDA 3VWKD 5IQ7H 1OM3H 4MA1C 3K4AA 1S78C 2HLAB 4K3DL 5E8EB 1NMAH 2Q7NA 4X4XA 3GI9L 5E8NA 1A3LH 5FB8B 3PDOA 4JANB 5JPMA 4TVSa 2NY5L 4OLYL 3EO9L 5E5RB 2O61B 3DV4B 1TQCB 3KYNB 5ICYB 3OAZK 3KPLA 3PJSA 4EVNA 1G9ML 2ZCKH 3TH4T 1QHOA 4L1HA 2HLFD 5JIPA 4WV1C 1BVLB 4EBQH 1BFOA 3DARA 4H20L 2XOTA 1YNTB 4MNQD 4AL8L 1OAYH 1I3GH 4HKXA 5I19L 4KVNL 3DWTA 5DUBB 4Y4HD 3HA0A 5A2JH 3PQYA 2GSIA 4R90H 3GK8L 1X5YA 2XTJC 2YD9A 4ZUUA 4MXWL 4NP4L 2R29L 1K5NA 3MR9B 2YPKB 3GMMA 2KL6A 3QDJB 4XPFH 3ZDXE 3C6LD 1LP9E 4ZUVB 2C3XA 1PY9A 4UU9A 4ZMAT 4Q6IB 5DQJA 4F7TB 5F97E 4H88L 5GJSH 2YD2A 4RCAA 5ALBH 4FQPA 3H3PH 3S36L 3U79A 3D85B 4WHTB 4FZEH 3OKYA 5D1XB 2BNRB 5I73B 5ICZA 1T2XA 4BH7B 4W6WB 3UBXI 4K2UH 4E9LA 1MWAL 4PPTA 2ZZUT 1OD7A 5I1AB 5GGTL 4NNXB 3CFKB 1GAFH 1IGFL 2RAMA 4JB9L 1ZEAH 1NJ9A 1M71A 4IOIB 4UDUA 1A6VH 4HMDA 1OARL 2OI9C 4K3HA 1BEYH 1W0YT 1LDPH 4MMZC 4NFDA 4HKJB 4RNRB 1K2DA 4OTXH 4FQJH 5HBBA 5IVOA 2DQEL 4PJGA 1UKTA 3B5HA 1KC5H 1LD9B 4TYUA 3ZHDA 1T4KA 1K4CB 4YBQD 4G80A 4YDKL 5I30H 5K9OA 5DUPL 2XWBB 2J6EH 5D7IA 5GGRA 5JZ7D 2ZUUA 1UACH 5D9SA 4DVRH 2A73B 4RAVA 5IMMB 4UV4H 5IOPA 4DKFL 5LCVH 1R3JA 3X17A 5FYKL 3UJTH 1RVFL 3WNMA 3D0VB 2Z31C 1OB1A 4EEEA 4LEXH 2DBLL 3ULVH 4KK8D 4HV8A 5T1LD 2DF3A 4QRSA 4WHDA 4FG6D 3MCLL 4WFGD 3BPNB 1LILA 4ERSH 3P11H 4HFUH 5L2KE 1ZGLB 4GXUM 2CRZA 2D7NA 3D39B 3ZKMC 3IF1B 3MRNA 2NY0D 1N7MH 1RU9H 5B39G 5KVGH 3DV6B 2Q86A 2FJHA 2V17H 2FGWH 3IJYA 4X0KB 4ELMF 5DHVB 1LE5A 1IC5H 3KYOB 1QRNA 2NW3B 1TZGH 1ZA6B 5BZDB 2APFA 3U1SL 5C0IB 2WBJA 5D5ME 3QA3B 3CDYA 3WNKA 4DN3H 1A3RH 5F9WB 1NGZA 3C5JB 4PJAF 2BSED 2ITCA 3VJ6B 4RGNC 2BVQA 1IC7H 1TDQA 3NIDF 1MVUB 3DBXB 5HVGB 1S78D 4O2EB 4ODTL 3K2UL 1ZT1B 4LLAA 4AH2B 5IW6B 5D2NE 2Y4SA 4U7SA 1SVZA 3X13A 3H0TA 4HK0A 5K33A 1EFXD 5J12C 5BVPL 4LIQH 3L95B 1GHFH 1M05B 1WZKA 3W5NA 4RIRB 3GBML 5EDXA 4PBWD 1UENA 4NRXB 3T0DA 1S9VA 4Y16C 3V4UL 4JDVA 4R0LC 4KJYB 5D70L 3CFCH 4MJIB 4ZYKB 1GIGL 3GKWH 1UWEL 5HJ3A 3C08L 1RUPL 3QUYA 1YJDC 4OLXH 4PR5A 3CAFA 3K81A 1R3LA 5C9KA 4JO3H 2R0WL 3ULUH 2XTJD 4RISL 5MEQB 4X4ZA 4JFXA 4OJFH 1NGWB 3T4AB 1PLGL 3GIZH 2B2XL 3S96A 4K55A 1S7XB 4OLZH 3O6LH 1J12A 1CR9H 5KANG 5A2KH 2AXFB 3IFPA 5JHDB 4N90D 1UZ6F 3TBTB 3BGAA 1CIUA 4JDZA 4PBVC 4F9PA 5HYJE 3ILQC 2CDGA 5SV4A 2CIIA 4X4XB 1FL6A 4Z7WE 2R69H 4JN1H 5C0EB 3PDOB 5GXBB 5JPMB 4HWEL 4LSSL 3I6LE 3QQ3A 4PGEB 3PJSB 3KPLB 3MPCA 2G5RA 3OKKB 5JIIA 2YD3A 3W0WE 1CDUA 1BFOB 2XG5A 4G7YL 4LASH 1JRHI 4LSVH 4HKXB 4LHUD 4D3CH 2EIBA 4F57L 5LWYL 1H3UA 3MMEB 3PQYB 1JUFA 2GSIB 3GMOA 5CJQH 3ZE1E 2AJ3A 5IHUL 5EA0H 4P59H 5JTWA 1DN2A 4JZJC 2G9HB 1ONQA 4CN4A 1NC2B 2JJVA 3FT2B 1K5NB 1EA9C 3PHQB 1RIVH 4M62H 5CFHA 2UY7A 1ITBB 1E6OH 4X6CA 1N3NA 1ND0A 1VERA 1ZV5A 1JTPA 3QDMA 2Z31D 3OAUL 4NHUA 2E27L 1RZ8A 3CNKA 4F37F 4ORGB 3QCUL 3LPFA 1GGBH 1A0QL 3LD8C 2F19H 1AC0A 4AMKL 2B5IB 5ICZB 2UUDH 1R24A 4PRHB 1SEQH 1K8IA 5JR1H 1C5BL 3D18A 3ZKMD 4DFHA 3EZJB 3FQWB 1P53A 4WCYH 5I2IA 5DR5H 2P8LA 2DQIL 5D71L 4RFNB 4WNQB 1NJ9B 1FRGH 4UDUB 1UWGL 4BZ1L 5ANMB 4N68A 1HHGA 2L7JA 2J88H 1WWCA 5H35A 3L5XH 4GXUN 5TDNA 5ALCL 5FK9B 4MCZA 1OTUC 4JM4H 3U2SB 4RGND 2OR7A 2DLIA 3GM0A 4Y19D 5K9OB 3ZDXF 4FQ1L 1LP9F 5GSRA 5D7IB 5GGRB 5D9SB 3VH8A 3WNPA 5HYIA 1B9ZA 4RAVB 5IOPB 2X4QA 3OF6A 1R3JB 5DJXA 3GGWA 1OB1B 4Z7UF 1JVKA 5F1IA 3QDJE 2MCPH 2IH3B 4Y16D 4HV8B 5KVFL 2FHFA 1XF3B 4HZLA 3HUJA 1GYAA 5F3BA 1Q0YL 5ADOL 3ARDB 5GISH 3DI2B 3L3HA 1ULVA 3TJEL 3ARGC 2DLEA 1X6LA 3MRNB 4KI1A 4PRPD 4UUJA 4X9GA 3MV7A 1UYWH 3JTTA 2Q86B 2FJHB 4QRPA 2A38A 2CKBL 3IJYB 4TSAL 1LE5B 1JN6B 1QRNB 3O8XC 3ARYA 5C0DA 2D7TL 3H9SD 1ZLSL 1AHWA 5HYQB 2I60L 4XPBL 3WXVL 4U1MB 3ULVC 1U8HA 2LABA 4HGWA 4HUXB 2ITCB 5I1KL 1G6VK 1B4JL 2BVQB 4ZXBA 1FAIL 2GEEA 4M1DH 3ILQD 1G84A 2F5AL 3QEGL 1U3ZA 1RURL 1KIPA 3EOTL 3X13B 1LO2L 4Y4KC 3H0TB 4HK0B 4JAMA 4G6JH 3QIWC 5D2LF 2V5YA 5F7DB 1I1YA 2Y72A 4XP6L 4G8GB 2BVYA 1JYXA 3WUWG 3U82B 5JOEA 1S9VB 1EEQA 3KS0H 3IDXH 4R97C 4UB0H 4XAWL 2NY2B 1U8MA 1K9TA 1TCRA 3KHOA 4HDIA 4HMEA 4JDVB 2VC2L 1AXTH 1FDLL 1WICA 1X3DA 4TNVK 1MFDH 5FCSH 4OGZA 1XGPB 2HJLA 2F5BH 5HJ3B 1AE6L 3QUYB 4E5XB 4PR5B 3FT3B 1R3LB 5T1KA 4J3OC 2L7UA 3RPKA 3C2SA 3D39E 1L7TL 4P5MA 4OCWH 4LHJB 5D5MF 3GDBA 1AC6A 4M6ML 3S3SA 3P9MA 1MFBL 3S96B 4JFFE 4IOSD 1VFBA 1EHLH 1QPXA 2HT3C 4HPYH 4QRRD 5BJTA 1BHGA 3IFPB 1BD2A 3U36A 4JDZB 2KKQA 5E2UL 4PRAA 1J0HA 3DIFA 5L8KB 3F62A 3VXOA 5F7EL 2CIIB 1FL6B 3MBXH 1J05A 3MGOA 1X44A 3DYOA 2V7HA 3ARPA 4OI9A 4G5ZH 4YK4C 5I1HH 3ZL4H 3ULUC 3QQ3B 3B5GA 3DGCR 4S1SH 3JWOH 1UH3A 1MCPL 3UYPA 3ZKXB 1CVRA 1EH9A 3WL9A 3QFJA 2D9CA 1S9WA 2V2XA 5FYJU 3V79C 4DGIH 3RJQB 5TE6L 3MLYL 5DVOA 4N8VG 4JPKL 4HXBH 3GMOB 2C26A 2FL5B 2BSSA 2AJ3B 1BFVL 4C4KO 1OTUD 1M6OA 2YEZA 4M6AA 3JWDC 4PUBH 1MCFA 1EHXA 3ZT5A 5K93A 3KPMA 5DJDA 5IFAH 3L7EA 5IF0A 1W0WA 4GRLA 5DMIL 3TP4A 2G60L 3ZDZE 5HGDA 4X6CB 4Y8DC 1ND0B 2DN7A 1PEWA 3QDMB 4RDQG 4QHKI 4NHUB 1RZ8B 4TULH 5C0BD 3T0EA 1FZOB 3OPZL 5IT2H 3IJHA 4Z7WF 3WE6A 5GS3A 4KTDH 4DGVL 3D2UB 4R4BA 3GSNL 3HZVA 1HE7A 1R24B 3FB8A 5EO1A 5JHDE 3INUH 4XMLH 1K8IB 1FL3A 3BAEH 3SDCA 3ARGD 3D18B 5E4IA 2EKJA 2W0KA 1Q0XL 2OR8A 5B8CC 5I17A 4OD1L 3I6KA 5ID0A 5I2IB 3PP3K 1ADQH 4QHUA 7FABL 3BH9A 2P8LB 4P5KB 4G9FD 2KZ1B 5GRYA 4KPHL 3MOAH 1YA5A 4JO2H 5AEAA 2Q1EA 3O8XD 4JG0L 5KW9H 1YN7A 4MDIB 3L3KB 5KSAA 4LVHC 3MACL 1IQDB 1HHGB 3G9AB 1WIPA 4N0UA 3ZE1F 3CSPA 3TO4B 3ULVD 3E2HB 5BW7A 4NWUL 1KCUL 5TDNB 3LH2H 1R5IA 4JQXC 4KXZH 4AIZB 5B21A 1DQDH 3I3BA 2AKRB 5B39A 2B4CC 2QQLH 4I18A 3QULA 1BMGA 1JHTA 3PQYE 4LRIC 3VH8B 3QBTB 4Y4KD 3QIWD 4U1NA 1A7RH 1O7SA 5E4EB 3JTSB 5DJXB 3UAJC 2A6IA 2F54B 3MXVH 5F1IB 2UZXB 4LGPB 3HNVL 4HZLB 3B4NA 2F8VA 1U41A 1F02I 5DWUH 3HUJB 5C7XH 3C6LA 5F3BB 3VFWA 4P23C 3BH8A 5CCKL 1Q1JH 3QHFL 3L3HB 4M7ZC 4YDIH 1FG2B 2IPUG 1NUDA 4N5EC 4UUJB 2EDQA 1CDGA 1IGYA 4OQ1A 3JTTB 3H6JA 1NBQA 3RY4A 3C5ZC 4P4KA 1CD8A 2F74A 5B38G 4FABL 4OZIA 5C0DB 5J56B 5CEXA 3HAEH 4JO1H 5BV7H 2ICWA 4U6XA 1AHWB 1OTTC 1IGCH 4F8TA 4PB9H 1U8HB 3T65A 1MHEB 1WLHA 5F7UA 4P49A 2HT3D 1H3PL 3CPLA 4L4TD 5J6GA 5GRWA 4ZXBB 4PJIA 3VG9C 3EYFB 5FYKU 2OYPA 3JSSA 1F3DJ 1KIPB 1GPOH 4PJGE 1HNFA 4JAMB 3RZCC 1T1YA 3V95A 1I1YB 1YMMB 5TQ0L 1J9CT 2NY1B 3ULUD 1UM6H 5D7IE 1XGTA 5FAAA 2D4FA 1U8MB 2L0DA 4HDIB 3CFEA 5DT1L 5E8OB 5J7CC 4ZODA 1Z9LA 3SDYH 3VI3E 2HJLB 4M7JH 2PW1A 2OK0H 3PWJB 2P8PA 2R56L 2OP4L 5E2VH 2NY7L 1UWXK 4YX2H 1QKZH 1QLRA 5T1LA 5T1KB 1H8OA 1VEPA 5F21B 1T7VA 4JY5L 1CL7I 2IMNA 1UH2A 4JKPH 2B7DT 2MPAH 2UY6A 4FFYH 3WXWL 3D87B 3BFOA 3P9MB 2XN9D 3V6OC 1IGTA 4KUCD 3O0RL 1VFBB 1QRNE 2HH0L 3RRQA 3N85H 5BJTB 5DD3H 1BD2B 1XH3A 1RZGB 4TVPH 2WK2A 5A1AA 4PRAB 3BX7C 4JRXA 4LK4A 3VXOB 1L0XA 4QXTB 3DUSA 1J05B 1NMCC 5F88A 4RFEA 3MGOB 2AQ2A 2V7HB 5D7LD 4Y7MA 1BAFH 4L8SC 3ALXA 3RX7A 4LLMB 2FX8H 2F53D 4G6MH 2CK0L 4QTHA 3WL9B 3QFJB 1VA9A 4BK4A 1G7JB 2DQJL 1S9WB 5E8DL 4JCLA 2QTEA 1WFOA 4TPRH 4LCYA 1G9NH 2NX5D 2I24N 3LQMA 4NIKB 5FKPA 3FO9A 4AY0A 2BSSB 1M6OB 2YEZB 5C0FB 2I5YL 3DX7A 4ODWA 5DMGC 3KPMB 3ZSTA 3TCLA 5DJDB 1FGVL 3L7EB 1MHPL 4KKAC 1W0WB 5IF0B 4GRLB 3JWOC 4NQVA 1MCWM 4PP2A 2VDOH 3BKJL 2A0LC 3U4AA 1MEXH 4NKIL 3UAJD 3JV6A 5JOPD 1OD9A 2QEJA 2VXSL 3WE6B 3QWRA 4YWGL 4R4BB 3VFNA 2Y06L 4TUKH 4OSUL 4LCWB 3HZVB 5IJKC 3B2VL 3FB8B 1QTYT 1OHQA 4JKMA 4P23D 1RZIA 3MRFA 5D1ZA 1FL3B 3WIHL 3SDCB 4X7TA 4N5ED 3ARXA 1CI5A 5I17B 2JELL 4LPTA 4I0PA 3GI9H 5ID0B 3I2CL 1EEYB 4WFHE 4QHUB 1HZHH 1GZPA 1D5BB 3BRGC 4YHIA 2NY5H 3C5ZD 4OLYH 3EDKA 1I4FA 3EO9H 2EIDA 4ODHL 4YFLI 1S7RA 2JJTC 3GMQA 3FCTA 1G9MH 1YN7B 2E7MA 5KSAB 4PJDA 5C08D 4N0UB 1OTTD 4NWTL 3VFUA 1YEKH 4AJ0A 5E6IC 4H20H 5KVMC 4AL8H 3AC0A 3GSXB 4HUMB 4OF8A 4BM7A 2OMNA 5I19H 3B9DA 4KVNH 4WW1B 4MNQB 2C1PB 1FZKA 2ENYA 5B39B 4I18B 3QULB 3LDBC 4NQTA 3ZDZF 1JHTB 1NQBA 1IGML 4JCMA 2D7OA 4BQCA 3TEUA 2DYPA 1V8HA 1OAQL 3RZCD 2HKHL 1JNJA 1WAAA 3OKEA 5D72L 4MXWH 4NP4H 2A6IB 2R29H 3EYUL 1CT8A 2DDQL 4LLVA 4OFDA 1NPUA 4JQVA 4M48L 3L5JA 1U8QA 3PV7A 4UNVA 4X6CE 3C6LB 4X80L 3VFWB 3BH8B 3QDME 2PUQT 1YNKL 2J1KA 1Q9LA 2CLVB 2EXWC 3QEQD 3S36H 8CGTA 1IGYB 3VU2A 4QEGA 1WTGT 2ADFL 5D6CA 1B88A 3QZWA 4P4KB 4ZAKA 4U1JB 3TF7C 1RJLA 2F74B 4JZNA 5I18H 3WUWA 1MHCA 1MWAH 4NM8L 1SJXA 5CEXB 2ICWB 1E4KC 1IGFH 5T5NG 4JB9H 3QIUA 3CPLB 4Z76A 4KKBC 5J6GB 1OY3B 1I1AC 1OARH 4PJIB 1NDMA 3G5XA 5E99L 2FB4L 5ISZA 2DQEH 3VXRD 2WIIB 3HR5A 1JNLL 1G6RA 3U9UA 4N8CH 1T1YB 5ESAA 4ZFFA 2GFBA 5HY9A 5JXAL 1J1PL 4MQ7A 1Q8MA 4HKZA 2ICWJ 4LSUL 4DKFH 3C87A 35C8L 5BV7C 5FYKH 3CFEB 4OBSA 1T7YA 3VFTA 1QFPA 4OZ4A 3ESUF 1MCNA 2IG2H 2DBLH 4OLVL 4OCYH 1CL7L 2YSSA 5FDYA 4M93C 2PW1B 2V2TA 1IGJA 4KDTC 2P8PB 4I48B 5J57B 3HUJE 5CHNB 1QLRB 5T1LB 2AJSL 4F58L 1F11A 1K4DA 1LNUB 3MV7E 5DMGD 2FO1A 1FCGA 3KPNA 4H0GA 4QRPE 1PG7W 5I1LA 1IGTB 4KKAD 3LEXA 4YHKH 4X7SL 4EIZC 4X6BA 1RULL 4O02L 2A0LD 3MCKA 3WNOA 3U1SH 1XH3B 3W39A 3L3JA 4JFOA 4RAUA 3OL2A 1BBDL 4N8VA 1DQJA 4UV7H 5GS1A 2GJZA 4JRXB 1JWUB 3P4LA 3DUSB 3BT2L 3CC5A 4U1KA 5F88B 4RFEB 4XVTL 4HS3A 3BP5A 3T3PE 3A6BL 1XGUA 3K2UH 4ODTH 5D7IF 3FHQA 3GSWA 4MA1B 5IUSA 1U6AL 3MLRH 1V5JA 5KS9B 4N9GA 2VUYA 4IMLA 3PXHA 5T1DL 4IOFC 3GBMH 3EAKA 4KQ3L 4C55A 4DFIA 1EFXB 3O6FC 3K8KA 4GKNB 4LCYB 2Z92A 2AEQH 2D03L 4MA7L 3JVGA 3SBWA 4L4VD 5E6ID 4LVEA 1MPAL 4X9HA 5D70H 1TTGA 4DTGL 4W4NA 1JCKA 1GIGH 1UWEH 5HGHA 3SDXB 5MENA 1CDIA 1RUPH 3DX7B 4JHWL 1KYOJ 2NYYC 1HIML 2R0WH 3DXAA 4LQFH 3ORJA 4NQVB 4OZGA 4RISH 4PP2B 1QFOA 2AK1L 5EU6D 3VCLA 4LSQH 1PLGH 1YNLH 2B2XH 1FVDA 4KI5E 1T66C 1BFTA 4S10A 4O5LL 3VFNB 4MHHI 1RZIB 1IEAA 2H1PH 2W9EL 4ZNEA 1OSZA 4X7TB 3SGDI 3F5WA 4ZFOL 1LO4L 2EXWD 1XCQA 3K4ZA 4I0PB 1WCBB 1YYML 1I85C 4YHIB 3BEVB 3QPQC 4FQIH 4HWEH 4LSSH 4MXQC 3QCVL 1S7RB 1KB5B 3GMNA 3G6JA 2PO6A 1E6JL 1FC2D 3CDGA 3GMQB 3FCTB 1JNHA 4LGRB 4P46A 4RA3A 4XPTL 4HQQL 1N8ZB 4I4WA 4PJDB 1SMAA 4PJBA 3VFUB 3QFJE 3V6FB 1FHGA 4GBXA 4G7YH 4P2QA 4KKBD 3SKUD 3R06A 1I1AD 4ORZC 2ZCHL 3DVIA 2J12B 4F57H 3M45A 3PWPD 5J9PB 4OCRL 5LWYH 2YUVA 1CICC 1BREA 4FA8A 1RZJH 3C09C 3BESR 5JW3L 3VFOB 5IB2B 2OI9B 2NXZB 5D4QA 5LQBL 2NTFA 4FFWC 2P1YA 4UZGA 4WWKA 5B38A 2NY5C 5DVLA 4MQSB 3RIAK 5DJYA 4M3JA 5FUZL 5SWSA 1CXLA 4X6EA 2JB6A 3QYCA 1G9MC 5GRZA 1J0IA 2GUOA 1U8QB 3CFJA 4HBCL 1I9JL 3UJIL 2XKNB 3OAUH 2P24B 2E27H 3AB0C 3I50L 3QCUH 1Q9LB 3T0EE 1A0QH 3OWEA 4AMKH 3QRFM 1DBKL 4G6FD 1UKQA 5JNYA 5D6CB 1QUNA 1I3RB 3QZWB 4ZAKB 1RJLB 5DK3A 3DX6B 3ZHLA 3TNNB 3BO8A 3ROLA 3WUWB 1MHCB 4M6OL 5EPMB 3HE7A 4OUUA 5HHME 1NUFA 2BVPA 4GRWH 2DQIH 4M9PA 5D71H 3QIUB 5DZOA 3LMJL 1HH9A 4BZ1H 4G9FA 3T2QA 1LE9A 3K1DA 5D93C 1KJMB 3IRZA 1NDMB 3G5XB 3O8XA 4N0UE 4YE4L 4JE4B 3V5KA 5ISZB 1L6ZA 3HR5B 2GI7A 5ALCH 1G6RB 3U9UB 2MQ0A 1ZHBB 1K85A 4RMVA 3VFPA 4OF6A 5INDA 2GFBB 4KC3B 5HY9B 1UG9A 4ZFZA 3CVHH 4K7FB 2VDMH 4JRYD 4MQ7B 4NDMB 1KYOK 2A1WL 4X6CF 3RVVC 5AD0A 3BD4A 3VFTB 4BFIB 4Z6AT 3Q48A 4OZ4B 4IOFD 2X4PB 2YBRB 2YSSB 4K3GA 3O6FD 4JHZA 5KVFH 2V2TB 3BZEB 1IGJB 3O4OC 2VN4A 3MLUH 1CGXA 4TVPD 4R7NA 1Q0YH 1YPZB 5ADOH 3MJ9A 3SDAC 1F11B 1XF2B 1SMOA 1OP3K 1RUAL 2YD8A 4HUVA 2G75A 5CGYC 2QHLA 2CKBH 2NYYD 5I1LB 3NMEA 4PRPB 4TSAH 3LEXB 3BPOC 5F9AC 1OTSC 1WT5C 2X7LA 4D0BB 2D7TH 3MCKB 4OZIE 1RJYA 1ZLSH 5GGRY 4LU5L 3W39B 3L3JB 4JFOB 2I60H 2VSDA 4PJ9C 4N8VB 3O11A 4RAUB 4U6VL 4XPBH 2GJZB 3AU1A 4YEEA 1T66D 3O9WA 2ZUVA 3CC5B 3TT1H 1WEJL 4HS3B 3NGBB 3BP5B 1QA9A 1FAIH 1FO0H 4PJIE 1XGUB 2F5AH 3HI6L 3QEGH 3GSWB 4F3FA 1RURH 1XFPA 2YC1A 1LO2H 4N9GB 1QLEL 4IMLB 2EDKA 2IPKA 4XP6H 5FYJD 3QPQD 4MXQD 3G6AA 3QXWA 2R4RL 3WO4B 1JWMA 1ZSDA 5IBLC 1NBVL 4XAWH 2OTPA 4BSVA 3HUJF 2Z92B 2VC2H 4MJ6A 1FDLH 1X5IA 3M8OL 4OAWA 1PYWA 2FLBT 2W65B 4H1LB 4JPVL 4W6YB 5DC9B 5GS0L 3ZTNH 5K9QG 5MENB 1AE6H 2CO7B 1M1SA 2XA3A 4BJLA 1CICD 3NOIA 1EBPA 4WI6A 3DXAB 3PHSA 4OZGB 1L7TH 3UZQA 3JUYA 4FFWD 4P0DA 4NQED 2BRQA 3VXUD 2VIRA 3VCLB 2AK4D 1FVDB 1MFBH 4AZ8A 1C8PA 1S7UA 4I13B 1SM3L 3MFFB 4TQEH 3T3PF 4YHOL 2EDTA 1EXUA 1KJ3L 1IEAB 3BPLC 2EH8L 1OSZB 5E2UH 3F5WB 4QRRB 1XR9A 4JRXE 1CFNB 1HYSC 5CKAA 1ZVHA 4KRNA 4G8FB 3DYMA 1NLBL 1Y0LA 2EH7L 2YD7A 3LD8B 3CDCA 3VXMD 1FGNH 3GMNB 3G6JB 2CLRB 2PO6B 3CDGB 1MCOL 4P46B 4XPGH 1JNHB 1GGUA 1MCPH 2VLJD 1MFCL 4I4WB 4Z0BL 4PJBB 1WITA 3SQOH 3VI4E 4GBXB 5GS2H 5MP6L 3IYLW 1IRAY 4P2QB 3DO7A 3MLYH 5DRNA 3L5HA 3R06B 4OFYD 4JPKH 1ES0A 1A7QL 2BNQD 2FWOA 4CVUA 1BFVH 3MRJA 4AG4H 2NX5A 3DJ9A 2NTFB 4LNRA 4WWKB 3IDJB 4I2XB 4OGXL 5B38B 1X5AA 2IWGA 1G1CA 4BSJA 5AAWA 5SWSB 4KI5F 4X6EB 2JB6B 3PWLA 4F15C 3KR3L 2E3VA 5DMIH 2G60H 2NY6B 3RVVD 2GUOB 3CFJB 1A1OA 3GNML 2ATPA 4ZNCD 3OPZH 2APWA 3SGJC 4APQC 5CILL 4JHAH 4D9RD 4RWYL 4JPIA 4DGVH 5CJXA 4NO5B 2ZJSH 3GSNH 3O2DL 4XPAL 5JNYB 1J5OL 3SDAD 5CWSB 2J7LA 5DJ6A 1HH6A 2FJGA 3O2VH 3BO8B 5KZCB 2EYTB 3ROLB 5J6HA 4OD1H 1DUZA 3FN9A 3QO0A 4P23A 3HE7B 4ZS7L 2A6KB 2X4RA 5CGYD 7FABH 1TZHA 4YDJB 2BVPB 5ESQB 1K6QH 2GW5A 1Z3GH 1OTSD 4MLIA 5I8KL 5E2WH 1PZUB 4JG0H 4X99B 4G9FB 5EUKA 1LE9B 3MACH 4PJDE 1UM4L 3M1BA 4PJFB 4PJ9D 3O8XB 5I1DA 4NWUH 3V5KB 1X7QB 4LCUA 1KCUH 4KZEH 4QYOA 4B0MM 1RK0B 4G7VH 4KUZH 3FFCA 5INDB 5F9DC 1T21A 4ZFZB 5DVNA 5CEZL 2R1YA 4X9FA 3IU3A 4OQTL 2AXHA 5AD0B 2JJSA 1NLDL 4ODUB 5TFSH 4B41A 1WAAE 3KYKH 4JEGB 2BP3A 4Y4KB 2FSEB 1U2HA 3HNVH 5IBLD 5LGKA 5E08L 4R7NB 1IFHL 3BKYH 2J8UB 3WJLA 3IU4L 3QHFH 3ZE0E 2LTQB 1BQUA 4HUVB 3D9AL 3WFCL 1HWGB 2ERJB 1MQKL 4ETYA 1LO0L 1OWWA 1AXIB 1H0DA 1DZBA 5JXEC 4L3ED 4YAQA 5K59F 2P48B 4BKLA 1KULA 4FABH 4OLUH 2X7LB 3L3OB 3V7AG 3UYRL 3HG1A 1RJYB 4O00A 4HS6A 5D96C 5TE4H 3O11B 2KBGA 2P4AB 3U4EA 2X4OA 3O9WB 3S88L 3FO2A 2RHEA 2C7UA 1H3PH 3G5ZA 1QA9B 3IDIA 2APXA 4GS7C 4L4TB 1EO8L 3VGGA 2VDNL 2YC1B 3B3IA 5ISZE 1HYSD 2IPKB 3CMOL 4CDGC 1KFAL 5TQ0H 3DROB 2EYRA 3QFDA 3G6AB 2E5EA 4PRID 1JWMB 3WCYA 2ZG3A 1ZSDB 3TT3L 4BSVB 3U46A 3G5YB 4MJ6B 2IAMC 3IDNA 1ZVSA 1T7XA 4OAWB 1PYWB 5HHQA 4DN4L 2P8MA 3EYVB 2VUOA 1DEDA 1FNGA 3CUPA 2OXHA 5IMLA 3GB7B 4HLZH 4H8WL 1U3YA 5IQ9A 5I71B 1IEHA 5L8LB 3GFUA 5C09A 5HD8C 2EE2A 1NAKH 4JY5H 5I15L 1NGQL 4QHMB 2KZWA 1J1OL 2WNGA 4CMHC 2VIRB 3WXWH 1LO5A 3IS1X 3R4DA 4LARL 3UPCA 1CLYL 1R5VB 2HT4C 1S7UB 3NTCH 1P4BL 3O0RH 3KLAA 2HH0H 4U6TA 1S5HA 4NC2B 4Y5YC 2XN9B 2QLVB 3VMPA 3W82A 2H3NA 1EXUB 4PJIF 5D6DC 2K3TA 2Q7YB 3TNMA 1JV5B 4W4OC 4APQD 1XR9B 3TPUA 1NAMH 3IDYC 4EKXA 4J3VA 1MRFL 1Y0LB 3F58L 4YEFA 5LGJB 1MCCA 2GJJA 4U1LA 3OB0K 2DQFA 1BP3B 4X4MA 3CJJA 1NCDL 2K9UA 5CLWA 4K9EL 5D7LB 3RNQB 3NCJH 4IMKC 3P77A 5I8OL 2CK0H 4Y2OA 3GSQA 1ORSB 2R2CA 3RWGA 5B8CB 4HHAA 3IVKA 1DLFL 2F53B 2OJZH 3PGFL 5A3IC 3L9RA 2ESVA 3MRPB 5MI0C 5TDOA 4NRZA 3DO7B 5FYLE 3HCVB 4U49A 5DRNB 1D6VL 5IMOB 1X4XA 15C8L 4GG6B 5GGVY 2ZUQC 1BWMA 2FWOB 1CGTA 2NX5B 4WUUA 1S7VA 1EEZA 4KV5E 1I3UA 5IESH 4LNRB 4L4VA 2BSRB 5MENE 2I5YH 4L9LA 5JPNA 2VXUL 4PRBB 2VABA 3Q2CA 1MHPH 1FORL 3DXAE 4JREC 3AUVA 4OZGE 1J11A 2DQGL 3BKJH 3HE6A 4LSTL 4NKIH 4XWGL 1AO7D 1A1OB 1HXYA 3CSYA 5SX4H 5CD5C 4E41D 2ATPB 1I7UA 2VXSH 1I9EA 3HNSL 5EFIB 4JPIB 4YWGH 5IBUG 3I3EA 4PREA 2Y06H 4LPVA 4OSUH 2GSGA 3B2VH 2GCYA 2VO5A 1R5WA 3T0BA 4RAHA 3WIHH 1J1XL 3BQUA 4ZNEE 4Z78A 1HH6B 2FJGB 4NHCL 1MNUL 2JELH 3E8UL 1DUZB 4P23B 4XVJL 2Z8SA 3I2CH 4OF0A 4M7ZB 1P9MC 2JK5A 1RAMA 4KKNA 5JXED 1TZHB 2IBZY 2EDEA 2KQNA 3MLWL 3VI4F 3TESA 1YEJL 2HVJA 3CX2A 1IQWL 5AG8A 3UTZA 3G6JE 2WWKO 5DJ2A 3C5ZB 5ID1B 1RUQL 4KRPC 4PJBE 4NWTH 3M1BB 5I1DB 3FB5A 4KMTL 1DBAL 2H45A 4U4BA 1PG7X 4QYOB 2FGZA 3O3BA 1QOKA 3SDXF 1SYVA 5E9DA 4P2QE 2BY2A 2YWZA 5E00A 4HWBL 3BPCA 1T21B 3C2AH 4NN6C 4S1QL 2R1YB 3BVNA 1MFEL 3KPRA 1IGMH 3VFRB 4X8JA 4K8RL 3R0NA 5TDPA 2R2BA 4NQSB 2HKHH 5J11C 2DMKA 2MHAA 3WFZA 4S0TD 3EYUH 2C3HA 1AD0A 1MSPA 4O2FB 2E8YA 4WGWB 5SWSE 5JW4M 1N6QL 3K80A 2CJUL 1A6ZA 2I27N 3T0XA 1FJ1A 4MX7A 2IAMD 4UQ3A 4EQ2A 4X80H 1D5IL 5HHPA 5IGXH 5CGMA 3VG0L 3MBEC 3DRTA 1N4XL 2ED7A 1TMCB 2ADFH 5JQ6L 4YAQB 4KKCC 5FM5O 1DL7L 3QEQB 4BKLB 2W07A 5HD8D 5T1MA 3OJDA 1UJ3A 5DD5H 1OGAA 4U3XA 5EZIL 5CIPA 2VQ1A 3HG1B 4PJDF 4NM8H 5F1KC 4HS6B 1N5AB 3U7YL 2X1QA 4MS8C 4E42B 3EJZC 2HT4D 1TVHB 3MLSL 4F33A 2E7HA 5EORH 3U4EB 2X4OB 1X5GA 4X9IA 2C7UB 3G5ZB 3RQ3A 2VDKL 1UZ8A 4G9FE 3IDIB 3P9LA 4RGMC 5E99H 3V7MA 3W11C 3B3IB 1JNLH 4H26A 4MSWB 5GIRA 1I8KA 1P5VA 4FQHB 1WAAF 3ULVE 3BIBX 5I6XB 5JXAH 2EYRB 4NO3A 1NMCB 1T0NA 4HWNA 4P4RA 1MI5A 1J1PH 1EGJL 3HI5L 3HLAA 1BX2A 4XI5C 4L8SB 1YZZA 2MQ3A 35C8H 3QSKB 1A1NA 1ZVSB 2R0ZH 5HHQB 2X6MA 4QRTA 3IDUA 4L3CA 2P8MB 5A3ID 1FNGB 4OLVH 4XGZA 3CUPB 3DSFL 3T0WA 1CL7H 4Q9BA 3KS0J 4NT6B 4ZPTB 5IMLB 2IJ0C 3RDTA 3UO1L 5IQ9B 4F58H 5C09B 1JGUL 3W81A 3QUKA 1P2CA 5DTFA 1KGCD 4L29B 1LO5B 1SQ2N 1A64A 1RY7B 4ODSH 3GIVA 1NDGA 1RJZA 4NCDA 3W9DB 4HUWA 3RKPA 3KLAB 1RULH 4O02H 1S5HB 3C60C 1QHPA 1WK0A 2EYSA 4I3RL 4KVCL 1Y6MR 5EN2B 5GS2D 5CD5D 1I8IB 4CVWA 3G08A 1DN0A 3ARTA 3TPUB 1Z6JT 4QOKA 4XVTH 1TJGL 3MRQA 4L8BB 2ZG1A 3EBAA 4Q9RL 3A6BH 4U1LB 1FP5A 2DQFB 3U0PA 4HMCA 3PGCA 5HDLA 2VTFA 1JGLL 3H9ZA 1U6AH 4R2GB 3P77B 1FNFA 3EOBB 4YPGB 3GSQB 4YGAB 4XAKE 5T1DH 4NNYB 4EOWL 1WJ3A 4Q58C 3L9RB 4XBEL 5GQBA 2ESVB 4NRZB 2ARJA 1I85A 2V7NB 1QBML 2W91A 2DBJA 3B9EA 1F4YL 4Y2DA 2D03H 4G3YL 4NJAL 3NCEB 4KRPD 3FQUB 1MPAH 4DTGH 1S7QA 1S7VB 1EEZB 3DETC 4L4VB 3MRRA 4WFEE 4YC2C 3D6GA 4GSDH 4MJ5B 1IM3A 2P7TA 4L9LB 4DW2L 2DM7A 1HOCB 2VABB 1I7RA 3MV9A 2B1HL 2FIKA 5FGBC 3HE6B 2HMIC 3BW9A 2AK1H 3EJJX 3MRHA 1HXYB 4XNXL 1I8MB 3JV5A 4QTIL 1I7UB 3WLWC 3G5VB 3VD9A 2DL9A 4NQEA 4AT6A 5EU6B 5LG1A 2EDFA 4PREB 2GSGB 2FJFA 2YKLH 3BQUB 3MBED 4Z78B 1FBIH 1LO4H 3A6CH 1Y18B 3WBDA 5KSVB 1VGEL 3T8XA 3MV8D 2ZSVA 4HH9A 1MJ8L 1TNNA 1YYMH 2JK5B 3FAWA 4LAQH 4PJ5A 4KKCD 2PETA 4DK3A 3OJ2C 3IAPA 2HVJB 3BEWA 3AAZA 3QCVH 4RDQF 5MEPA 3V52L 1KCLA 3LQZB 2DQTL 4XPTH 5JW4N 3UTZB 5DJ2B 1GOHA 2HJFB 4HQQH 1YYLL 5C71A 1EIBA 5DLML 1T6WA 3MRLA 4MS8D 4M4PA 4HUKB 3V6ZA 4F7MA 3EJZD 3PP3H 3FB5B 2FR4A 5F93C 1HKFA 4KV5F 4M5ZL 1T03L 3TA3C 1F58L 3O3BB 1SYVB 1WTLA 4W6XB 4Z7VB 3X11B 4Z7QE 1CFSA 1QSED 2ZCHH 2HWZL 3BPCB 5IHZA 3IXAB 3W11D 3SGEI 5DS8B 2A83A 3KPRB 1I1AB 4OZGF 3H3KA 5JW3H 4AIOA 4XMPL 5LQBH 4X8JB 4ZS6C 1X4ZA 3IB4A 2NX5E 5TDPB 1SEBB 2R2BB 5KAQF 2MHAB 1RHFA 2P5ED 5FDWB 5DI8A 1WFNA 4DVBA 4WW2A 5DJAA 2ADGB 3QAZC 4XI5D 1A7PH 1A6ZB 2ATKA 2AJUH 3CXDH 4HBCH 1I9JH 4MX7B 4UQ3B 5HHPB 2Q6WA 3HAEB 4WY7L 5BV7B 4ZOAA 1ZLUH 3RGVA 2WBKA 3DRTB 3T2OA 2ZUTA 4M93B 3LCYA 2QADC 2YZ8A 5T1MB 1HWHB 3BIKA 3G6JF 2APBA 3WNNA 4DUXA 1NANI 2WP3O 1OGAB 5IWLC 3U6RB 4M6OH 2VQ1B 5MEOA 4PJBF 2FH6A 5DDHB 5T3XE 4F33B 3RWJA 1NCWL 4KTYA 2C5DC 2RB8A 5SX5H 2Y6SC 1J8HD 3LMJH 3C60D 5TJWK 1W8OA 3IFLH 3RWHA 3P9LB 1FFNA 1MCJA 4YE4H 1UH4A 5SWZD 4H26B 2EE6A 5GIRB 1R3IH 1I8KB 4U1GB 3W5MA 2Z4QB 3RGHA 5C2BL 2NTSP 5KOVC 4D2NA 1ZT7A 3FFCE 4NO3B 5DK2A 1T0NB 1R6VA 1ACYL 1KTRL 3D3VA 4XC1L 2A1WH 2PXYC 3CDFA 3ARBA 2GTZA 3PNWA 4YZFE 5HVFB 4KQ4L 4QRTB 3Q5YA 4L3CB 4LNVA 4XGZB 1A7OL 3MV01 5BMFL 3O2WL 1S5IL 4UTAL 3UTQA 3RDTB 3Q3GA 2BVOB 4UILL 1D6EA 2VWEC 2WQRA 5FCUL 3TYGL 1RUAH 1IAII 1P2CB 3DETD 1FYHB 4FQXA 2LU4A 1OSPL 4G43A 4QT5A 3MO1A 3L3GA 4JFED 4K3JL 3GIVB 1RJZB 2VXTH 4HUWB 4P3WA 1IL1B 4L3EA 2HMID 2IF7A 5CJOL 1MCKA 4LU5H 1FN4A 3HG1E 4PV9B 1F3JB 4UT7L 1A7NL 5IV2A 4PJFF 1KXVC 3TBVB 1I9IH 3T08A 3WLWD 1G0YR 2C4FT 3FZUC 4ETQB 3OXSA 2UYLA 3G08B 4HPOL 2GJ6D 1DN0B 4P2RD 5DEZA 2YWYA 4QOKB 4GW1A 3V0VA 3ULVF 3MRQB 1WEJH 4HF5L 4I5BA 3BSZL 1OAKL 4WO4C 3U0PB 2XG4A 3NPSC 3S34L 1WV7T 2H8PA 1KENL 1NBYB 4WHCA 1QLEH 3MUGA 2MKLC 3SCMC 1BIIA 2J3SA 2FZ3A 1EZVX 2IPTL 5CMAB 1MFAH 2R4RH 2APVA 5F9JB 2ARJB 4UQ2A 4WHYH 1NBVH 4Y2DB 1ZHKB 3M8OH 5J8OA 1ITCA 1S9XB 4EI6A 4GMTL 1S7QB 1PG7L 3QDAA 4JPVH 3TA3D 5HGBA 1EUTA 3FTGA 4Y89A 1IAOA 3UDWA 3MRRB 5GS0H 2P7TB 4LLWB 3CFBA 4ZDHA 2B8OT 2VLRA 3X3FH 1I7RB 3MV9B 3KDMA 5C09E 4F7EA 1BQLH 2FIKB 4ZS6D 4GXVH 1O5DT 1D9KC 2BSTB 2WLZA 5CZVH 1S7TA 3BW9B 3MRHB 3C09B 3SEPA 1A02N 4LKXA 4MAYA 4NQEB 3HKFA 4AT6B 1SM3H 1Q72L 1T5WA 2ICEA 4NQCD 3WSQL 1KJ3H 4B5EA 2EH8H 4PJ8C 5INCA 1FYTD 2EIEA 3T8XB 2ZSVB 2HA1A 3CU7A 1U91A 2EH7H 3SGJA 1QNZL 2CDEB 2QADD 3AAZB 5MEPB 1Z2KA 4X4ME 5K9JL 2ED9A 3JV4A 1MCOH 2A6JA 1MFCH 4Z0BH 3ULUF 3BWAA 2VLME 3MRLB 1KIQA 3WS6A 3V6ZB 4F7MB 4PB0H 1F3DH 2XRAL 2FR4B 2MJWA 5MP6H 2Y6SD 4ZTPH 4CU6A 1EDQA 2ESVE 2FDBP 1F97A 1EHNA 1CFSB 5IHZB 1OVZA 4Z95L 1JYNA 5FKAA 3RA7L 2EICA 2A83B 4I9WD 3UTTD 4QF1A 3WFBH 4WUUE 1KEML 3U7AA 4OGXH 1CDYA 4L4VE 1KNOA 3U30B 5F96L 3SJVA 2YHGA 2LVCA 4WW2B 5DJAB 4U05A 4YO0B 3KR3H 2PXYD 2ATKB 4M02A 4HULB 2X10A 3PABA 1L6XA 5IVXA 1MWAB 2Q8BL 3MSPA 4BQBA 4EN3C 1KTKE 5MHSD 4I3GA 3HMWL 3VGEA 5IJVA 3RGVB 3NIGE 5CILH 4ZPVA 2OTUA 4XBGA 4WI9A 3D5OF 3O2DH 1J5OH 2HT2C 3VD3A 3O4OB 3BIKB 2P49B 1C16B 3SDAB 3D25B 3SE3A 4ZS7H 1G7LA 2QQNL 1KBGL 4ONHA 3RWJB 1JE6A 2HFGL 4IRSA 4JM2A 5I8KH 1CD1B 2YR3A 3Q6GL 1DQTA 3CVHA 3GSVA 3RWHB 1VHPA 1UM4H 4GG6F 3HNTL 1FFNB 1T0PB 4ONFL 3VWJC 1YEEL 2IFFL 4U7MA 1ZHLB 2NW2B 2C3VA 1OAUL 3MOBL 5E9DE 1H3WM 1ZT7B 3LIZL 4WO4D 4A6YH 2D7QA 3NN8A 4PG9A 5EOTB 4OQTH 3D3VB 3KPRE 4OIIL 1C1EL 5T5NF 2CO6B 3QI9A 3SCMD 1NLDH 5GSVB 3ARBB 2GTZB 3PNWB 2BVTA 1QEWA 4CW1A 3MNZA 3FQRB 1IAIL 5ESVA 2ZWLT 3LRGA 3KNBA 3UTQB 5E08H 3FRUB 3VXSD 3VXQA 3Q3GB 1OW0C 3RWEA 3DNKA 2VR5A 1D6EB 3IU4H 1Q9OA 3S8WA 3WHE0 3D9AH 3AM8C 1MQKH 1LO0H 4G43B 3RY6C 3MO1B 3L3GB 1NC4A 2E6PA 3QQ4A 4HUNB 3KJ6L 1FO0A 1U2CA 2D4DA 1D9KD 3UYRH 4L3EB 2Y25A 1OGAE 2KPNA 2B0SL 5ADPL 2V9RA 4Z7UA 1FN4B 1XMWA 2DQDL 1JZ4A 5ACLA 3HC3H 3OXSB 2UYLB 2FIRT 5HHXL 2AS5M 3U9PH 4URTB 3S88H 2QBWA 4YHLH 5TF1L 3QXVA 3V0VB 4IRZL 1CFTA 1F4HA 2XWTA 1BZ9B 4I5BB 4UOW0 2EECA 1OGTA 4PJ8D 1XGYL 2V9QA 3ZO0A 3PWNA 1Q9KB 1EO8H 5D6DA 2VDNH 3KXFD 2H8PB 3BZDA 3BPLB 1KJ2H 5TF0A 3MUGB 3CMOH 1BIIB 2VH5L 4KMQA 1KFAH 2FZ3B 2NR6C 3JUZA 1MI5E 5L9DL 1EO5A 4UQ2B 4JFZL 3TT3H 3P4MA 2A9NH 5F6IB 2EC9U 4V1DD 5IBUB 4G8EA 4HW6A 4DN4H 4EI6B 3PXJA 4LVNC 5HGBB 1IAOB 2FBJL 1RUKH 1H9VA 1H3TA 3AGVA 3CFBB 4GLRH 1UCBL 5JIHA 2DLHA 2R8SH 1HKLL 3KDMB 4F7EB 1T04B 2ZOLA 5I15H 1S7TB 1NGQH 5IHBA 1J1OH 2W9LA 1CFBA 3MRBA 4MAYB 4LARH 3UTSA 4BZYA 2ICEB 1T5WB 5IROA 4J3SA 4L8DA 4U2ZA 3S37X 5J1AB 4F15B 4O4YL 2WWMC 4EN3D 1WFTA 5INCB 4PRNA 4OIAA 3D0LA 3KPSA 1A6PA 4QOKE 5DMKB 3MLZL 3F58H 43CAA 2HT2D 4APQB 2E7BA 4RMWA 4TOYH 1UB5A 5JMOC 3QIBC 2Q3ZA 3JV4B 4OUOA 4K9EH 2A6JB 3TBSA 3EOAA 2ZSWA 5I8OH 3VW3H 1RSFA 5KSBB 3BWAB 4U1HA 1KIQB 1TJHL 1C5DB 5FEBA 3NH7L 1DLFH 2HKFL 3PGFH 3PL6C 4Z8FH 2OQJA 5DEFA 3B8SA 4EDXB 2E6JA 1H5BC 1D6VH 3WDHA 5GRJL 3RBGA 3DHJA 5FKAB 3VWJD 5EIIA 4TRPL 3ARZA 5EU7E 3QXDB 4ZQKA 1AKJA 3TIDA 1KNOB 3K46A 1TPXC 2NNAA 3GSNA 5CD3A 5FHAL 4XB8A 3AS0A 3MLVL 3MV9E 1B2WL 2ARJQ 2DQGH 3PABB 5IVXB 4XWGH 4L5FL 1A6WL 1CDJA 1AH1A 5E7BA 3HNSH 4ZTOL 5IJVB 4GRWB 4ZPVB 2OTUB 4NQEE 4XBGB 3GHEL 4S1DC 1EBAA 4OM0L 1J1XH 2XZAH 4O58H 3MGAA 4NHCH 5D7KD 4XVJH 2AABL 3ECBA 4OFVA 4J4PC 3EJYC 3MLWH 4PJ5E 4ONHB 1YEJH 1J0KA 2ICWI 3NIFE 4MB4A 4IRSB 1TIUA 4JM2B 1UC6A 3AMKA 3CVHB 3GSVB 1RUQH 4FN0A 4OFKA 4C56A 4NO0A 4KMTH 3QUXC 5HHOD 1BJ8A 3H9YA 3PV6A 4HWBH 4K07A 1GXEA 3PG2A 3AVEA 3FN3A 4S1QH 3NN8B 4PG9B 5SWQA 3BXNA 3QDGA 1QSEA 3GSRA 4FFZL 2OR9L 4K8RH 3QI9B 3GSUA 3MA7A 1F90L 4QXGH 3V7AE 2NR6D 5DK0A 3NIGF 2Z91A 1N6QH 1FNHA 5KANI 1KPVA 4DAGL 2CKBB 2WANA 2CJUH 5ESVB 1MRDL 2P5EA 2ZKHL 4LEOA 3WIIL 1WC7A 3HS0B 1HCVA 3VXQB 2MOVA 1A9EA 1D5IH 3IFOA 4PGDA 3I3DA 4WJ5A 3VG0H 1Q9OB 3ZSSA 3WD5L 1YECL 2Z8RA 2P42B 1U58A 5GGVL 3QNYB 1E4JA 1YEFH 2XA8L 3TN0C 1WCQA 5CKGA 4FTVA 1KUMA 1Q94B 3U7WL 1DL7H 1X5JA 4LRNH 1FO0B 1DJSA 5EZIH 4FP8L 1HINH 5FUCE 1G7QA 3U7YH 1MCHA 4C58B 4H25A 4PLKC 2DJUA 5E0QA 1KT2A 1WIUA 1HN1A 4KJWC 4Z7VF 1CFTB 2WWMD 2XWTB 3V8CA 3RVTC 3KJ4B 1OGTB 5I16A 5DRXA 2XY2A 3PWNB 5FYKE 2ID5A 4JANA 2CGRL 2CXKA 5DFVC 2O61A 4N9OB 2OJEB 1PSKL 1XIWC 1MJ7H 3QIBD 1TTUA 1RMFH 3RI5K 1EGJH 5EU3B 4JKLA 2VOTA 3CIQA 4XBPA 3D3VE 3P4MB 4Y4FA 3FOMA 3VGHA 4LPCA 3B9VA 4G8EB 2EXYC 3SGKC 1UADC 4K7PH 3P4NA 3PL6D 3UX9B 2E9BA 2Y36L 3IS0X 3L3DB 1XT5A 4M1CC 5MI0B 3RWCA 3BHBA 3UO1H 4EI5C 5DD0L 4KDWA 4GAJH 3V8OA 5H37G 1JGUH 3EFDL 3UCRA 2VXVL 4OKVA 2ZUQB 3MR9A 1CXIA 2YPKA 1NAMA 3MRBB 4KDVA 3UTSB 4D8PA 1GC1L 1KPUA 4JJHA 4F7TA 4L8DB 4I3RH 1FPTL 3DX8B 4OT1L 4OZHA 3DUUA 1HI6A 3RHWF 3BGMA 4PRNB 3D85A 4RFOL 4Q2ZB 5D1XA 3JXAA 2BNRA 1W72L 5CZXC 3D0LB 3KPSB 4S1DD 2DTML 2OLDA 1JMZA 5L0QC 4H8WC 43CAB 1FCCA 1UB5B 3OSKA 2CH8A 3SO3C 1PJ9A 5DURD 3TBSB 3EOAB 2ZSWB 4J4PD 3CFKA 3EYSL 1HQRB 3EJYD 4NN5C 5JA9A 1RIUH 4EOWH 1VFMA 3UXFA 1I1CA 1JGVL 5TPWL 1AR2A 1XEDA 3VFGL 4IOIA 4XBEH 1A5FL 4LLYA 5D7SL 4RMQA 1FNSL 1QBMH 1F4YH 4G3YH 3QUXD 1XF4A 1LD9A 5EIIB 1HQ4A 4Y5XA 3AFLA 1MCBA 2F8OA 4ZQKB 1AKJB 1PGRB 3TIDB 1PX3A 1NUNB 3KVQA 2OS7A 1WVZA 3GSNB 2NNAB 5IMMA 5CD3B 2F15A 5EOCJ 4K9EC 2VLRE 2B1HH 4NN6B 1T1XB 3OV6A 5HI5C 1VPOH 4NFCA 3QWOA 4WTXA 4XNXH 3STZA 4QTIH 3MA9H 3QUMH 5CSGA 4CNIA 1WBZA 2VDPH 3T1FA 5I75C 3VFSA 4ALAL 1RZFL 2KH2B 4NQDD 5DQDL 5EB9A 1X4YA 5F9OL 1VGEH 3ECBB 3VH8G 4X0KA 3TN0D 5CEZD 3VRJA 3ALWA 4LDOB 1ZA6A 1J87A 4HFWB 3V52H 3IKKA 2IANA 4HIHA 4TTDC 2OXGA 1YYLH 4WI8A 4MD5A 4C56B 4NO0B 2Q76A 4PLKD 4M5ZH 5ABDE 1T03H 3CFDA 4KJWD 1MVUA 5JIKA 4OCMC 3PV6B 3RVTD 1ZT1A 2HWZH 5SWQB 5DRWA 3BXNB 3QDGB 4D9QD 1QSEB 3GSRB 4GMSL 4XMPH 1RJCA 3BDYL 1WZLA 1M05A 4F9LA 5DFVD 3GSUB 1XIWD 3MA7B 4NRXA 1D3CA 5GHWL 5FOBA 2R0KL 5D2NC 5DK0B 3SJVE 2Z91B 1JIBA 1KPVB 1WZ1H 4KJYA 2JKXA 2P5EB 3NZ8A 4LEOB 1WC7B 1A9EB 4JFDA 3L6FA 5IVXE 1FZJA 2EXYD 4MJIA 4BA8A 4ZYKA 3IFOB 4PGDB 4WJ5B 1F4XL 4IDJH 5EO0A 1OCWH 4WY7H 3AY4A 1QO3A 4OKDA 1U58B 4GG8A 1V3LA 4M1CD 4EI5D 3ARFC 3MLXL 5CJ8A 3NIFF 4P5TC 4FTVB 2XWJB 5MEQA 1WGOA 5EOQL 2IBBA 4K8RC 1HHKA 1NGWA 1KCRL 1IC1A 1G7QB 4X6DA 4Y5VC 3LZFL 1NCWH 1ZTXL 2AXFA 1KT2B 1T5XA 5MERB 3TBTA 3A67L 3S37L 5BRZA 3RVUC 1H8NA 4JR9L 3PHOA 5I16B 4Z5RB 1RZKL 2B20A 1DVFA 2DI9A 5DRXB 2GK0A 2W9DL 3GHBL 4JPWH 5C0EA 2FBOJ 5CZXD 3GRWL 5C2BH 1H3XA 5BO1L 4PGEA 4WW2F 3RY5A 4UNUA 4F7CA 3E3QE 3OKKA 1ACYH 4XC1H 3QUZA 4XBPB 1M7IB 4ONOA 5EU4A 4Y4FB 4EJ1C 4ZG1A 3FOMB 2VSCA 4MWFA 3PP4L 4GQ9L 4KQ4H 4LBEA 3SHSA 4PJCA 1JHKL 3P4NB 4YHML 1A7OH 2XQYK 4GW4B 3PF2A 4D9LL 5BMFH 3O2WH 2OBGA 4CVXA 1S5IH 3MMEA 4NKQB 3RWCB 3BHBB 3LV3B 3EIFA 4UILH 2A9ML 1N64H 2G9HA 4FQCH 1U92A 3VXSA 5FCUH 4OKVB 4ACPA 1NC2A 3FT2A 2Y5EA 5C86A 2C4XA 3PHQA 1KG0B 4PJHA 1NAMB 1OSPH 3T77A 4XP5L 4K3JH 4YC2B 4D8PB 3SE4A 4UDTA 1KPUB 4NZRL 4ZSOB 5HI5D 5C1MB 2B1AL 4LVOB 4ORGA 5DD1L 4UT7H 2AQ3A 1A7NH 4OZHB 4Z7UE 1MVFA 3DUUB 1EFQA 1HI6B 2AEWA 4JGJA 1D9KA 3BGMB 3S4SB 3LKNA 4AEHL 1QFWL 5I0DA 1FV1A 4CMMA 3LRHA 4PRHA 1CVSC 4HF5H 3U48A 2GJ6B 3BSZH 1OAKH 3FQWA 5B3JE 1CE6B 3S34H 3VXNB 3CU1A 5DQ9A 4ZFGL 4JQIL 4Y1AA 5L2KD 3BD3A 1I9RL 5CSBA 4WNQA 2IPTH 4UAOC 5FA4B 3X14A 2D2OA 4LLYB 3OB0H 5ANMA 4LGSB 4TTDD 4H5SA 4U0QB 3O4LA 5H2BB 1G0XA 1SBSH 5FK9A 1XF4B 4YXLL 2PW2A 3U2SA 4GMTH 2VDRH 1HQ4B 4Y5XB 1TQCC 4X7FC 5T5FL 1NEZB 3LS4L 1D5XA 3TA3B 5AUMA 1JMXA 4ZOEA 1GZQA 1NKRA 1Z9OA 4YNYA 1BFSA 5D2LE 1FVCA 3GEWB 4QHKJ 3QWOB 1NGPL 5FM4A 2IH3A 3STZB 1EX0A 2IEPA 1XF3A 3NA9L 3KYMA 2M8XA 3UTSE 4CNIB 1WBZB 2CPCA 3T1FB 2XPGA 2VQUA 3H42H 3VFSB 1Q72H 3GUTA 3ARDA 1YEGH 4XHJC 1J10A 2IADA 4ELKA 4XHQA 1AY1H 3QAZB 1U93B 2R0LH 4HLJA 3IRPX 1RFDL 3VXTA 3STBA 4U3CA 2XZZA 4Q6IC 3RWDA 3KPSE 5CUSL 2YPLA 3ARFD 1JN6A 4P5TD 3VRJB 4OD3L 1KELL 5D8JL 1QNZH 4LPXA 2AJXL 4K8RD 5K9JH 2IANB 4HIHB 1G6RL 5HYQA 4V2BA 1UEMA 2FATL 4MD5B 4U1MA 3KPTA 1CFVL 1S3KH 2I25N 2XRAH 4HIIA 4HUXA 2Q76B 3VD4A 3CFDB 3ARVA 3RVUD 4X7DC 3VRIA 3OGOE 3DRQB 3MRMA 1MAML 4Z95H 5E95B 5DRWB 1INEL 4HGKC 5KOMC 3RA7H 1U3HA 3DVFA 5DJ8B 5E5UB 1FFOA 5F7DA 5C8JB 3VD7A 4G8GA 4JFHE 3NCFB 1KEMH 2YD1A 4ENEC 2QSQA 4JHBA 1IM9A 1G9EA 5F96H 3UTTB 5I1JL 5FOBB 2JB5L 1ZT4B 1KOAA 4LCCC 1TITA 3NZ8B 3IGAA 4OCLC 2PYEA 3QDHA 4JFDB 4YDVA 3L6FB 5I1IL 1FZJB 2Q8BH 2E7LC 3I6LD 1BF8A 1XGPA 5EO0B 1X5XA 3HMWH 3KG5A 2Q87A 6CGTA 3DURB 1SVCP 3R0MA 1QO3B 5D7JC 4E5XA 3ES6B 3FT3A 4GG8B 4R96A 3EDFA 3W0WD 3QRGH 3BYTA 5KVEL 3X3GL 4C59B 3W2DL 1ZLVH 4RX4D 1QG3A 1HHKB 2YD6A 1REIA 3K8LA 5KSBF 25C8L 3BPNC 2AV1A 5DRZA 1S8DB 2X5PA 1ZGLM 1KBGH 4X6DB 3IAQA 2HFGH 2MFNA 2Z93A 4KJPC 1I8LA 1T5XB 3EO0B 3Q6GH 2MCG1 3RZWA 3EGSA 5BRZB 1TJIL 4XPHL 4CN1A 3PHOB 2FHBA 3HNTH 1P84J 1DVFB 4ODBD 3CK0L 4WEBL 5JW4Q 3IETA 2GK0B 4WFFE 4C56E 2IFFH 4OI8A 4R8WH 3N50A 5HTSA 4XVUC 1UKSA 5FYLL 3JWDH 1OAUH 3MOBH 2APTA 1MIEL 5HHOA 3WJJC 4N0FA 3LIZH 5A2LH 1JJUA 4F7CB 1OWRM 3QUZB 3QDGE 3GMRA 5EU4B 4OIIH 1C1EH 3ROOA 5IVXF 3NPSB 1MY5A 5AZEL 1A1MA 4HT1L 1DBJL 2XNAA 3DMMA 4MWFB 3ESVF 1MAJA 1MCSA 4LBEB 4OCSH 3TIEA 4JVPA 5JLZB 2DIBA 4PJCB 2Q8AH 1G7IA 5IQ7L 1IAIH 4GRWF 4X98A 3NCYS 4CVXB 2ZUSA 2P5EE 2FL5A 1NMAL 5F1NB 1UCTA 3EFFA 3DGGB 1U92B 3VXSB 4NKDA 1BGXL 4XT1C 3SDDA 2X42A 1IKNA 4Q9CA 4PJHB 4IBLT 1JNNH 3T77B 4FTVE 4XP1L 4JM2F 5EBWB 4UDTB 3KJ6H 4ZUTA 3BD5A 2YPVL 5FGSA 2F58L 5ADPH 4LMQE 1FZOA 2DQDH 1OAYL 4XNYH 1I3GL 1D9KB 5I9QC 3LKNB 4S0SD 3D2UA 5TF1H 1FV1B 4CMMB 4XHJD 1L0YA 4IRZH 5C0CA 1XAUA 4R90L 2C3GA 2B4CH 4K94L 4QY8A 1FNEA 1JZ5A 4NRYB 3ULSA 3QDJD 1XGYH 2K7QA 4E0RA 2CUHA 2PN5A 4ZOBA 2JIXA 4MA8L 2FHCA 5GRVL 2DQCL 4EDWL 4PJ8B 2LQRA 4P5KA 4N1CA 4XPFL 5DQ9B 4Y1AB 3C8HA 3ZLQC 2HFTA 3O6KL 2I26N 3EYQC 3X14B 4MDIA 3T2PA 3L3KA 2H2PC 1M4KA 4ZD3L 4C4KT 1RV6X 1IQDA 2CLZA 4H5SB 1N59B 4JFZH 3TV3H 3O4LB 3TO4A 1MCRA 5BXFB 3DSNA 2PW2B 4AIZA 2Q20A 3QNXA 4I3SL 3MGTB 4IHOB 3B9KA 4OBRA 5J06A 2FBJH 1YUHA 3CXHJ 2AKRA 1D5XB 4K2UL 5A16A 2WAHA 1AGEA 5I1GL 1DP0A 5AUMB 4R26H 1UCBH 1GZQB 1SJHB 1HKLH 4YNYB 2I9TB 3JTSA 2WUBH 1GAFL 2F54A 4ENED 1FVCB 5I66A 4M8VA 1VENA 3Q1SL 4I77L 4HK3N 1L9NA 3KYMB 4AEEA 2EDXA 2XPGB 3VD5A 3GUTB 4XP9L 5FUOL 2IADB 3DO3A 4O4YH 4ELKB 5B3JF 1FG2A 5CS7A 1KC5L 4OZHE 3RNKB 1IGIH 1C7TA 2AJYL 4K71B 3VXTB 1P84K 5I30L 5D7JD 2O5YH 1PKOA 4LHUG 2BNRE 4EN3B 3RWDB 1EEUA 1WWAX 2YPLB 5FO9A 3MLZH 3TYFA 4MD4A 4YXHL 2N56A 3QHZL 4DUVA 3B5TA 3UJTL 1LEGA 4KROB 4HH8A 1GOFA 4LEXL 1MHEA 1TJHH 4UBDC 3KHQA 3NH7H 4HEPG 3STLB 3D39D 1BPVA 1AD9A 4HIIB 1VGKA 4FQLL 4KJPD 3KLDA 2RQ8A 3TLRA 1KEGH 3EYFA 2DRUA 12E8L 3VRIB 5IG7A 2Y9RT 1YDPB 2ZUXA 3ARRA 3MRMB 4DEPB 1N7ML 5GRJH 4LP4A 1RU9L 4JFFD 5FA3A 4YHYC 1F8TL 4RFNC 3QZWG 3UPAA 1U3HB 4XVUD 2V17L 1FFOB 1YMMA 4NC1C 3I02A 3VWJB 5FOJA 2VE6B 1IM9B 3DECA 4MCYB 1CGYA 3O41B 3MJ9L 3OG6B 3O2DA 5FHAH 5ERWA 3HMXA 3MLVH 5E8OA 1B2WH 3IGAB 1KIRB 3H2WA 1N0XH 2PYEB 3U0TA 4YDVB 4L5FH 1A6WH 2DI7A 2QHRL 1FAKT 1B3JA 1T0MB 2IH1B 3PWJA 3QQNA 1A22B 1JK8B 2VLKA 1F5WA 4R96B 4JZOA 2ZUWA 4OM0H 5IB1A 4OLEA 4NN7B 4YBHA 3MC0A 4UIMA 5JDSB 1JTOA 4OGAC 2AV1B 3KLSA 5DRZB 2CUIA 4DK6A 2Z93B 3TZVC 4A6YA 1RZGA 1P7QA 4LLUB 3CFIC 1CZ8L 3EGSB 2IANE 4P57B 4QXTA 3IETB 2GT9B 4BSWA 5DUML 1U8IA 3ZYOA 2YMXL 2ZP0T 2BOCA 2OX5A 3BE1L 5HGGS 5HHOB 5HSFA 1JRHL 2YUZA 4N0FB 1T1ZA 2WBJC 3CXHK 4L1DA 4LLMA 4QKXB 4FNLH 4X7CC 2OR9H 3GMRB 4LPUA 3GIZL 4MB3A 3ROOB 5JHDD 5I1EL 1G7JA 1Q38A 1VCAA 1A1MB 2XNAB 3DMMB 4OLZL 3O6LL 1FSKB 3BDBA 3BP7A 3MYJB 3TIEB 1CR9L 3EYQD 1G7IB 1CE1L 1BQHG 2H2PD 4DAGH 1CK0L 4X98B 4ESKA 3CLFL 1MRDH 4Y88A 2ZKHH 2PF6A 3WIIH 4IRJA 5BS0A 5EOCL 2P43B 4JFDE 4Q97A 1CXFA 4MJIE 3BIAX 3EFFB 3NFSL 4JN1L 5C0FA 5IR1B 3WD5H 1YECH 4NKDB 3U0WL 1RIHH 3SDDB 1ED3A 2BXYA 4HUUB 5E2TL 2NZ9D 3T2NL 2XA8H 4LVNB 3QQ9C 2CD0A 3F7PC 2DQHL 3V9FA 1I7TA 4ZUTB 3DVNA 2CKNA 4FP8H 4DKDC 3RTQA 3QUYC 1IMHC 2IQ9L 2CMRH 5IKCB 1KJ2A 3PQYD 1IAIM 4X6DE 3UJJL 4D3CL 1DEEA 2JE8A 4LCWA 1UFUA 4H1LG 4CRPA 5C0CB 1UQSA 3HFML 3AMLA 1RZ7L 4QY8B 5EA0L 1FNEB 5BRZE 3WKML 1IZKA 1GSMA 3LS5L 3ULSB 3VWKA 4EXPX 4E0RB 1FVEA 1EEYA 2A74B 2JIXB 5IW1B 1D5BA 3BISA 3DHMA 3NCMA 3OBAA 1RIVL 2IC2A 4M62L 3H7LA 4OD2A 5KAQG 3TM6A 3G6DL 2IGFH 3B43A 2CLZB 3C9NB 4XH2B 3QXTA 4PLOB 3QIBB 1GGBL 2VITB 4UBDD 4O2CA 3VDCA 1HCFX 1V05A 3QNXB 3GSXA 5L88L 3TC9A 4GT7A 3B9KB 4PJCE 4DWHA 2GAZA 1LEIB 1YUHB 4WW1A 2Y36H 4MNQA 2C1PA 3ZKXC 2NY4B 2WIMA 5A16B 1WQVT 1AGEB 1G1YA 5DD0H 2OL3L 4Y4HA 1BVZA 3EFDH 4WDIB 3VXSE 2VXVH 1ZLUK 4P9HC 5I66B 5IHLB 3S97C 2E8ZA 5E5MA 1FRGL 4PJHE 2QQKL 4KK9C 1GC1H 4KU1A 5EO9A 2J88L 4NZUH 3L5XL 5ACMA 1FPTH 4OT1H 2CLVA 2WSKA 5T3XL 4KKLC 1ZLWH 4RFOH 2R2EB 1W72H 3BGFC 5T3ZE 5SX5K 1DFBH 5F1OB 5E94B 2DTMH 5FO9B 4U1JA 4PRHE 3TYFB 4MD4B 3RBSA 3VDAA 4KXZI 3JWNC 3RFZC 2UZIL 2R15A 1LEGB 4OGAD 1FFPA 3EYSH 5IM7A 2CIKA 3SKJL 4Y1AE 4UNTA 2XZCL 5DURB 1JGVH 1AD9B 3IFNL 5TPWH 3TZVD 1VGKB 1A5FH 4R4NC 1T89A 3QPXL 5D7SH 3UYOD 5GISL 1FNSH 5ANME 1MQ8A 5IG7B 1L9MA 3O4LE 4J3XA 2Y7QA 2WIIA 4ODXA 5FA3B 1QRND 1FNAA 3I02B 5GPRA 3QUXB 2WBJD 1ROWA 2BNUA 3E2HC 4JO4H 4P9MH 4QRUA 3MXWL 1NCBH 2LVEA 5ERWB 2MSPA 3U0TB 4LDEB 1VFOA 2A6DA 1E4XH 4OZHF 4IJ3C 3R1GL 4MQTB 5DEGA 2O26U 2JJWA 3MLPA 4I48A 2VLKB 4ALAH 1HHIB 1RZFH 3MYZA 5E56A 5CHNA 2HTKC 3U83A 4JZOB 5DQDH 3ZDYE 1ACZA 4FQ2H 1LNUA 5IB1B 2DIAA 4UIMB 5F9OH 4NQDB 1JHLL 2EDYA 1QZ1A 3QQ9D 1B0RA 1DLHB 2YPLE 3IDXL 5KJRL 4OLWL 1IE5A 3O3AA 4YR6B 3SKMA 4A6YB 4P5TA 1MFDL 1P7QB 2X1OA 2D0FA 3QUYD 3GJFH 5DMJB 3S9DB 1JWUA 2F5BL 5J1SC 2FO4A 3SOBL 5K9QI 4BSWB 1U8IB 1I75A 3VE0A 1H15A 2BOCB 1FLTX 1T1ZB 4LL9A 4X5LA 3HC0A 4YXKH 5KS9A 1QACA 1U95B 4OCWL 2WBWB 2XFXA 3ZZ1A 4WWID 3BDYH 1JGDA 2PR4L 4G8GE 4U6YB 1DUYA 3K1KC 4ZXBC 2NZIA 2C4FU 5GHWH 1EHLL 3BP7B 1GRWA 1EFXA 4HPYL 2R0KH 3BWUC 5TGBB 4GKNA 4WFHD 4IRJB 5BS0B 3L5WA 2PYEE 2VDLL 4HJJL 1KPRA 1U42A 2NY1C 1F4XH 4WV1A 3SDXA 4OB5L 1JZ2A 2ICES 4G5ZL 1ED3B 2ZUYA 2NQCA 4WENB 5FYJH 5FM5M 4KAQL 3VA2C 5GRXG 2QJDA 2I07A 4WU5A 5EOQH 3HPJA 1I7TB 3DVNB 4TN9A 4EI5B 1KCRH 2I9LA 3RTQB 5A2IH 5C0NC 3FT4A 4YJZL 4RX4A 1KJ2B 1INDH 4POZC 3SKNA 3LZFH 4LQ1A 5EBLA 4KK9D 3GZKA 2DJ4A 1ZTXH 1DEEB 4HXBL 3PWUA 1QLFA 2DLFL 5HDOA 1NCTA 3A67H 3ZTJH 3S37H 1UQSB 2VNCA 4PJEA 4XVSL 4K3DH 2Y23A 2EC9T 3IKCB 3BZFA 4JR9H 4KKLD 3VWKB 3WS3A 4KI5C 1RZKH 4HEME 1GCFA 1A8JH 1FVEB 2W9DH 3GHBH 1WCBA 3N9GL 5HI4C 3GRWH 1CYGA 3NAAL 4Q9QL 3BEVA 1S9YB 4ZOCA 3QDMD 1N26A 4OD2B 1KB5A 5BO1H 2Q3AA 1JTTA 5L0QB 1N8ZA 3ZMRA 5DA4A 4LLDA 3V6FA 3SO3B 2VDQL 2BY1A 4Q7DA 4GAYA 4O2CB 4AENA 4GQ9H 4L8CA 3C6SB 3OJMB 5CP7A 4R4ND 4D9LH 2GAZB 1VESA 3RU8L 5J9PA 5CP3H 5CINL 3GK8H 4LHUA 3VFOA 5IB2A 2A9MH 4MA3A 4OF5A 4J1UB 4Y4HB 5F1SA 4JO2L 1TNMA 5E5MB 4X6DF 3MROA 1E0OB 4M00A 4XP5H 1JPTL 3MRDA 5ITBL 3BP4A 2XKNA 4MNHA 5EO9B 4H88H 2P24A 2B1AH 5DD1H 2RGSA 4LFHD 4MVBD 2Z31A 1CLCA 4GRLC 1QFWH 3OF6D 1AXSA 4XXCC 4RBPH 4M5YL 1I3RA 2HTKD 1MELA 5C0CE 3DX6A 5I75B 3TNNA 1Z5LA 1D7FA 3T0EC 3LRSB 1A7RL 5CGTA 5EPMA 4OV6F 4F8QA 5GGTH 1FFPB 4TNVF 4ZFGH 5IM7B 1IKFL 2CIKB 1JI1A 1I9RH 3HZYB 1AGCB 4OF3A 3SDCC 4PJCF 1GC1C 5DWUL 3LKRA 2X9XA 2XXCB 3D48R 3MV7D 1KJMA 1Q1JL 5F7WC 4QRPD 2Y7QB 5FECA 4ODXB 4YXLH 1ZHBA 5T5FH 2Y07L 4YDKH 3QUMA 5DUPH 5KSAC 3LS4H 3ARUA 4PJHF 4PY8J 4K7FA 5C6PB 2BNUB 4NDMA 4Y19A 3LY6A 4QRUB 2IALA 4XNZB 3IDGB 1A6AB 1RVFH 1IGCL 4LCIL 4BFIA 5HYSG 4ZXBD 2X4PA 2A6DB 2YBRA 2F54E 1T1WA 4I18C 3BZEA 3NA9H 1AR1C 3MCLH 5DEGB 3GSOA 3F6LA 4NGHL 4F37K 1YPZA 4Y16A 2M2DA 1N2RB 4QCIB 3S35X 3OTTA 1XF2A 2NY1D 4R0LA 1EUUA 5IB4A 1BZ7B 5EZJA 4NYLA 5AZ2L 2NY0B 4KY1L 5HDBE 4PRPA 1B0RB 4MJ2A 8FABA 2J2ZA 4WI7A 1FC1A 1KELH 4D0BA 1GGCL 3ME0A 1BJMA 2AJXH 3O3AB 3WLBA 3SKMB 4P5TB 3QT2A 5EIVA 1G6RH 3FFDA 5C0ND 1BQHA 1YY8B 2H2SC 2FATH 5EG6C 1CFVH 4FXKA 3BJLA 5HVHB 3H9SA 4M7KL 4POZD 5T1KD 4M7JL 4P4KC 2FO4B 2Z35A 3MNWA 2KQMA 5DZLA 1J86A 4FXGA 4YX2L 3VE0B 3NACL 1H15B 1QKZL 4Y5VB 1NBZB 1MAMH 2ZOKA 3MRKB 4KI5D 4IS6A 3HC0B 1INEH 4ZUSA 4FFYL 5CLTA 5HI4D 2XFXB 4G8IA 5BVPH 2XKUA 1JGDB 4QWWC 1YMME 1DUYB 2AI0L 4CAGA 2JB5H 5DD3L 3V4UH 2VERN 3WJJA 1A9BA 1TVBB 3V4PL 5F7NC 3ZDYF 1K8DA 1OAZL 3L5WB 3CD4A 5I1IH 2DTSA 2W65A 4EZMA 1KPRB 4H1LA 4HJGA 1T2JA 4WV1B 4X6FA 5EULV 3GO1L 1AI1L 4TUOB 2YRPA 3C08H 4D0CA 2VLKE 4J8RA 4JFYA 4KHTL 2VAAB 2R1WA 2I07B 4WU5B 4HXAL 2ADJA 4J12A 3RX8A 2VZUA 3FMGL 3IXTA 3X3GH 3HPJB 4U1IA 4DKEL 3UTPE 2I9LB 2K7PA 2XTJB 4OGYL 25C8H 4JZJA 3FT4B 3B8YA 3SKNB 5EBLB 3MFFA 3S3PA 1G9NL 3PWUB 1QLFB 1BD2E 2RFXA 4PJEB 4BH8A 1TJIH 4XPHH 2HFFA 4FS0A 4QRRA 3BZFB 3WS3B 3Q0HA 3CK0H 1CFNA 4GRLD 4G42A 4G8FA 1LQSR 1RK1B 1CG9A 3FAXA 5FYLH 4IIQC 3FB7A 4B53A 1MIEH 4NOBA 2CLRA 3T0ED 3EOYG 2VDOL 1CQKA 4P48A 3FOLA 4LLDB 1A2YA 5AZEH 4HT1H 3LEVL 1DBJH 4GAYB 5DXWA 4C83A 4AENB 3SDCD 1MIML 4L8CB 4M3KB 1CCZA 5CP7B 3R8QA 2WM0A 3N1MC 2H32H 4UAOB 4OCXL 5HHMD 3TBWB 1OF2A 1MHHA 1RZKC 5BS0E 5IHUH 3MUJA 4LHUB 4N8PA 4MA3B 3WYRA 1XGQA 4S2SA 2AJZA 1BVKB 1HZHL 1QBBA 2DJSA 3IDJA 4I2XA 1BGXH 1BIHA 4P3CL 3WHXA 1KLFA 5KSAD 1AGBA 5CBEA 1T22A 4CU7A 1U8KA 2DMCA 3MROB 5JOFB 4XP1H 3MRDB 5CJ5A 3BP4B 4MNHB 1LWRA 1YEKL 2YPVH 5JA8B 3KPPB 3ZKNC 2F58H 2DLTA 3D69A 2AQ1A 3BP6A 2Z31B 3TFKC 1AR1D 5C0BA 4NO5A 3UROR 4WGVB 1AXSB 2X1PA 3QEHA 4LCWE 3OHXB 3N1FC 5CWSA 1ZGLP 1C5BH 4K94H 1PZ5A 1Z5LB 2EYTA 4LF3A 4MA8H 2A6KA 3ARGA 3OR6A 2DQCH 4YDJA 4EDWH 5ESQA 4CJ1A 3GBNL 1CN4A 1VDGA 1T3FA 3OKMA 2E9IA 3O6KH 5C07D 5D1ZC 5K59E 2QR0A 2J6EA 1UWGH 4X99A 3LKRB 4OIBA 4U7KA 4ZD3H 4I0PC 4KK6C 5AG9A 5JHLL 2H2SD 4NO2A 4PJFA 1X7QA 1DQML 1XCTB 5FECB 4P4KD 1QP1A 1P7KB 1QFWM 1RK0A 4I3SH 1LEKA 1Z9MA 3MRGA 3QUMB 4FQ1H 3UP1A 4OZFH 4MNQE 4RGNB 5I18L 5I1GH 2VXQL 4Y19B 1MCIA 2IALB 4HSQA 5C3LD 4ODUA 4KK5C 4QWWD 3RWFA 5HHVL 4Y4KA 4OF7A 4EXKA 3Q1SH 1T1WB 3QIWA 2YA1A 2FSEA 3NABL 4I77H 5J12B 3ZT6A 3GSOB 2NXZC 4LDLB 2EEAA 2FX7L 4Y16B 4XP9H 5FUOH 2J8UA 5ETUA 2W38A 4LCCB 3TJEH 4R0LB 2FX9L 4N8CL 4HK3J 5IB4B 4M6NL 1JZ3A 1O7VA 4HAFA 2AJYH 1MCLA 4JQVC 5EZJB 1U36A 4NYLB 5FIEA 4YXHH 8FABB 4IM8A 5D7JB 3QHZH 3L3OA 4NBYB 3EYOA 3WLBB 5I1CL 3HC4L 3FONA 3FFDB 1BQHB 2IG2L 1CD0A 3WXVH 1FG9C 2QSTA 4FXKB 4OCYL 3H9SB 1P6AB 1KJVB 4ZAKC 1A47A 5I1KH 4FQLH 2Z35B 1B4JH 4JFPB 3MNWB 1C5CL 1MCDA 5C9JB 2BC4A 3HAEG 4FXGB 5LBSL 4YGVB 5F6HI 5TE7L 4IDLA 12E8H 3TZVA 3HR6A 4L4TA 2ZOKB 4IS6B 3C8KA 3EOTH 4ZUSB 2P44B 1F8TH 3DX9B 3QIUC 4RGOL 1DTUA 4G8IB 3DROA 3FQXB 5DC4B 5KVDL 4JFFB 4BQ8A 4YHKL 4F2MA 1OOAA 3OX8A 3MJ9H 2XT1B 4JRXD 2LU3A 3O3UN 3G5YA 1B0GB 5IB5A 4FOMA 1A9BB 1OLZA 3FN0L 4BQ6A 4UV7L 3L7FB 1K8DB 1KLGA 3EYVA 3M07A 4HJGB 2Z9TA 4X6FB 3ZYJA 5T33L 2BK8A 2QHRH 5BCAA 5HDBF 4D0CB 1A7BA 3GB7A 4J8RB 4JFYB 4RMSA 3FO1A 4CN6A 2R1WB 1J7VR 3MLRL 2ADJB 1ZANL 3IXTB 4WFGE 2W60A 1TQBC 4QHMA 4U1IB 2DM4A 4M6MH 4WUKL 1SJVA 1GH7A 1R5VA 4JZJB 2VZVA 2AEQL 2XN9A 1LK3L 3BI9X 2RFXB 3ZKND 1CZ8H 4BH8B 2Q7YA 3DVGA 1JV5A 1DQQA 3IDMB 2HFFB 3PUCA 5F7EH 3TFKD 2OZ4L 4TSBL 1X5FA 3DPBA 4G42B 5DUMH 4KH2A 4B7LA 1CG9B 5LGJA 2ADIA 1KTDA 2YMXH 3FB7B 5I9QB 3EDDA 5IEHA 3BE1H 4UT6L 4DZBA 1JRHH 4LQFL 4GO6B 5D7LA 3RNQA 5GS1C 5KS9E 3QWRD 4LSQL 1ORSA 1YNLL 3FOLB 4MXVE 1A2YB 5B8CA 5I1EH 2F53A 3NGBC 4C83B 3QG7L 2DB8A 5D1ZD 1C12A 3MRPA 4PG2C 4D0DA 5TE6H 3HCVA 1CE1H 5IMOA 1DANU 1CK0H 3CLFH 4I0PD 4KK6D 1G7HA 2H1PL 4GG6A 1OF2B 1MHHB 5EOCH 3BMWA 1XGQB 4S2SB 1P69B 3VFMA 3NFSH 5E8NB 2AJZB 5L8JB 3WO4C 3SDXE 2BSRA 3U0WH 1CU4L 4DKAA 3WHXB 4FQIL 5I8EA 4OCNC 1EJ6A 1AGBB 4JQXA 4PRBA 3MRIA 5E2TH 1T22B 4XB7A 5EH1A 3T2NH 5CBEB 1U8KB 2EDBA 3JVGC 3SBWC 4EVNB 2BJML 2DQHH 3ELAT 4J3WA 4OFPA 5J4MA 4FFVC 3O45A 4KK5D 4LRIA 4HWUA 3D69B 2XTJE 2IQ9H 3LHPL 3BP6B 3WMSA 4LSDA 5EFIA 5C0BB 3UJJH 2NXZD 5FO8A 3OZ9L 3QEHB 1M7DA 2DYPD 2W92A 4A2MA 3HFMH 3S35L 1RZ7H 1RZJL 4PJEE 1V3MA 1PZ5B 1Q0XH 1UJTA 3WKMH 3LS5H 4YFDB 4ZUUB 4FRWA 4N90E 4RQQA 4LF3B 2IMMA 3ARGB 2DD8L 3OR6B 3ZTJG 1CLOL 3GMMB 5GGQL 4KPHH 5HHNA 4MZ2A 3WKNA 1T3FB 3OKMB 3L5IA 4PJXA 2QR0B 4UU9B 5HYSA 3BKCL 3C5ZA 3G6DH 5DQJB 1QFHA 2N4IA 5EBGA 5ID1A 2LFGA 1DSFL 3N1GC 4JVWA 5IVZA 1ZS8A 4NO2B 5JORA 2EO9A 5B4MC 4ZAKD 3V4VL 5C08A 1EK3A 5L88H 4BQ9A 2PO6C 4NUJA 4P46C 1LEKB 1JPST 3MRGB 2JJUA 5BQ7A 1F13A 4K94C 2PTTA 4A2LA 1BWWA 3K8MA 4FZ8L 3VFRA 2OL3H 1BM3L 4GBXC 3QIUD 4NQSA 1X9QA 7CGTA 3RWFB 4YHYB 1URLA 1WWBX 4O2FA 4RZCA 3QIWB 3RZCA 1M71B 2L4OA 3K4DA 2QQKH 4PJ7A 5ISZD 3REWA 3UEZA 5E6ZA 1K2DB 4WWKC 5ETUB 5CCKH 4R97B 4U33A 3WIFA 4PJGB 1V3JA 4HIXL 1SJEA 3HB3C 1KCVL 5T3XH 1T4KB 3N1QC 1BZQK 4G80B 3VGDA 3BN9C 2LAAA 2NY6C 2WWKT 3CVHL 5ILTL 2VDML 3LB6C 3QEQA 3EYOB 2DOCA 2UVEA 2UZIH 1UM5L 2D0HA 3ARWA 3FONB 1N5AA 2X89D 3DUHA 2CR3A 4E42A 1B6DA 1TVHA 1P4IL 2DIJA 3SKJH 2XZCH 4D94A 4QRSB 3TO2A 3IFNH 3MLUL 3V6OA 3RL2A 5IEKA 2BC4B 3QPXH 4HCRL 4NNPL 3HE7C 3QO1A 3TZVB 3CZFA 5E1HB 2CR6A 4GKSA 3C8KB 4MSWA 4ISVA 5J13C 4FQHA 5ACZA 1A3QA 3VXRA 1FZMA 4NSKA 4F2MB 3OX8B 4RGNE 4YK4B 4L8SA 2BRRL 4WTZA 3ZT7A 3MXWH 4Y19E 4X5WA 5DVMA 4FXLA 5DT1H 2WBJB 5IB5B 1ZE3C 1TCMA 2X44D 1KLGB 1NGZB 1ORQA 2WLYA 3RVXC 4G6AC 3TT1L 4NT6A 1WFUA 3R1GH 4PTTA 4ZPTA 3A6OA 3REVA 2ZCLL 4O9HL 2R56H 2OP4H 3KAAA 4J3TA 2VJXA 1FO0L 5FF6A 2NY7H 4CUCA 4LHQB 1YPZE 3FO1B 1JPFA 1EPFA 1ZVYA 2W60B 3OAYH 5FYLD 4L29A