2DWXA

Co-crystal structure analysis of gga1-gae with the wnsf motif
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
129
structure length
129
Chain Sequence
b'NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor-binding protein GGA1
publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 17
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwxA00
1KYDA 1QTPA 5CN1A 3MNMA 1GYUA 1P4UA 1KYUA 2DWXA 1OM9A 1KY7A 2VJ0A 2DWYA 4BCXA 2YMTA 3ZHFA 1IU1A 1KY6A 3ZY7A 1NA8A 1GYVA 3HS8A 5CN2A 1B9KA 2E9GA 1GYWA 1QTSA 2A7BA 1KYFA 1W80A
chains in the Genus database with same CATH superfamily
3KPRB 5FGBA 2R23B 2VOTA 4LHUA 2OV0A 3AM8A 3GBMH 1KXQA 3VM7A 3TBWA 4O2CA 1G84A 4NQVA 5DFAA 5EUKA 5CEXB 3MLUH 2NNRA 4JPSA 3W57A 3JXAA 5KBNC 2XWTB 3O9WD 4YFLI 4YBLB 4HSCX 2R2EA 4S1SH 5BS0E 4U1IB 1XWVA 3T8MA 3CQPA 5L7XH 1Z9SA 4UZUA 4JRYE 5HDRA 1A9EA 1UCBH 3UTSD 3VFSA 4UZSA 1KCVH 3AGVA 5EOTB 3RNQA 2PMZA 2ZKXA 3MACL 1FVEA 4WNQB 1JHTA 1ZOXA 1YZZA 4P06A 5T1MA 5HPMA 3NAAL 4H88H 3ARRA 3IE4A 4UM9D 4ZNEE 4YDJB 3BZ4B 4PLNC 1AGBA 3F12B 4YVNA 3BQUB 3ZIYA 4EQ2A 2IV9A 1FCGA 1BFTA 3MJ9L 5PAZA 1IQWH 2X4QA 1A7OH 5HYJA 3GRWH 2ZYHA 2FO4B 2YAHA 4PP1D 1KLGB 3K6SA 3O45B 4WV1B 1XT5A 2ENYA 4HZLB 5GSRA 1AKJB 2BSBA 2H6PA 2ZKMX 3OKLA 3IXAB 1NJ9A 3TO2B 2C26A 3IS0X 2ADFL 4PTTA 4AMXA 1WQVT 5AW2B 3ETTA 2XPGA 2PWEA 3GIVB 4I18C 5I6LA 3IPFA 1IGIH 4QRUA 2VLJB 2X3BA 3KM1A 4WFHD 2YC1A 1B6DA 1BHGA 3HRZC 5IHUH 4OZIF 3BEWB 5FO2A 4MD4A 4XRCB 4MASA 3UAJD 5I1CL 5ETUA 3V4LA 1WISA 5B39B 3IWVA 1OGTB 5DWUH 2HG5A 1GSMA 4MZ3A 2H0EA 2R51A 1SDYA 5EEXA 2C4FU 4IK7A 2H26B 1JF6A 3QCUH 4HJ0D 4YJZL 1ZVNA 1YEDA 1DQJB 4I0PC 1DQKA 1HHKB 4GO8A 3T71A 3PS6A 3X1EA 4PREA 1EVUA 2NDGA 3CLFL 3K74B 5EF1A 4NKIH 1A1NA 1GR7A 1S5HA 2V2TB 5BRZE 1GMIA 5FGSA 4NQEE 3QQ4A 1T6BX 3MXWH 2GI7A 4J3OH 2Z7YA 3GGWB 1CYXA 3MBEC 2VL5B 5EZIL 4XMPL 4TUJA 3RVWC 1L0XA 3VSUA 3V10A 1S8DA 5F7HA 2WN2A 4NKMB 5E51A 1ZSDA 2IH3A 2RGSA 2WP3O 3I6KB 2QQNL 3VI4B 1IM9A 1MG2C 3L3HB 5DJDB 1N6QH 3LEVH 4NZDA 3V9EA 4K3DH 1QTPA 3PXLA 3BH9B 3ISRA 2OW7A 4P3DB 4KHTL 3GRWA 3EYVA 3UXFA 2HWZH 4PG9A 5JHMA 3U2SB 4BKLB 2BXZA 4ZFOA 5I1KL 2FIKA 1TG8A 4OAWB 1B9ZA 1PG7W 5HGAB 4M6MH 1YYMH 4FXKC 2AK4D 2LU4A 3QPKA 1ID5I 3ARDA 3FQNB 3U9PH 3QEGL 4P4RB 5DLML 4XH2B 4PRHB 4MTMA 3DYMA 5E99H 1AMXA 1AGCB 2R1XA 3OR6A 6CGTA 2OXHA 1NBQA 4L37B 4JDTH 2VIRA 4PJ7F 1OK8A 5EZOL 3WEBA 1I1YB 2KT6A 4M8VA 4P2RA 3C5ZB 3QDGE 2ZYSA 1BECA 1QBML 1F4AA 3BT2L 1JPEA 3L2NA 4GKSA 1AI1L 3LSOA 2NYYC 3NFNA 4F7CB 4ODWB 1WTLA 2W9EH 2LLNA 3EJYC 4LCCA 3ABLB 4PGDA 4OLYL 3DPBB 1MWOA 5CILL 3X13B 4CVXB 3D51A 1EO7A 1MAJA 3ARGA 3LRSB 3MRFB 3ARUA 1YHPA 3RI5F 5I66A 5K1NA 4P46D 5FUCC 1IFHH 2ZXCA 3EOTH 1ORSA 3CZGA 4PLJD 1MLCA 1S9XB 3VWJA 5ITBL 3VXME 3BMWA 5E8NA 3UX9B 3VFWB 4MD5A 3ME0A 1ZHNA 1F3JB 1P9MC 2C9QA 1PZCA 5DJ2A 4F8OA 3LN5A 4RESB 2W65B 3PV6B 4JDVB 4G43B 3VFUB 1LMIA 4OCRH 1G7JA 1KBVA 5DS2A 1YC7A 4GKNB 1WFUA 1RZ8A 3EGDA 4U33A 1SDAB 4NX0A 3S37L 2Q6WA 9PCYA 5DRNB 4JFFA 5I1DB 1E6OL 3OKYA 3NK3A 2R69L 3ZKMD 1JMZA 3EO1A 4XCNB 5AWNL 4UQ9A 3S5LB 2WNWA 4H0GA 4HPYL 3ARPA 1CL7I 2ZAIA 4WCYL 3MACH 1YY8A 2QMJA 4Z3JA 2R4SL 3OGCB 5F9AC 5BMFH 3RWHA 3MRHB 2I26N 1NCHA 2Z93B 4HMEA 3X11A 3NAAH 1GZPB 3NCWA 3D4CA 3KGUA 1OPGL 3C75A 2DOCA 4RAVA 5KN5A 5IMOA 5DSCB 4NJ9L 2BNUA 3MJ9H 1XCTB 1XGUB 4OFPA 4HU8A 1HESA 1XR9B 3WJMA 4MJID 3SOBL 2YMTA 1QBLL 3L3DA 3DIFA 3OKDB 4EXPX 4F2FA 4F2MA 4PW9A 4B7LA 1BG9A 2AVFA 4K5LA 1R24A 3VXOA 4NZ8A 5A2CA 3RVXD 4OV5B 4GG6E 3WELA 5C0DB 4GXVL 4DGYL 1DFXA 1WFMA 3S2CA 4TMPA 1FAIL 2I32A 2ROYA 1JIBA 4AQAA 4Q6YA 5AB1A 5DK0A 1Z66A 1YEFL 2DEWX 2E8YA 1ZKAA 3QUZA 4JPIB 3ARBB 5ADOH 2XT1B 4KXZH 5DHDA 4YHOH 4JCLA 4MDIA 1D5RA 2DLTA 2HFEB 3MRJB 5GS3A 2E7CA 2G0KA 5KVEL 3QUXA 4AQ1B 1RZKC 2XYBA 2L04A 4GRLA 1V3MA 2EKJA 3RUGA 1BMWA 1YDPA 3P73B 3O4LD 2BNQB 2J73A 3HOGA 4Z7WE 4YE4L 4AE0A 5CEYB 2AXGA 5BQ7A 4ANXA 3UAFA 3EGSA 3CLFH 1ACXA 2P42B 2YPKA 5HI5C 4XX5A 4B0MB 5IMKB 1JCVA 2C3WA 2EDLA 4FG4A 3CIQA 4JFZL 5D72L 5DUML 5F0JB 1E4WL 1NMCC 4W1TA 3WEXB 4B3VA 1AGDB 4L48A 1EA9C 3WUWG 5CP7B 2R83A 1Q1PA 2KZBA 5EZIH 3D0VB 2B3IA 5T3XL 2VDRL 1XBDA 3UYPA 3QIWB 3GMPB 4LSSL 1CK0L 5HGHA 2VGLM 3FFDB 3KJ4B 2QQNH 2WQAA 2E9JA 5DVPA 2ICEB 4L0PB 3MJ9A 3RRQA 1NM9A 1L5GB 1J8HD 4KHTH 5KW9L 4CADA 4MJHA 4IMKC 4Y4HA 1JNHA 3V6FA 1N8ZB 1IBHA 1HL8A 5I1KH 2BMKA 2CRYA 3DTUB 2LAGB 3GTTA 1NGZB 4GY4A 3LTVA 2Y5TA 43C9B 5DTFA 4BXVA 5D1QE 4PGCA 5DLMH 3AG1B 1LNUA 1NBYA 3AQXA 5TPWL 5ID1B 3N0PB 4KITB 1X7QB 4A2HA 1F4YH 3VRLF 5FGBC 2GEQA 1HHGA 1VFBB 3DROB 3QFJD 4N2AA 5EO0A 5DMGD 4F15C 1JDCA 1QBMH 3BT2H 3ZK0A 1AI1H 1EIBA 3BEVB 4ICWA 2HUHA 2HT3D 2IV8A 3BVUA 2CBQA 4P5MA 4PJHB 4PGEB 5A2FA 3OR7A 4WTZA 1OSPH 4YC2C 1EJFA 1H5BB 3CDYA 4JFDD 4ZYKB 3HBGA 1U8PA 3ARFD 1UD5A 3O6FB 1M7XA 2B0SL 2QHLA 4OKDA 3C2SA 1SYVA 3ZHKA 1KTJA 2XZCH 3HHSA 5ITBH 1GYVA 3HC3L 4RWHA 2Y4SA 1OLZA 2XWRA 5C2UB 1C5BL 2WBJB 2AEOA 1NANI 3VW3L 3LAFA 3VFMA 3QIBD 2X0WA 2HKHL 4JJ5A 4P2YA 4MQXD 3FONB 5BV7B 3S37H 3VNZA 1O6VA 2C7FA 2R7EB 2CJUL 5FK9B 2MPAL 2R69H 2VXUL 5HY9B 5AWNH 2NT1A 3TBYB 2CR0A 4HUCA 3LZFL 4HPYH 1K8IA 4WCYH 5BZXA 1VZIA 2GCYA 2GTWB 2ZG3A 3C5XA 2R4SH 3FK3A 5EZLA 5B7EA 4HIQA 1QZNA 1IEBA 3BZFA 1WCQA 1LK3L 1P1ZA 3HC4L 1NDTA 3PL6D 5I17B 5EZJB 3LS4L 1QTSA 4HBCL 1IKOP 2FSEA 4X9HA 1OPGH 1N0LA 2X4TB 4N6QA 1HKLL 4R4BB 1PGRB 4KKNA 4QNPF 1WZAA 4BSVB 4NJ9H 3VXUE 1OZTG 3U2IA 3RIKA 2IH1A 1U8QB 5EG6C 3UGXA 1SJHB 3CXHJ 4FQHA 3S35L 1AZZC 1FL6A 3SOBH 4RQQA 3V4VL 2E8ZA 4FG6C 3KPSE 4J28A 1OTUD 3LPPA 2A6IB 2V0AA 5E95B 1T5XB 4JL1A 4XCEB 3T4AB 2XTJC 2A9BA 3OAZH 5IY5B 3T1FB 3N3EA 4K2UL 1B0GA 2JCCA 3T2PA 3UDWC 2VSMB 4GXVH 3LQAL 4EI5B 3GSWA 5KYWA 1FAIH 3QQDA 1W72L 4U4BA 2HN7A 3D07A 3GLAA 3NPSB 4CVWA 1I8MB 4ONOA 5FDYA 4NPYB 3NIFE 1G5AA 2W94A 4D0DA 1CD1A 4QHUB 3QWOA 2B9BA 5ERWB 4LCWA 4KZDL 2BSTA 3FUEA 3O8XD 4HJGB 4U49A 2WWKT 4GKZA 3EOAA 4Y9CA 4PJGB 2MEJB 1ETJA 1XB3A 2DQHL 3G6JA 2WXJA 3MUGA 4H26B 4HUNB 4PJIA 5EFIA 2J7LA 1VCBC 2WAQA 4YE4H 1D5BA 3S5YA 4AEIL 2B5IC 4PRIB 3BSHA 5ICXB 1AQKH 1CDYA 3WDHA 1S7WB 4YHZL 2CJSA 5EEVA 32C2B 3SBPA 1P1VA 4B7IA 3CCHA 1DUYB 4MQTB 2MRYA 1FV1B 2R69A 5AVQB 2WBWB 1F3DH 1G1YA 3PPSA 3AREA 4JFZH 1IEHA 5DUMH 1E4WH 4JPQA 5KVGE 2LT9A 2WQSA 2BZCA 4KY2A 3ARDC 4EI6A 2MQGA 1YMMB 3U4BL 5JXEA 1UWEL 4NDMA 4NC1E 5T1DH 1BCIA 2P8LA 3S7GA 5T3XH 2A4ZA 2DEYX 2VDRH 3MCKB 4LSSH 2PCFA 1UQSB 4UILH 1GXEA 1U6AL 2L3BA 4LMQI 4Q2ZA 4ORZC 1UZGA 4AW4A 1UH2A 1AD9A 3MRCA 3I2CL 4LCCC 3JYBA 3V0HA 1KELH 4JY4B 2J5LC 3OF6D 3PHOB 5EO9B 3ZDWA 2CU9A 2WWNA 4LARL 2YLKA 1QP1A 2DH2A 2H4EA 1Q9WA 2O6CA 3ARGC 4YS4A 2ZX5A 3NSFA 2CIIA 2IPUK 3QULA 2OP4H 4XI5D 4GKOA 3VWJC 3ZYJA 5GSVB 4ZMVA 5TPWH 3BYTA 2JI3A 2PPAA 3IETA 4KX9A 5CLZA 3Q2NA 3U4EB 2XG5B 4J3OC 3K6FA 5J57B 3W38A 1AIZA 3ML9A 5K9OA 1E28B 1ACZA 1KPUA 4FCAA 4NZJA 4AYBA 1MAML 3EH2A 3TEZA 3IGUA 3IF1B 5L8LB 2BSEA 4R9HA 5HHPB 4Q6IB 4MDRA 4HISA 2EDQA 2FTAA 4M48L 1T3FA 3O3UN 2FYVA 3M7FB 3JT2A 4LIQH 1DE4A 3IN2A 1ILSA 2B0SH 4HLEA 3MUJA 2BFGA 1M6OA 4GS7C 3QWRA 1BLIA 3HC3H 3VXRA 1MHHB 3GS4A 5C71A 1Q9LB 3L7FA 4LVOB 4AV4A 5I1JL 1C5BH 2PCPA 4POZD 3VW3H 1OT2A 4FQXB 4GRWF 4YHLL 3FTGB 2OJZH 2WN3A 2GUOB 2EYTA 3SO3C 3ULUF 4WFEE 2HKHH 3MV8B 4AVHA 3ALXA 5DEJA 5KS9E 1EH9A 1JK8B 1FO0L 3RTQD 5DHXB 2CJUH 4BFBD 2MPAH 2VXUH 5C09B 5D7IE 3HKZA 2JV6A 2RFXA 3EH5B 3LZFH 4G3YL 4BJLA 4FMKA 5B1BB 3H6AA 1UZ8A 1XF4B 3KBHE 1BWMA 5DF0A 1HE8A 2PCXA 1LK3H 3HHMA 4ZAKB 5GGSB 3HC4H 5F9JB 1TQCC 2GB2A 3AU1B 1NGYA 2D31A 3LS4H 3G5YA 4J5VA 4HBCH 3DURB 3QUZC 2FJFB 4X6BA 1HKLH 4Q9CA 3KLHC 4IHBA 4YHPA 2M83A 3CFJB 4G8FA 5KSBB 3L5JA 1PEZA 1YN6B 2QTVA 2W59A 2ESVA 2ZUSA 8CGTA 2WXHA 4N6RB 1F0LA 5AW5B 4U0RC 4HWUA 4PJDF 3Q5TA 5I5MA 3S35H 4DQOL 1FVDB 4NN7C 1NFDF 4W4NA 4FABL 2AHIA 1F18A 3UZEA 1YAIA 3ZTEA 3RBSA 4FFVC 4PY7B 2G9HA 3O2DL 3VD9A 1TYJA 4IOFC 1L3WA 3SE8H 2HTLD 3HVNA 2AI0L 3HZ3A 2H7WA 5DO2C 1TJIL 4CGTA 2E7DA 2VAAA 3ZKNC 3ZSTA 4ABVA 4I5BB 2ZXAA 2OA9A 2X70B 4ATTA 4CJ1A 5MERA 4XXCA 1NPUA 4C4KT 5TGBB 4X7TA 4OQ1A 4YDLC 4L8CB 5SX4H 1CICB 4QOKD 3IJEB 4JN2A 4Y16D 3B2XA 3KYNA 4OCNC 3MGTA 3TPUA 5BS0A 2DQHH 4Y2DD 5TE6L 4AEIH 3DECA 1DJSA 2XV2A 5KJ4A 2KLTA 5C0NC 2NNCA 4YHZH 3N2JA 3ESVF 1R0AL 3V5KB 2PXYD 4Y4HC 4HGWA 5HP5A 4HHWA 4OZ4A 3G5XA 1WUNT 1OAXL 4XN2A 2G9KA 4PW4A 1J1XH 1K5NA 4R2GB 4WTWA 3VYNA 4HUVB 1U3HD 4G7YL 1U8NA 4KX7A 3U4BH 2YQGA 4ZNEA 4HIEA 5IEKA 1BJ1J 4TVSa 5AW6B 3GFUA 2XN2A 3EHBC 4P5TD 4NQSA 4U1IA 1FI8C 35C8L 1CZ8L 3T0AA 2J88L 2OULB 4ZZFA 1GC1L 2IWGA 3X2QB 5FW7A 5B1CA 1JZEA 1MQ8A 1U6AH 3KXFA 4QTIL 4WNQA 3QJHA 4KK5D 3ZE0E 4LGSB 3NP4A 2OMVB 4G8GB 5HHOB 3PHSA 3SE3A 1QNZL 4C56B 4ZPTB 2YD3A 2FBRA 3B9KB 1IL1B 4LARH 5EWIL 3N1PC 4M4RB 1Q9KA 3CPLA 2JJWA 3VI3F 3BZ4A 3T65A 3L95B 4H2AA 1NKOA 3D2UA 4G8IB 3ZRFC 4OTXL 2VSKB 1DJGA 2A74C 2WZ5A 4HH9B 2XC8A 1SVBA 1FSKC 2YFNA 2FO4A 2UX6A 4PJAB 5CCKL 4WV1A 3ZDZF 1G9HA 3DYOA 4UAHA 5K33A 3CFQA 4N2DA 1KG0B 2ADYA 1QWUA 3LRMA 4UIMA 5EU6B 5DHYB 5F0LB 1P0SE 1JGIA 2QVTA 3GIVA 3KLKA 4MAZA 5E1QA 1AQMA 1R3JB 3OHXA 4KGLA 3HG3A 1P84J 1WTGT 2VLJA 4M48H 3W37A 2AZUA 2Z92B 3G6JF 4PB9L 4PRPE 5BRZA 1GKEA 4N3UA 5K39A 4DEUA 5ADPL 5I1GL 1QVOA 1IZKA 4O51A 3X1NA 3AWGA 3K8KA 3MDJA 5T33L 1RURL 2CPCA 2OLDA 5E8DL 5KBMA 5DDHA 3WN5A 2E0PA 2DYPD 3MO1B 2NXZC 2M26A 2YBRB 5LWYL 3LNGA 2ZWSA 2WLHA 2P7TB 1G0YR 2L8AA 4GQPH 4WU5A 5BW7A 1BVLB 4RGOL 4KKAD 4FYSA 5D7HA 2EDBA 1AC6A 1FO0H 4OI7A 4YNYB 4QRRE 4PJFE 5SWZB 5DMKB 1IEAB 2Z31A 1JV5B 4WO0A 4TRPL 3QA3A 3QR0A 4G3YH 2D7OA 3QJOA 2Q8BL 1CF8L 5FYJU 5IREA 1D5MB 5TF1L 3F85A 1XCXA 5BRPA 4HKJB 1Y1DA 4MJ6A 5ISZD 5KUKA 3RVTD 3QZMA 4NKMA 2XN1A 4WW1B 4WJ5B 3JWOL 1KCBA 4J23A 3C8DA 4OSUL 3LMJL 1E2WA 3NABL 4KK9C 2OW6A 3ZX1A 5DJDA 1EO5A 2UWEE 5DD0L 2H3NA 1Y0LA 1ZDQA 3BH9A 3GBLA 5TH2A 2MSPA 3MREB 5FYJE 4EMZA 1UWXK 5I1LA 5L4JA 1TCRA 1SN2A 3QDJD 1PJWA 2KH2B 4MS8C 4FABH 1MFMA 2X6CA 4ZO6A 1R17A 1U41A 1UYWL 3G6DL 5DFVC 4MCYA 4AYDC 4N2KA 5AZEL 3O2DH 4KBPA 1DANT 1ODUA 1I9RH 4XHQA 2AI0H 1H19A 1TJIH 4L05A 3O3EA 4MNQE 3AREC 4Z0XB 1K9TA 4ILDA 3VXMA 4AE1A 1Q0YL 5L2KA 1TJMA 5JXEC 1CDHA 1EJOL 3WL9A 2GK0B 3PAVA 4QRSA 5I9QB 2ALWA 5TE6H 3AACA 3SZ6A 4CVXA 1W15A 3LRSA 5HBBA 4FYQA 1LO3L 2DQMA 1J7VR 5JDSA 5JPMB 1R0AH 4HDIA 2KBGA 3FB7B 1CU4L 1FO0A 6PAZA 5KVGL 2DTML 4OBSA 3WO4C 4HFWB 4U1JB 5EC2A 4CMHB 5I71C 1OAXH 4PJ8D 1XMEB 3WJLC 4FTVE 2E86A 2W65A 3PV6A 4JDVA 4I0PD 4G7YH 2ZF9A 4YO0B 5LAXB 2W0LA 4RGNE 2OCFD 1ZAGA 4K5MA 4S2SA 35C8H 1CZ8H 4DOHE 3UJIH 3SDAB 4TN9A 3VXPA 4MA3A 5DI8A 1F45A 2QKSA 3K72A 2XYCA 2IF7A 3DGDA 2HLAB 2DBLL 2TRHA 4QTIH 3MBED 1WZMA 1COBA 1U3YA 3RVWD 1E3ZA 3IKKA 2ED9A 4E9WA 1PZSA 5CD5C 3NJGA 5C0FA 4X5QA 5IJKA 1QNZH 4GG6A 4P9ML 3RL2A 4O9HL 1CD0A 4JB9L 4C83A 4FXGB 1FZMA 5EWIH 1AYRA 1HVXA 2AJVL 2H3XC 3O2DA 3Q01A 4LL1A 2QDVA 3MNVB 4R4NC 4MA7H 2VE6A 3CZJA 2BY2A 3ZE2F 4Z7QB 4OTXH 4W9FC 1DVFA 4NWUL 5BVPL 5FYKU 2AERT 1XR9A 3K2KA 4OM0L 1WBXA 2DQJL 5CCKH 2HP4A 3OKDA 2VR3A 1ZWIB 4N1CA 2ERJC 3B8YA 4Z7WA 3QHTC 3FZUC 5IROC 1EFXB 1VIWA 1M1XA 3F83A 4OCYL 5I24A 4U3CA 5CN2A 4L1BA 5JZ7C 1TCMA 1QLEB 1NDMB 2DLGA 2H5UA 5FYKE 4PB9H 4YUEH 4PPTA 5IHHA 1UH4A 4ONHB 5ADPH 5FKAA 5IHLB 4AQ8C 2FEEL 5I1GH 1DL7L 2CDEA 5T33H 2HFEA 3EJYD 3Q43A 3ESOA 3OB8A 4HLZH 1TSHA 4GBXB 3KLAA 5K9KA 5JIQA 2BNQA 2P45B 5LWYH 4AVIA 3FO1A 1HCVA 5IHZA 3ZTJH 5ACZB 5JXAL 1L0YA 4AGOA 4EO5A 3FFCB 1U8JB 4DSYA 2EEXA 4LBEB 4PYGA 3UIZA 5I8OL 3MJ8A 5E4AA 2MIZA 1R3LB 2RD0A 2VJXA 2AAAA 5CFHA 3TN0B 4OB5L 4G7QB 5TQ2L 4HIIA 2XWEA 3S98A 2BZ7A 4TRPH 3VRIA 4HX1B 3CC5B 2Q8BH 1CF8H 1N18A 4GYBA 1NOLA 2IH8A 1TQWA 2JIXD 5TF1H 5D1QA 2CNYA 4MWFB 4CC4C 5BV7H 4QRPD 2VQUA 1YQVL 3D30A 3DJSA 2HJKB 2QGBA 3JWOH 1F86A 4OSUH 3RWJB 3LMJH 3MCLL 4EIUA 1MJUL 2CKBL 5DD0H 4ZFFB 1JV2A 3A5VA 3WY4A 5F6IC 2NNFA 1A6AB 1N8ZA 1XH3B 2K4AA 2XBTA 4HW6A 5A6LA 4IGBA 2ADGB 1O5PA 1NGZA 2I25N 4P2OB 1UYWH 3G6DH 3HAEH 5EN2A 5HHME 4XMXA 2CAKA 3K1KC 5ANMB 2R0ZL 1DQQA 3IMTA 4MCMA 1XGRA 4YXKH 4PJEE 1SQ2N 3KYMB 3ZOAA 3GSRA 1JZ2A 4L4TD 5KVFE 4RWYL 1N59A 2YOAA 1BD2B 5IB4B 1Q0YH 3KGTA 5I74B 3AT9A 4C8XA 3C6SA 3VXNB 3KHQA 1LE5A 1LYQA 1K6QL 1SEQL 3BEVA 1SYSA 2QDWA 1EJOH 3T0ED 1HHHB 5C08E 2CNZA 3NZUA 1A9BA 3CFKA 1MCQA 5T1KA 2GSGA 3SPVB 2CO6A 1EAOA 5MENB 1LO3H 1EO8L 3UG5A 4ORGB 4OCXL 3O6FA 1S7UB 3TJEL 4TQIA 1JZFA 4NPJA 2AXHA 2DQEL 1CU4H 5K69A 1MH5B 2DTMH 3BZ5A 1QI4A 5EUOE 3Q6GL 1KT2A 3TBSB 3BPLB 1QLFA 1FN4A 2QKIA 2EE2A 2W80C 2WBJA 3L5XL 2B4CL 4ISVB 2AJUL 3P4OA 4HUXB 1S78C 1HTYA 1OGAA 3TVMD 2E7LC 1FYTB 3Q3GA 3DGGA 3LQAC 1QHQA 5DS8B 5MEQA 5HI5D 4NO0B 2N0MA 1RJYB 3BJLA 4GKLA 3MV7E 5DD6B 3GSUA 3QEHA 3AMKA 3UO1L 3VXUA 1OAZL 1PF3A 1A6UL 3TBYA 4N0CC 3VH8A 5A6MA 3II1A 2ZOLB 3KPSA 3VI4F 3WTTA 1G9ML 2GABA 4HCFA 2WQRA 4QXTA 2LOEA 5F7LB 4RIRB 3OHXC 4HGMA 2Z6FA 1FLTX 4P9MH 3T04D 1R33A 1T5WB 1XH0A 3HAEA 1I8KA 4H20L 3CFIC 4JB9H 5E7FA 2AJVH 5FECA 2QADC 2X4TA 3PXJA 3J27A 3QPQD 4PCSA 4R8WL 3KPNB 4JREC 3QNXA 2BVOA 3WEOA 4NWUH 2X38A 4MKMA 4PJ9B 3O3BA 4P23A 5BVPH 1VEOA 4F5CE 2WBKA 4X8JA 3WN5C 3IS1X 3VGBA 3OXSA 2DQJH 4OM0H 2XKSA 4F33A 4M56A 4ANWA 3V7AE 4KMTL 3E7JA 5CD3B 4ZUVB 1T5XA 4LCYB 1MY5A 2HVJB 5E5RB 2VDNB 5TDOB 3D2TA 3HMWL 4XVUD 4ZXBB 2FL5B 3KWVA 1A4AA 2AMGA 1U95A 1F6AB 2ITFA 5DZVA 5EPMA 1NAML 3WTVA 2Z31C 1FJ1A 4HETA 4Z7VB 3PWLB 4NRYB 2IPKA 4LHUD 1JZDC 2H2SD 3HG1A 4L3FA 4LSQL 1XSKA 1J0YA 2LLGA 1S9WB 2NY6C 1DL7H 3TX4A 1ZLEA 4LEBA 1I8LA 2GFBB 3PAYA 4JFEE 4MJ2A 1OE3A 1I8IA 3OJDB 1ID2A 4Y1SA 3FBQA 4XCYB 4U1HA 2X2HA 4IBYA 1Z0NA 2NW3A 5JXAH 1KJ2B 1MWAB 1TEFA 1OE1A 1RZIA 2NLJA 3BAEH 4GW4A 3NCBB 2DD8L 5I8OH 3CGTA 2YPLD 4WEBL 3VFGH 1DDTA 1PNDA 2K6ZA 4OB5H 4M61A 4JAMB 1T1ZA 4G80B 1QATA 3HW7A 3KG5A 3CHPA 3RIFK 2F19H 3QYCA 2GBUA 1X5ZA 3BE1L 5IBTL 3W0WB 1QPXA 3BUQA 5G5DB 3RWGB 1YQVH 1S3RA 4MQ7A 2FX9H 1CYGA 1KPVA 1YEKH 4OQTL 5FYJL 1CLCA 2QT6A 1G7MA 3GHPA 4NNXB 2QVMA 2W0KA 2IAAC 1H6EA 5C07A 3RU8L 1KPRA 3ZRCC 3ZXAC 1JYNA 5D1ZC 4W6YB 1P7QA 1TR7A 1M9WA 4ODXB 4PHXA 5GRZA 1UGNA 1L7IH 4EUPH 2YUXA 1VKXB 4X5RA 4AUUA 4DEWA 2R27A 4G6FD 2R0ZH 2PPFA 1BQUA 1BLNB 3MRNB 2NQCA 4HJSA 1H8OA 4HHAA 3ZN6A 4RWYH 1S7VA 3MU3A 4FG6D 1Z9LA 1V54B 2BX5A 3N1QC 3ZZQA 3FU5A 2Y1VA 3H42L 1ZA6B 1J9TA 1ZLWK 1K6QH 4ZD3L 3IF1A 3ZJAA 4G8EA 1N70A 3E0GA 3CZSA 1F5WA 2AW2A 3MV9B 2FGWH 1DVXA 4EXKA 4H1LB 1O7SA 3UTZB 4ALAL 5JDJA 2X53A 4UUJB 4DNLA 1TETH 2CO7B 5LHDA 3T9WA 4OCXH 1X9LA 3T0WA 3F5WB 1D9KB 2DQEH 1C16A 4KI1A 4UB0L 5CIPH 4U3XA 5EBLA 3BVVA 3CX5K 4JCMA 4OVVA 3Q6GH 1B6UA 3INUH 3GKZA 3BD3A 2OMXA 3ECBA 1TPXB 5J3HD 3WMPA 2B4CH 3QRBA 4M43L 3FQUA 2KZKA 3F7YB 1YY9C 1T7WA 1M7IA 2XN0A 3FPYA 3ATDA 3EJSA 1DVFC 3QXTA 2D8KA 2X2IA 1J5OH 3VFVB 3UO1H 5DCCA 4YIQB 3BMVA 1OAZH 1TTUA 5EU3A 4IBWA 2R59A 4RGMB 4EZMA 1OSEA 3ARDD 2GITA 4Y5VB 4C59B 2O5YL 5HDBE 1G9MH 1XDTT 2EC8A 1JGDA 5AFAA 4YL4A 3UZVA 1AHKA 3IMBA 4U6XB 1IQDB 1F1AA 1JNLL 3TOPA 3WDJA 4XPAL 2BOCA 3ZL4L 4UMGA 2JKLA 5AKTA 4EUPA 4P2RD 3GSXA 4FJZA 2D2OA 4IK6A 4R8WH 3RGVA 4KRPB 5BJTB 3K1DA 3O4OC 5C6WH 3ZQXA 1G7IB 3GMLB 1LP9B 4MLIA 1HQRB 1OCWL 2EDKA 1OSZB 5KG9B 2C9XA 3MQIA 2OJEA 1VCAA 3PWVB 4M3HA 1MXGA 2COQA 2X4RA 4LAJH 4XCCL 1MI5B 2XBDA 2G0LA 4X6FB 1OWRM 1E4XI 1QSFB 5FYKL 2EDHA 3HMWH 2OYMA 1GC1C 2LFGA 4FHKA 4LLYA 3RAJH 3ATAA 1NAMH 4LL9A 1A4JB 2P5EE 1PJ9A 4UV4L 1T66C 3UP6A 5M94B 2YK1L 4IOIB 4LSQH 1CICA 4XBEH 5CIPA 3BN9D 4CN6A 1NPJA 4K73A 3QNFA 4TKWA 2YKKA 5D1QC 3WAKA 4DK5A 1UUSA 4QO1B 4EOWL 2AJZB 4XB8A 1DUZB 3HE7B 4DCQB 5AB0A 4D9RD 4WWKA 5DUBA 3DVFA 2WVSA 3K71B 2Q1EA 1K4CB 1GMEA 5HYIA 4QIRA 5EHFA 1WFIA 3B7YA 4WEBH 3Q8EA 4U3HA 2ZOKB 2WTOA 4IGBC 3BCDA 3C8KB 2VMDA 3KPTA 3UACA 3ZDXF 1F56A 2A9AA 4BZ2L 2I9TB 1BZEA 3BE1H 5IBTH 4N90D 1TQBC 3H9YA 4GH7B 1P5UB 1KBBA 4X6CB 3GQFA 1FL5B 3F7QA 1T0MB 4F9LA 4OQTH 5FYJH 3TYFA 2YXFA 2Z91A 4HUWB 3ZKXC 5FKPA 1P7KB 4AJWA 2ZICA 4GW5B 4P04A 4JO2L 1TYEB 2NY1B 4L4VB 1PMYA 3EFFB 4NUJA 3RU8H 3NCEB 3GXMA 4JO4L 4TPRL 4TQEL 2CK2A 1R3KA 2ED8A 2WLIA 4FQQB 1EZSA 4QHKI 2PYEE 3APDA 1H6UA 5IQ9A 4F7MB 2IXQB 2HFFA 3KLHD 3KLLA 5KVFL 4PRPA 4G8IA 1A3QA 2OL3H 5EBMA 1QWHA 1ZHLA 1YNLL 1DSYA 3PQYB 3MXVL 2QKIC 3RWFA 1R5IB 2AQRA 3KBFA 4LASL 5D7LB 3TA3B 3MROA 4Y9GA 3T6QC 4FFYL 4FFVD 5DRWB 1HI6A 2BSSB 3H42H 2WO4A 4IOFD 4K94L 1UXLA 4ZD3H 2P80D 1NCWL 3MCYA 1SXZA 4JHVA 4NM8L 5ID0B 1OANA 3WG7B 3ZKND 2H9GB 3JWOC 3U0WL 4ALAH 5B4MC 1AXTL 4PJGF 2WXKA 4PJFA 1TNMA 2F53B 4QRBA 2WPGA 4PRNA 3U6RA 4F80A 1ZT7B 2PPCA 4MVBC 4UB0H 2IFGA 5I6NA 2XG4B 1NSNL 5K1JA 4XX1E 4IRZH 2YBRA 4W68A 3OHMB 5IFHH 2OMTA 4XNQB 3BXNA 3BVWA 4M43H 5EF2A 1NPNA 1CN4A 5C0ND 4AMWA 5CBAB 1IE5A 3P77B 4G7SB 5DURB 3D7PA 3NJXA 3QC6X 2XSKA 5A2BA 4P4KC 1E0OB 1QBAA 4Y2LA 1DFBL 4P23C 1SLUA 3SYPA 3O11A 2DQFA 2FEDC 4QLRA 5GGSY 5HVHB 2OMYB 2XN9B 2VW4A 2X6AA 3H7LA 3LKSB 4FD0A 4UV7L 4DF9A 2ATPA 4JX0A 3LS5L 3L3OB 1JPGA 2DLIA 4HUUA 1MQKL 3VTMA 4RZCA 1BYOA 4BH7A 2VQ1A 4BSWB 2Z4TA 3EHBD 1UTDA 1JHKL 1Q4NX 2VZOA 4PJXE 4M7ZB 3TNNB 1KBPA 2E9GA 2ZNWA 5DJZA 2Q87A 2V3DA 4UOW1 5INDA 5TFSL 1BQHA 1DJYA 3UYRL 3Q05A 3J2PA 3IN0A 4IS6B 4JUSA 5SV3A 2OL3A 2AJ3B 5J11B 1EZLA 4NIKB 4WDIB 4J3WA 1I8LC 4XP5L 3PRZA 1VJSA 5T5FL 4NC1C 1UOWA 5JMRA 5L88L 4GMTL 4B9IA 3FU7A 2IANE 2N1KA 3QG7L 3TO4B 1F6FB 1KN2L 2P8MA 1D5XB 5IVXE 4KUZL 2J72A 2FEJA 4XCCH 4GW1B 5DJYB 4WY7H 1R3HA 5E4IA 5FYKH 3L16A 1G7QB 3FQRB 1T1YB 3KMDA 3B2UC 3FQXA 3RJDA 2D3JA 3NZ8B 4UV4H 3U7WL 4QGYA 4OT1L 3QG6A 4X98B 5CZXD 4TOYL 5J6HB 4FTVA 1TQVA 1KEGL 2ZCZA 4GSUA 4N2IA 3OKKA 2NSXA 3F65A 3BUBA 5IEHB 4IRZA 1JD7A 2Y72A 3HMXH 2CGYA 4IRJA 3OG4B 4AKPA 4DP8X 3L4XA 1LEIB 1M71A 3ETSA 3WXVL 5FWQA 4HOWA 1N7ML 4H13C 2BVQA 1YNTA 5I1HL 2MNUA 2V37A 4PRHE 3H8NA 3MLXL 4KMQA 4E41A 4HSQA 5D7KD 3J8F7 1XGPB 1ZV9A 1HSBB 1NBZA 1CFSB 2C3VA 3UBFA 2RB8A 2YMXL 3KPPB 4XPGL 2PYFA 4YAQB 2NXZD 1KSRA 4TVUA 1QUNB 1DO5A 4NKQB 2AQNA 3EFOB 3KW8A 4A2GA 4S0SD 3GXTA 3NFSL 3H9ZA 3RA7L 4Y1AB 5AD0A 1KBGH 5I6PA 4LPCA 1JXGA 3F62A 3QUKB 2IOOA 3WSQL 1FNFA 3DDGA 1VAHA 1BJ8A 2FJSA 1RPQA 3H4FA 2Y7NA 3SDAA 3SDXE 1BGXL 1KGCD 2VLKE 4J2XA 1KZQA 3QUYA 2H6UA 4ZS7L 5E6YA 4DZBA 2GSIA 3ILPB 3TU6A 2NX5B 3DDFA 4JO2H 3P3YA 1HYSC 4YVUA 2EXSA 4JO4H 3LKPB 4LLUA 4N9GB 4TPRH 1BM3L 2B15A 4GP8B 3SOTA 4B9PA 1OD9A 3H54A 1SDDB 2F1BA 2BNRE 2YGOA 1VFOA 4IMLA 1RZJL 3V8CA 3ETBJ 3K8MA 2P46B 5FFLA 1KXHA 5E2WL 5KVFH 2HT2D 4YR6A 3NCXA 3LH9A 2VXSL 1ROWA 4LCWD 3CN1A 4PI0A 5KYXA 1J8SA 2ILLA 1YNLH 2CJ3A 3MXVH 2AQ1A 4MS8D 4AC2A 3P3RA 3V6ZB 4NQUA 5DFVD 4FFYH 1C1EL 2QQLL 1Z5HA 3IJYA 3B9DA 3IDGB 4Y89A 5I2IA 1PLGL 1EFXA 2R2BB 4K94H 2Y7QB 1NCWH 4MNHB 2ADJB 3KLQA 3QS2A 3HMXA 4NM8H 1C7TA 3HN5A 3T3PE 1AXTH 3V7MA 3VGFA 1NUDA 1W8EA 1OHQA 5CJXA 3D0AA 3W1ZA 3QORA 5L0QC 5FYLD 3P0VL 4CNIB 1LO5A 2IAMA 4NQDB 4WU7A 4UU9B 5AOKA 4YSQA 4DTGL 4GBXA 1PZ5B 2R0KH 3D18A 1NSNH 4HMCA 4KMLB 4UBDC 1FDLL 2FQDA 4AV5A 3QZWB 5H37H 1YAZA 3FTXA 1J0ZA 3U48A 3TM6A 3RGVC 4Z7AA 1WWWX 4X8CA 2LU7A 5DEGB 4LBEA 1Q94A 3ALPA 3MODH 4I0CC 1ETZA 1E9QB 5TE7L 3W9DA 4TULL 2HTKC 4E2OA 2XA3A 5DVMA 3DUUB 5IT2L 3NQKA 4UV7H 1THAA 4BGLA 3S3JA 2IGFH 1VHPA 2FBJL 2IIJA 3ZT7A 3EJCA 4X5WB 2GBAA 4YPGA 3VWKC 2RCSL 1WAEA 5EU7E 1BG1A 4ZX3A 3DHUA 1JHKH 4W9LC 3LIZL 5IK3A 4PJEA 1E27B 2I85A 5HYSA 2ODHA 2Z7WA 5AOIA 4LKCB 3HZVB 4G6AC 1A8ZA 1KGWA 3P4LA 4U31A 2F8XC 2XUWA 5CD5D 1NCIA 2ZAHA 5T5FH 5L88H 1U3NA 2B4CC 4GMTH 1SFHA 2ADGA 2X4OA 4FFYA 4JO8A 3R8BB 5C08A 1KN2H 4QYOB 2YJLA 3GMRB 1FL3B 4NSKA 4PJAF 1FNLA 4R4ND 3UTSE 4Z7NB 1UZ6E 2EAEA 2AEIT 2QELA 4N2CA 3WNKA 1DLHB 5B22A 5FR3A 3D39B 2BVEA 1JF5A 3C09C 1GTFA 5FO9B 3WTSA 1H0DB 5EUOA 3DX4A 3B83A 3U7WH 2FJHA 2AGJL 4MAYA 3TCLB 4OT1H 5C9JB 1JAEA 4NZTL 4AYGA 1IVLA 4TOYH 1KYFA 3FZUD 2GI0A 4ZUTA 5T3XD 3V8OA 5IROD 3L6FB 1KEGH 2XWJB 4JANB 4NKDB 2I9LB 2ADIA 1O9VA 1KGUA 4X50A 3G5ZA 5H37A 2DM2A 3GMQA 4BQ9A 1QHOA 4N3TA 3MV7A 4JRXA 3BWZA 4F9LC 3WXVH 3BHBA 5AALA 4XBPB 1N7MH 1L9TA 3ERXA 5I1HH 4DEPB 3W39A 2AABL 3LD8B 3MLXH 4HLJA 3UYOD 5CR1A 2LFEA 3KVDD 3BKYH 3LKRA 4UQ3A 2YMXH 1EDYA 3VG9B 4XPGH 3OZKA 1ASOA 1E7VA 5IG7B 1ACYL 4XP4L 4C55A 1WK0A 3QH3A 5JOFB 4YEFA 1X9UA 1TTFA 4J12A 3RA7H 5ICZA 2IALB 3OKOB 4JZNB 3WSQH 5TDNB 1CS6A 1PX3A 4PJHE 2IDUA 3SKOB 4Y7OC 4ZTOL 4P8QA 1BGXH 1KIQB 5IKCA 4F5CA 2EE0A 1RHFA 5AOMA 4TNEA 4ZS7H 2Z3FA 1BEYL 3LRLA 3KCPB 5IIEB 3B7UX 3QEQB 5D2NA 4HWZB 5T5FA 4A67A 3IGAA 3HPJB 4GO9A 4BFEA 1UFUA 2A83B 5LGJA 1BM3H 3PJSA 4I9WD 4D9QE 5F88B 4UMSA 4PWJA 4ZPVA 5I0YA 4GRMA 1RZJH 1H3VA 5I23A 2R2HB 4J3SA 3IMWA 3SGEH 5AW3B 1BVOA 5EBWB 2VXSH 1KIUB 5T1LD 1JD9A 2NY3C 1P6FA 1RSYA 3L3KA 4E5XB 1U93B 3AWFA 4LRIA 5BS0D 2YPVL 2YUZA 1PKQB 1WCBA 4JFEA 3CJJA 4JRYD 2QQLH 4YBHA 2PTUA 1IC5L 3VVWA 1PLGH 4KKLC 4YFDB 3CFMA 4OH2A 3HIZA 3SDDA 2HMIC 3VTAA 5HGBB 3O6LH 2B2XL 4P99A 1F6AA 4PRAA 3OZLA 1CO1A 2G5RA 2A73A 3SJVB 4F7EA 4WENB 4O02L 1SLWA 2MH4A 4I8DA 4AYFB 4AQZA 1FVCA 4BK8A 2EDEA 4KPHL 5HDQL 2AK4E 1RPUA 3P0VH 1BQRA 4N85A 3CK0L 5GGUB 2GFBA 2Y22A 4DTGH 1DBBL 2C5DC 3NJMA 5I73C 2NXYB 3S34L 1FDLH 4EJ1C 4P46B 1ZS2A 1FNAA 1IM3D 3KL3A 3U36A 3DETD 1KLUA 2DI7A 4HCGA 1IBDA 3HJEA 2WQXA 3OJMB 4LKXB 4OI9A 2CCWA 3IJHA 4KV5F 4JRLA 3AAZB 3TEXA 2GTZB 4AVKA 4RMUA 4FQJL 4R96A 5TE7H 1T21A 4TLKA 2ZUWA 3UTOA 3AQYA 1DBKL 1EWHA 2Y6SC 5IT2H 4PRDB 4S0TD 1S78D 1M2VB 3TIDB 4A6YH 2FZ3A 4JM4L 1WFNA 3WD5L 2CLRB 4KKBC 3W0WA 4ALAC 5HVWA 3LIZH 3L1OL 3S3DB 3K6OA 4LFHG 4IU2A 2JF1A 1E43A 2XY1A 5F9OL 2UYLA 4GNKB 1A6TA 5B1AB 3TCTA 1UKQA 5GRJL 1IBZA 3EG9B 4RGNC 5TD4A 3MA7A 4AIEA 4Z7QF 2HFGL 3STLB 5SX5H 2F68X 4IRJC 1UM6L 3MTXA 3ZL1A 4NT6B 2J2ZA 2RALA 1TJGL 3N50A 4KXCA 1Y18B 4NQED 2X4UB 3HG2A 2A9NL 4MXVE 4MJIB 2QZQA 1BLNA 4OCLC 2J8UB 5H35A 2E9WA 2QL1A 2TRYA 4YHNB 5KSUB 4ONFL 3BPNB 3QISA 3HHRB 4K3EL 4AK2A 4NZTH 4G1MA 4OLXL 3RI5K 3V0FA 3FTZA 3EDEA 5E8PB 4IOSD 2IVFC 4MS6A 5D5MB 7PAZA 1VGKB 5HVFB 1DJHA 5JQHC 3X1BA 2Z31D 1N3NB 4N24A 4AJ0A 3PWUA 3QUYC 4Z7OB 4DKEH 3OLGA 4KZCA 1R34A 4HXAL 1NEPA 1URZA 2AABH 3F5WA 1MVFA 2HAZA 1S9VA 3B3IA 2NY6D 4RFNB 4ABUA 3O4LB 1EQWA 1I9EA 1MFNA 3WU1A 3ZPDA 1ONQA 5EDSA 1RP9A 4FLRA 3TBCA 3WY1A 3ZUCA 3EOBA 5FUOL 3UZQB 1ACYH 5JOPE 4YSRA 4XP4H 2X5PA 4L2YA 4A6YA 2OM5A 4ACTA 5FA3B 4DH2A 4LCUB 1G7PB 3QDGD 3QHFL 5C7ZA 1YN7B 3LIZA 4HHGA 5E8OB 3V6OA 1P4UA 1OP4A 3NFPB 1CI3M 2EINB 5GISL 1ZIBA 5KOMC 1T6WA 2ZWZA 3NA4A 1QYGL 2C3GA 1BEYH 3MUY1 1HAWA 2P26A 3UO8B 2MKWA 4JFHE 1CR9L 2CDFA 2L7UA 3H9HA 1BMZA 1A14L 3STZB 5FXCH 2Y5QA 3EH4B 4JQXC 4LLDB 5DJ0B 3VXMD 1UB5A 1J8HB 3IFOA 5CJXC 3N9GL 3QORC 4S1QL 4I1NB 3EJUA 4YSCA 4FYTA 3WAJA 2ZSVA 3D05A 3KH4A 5B3JE 1AGEA 1IAIM 2M8XA 2UXGA 3ATBA 3F64A 3NZHL 5BXFA 4UTAH 5D1ZD 4ZUWB 2VDKB 3L5IA 4LLAA 1XV8A 2X2YA 4PB0L 3EYSL 4UT9L 5C09E 4L0ZA 3MYJA 2MMXA 3HE6A 2DWYA 1IC5H 2C8NA 3GTVA 5DD5L 4BA8A 3DRQB 1HS6A 3QXDB 2O30A 1QSFA 4G5AA 4E42B 4AKOA 5G2NA 1QD0A 2JJTA 2B2XH 4XNXL 4D9LL 2EABA 1A4JA 1MCCA 3NPZB 3ISYA 3PNWA 4KC3B 4O02H 2NR6A 1QFUL 5KSBE 5JOEA 2HX8A 2WXMA 4N2MA 5C3TA 3H7BB 4XN7A 5HDQH 1JS4A 2HT4C 4AZ8B 3LDBB 3BVNB 1SVZA 2MCG1 1NC2D 4JFDB 2WXNA 3U79A 1DBBH 1W6WA 3ARFB 3KPOA 4LDLB 3S34H 4DCQA 2EIZB 5A3IC 4OLUL 5IMMB 3LN4B 3FTSA 3IXTB 4AEHH 1NLBL 4BGDA 1DVQA 1EBAA 4FQJH 4TNGA 5I76A 2YAPA 2ZOKA 1DBKH 3I9IA 2FHFA 3QI9C 4UIKL 3C8KA 2NY2C 2PYEA 1QABA 4FNPA 3EZJB 4K94C 1USZA 5D1XE 2VLLB 2I5YL 4RA0C 1AXSA 3C8HA 5C0JA 5I1AA 4DN3L 2XWDA 4ZODA 2BIPA 1JWSB 4YH6A 2EUWA 1AP2A 2E6JA 3HB3C 3UGUA 2BS71 5DGQA 4QT5A 2WO3B 3RL1A 4BK5A 3L4ZA 4LU5L 4MAYC 5HTSA 4LSRL 5F9OH 1U2YA 4G5ZL 4HUWA 5GRJH 3SE4C 5MI0C 2DJSA 2LW3A 2PW2B 3EDFA 1MJJB 4JRFA 4KTDL 1JVOA 4UTAA 5H2BB 4N4YB 2DIAA 5AW8B 2HFGH 3KS0H 1HDMA 1UM6H 2VR7A 1TJGH 1FNSL 4KJQC 1E5ZA 2A9NH 1Q38A 5DQDH 5J6GA 3WFHA 2DN7A 2IMMA 1PX4A 3L3IB 2XTLA 5CJ8A 3SQBA 3NCYS 1RZGA 5D96C 3BO8A 4BQ6A 2ARWA 4NKOB 4M7JH 2LTQB 4O02A 2WQ8A 1ZLDA 2WCGA 3M1BB 4ONFH 5DJ8B 4K3EH 2UUDH 1MCBA 2X10A 3Q2CA 4Z7VF 4P5SA 5FO8B 3VA6A 5B3SB 3IRPX 1A47A 4K5OA 4NZUL 5F7BA 1MLBA 1OD7A 3IFPA 3L48A 3F01A 3TV3L 1NGQL 2X4SB 4A38A 2DWXA 3QCVL 4KNSA 2JI2A 2KDYA 3DO4A 4HXAH 4QAMB 3OBAA 4NYLA 4FL4B 3WUZA 5D1QD 1JK9B 2EJ1A 1U91A 3CD4A 2OZNA 1USQA 4PWHA 2EDFA 2BXYA 4UTCA 3G04A 2Q10A 3EOYG 3ZZLA 3G9AB 2BIQA 4P2CG 1MNUL 4HIJB 5CN3A 4PJXA 3L3JA 4L3EB 1BW8A 2N56A 4FMVA 4QKXB 4K71B 3DX2A 1XVSA 4U1MB 2QLVB 2Q9OA 4GAFB 3QHFH 3WIIL 2YD0A 4KVPA 2I07B 2XV6B 4IIZA 3PGFL 4LRIC 5JA8B 5E6IA 3QDMD 1CXLA 1TZHA 2XA8L 3CUPB 1ZVYA 5GISH 2XN9A 2ZXQA 4XHJD 1CFNB 1YPZE 2IANA 2PNDA 4M1DL 4ELMB 5C6PB 5IW6A 3L3OA 4FCHA 1PLBA 5IVXA 3JVGC 1CR9H 1WP6A 1X5FA 2DKUA 1P4BL 1UD3A 3SDDC 1UEYA 5LXVA 4Z6AT 2WINA 4BXSV 3V4PB 1BQSA 3KM2A 1V3KA 1V05A 3GF8A 3VB9A 1EX0A 2CRIA 2EDOA 4J8RA 2AK1L 1IC4H 3VDBA 3N9GH 2PWDA 4OZGB 1X9RA 4PGBB 4S1QH 1BIIB 2EXTA 1KC5L 4XNUL 1XSJA 4J1UB 4NENB 4ZZKA 4U0QB 2PWFA 4I7ZC 3WNIA 2EEDA 4UT9H 3EYSH 5T1KD 2H32H 1S5IL 1D5XA 2Y2WA 1WHPA 4PJBE 1MCLA 1N2RA 1SRDA 2OSYA 3BKJL 1IAIH 5DD5H 2W5PA 4AIOA 3VGEA 1XGYL 1N5AA 3H0TA 1L7TL 4XNXH 2PTTB 1E4HA 3NZ8A 1TO5A 1KTRL 5CZKA 5B7FA 1I3RB 4K0OA 4M4PA 4V1DB 1QFUH 4ZRGA 4A7TA 5J6HA 2G5UA 4Z3TA 5DFTA 4BUQA 5J1AB 4M8QB 1KIPA 1SXCA 2VO8A 4P2QB 1RZJC 5B4MD 1QFWM 1OAYL 4OLUH 3SDXA 4L3CB 1VEMA 3QAZC 2VLKA 3KPSD 1E42A 5I1EL 4QRTA 5HHQA 4MVBD 1XGPA 1MREL 1X5YA 2V7NB 1QFWL 1ES0B 4PJ6A 4Z77A 3E38A 2WZPD 1RPKA 2F8IA 4UIKH 1U8LB 4LMQE 2BNRA 2W0FA 2I5YH 5B1KA 2JELL 5J12B 4DN3H 1GW0A 2L7QA 4P4KD 4S11A 4TLSA 4HKZB 2AANA 4P23D 4PJCE 2J20A 3Q8CA 2A6DA 2FEDD 2OMZA 4GP5B 4HJIA 5HI4C 3L13A 1ECZA 5K59F 2VN3A 4NP4H 5INCA 2Q8AL 4J8QA 4LU5H 1CGSL 4LSRH 2ZXEB 3MRLB 4G5ZH 2NY0B 3ILPA 4KTDH 4X4XB 4WKZB 3UTQB 5I16B 2PUQT 1RIVL 2Y24A 5MEPA 1ND0B 4K5PA 5FA4B 2YA0A 4PAZA 4PJ5B 4RAUB 2H32A 1O75A 1LP9F 4X9GA 4GI9A 1SUJA 1HXMB 4XOBA 4WGKA 3QRGL 1FNSH 4MMYB 5A40E 5JR1L 5GZND 5C0AB 3ARYA 5KWYC 1PVHA 1NBVL 4AI7A 5I8CB 4BWWA 1AVAA 2H0PA 2DQCL 4HP5A 2DLFL 1UJ3A 2XVLA 2CCLA 5A16A 5ICUA 2PABA 5E2UL 2BW5A 3BWAA 3UPAA 4A7UA 5T1JA 4HJ1A 4EDWL 3B3BA 1XGQB 2XOTA 3DVIA 2XWBB 3EO0A 1NUNB 4B9ZA 4NZUH 4QR7A 1FFOA 4TQ8A 5E9DE 4BRJA 4Z18A 4NRZB 4TVPE 3TV3H 4B97A 3D69A 3I02A 4F8QA 4ZQTA 4F7PA 4JM2C 5DZOA 5E2VH 3QCVH 1NCGA 2G2RB 2OBGA 4N68A 1S6NA 4Z1PA 2VDOB 2HRLA 1XF5A 4Y2DB 3BPOC 4YDMA 1K85A 4ZTEA 1RLBA 3UTTB 4WNSA 2EH8L 4UU9A 1XZ0A 1I7UA 1CL7L 3IPBA 4U1LA 4XOCA 5C3LD 1MNUH 1QEWA 4XR8C 3FUNA 1HEJC 2PXYB 4TSAL 5DQ9A 5LGHL 5AUMB 4X2UA 4FZEL 3WIIH 4JS7A 2IBGA 2ZCKL 4QOKE 1FIEA 1U3HB 3PGFH 4FERA 1I4FB 4UDUB 4PV9B 2XA8H 1LO2L 1P7QD 3O9WA 1ZTXE 3HE6C 4X6CF 1FZJA 5GIRA 4M1DH 3UEZA 5ENWB 5GHWL 4I48A 1UATA 5CINL 4XMWA 3UTSA 4IU3B 1P4BH 3W3BA 5D4QA 1PTZA 2JJTC 4L8BA 4ZUSA 1ZJAA 1E27A 2AK1H 3OJ2C 4HVBA 1WH0A 1NBCA 2CUMA 4NHUB 4QF1B 1KC5H 4XNUH 5B21A 4M8RA 3CFCL 4JFPA 4WFED 1HYSD 3U30C 3VVVA 4UM9A 3S9DB 4G1EB 5I8EA 1BZDA 2EXYC 1PX8A 2K7PA 2DLEA 3HLAA 4DPBX 3WIFA 4ZUUA 1S5IH 3GMRA 3LIUA 1ML0A 4LGPB 1XEUA 1CTOA 3BKJH 1AGFA 4Y4FB 2CZNA 4P3CL 1W0VA 2XZQL 2HRHA 3NEEA 1DEEA 3GSOB 5B39G 4DKFL 2O93L 1MHCB 1TLMA 2IH9A 4JZOA 3WKQA 5ECJE 3IMRA 1L7TH 3FSOA 1ZXQA 4UM8A 5BQDA 1AS7A 3CLWA 5C9JA 1UB6A 3O6ML 1BBJB 4FNUA 4D8PA 2LVCA 5D2LB 1SM3L 4GQ9L 5F7KC 1H15A 4R7DB 4A7GF 1A65A 3UAJA 2IEPA 3V9FA 1PDKB 3Q48A 1OCZB 4BK5C 3FRPB 2Q0ZX 3DXAE 4TV3A 3U0PA 2IFFH 3L5WB 1JYVA 3L5HA 4HALA 4HXBL 4APXB 5CCGE 1D7DA 2DYPB 3MOQA 4YDVB 1B3IA 1M05B 1MREH 1JYWA 2GT9A 1H6FA 1OF2A 1QFWH 1KNOB 1T0PB 4KX8A 3EDKA 1E5UI 4UBDD 4G9FE 4WQOA 3MRKA 4MMZB 1P2CB 4ODHL 4MHHI 4URTB 4Q4IA 3RGVD 2JELH 5E24E 1U8KB 4ZBJA 5TDNA 1DDHA 3MNWA 3SKOA 4N1HB 2MJWA 4JGMA 2HTKD 1ZVSB 3EKCA 4YBQC 2DJUA 4O2FA 2Q8AH 4AWJC 3Q2VA 1G4RA 3ZQWA 4XPBL 3VWKD 2P1YA 3IDMA 4JNXA 1RIVH 3JV6B 1X5AA 3D6GA 1HHIB 4IKKA 1IO4C 4YMPA 3SYCA 3DTXB 2FRGP 3REVB 3QRGH 3BP5B 3S4SA 5JR1H 5CBEB 3P9MB 3L4TA 4PS3A 1JGEB 5C0EA 4HZAA 4R90L 1A1MA 3QDJB 3P0GB 4X42A 2FYYB 2F7OA 4NRXA 4WHCA 2DLFH 2UVFA 3GJFK 2AK4A 2YEZB 4JGJA 4W9DC 5CJOL 5IVOA 5D6CB 3FDWA 4QRFA 1ZS8B 1LXMA 2QJDA 3MOBH 5ITFB 1QA9B 2FDBP 5ISZE 5E2UH 3S36L 1HCFX 3DV4B 2X4PA 4EDWH 1XCQB 3E8UH 4KI5F 4LOEA 3U7YL 3UIYA 4DP5X 2WTRB 5CSZB 1T7YA 2BO0A 2OPCA 4PD4K 1G9EA 3N6YA 5E6IC 3QO1A 4ZFZB 1IBGL 4E9RA 3MFFB 2P48B 4JFOB 1RK7A 3L4UA 1WS8A 3CH8A 1GL4B 4I18B 1J9QA 2Z4QB 4PP2B 1E8WA 3NIGE 1PD1A 3MRQB 4RFEB 3HRZB 2EH8H 1KXVA 4Z3EA 3CG8A 1THCA 4DFIA 4M62L 5DC2A 4K7PH 4KO5A 4TSAH 4LKXA 1VACB 4YSOA 5FO7A 5LGHH 3S5LG 3ZDYF 5I1IL 1XL4A 1S46A 1VFAB 3K8LA 4JG0H 5ESVA 4FZEH 2GTZA 3UBXA 3ZTDC 1FBIL 4JE4B 2ZCKH 4N28A 4KH9A 4I0PB 4PCTA 5EC1B 5E1AA 3D52A 1LEKB 5I28A 4X7CC 1V8HA 2X9ZA 3N42B 4P59L 5FM4A 3FRUB 3TIDA 4U3SB 2L0DA 2Q86A 5FOBA 3ETBF 1OM9A 2GVYA 4JPKL 5GHWH 4PRPD 4JHAL 3P4NA 3QJQB 1K3IA 3OAZK 1UXWB 5J1TC 3KWWB 3FT3B 1G0XA 2W60B 3ARVA 2OX5B 1JWMA 2BHZA 1WA2X 2C1PA 2YXWA 5D7JB 5HVGB 3V0VB 1IGYB 4R3SB 3VRJA 2X7LA 1OPOA 3EYOA 4DVBB 3WY3A 3S37X 3C5ZC 4D7PA 3H85A 2V17L 4XMLL 2WTPA 3RVUC 3RY5A 2ZUYA 4ECNA 1L6PA 4QRRD 1HOCA 4NLHA 4P3CH 3V52L 4Z7UE 1WICA 2XZQH 2DPKA 1AQDB 2NY5H 2NY3D 3AWEA 3ZO9A 3R4DA 4FXKB 4C4BA 1G9NL 2DTSA 3N55A 4OGAC 5JPNA 3DSNB 3PDGA 4M9OA 4MDJB 2CGZA 1B0WA 1RL1A 1ZANH 2Z9TA 3B6SA 4M29A 3O6MH 1MCNA 4IKIA 3TNMA 1HJBC 4MZIA 2BCMA 4GQ9H 1CFVH 1XGTB 2Q2EB 3DBXA 1MDAA 1VGKA 4P57B 4O58L 5FYJD 2HH0L 5IMLA 1QW9A 2ED6A 2R1YA 4F1ZA 3CVCA 2C9PA 3BKCL 4YFEA 2DV6A 4OVUA 2ZJSL 4UF7C 4HXBH 1SHXA 1TMCB 3MRRA 4W9GC 4LSUH 2WVVA 1TQUA 3CDZB 4P9HL 4MNQD 1RH8A 1O0VA 3DMMD 1KB9J 4LL4A 2CQVA 3CFDA 5FA3A 3QFGA 3KBEA 3CFBB 4JG1L 1LD9A 4KJWD 1DVUA 5GGRB 1UJ3C 1WWCA 8FABA 3LNEA 2K9FB 4RMQA 4XCFL 4MCNA 4WHYG 4HOZA 2UXFA 5FM8A 3DIVA 4R7NA 1FFNB 1BFOB 2JIXB 2VO5A 4AUYA 4XPBH 3UBHA 1AFVL 2Q7AA 5LG6A 4M5SA 4KKBD 1S7TA 1GZQA 4UNTA 3Q6FA 3BPCB 3D9AL 2YBGA 4GAJL 4I9XA 4PG2A 4M7KL 4LLDA 3VG0L 4CDHA 3VFRB 3AY4A 1CE1L 3FQ4A 2W91A 4R90H 3SBWA 4XMKL 1CMOA 4HKBB 4Z7NF 1PIFA 2VWEE 3QDAA 1NMBL 2FCBA 5E0FA 2N59A 3QPXL 4ZW7A 1HH6B 5CJOH 4OM1L 5EU7C 4HJTA 1NEUA 4IQHA 3GSQA 4U6VL 2HJFA 4QRPE 3N04A 2G75B 3S36H 3MMEA 2J6EL 2Q7YB 4TVPL 4RA3A 3QNYB 4TTDC 4MXWL 5ESQA 3VCLA 1PBYA 1KJVB 3GJEA 4L4TB 5AYTA 3U7YH 4EE2A 1KTLB 1XR8B 1NANH 2A1WL 4L8DA 4F2EA 1M53A 1TT6A 1ZHKB 5JO5B 3S2AA 3EUUA 3WYRA 3CXDL 1UXSB 1N19A 3QFJA 1IBGH 1FG2A 2R39A 3GNML 1HZHL 4XVTL 5AKSA 2BFVL 1UHVA 1VDGA 5EV7A 1SBBA 3DV6A 3FB5B 3RWIB 2K6WA 1U36A 1W2KT 1YUHB 2EE3A 3SCMA 5D1XA 3VFNB 3RZCD 1R47A 1GSKA 4N5EC 2H3KA 3ARFA 5D9SB 1AC0A 1ZA3A 4KKQA 3QIWC 3QUYD 4EZJA 1Z5LB 4ZT1A 5I1IH 1HXYA 3KJ4C 5DQJB 4TUKH 3V95A 3IXTA 1ZPUA 1J05B 4KTEL 5JORA 1ZTXL 1O7VA 4DAGL 1FBIH 2X89D 3QIBA 4CVZA 2M2DA 4L23A 1H8NA 1LMKA 3T0EE 1CGUA 1QSED 4NEHB 5KAQF 4YSPA 1OALA 1JZIA 4P59H 2VQ4A 2ENPA 2VLRD 5FYKD 1J0HA 3GI9L 4KQ3L 4JPKH 3TFKC 4HOMA 5JW4M 3BJ91 4PP1C 1NMCB 3F8UB 3ZVVA 3NEXA 4F27A 4BWTA 3CDGB 1LWRA 2JKRM 3BD4A 3VXSB 1LO4H 2XETA 3W9EA 3NIDB 4HFUL 1RMFL 3PL6A 4IJ3C 5BRQA 1V10A 1MIEL 4YSTA 4GQQA 3IFLL 4EN3A 5IJBC 5AB9A 5KSVB 1VPOL 1XH2A 1H5BC 3QORD 3V6BR 4EEEA 3IMUA 3B37A 4HJ0C 3VSQA 2VN7A 3QNZA 2F7IA 3P9LA 1OTTC 3SPGA 2K8QA 1CG9B 1G9NH 4K9EL 4X80L 7CGTA 2KZ1B 5E2TH 3TIEA 4XTRC 2C7UA 1H3TA 3KPLA 4OF6A 5DJ8A 4DO5A 3FF8A 3PYCA 1WRFA 4KO6A 3DX8A 4CU8A 3I74A 1T20B 1OGSA 5DC9B 5B38B 3L2LA 5I30L 3S35X 4FI7A 4LHUB 4U1NA 1AY1L 3JT0A 4O2CB 4NQVB 4F15B 5EUKB 3F05A 2HH0H 5EU4A 3BKCH 4IDLA 3GEFA 2R2EB 4Q7DA 4F3FB 1YEGL 1KY7A 2D4DA 5HHMD 3O8XA 2ZJSH 3QB7C 1Z9SB 5BZZA 3B2VL 1A9EB 2VDLB 1ZV5A 2HT4D 3O3AA 4ICXA 3VFSB 1CI5A 1RK1A 5AAMC 1KDIA 3PQYE 4J3UA 3RNQB 4KKCC 3FT0A 5D7LE 1FVEB 1E3XA 4P9HH 5A3ID 2VZSA 3LB6C 5GJTL 1JHTB 2BY0A 4ZTPL 2GIXA 2Y2TA 3TT3H 5JMOC 1LLAA 3FO9A 3U1PA 5T1MB 3T6XA 4JG1H 2GJPA 2HRGA 1H3GA 5AW0B 1UD6A 3GBNL 1WFJA 2I07A 2A99A 1AGBB 4XCFH 3WN6A 4IBSA 3NDZE 5C08D 4HCRL 3QI9D 4NUQA 2NY2D 2GJ6E 2X4QB 2PN5A 5HYJB 3D3VE 3QXAA 2V2XB 4PJBA 3S48A 3K6SB 5DR5L 4BDVA 3CHQA 2IDCA 1ICTA 1MCIA 3HB3D 5GSRB 5IB1A 2H6PB 1F13A 3FTWA 3D9AH 4GAJH 5AOLA 2YPLE 4M7KH 1F4WH 2VW6A 3OKLB 5F1SA 1NJ9B 4FQ2L 1CE1H 2P43B 4KVCL 4PTTB 1R9FA 3EYFA 3OAWA 4PIRF 1LK2A 4QRUB 3OF6A 3HI6L 4XMKH 2VYRE 3ISWA 4MRCA 5L4MA 3M8OL 2YC1B 5K9QI 3CPUA 4MD4B 5DD1L 4OM1H 2J8UF 5ETUB 3HKFA 1PZAA 4U6VH 2X41A 2HG5B 2IGTA 1RK0A 4NM4H 4OUUB 4TVPH 3C2AH 1E40A 4MJ5A 4DZ8A 1GOGA 2IMNA 3CQFA 5E4EB 2A1WH 1YEDB 2Q20A 3CXDH 1YEJL 5IGXL 3GNMH 1TTGA 1HZHH 2XTJB 4I13B 2BFVH 4PREB 5GRXG 5BNXD 2VDML 1MCPH 3OMNB 1A1NB 1QSZA 1S5HB 4Z7OF 3QJFA 4KTGA 3G7TA 4F7TA 1E3FA 4BD4A 3QQ4B 2QSCL 3FTUA 3UGEA 2YFOA 2V5YA 1GY2A 2ZSWA 4PJCA 2EADA 1TVBA 4JVWA 4TUJB 1DHKA 3DGCR 4PVBA 1S8DB 2ROXA 4OCWL 3ZTCC 4I1RA 4P07A 4KTEH 1ZSDB 1ZTXH 4DAGH 1ADWA 2IH3B 3ILEA 4H8UA 3E6HA 2B5IB 1IM9B 3S3PA 1IBBA 3D87B 4OLWL 5F7EH 3MRGA 1J87A 3EYVB 1NCBH 4PG9B 5ESAA 3RTQA 1ROCA 2DZEA 2KPWA 4ZFOB 2IDQA 4V2CB 3SGDI 5L9DL 2FIKB 4JBSA 1NC4D 2DQIL 1ZK9A 5C2BL 5FC9A 2VJ0A 3U1QA 5JPNC 5KYNA 3ARDB 2LE9A 3TURA 4AH2A 3GMOA 3N44B 5KZCD 3RVXC 3FCUB 2R1XB 3OR6B 3MRLA 2OXHB 1YEIL 4HFUH 2AQ2A 1NEZA 1ASQA 3SDDD 1MCKA 1NINA 3SDYL 1AIFA 4RNRA 4P2RB 4IRSD 1ND0A 1R5VA 1Z6JT 3MRMA 1JI1A 4GKSB 3LSOB 5E9DA 3NFNB 1T7ZA 3MVSA 1VPOH 3MNMA 4LCCB 3DHJA 4GB9A 4PGDB 3JUZA 2J5LB 4BWUA 3TBTA 2JB6A 4PSPA 5E00A 3ARGB 3EFDL 3CFEA 1MF2L 4K55A 1MRCL 4K9EH 4X80H 2PR4L 1X4ZA 5I66B 1RULL 2X05A 5F7FA 4LVOC 2HVBA 3ARWA 1CDJA 1ORSB 3VWJB 1MLCB 2CA4A 1NOAA 5E8NB 3QFDA 2WSKA 2K4WA 4MD5B 5GS0L 3ME0B 1ZHNB 5I30H 4MA1C 1ZLUH 5DJ2B 4M7LT 2VW7A 4WW2A 1AY1H 4NRZA 5IOKA 3AG3B 1G7JB 4QOKA 1RZ8B 3EGDB 3CMGA 3QZOA 3FCTA 5HYFA 4Y16A 3IDJA 4JFFB 1IC7L 2BP8A 4OGXL 1DVZA 3B2VH 2MHAA 3EO1B 5TF0A 2EEBA 2X1XR 2EVIA 2OYPA 4OIIL 1YY8B 5CF3A 2RACA 2OMWB 2TSAA 3AY4C 5GJTH 4GS7B 3FHAA 4UNIA 1PFOA 4G6MH 3FU8A 4GIPD 3X11B 5AUMA 3SBWC 4LPWA 4PS4L 1A6PA 4PVNA 3VE0A 1SMAA 3HZMA 1K8DB 2J21A 4A63A 3GBNH 3SO3B 1UKTA 4RAVB 3ZMNA 4OZIA 3WJJA 3GXIA 3FUFA 2BS8A 1TTBA 5IMOB 3T77A 2BNUB 3FB8A 4EVNA 4P5TA 4NCDA 4BM7A 3WJMB 2EVHA 3CDCA 4NQDE 3L3DB 5DR5H 3DIFB 3SKNA 1T7XA 4F2MB 3MLVL 5JHBA 5HI4D 1R24B 3VXOB 3HUJE 4FQ2H 1R3IH 2ZCHL 4ENEC 4LNRA 5C7XH 2PO6A 4MNGE 3MNZA 1CFQB 1TQCB 4AQAB 3AUWB 3HI6H 4YXHL 3SCMC 5D1XC 5DK0B 3WOVA 1CLYL 3M8OH 3CH1A 4YHML 3QUZB 4XN1A 2Y36L 1PZBA 4MDIB 5E03A 1NTDA 1PW3A 2AEPH 3DVGA 1MFAL 1WAAA 4U0RB 4F20A 3QUXB 1HZLA 4NN7B 3DXAA 4ZDHA 3RUGB 1YDPB 2YGPA 2IDFA 4W70A 1Q72L 2AXGB 5BQ7B 1YEJH 2XKUA 4QWWC 5CEZE 5IGXH 1SHWA 4MQXC 4HEMA 5DVLA 3EGSB 1G87A 1HL9A 2YPKB 3BWUF 2OMUA 2VDMH 4G9FA 4R2GC 1SPDA 4IIQA 1BBJA 1W91A 4WWID 3W11C 5IFJA 5D2LA 4NO2B 4NLAA 1EZVY 4XWOD 3UJJL 3HNSL 1U2HA 2YD6A 3FU9A 2WXIA 4QHLA 2QSCH 3ZO0A 1FGVL 4YDLB 1Z9NA 1JI2A 1X7TA 4TXVB 2YA1A 3GMNA 2J55A 4JM2D 1Z9OA 2FWLB 2WCPA 3UYPB 4OCWH 3FTYA 3PL6C 5HGHB 2V2WA 4MD0A 5GZOC 5GRVK 5I5JA 3R06A 2GG1A 4KVNL 4NN5B 3EDDA 5ELIA 3CXHK 3DX9A 4EN3C 1JBJA 3CZFA 1KWGA 2A6JA 3B9KC 5I15L 5LNDA 4CADB 3NJNA 4Y4HB 2P5ED 1JNHB 1OP3K 1FP5A 4ELMF 2FK9A 2P24A 4JUTA 2BMKB 1T03L 2DQIH 2WO2B 2MTAA 3JWNG 2BC4A 2Y5TB 1OTUC 5DTFB 4ZFGL 3QUML 4PGCB 3K5SA 3MUZ1 4KNUA 4DJMA 3HE6D 4NQCE 1LNUB 1NBYB 4D0CA 2DLHA 3EHBB 1RXLA 2J1YA 4HWNA 1CURA 1YEIH 5ISZA 3D09A 1OGPA 3LXBA 4CL7A 3DOIA 4OZGF 4KROC 3M88A 3JV6A 4FGMA 4WHDA 4K7FA 3SDYH 4J4PD 1HHGB 3ABZA 5IBLD 4TF4A 1XF2B 4KNTA 4TQPA 4L0YA 3B8SA 3DJ9A 5CGYC 5CBEA 3GM8A 4JFWA 3O8XC 4P5MB 2YOCA 3DOHA 3OR7B 1A0QL 3TZVA 4XN9A 2OSXA 3FU0A 1CUOA 3WJLA 2XQYG 3EFDH 1ORQB 1IBYA 2EXYD 1UCTA 1U8PB 3HS0A 2EDXA 2PR4H 3MC0A 5LBSH 1F90L 1RULH 5ITFA 5LGKA 3M07A 1SYVB 3TV8A 2JI1A 1BP3B 3HHSB 1MSPA 4WK2B 3BCFA 2FX8L 1I3GH 1FFQA 3P3SA 3NRFA 1FSKB 3JWDL 5I6MA 1B9KA 3US1A 3ES6A 3VFMB 1A7NL 2B77A 4JJ5B 1ZLVK 2CHXA 2EH7L 4HQQL 2N7AA 5EEUA 3OLDA 2PYED 1L9SA 3KPRD 3WLWD 4AX3A 1IC7H 4I18A 2YEVB 4OGXH 3T0VA 2H6OA 1CGYA 2OQJA 1K8IB 4OIIH 1TVHB 2GCYB 5EZLB 2EILB 3BZFB 5B7MA 1VFAA 1F42A 2NXZB 4PJ8A 1G9NC 3SGJC 2FSEB 4MB4A 1MCEA 1N0LB 1ZHBA 5FW8A 3KEHA 1LEKA 4DKAA 2YD2A 4MX7A 3RFZA 2IH1B 3IAQA 2XFXA 4CUCA 1CGXA 1FL6B 3MLZL 4L8SA 4RQQB 4GQZA 2YLHA 2CKNA 1NFKA 1KXTA 3DRTB 3FT3A 3BT0A 3MLVH 3QJZA 5D7KE 5CSGA 2P49B 2OX5A 3IBEA 3V0VA 3VYPA 3MBEA 1TLKA 4I2XA 5F71A 2O61A 3ZY7A 3L4CA 1B0GB 1IGYA 2JCCB 5EORL 3NVQA 3SB3A 3GSWB 5KYWB 3QQDB 1EK3A 1AKJD 3SGKA 1X5JA 2YHGA 3BZEA 2HN7B 3ZDZB 4YXHH 1DQTA 1ZPLA 4LOUC 5LBSA 3WTUA 4YHMH 2LABA 3FCBA 1JVLA 5HI3C 3P11L 1PZ3A 4P9HC 3RDTA 2Y36H 4CAGA 4D0DB 3H2WA 1CD1B 5IUCA 5I9QC 4LCWB 1MFAH 2BSTB 3FQ1A 2WC7A 3LNDA 4GKZB 4H8HA 2GSMB 3TWYA 3MUGB 3DBSA 3G6JB 4PJIB 5EFIB 3VQ2C 1WBZA 4KKZA 1D5BB 4GXUN 3RWDA 4AIZA 1Q72H 2DW5A 4HWBL 4J3BA 3CCHB 3L1GA 2DWSA 3HBPA 3IDNA 4TM9A 3AREB 2D7TL 5E08L 1RJCA 3UJJH 3HNSH 1BAFH 1X44A 4XPTL 2PCYA 4DP9X 3NGBC 3UPRA 1FGVH 5E6ID 1E9OA 1K72A 3BSGA 2ZWNA 3GHEL 3WKYA 4MCZA 4NDMB 7FABL 1OWWA 2P8LB 4WI7A 3LNFA 4K3GA 2KC0A 4AXWA 3BUYA 4JO1L 2R56L 5HYQA 2PCFB 4LB8A 3EJPA 1G94A 4Q2ZB 3QCTL 5IJVA 1S3KL 1ITCA 4KVNH 4OFYA 5H4ZA 5SWSE 2IDSA 2HXAA 4KGJA 5TJWK 1CQYA 5I15H 1AD9B 4H25B 4NC0B 1KENH 1ET5A 2EEFA 5CMAA 4IKLA 2W9DL 4TUUA 5I71B 3U7AA 1F58L 4LVNC 5D5ME 1P9MA 2UVEA 4OBRA 2G60L 1Q9WB 3CE1A 4P2AA 3V0IA 5FYLE 4BKTC 2E6PA 1MFVA 4DGVL 2CIIB 2EKSA 1S7QA 3QUMH 1BZ9A 3QULB 1DCLA 3PP3H 1X6NA 1BFOA 2XJKA 2CO3A 2Y1ZA 3IETB 4QRPA 3GI8L 1DN2A 1YECH 3J7HA 3KW7A 1N9PA 2D03L 4PRHD 4WW2C 2CRZA 1VZGA 1J9SA 1HH9A 3NCJL 3VJ6A 5K9OB 3H9SE 3ORJA 5AOJA 1KPUB 4HK3N 5IHWA 4Q0XL 2JKXA 1ZSHA 1OW0A 3ZE1E 3OQ3B 1KTDA 4Y16C 3WFDL 4ZMYA 3HFFA 2BDNH 3C5ZD 1RIHL 5F3BA 1A0QH 1WAAF 2WWKO 4HKBA 3ULVF 1T3FB 2AVGA 3ZYOA 4Y9FA 1DE4B 1QI3A 2BS9A 1TZGH 5GPRA 1F90H 4YSUA 4FEIA 5C9KA 4NUGL 2N7BA 4N2GA 4ABWA 2XBZA 4YE0A 3VXRB 4QJ5B 3NJLA 4PTUA 3MBXL 2FX8H 3QNYA 3JWDH 4L4TA 2PCPB 1XR8A 4TNFA 5D2LF 5JO5A 5FPIA 2EYTB 1KZYA 1A7NH 3U4AA 4OGAD 3II3A 2ERJB 1IUZA 3TWCL 3WJJC 3JTTA 2VDRB 4HQQH 3DUSA 3H1ZA 2F0CA 3GLEA 3QVAA 3BKML 4ZW8A 4GUOA 3V2AR 4P5TC 4B41A 1F3DJ 3T0EA 2BNRD 3PCYA 4PWKA 1UASA 3FB5A 1PY9A 3D0LA 2FIRT 1YUHA 3BVDB 5DO8A 3VFNA 1H3WM 2RFXB 1OSYA 2QSQA 4GAYA 3VX1A 1UZ8B 5EIIB 5L4IA 3BIBX 4KK5C 4WI3A 1SY6L 2PO6C 3FOLB 4WUUE 2FHCA 1NGYB 2D31B 2YO3A 3G5YB 4K9EC 4BH8A 3QUMA 4OZFB 4RDBA 4X6BB 1FGNL 2G5BA 4WI9A 4YHPB 2OMBA 2F74A 1KTBA 3AG2B 4G8FB 3TVMA 4Q9RL 2Q76A 2D3LA 2ESVB 3WLBA 1KN4L 3PFUA 4P2OC 4XNYL 5DMIL 4JDEA 2E9BA 2QPFA 3LEXA 3UEQA 4QXWA 3ZE2B 3CDGA 3QJSB 1EEUA 4LSVH 5D7EA 4P5RA 2CE6A 1RUKL 3E6FB 4TUOA 5D93C 4BRVA 4NNYA 3IJ8A 4X9BA 2CM6A 4IIQC 4NUPA 4ZSOE 5AVSB 4KDTC 1LTXA 4EQ3A 5F7AA 4U2ZA 5MERB 1JWUA 3P11H 1DJWA 4X7TB 4JM0A 2O6EA 5BZDA 5J9PA 3A6OA 4JN2B 4X0KA 5F6IB 2GBVA 3MGTB 5T1LB 3TPUB 1OAKL 5CEZL 1GY1A 4YEEA 5TK2A 5IP4A 5BS0B 3FHEA 2V3FA 1NUGA 4YQXL 4JRYB 2YQBA 4YL9A 1FYHB 4HWBH 1Z9PA 2AMUA 5DZPA 1IGJA 1XBRA 1RUAL 1LWJA 4JY5H 3T4YA 1YA5A 3PPEA 1UACL 1KV3A 2DEXX 2F54E 4HGWB 4OZ4B 5B38A 3G5XB 2D7TH 1A4KA 1A5FL 3ZUNC 5E08H 3WE6B 1FORH 4XPFH 3UAEA 3VFPA 1K5NB 4XPTH 3RPIA 1U8NB 3PG2A 3GHEH 4QKTA 3K7UA 4HIEB 1ZGLM 5DWPA 5IEKB 4NC2B 7FABH 4X8GA 4F3FA 4NQSB 4FA6A 1JXDA 3CX2A 3OTTA 4D3CL 4JO1H 2R56H 3RVTC 2VN5A 2DJ4A 3C5SB 1H3PL 3D3VA 4G71B 3UTPD 3QCTH 3KXFB 4N5ED 4BQBA 3AROA 3WV0A 3QEUA 1QW8A 4Z5RA 3QJHB 1Z1WA 3QIWD 3DX1A 5EB9A 2WZ0A 2E9IA 1X5XA 3U9UA 2YPLA 1HNGA 3UJTL 2MCMA 2EDRA 1TU2A 2W9DH 2YAQA 3N42F 3V4VB 4JHBA 3TZVC 1F58H 2NYZA 1Q9KB 3CPLB 3N06B 4IKNA 2IDTA 3T65B 4PJ9C 1OM3L 3HS0C 3BD5A 3WUWA 5EMYA 3DNKA 1B4RA 3D2UB 3MN8A 3DX7A 3L17A 4XNMA 3FQTB 1IKFL 1W72B 3GSNL 2VC2L 3TFKD 3J07A 2V2XA 3GI8H 5AYUL 5EEZA 4HWEL 3QXWA 4ZXBC 4XO8A 1A6WL 2NW2A 1P6WA 2CCVA 4C4KO 4Q0XH 2NY4C 4UIMB 3OGOE 2D2CC 4UWQB 3NCYP 5F44A 3D1MC 5EZPA 3WFDH 1G6RL 2XDHA 3OHXB 1RIHH 3VGAC 2DI8A 4PHZA 5KYUB 1J9RA 4JZJA 3ZR6A 5SV4A 4HWBA 2QADB 5BRZB 5K39B 1X3DA 1FF5A 2XQYK 2X1PA 4AMKL 4JREB 1L9PA 1QVOB 4H1LG 4O51B 2WXGA 1OB1A 4DWHA 3HN3A 4OUUA 4ZMWA 2V7HA 2A6KA 3MBXH 4N0FA 4OLZL 5DDHB 2F8VA 3WN5B 4S1DC 1IIKA 5ALCL 4PJ8C 1FHNA 3L4VA 3KYKL 3G3LA 1OTTD 1BF2A 1UWGL 2BOLA 2J25A 4WU5B 4AL8L 3TWCH 2BPBA 4XTRD 3UDWA 2O5XL 3FC8A 5DJCA 3IRCA 1T0OA 1U8IA 4D9QD 3RFZC 1HWWA 2XY2A 5L2JA 4L8SC 4OZHE 1AQ8A 1JJUA 2Z31B 4N2BA 2ZX7A 3QA3B 1QI5A 3JZYA 2QR0A 4N20A 3QZBA 4L29A 2FO8A 2NY6B 1UA6L 2DF3A 2EEAA 4MJ6B 1PQZA 3SGKC 5I75C 4FI8A 4PS8A 1L0QA 3MJWA 2GTQA 3RDTC 2VUOA 1FGNH 4HUKB 4KKCD 2M1KA 1XQ4A 4DK3A 4RBPH 1RFDH 4Q9RH 2H3NB 1Y0LB 2VMCA 4IBVA 3LB6D 1CT8A 1VEPA 1L9OA 1O6SA 1YCSA 3CLEH 2BERA 1KN4H 3QDGB 4V1DE 5TH2B 5GS0C 5I1LB 1DTUA 1TCRB 3LRGA 1W9XA 2NNXA 5DMIH 4GAGL 4AM0A 4MCYB 2IPUG 1EMTL 4LAQL 4P2QE 2J6WA 4LLVA 1RUKH 1BJMA 5EO1B 3ZHNA 3F00A 3IEAA 3AS1A 4A2LA 1RY7B 2EDDA 3O3EB 3BH8A 2VR8A 1CDIA 5AW4B 1C08A 3VXMB 3AITA 5DEFA 4BV1A 3KHOA 5L2KB 2E56A 4EI5D 4X6DA 1H8SA 1IGFL 2UZXB 3VDCA 2Q3AA 2WXLA 5AKVA 2DIBA 2BRQA 3QGVA 4W4OA 1P7HL 3WL9B 2YR3A 1OAKH 5CEZH 5C0IA 3C6LC 5AVWB 2GPZA 3CFTA 5D1ZB 4QRSB 4YQXH 3MLWL 6FABL 2OR7A 1FFPA 1F1DA 5EF0A 1X5HA 1CE6B 1RUAH 5JDSB 1QLRB 4HDIB 1FO0B 1UACH 3FMGL 4U1SA 2L7EA 3L1FA 5DGRA 5EC2B 1A5FH 3B9AA 3RILA 1WIOA 3Q0HA 3U9WA 5DYOA 4PJ5E 1H9DA 4N2FA 2VWEC 2Q2LA 4Y5XA 3FBKA 4JVUA 4S2SB 1CVRA 4H5SA 2BIHA 4XNBA 3VXPB 4MA3B 3P4MB 5DI8B 3K72B 1H3PH 3B1UA 3WMQA 2ATKB 2OMWA 1OW0C 2G4GA 4W9EC 5FYLL 3HUJA 3UJTH 5C0FB 3WI9A 3TL5A 3RL2B 4GG6B 2HSIA 1IV8A 4ABQA 4C83B 5GXBB 1FZMB 4YPJA 1IVTA 1K8DA 2ZWLT 1F02I 1OM3H 1CIDA 3FN0L 3QE5A 4DP7X 4JJOA 4O4YL 1GPOL 5E5MA 2VE6B