2DWXA

Co-crystal structure analysis of gga1-gae with the wnsf motif
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
129
structure length
129
Chain Sequence
NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor-binding protein GGA1
total genus 17
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwxA00
5CN1A 1NA8A 1W80A 3HS8A 4BCXA 2YMTA 1KYFA 2E9GA 2VJ0A 2A7BA 1B9KA 1KYUA 3MNMA 2DWXA 5CN2A 1KYDA 1KY6A 1QTPA 2DWYA 1P4UA 1GYUA 1GYWA 1QTSA 1GYVA 3ZY7A 1IU1A 1KY7A 1OM9A 3ZHFA
chains in the Genus database with same CATH superfamily
1KBVA 1T22B 1MLBA 3ZE0F 5EZPA 5IV2A 3WL9B 2WXGA 1ZTXE 5DVLA 3EDJA 3K6IA 4KO6A 1VESA 3TPKA 2BJML 3IPBA 4KJYA 4YDVA 4TSCL 1HESA 4J3OF 2GKIA 2VDNB 1M9WA 3JZ7A 3ZZQA 2IOMA 3FPXA 1IM9B 2XDHA 1FE8H 2LTQC 3L17A 3V4VH 4UV7H 3QWRA 2IBZX 2HKFL 3GMNA 1OP9A 2LW3A 5DU7A 4G1EA 1LO3H 1OLZA 2B4CL 1OY3B 4AEHH 5C0RL 1AXTL 1BD2D 2BWDA 4HOXA 3Q48A 5ITFA 1QNIA 3QR1A 3RDTA 1EVUA 1KFGA 1M6OA 3BSZH 4LOEA 5FF6B 4APQB 4MA7H 4NNYB 1SYSA 1JWSB 1EJOH 5SWZE 4UTAA 2HMIC 5DJ2B 4O2FB 5JOFB 5KSUB 1XDTT 1MQKL 5JQ6H 4BFBD 4NDMB 5FO2A 4XOEA 3G5WA 5DC2A 2HX8A 3GLAA 4KNQA 1ET7A 3ESOA 5KBMA 4G6MH 3PDOB 4HK3J 1S7RB 2JCCF 4ENEC 2QVKA 3JWOL 2OCCB 1LJMA 4KC3B 4H8WH 4Y5XA 5E6IC 3FAWA 3ZTCC 1O9VA 3ATFA 1MRDH 3U9UA 2M8XA 4OBRA 3KVDD 4N6RA 4UT6L 5DVOA 4DWHA 1GGCL 3DX8B 1HHHB 4FP8H 3HZKA 3KM2A 4Y4HC 1LGVA 2FEDD 2NRDA 3BVVA 1URIA 4OD1L 2E6QA 1AI1H 3QEQB 2HXAA 2L4OA 3M6DA 5LGHL 3FFDB 4CKQA 3IVKA 2ITFA 4P8QA 2BMKB 4LESA 3HIZA 5ALCH 2YAFA 5L2KE 2VZOA 2Q6WB 3NIDF 3CLWA 4MYPA 5E99H 1BF2A 1NIFA 4HWBH 2E47A 3O6FD 3NMEA 4NFDA 5D1ZC 4TUJB 4H0HB 4YXLH 4ES9A 2Z4TA 2WD0A 2Y36L 3VX0A 4DGYH 1YEHL 5JQHC 2HG5A 5ECJE 1T4WA 1CFQB 3L4UA 4DGWC 3T5WA 4ZX4A 4YDJA 3ZQWA 2D0HA 5IW3A 2JXMA 3NIFF 4LVHB 3HRZA 4HH9B 3R8BB 4WI0A 5F7NC 2L3BA 2X4RB 1KB5H 1PY0A 3NJFA 4EOWH 1U8NB 4JFYA 3EUDA 1COBA 1RAMA 1MW3A 2L7QA 2X6AA 3ULSB 2HT2D 4WQOA 4A68A 2Q6WA 3LS4L 5I1HL 1RP8A 4FNUA 3OKDA 3ULAB 4QJ4B 4N0UE 1FO0A 4ATWA 1U8CB 4G8AC 4YR6B 4CA4A 2X5PA 4HIIA 2DN7A 5C09D 4PRNB 4PJAE 2F54A 1BM3H 5C0CD 3PUCA 1IAIL 1YQVH 4NLHA 3LRSA 4OF8A 1W72B 2ID5A 4ZFFB 1E9OA 3FONA 1RUAL 4JREC 3HNTL 3P0VH 3RIKA 5KSVB 1U3HC 4IOSA 2E7MA 3BYTA 4NQDB 4XMWA 1I7RA 5DYOB 2H1XA 5AKTA 4PIRF 3C09B 3RVXD 1CL7I 2ITCA 3LKPA 1NAMB 2WVSA 4JZOB 4LU5H 1F11B 4O58H 1PKOA 2Z35B 4OGAC 2AJZB 4FTVB 4RGNC 1NPUA 4ZPVA 1R0AH 5CZXC 1TJIH 2VGLM 4YK4C 3KWTA 3RZCA 2VMEA 4XVTH 1JDAA 1Z7JA 5EC1B 3VXQB 1N59B 3TN0C 3L2MA 3KBFA 1TTUA 3X1GA 2J73A 4P4KD 2NTFA 1YEIL 4QHLA 3SDDC 3U30B 4ZFFA 1ZTXH 1K2DA 1H3VA 2LAGB 2QDVA 2ENQA 5K93A 1Q9LB 1KXTA 4ELKB 4U6VL 3FSAA 4H5SB 3V0VA 2RJMA 3F58H 4M6OL 1FI8C 2HRGA 3QR2A 5B1AB 3V0WH 3VGAB 3MRCB 4Q4IA 3J8F7 3BPLB 3G5ZA 3L5HA 4YBQC 5DVKA 4U1LA 4W9CC 3KPPA 3PXHA 1L9PA 5JR1L 1TJXA 4MA1B 2HPOA 4W4NA 5TDOB 4OVUA 3HEIB 4F7PB 2DYRB 3E9TA 5HDQH 3V2AR 3U30C 3SDDB 5IFJB 3L1FA 5AZ2H 2J8HA 1P7BA 5GRVK 1R3HA 1XIWB 1R3KB 5JDJA 1G6RA 2HTKD 4KY2A 4G9FB 5IHHA 5HI5C 2CO2A 3AITA 1NC4A 2CSPA 2EDWA 4KAQH 1QEWA 3DYPA 1KJ2B 4L9DA 5DO2C 3H9SB 2MSPA 4QXWA 4XNMB 4AX3A 1KXQE 5IFHL 5KVFE 3L9YA 3KL3A 4BKLA 2VDNL 5J1SC 3D7PA 1O5PA 4O51B 4UYPA 4BRVA 4UQCA 4OD2B 3ZKQD 4Z7NE 4XVUD 4ENZA 2KLRA 1JNLL 3S5LB 5KTEL 2VCOA 1NBZA 2NQDA 2MCPH 5DFWH 2OYKA 4J5VA 5IOKA 4NJ9H 4BCYA 2X0UA 1U3HD 5IKCB 3VXRD 3MUGA 5C0FB 2K4WA 3Q9PA 3IETA 5F89A 1UWYA 3PQYB 4PB0H 3FFOA 1IKFH 2PW1B 3ARBB 1MCNA 4HSCX 2WQXA 3JWNC 3U0TA 1C16B 2BRRL 1QI4A 5CJXA 3HAEG 4XE0A 2MNJB 3WFCH 2VLRE 4LDLB 2BSCA 2WO3B 1KCKA 2OTPA 4E41B 4F37F 3LXBA 4KQ3L 4PJHF 2AQ3A 5KVDH 3MGTB 1N19A 3MRFB 1RURH 4TLSA 3V4UL 3GRBA 3LS4H 2FLMA 2W9EH 4NQCA 3WFCL 1REIA 5A2BA 1AYRA 1ZSDB 2ZYIA 3N55A 4GXUM 2CPCA 3GSUB 1DBBH 1A7OL 4IBZA 1KJMA 1AP2A 4YVUA 4LDOB 4U4IA 3SDCA 4IIQB 3PJNA 3VD7A 5EBMB 4AQZA 5ESQA 1WD9A 3ABMB 3WAJA 3OJVC 1WG3A 3P30L 3QIUC 4M7ZB 2ETWA 3F3HA 1CF8L 1P4IH 5BJTA 4XTRD 2Y9RT 4QD2E 4TV3A 4DGYL 1PEZA 2FSDA 1EEQA 3NCYS 2OV0A 2NPLX 4K3GA 4PMFA 2FT7A 3ARFC 1DUZA 2P3YA 1CD1B 4N26A 3I75A 4YZFF 3KDPB 2WWKO 1F56A 3P11H 1J1PH 3QXDB 2G4GA 4JM2A 1WA1X 4IS6B 1F3RB 2ZAIA 1IAOA 4KOBA 2I32A 4XCEA 5CEZH 3DPBA 3IFOA 4NQSB 1HSAB 2G5RA 4KNSA 2YR3A 4KKLC 4JFTA 5DC9B 4LLAA 1CI5A 1CR9H 3WFDH 4NZRL 3SBWC 1JN6B 4IKJA 5DD5H 3ZHFA 1WWWX 2VQ1B 4L29B 2KKQA 2P5WD 3HG5A 3CC5A 3MRMA 2A7BA 2C9QA 3U7AA 1IL1A 3SGJC 4PMEA 1U30A 3O2VL 1FNGB 3HUJE 2EDBA 1ZCRA 4R8WH 2ED6A 4E9WA 2ZUQB 1N6UA 5F9JA 2IDTA 4QF1A 4KKQA 1AO7E 1SFHA 2L7UA 1IB5A 5IMOB 3LS5H 4WW2B 5AVWB 3M07A 3KWWA 3GMNB 3OD3A 3VYPA 2CR0A 3U48A 1BOYA 1U92B 3GNMH 2BSEA 4QGYA 2HVJA 1V27A 1AXTH 1YO4A 5FUCE 1HXKA 4FULA 4JY5L 5I16B 1BQKA 3E3QE 3G6DH 5D7IE 1T2JA 1MZZA 3RTQD 4JFOB 5F7LB 4FTVA 2AAVA 3AREB 1CVRA 4JAMA 4QKXB 3GUTB 2Z6FA 5I0XA 1SOQA 4RZKA 4PJ7F 1Y07A 4JDTL 3PWLA 2AXJA 3DOHA 1TJGH 1TTAA 1R3LB 1U2CA 2VN5A 2Z34A 5BCAA 3WLWC 1SQMA 1Y6MR 3ZTNH 3WTXA 2FWOA 1RY7B 2P43B 3N9GH 2J7LA 5HGDB 2CU9A 5A2IH 3RILA 2ZWNA 2PYFA 2EO1A 2ED8A 4DKEH 4A39A 1CIDA 1XGYL 4TQEL 2YAMA 4ZTPH 3C6LB 4GMSH 3UPAA 4HCRL 3DBXB 4A6YB 3V0VB 2WWMC 3SE8H 4P2RD 3UBGA 1JZHA 5J9PA 3RWCA 2DWXA 1D3CA 1KUMA 2XYBA 3HC2A 3K74B 3Q2WA 4DTGL 1Q4NX 2R29H 2WAQA 3M1BA 2CK0L 5E00B 1RZFH 1HU8A 4PV8B 5JXAL 4JRYE 3HHRB 2OBGA 4LHUB 1PZ5A 1OSPL 2HLFC 4H0IA 6FABL 2QGBA 2KDGA 1XF2A 2KLSA 1KIPA 5FO8B 1MRFH 1XIWD 3BWAB 4GAAA 1PY4A 3OQRA 1T0OA 4PJEE 4WK4B 6TAAA 5IBLD 1ODAA 4NT6A 4GXVL 3WHE1 4GQPH 1WC7B 2J6WA 4EZLA 4Z7QE 4ZI8A 1CL7H 3T0DA 1GY1A 4KBPA 3ERXA 5GGUB 5A16B 4TSBL 3NSJA 3C8KA 3U4KA 4G83A 3T4YB 2LFGA 3VI3A 4X6BA 5D72H 3QXTA 2GJZB 3G04A 2DI7A 1E5BA 4Y5VA 2XTSA 5KVGH 2DYPA 4FQ1L 1E6OH 3MRNA 4JVUA 3SPJA 3B5TA 1QBLH 4I0PC 1YA5A 3IJ7A 3NA9L 1SLUA 5TF0A 3RPBA 3FTVA 3NDZE 3FYIB 3H9HB 4U6TA 5IJCC 5CJBA 1TYRA 3PWNA 5T5FL 3K71B 5CXPA 3S5LA 4IMLA 1MFAL 4GBXB 5CEZL 2QADD 2EE0A 4XP9L 2VERN 3CC1A 4YVNA 1HVXA 5T1LD 4GRWH 3UO8B 1WDAA 3I9IA 2WK2A 3S48A 3OKDB 3UYOD 4NFBA 4C83A 4Z3JA 5G4OA 5SWSB 2ATPB 5IW6A 3O9WA 2Y06H 4GAGL 3OWRA 5I18H 3BRGC 2UYLB 4PBVC 4X6BB 2VXVH 5J11B 4N0FB 2PTVA 1CXEA 3TA3C 5H35A 1WICA 3CZNA 1B4JL 4M6ML 1PFOA 1E9OB 3FONB 2F7QA 4Q7DA 2PCPA 4WU5B 4FQQA 2HYMA 5T1KB 5AYUH 1H5BA 4G43B 3RDJA 3F6IA 3TFKC 2GW5A 1EX0A 3E6FB 2LAAA 3K71A 3TZVB 3LH2L 4JO4H 4B5ZA 1EWHA 4QDGA 4QEGA 4JY6B 4LOUD 3TYFA 1JZ2A 1DANU 1B0IA 1VGEL 3Q3GB 4R3SB 1T83A 2VLRA 3TJEL 3DXAD 1KCSH 4UNIA 4G8EA 1FN4A 3DX3A 3GMQB 3QORD 4HJ1A 4O9HH 1FSKB 5GGTH 5D70L 4EF3A 1JF6A 1JGUH 3WIIH 2DH2A 3POHA 4BZ1L 5TFSH 3DIDA 2EDLA 3KBHE 3V4PB 4LSDA 3TBWA 1E5ZA 3PWPE 2E7HA 1EO8L 4PD4K 5DI8A 3T3MF 3TCLA 3A6CH 4L1BA 1QRND 2AAAA 4MKTA 5T3XH 5IQ7H 5C0IA 3QZMA 5GZOC 1MG3C 1Z9LA 2CALA 2K6YA 5B4MD 3PWUA 4YE4H 1J9SA 4Q6IA 5L9DL 2GY5A 4W9ZA 3OAYK 5AYQA 1N7ML 3WS3A 4FYSA 4HV8A 3WI9A 5LNGA 1MWAL 4LPYA 4YGVB 3MROA 5DD3L 2AZUA 2P46B 4L23A 5D55A 5FOBA 1U8KA 2ZXDA 3KPNA 5BMFH 2BLFA 2JI1A 4GT0A 5DS8B 5HHMB 2A6JA 3NRQA 3BO8A 4U1HB 3LHAA 4KKPA 3FUHA 2X89A 4WRLA 3IDJB 4F91B 2Q7AA 4HZLA 4P2OA 2XVLA 3GIZH 1DO5A 5A2JH 2Q9OA 3OKMA 2AXGB 2DWDA 2FYVA 4GKSB 4WI4A 2XI9A 1QATA 1MHPL 3C2AH 3CXFA 5E6RB 2O6PA 4B96A 3M8OL 3RDTB 4HKZB 4PBWD 2X70A 2WC7A 4BQCA 2F15A 2XN9A 2B20A 2BSTB 2JQAA 1FWXA 1Q0YH 4N2CA 1KBGH 3MU3A 1NFAA 5JIKA 2IFFL 1FZMB 2E27H 5GGRB 1UJ3A 3UX9B 4JPSA 5ADPH 1WFMA 5JOPD 2E6JA 2YFNA 1WHPA 3HMXA 4G6JL 3HUJA 3P02A 3KCPB 1X9LA 2EIKB 2YPLA 1FL6A 4DKTA 4NOFA 3KPOB 2R7EA 2ZCKH 2GBUA 4N24A 1UG9A 4FI8A 2IH1B 3TLRA 1XGUB 4M7JH 5FYJL 3SDCC 5EN3A 4N5EC 5EEXA 4FG4A 2A83B 4WKZB 4YSOA 3UDWC 3W57A 4K3EL 5KS9F 5F8QC 5TH2B 3CLFL 1F58L 1MPAH 4H20L 4H8UA 1JVLA 1F0LA 3QFDA 2FB4L 4HCFA 3ZDZE 2FX7L 3DIVA 3F6JA 1LEKA 3SKMB 1Q0XL 2NW3A 5CM1A 1P84J 2ZKXA 4L4JA 2VB5A 4GUPB 2GK0A 4I5BA 2O5NA 2VAAB 4Q9RH 3MXWL 2AJUH 5D7JB 5CSZB 3Q13A 5BUAA 2XN1A 3GSQB 4EEEA 4ODWB 1B0GA 4ETQB 3DURA 5B3JF 5IB5B 1JHTB 1GC1H 2OMYB 3Q5OA 3W56A 3I6GA 4TUKL 1G0XA 2QVMA 2F6AA 3OGOE 5JYLA 1T3FA 4HJEA 2Z91B 3BIAX 2ROYA 2WUBH 3BSGA 3K72A 4PAZA 2MOQA 4DCQB 1IGMH 1V3JA 1BZEA 1RUAH 4AJVA 4UINH 3SKMA 3ZSSA 2J8UE 1R19A 5DFTA 4FA8A 3MV7E 3UTPE 1WCQA 1HHIB 4XN8A 1TYEB 4HJGA 3LPGA 4L4TA 5F93C 5FHBH 2JELL 1OTTD 4NAQA 5FKPB 3TEZA 1DVYA 2WSKA 4WNSA 4ZFQA 5FM4A 1UD4A 3L3DA 2AQ1A 4O02B 1UD5A 2CKBB 3V0DA 1LE5A 1U4FA 4W9DC 1C7TA 5EWIL 2ARJB 1UB5A 3VFUB 5EF1A 3ZE0B 1MCOL 1QO3A 1RCYA 4FQCH 3DX8A 3ZR5A 3VI3E 3UTTD 2CUIA 3D2UA 4ERSL 4JG0H 4Z8FL 3W39B 4NQEE 1TEGA 2WXIA 1ASPA 1I8UA 5T1MA 1M6UA 3MLPA 4Y5VC 2Y36H 4AW7A 3OB0H 1LEIA 1FL3B 1KFAL 3RE0A 5IW6B 2CO3A 1PVHA 4M5TA 5E6IA 3QXWA 2Z7UA 3RX7A 2CHZA 3SDXB 2PP7A 4L1LA 5C6PB 2VXUH 3ULUD 4RMRA 3CFCH 5DRWB 2EO9A 1SEQL 3N85L 3O4LB 1UB5B 4K94L 4UTAL 3QH3B 2R9HD 2X2HA 5FUZH 1HQRB 4PP2A 3RG1C 3T6XA 3KHQA 4I77H 3QJVB 4NCDA 1CGYA 5CWSB 2LLGA 1OL0A 4YPGA 3ZGHA 2VQ4A 2BSRA 4TMPA 1P7KA 4O2CB 2YGPA 3FSVA 4UB0L 1XSOA 3AVEA 2CRZA 4NIKB 3FPYA 5C9JA 1RIVL 4PRPA 5KJ4A 4FNPA 1DEEA 4QMEA 4NZJA 4PY7B 1C12B 5CUSL 4E0RB 1NMCC 5EZIH 5DMYA 3D05A 1MLCA 5CO1A 1YY8A 1BZDA 4BFRA 1X7SA 4AZUA 2DKUA 3F00A 2PYFB 2GUOB 1R3HB 1BJ8A 1FRGH 3D39A 4OI7A 1DSWA 1HCVA 3LSOB 1RERA 1HQ4A 3FT4A 4OUOA 5GJTH 3HRPA 4ADGA 1QFUH 3QPKA 1EJOL 3IFNH 4NOBA 2MH4A 1BXXA 1RJLB 1VPOH 3VM5A 1WAEA 4KJWC 4LLYA 3B56A 1OTTC 1G7HA 5I24A 3LH8A 3VD9A 4F7CB 1MHHA 5JXED 3C5SA 2OTWB 2RFXB 1G9MH 1JV2A 2Y7SA 4V11A 5I6NA 1A5FL 2VSCA 3H3PL 3SKOB 4KQ4L 1QOKA 1JPFB 1T6WA 4N90E 4ZS6C 2QHRH 4GRWE 1NGXB 1JNNH 2ERJB 4D8OA 3D0AA 2R2EA 3QDJA 4WDIA 3RX8A 1W80A 3FQUB 5DWPA 1CU4H 3F64A 3RDTD 5CZKA 5DURD 5EDSA 3R8QA 3ARVA 3GSOA 4I1PA 3IF1A 3TNMA 5I30H 1NH6A 5FV1L 3EFOB 4NI6A 3T6VA 3VI3F 3NZHL 5B39A 3BZ4B 1MW1A 1RXLA 2NTFB 2ZSWA 3EJSA 4WWPA 2VXTH 1M2VA 3N91A 1CXFA 3ZKMC 4BZ2A 4E9RA 3V7AE 2W0FB 1RJZB 3WLWD 4X7FC 3DRTA 1VA9A 4JKKA 1R5VB 1W0VB 4RISL 3EDEA 5EF3A 4HX1A 1U8NA 4DK5A 2R9HC 3BKJH 1XTLA 1IC5L 1YMHB 2VDMH 1IM3B 2WY3B 5FFLA 2YPKB 4FOMA 4DW2L 5SX4H 2VABB 3AU1B 3VWKA 1NCDL 5CJ8A 4AYEC 1XR8A 1OV8A 1Q9WA 2EIEA 4BGLA 5DUJA 3ARTA 1RZFL 2A74B 2J2ZB 2OFQA 2R0KL 3NSDA 3UMTA 4ZYKA 4NRZB 4FQXB 1Q0EA 2NZ9D 2XHNA 3K8LA 3MRBA 4HWUA 4U3HA 2K45A 4QKTA 3E6HB 5DLML 4NUPA 2GJ6A 5IBUB 4X0KA 4PLOB 3ISYA 2V9QA 1YSOA 2JI2A 4PS4H 2JKIS 2VN7A 3BQUA 4JG5A 4TOYL 4Z76A 3TGXA 4D9QD 1EH9A 4NM8H 4X5XA 3RL2A 1AKJD 1YNTB 3AQYA 3EOAB 1ZE3C 3GMRB 3JT0A 4LQ1A 2CO4A 1DDHA 4JDZA 5TK2A 1CXLA 4OM0H 1JWMA 2ADJA 4IS6A 4FG6D 1DFXA 3RX5A 3PP4H 1GGBL 3CXDL 1QTPA 1S5IL 4QHKI 4S1QL 3SQRA 4PGDB 2WKLA 2BX5A 1CFBA 3UTSB 2QTVA 3WELA 2PCFB 5DI8B 2OI9B 1LK2B 2GCYB 5JIQA 4HOWA 5C3IA 2EYRB 3RWEA 2FEEL 2HT3D 2P26A 3D07A 3VXOA 5DJXA 1NDMA 1ZTMA 2PYED 1WS7A 3HG2A 2AK1H 1K5NB 5T3XD 2NYKA 3MOBL 2BVUA 3O9WD 1DVXA 2E4TA 1L5GB 2VR3A 3PUUA 3I9PA 2A9BA 1PLCA 5KG9A 5GZNC 4DK6A 2Z8VC 4YAQA 3V79C 1RFDL 1UCBH 4M1DL 3QO0A 4LPXA 4A2GA 2W81C 2VT0A 1CFTA 4W93A 5EBLA 3MRFA 5K1VA 3D9AH 5AW8B 3FO9A 2XRAL 1KB3A 4XHJD 3ARDC 2GSIA 1TJHL 3LRKA 3NRFA 4GAYB 4FHJA 4ZFOB 2VL5A 1Z5YD 1I3RB 2D2CC 2GIYA 3DJ9A 1ERNA 5CJOH 3S3PA 4DETA 3IGFA 1S46A 3QAZC 4PWGA 3ZLQC 4HJUA 5B7FA 4WLCA 4HHGA 3IU3B 5AZEH 4AM0Q 3LRMA 3TWYA 4JFFD 4BFIA 4G3YL 5ESQB 1CIUA 1T1WA 4PV9A 5ALBL 4D7PA 5HHQB 3G6AB 3G5XA 4K07A 4GSQA 1JPSH 2P49B 4NPYB 1UD3A 2FBJH 1GL4B 1UXLA 5F8RC 3FOMA 4M7LH 5DVMA 3OLEA 1JHKL 1VAHA 2DTML 2YQBA 1IGJB 4OM0L 2PWFA 1KGCE 1MLBB 3LPPA 2DLGA 2WOBA 4UQAA 1KXVC 3N40F 1J8KA 4KDTA 1TSHA 2OCJA 3BVDB 4HIHB 4I1RA 4LFHD 2UZIL 3ZDZF 2DQEH 4ZMVA 3J2PA 5DLMH 1XGUA 1PD1A 1Q38A 5AZUA 4AXWA 1HYSD 2OL3L 1QLFB 3BPOB 3OLDA 4IRZH 2VDPH 5MEQB 5BO0D 1D9KB 3MJ9H 1VFBB 4HJSA 4EVNA 4R2GB 4UANA 3NIFB 2PPEA 4JN1L 1QQDA 4FFWD 2VW4A 1I8AA 3V10A 3L9BA 2RH0A 5E8PB 4LASH 3IJ8A 1RZJH 2YSSB 3BWAA 3KR3L 2CBQA 3BH8A 1LO2H 4Y5YA 4PRAB 4ANKA 1MSPA 1MY7A 5L6YL 5DO2D 5AUMB 3DX9A 4GO9A 5K9OB 5JHLA 1R3IH 1C9SA 2G75A 1KPRA 3LAFA 4K5OA 5GIRA 5DEJA 1P5VA 5I8KL 3K6NA 4M9OA 4EIZC 1NEZB 3H6AA 1II4E 3SODB 2CBPA 1QI5A 1T04B 5KYWA 3D25B 3T8MA 4MNQA 3LH2H 5BQDA 3WEMA 2YWYA 1JZIA 3T0WA 35C8H 4XI5C 4A2MA 4JM4H 3MOBH 1E0OB 3F7RA 3FSOA 4PP1C 2X88A 5I30L 4U1NB 3QQ9C 2BSBA 4LGRB 1OSZA 1SDDA 3RJOA 1UXMA 2Y6TE 3UJIL 3ILDA 2FJUB 4LIQL 4E5XG 1HZKA 3DX9B 5F0PB 4S11A 1AHKA 1RH8A 43CAA 2WNWA 3HZVB 4P9HC 4AKQA 4CVZA 3L4CA 4PJ7B 4DIXA 4ZZKA 5HP5A 4DN3L 1UACL 3U46B 1JS4A 4AQ1A 2ENPA 3NN8A 4LSTL 1E3FA 3QP3A 3T6QC 3MJGX 5H35B 1MIMH 2J43A 5CBAA 4EI5A 3L3IB 2MMXA 3LQZB 3GINA 4EI5C 5L8LB 1FNFA 1KEML 1QPXA 2VIRA 1KTBA 2Q10A 5C92A 2AMUA 3FCTB 3DBXA 4A6YA 3NJLA 1L0QA 3PNWB 1RUPL 1GC1C 1OAQL 3MRHA 4Y7OC 1AHMA 4XZUB 3AC0A 1KJ2H 1X44A 1ZLUK 1KCUL 1MCHA 3DMMC 1RMFH 4NWTL 4XHQA 3BN3B 1YNKL 4WHDA 5CP7A 2BZDA 5FX3A 2HFFA 1AIFA 1OPGH 1TKWB 1ZPLA 1VIWA 2WINA 1SMOA 3SOBH 4BM7A 1IBBA 3LCYA 5F7HA 3I2CL 1B6UA 1G7PB 4XMVA 4BV1A 2HLAB 1EJ8A 4R2GC 4P2YA 3CZSA 3PS6A 1WK0A 3TBVB 4YSUA 1RULH 4IMKA 1AKJB 1XF3B 2PW1A 3ARBA 2CO6A 4HFUH 1ZGLA 2PXYB 1F3DJ 5ACZA 3MPCA 2YC1B 4ELKA 1JP5A 4R90H 1ZT7B 4BWWA 4FI7A 1QKZL 4TSAH 1BM7A 3O3EA 2YQGA 4WFHE 4MRBA 3BN9D 3APDA 2OTUA 3L7EA 3WN5B 2NNFA 2GEEA 1F97A 3B1TA 4FLOA 1KB5A 4UM9D 5CFAA 1BP3B 3L95B 3SJVD 1S9WA 5IESL 1LE9B 4C58B 2EO7A 2H3NB 3WY2A 3P3RA 5ELIA 5T1JA 3ULVD 2P24A 5E08L 3VFOA 3HW7A 3TBYB 2DM4A 4KKLD 1OB1B 4KXAA 1QI3A 4HK0A 2EIDA 4YLCA 5I8CB 3U4AA 4PLKC 2X4QA 4LLQA 3HNTH 3ZE0E 2YGOA 4C4UA 2LT9A 4M5ZL 4B9CA 2B1AH 2VMJA 2DMGA 3QUKA 5E8EB 5C0JA 4GO8A 1KY6A 3I6KB 1A6TA 5EOCL 3N1MC 1K2DB 1JV2B 2XLLA 4GIPD 1U3HB 4PREA 3WHXB 3VXRB 2VC2B 2H6UA 1SY6A 1KXTB 3M86A 3ULUC 3CHRA 2FJGB 4UM8A 4V33A 2ZZUT 4J3UA 3WHE0 3TTYA 4LCCB 4HJ0C 3C60B 4DEPC 1I1YB 1N0LB 1OQXA 3REWB 3FQUA 3MLVL 2NY4B 4IJTA 1NANI 5A2FA 5K59F 4P23C 4UTBL 4DAGH 3OKNB 1SEBA 2C9PA 3QBTB 3ZTJH 3ZX1A 4BFIB 5CCKL 5E56A 5J0BA 3VG0L 5KN5B 4L18A 1FFRA 3E2HB 2BNRD 3RIAK 1XH1A 3GXDA 1IU1A 4EDWH 3SYPA 1WFUA 1NCCL 1NOLA 2EC8A 1IVTA 1KT2A 4UWQB 1FL5B 2F54D 3FSWA 4NSKA 2AC0A 2G30A 2WBJD 2ZOTA 3ZDXF 4YSSA 4HUKB 4LLUA 1YMHA 4EI0A 5L7XL 2L0DA 4ZNCD 3KDMA 1WV7T 4XPFL 2ZUSA 4LCWA 2Z31C 4MAUL 1TZGH 4QHUB 1D9KD 2QMKA 3FL7A 3KNBA 2E8ZA 4GS7C 4UT7L 4DEWA 1XIWC 4GO6B 1KJVB 1QNZH 5E4OA 5E4EC 1QSEE 3GT6A 4EQ3A 1JGDB 4NHCH 4Z7VE 1IM3D 1AIZA 2IQAA 2RR3A 2OXHB 3TCTA 4DVBA 3WCYA 1HNYA 5BUPA 3HG1A 1CGUA 3O3DA 1L9RA 5DD1H 3IMSA 3LEXA 4JG0L 3T0BA 5BW7A 4JM2C 3BP7B 3APNA 4IEFA 6PCYA 1KMGA 1OKEA 3BLPX 4OZHB 2CLVB 4X99A 2Q7YA 3OM3B 2BVPB 1JWMB 2ADJB 2V2WB 2OMZA 4KMTH 3QZPA 4JW3A 4QXGH 3UROR 1NCAH 4JZJC 5DLLA 5K5YA 2IPUK 2BY2A 3U25A 3RNQB 2VDOB 1THAA 5EBWB 2UXVA 2CKBA 1LK3L 3DPBB 3IFOB 1LE5B 1AGDA 3QQNA 2LHAA 2V9TA 5I0YA 3BW9A 4RX4A 1H3TA 2UWEE 4MJ4A 3HC4H 4JKPH 2EZ0D 3GLEA 1WHOA 4PRBA 1TTFA 3DMMB 5C7ZA 3VWKD 4YK4B 4C47A 4G7SB 4PCYA 4I4WA 5E5RB 5IUCA 1KNOA 4QXUL 3LZFL 4NNYA 3S3DB 5I66A 5FO9B 2FEJA 3C6LC 4HKXA 3ZYJA 3IKCA 4M8QB 3VE0A 2DI9A 3ECQA 3STLB 5CN3A 2AI0L 3CX5J 4X42A 4XO8A 2ZAGA 2MKWA 5CBAB 3PWVA 4N9GB 4AEFA 5L4IA 5GGUA 3BEWA 3QHFH 4X7TA 5IB5A 4YHLL 4QRBA 2VM3A 3L3KA 5HSFA 2K70A 2H0JA 3IFLL 4HIIB 3I50H 4LEXL 1BJ1H 2PWDA 1TVDA 2Z0UA 3LVTA 4RA0C 4YHNB 4IGBC 4MB1A 4LOUC 3TTSA 3ULVE 4L8DA 1WYJA 3K72B 2K6WA 2ZIDA 2A6DA 4JFEB 4RA3A 1MI5A 4JCWA 3S97C 3V9EA 1C16A 2ZF8A 5GZOD 4L8BA 2X4TB 2BMKA 2Y07H 4XAWH 4KROB 3V6FA 3IU4H 3GEWB 4WFHD 1D6VL 1PLBA 4WWID 1M9SA 5DVNA 4EIGB 4MKMA 4M7KL 3VFGH 3WEXA 2QV4A 2J8OA 3QUZD 3FH5A 2PXYD 3C9NB 4OQTA 1YEEH 5BRZD 1FDLL 3CDFA 5FKAB 3FZUC 5LCVA 4WZ9A 2D03H 1YEDB 4TUJA 4TNWF 3IU4L 1SLVA 2X53A 4TNFA 2ZUVA 4YFEA 1PS3A 4NZTH 4XVUC 4ZOAA 2D4FA 4FCHA 4QHLB 5H37A 5E70A 4MAYB 4G6AD 3LZOA 2IBZY 3ES6B 5IJKC 1DFBL 1GSKA 2VLMD 2HN7B 3QNZB 1SOKA 1DQTA 3ESPA 4BWUA 4PSPA 4AM0A 3F62A 2H8PB 4PJXA 4APQA 3CNKA 1M7IA 3D87B 4AQ1C 4B9YA 2PABA 4OCSL 5KSUA 5IR1A 5K9OA 2DKMA 2NY3C 2NXZB 1V8HA 3KPRE 3IWVA 3U9PL 5I0ZA 3U0WH 2FBRA 2DOCA 3QFJB 4N22A 1P5VB 5IB1A 2UXTA 4JFDA 5MP6H 4FYRA 4GRWF 4U1KB 1Y6KR 4FQ1H 1OAYH 5DJ6A 3AXLB 1U93A 2NR6C 2VLRD 3BP4A 1LMIA 4JQXA 3GHBL 3L5XL 2ZXCA 1F13A 1HAUA 4OGYL 2AERT 5JHDE 4KVPA 3FT2B 3TO4A 4LSUH 3RUGB 1ORQA 3DRTB 3BP5A 1JNJA 4ODBD 3C8DA 2GK2A 4CSPA 4F15B 4JZOA 4BD4A 4F8OA 1XGQA 5IUSA 5IQOA 1T0MA 1H3UA 2RCSH 4E2OA 2V2XA 4O2EB 4HJIA 3R0MA 3TCXA 3DV6B 5T1KD 3Q43A 5EPMA 1KTLB 4YZFE 5D7LE 5HI4C 5DJ6B 4WY7H 2GI0A 4M00A 2KT6A 1INDL 3MC0A 4F9PC 1RZJC 2ZP9A 1FGVL 2WYIA 2B1AL 3EW3B 1FIGH 3FQNB 3TBTB 4LPCA 4JO4L 2IAAC 4HJJH 4X7DC 1ITBB 4G43A 3A21A 4IM8A 4PUBH 4S1RH 4RX4D 3MO1A 4OBSA 3I3DA 3IE9A 4F7CA 2MNUA 5DFVD 1YEHH 3VM7A 1NBYA 5MENA 2ZD0A 4BA8A 3IYLW 1DQKA 1UQSA 1Z9MA 1TJGL 4G8GA 1DBJL 2Y7QA 5F7WC 5FK9A 3PPSA 5D7LD 1NMBL 3CQQA 2QSCH 5AOIA 1D5RA 3MKGA 4MMXC 3WJJC 1CGSH 4NAMA 4U7MA 5C0DA 3TNNB 5EIIA 2PCFA 4BE6A 1QFOA 1GGUA 2MNWA 3R4RA 4XP9H 1J5OL 3JUZA 1MFAH 4IOFD 5KVEL 3TWCL 1U8CA 5TH2A 1KN4L 4M43H 3BMWA 3E1ZA 5HDLA 4JQVC 3HBPA 4OI9A 4PJEB 4OLWH 1SQ2N 4MZ2A 5BJTB 4TQ8A 2FH8A 3RNQA 5BVJA 3T6ZA 1JVOA 4TSBH 5GZND 1NGQL 3RKDD 5LGKA 5JQIB 5LHDA 4W9JC 2XG4B 3SKJL 3GBDA 4GXVH 1AZRA 3VWKB 4AV4A 4FNLL 1MNNA 2EVIA 3ARQA 3NSFA 5F70A 2ATKB 4Q6YA 3ELAT 1J9TA 3V5KB 1JZDC 5GXBB 2BHYA 4S2SA 5DF0A 2K1MA 3ETBF 3F04A 3WTUA 3HR5B 4NAJA 4KDWA 3JVGC 1FVCB 1KLUB 2Y7NA 4N8PA 2VM9A 3TCLB 2C9RA 5KBKA 4Z0XB 5E6ID 3I50L 3HE6D 5I17B 1JK8B 4HD9A 4IOIB 3HI1A 3P11L 2GBVA 3QWNA 3O4OC 1OHZA 1JGVH 1NLBH 1LO0H 2J55A 1SJVA 5DZVA 2ZP0T 4L1HA 1NAKL 5I1EH 4KJYB 3B6SA 1ZOXA 3Q1EA 4FQIH 1DBAH 4JB9H 5DTFB 2X4NB 1QRKA 2AI0H 3ZHDA 3F7LA 2DQTL 4YXHH 5LXGL 2EDFA 4WSKA 2VDMB 1IRAY 2XNAB 2HLFD 2A6KB 2NOYA 1FG2A 1JJUA 2VDLH 4OJEH 2DLFH 1PYWB 5BV7H 2IDUA 3SGJA 4BE5A 5EOTA 4PUBL 4S1RL 5AW4B 3VFTB 5JTWA 4LVOC 1T1ZA 1CXIA 2N1KA 4F20A 5LBVA 1PDKB 5CGYD 4UDUB 3GSWB 5IMLB 4H8HA 1AS6A 2CGRL 4JKPL 2OMWA 3BGMB 5BRZB 1BSIA 2KQMA 3QJHB 1C5CL 1KIUB 1CCZA 3DI3B 2RCSL 4CVXB 2FATH 4J39A 2WXRA 2VABA 3O3UN 4XBEL 2BS9A 3LQAL 2KPNA 3GHEH 1BW8A 3SDAA 2D31A 4PB9H 3CDZA 1XEDA 2XKSA 4CADB 5GRJH 2XQYA 4CGTA 4NZUH 3OKEA 1I8IB 1PEWA 4P57B 4QRQA 2YPLB 3ATEA 5SWZB 5E2UH 1IKFL 1P5UA 3CX5K 1QHOA 4N4YB 5IWLC 2ICWA 3NEXA 4U1NA 5DD1L 2D3JA 4PG2A 5J11C 5FM5M 4GXUN 3ETBJ 2Y1ZA 4N3TA 4M02A 3WAKA 2X44D 3PGDA 3AXIA 1ZLEA 3VTAA 1CLYL 4NUGL 2YOCA 2Y7OA 5JORA 4GKLA 3UZVB 4XNAA 1TVBA 3NFPB 5F9JB 3LNHA 1MCPL 1PZ2A 1WUNT 3OR6A 1J1PL 2ARJQ 2AJXL 4ONGH 5AB1A 2AHIA 2CCVA 4H13C 3NJIA 1XH3A 2VJXA 5I0WA 3D8MA 4KTEL 5H2BA 2GEQA 2WZPA 3L3JA 2ENSA 4J7RA 4E41E 1NCJA 3MV7A 2OSWA 4FZEH 5TE4H 2XRAH 4IIQA 5DT1H 4GAFB 4CKVX 2JXMB 4HKXB 3PHOB 2V37A 1BD2A 1RZGB 3CHSA 1GHFH 1KTLA 3DGGA 3EH5B 4DGIH 1BV8A 3V0WL 1NCIA 3H54A 3MYZA 5B3NA 3ZMRA 2FATL 4B7IA 2YAEA 4X8GA 1T03L 2X2IA 2CRIA 2V0AA 1RZPA 4N1HB 1WBYA 2YA1A 5FKPA 4NO3A 4RSYA 5FHAL 5JW3L 3ML8A 3SBRA 2ZJSL 4RBPH 1MAKA 3WUWG 2ZAHA 5D6DC 3X14A 4QUOA 1SXCA 3GXPA 2JE8A 1U8HB 4N0UB 5JZ7C 2XWDA 1SHXA 4GT7A 5E1HB 1OGTB 5EIIB 4PI2A 1QUNB 3JTTA 4M5YL 2H32H 1XF2B 2Q86A 4LU5L 2Y3NA 2ZWKA 3O45A 1N3NA 1TMCB 5I1EL 4V2BA 3BP6B 1MJ8L 2CM6A 4XB7A 2O1AA 3AREC 1UD6A 4H88H 4K5MA 1JHTA 2YD1A 4JO5A 3ME0B 3QZWA 4PRDB 4AH2A 5IFHH 4UT6A 4JFPA 4M1CC 1DVZA 4Y9GA 5F21B 4AOFA 3US1A 1V54B 1RPQA 4MD5A 1CF1A 4Z7OF 1NMCB 3MRPB 5IHUL 2EXSA 3C5ZC 3V52H 3ZIMA 5E94B 2UX7A 1VZIA 3ZK0A 4YNYB 3HG1D 3O6KL 1GGIL 4WDIB 4OW6A 5DK2A 4F15C 3WXVL 2R2BA 3BKCH 2ATPA 4JFDB 4KXZH 3HAEH 3BFWA 3HMWH 1HXMB 2DQDH 4FS0A 4IIZA 1E5UI 2IDCA 5TJWK 2AXGA 2AK4E 1M2VB 4YEFA 1PL3A 1HZLA 3I84A 1X5GA 2WMPB 2VLLA 2H2SC 4PGBB 2QELA 3C6LA 3KH3A 5AVZB 3EJZC 4LK4A 5AALA 4H8WC 4JHWL 3AXHA 2X70B 3EBAA 2VWEC 4OIFA 1IQWL 1MNUL 2UY6B 5KUKA 4CGUB 3IAQA 1I1AA 1MIML 4XAKD 1U58A 2BSTA 3LPOA 1EANA 5DHMC 5I71B 2UXGA 3AB0C 4R4FH 2GI7A 1KGXA 5DMIH 2IOOA 5HGHA 1U8PB 3AGVA 2EE6A 2FO8A 3UJJL 1VKXA 2I07A 1XH0A 1NFIB 2NYYC 4LQFH 1IT9H 2DYPD 3BIBX 1KJVA 4HULB 5CCJA 4WV1B 3CFBA 4NN6B 1ETZA 3V4PA 4N0CC 3RB5A 4UUJB 4QLRA 5HHOD 2DKSA 3C75A 3J27A 2Y7LA 3GMOB 3R1GH 4ADJA 3VD1A 1GGCH 3SKNA 5I15H 1FH5L 3IETB 5KJ7E 3OR7B 4TOYH 4Y4FD 4N8VG 4R9HA 5BZWB 1X7QA 3AM8C 3PWUB 4I8DA 1NCBL 4P23A 5J57B 4CVXA 3I6KA 2WHVA 4GW4B 4R7DA 3EG9B 4MS8D 4R84A 3IGAA 5HJ3B 4J12A 4PREB 1HL9A 3MA9L 2VLKE 4G7VH 1T2QH 4FFTA 2ZOLA 3FHEA 3CN3A 2IXQA 2B8OT 4I2XA 4DN4H 1QRNA 3KPSD 1RLBA 3QFJE 3KR3H 3EYSH 3N1PC 1MRCH 1RUQL 3BWZA 3QRGL 3KS0J 4JQVA 4EI6B 1HZHH 3EO0A 1JD9A 4EOWL 4NNPL 2ZOWA 4AE0A 2J25A 3T3PB 3G6JE 1AHWB 3IAPA 1KJMB 4L2YA 3GKWH 5FOJA 3SSGA 5I66B 4R7NB 2XTJC 3CFCL 4L1SA 3K0YA 2VXUL 5IHZB 1FZOA 4CN4A 3GGWB 4MMZA 2BERA 4LLDA 5HI4D 3RA7H 3FUJA 1JGEA 1DJWA 4NLAA 1UATA 1VZGA 4HF5H 4HJGB 4JFFB 4R83A 5E99L 4NBYB 4F92B 2CUMA 4HUWB 2X7LA 3FCSA 4U1IA 1AD0B 2DTMH 2VO5A 3MRQB 1UD8A 3QPQD 4L3ED 4TSAL 4XOCA 4X80L 1JZ4A 1ID2A 3E9UA 4F80A 3GKWL 3B9KA 4KX7A 4GBXC 3JV5A 3QJOA 3QXAB 1RZGA 2HFGH 4IK7A 3RVTD 3LEXB 2IH3B 5I28A 4P2OD 3T08A 5LBSA 2P80A 2BS71 2YQ2A 3Q8BA 4PJ8A 3LKOA 1OP4A 1XB6A 2NUTA 5HYFA 3W5NA 5ICZB 5CSGA 1NBCA 4R2GD 5DK0A 1IBFA 4HWEL 1KBPA 1I9JH 4LCIL 1E4XL 4JG1L 2X6UA 1HL8A 2AK4D 7PAZA 1BXUA 2DYSB 1EZLA 3GZOA 5C0EA 2A74A 2H3KA 2OR9H 2EDQA 4NRYA 2UZYA 1IGFH 3EJYC 3QXAA 5H8DA 5B38G 4KZDL 1AQMA 3WDIA 3N41B 2R1YA 4UT9H 5EUOA 2JVUA 3PHQB 3QUMA 1Q1PA 1I9RH 1UEMA 2K9UA 1A6AB 3CSGA 4FNRA 4Y1AB 2WLLB 1MEXH 4OLUL 1DLFH 4J3OG 3H9ZA 2AS5M 1K6QH 5MERA 1IGTB 1O7DE 3BQUB 4M03A 5K9QI 5ICZA 1JGIA 1MFBL 4ODUA 4HU2A 2BOBA 4PJCB 4NBXB 5KANI 1MFNA 3L4VA 4QHUA 1UZGA 1WVZA 2FWOB 9CGTA 1WBXA 4U2ZA 5ESVA 4K7PX 3FBKA 1BPVA 2QADC 3A67H 4MMXB 3UPRB 4NO0D 4L3CB 4Y4KD 1AGCB 1KFAH 2XFXA 4K3EH 2R1YB 1LL1A 5CIPB 3TBSB 3CE1A 4YH6A 2YC1A 12E8H 4R97B 1BQHG 3IWUA 3UYRL 3WDHA 4CW1A 5DZPA 2D7TL 2BP5M 2HWZL 2DLHA 5I8KH 4AZ8A 3HC4L 3BKCL 4PGCA 2XOTA 1QA9B 1S7QA 4K3JH 4YHKH 4AEIH 2Z8WC 1BFOB 2CNZA 5B21A 2VLJE 1PY9A 2BVPA 2PW2B 2V17H 3TVMD 4DUWA 4LEOB 1JPFA 3M7FB 5FGRA 4HPHA 3EYOA 1T21B 1F2QA 2VKXA 2PN5A 5EB9A 3VW3H 4JFYB 4AQ8A 3REVA 1KXHA 2ZKYA 1XB8A 4YFLI 2Y2TA 5DJYA 1ZS8B 3FBQA 3QDMA 1AGCA 2XFXB 4HUUA 4OCWL 4RISH 4WW1B 3L3OB 2YARA 3MXVL 4JFUA 1N18A 3ZE2B 2BVQB 5LUMA 4PRBB 2K3TA 3GMPA 4Z77A 4PJAF 1CGWA 1A0QL 4GAJL 4Z7WB 3P69A 3AACA 3VYNA 5I1IH 3VXNA 4XCCH 4NWUL 3BDBA 5E5LA 4X6DE 4R4ND 1Q94A 4PJIA 3L1EA 3NJMA 4A66A 1B2YA 1FNAA 1YECH 1E9PB 4LMQE 4ODVL 4MJ5B 3CFBB 5CLWA 3SQOH 2WO4A 5DD3H 5J6SA 3F6LA 2DIEA 4W9KC 3HZVA 4OGXH 3SKNB 2EXWC 3HPLB 3NIFE 3VD4A 3S3BB 3C12A 1OARH 1A5FH 3H3PH 5BZWA 5I71C 5DQ9A 3U46A 4AQ1B 4R5XA 1M1XA 2DPKA 4NN7B 3RIFK 1C08A 3KL5A 3X11B 3SJVB 3LHPH 3QORB 5DEZA 5I6XC 1OW0A 3LPFA 5B38B 3Q8CA 3UEZA 2OTWA 2RFXA 2YPVL 3CTTA 3QIBB 5IHBA 4A7GF 2R2HB 4DT2A 4LSSL 4WNQB 1DJSA 2B77A 4OJFH 5D71L 4DJMA 1NLDL 1NKGA 1QRNB 3ARGA 3QXVA 4FTDA 3CFJA 1UA6L 2WYZA 3FTWA 4XNQB 1UCBL 3TEXA 5AUMA 4P05A 2OMNA 2KI6A 3B7SA 4W9HC 1NGZA 2FEDC 2PO6A 1TQUA 1XO8A 3VVWA 4PRNA 2XKUA 1BVLA 3ZKXC 5LG6A 3U36A 1UWFA 4NZFA 2ESVB 3NPSB 2YRBA 4XP4H 3WKML 4MD5B 4LCUB 3N40P 4QRUB 2ADFL 3GJFH 4YHOH 1W0WA 5HHPA 1NINA 5I18L 1GXEA 2Y06L 4GAGH 1BXVA 1E65A 3IDNB 4JKNA 4LDEB 1F90L 4OFQA 1HYSC 2J44A 1I8LC 1AE6L 2BNRE 5JW4N 3RGVB 1D5BA 3O3EB 2GJJA 1KJ2A 4RMBA 3W9EB 2WUCH 2R8SH 2OTUB 3L7EB 4OZFA 3C5XA 3TFBA 1CFTB 1SHWA 4ODTH 2PO6B 2QKIA 2C3XA 5C0DB 3BWUC 1UWXK 4BKSC 5LO7A 1USQA 4AMWA 3FUMA 1D7CA 4HQQL 4KV5E 2NY7H 2K8MA 1PD6A 1I85A 2F53B 5CD3A 1FC2D 4PN6A 1L7IH 1H9DA 3OXRB 4LLQB 4LHUG 5KZCB 3IMTA 4EUPA 4TKWA 4TVSa 2J1WA 3LKOB 3MKKA 1ROCA 1DVFB 1BXAA 1OTUC 2IALA 4KH9A 1SJXA 1G7HB 4N2IA 5T3XL 5IQ7L 5HVWA 1YJDL 4XZUA 2EADA 1KN2L 1V7NL 4JZNA 2I7OA 3FQWA 2A4CA 4FNQA 2CIIA 2JB5L 1OPGL 5IQMA 4M56A 5AB9A 3ABLB 3CDCA 4I13B 2OP4L 4OLZH 1U9KA 2OXHA 3MAWA 2R23B 3BE1L 5L0QB 1MUJB 2Z7ZA 2ICWJ 3AS1A 1Z5LB 2BVOB 3O0RH 3BQUD 3FB5B 1OLLA 1GS7A 3ZE1E 3V6OE 5AYUL 2IPTH 4AV5A 1KEMH 3K3QA 1QEWB 1RVFL 3RTQC 1EAOA 2BOBB 4OF0A 3R1GL 1CDCA 3E8UL 4PVLA 5GGRY 3JTBA 2HMID 1LEKB 3T4AC 4U6HB 3ARWA 4HHAA 4HZ1A 3UZEA 3VJ6B 1FL5A 2F68X 2YMXH 3X3GH 5C0CB 3BH8B 4Y5YB 5C7XL 2WV3A 4P4KC 3MXWH 1N4XL 1EEUA 1ZV9A 2Y0SA 3F2LA 4XN2A 3FU5A 1TPXC 5EIQA 4LL9A 1FFQA 3WKMH 3DX1A 2A1WL 4DP4X 3SE6A 5F6IC 3TU6A 4Z7UF 3VXRE 2FR4B 5E9DE 1O0VA 3HC0A 4IBLT 5DCCA 3QGVA 2WWMD 3D4YA 3TT3H 5D96B 4Y4HD 1PF3A 1ZIBA 2X1WL 5AOJA 5F44A 1Z6JT 2AJVL 4ZUVA 3FTZA 4Y2DC 3V4PL 4QCIA 2MCG1 1RHHA 1UH3A 3E2HC 4L3EA 1P5UC 2EKJA 5FGBC 1ND0A 5CR8A 2WO2B 3R0NA 5FYLL 1JUFB 3P9MB 4FL4C 4IRJB 5INDA 1WJ3A 3MN8A 2WBXA 3S4SA 3L3KB 3QEGL 4UAOC 2J8UB 3HS0A 1AC0A 3P2BA 1Q0YL 4KROD 3OKEB 4R97C 4BBWA 4EBQL 3RWDB 3DBSA 4QNPE 3UEQA 4XGZA 1P5UB 3L08A 1QASA 5I6OA 1JPGA 3NK4A 3Q7JA 2JI3A 4CSSA 4A7SA 5B8CA 1ADWA 3P4LA 4IBTA 5G4MA 3BUYB 4K2UL 1U92A 5ABDE 4K94H 4XN5A 5IGXL 3QULA 2DZEA 4GRLC 3HBQA 1KELH 3W39A 1QUNA 2YZ1A 5ES4B 4JUSA 4E42A 1OOWA 4FQ2H 2CO1A 1ZT1A 3OC8A 4HT1L 2B4CC 1OCRB 5FB8A 2WTRB 5EZJB 3DROA 5CILL 2R1XB 4M1GH 3IEAA 1ZDSA 3MGOB 1QSEA 3PL6A 3BQUC 3B6SB 5D7EA 3RI5K 4IOFC 4NYLA 3BUBA 4XCCL 5JOPE 1U8LB 5JA9A 1JPST 4OCRH 4NQEB 4MX7A 4PRDA 3CFKB 3QIBD 3ZO9A 4AH2B 2FBJL 1JNHB 2XPZA 3B2VL 4A2DA 3QQ3B 4B9KC 2B1OA 3WJLC 4CU8A 3VD2A 1G7PA 1RL1A 3QDGA 1CLOL 3LB6D 4WSGA 1MCOH 3G6JB 4N2NA 4G3YH 3A4AA 2V3EA 1GCYA 2VL5B 3BOVA 5J1AB 2W0KA 2YJLA 5E94A 4XCNA 5AOMA 2W65A 3AS0A 4WY7L 3BPLC 5IROC 2XVBA 3C5ZD 1EO8H 1M6OB 3VXPA 2IGTA 3FB6A 1G7MA 1SF5A 3MGOA 5KVDL 4H1LH 3ZL4H 4HEME 4KQ3H 3S34H 4ACTA 3ZKMD 4DGVH 1BPLB 4UIKH 2RQEA 1XCQA 3ARBD 4JPWH 4C4KO 1XR9B 1HEZB 1JOIA 5E5MA 4B9PA 3KS0H 2WPGA 2D7TH 4PWJA 1PKQE 2WQSA 4KVCH 4WO4C 4KTGA 4KFZC 3LNDA 4IOSD 2GUOA 4JFXB 2BP0A 1KACB 3RAJH 4I18B 5D71H 4HSQA 4JM0A 5K9JL 3ULUH 4C56E 3S8FB 3IDNA 2X42A 3PABA 4JDVB 3RGVD 3PAUA 5ENWB 5MI0C 3MV8D 2WWKT 3ZMNA 3VFRB 3KYKL 4ZUSA 5DURB 2QPSA 1QLEL 2PPFA 1G7MB 3PL6C 2A4EA 1U8PA 1OK0A 2Z1PA 3DO7A 4RMVA 1WRFA 1E8YA 1WIPA 4ODHL 2XC8A 1H8OA 3HMXL 3IJYB 4PTUA 2HX7A 1Z9SB 2MTAA 1E90A 3I74A 4ISVB 5C70A 1Q0XH 4LF3A 2R2EB 4KK8C 4Z7WF 2WXLA 3HLAA 2QQKL 1BAGA 3MBEA 4U1JA 5D4QA 5T5FH 4CILA 1OZUA 1PSKL 2BIQA 1G87A 1YECL 1MWOA 4YHYC 3DC0A 3QCTH 3SCMA 4P23B 3D06A 5G5DB 5DUBA 4N0RA 3QIWB 3L3HB 4YXKL 1E7VA 4Y4KA 3VMOA 4C54A 3WY3A 3KWUA 1JHLL 4FZ8H 3BAEL 2IEPA 4ZS7H 1NCHA 2OMVA 3VD3A 4G6JH 1SDDB 1TQBC 4JGJA 5C08A 2TAAA 5KBDA 4GSUA 5DZOA 5C0GA 1I1FA 2PYEA 3L16A 3PAYA 4TUOA 1OO2A 1X5HA 2NSQA 3OKOB 4JQIL 1GSMA 4WJ5A 4Y7MA 4ABVA 3V6ZB 2W94A 3IGKA 3DETD 4BQ9A 3R19A 6FABH 3ZPDA 3O4LE 2VQTA 4MNHB 4FJZA 1TQCB 1LXMA 3ZSTA 4DZ8B 5EO1A 4CAGA 1CPUA 3IJ9A 1CBVH 3TBWB 2NY1B 1KTDA 1PZAA 3QUMH 1T5WB 4KTYA 3S35H 4A6YL 7CGTA 4ORGB 1A6UH 2V9RA 3MRGA 2BXZA 4MJ6B 5C07E 3UYRH 4HHAB 4BIKA 1GIGH 3F7VB 2QKIC 4G5AA 2R15A 1P69B 3NYKA 5JW5B 5I9QC 3QJHA 3ARRA 2JJTC 1U3YA 4XB3A 5HDBB 2P8PB 4WGVB 3OPZH 4PLNC 3QPXL 4WJ5B 3AMLA 1HI6B 3ZW3A 5JHDB 5KTEH 4K3DL 1DN0A 4Y4HB 5SV3A 1J0ZA 4JEGB 5DS8A 1JGVL 3O9WB 2KHAA 5CS7A 3NZUA 3U4BL 2WKOF 3W37A 3ULVL 4QGTA 4EQ2A 5F7MC 1FAIL 2FUTA 1QSED 3PL6D 4NKMB 4U1KA 5TPWL 2ZE0A 4F8LA 4Z0BL 2K9FB 2V5SA 1T0NA 2BSSA 1E6JL 3GJFA 4NX0A 2YBGA 1WE5A 4MJ6A 4F33B 4EZMA 3H42L 4K8RC 2DY2A 2EE9A 4IW4C 1UB6B 4M29A 4UT9L 3EYSL 4FABH 1X3DA 2N0KA 3GNML 4LEBA 2FUQA 3HI1B 5LDSA 3E6FA 4G42B 4HAGA 2IC2A 4BK4A 2YD8A 3TYFB 1AYOA 2XY2A 3GSNH 4LNVA 4O9HL 1DCEA 4YSTA 4BWTA 1HN1A 4IBQA 1HWHB 1XGQB 4NGHL 5FPIA 4OZGA 5GJSH 1LILA 5FLVA 5JPNC 4KRMB 4LPWA 4OLEA 3DJTA 2VRKA 3N0PB 3NJJA 1OAXH 3FKUS 2DQUH 3MODL 3VRLE 5L8JB 1RIVH 4D8PB 4JO3H 4OLWL 1UFUA 2D7MA 2NY3D 3ZL2A 1EHLL 4IDJH 2X3BA 3BEVA 2V5RA 2DQMA 4KTEH 1EERB 1Y18A 1IFHL 4JN2A 3DGDA 1KDJA 2R1XA 1KBWA 4AYBA 1G7QB 4ONGL 2WLIB 3F7YB 2JQMA 3QDMD 2E7DA 1OB0A 3R06A 3FB8A 1GZPB 3IGUA 1QBML 2Q3ZA 4U1HA 5KZCD 5AD0B 4PRHD 5I1JL 4NUGH 4BXSV 4ZAKC 2CJSA 2OM5A 4PJHE 4RGOH 5CEYB 3STZB 4JFZL 4UAHA 2NW2A 4XPHH 1AG6A 1HS6A 4IDJL 4XCYB 3G08B 3TIEB 3HZMB 2HJFB 3N1FC 4M6NH 3HVNA 3ALXA 5F89B 1UGKA 1W6WA 3UBXA 3NFNA 1EMTL 4G8IB 3GSNB 5MI0B 3VGHA 4MDJB 7FABL 3PGDB 2Q8AH 4J3WA 3ZBMA 4GXFA 4NZUL 1A14L 1IARB 1N67A 3B2UD 5FO9A 2Z93B 1UKSA 5FGBA 1INDH 5KSBB 5HY9B 1IILE 1KF9B 1MFMA 1ZLWK 1IZJA 3W82A 4NJAH 2ZOLB 3KCPA 1R3JB 3ECBB 1OXYA 3APCA 3NABH 4LHQB 4ELME 5IM7A 3OHMB 3MLWL 2EEFA 5JXAH 3KLDA 4A37A 1XMWA 4AGOA 4Y19D 4L2LA 3SGDH 3ULUE 3H42H 1AZVA 4PIBA 4HUCA 4ILDA 5DQJA 1N64H 2ILLA 1CZ8L 1OTUD 3DXAB 7FABH 3PGCA 1YNLL 4U4BA 4WI7A 1CG9B 3HE7D 4UV7L 3DO7B 4Z18A 1QPPA 4JDEB 3T0EB 5I1LB 3BXNB 3BGFC 4HS8L 2VXQH 2NW3B 1Y6NR 4PEEA 5AL0A 3KAAA 5AW1B 2O61A 2KPWA 2VAAA 1NAKH 3CVCA 3IPEA 4OZHA 5JNYB 1ZWIA 5GGTA 2I60L 5IBLC 4YLBA 4PJBF 4PJ8D 2X9YA 2YD9A 3H7BA 3QIWA 4ZZFA 3QQDB 4ZTEA 1CBVL 1W72A 2MTPA 3T1FA 5HYSB 1SHSA 4GRLB 4DKFH 3TEYA 4D9LL 3MRNB 4Q9QH 5FGSA 4WTXA 5A2LH 3ISRA 1J1OL 1AZZC 3VXUA 1FFPA 1X5ZA 1AI1L 4OLXH 4YHIB 4MFHA 4AQ8C 2E76C 3MRRA 4JQIH 3OL2A 4WI8A 4BEIA 3Q1SL 4L4VD 4YBLC 1P1ZB 4FP8L 1DQJB 4FNLH 1DL7H 1F4WH 4DO5A 1AHWC 1GHFL 4H1LA 1FDLH 2Z35A 3O45B 3VMNA 4R8WL 1X4YA 3DTDA 5SWSA 2DH3A 4HWBA 5C08E 3IDYC 4IRJC 2HFFB 2VW7A 2H1PL 4EDXA 1QUPA 2C1PA 2N1TE 2F5BH 2XZZA 3NACH 1R34A 4WEUD 1ADQA 2YIHA 4RMWA 3V52L 3FU9A 2APSA 3QJXA 1ZJAA 2XZAL 1NIBA 4ABUA 3FTSA 4HFWB 1GA2A 4JHVA 4NO3B 2PXYA 2QHLA 3TASA 5ACZB 3LN9A 5KVEH 1UZ6E 4LCYB 1U6AL 2ZKHH 4PR5B 3FRPA 3SZ6A 4DN3H 4J1UB 1JZFA 5I82A 3ULVH 4F58H 1WAAA 5E2WH 2A38A 2WXJA 1CVSC 1N2RB 1EXUA 2CXKA 4PHZA 4Y1TA 1G9NL 1NJ9A 5D1ZA 1FE8L 3V4VL 4GFXA 5DEFA 5H94B 4JRXA 2BNUB 4P07A 1AXIB 3OXSB 4X5RA 5HVGB 2P28B 2FQEA 1X9UA 1VEPA 3D0VB 4JFEE 2YXFA 3B5GA 4Q52A 5DUPL 3LPWA 5AAMA 1OD7A 1X5FA 2X4QB 4E9QA 3TBBA 3ECUA 4K55A 5CEXA 5F3FA 1MJUH 1U8OA 3BISA 4HC1H 2ITEA 3MJWA 3LQAH 2G0LA 5HHOB 4PFEA 1JRHI 3GGWA 4G11A 1TDQA 4WNQA 2DLEA 4HBCL 3DK0A 4TL5A 3VQ1C 3M7OA 3GO1L 5AW6B 4HIPA 5D7KD 1IBHA 4KK6C 4MD0B 5CFHA 3MTRA 3EUUA 3CFNA 4QXGL 2CGRH 4Z9KB 3IRZA 4P4RB 1CYXA 3DX7A 1DBKH 3CK0L 2DQGH 3H0TB 4DH2A 5IREA 4G5ZH 3AU1A 3LNFA 1WEJL 3QG6B 4I9XA 2FYYA 1FJ1A 3B9KB 3Q6FB 1XCWA 5GSVB 3TYGH 5CU9A 1NPNA 1RZ7L 2MIZA 3T4YA 3VI3B 4IBUA 4OCRL 4YLQT 4YXKH 4QAMB 1OAYL 4P46B 3GDBA 2J88L 4WGWB 2O5ZL 3GYRA 3I6LE 4FQIL 2APXA 4JB9L 5FA4B 5BRQA 3UCQA 1U8IB 2C7UA 3KPRB 1HSBB 4F27A 1FP5A 1EFXD 5E2WL 5D9SB 4KUCF 5LG1A 2PO6C 1NM9A 3DX0A 4TNEA 3RKPA 1MREL 4XPAH 4XPFH 2QQNL 3JYCA 5BV7B 3S5YA 1K5WA 3NJVA 3QEUA 3CZUB 2AXHA 4AIXA 1EHNA 3LMJL 1DFBH 3DV4A 3MNDA 1ZK5A 1LD9B 1CLYH 3BWSA 3LNGA 1V7MH 1ETZB 2IWKA 5FM5O 1MFCH 4RETB 4ACPA 3SBWA 1FZJA 5IHZA 3P77A 5AZ2L 1NCWL 1A6WH 5EO0B 4LAQL 4HGWB 1G6RB 5C6WH 1LYQA 5KS9B 1CICC 3D3VE 1JXKA 4L3EB 3UAFA 4LP5A 1A9EB 2Y5TA 1X5LA 1IEHA 3MNZA 1JUFA 4G80B 5DC0A 4JVWA 3P3UA 3KLQA 1IFRA 4RVBA 4GW4A 5K9QG 3BPNC 4WU7B 5IK3B 3DVGB 4ODXB 3ZQXA 5AW0B 3QO0B 3A4FA 3PDOA 3TT1L 4ALAH 1A1MA 2I5YL 2X1XR 1E5AA 3DSNB 5HGAA 2KDYA 2HT2C 1EO7A 3BH9B 3L9EA 4HMCA 4MRCA 1X5AA 4G70B 1ZTXL 4WV1C 1AZNA 2VQ1A 1Z5LA 2BVOA 4PQXA 3WEOA 4WHYG 3LV3B 3NOIA 3B5HA 5J12C 2B5IC 4KK6D 1NPJA 1OK8A 1TUPA 3AG3B 3LQMA 3P4MA 2I60H 3MNZB 4ZSOE 4QAWA 2AKRB 1MFDL 2XSKA 2VZUA 5EOQH 4ZD3L 5I1CH 3IDUA 4Z3GA 4PJBE 2IPKA 2EUVA 1OTSC 5DHXB 3T8XA 4O58L 3FOMB 5E4AA 3L6FA 3AZUA 3SPIA 1WZLA 2PUQT 1QTSA 1FV1B 4XPBL 1TLKA 1P6WA 1VDGA 4B97A 1JXJA 1J87A 1ZLVH 3VFMA 1CZ8H 2HVJB 3CZKA 4FQ2L 4P3DA 1NDTA 4UTCA 2JLPA 2EDRA 2GC7C 1D7BA 4YFDB 3QUMB 4Z77B 1NDMB 3G7TA 4G9DA 5DDHB 2A6IB 3V0IA 4O00A 1UADC 1ZIAA 5T3ZD 1OCZB 3KPLB 2A6DB 3MBWB 4PRIE 2X38A 4P4KA 3WFHB 4EO5A 5CR1A 3L3OC 4D94A 3GK8L 5A6IA 1E4JA 4LE8A 3ARDB 3EJZD 5BS0A 3EXLA 3MZTA 2FQDA 3QS3A 3VNYA 3UGEA 4KRPC 2CHDA 2YSSA 3MBXH 4N87A 4RGMB 1ITCA 3WBDA 3Q44A 5DEGB 3QHTC 1AZCA 3HJ0A 2GJ6D 1R5IA 5DMGC 3M1OA 4ZFOA 1SXNA 2X0WA 1F1AA 5JUEL 3FO0L 1NCWH 4H25B 2ENYA 3QORA 1TQSA 2A0LD 2BIIA 2FJFA 3AROA 5DD5L 4NZRH 1B90A 1CFMA 3NFNB 4PR5A 4EKJA 5KYWB 4Q97A 4B7LA 5F88A 2UZYB 3QEQA 1D5IL 1JG9A 4WWOA 4NHUA 3TX4A 5K69A 4XT1C 1SN2A 4MXWL 5DWUH 1WFJA 2EIBA 3BUTA 3KWVA 4J23A 4MDIB 4XX5A 1L3NA 5CJXC 1KPVA 2JB6A 2V7NB 5DA4A 5L4JA 2RACA 2UY7A 1YEGL 4OD1H 5GGSA 1UOKA 1NCGA 1AS8A 1UT9A 3C8KB 5PAZA 4XRCA 2IH8A 4YSAA 4H7VA 3VFNB 4TM9A 3L4ZA 3GSUA 2C9SA 3C5SB 3EH4B 1JXDA 2BP3A 3O4OB 2DMHA 3D4CA 4YDJB 5SWZA 4Y19B 2O6CA 1WCBA 5HHNB 1UXSB 2Y2WA 3DVIA 4NKQB 1CFNA 4P3CL 3ZDYF 4D0DA 3H9HA 1E27B 1FIGL 4I0PD 3UTTA 1EGJA 4W9LC 4ZMTA 2XVGA 3MLVH 2CQVA 5EZIL 3P4NB 1HNFA 2VLKB 1G9EA 4MXQD 3VU1A 4LSSH 3TM6A 1SN5A 5JNYA 2BC4B 3B9VA 2NUTB 4N0YL 3RDTC 2GTZA 3CVHA 3I85A 3PYCA 3LIZH 4L37A 4I0KA 1MFUA 2ZONA 5F1IB 5I1DB 3KZ8A 2WOYA 1M1XB 5EO1B 5INCA 5CNHA 3KYMA 4FABL 5IVZA 4FA7B 3RKDC 4RMTA 4Z0BH 3EFDL 4B5EA 8CGTA 5LXVA 3N1GC 1XIWA 1XSJA 1KEGL 3EFFA 3VXUB 5LQBL 5SX5H 1QO3B 1X7TA 2RGSA 5ADOL 4Y16B 3BZ5A 1RHFA 3M17A 3WS6A 5L4FA 3NGBC 1MH5A 1N70A 3L3JB 2FO4B 3T09A 1A25A 1FG9C 4UMGA 3NCXA 4HQQH 1Q94B 3D30A 4PJIB 2BOCA 2H9GA 2GTZB 1UM6L 4F7TB 4IU2B 3SDXA 3KYMB 4PJFB 2V2TA 1UH2A 1PW3A 3VFOB 3WIFB 4JHUA 4F57L 3BAXA 3T2QA 1DE4A 4MS6A 2Q3XA 4KRLB 4QIRA 5D4HA 1HH6A 3W0WB 4DP1X 2XJKA 4HUMB 4KKZA 2VDQB 4ZO7A 4HC1A 4U6YA 2VO8A 4J2XA 3LH9A 3VWJA 1G5GA 4KXZI 2MHAB 3X1NA 3V9FA 3Q06A 3S8GB 4J3VA 4AEIL 1QFWL 1H3PL 1AQDB 4XP6H 5TDNB 1U8HA 1N2RA 4JO1L 4N0UA 5JR1H 1NFDF 1XZ0B 4YMPA 1OD9A 2BIOA 5DJZB 4XMLL 4FF9A 4JFFA 2R27A 2LGNA 4M7KH 4UOQA 3VFGL 3QYNA 4IRSB 2C9UA 1ZA6A 3MUUA 4U7SA 3QDAA 5DJAA 1N3NB 2BP0B 3D39B 4HLZH 4M6OH 4H40A 3RWEB 4LKXB 4N2HA 4P5TA 1JDDA 4X6DA 5HYJE 3F8UB 3DYMA 3EJTA 3IJHB 5FGCB 4ABQA 3CZLA 3VSUA 3A67L 4DUVA 1D5ZB 3GIVB 4AGQA 2E6PA 1JI1A 4AIZB 5FECA 3GMLB 1W8OA 4LSTH 4BCZA 4JPVL 2FSEA 1JK8A 1KGUA 4IOIA 3C6LD 4JZNB 3W2DL 2O6FA 3HMXH 1ODUA 3LKSB 3T0EC 4Q56A 1I9IL 5F7DB 4OCXL 4EPSA 2HKHL 4ISVA 4I2XB 3FN0H 4YDVB 3LB6C 3DX7B 4L8SA 4RRPM 3TIEA 2LU7A 4LHUD 5EO9B 1IGFL 3QJQB 1UM4L 4F8QA 2IVFC 5T1DH 1YMME 2X28A 3WSQL 4MA8H 2K7PA 1QLEB 2P5EB 1I3GL 3BHBA 3N42B 4OB5H 3CVHL 1QHPA 5EU6B 5K39A 4DAGL 5GHWL 3II1A 2CDEA 2VMFA 1CDHA 1AGBB 2Z8RA 2GFBA 4HKJB 4R0LA 5A6MA 2XG5B 4W1TA 2FLRT 5D7SL 3R7RA 4DGVL 1ZLSL 3P3SA 1CWVA 5IQLA 2FX8L 4WFEE 3ASNB 2CLZA 2X4SB 3FH7A 3P0GB 4ODWA 4P46D 4GUQA 3RHWF 2L04A 4NFCA 2PWHA 1I8KB 1HHJA 5AOKA 1CE6B 1KJ3H 3KPRD 4GMTH 1I7UB 1Q9WB 3DDFA 3FJTA 3CCHB 3MRJB 4WHTB 2M83A 3IDMA 5ETUB 3EBGA 4QRQB 3DXAA 5T5FA 1W16A 1UUSA 3QJSB 5KVFH 2CZNA 2A9AA 5T1LB 1G43A 2E8YA 5E8DL 4ZUVB 3WE6B 1IO4C 4RWYL 2FAUA 2XG5A 4FFWC 1RHHB 3OGCB 2KC0A 4JFOA 4BK8A 1RIUL 4WI3A 4AT6A 1ZLUH 1KYUA 4L4TB 4JGUA 1N6QL 2JH2A 4J28A 4FLQA 3IGAB 1A4AA 4WU7A 2ZXWB 5HJ3A 1A7PH 1FBIL 4ANVA 1RUKL 1Z1WA 5BRZE 4UCFA 5HYSA 2R2CA 1MFBH 1H3XA 2E56A 3TZVD 5T33L 1M05B 4KZEH 2V7HA 4N9GA 3L3OA 5T1LA 1AKPA 3VYOA 3NPSC 3TA4D 1VEOA 3NQKA 1OSZB 3TH3T 2HJFA 2O5XL 2R4RH 4PWIA 1CFSA 3BESR 4HMDA 1BF8A 2X9WA 1Q1JL 4ZMLA 2W38A 1YYCA 4WKZA 4MQXC 3QDHA 4HJ0D 4N0YH 4Q6IB 2EDYA 3SGDI 2BNQD 3U6RA 5E8OA 2JCWA 1SYSB 4FLSA 3MA9H 2C34A 2GTQA 3MLYL 4NGHH 4NQCE 3D69A 4M1DH 1VGEH 1BVKA 2ODIA 2A6JB 4PYGA 2JJUA 1ND0B 4X9GA 1KV7A 5JQ6L 2LQRA 3TJHD 4U49A 3V6OA 1NC2D 2R59A 4L3CA 2OMYA 3QORC 1P2CA 1WGVA 3O3BB 2GYSA 4YPGB 1J5IA 5EV7A 3BZDA 1LWJA 2MOVA 5G5DA 1A3LL 5G2NA 3WENA 3FAXA 1DEEB 4PY8I 4AEHL 3VXPB 1E3XA 4CVUA 5C9JB 3PJLA 1YY9D 4KK9D 1C12A 1DDTA 4PGCB 1NFDB 4KV5F 3DI2B 2WWNA 1BFOA 2EJ1A 3R06B 2CAKA 3KWXA 5GGRA 2K3HA 3FSZA 2ADYA 3OMNB 3MYJA 2XIDA 3TN0B 4WTZG 5E4EB 3UTQA 2VZSA 4P2RE 1DQQA 1D5IH 3AT8A 2B2XH 4JHWH 3QDGE 3L2LA 5IR1B 2IQ9H 3MLZL 2CKNA 3EOBB 4L4VE 2WBJB 1WZAA 2NY0C 1ED3B 4I9WE 4KY1H 5IB1B 2Z9TA 5HHXL 1DQLL 4Z8FH 1G6RL 4ERSH 4ZO9A 2LOEA 3QUML 3IDGA 4FCAA 2CCLA 4KI1A 4S0HA 1B0WA 3CHOA 2IGLA 4Q4EA 3AWEA 1PU0A 5FGCE 1HFUA 4L48A 5J1AA 5GS0D 2KYIA 5DJZA 3FYEB 5FCSH 3IJYA 4OLYL 4PTUB 2X4RA 3EYFA 1RZJL 2ZXBA 1J0IA 1CLZL 1UOLA 2LE9A 4LLWB 4A04A 1AR2A 3MLXH 2YKLH 3IDXL 1IC5H 1UOVA 2VDML 4MDRA 4DP6X 1KIRA 3EH1A 3M45A 2JELH 4Q6KA 3FB7B 3I02B 4Y9FA 3DTXA 3SKUD 2WBJA 1A4KA 1ZXQA 5B39B 1YEDA 4OQTH 4YR6A 2V6HA 3SCMB 1R5WB 4Y1AE 1G6RH 3MMEB 3GJFB 5GISL 5KSAB 1T3FB 4ABWA 2B39A 2YEVB 2DYPB 5D7JD 2CCWA 4J4PC 3GSVA 3QYCA 3MTXA 3V4LA 5B1KA 3S0PA 4RIRA 2YMTA 2PP8A 5D2LB 2VLJD 4A7QA 3FQ4A 3SN6N 2WXKA 2MEJB 5FB8B 2IMMA 4DOHE 1UACH 3C87A 3DTXB 1DLHA 1U8MA 1IC7L 4QRAA 3WO4C 1J0YA 3PDGA 3FU0A 2P5PA 2D7NA 1WZ1H 2FHCA 4UQ3A 4X0KB 5C6TH 2WP3O 1VFUA 4MA1C 4LCUA 4QRUA 3QJFA 3H4HA 2ZUTA 2VDPB 1GMIA 4K4KA 4XPGH 1CT8A 3S3SA 5MHSD 3LS5L 3FFCD 4JANA 4P06A 4XCFH 2X89D 4OZFG 4B0MM 4X4YB 4ADIA 2SEBA 4ZW8A 2CDGB 2PMZA 3WV0A 1MHHB 4LCWB 4M4PA 1EXGA 2BOCB 2AP2A 5B1JA 3MLYH 4XC3L 3KMDA 3MVSA 4J3SA 4JPWL 2CHNA 2YXWA 2OMVB 1B6DA 3IJSA 2EIZB 2J6EL 2AK1L 3JWDH 2WIIA 1A6VH 3ZL4L 4KFMA 5J6HB 4ZG1A 3VXME 5TDOA 2CR3A 4HIEB 4O02H 3S37H 3JV0A 1IQDA 2Q0ZX 2B14A 1T7VA 2EEDA 4O5LL 2XWTB 3GWJA 1HXYA 3EBHA 4AVJA 3QUZB 3B7RL 3WU1A 1C08B 3NP3A 1LO5A 1TEYA 2FGWH 3HR5A 1GGBH 1OANA 3CXDH 3VA6A 1EIBA 5AAPA 4K8RL 2MHAA 1YJDC 1TETH 1B2WH 1JAEA 3DVNB 3F7VA 5HDOA 4FTVE 1P7HL 2QR0B 2XBTA 5AOLA 2V3FA 3QYMA 3VSTA 1H8LA 1TFPA 1M05A 4Z6AT 4R4BA 4N2OA 1YY8B 4U3XA 4PVNA 5DHVH 1KCWA 4P2OB 5I5IA 1TETL 4L0PB 1OGSA 3FUIA 1TIUA 5EZLA 3QNYB 4HK0B 2CUAA 3SD2A 1T1WB 4YHZH 5IB4B 4G7RB 5LQBH 2IWEA 2Z0BA 3GBMH 2PTTB 2G3NA 3A6OA 3OAUH 4K5PA 4AVKA 5D2LE 3HI6L 2ED9A 3KBEA 3STLA 1GYWA 2TRYA 1DZ0A 4GKZA 1R17A 1W0WB 4IKLA 3TS8A 1TZAA 3QUYA 1NC2B 5I19H 1NCUA 2A9CA 2FO1A 1MCSA 3CD4A 5D4JA 1JGUL 4YHKL 5D7SH 4MD0A 2R1WA 5JORB 4F37K 4KRPD 2BXYA 2X6MA 1XGRB 2H0FA 4LEEA 4UV4L 2P45B 3Q8EA 5EC2A 5LCVH 3GRWA 2GSGB 3HHMA 3SPGA 5D1ZD 5EO9A 2FHBA 2PPDA 3MNVB 2CGZA 3PGFH 3F83A 2EP6A 4UINL 4D9RE 1K8DA 2FIRT 5IMOA 3V55A 1G7IB 1SBSH 3V8CA 1ACCA 1AANA 7PCYA 3E1F1 5DUPH 3PAVA 2MCMA 3QDGB 1E9QA 1ZHBA 4ZQKA 3BAKA 1AZBA 3RWGA 1MXGA 1B4JH 2YRPA 5IB3A 5LXGH 2F53A 5CD3B 1N68A 3EXJA 2CDEB 4LCWE 1T89A 4AMKL 2I9LA 4FI6A 1JIBA 3NCBB 4GUPA 1LO0L 1SRDA 1IMHC 2ZXQA 2HVKA 2YGNA 4OAWA 3FQXB 4DZBB 5HPMB 5KVDE 4HXBL 3AB0B 3I75B 1R46A 4GSDL 4PJCA 4KPHH 2PXYC 4YAQB 1BDYA 1MFEH 3B3BA 5JMOC 1JMZA 1HL5A 4FMFA 3O6LH 1H15A 3GZKA 3ASOB 2BIPA 3NA9H 1NIAA 5JA8B 4JQXC 3K4AA 5CLZA 5HYSG 2R4SH 1CFNB 1BHGA 1K3IA 2C4XA 1FZKB 1CC3A 2ZCLL 4R5TA 4LO9A 3BIKA 3BE1H 5EU7E 4W4OA 4NP4L 3GRGA 3LY6A 3BPNB 4HDIA 2YGVA 3FF7A 4OZGE 4OKDA 4UIMA 3CC5B 3MRMB 3Q05A 4DZBA 5HPMA 4OH2A 3MUJA 4W6XB 5KOVC 5KYYB 2X2UA 1XGPA 3SCMD 3MBXL 1YEFL 4MXQC 1T5XB 4YEEA 4P2QD 4KKRA 4U1GB 3CDGA 4FD0A 2E27L 3OMAB 4J4PA 5DGQA 4DQOL 3EHBD 4OV5B 3QI9C 5KW9L 3F58L 4OZGB 3UG4A 1NEPA 3DVFA 4EI5B 1CGXA 1PCSA 4JFHD 4YSDA 4XNDA 1JNHA 3AQZA 1GOGA 1R5IB 4GP4B 5FO7B 3B2PA 4FQHB 4WEMB 4I77L 3WY4A 2IH9A 3CFTA 3BYYA 2JSFA 4P5KA 3SO3C 2VLJB 2B0SH 2ZQKA 1RJLA 1MF2L 2F19H 5TF1H 3PWPD 3EIFA 1MH5B 3KJ6H 3N5AA 5ANMA 4DK3A 4J2QA 1H0DB 1HOCA 3KD4A 2NZ9C 3T0AA 2AKRA 3D09A 3W38A 4JAMB 2JKLA 2IIJA 1SYVA 4L8SC 3FQTB 4DUXA 2ZWLT 1SJMA 3WFEL 1QW9A 1LWRA 5E8PA 5KAQG 1U8JA 4X9FA 3LZNA 2YD6A 4IHOB 4F7EA 2FLBT 3CFMA 5GS0H 1UZ8B 3H9SD 5IG7A 2AXFA 5LBGA 1A3ZA 3AJ7A 1AGEA 4JRYB 2NNXA 5H2BB 2JKNA 3DUUB 3V7AG 4NNPH 3ZN6A 2BSRB 1A64A 2HFEA 2JKTM 2VN4A 3I3EA 1A3LH 1ZVNA 1ZV5A 1GGYA 1KCRH 2WVTA 3MRGB 3FRPB 5JOEA 1WCBB 1QYGH 4G9FE 4XC1L 2UZXB 4WTQA 1Q9KA 4PV8A 3VG9B 2FZ3A 2PNDA 4B9ZA 1ES0A 1AR1C 4Z7WE 4JFQB 4JJOA 1M7DB 1CLCA 2LABA 3I3BA 4QXVA 1GMEA 2ZWSA 3T2LA 2B1HL 3KYAA 4H1LB 2AJZA 1UC6A 3PDDA 3I9AA 3CVHB 3CPUA 4Z7NB 3L8QA 1H9VA 4ZFZA 3MUHL 5I8EB 5IHLB 2QSQA 4A55A 1EHKB 4N20A 1P7QA 5JDSA 4LRIC 5D2NA 1E30A 5HDWA 4ZMXA 4CC4A 4Z7UE 1Q1JH 3U36B 3CPLA 4ZBJA 5FCUL 2LFEA 3H1ZA 1GC1L 4KO7A 4PJXE 3US9A 3WHXA 4PW9A 4AKOA 1Z0NA 4JMXA 4PGBA 5AKRA 1RZKH 4YDNA 2HJKB 3MRIA 1FNLA 5SWZD 4H5SA 4MB3A 1MCEA 1BQUA 1BFVL 1IIKA 1L9SA 2F58H 2KZBA 5L2JA 5TE7H 1DDHB 4JDZB 1XMEB 2ZYSA 2H9GB 1IKNC 4APXB 3CHQA 1ZDQA 3QAZB 4MQ7B 4G6KL 1X5MA 2FYYB 2XCMC 3CLFH 1RUMH 3FK3A 4ZK8A 5ABAA 2D7QA 3P1VA 3UTSA 4X6FB 5FCUH 2W0LA 4WEBL 3BSHA 1INQA 2QLYA 1SUHA 3MODH 4ZUUB 3PV6A 5FA4A 5CLXA 3MRPA 3L5JA 5IY5B 5TQ2L 3X3FH 2ADGA 1MW0A 3B43A 4JN2B 1YEKL 4U6YB 1CL7L 4UU9A 5KSAD 1N0XH 3EYUL 1LDSA 5D2LA 1IM9A 1F02I 1N5AA 5KG9B 1RI8A 2E7LA 2CG9X 2ZX9A 4B27A 1KBGL 5I73B 5CZVH 3KNBB 2V17L 1FN4B 3GMQA 3D52A 4QTIH 1FV1A 2A0LC 1NBVL 4NRZA 3VFMB 5JIDA 5AYTA 4KMLB 3T9WA 1S7WA 1OM9A 4IBYA 2HAZA 4NRXB 5IP4A 4X6DB 4H26A 5C0FA 5DDHA 2JCCB 2EYTB 4F2EA 1WAAE 5DUML 2XZCL 5ESAA 3U82B 4WI6A 1QSFA 5FYKL 1Q72H 3B3IA 4JBSA 3OAWA 3VFWA 4Y16C 4TVPE 2V2WA 3QC6X 4K23H 1S7RA 2JCCE 3DSFL 3FN0L 3BMVA 4KKBC 1WUZA 4QOKB 1I75A 3FFCB 4I0PA 3L9RB 4PGDA 3T3PE 1GIGL 2P5WE 4LCCA 3B1UA 2J21A 3NQIA 4PJCE 3UERA 3T4AB 4Y8AA 3NTCL 1CGTA 3DMMA 1IZKA 3LIZA 1PCXA 2KL6A 4PU2A 4RDQF 4IRJD 2ZTBA 3BCFA 3BEVB 4GG8B 5I8OH 2ITDB 5T8IA 4ONFH 3DNKA 4BZ1H 5EUOF 3JV4B 3VWKC 1OT2A 1F4YH 1LNUB 3EYUH 4UZGA 2WZ6A 3FULA 5EEVA 2IAMD 1TQVA 3QC5X 2V4LA 4CN6A 3H3BC 1AQDA 3M1CA 5TDNA 1SY6H 4PRPE 3KJ4B 2BZ7A 4KGJA 4DPBX 1NC4D 4TLKA 1MN4A 1J5DA 3ESMA 3WFZA 1TOXA 2JIXA 4YL9A 3WUWA 1S4IA 1OB1A 3ATDA 4TQHA 3BUDA 4H8QA 4PJ9B 3Q2NA 1J0KA 2A6IA 4ONFL 1JGDA 1OEZW 3WGUB 4JX0A 4D9LH 3M8OH 2HSIA 4LT7A 4NQED 2ISDA 43C9B 4AQOA 4BJLA 4DHLA 1P6AB 4L3AA 3RPIA 1U8JB 1FVEA 5BUGA 3P9LB 4N8CH 1M71A 4LLDB 5FUCC 3V95A 2AJ3B 3PIQA 4RMUA 4XMUA 3LRLA 3S2AA 5I76A 1LEIB 1IGTA 4CVZB 1HH9A 5ICXA 1QBLL 4HIHA 5EU3B 4KXCA 2JJVA 4PJIF 3LIUA 2HTLC 5ESVB 2XZCH 3BZFA 4KRPB 3K7UA 4EVNB 2UV3A 1XGTA 1FHGA 4JDEA 5I1LA 4RMQA 3RPIB 5KBLA 3T0EA 2NY6B 1I9EA 3P77B 2R83A 4CW1B 2NQCA 2NX5D