2DWXA

Co-crystal structure analysis of gga1-gae with the wnsf motif
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
129
structure length
129
Chain Sequence
NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor-binding protein GGA1
total genus 17
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwxA00
1KY6A 1KYUA 1KY7A 3ZHFA 5CN2A 1B9KA 1QTPA 1IU1A 1NA8A 2A7BA 3ZY7A 3HS8A 1GYWA 1OM9A 1KYFA 1GYUA 1GYVA 1KYDA 3MNMA 2VJ0A 2YMTA 4BCXA 1QTSA 2E9GA 2DWYA 1W80A 5CN1A 1P4UA 2DWXA
chains in the Genus database with same CATH superfamily
3ZMEA 1AHWB 2PCFB 2BY1A 5HYQA 1ZT4A 2WLMA 1H8NA 3D25A 4QOKB 3L9RB 1NAMB 4X6DA 3PL6B 2F54D 5FYJE 1NLDH 4C59B 1E27B 4PLKC 3JYCA 4Y4FB 4P4KA 2KPWA 4AGLA 1UXWB 1FL5A 43C9A 4IEFB 1NCNA 4EKJA 4XI5C 3QQDA 4UTCA 4HJGB 4HJ0D 1RXLA 2CHNA 4KNQA 5JXAL 1R17A 2V2XA 2ITFA 4KTDL 1AZRA 1MFBL 3V55A 1DQML 3TYFA 1RZ7L 3MCG1 1QFWH 1X5KA 2C3VB 3GSWB 1EAJA 3V6BR 4GNKB 3TIDA 3H9HA 2ZZUT 1LP9F 1AFVL 1NBZA 4P2OD 3ARGB 3GSOB 1PJWA 1S7WA 4TQ8A 3WN6A 3TF4A 3PUUA 3FCBA 4MX7A 1SY6L 2OMBA 4NNXA 1G7LB 1TZAA 1NGZA 3TCLA 2B0SL 1BPVA 4R2GB 4X5LA 2P5EB 2I9TB 1FNSL 3FU9A 3CFDB 4JFUA 3V4UH 1PZUB 1IM3B 1Q9OB 3OAZK 5A2CA 2FJHB 1E9QB 1NPNA 4FN0A 4YFDB 3QQ3B 5DJYB 2HMIC 3N1PC 4P5TB 1Z9PA 3S37L 5HI4D 5EEZA 3GBML 2Y1AA 3TO4B 5MERA 3QJFB 4X9FA 4HLZH 3O8XA 2I07A 2RB8A 1FGNL 1SXSA 1MWAL 3VFSA 1FYTA 3KYOA 1XGUB 4U6TA 1CG9B 1DTUA 2R4RH 1HIMH 3RDTD 4FJYA 4PTUA 5DEFB 2UZPA 5DT1H 2BK8A 1HNYA 1U8OA 3NZ8A 2DEXX 4ECNA 2DAVA 5ILTH 4YR6A 1AP2A 2R69H 3AMLA 3UCQA 4QYOB 1U0QA 1NTDA 4NRZB 3ZR6A 3OR6A 3STZA 4QXUH 3CGTA 1VF5C 1E6OL 3TBCA 5JDSB 1U8MB 2EEAA 5DD1H 4AYBA 3Q5OA 4WHCA 5I73C 2Y5EA 3IDJA 4KXDA 1BD2A 4YDJB 2ZPKH 4J3BA 1FYTD 3ULVF 1NANH 2X0WA 5L2KB 3NPSB 2V5YA 3BISA 5D2NE 4WDIB 1C16B 4PB9L 2Y7LA 5I24A 2M1KA 5GS1B 2WXHA 4PJ7E 5DMIL 3SDCB 4E42A 4JFED 3B43A 1UVQB 3MUZ1 4FMVA 5DJAA 1BJ1H 1LO5A 2ENPA 3D9AL 3VSTA 4EMZA 2DIEA 4NRXA 2NY3D 4LBEB 1HE7A 3K2UL 3QA3A 4PY8I 1SOKA 2EE0A 4YPGA 4Q74A 4GQPH 4K3DH 3HG1D 3OB0K 4GKSA 4AENA 3VD1A 2DKSA 3BGFB 3NA9L 4QLRA 3FBQA 4WTZG 3V7AE 3NAAL 2YBRA 5A43C 3INUH 2EYTB 4G59C 5DD3H 4GBXC 1DVFB 4WI0A 3FQNA 4FQCH 4YN3A 1YY8B 3ETSA 2QZ5A 4PG2C 4XC3L 3WJJA 1ID2A 2P9RA 3EKCA 5HI3C 1EJ6A 1HWHB 2WZ0A 1AO7E 2BW5A 2H3NA 4FLOA 4TMPA 2WTRA 3TJPA 2I9TA 3ISYA 4L8CA 1LL1A 1F3JB 5D1QC 3T6QC 3TVMA 4XNXL 5B1BB 4S11A 2A9NL 2QL1A 4LSVL 1A4CA 5FUOL 3HG1B 3QUYC 3KNBB 3HUJE 3OB8A 4U1GC 3BZFA 4KOBA 4MNGE 3KNBA 2CJTA 3GINA 1YEGL 3JBG7 4X4KA 5EU4B 3RVUC 4XCEB 3LHAA 3SGDI 1WFTA 1U8OB 3NZ8B 2HZHA 3V6FA 2ZXEB 4HU2A 2GY7B 3QK0A 3QUZA 4U1HA 4WO4D 2G9KA 4A6YB 2Y22A 3UPRB 1JPGB 4XPBL 2OTWB 4JY5L 2I07B 4YQXH 2XTJB 4O2EB 4XB8A 1T80A 1U9KA 1ZLUK 5E9DB 4A38A 3K2IA 3LV3A 5FHAL 5GRXG 1T22B 3ZT7A 3IFOB 1QFUH 3H3BC 3S7GA 3IXTA 4HWNA 3KW7A 4NN7B 3WFDL 3OZLA 3IDUA 5DZNA 5J1AB 2WZ5A 2R69A 1JNHB 3DRTA 1NCWH 3RPIB 3SSGA 5E00B 3R1GL 1YEFL 4NUGL 4MD4B 5E6ZA 3FFCB 1CFSA 1EK3A 4U6YA 3ZDZB 4FG6C 4WRLA 2UXGA 1I82A 4BHUI 4BUQA 1JGVH 4P2YA 1JVLA 4MD5B 4KRMB 1AMYA 2MQCA 3SBRA 4BELD 4YPGB 3KWXA 4F91B 1P4BL 5AAPA 1S78C 1GS7A 2FJGB 4E9LA 1KC5L 4MASA 3NJNA 3OR7A 2DQ6A 4NZUH 2MWCA 2VAAB 3D3VD 4R7DB 5DHMC 2VXQA 4IU2B 1OWWA 5AYTA 4ZAKB 3ZTJG 4B3VA 2EABA 5DUPL 1JGUH 1UZ8B 4UQ3B 3NN8A 3SKOA 5FYJL 4XVJH 3C09B 1FL6A 2E6JA 2L3BA 1I4FB 1AGDB 4PPTA 3JZYA 4N6RB 3WO4C 5JXAH 2FWOB 1D5MB 4PP1C 2F7QA 1DBMH 2AK4A 3QHTC 2OSLA 4MTMA 1DQMH 2EAEA 4DZ8A 3BZFB 4FEIA 5DK2B 2Z4QB 3VJ6B 3FO0H 1KTBA 2VC2B 3FF7A 4G72B 4KI5F 3WELA 3P0VH 4RNRA 2AXHA 4PJEB 1GKEA 3WIHL 1G0YR 3B9VA 5DWPA 4BFRA 3H55A 4KRPD 4ELKB 2V3DA 1SY6H 2ADYA 2YQGA 3T0DA 1NDMB 5GHWL 2OTWA 3TA3D 4B0MB 4XNBA 1GJWA 1FN4B 3PWLB 2A83B 4WEEA 4ZZFA 2BCKB 4HXAL 2BXZA 5IQ7H 3AVEA 3OQ3B 2YUWA 2QSQA 2B20A 3PAYA 1WYJA 3GBMH 5C07E 1X5JA 5MEPB 4N26A 4I48B 5D7JB 1F4HA 2KUTA 1XGYL 4IU3B 1HIML 3T8MA 3JTTA 2V5TA 2KLSA 1MXGA 2AJXH 3GO1L 4U1SB 2RAMA 1B0RB 3F85A 2VDRH 3NT0A 4Z18A 1JE6A 5HYSG 2HTKC 4DW2H 2ZOTA 1UXWA 4QXUL 4F37F 1FVDB 1XBRA 1E6OH 4M4PA 4DHLA 2XA8H 3RBSA 1E43A 4PCYA 4CAGA 4PJHE 1X4ZA 4LRNL 5DUML 3SKNB 4ZXBD 1TITA 4RQQB 3VXPB 4HS6A 4DETA 4Y5VB 5I5JA 3S37X 5SWQB 3ZQ9A 4JHZA 1KEGL 2HKFH 2ZJSH 3GSNH 3H1ZA 1KCVL 4QF1B 1XSIA 4YZFE 3MV01 5F0JB 1MQ8A 2FNBA 5DU7A 1RZGB 4JM2A 2APVA 4LCIL 4MXWH 4XNMA 3RPBA 2OW7A 2JB5H 4P57A 5G5DA 5A7BA 2JVUA 3R4DA 2VQ4A 2APWA 1TXKA 3T9WA 1I8LA 5D55A 2XZAL 3P9MB 3V4PA 2XV6B 2FSDA 4OD3H 2OZ4H 1TQBC 3W5MA 4WNJA 1AGDA 1HYSC 3UDWA 1CLCA 1IBFA 2FJHA 2FWOA 4AEEA 4DQOL 4TL5A 2GTWB 4UZSA 3CJJA 5KBPA 3QRGL 2VO5A 3B1UA 3BD5A 1U8JA 2VDOH 1BG1A 1RJZB 2JQAA 1JZ2A 1FYTB 3KYOB 1TR7A 3FS9A 1WO2A 3QI9C 3ZHDA 1WFJA 5C0GB 3QIBC 4GAGL 3BKYL 2R2BB 1X5FA 4XVTL 1SMAA 1TETH 4Z5RB 1MLBB 2OLDA 1DBAH 2O5YH 3T1FA 2R1WB 4XBEL 3FCSB 1OAJA 2CUMA 2R83A 2ZKWA 1A1NA 1WZAA 4YLCA 3ZU8A 1FFPB 4GSQA 2VQTA 2XKNB 4MJ5B 1YUHA 1IARB 1WP6A 3DX9B 1P2CA 3OHMB 4IRJC 3B3BA 5EZPA 3VFOA 3ZHKA 3BP4A 5CGMA 5IGXH 1GGIL 2VR5A 5F3HB 1OZTG 3CV5A 4QTHA 4JRYE 4ILDA 1BAWA 4N9GA 5CMAB 4YQXL 5GS1A 3U1SL 1N3NB 4IIQB 3TLRA 3OMZA 4N8CH 2DQJL 1JVKA 4ZOCA 4HIJA 5K59E 3EOTH 3L48A 3LKSB 4P9ML 1DCLA 3WFDH 2LQRA 5FGRA 1IRAY 4HSQA 4NN6C 4Y1SA 5DJCA 2XVKA 3GD1C 2HPTA 3LJ3A 1HFUA 4FX5A 1SYSB 5FYKD 1JI1A 3VI4A 4JFEB 2CKBB 4HG4K 2IANB 1DDHB 1RZFL 1HKFA 4LP4A 1G7IB 1ZGLM 3B6SB 1E7VA 4U1MB 1TZGH 3O3UN 5TK2A 2DWTA 1OAXH 2BHUA 1BCIA 3FTSA 1P4BH 3IJSB 1YEHH 4N2BA 5E6ID 1QFWM 1WGVA 3D48R 4I9WD 3PIQB 2YS4A 4L8CB 3OL2A 4MNQE 3BQUA 2H2PC 2RIKA 4AMWA 1B6UA 3KHQA 1EBAA 1QI5A 4B5ZA 2P3YA 3HI5H 1Z7JA 1G7MA 4R0LB 3T77B 5BQ7B 3MODL 5L4MA 1BAGA 2ZX6A 1JUFB 2PABA 2GY5A 3LRLA 4ICXA 4MNQA 2XWZA 4B9ZA 3U6RB 4GRLB 5J13C 4ZFOL 1FNAA 3D0VA 3GM0A 1DJYA 4MCZB 1A4KA 2Y3AA 3DXAA 3KPOA 3PAZA 3EJYD 2D7OA 1U8PB 4WWOA 4YDLC 4OF6A 3P0VL 3UC2A 1NC4A 4ISVB 4M00A 5E6RB 2FX9L 1X5AA 5CSBA 4KY2A 2QGDA 3TGXA 5LHDA 1S5IL 1HL5A 5EZLA 4JE0A 1KCSL 4WFED 1HHGB 3OKKA 4MD0A 4Z1PA 1T83C 1GGYA 4ZMXA 2ZWNA 4KKLD 5EO0A 5B3JF 4PWIA 1FA4A 1C5DB 3FC8A 4MXQC 2CO1A 3HN3A 2IPUG 2XG4B 1LE5A 5BRZA 1QVOB 1MAJA 2DYPB 1UZGA 1J9CT 4UAHA 2CBOA 3GBDA 3IDNB 4R97C 4B27A 2ENJA 2JJSC 2XVGA 4KAQL 4UTBL 2IGTA 2V3FA 4OZHF 4KUCD 1XGYH 5EUOE 2CSPA 4JFQB 3MLPA 3QH3B 2F0CA 4M8VA 5CLWA 3L7FB 2BP0A 3D30A 4Q2ZA 2X9XA 3O3BB 2G3XA 3GRGA 3V4VH 4JFDE 5K33A 3VGEA 3GMLA 4H2CA 1L3NA 5C0BB 4JB9L 3KPSD 4XVUC 4I89A 2M83A 3EJSA 2DRUA 2VDQB 3U1PA 3PIQA 2DQEL 5E6UB 1T0PB 4LRNH 1GZPA 5DUMH 3GSXB 4PJBB 3J07A 5FCUH 4JGMA 3TH2T 1BQ5A 2AK4B 3W0WE 3BVVA 4XE0A 3KYAA 4PVBA 4A7SA 1GZHA 2XTLA 2DQUL 2O5ZL 4GH7B 2AEWA 2B16A 3ILDA 3MV7B 1DN2A 4O58H 2VWEE 3B9EA 5A2KH 2DIBA 1A25A 1U42A 4ETQA 4LSUL 4ZUVB 3EYFA 4LVNC 3FU3A 1KY7A 1NSNL 2YA0A 4JPWH 1XD1A 2BWQA 4G42B 4BSVB 1T6WA 4HLZG 4YSEA 2XN1A 4LSDA 2IGFH 5IVZA 2YD4A 4KQ4H 3NIGE 4PGDB 2J1ZA 3WLWC 4D0DB 2QLYA 3ARXA 1I85C 1E67A 5LGHL 3GBEA 4Y9GA 1I8AA 4OJYA 5EU7C 1M2VB 1JN6A 2UVEA 4NLAA 5DQ9A 4DGUA 5IEKA 3WSQH 4ZK8A 5DUBA 1IBDA 2IO5A 5I74B 1FNFA 2IDTA 1MFDL 4BCZA 1C5DA 3CVBA 4RZKA 3GI9L 5C2UB 4AMKL 5BZDA 5IMMB 1XCXA 1E6JH 3KJ6H 1RK0B 3LXAA 3NJHA 4IK7A 5DA4A 1QVOA 1TETL 2FK9A 4PRHD 3V6OC 4DUWA 1U36A 2VAJA 5GRJH 5B1KA 5KBDA 3VD9A 3SKMB 3FU6A 5TQ0H 4O2FA 2PR9A 2RH0A 2EEBA 4BCXA 3MRIB 4KK6D 1TZIA 4LEXL 4LDEB 5FO9A 1FO0A 4WGVB 5IGXL 1F4WL 4ORGA 3FCGA 4I0PD 1SYVB 2IH8A 1BQHA 1KFAH 1HILA 2F54B 3MOQA 4HK0B 4UT7L 2AV7B 3N6YA 3LIZA 3DPBB 1RHHA 3MRGB 4HCIA 2XZCH 3IMTA 4Y16D 1CWVA 1N2RB 1FZKA 3EOTL 4X9HA 2P7TB 1UWGL 2V2WA 1L4IA 2ZOKA 1ZHNB 2YXMA 4GB9A 3RNQA 3CZFA 3WEOA 3MV7E 1K5NA 4XVSH 3RBGA 2UX7A 2AJVH 2HFGH 4F7MA 3GMLB 3L4CA 2A74C 5BZWA 3UTTD 1T0OA 1R3LA 1KWKA 3QG7L 1CCZA 4I1PA 4MJID 4MS8D 1I31A 4GS7B 1BBDH 4X6CE 3RAJL 1OAXL 4J3OG 2Y1VA 3HRPA 3VI3B 4ZW8A 1G5AA 4FKKA 4HUXA 4YHZH 4YHPA 4EE2A 4IJ3B 2JQZA 4GXVL 4DO6A 1P5UB 5AVQB 4JZJB 1W72A 1IGMH 5F1NA 2ZICA 2BY2A 4Y1AA 2NYYD 3SKUD 1F6LL 4LEBA 5C71A 1PYWB 1KGCD 2XQBH 1R3HA 4JDTH 2Q2LA 3BSHA 3IGKA 2HFEB 3C60B 4ZMTA 2VLME 2Y25A 2FO4A 2C3HA 1LWJA 4JG9A 2B1OA 2VM9A 4G9FD 8CGTA 5I1EH 1OOWA 2VLRB 5CEXB 4X9BA 2X6BA 2BNQE 1MF2L 3WLBA 1J9QA 1BIIB 2BIQA 4TXVB 3IBEA 4C57C 3IDGB 1KIPA 2CLRA 3B37A 3V6ZA 5HD8C 4AE0A 2HVKB 3L5JA 4DP8X 1LQSR 1R6VA 1EAQA 3T08A 5AAMC 5DF0A 1A9EB 1W6LA 2ZCLH 2VERA 4NZJA 1PZ5A 4AGPA 4HD9A 2DBJA 4WKZA 1WISA 1KBPA 3A0OA 2H6UA 5FW8A 1UWXK 3D87B 4I4WA 2FIRT 1ZANH 4ZUWB 3DSFL 1NLBL 3RY6A 2V2TB 1AXSB 1B2WL 4LCCC 5F1SA 3ZRSA 5FYKL 4PCKA 1J8HB 1G1OA 4RGOL 3BDBA 3GSVA 4RGNC 4IIZA 5IBLC 5EOCH 5IB5B 2WO3B 3QQ3A 5DJYA 3O0RH 3Q5YA 3SDCD 1UJ3B 4F27A 5HDOA 3MU3A 2ZOKB 5F0LB 3GSRB 3RVVC 3KPMB 1FJ1A 4GG6B 1B4JH 4L3AA 4FNLL 4PVNA 4AK1A 3GIZL 1ZV9A 4D0BB 5EBMA 4WJ5A 4OZFG 4E9QA 3CU1A 4OGQC 2LW3A 2WAHA 5DHYA 1AP2B 4HAKA 4N0UA 4L1TA 5KSAD 1NKRA 3LEYH 2Z8WC 5K9OA 3KYNA 4RGMC 4Z7IA 1N18A 4HG4J 4PG9A 4LAJH 1UM6L 3K0WA 4WW1B 2DQEH 3WTXA 4NRYA 1BJ1J 1TJHL 3LRHA 3SO3B 1JZ3A 3M1CA 1H15B 5ANMB 1ITCA 5FCUL 2XWEA 3RZCC 3MRNA 1TJXA 4JDZA 4IM8A 1TT6A 1BM3L 1AZNA 2VIRB 4HGMA 3WGVB 2O5ZH 3EBGA 5E2VH 3UEQA 4OVVA 4CA4A 4LP5A 1OXYA 1WITA 3WTSA 3F58H 4BFEA 5HDBF 2ZP8A 5EHFA 4J3UA 3ASOB 4OZFA 3RWIA 3UTTE 3L1OH 2JLLA 3LPPA 4PRPD 2A4EA 4FERA 3QIWB 2CO6B 5E08L 3NJFA 2KLTA 2CGYA 2X41A 4G2AA 4OUUA 4FAAB 4FZEH 2YN5A 3MFFB 4XVUD 1NANI 2VLRA 3KVPA 3QB7C 4RH4A 4ACPA 3ZKSD 1NUFA 3DI3B 3WE6A 2OPCA 2X4SA 1NUGA 2BERA 2X12A 4JAMA 1QBAA 4U1KA 2OMWB 3L45A 2R2EB 4D3CH 1CBVL 3P3RA 3Q3GB 3UBGA 1TEFA 2W80C 4LRIA 2NMSA 5IV2B 5K5YA 3CZGA 1Z9SB 4IBZA 4B9CA 2ARJQ 2EDNA 4RMVA 2CWRA 4JL2A 4OM1L 2FH6A 3QXDA 3ARDD 5F1KC 1N5AA 1INEH 2L0DA 3GK8H 4QRUB 3O6KL 4EUPG 4HH8A 1WJ3A 2VW6A 4FFZA 2ROYA 3B9KC 5DMGC 5D1ZD 1A3RH 4JO1L 4NJ9H 1LO0H 4JRYD 2AS5M 3KCWA 5KVEL 1I3VA 5IBLD 1UJ3A 3GSXA 4PJBA 4X7SH 3O4LE 3N41F 4HHAA 1BOGB 4L0YA 5GS1C 3RNKB 2DM7A 1BOGA 2D2OA 3BP6B 4UT7H 4ZFOB 4A7QA 4B53A 4XPTL 2H26A 2XG5B 4R4ND 4UOJA 2CH8A 1YYML 3PS6A 2TAAA 5AB0A 4HOXA 2OI9B 4K7PH 4QPEA 2WWKT 3WUZA 3ELAT 1HDMA 2BFVL 5GGQH 1AKJB 1JVOA 2A77H 4WK0B 2OJZL 5CHNB 4R5TA 4I2XE 5DO8A 3HE7B 1RUQH 5JW5B 2WC7A 5C0DA 1N67A 3NJXA 4ZPTB 3APNA 1Y07A 1O5DT 4S1RH 2E76C 2X2IA 9PCYA 3KMDA 5IQOA 1XGPA 4G80B 1EZLA 1BBDL 2CHXA 4M7KL 1GC1L 2R23B 5SWZE 3FO1B 3TIDB 1THCA 1DSFH 3QIWA 4XH2B 1T1YB 4FC3E 1T7ZA 2FJGA 5CBEA 4TYUA 3EG9A 4P2OB 3AG2B 2EYTA 3LH9A 2DQHH 3IGFA 3MBXH 2R27A 4CJ0A 1MCRA 1L3WA 2MHAA 4CBPA 1JF6A 4MA7L 4BZ2A 1B3JA 3QUXB 3VGAB 1QOKA 3HFFA 1KEML 2I24N 3EGXB 1EXHA 5L8LB 1GZQB 4G3YH 4R4BA 3FAWA 5E8NA 2JB6B 4PGEA 4JFFE 5C7XH 4K5LA 4ATTA 1NDMA 4RRPA 1LEIA 3ZKMC 3VFSB 2UYLA 1IILE 1NINA 4FFYL 1JDAA 4PJXF 5EF0A 1CLVA 3NK4A 3EFFA 1ZGLA 2NW2A 2WLKA 4I3RH 2D03L 1QBMH 4RFOL 4WKXA 1AY1H 5IEHB 5JUEH 2NW3B 5HYJD 2OYPA 4HHWA 1UACL 4F7TA 1N5AB 1WD8A 3A67H 2BHFA 1CXLA 5AKSA 1B2WH 3QC6X 1H8SA 3FB6A 1NC2A 1OAQH 4X7TA 2N0KA 2KYIA 2QTEA 1NFKA 4ZYKA 2Q86B 1LEGB 2W1NA 3AY4C 3ECUA 2CO7A 5AB2A 3BO8A 1TU2A 1HKLH 5KVDE 3HEIB 3QXVA 4H0GA 2QKIC 4FNLH 4Q8BA 4OFPA 5JW4N 2WIIB 3EH2A 2L04A 3TIEB 2XICA 1YRKA 4A66A 1PLCA 3BIKA 4MHHI 2P1YA 3FOMA 4LQFH 2ZE0A 5ACLA 1EJOL 3G6AA 4NXSA 4K9EH 2O5XL 3VXMA 2F8OA 5CILL 4WEUD 1O7DC 3LEYL 5SWZB 1PEWA 2HFEA 3M1BB 3HE7A 4KMTL 2B9AA 3WENA 3D07A 4J8RA 1UM6H 3EDEA 4N2DA 4PMEA 1EBPA 2CMRL 1WZ1H 3PG2A 1JGEB 3PWPB 2WW8A 3VCLA 3PXHA 4NXKA 3ZE0F 3IDGA 3MFGB 4E9XA 3L95B 4YE4H 3RHWK 3D4YA 2VM4A 3KR3H 3QUMB 4H8PA 2D3VA 3VGGA 4N1CA 1ZXKA 4B5EA 5ESVB 3QJQB 2D3LA 4RRPM 1S9YB 4HMDA 1HXMB 4LNRB 3EGSA 2A1WH 2HJLA 3T65A 3FTUA 2BNRA 1RZKC 4XP5H 4R97B 3X3GL 4ZNEA 2COQA 1G84A 4MA1C 4GUPB 1JHLH 3E2HC 4YSCA 2TSAA 5IEHA 1BXUA 4JKLA 1IC7L 4RAVA 5HHXL 3TC9A 1SNRA 2IXQB 1IBGL 3SCMC 4NO0D 2FWLB 3KLKA 4RX4D 4XP1L 4PREA 4F7CB 5LAXA 4X5PA 3U46B 1TSRA 3GC3A 1AYRA 2APFA 2BZDA 1WA1X 5ABAA 3QYCA 1HL9A 1I8IB 2VC2H 1CTNA 3RWJA 1ZGLB 5F72S 4MZRA 2CGRH 1U8HA 4LCYB 1HNFA 3P30L 4GMSH 4YH6A 4IRJD 1XGQB 3GIVB 1INQB 1NWPA 1QW8A 3FULA 3QEHA 2EEFA 1VA9A 1A6ZA 5LCVL 5A2BA 2C7FA 3O6KH 1E4HA 3OAYH 2G9HA 2K3TA 3BKCL 3VWJB 3LB6D 4Z3EA 4YDKL 5AW2B 3BE1H 4QRTB 2YPLA 3X12B 3RTQD 4JDVB 4X6EA 4H8WH 3O2DL 3F84A 1NCUA 3CXFA 1BA9A 2GEQA 1FVDA 3SGJC 4V33A 4HWEL 4NZTL 1OHQA 4HJGA 4PJXE 4CADB 1EEQA 1OAKH 1OCWH 4LOUC 3U4BL 5I1JL 4N2AA 5GGQL 1ADWA 1OP3K 1YN7B 4Q14A 3RZCA 4PJAB 3ZDYF 5B8CB 4KHTL 4JY6A 4KRPB 1T2QH 3T0VA 2Y7OA 2W94A 5ABDE 1I1RA 2X4PB 4JZOA 1YJDC 3N5AA 2ATKB 4TNGA 5FDWB 4X4YA 4Y9BA 1KN4H 4M7KH 5AVWB 4FXKA 3FRPB 4NDMB 4K5NA 3T6XA 3WXWH 5GGTL 4YXLH 3TBBA 2WO4A 1UD2A 4JFFD 4EAEA 4YHNB 1JUFA 2PPFA 2UZXA 2FD6H 4PJEA 3L3GA 3I6SA 3MBXL 3MUJA 4KZCA 4R7NB 1DVZA 2JK5A 2QDVA 3AADB 2OSLB 2DM4A 4I13B 2ZWSA 2FLRT 3ILPA 1DCEA 5A7EA 5MERB 3TO4A 4AQ1C 5I28A 4QXVA 5LAXB 2LFEA 3Q9QA 4X6FA 4MJIB 1L6PA 4M6AA 5DLLA 3TNMA 2G0LA 4EDXB 4WFHD 4JM2F 2JCCB 1I8IA 3RWJB 3WGUB 1AJ7L 3IJEB 1JZ4A 3KPRD 2V9UA 4D0CB 5D70L 3UXFA 3D09A 3BC9A 3L3JB 2EZ0D 1CGVA 3CFEB 1BQKA 1G0XA 1F41A 4W9CC 5H35A 3PJLA 5AWNH 4UDTB 2DL2A 4XN9A 2KBGA 4IOFD 3BW9B 4JFHE 4PJ5A 4BH7B 4I3RL 4OLWL 4E5XB 5CJ5A 3MRRA 1DLHA 1UH3A 2DWDB 3ME0B 3P4NB 4FQCL 5GS3A 5CEZH 3HC2A 1MCKA 5F9JA 5AG9A 3VXQB 3ARBC 5F7MC 3WHE1 1RJLA 4S1DC 1JZGA 1XF3A 4XAKD 4TM9A 4AM0B 2IH1B 3CFIC 1UGNA 1SJEB 1WHPA 3UTQA 5BUAA 5IW3A 3QDGB 4TULL 2WBJD 3ZKXC 3T0EC 3C6EA 2CM5A 3SQRA 4CNIB 3J2PA 3C5SA 2A9NH 2JF1A 3C5SB 4LHUA 3ABLB 4ONHB 4IOSD 4X6EB 3IDNA 4BFNA 1WH0A 4G7VL 1GYUA 3X2QB 2BWDA 2EUZA 4GP8B 4AENB 1NBCA 3HG2A 2J7LA 3CVHA 4GLRH 4OD1H 43CAA 1MW1A 3NIDE 1FVCB 3O6FC 4K4KA 3NK3A 3BAEL 2WQSA 1B0WA 4X8JA 4S10A 4L3CA 4JRXB 3N04A 3VA6A 2R56L 1WWBX 2XWDA 5GRVL 1XCQA 5CILH 4HOMA 3D2UA 3QS2A 4XPBH 2R2HA 2BVEA 4Z77A 5I8CA 4Y4KB 4ESKA 5F9AC 1P9MC 3QDGD 5F70A 1WDAA 2WXIA 3W5NA 3U1QA 2WWNA 1XFPA 4AQEA 3S98A 5C6PB 2CMRH 4TQIA 4YGAB 2XKUA 3LEXA 3NFPB 2AGJL 5K39B 3ILQD 4PJGF 3R1GH 1I53A 1OF0A 4JKPH 4U1NB 4LSQH 3P9MA 2YLHA 2ZAHA 4YE4L 5IB3B 1V7ML 3FQWA 4GQ9L 2ZWYA 2C4FU 4OV6F 3JWOH 2YA2A 4JGJA 4FTVB 4ZSOA 4P3CH 3T4AA 2F54E 5FYJD 3U30B 3ZY7A 2ORBH 3LKRA 4X5WB 5E4EB 3QUHA 4HCFA 4RMSA 4FFWC 1JHLL 3D34A 4R4FL 4X50A 1M7UA 4K71B 3QQ4A 4Z95H 3RUGB 4HJEA 2FEEI 4ZAKD 1A1OA 2VLJA 3WS3A 2OR9H 2HX9A 3CHPA 5DK0A 5GZND 5FK9B 4XVJL 4F5CA 4U7KA 5IEKB 1MCIA 3X14A 2PO6B 2YARA 3MBED 1MVFA 3D69B 4M61B 5EC2A 3VFOB 4OFQA 3EJRA 4U7MA 2VN7A 4YZFF 1LEKB 4GMSL 3B8YA 1H9VA 4OAWA 1Q1JH 3NJGA 3O6ML 3EYUL 3FCUB 1ET8A 4UYPA 4HJSA 5LCVH 3NGBC 4AIXA 4NQED 4NQXA 3GPEA 4H2AA 4UCFA 1ZT7B 4LF3B 4YDKH 4GP4B 3NIGB 4UNUA 5GRVK 3MRBB 1SJHA 4X8JB 4ZFZB 4BKLA 4Y16C 2IAMC 2Z7YA 1S6NA 3ML8A 4DP9X 1KJMA 1PMYA 1UWFA 4HX1B 1KIUB 2ZKYA 1FZOA 4ZTEA 3L4VA 4GSXA 4Z7UE 3EJPA 2WUCH 2E7CA 5C09B 2GSMB 4GIAA 5J1TC 4PJ9D 5ERWB 5EMYA 2ZYSA 5JHMA 1JWSA 3MA7B 1PZDA 4ZMNA 2Z92B 3EZJB 3FTXA 3L4XA 1SM3L 1P7HL 4EN3B 5L8KB 3A47A 3FT9A 1HSAA 4CL7A 1V27A 3CSFA 5KUMA 5L88H 4KHTH 4ODXA 5DK2A 2HB0A 4AV0A 4J4PD 4G8GB 2PYEA 3HLAB 2H2SC 4P46D 2CDEB 1BF8A 5E94A 4H0IA 5T1LD 1QATA 1MFAL 1PBYA 3CFJB 3IJ9A 3DJ9A 3FQ4A 1HQ4B 1KBVA 3WY3A 3TBWA 4LGRB 3RL1A 5JOPD 3NJVA 2DQMA 4W9DC 4FL4C 4L5FH 3V6OA 3CMGA 4BWWA 1OP4A 5LBSL 4KZDH 4XX1E 2ODIA 1J5IA 3QNYA 3UCRA 4L37A 1MREH 3II3A 4HPHA 2CBTA 2V17L 2YMTA 5EULV 3DGGB 1UKQA 5L8JB 1SXZA 2FYVA 2WGXA 5E8PB 1JGLL 3U9PH 1XR9A 2F53E 2GITB 4F15B 1ROCA 1TFPA 4NHUA 1U8LA 3OB0H 3X13A 4TSBH 3UZVA 4DZBB 5EC2B 4U1SA 1NCGA 2DJSA 1G94A 2DJUA 2YEVB 4OFVA 4ABQA 3HNVH 3NJIA 4AVIA 1MKFA 1H3UA 2K7PA 5CJQH 2NLJA 4XAWH 1HXYA 2XZAH 4PYGA 3G6JF 5CINL 5IW1A 1HXYB 1V7NL 1HOCA 4N9OB 5LGJA 1HOCB 3II1A 5C08B 4KVCH 4PRDB 4FQJH 4WKZB 2YAPA 4XR8C 2HLAB 2Y2WA 3JTSA 1XL4A 3GM8A 4RDBA 3DX7B 4DGYH 2MCG1 3TJEL 2DWXA 4KPHL 3MJ7B 3KPNB 3ZMNA 1KLGB 4EDWH 4MDJB 5KS9A 1HZHH 3BKYH 4UDUA 4YSQA 1SEBA 5KSBA 4RWYL 1NDGA 5I1IL 5DHVB 5JO5B 1JI2A 1CDGA 2DQIL 3KBHE 2DW5A 4PRHA 4G7VH 4Z3JA 1S9VA 1MCWM 3WHE0 5D1QE 1JSYA 4F7PB 4M9OA 4OD1L 3ROLA 5K9JL 5T1KB 3ROLB 1UH2A 3BUYB 1I85A 3LD8B 1L9OA 3PLYA 1PSKL 1G7QA 2GSGA 2HA1A 5FKPA 5C6TL 3BP5B 3OKDB 3ARBD 1T20A 4L0ZA 5EWIL 3UZQA 2EXTA 4HT1L 4WUKL 4MA8L 4WVRA 2NUTA 4TUOB 4MCYA 2X4RA 1I3UA 1MFMA 2JKTM 3RB5A 1KN2H 3QJUB 1RMFH 1SF5A 1KIRB 1UGKA 4MJ4A 4JPVL 2I7SA 5DJ6A 5BV7C 3MGOB 1JXFA 3DV6B 4Z78B 3C5JB 3FQYA 5IJCC 1AHKA 4RRPG 3NBNA 4N8VA 1QLRB 3H9SD 3IKCB 1L7IH 2IGLA 4AYDC 1R3IL 1KTDB 5I82A 4L8DA 3ZSTA 4JFFB 1CB4A 2Y4SA 1TZGL 2VZVA 1PQZA 2IFFL 5J3HD 4Y2DA 2BHYA 2XQYG 2EDEA 1X5IA 1KIPB 2CLRB 3VACA 2FT6A 3TO4C 2GITA 4YHOL 4U3SB 2E5EA 1HHKB 1UEYA 1RP8A 4U4IA 1DE4A 1H5BB 1ILSA 2AEPL 1F4AA 4XGZA 3IETA 2LVEA 2VMEA 1EEZB 1C5CL 3ZDZE 3LQMA 4MB5A 1MJJA 3HI5L 1OK0A 5L0QC 2IQAA 2X1XR 3VXUB 1J0JA 3Q6FB 1CYXA 2IALB 1TJGH 4QOKD 3J7HA 1WS8A 3CXHK 3IGUA 5D1XE 5KVDL 1KY6A 4XNUH 3QUZC 3PNWB 5KEZA 2J72A 2ICES 4JKMA 4GSRA 1DVSA 3GLEA 3ZDXF 3NSDA 2NR6C 3MLYH 4ELMF 1GYCA 1CG9A 3CZSA 3ML9A 5DEFA 1E4XI 2FWUA 4AE1A 4QD2E 3QUML 5IB2B 2XPYA 4WV1C 3A21A 4B41A 5F8RC 2HVJA 1S5IH 1Y1DA 3L4TA 5ANHA 1MLCA 2ED9A 2O72A 3MNZA 4PHZA 2KPNA 2UXFA 3SGJA 4IBWA 3PHOA 1PFOA 1YYLL 6FABH 5IF0A 3EH5B 1CFBA 4XAKE 4ABUA 4EI5A 3V0GA 4GAFB 1LK2A 4FXTA 3NCMA 4Q52A 2E74C 2KQNA 1IEAA 4BH8A 4UTBH 2BCMA 3PAUA 1YEIH 1AO7B 1TFHA 3BZ5A 2HP4A 2LAGB 4ZTOH 1Y6MR 1OT1A 3VE0A 3BIBX 2C3WA 3G9VA 4IDJL 4EEEA 1FRGH 4JGUA 1EO7A 4P2QD 1CMOA 5C9KA 3FUIA 4O51B 4JRFA 5D2LB 1EGJL 3MO1A 4LCCA 4FP8L 5D4HA 4M6NH 1P6AB 1G7PA 3MCKB 4XH2A 1XSJA 2OR7A 4OZGA 4MDIA 3RA7L 1E4KA 4HIPA 4JQVC 5CGYC 5C07A 4AUUA 2JCCF 2F8IA 5GXBB 3Q8AA 1MREL 1YAZA 3W9DA 2RALA 5E6IA 3GFUA 2CA4A 3NACH 4HU8A 2ZCKH 4ONFH 3UBHA 4NC2B 3ARVA 2DQFB 4PJCF 3ZZ1A 1CFQA 2WLJA 3B5TA 4F7KA 3I3BA 2K6WA 4ZNCD 3FK3A 4DUVA 3LIUA 1JDDA 1JZ7A 1KGYE 5ISZB 6TAAA 1AIFA 4IRZH 3KW8A 3WL9B 2WLLB 2EDRA 2EO1A 2J1XA 3QXAA 4PR5A 1YMHA 5DURD 4MAUL 1V7NH 5DVMA 4X8GA 5CU5A 2YD5A 3IDMA 1RJYA 4LARL 2MEJB 5FYKE 4XXDB 3VVWA 2ADIA 5SX5H 5CZXC 5EU6E 4AC4A 4UTBA 1UD6A 1DEDA 1IE5A 1IV8A 2F1EA 4NRZA 5E9AA 4DPCX 3FB6B 4F2MB 3LOWA 5ISZE 4M29A 5HI5D 1WLHA 4P2AA 1HZHL 4AMKH 2CJUH 2GJ6E 3KPLA 1E6JL 3S35X 4P5RA 3C9NA 2A3TA 1V3JA 4IRSA 4E9RA 2DQIH 3O2WL 4HS8L 5LAPA 5HYIA 3O6FA 5E6YA 2XNAA 5JORB 2CRMA 3FQTB 3QFJB 3VRLF 1H6FA 2J55A 5L0QB 3S6CA 5JHDB 3SQOH 1OP3H 3H9YA 4GKOA 4PRIB 3T8VA 1SLWA 4G8IB 3VXRB 2GJ6A 3UL4A 2B5IC 5J12B 5HHNA 3NRFA 2V7NA 3PQYD 4CDGC 3BUIA 3MRJA 5EO1B 4C56E 5ESQA 4B6ZA 2XN9B 4P2RB 2AEQH 1QA9A 5AW5B 3DX2A 1HQRB 4OZGB 4G7YH 4JCWA 3Q2CA 4KTYA 2X42A 3ZDXE 3EYSH 2ITDB 3QFGA 3GMNB 4S0HA 3B2XA 1LWHA 3WDJA 5DRXA 1G6RL 1PEZA 3V5HB 1D9KC 4U6XB 1NGYB 1XVSA 1CGSH 4KKAD 2L4OA 3P3YA 1EXGA 2VUKA 1FDLH 3MNVA 5CP7B 5E8DH 1HHIB 2BNUB 4HFWB 4V2BA 1D5IH 1HHIA 1II4E 2R2EA 2A5UA 4HS3A 2E8ZA 4NI3A 5EEWA 5E5MA 1HCVA 1XIWD 2FNWA 4JM2D 2Z31D 4TUUA 5ETUB 3MYJB 2NX5E 2OCFD 3PP3K 3ARQA 1NFIB 3B1TA 5DZ9A 5HGDB 1E9PA 1K4DB 4Q4EA 5EFIB 3B56A 4F8LA 5MP6L 3MCLH 4R84A 1ROWA 5BPPA 3NFSL 1FYHB 3QDMA 5CD5C 2BSSB 2JI2A 2V3EA 4PJIE 4A55A 1KB9K 3LQZB 4IHBA 1QPXA 3BX7C 2BSED 2YUXA 3UYPB 4Z7AA 4HQQH 2O6FA 4ENZA 2ZNXA 2RTTA 2LOEA 4UBDD 1S7SA 1JPGA 4QWWC 5ICYA 1XGUA 3EJJX 4O2EA 3IPEA 5CCHE 3ZKND 5LXGL 5A2FA 4HDIB 3US9A 2CJSA 4JZNB 1YECH 4Z7WF 3BRFA 5BZWB 2NQCA 4NKMB 1XCTA 3HMXL 4FI8A 4HEPG 3LB6C 1KGIA 2WN3A 5BVPL 4WUUE 4ANUA 3MI6A 2DBLH 2JKNA 1LO2L 3OAYK 3MRFA 3KXFD 2ADIB 3BP5A 3MLYL 2WBXA 3OKDA 1GMEA 4ERSL 1DJSA 2DTML 1MFCH 2JKJA 5J3HC 3UPCA 4P2QE 4JDEA 2OQJB 4HWZA 4IGBB 1EAPB 3TJHC 4Z3TA 1HZKA 1B2YA 4F58H 5AVZB 2IF7A 4BRVA 1TVHA 1H3GA 4Y5XA 5ITFB 1O9VA 3U0PB 4YEEA 4AZ8B 5B1JC 2QQNL 4UNTA 1NLBH 3RYMA 2BRRH 5KWYC 4APXA 4DT2A 3V79C 1A7OL 2HCZX 1F1AA 4QXTA 1E5YA 1KACB 2PLTA 2PW2A 4X6CF 1UQSA 2YSTA 3CFKB 4OT1H 4I18C 4MRBA 3B7TA 2H2PD 4NQTA 5CJOL 1CGWA 1B4JL 1Z5YD 2NY2D 5DTFB 3WIFB 4U05A 5DTFA 3U9UA 3D0AA 3EFDL 3EGXA 4ZTOL 5L2KE 1HQRA 3MLUH 4HCGA 4AG4H 2B08A 2X3CA 2WXLA 5EOTA 1JYWA 1BLNA 2X44D 3FSWA 4ZW6A 3L7EA 4Q6IB 4E0RB 5ESAB 2PPAA 2VDML 1GGBL 1QO3A 2E27L 2EIZB 3D3VA 4Y2DC 5LN8A 2PP8A 3L13A 4FQ2L 4L4VE 2OZNA 4G1EA 4UAOC 2ICEA 2WSKA 2FJSA 4G5AA 1WSST 2AQSA 1PFCA 4J3OC 1ZK5A 2FB4L 3VRLE 4LLVB 4IBVA 2H1PH 3WI9A 1VADB 2HPOA 3F7YB 3CFEA 4S1SH 4R5VA 5EO9A 1U8JB 1W80A 4F7CA 3JT2A 4F8QA 3L81A 2EH7H 3V9EA 2YD0A 1CGTA 4XCEA 3LNDA 1IKFH 2J88H 4ZYKB 5E1IA 4BK4A 4QRPB 4XP4H 3CHSA 1M3JA 2A7BA 1BYPA 4PJFB 3PGCB 1USQA 1DO5A 1XGQA 5JXEA 1AR1D 1P6FA 2AV1B 5D9SB 4QRSA 4MAUH 2AQ2A 5ICYB 4XMPL 1WVZA 4KKCD 3RWGA 3VFWB 4MJ2A 3RIFK 1CDUA 4L9LC 3VXOB 1BVNP 2NSMA 2XX0A 1Z9NA 4HWUA 4IS6A 2LHAA 4H0LC 3U36A 3HZVA 4ICWA 2ZX8A 4QTHB 4UZGA 1BJ8A 1ERNA 4GRMB 3SBPA 3FDWA 1G9MC 3OWEA 2PCYA 2W0PA 2KERA 4IIQA 3TCTA 4Z3IA 3BWSA 1Y1UA 4YXHH 4DO4A 4OM1H 1OARL 4ANXA 3QIBB 3UDWC 4Y5VA 1OSEA 3WFBH 3LRKA 3GK8L 2NY5C 1HHHB 2XWJB 4PJAA 3MCKA 5B8CA 3ZXAC 4JBSA 1UD3A 2IAAC 4FJZA 1A3RL 4JO1H 4NJ9L 1LO0L 4R7DA 4WWKC 1OSPL 4MHHG 3VYNA 1N8ZB 5C0NC 1T66C 3LH2H 2VITB 4U1IB 3OHXB 2W0FB 4Y4HB 5I8OH 1VGEH 1HTYA 4FJ6A 2XJLA 1MRFH 1EZSA 4ZOEA 3SE3A 2NTFA 5MENE 3ULSA 3CN0A 3LXBA 4F8NA 1YYMH 2XBDA 3VTMA 4HJTA 1G6RH 5E1QA 3ETBF 3S36L 5B4MC 1B3IA 3IVKB 2BFVH 2WQRA 1FDLL 5FV2A 1E4XL 2PXYA 2ZUYA 3OSVA 4JL1A 1RUQL 4H8QA 4KHXL 2ATPB 4OM0H 1OK8A 4DESA 3IJEA 4IHOB 3ARBB 4IHOA 4GXUM 2V4LA 4QRPE 1MJ8H 4N0FB 4JFXB 2BO0A 4ZSOB 5GGVH 4BHUA 4ELKA 1XF2A 4N0FA 4XPHH 3VSVA 5IJVA 1E30A 1GC1H 1SHMA 3HPJA 1R5IA 3LNIA 3FSVA 3NFSH 2E4TA 4EXKA 3D18A 3FHQA 2GUOA 3Q1EA 1I75A 3NCCB 2XWTB 4WLCA 3BH9A 1NIFA 3WJMB 1KIQA 4Q9QL 3KLHD 2BSRA 4H1LG 1BWWA 1YEDB 3QYNA 1NMAH 4XX5A 4MA7H 5I30L 1AQKH 3NZHL 3VG0L 1MCWW 4G8EA 3M45A 4FQQB 3JZ7A 2VLJE 3BWZA 2YRLA 4GXUN 1Q72H 4CADA 3HMXH 1KXHA 5F7NC 3B9KA 3A3YB 3FU5A 2Y5QA 3UP6A 4DGWC 1F18A 4YK4B 5C7XL 4UTAL 1PVHA 2W38A 3MR9A 3MX0B 2BIMA 4N0CD 5SWQA 2IBBA 2VDNB 3FO1A 3DX8A 4EIBA 5HBBA 4JFQA 1MY5A 1TTRA 4JPIA 5HY9A 5I0YA 3C2SA 2DLFH 1M42A 3M1OA 3FQNB 4IGBC 4W9IC 1V54B 2L7EA 4ZOAA 3V5HA 5KN5A 5JXEC 5DCCA 4K8RH 2CXKA 1F1DA 4D94A 3DBXB 4PWHA 1A5FH 1YN7A 2EXYD 1TYJA 3NCFB 4UM9D 5T3ZD 4FTVE 1OAQL 1SJXA 3IGAB 3LN4A 4JY4B 2X9WA 3F5WB 3NDYE 5B38A 1NCIA 2VDQL 3NH7L 3D1MC 3RWDA 2ZKHL 3ZUCA 2ED8A 2FIKA 1GYVA 3MNMA 4F3FB 3LY6A 3AU1B 4XZ4A 3CPUA 1XH3B 1PY9A 4K23H 1Q0YL 1YEKH 3ARFA 5BJTA 3Q6GL 5JIKA 2K8QA 2A4CA 4MMZB 3ZPDA 3RVTC 3Q13A 2R39A 4XTRC 5HDQL 3RFZB 4D0CA 4OCSL 1ZMYA 2VMJA 1KLUB 3E8UL 3Q8CA 3S8FB 1P4IL 1XEDA 4XBMA 4J6IA 3Q48A 4U1HB 1OPGL 1FL3B 1HQ4A 1EQWA 4G9FE 4P4KD 1M05A 4A2LA 2VDMH 3EO0B 1ZTXL 3CG8A 4ADGA 5KS9F 1BVLA 2X89D 5C3IA 5T33L 4WFFD 5GGSA 2ZUTA 4D9LL 2G75B 3MGTB 2NR6A 5GGRB 1E2VA 4LLWA 2QVFB 4JFXA 1A7PH 3QPKA 1EH9A 3U25A 1OSZA 4NKOB 3MUY1 4MNGA 1GOGA 3PJNA 4PI0A 4PLJD 4ODWB 5KAQF 2EH7L 3NIFF 3ZZLA 4NGHH 1WPCA 3UMTA 2BOLA 3Q1SL 2WKGA 2UZIL 5TDPB 5AB1A 2PXYC 1ID5I 2A1WL 3G08B 1LILA 1FPTL 3SY6A 3G08A 3H54A 2HT3C 1D5XA 4H1LA 2YZ8A 3L1FA 1DJWA 1SHSA 3B2VL 1C9SA 1T6BX 3POCA 3DX3A 1F97A 4NHCH 4J8RB 4HZLB 4WSJA 1NCBL 2O61B 3MNDA 3CSPA 3ULUE 1SHWA 3E6FB 2N0MA 2K45A 3WEAA 2R4SL 4J6RL 1NFDF 1D7DA 3QI9D 1D5BB 3E0GA 3VI4B 1U8KA 3LZFL 3U83A 1UA6L 2YSSB 2ZSWB 3FUJA 1EXUA 5DS2A 2NNRA 4O2CA 3LZOA 4Q0XH 4AQAB 2AVGA 3CNKA 5EU5A 4W1TA 3PABB 3K4AA 5HGGS 1P53A 3FOLA 1H0DA 3M17B 5DJXA 4RBPH 3TA4D 2VNCA 3DVNB 1CTOA 1OAZL 2D7PA 2EADA 1KCRH 4NQSB 1XO8A 2YKLH 2EXYC 2NTSP 4PRHE 2H6PB 5B22A 2JIXA 1VB9A 3VFGL 4KKCC 4EUPA 4IIQC 4LLQB 2Y72A 4HIXL 5I8KH 3FW6A 5AAWA 4H8WL 4FTVD 2GUYA 1D9KB 5DJ6B 2YQ2A 1W9XA 1JMXA 1P5VB 1H3XA 2O6PA 1H6UA 1MRFL 4PREB 1CFTB 4L8BA 5EOCJ 1UOVA 3T77A 4BA8A 4JFOB 1R47A 4WI4A 1A7NL 5ADPH 3H3PL 5AW4B 3SZKC 2NUTB 4OCXH 1OB1B 3RVXC 2EH8H 1DHKA 1YVLA 5DGQA 4UQ2B 2AJYL 4PGCA 1W16A 3DKHA 2Y07H 5GGRA 4DP6X 1JXJA 2XY1A 3TA3C 2EQDA 4WWKA 4E9WA 4KQ0A 1QBLL 1NCDH 1FL3A 4Y4FD 4YVUA 4NYLA 4BWUA 3ES6B 2BSTB 1ILUA 5HHQB 2VLKA 5J57B 3KDPB 1DUZB 2CNYA 3SY0A 3O4LA 3Q8EA 5C09D 5D1ZB 2Z7WA 3ZX1A 4J1UA 2G5UA 1N7ML 1NLDL 2XV0A 1JHTA 2Q76B 4LK4A 5ACZB 2DYPA 3QR0A 1X7TA 3PWPD 4XPHL 3VAEA 3ARFC 3O4OB 3WXWL 2QMKA 1C08B 1AGBB 1QZNA 2J12B 3D39D 2RACA 1IUZA 1GY2A 1HHKA 4QRRA 5EO0B 1Q38A 2J6EA 4PY7B 4CN4A 3B8SA 1N6UA 4KY1H 4LIQE 3BEWB 3Q06A 1JZDC 4Z8FH 4DP4X 4GRLC 1ZK9A 1Z1WA 4TRPH 2VISB 1HINL 4X9IA 1LM8V 1U95B 3FL7A 4RCAA 5F7BA 3I3DA 2NY1C 4QT5A 4ZFFB 4AC2A 4QT5B 1NEZG 1IGJB 2Y36H 2F68X 3VI4F 5I1GH 2JQMA 4KXZH 5D70H 5GGRY 4Y5YB 4LSPH 1FF5A 4RIRB 2WXMA 5DVPA 5HGHA 3F2LA 5I76B 1MFEH 5FO2A 3KBEA 2Q5BA 4M4RA 5I19L 4KK8D 4HUWA 4AIZA 5D6CB 4KKZA 5EU6A 4AKOA 1IGFL 2LTQB 1WFIA 1BSIA 1MRDH 2DWSA 4M43L 3S37H 5IROD 2GSGB 5FKPB 4EVNB 4CJ1A 4K8RL 1K8DA 4HJIA 3G5XA 4I18B 1U41A 3TH3T 3WKML 1U58B 2NY0D 3NG5A 4TULH 1U58A 3FBKA 1EWHA 5DT1L 2EYSA 2J44A 4WFEE 3EOBA 4JFTA 5AAMA 3EOBB 2JJSA 5J9PB 5E03A 5AB9A 4KV5E 4KXZI 2ILLA 3RGVD 4JJHA 1SXBA 5KG9B 1E8XA 3MMEB 4NQUA 5TGBA 4PW9A 4WGKA 2WBJC 4FXKC 3Q6GH 2XN0A 2OMUB 2OSYA 4YXKH 2J6EL 5HDWA 5INCA 4PJ6A 3AJ7A 2IAMA 3FTGB 4AVHA 3BAEH 3E8UH 2XWRA 1P7KA 4Q97A 4NOFA 5H94B 2CA3A 2R9HC 3L3HA 2DN7A 3HMXA 5CJBA 5CMAA 5DMIH 4BK5A 2YO3A 5E1AA 4BKTC 1OF2A 2H8PB 2IH9A 4PRDA 3A6OA 5CR1A 1U8CB 1YLBB 3O6LL 3Q2VA 3QR2A 3K2UH 4Z7NE 1NMCC 4ONHA 3FT2B 1LD9B 5IQNA 2VDLB 4Q9CA 4U1KB 5IUSA 4JKPL 3FHEA 2VISA 4XMUA 1WRFA 4UB0L 3VXUA 4MAYD 1HYRC 2ESVA 5BZZA 1V7MH 2CKBA 4GQ9H 3MRKA 3R8BB 3V9CA 1IM3D 1U4EA 4OZHA 1AR1B 2ODHA 4N87A 2WZPA 3AQXA 4G6ML 3T71A 2JJVA 4NUJB 3AS3A 3FU0A 1DANT 1V05A 2OK0L 4YDNA 4B95C 5SWSA 1VACB 3EGDB 3TEWA 3APDA 4KX9A 4YSPA 2LLGA 4NHCL 5FS5A 4L2YA 3ARWA 4JM4H 4Z95L 2NOYA 4XBGB 2QKIA 1PD1A 4LSVH 3WCYA 1KDJA 3VI3A 5FYLD 1B90A 2EINB 4HYTB 5I75C 2PNDA 1BVKB 1YEGH 4JREC 5HYQB 3AG3B 5JHDA 1IU1A 3VFPA 3VXRA 2VMFA 4P4RB 4MCYB 4PRBA 5AOMA 4ABVA 4YS4A 3E6HB 4TV3A 2WTPA 5SX4H 2O6EA 2B4CC 1RD6A 1G7QB 3WJLC 4F33A 4GUQA 1J1XL 4PCTA 5BRPA 2R59A 3CFTA 3HBGA 3HMWH 5EDXA 1WEJH 2WNGA 1KB9J 1QSVA 1MIEH 1KCRL 1OHZA 5EA0H 2HT3D 3COOA 3UJIH 1OWRM 3WAKA 4FADA 3DIVA 3I9PA 3OKOA 1HX0A 1IX2A 1CR9H 4R8WH 5AVTB 2Q9OA 2ZNWA 4AY0A 5EIVA 3JV6B 3IEAA 5CN2A 5DR5L 3PFQA 1KJ2B 3FUFA 3QUKA 5C0RL 3KPQB 3QAZB 2P80A 2JLPA 3EG9B 3LVTA 2P5ED 4M6MH 1F56A 5DHEA 2EH8L 2OA9A 3PV6A 3WY1A 2YXFA 3MFFA 4TLKA 3SDDD 5B7EA 4ZMOA 3GTVA 3WE6B 3FT2A 3WEBA 1A8ZA 5C08E 1FV1B 5DMJB 5L88L 2WTRB 2GVYA 1MXDA 4L9LA 3JVFC 2A99A 3GXNA 4OH2A 3SCMD 4RFNC 2BP8B 3T4YA 4U3SA 3WD5L 1XX9C 2I9LB 2H8PA 4NEHB 1PZ5B 2VLRE 1RZJC 4HALA 4HZLA 4NZUL 5ICXB 4FI7A 4FQLH 1OGAD 3ASWA 4L4VA 1TQTA 2ADGA 4QHLA 1NL0L 3CCHA 4JFYA 2EDJA 1EEYA 4ZODA 1WAAF 1ZSDA 2PWHA 4RAUA 4Z7QF 4WHTB 1T1XB 4EIZC 4KZDL 2DOCA 4KUZL 4PP2B 2AI0L 4XCYA 1N0LA 4KY1L 1DZ0A 4K9JA 5TPWH 2WQVA 3SEPA 3CLEL 3ZO9A 5FF6A 5I15L 3C8KB 3TBTB 2EE2A 2V17H 1S9KC 5C9JB 3ZYIA 3GT6A 3OMIB 4XNAA 5E9DA 4X5XB 4FOMA 5HP5A 3Q01A 4Q9RL 2P44B 3KWWA 2DH3A 5AD0B 2JIXB 5EC1A 3N44B 3G04A 1M7IA 3HNVL 2AKRA 1JTOA 2J20A 1MFEL 1DQJB 1V5JA 5FW6A 2J1WA 5GHWH 2CDGA 1FNEB 2IIJA 1G6RA 3QIUB 4XCNB 5CINH 4ZFQA 2XZQL 2VSCA 2CLVA 5KYYB 3OKOB 2B77A 4FQJL 3ZTEA 3C6LA 3THMH 1T6VN 4CMHC 4FQ1H 5IQ7L 3GGWA 4ZFGH 5DHXB 2PW1A 2A0LC 3ECVA 4ZUSA 1D7BA 2V9QA 3K5RA 4ZS6D 4EDWL 4J3OF 3K91A 5JPNB 3L7EB 3BT2H 1N6QL 2IWKA 5DC2A 3HI6H 3KHOA 1IAIH 2OR8A 5I1KH 2NNFA 5IT2H 4BIKA 4YIQB 5T1DH 1QPPA 2NY0B 5FM4A 4BM7A 1JGDA 5IHZB 2FHCA 2I9LA 4MKMA 4M8UA 5KSAC 5HJ3A 4F93B 2V33A 3MYJA 2J21A 4M03A 2O5NA 4RA3A 3S8GB 1S7TB 2P8LA 5IMLB 4K94L 4DCQB 3BRDA 1UT2A 5AYQA 1UOWA 3EUDA 4QIRA 4WWPA 3REWA 1I7UB 3VFVB 3QFJD 3BJ91 3SDXB 2X4QB 4MZ3A 3L4YA 2VYRE 1ITBB 1M4KA 4LCIH 2FRGP 3VXNB 1MCDA 1W0WB 4OCNC 4Z0BL 1DFBH 4ZOBA 4ZTPH 2G4GA 3R18A 5L4JA 4AEHH 2W95A 4JPVH 3SKJH 3IFPA 1XD0A 5IESH 2WBKA 4TSAL 3W57A 2E47A 5EEVA 2Z1PA 3VWJD 4F7PA 3PWUA 1L7IL 3MJ6A 1WFUA 4ZO6A 4OU3A 2Q6WA 2P5WD 4C4BA 2E7LA 5AVUB 4H44C 2F19L 4NKMA 3WG7B 3G04B 3Q8FA 4I9XA 3TBTA 4L4JA 3E3QE 3ZO0A 3K8LA 3LHPH 1GGTA 1AHWA 3LMJL 2ESVD 4YSSA 4KVPA 1YNLH 5D7IB 4AH2A 1O6VA 2WXKA 5I71B 1ASPA 3JWNC 5JPMB 1IAII 3ZRCC 1G4MA 5I6XB 3RL2B 2BOCB 4PYHA 4XVTH 4U3XA 3MLWL 3IT8D 4QI3A 1TVBA 3RIAF 1A1MA 4MMXB 3WNMA 1DBAL 2O5YL 3UOAB 4XBEH 2X6AA 3ENEA 4ELDA 5KVDH 1GPOL 1A4AA 3H0TA 3WFHA 3ETTA 4NRXB 1YYCA 2WP3T 3DHMA 3HZYA 2SEBA 2AK1L 2VITA 3MRPB 3QDJB 1ZRUA 4LCVA 4QHNB 5F7EH 4DPRA 5FFGA 3S9DB 5DFVC 1NCHA 1WEJL 2OMXB 5EUKB 1A6PA 4HS3B 1FE8H 3C12A 3U1SH 3A6BL 3ZTNL 3PAVA 3NCJL 2XQ0A 4XWGH 3BFWA 2DQJH 1PKQE 5EOTB 3VD3A 5I1HH 5C0BD 5F3BB 2V9TA 1P69B 3S2CA 4C58B 1SDYA 5CP7A 4S0SD 1QEWA 1YYLH 1T89C 5C0AA 6FABL 2F53B 3P11L 4X6CB 4AKQA 3NJMA 5TQ2L 5IHZA 2P47B 4Y7MA 4QLWA 15C8H 1NEZA 4CVWA 3RIKA 1R19A 4G43A 1GXEA 1VGKB 4N2FA 3FPXA 1GMIA 2FEJA 2E9GA 1EDYA 5IROA 4U3CA 1S7SB 1YEIL 2ZP0T 4NBXB 1YEHL 3O8XB 2C3GA 2V9RA 3I02A 4OGAD 4M1CC 3HG1E 3T2LA 3ZDZF 1F58H 3NUKA 1BF2A 3QDAA 5DWUH 4WTQA 4XOBA 4JUSA 3NJKA 5I0XA 5GGUB 3LPFA 5I1DA 4HF5H 2D31B 4CU7A 2QJDA 3QWQB 2D31A 4ADJA 4Z7WB 4YHYC 1EAPA 3QEGH 4GEJA 5JDSA 4OKVA 4KK5D 4OF8A 1XCTB 4PV8A 1A7RL 5C3LD 2E86A 4ELME 1FH5H 1U3HC 5I15H 4HBCH 3W82A 3BVNA 1OALA 3SODB 2NXYC 4MMYA 1JPEA 1Q94B 1JV5B 3HAEB 4N0CC 4BFOA 3PGDA 2P46B 3IAQA 3KPSB 1PIGA 2EKSB 4MLSA 4HIJB 4IBLT 1NFAA 1I3GL 4IOFC 1IKNA 4TNEA 2DM2A 5JMOC 2G3ZA 3S4SG 2F7PA 5IREA 1J9SA 1OP9A 1JPFA 2DMGA 3PWPA 4H8UA 4ODTH 1BFOA 1TMCB 2DYPD 1XF4A 4OZ4B 1QMUA 1FBIL 4Q4IA 3RWIB 5FKAA 4HSCX 3R0NA 5D5ME 2DQGH 2VZ3A 2XZQH 4GKSB 4L29A 3WMSA 1A3LH 1SRDA 3QIUC 5A2AA 3HB3D 4LEOA 1BLNB 1KB5B 4HFUL 4ZQTA 1DVFA 1BQLL 1T4KB 3OAUL 4B9IA 3JYBA 1T4KA 1ZPUA 1T0MA 2Q7NA 3DGDA 3F65A 1SQMA 4UQ3A 5C1MB 1KYOK 4NZDA 4AT6B 1HWGB 1N0XH 2IC2A 1FV1A 2IDUA 2B7DT 2OMXA 2K1MA 3O4OC 4BZYA 12E8H 1WBXB 3VMPA 4YAQB 2GCYB 2OJ1A 3GEFA 3OG6B 4LDOB 4B96A 3BSGA 3PDOB 3IWVA 2X05A 4DERA 3QDME 3AUWB 2IQ9H 3HI6L 5GS0L 4PJIA 3S4SA 1IAIL 3ZW3A 3KPRB 3SJVA 3MKGA 1J9TA 3B7YA 2FJFB 2Z65C 4GRLA 4X6BB 1IZKA 2X2YA 4OTXH 4WU7B 4B9GA 2GI7A 4F57L 4CDHA 3PGCA 4WK2B 5D2LF 5E6IC 3LRGA 1M05B 3CFMA 3D50A 3KVDD 3S96B 4X5WA 1DEEB 3VXTB 2A0LD 4CC0A 1H3TA 4G7YL 4H20L 4PIBA 2EDWA 3GS0A 3MRHB 2H3KA 1A6WL 4O58L 4F2FA 1MI5D 3KWWB 1GGCH 1AH1A 1UXSA 3TWYA 4EI6A 5EUOB 1NSNH 1DO6A 5TF1L 4EBQL 1YMMB 1FNEA 3QIUA 3PPEA 2BVQB 1YNTA 2Y7MA 3SKNA 4H5SA 4M56A 4XPAL 3D4CA 3K72A 1ZKAA 1JRHL 4MB3A 5D7SL 5IM7B 1KYDA 3SYPA 3VWKC 3BAXA 5CBEB 3LMJH 4TKWA 4LF3A 3WTTA 1H6TA 1CYWA 2VMCA 4YL9A 3VXSD 2VDNL 3FOLB 2R1XA 3KJ6L 1HZLA 4R7LA 2VAAA 4JR9H 1JCKA 4LPCA 4JRXA 3MLWH 4U6XA 4G6KH 5F7AA 3KWVA 5HXMA 2RGSA 4GG8B 2EDKA 4ONOA 3GDBA 1T7YA 4QF1A 2BNUA 5GRJL 4OFIA 1JK9A 2BOBB 2ZIDA 3AACA 1WUZA 4NO3A 2H32A 4AW4A 3LN4B 4JY4A 4TQEH 4Z7VE 4PBDA 5L6YL 5LUMA 2ZOUA 1FFTB 4ODUA 4X7CC 2I85A 1SVZA 4RMRA 4PU2A 5IVXA 1KFAL 1SVBA 2EE3A 2HX7A 4LMQI 1E4JA 3Q05A 1PTZA 1A4JB 1D5ZA 5CIPA 5L9DL 1IL1A 3BFQG 4XWGL 1MWAB 3ESMA 4MNQB 3U6RA 2ZXGA 4RNRB 4CSZA 5I1HL 3CN1A 1UWGH 4PJ9C 1PG7H 4GO8A 5IJVB 4A6YA 3T4AB 2BRRL 3NIGF 2AJVL 2HFGL 4GOSA 2P24B 3EYOB 5ICUA 2NY4D 3RX8A 3DURA 2K4WA 4L37B 4J1UB 1RUPH 4X6BA 4XI5D 1KPUA 3GMPB 5I18L 2EDHA 3FONB 4NQEE 3GMPA 2A73B 4UNIA 2L7QA 4N5EC 5EBLB 5C0IB 2BMKB 4H26B 4GS7C 4YHZL 1F11B 4G9DB 1ACZA 4WFGE 1LGVA 4HWZB 2VN3A 3MLUL 4IGBA 3AQYA 1IGML 1RK1B 1TUPA 2CE6A 3ELQA 3UABA 4K55A 3JUYA 4JDTL 4LEEA 25C8H 3I2CH 4JO3H 1J1OL 1PGRB 1ULVA 4HF5L 4V1DA 1NCOA 3FMGL 4IEFA 4YBQC 2C9QA 1Y6KR 3QORB 4FQ2H 4O2FB 3CVHH 3W81A 3ULVC 2H6OA 4L4TA 1FVCA 5EEUA 4TSCL 4Y5YA 4LXFA 2FBRA 4DP5X 2PPEA 5KYWB 1SFDA 2H1PL 5I76A 3KS0J 4KVNL 3VXPA 1HS6A 3DX7A 4ZD3H 4OLEA 1N5YL 3GKWL 5CSZB 3WIFA 4FXLA 4NKIL 1S46A 1BZEA 5KYUB 4ATWA 5ITBH 3F7VA 3QQXA 3IN0A 2ZP9A 1E5ZA 1YN6B 1T03L 3FB7A 4I7ZC 3VNYA 3LZRA 1BZ8A 3Q8BA 1DQLL 4RGOH 5AVYB 1I9IL 1ASOA 3MV7A 3R4RA 1T21A 5T1KA 1GW0A 3O0RL 3TA3B 5MI0B 5TE4H 4GW4B 1RY7B 4GBXB 1CO1A 4ZUVA 3QDGE 4MCZA 1L5GB 1Z5LA 2XN9D 4P2RD 4ETYA 1CL7L 2Y1ZA 1BVLB 4KWUA 1U8PA 5AL8A 4F92B 3IKKA 2A83A 3AREA 3NPZB 4NAMA 2C9VA 3TPKA 1U8HB 4LCYA 2ED6A 5DZPA 1INDH 1J8RA 5BUGA 3FONA 5DMKB 2XRAL 5EIIA 1KJVB 5GS0H 5DMKA 1C12B 1IQDA 1U6AL 1PG7X 3AS2A 3N43B 1ORSA 4PMFA 3LKPB 3V6OE 1K9TA 1Q9WA 3QCTL 3EYOA 1Q9WB 4RMTA 4UZUA 3WU1A 4MGXA 2OSWA 1G7HB 3LH2L 4XXWC 4EQ2A 2NLJB 4QHUB 3ARDB 1WAEA 1A9EA 1WF5A 2H3XC 3KWUA 3LPOA 2IPTL 3EIFA 3V52L 5C08A 3SB3A 4HMEA 5D6DA 1EHAA 3STBA 5FAAA 2GJPA 1PAMA 2HJKB 4LZKA 4MYWB 4JFHD 4PH8A 1QSEA 2APSA 5DD6A 1BX2A 1IB5A 4FMKA 4PIRF 2P5WB 3DHPA 5K59F 3S0PA 5TF1H 5I5RA 4XPFH 4YNYA 3TCXA 1VZHA 4OCLC 1DFXA 3QORA 3E1ZA 3NFNB 3KWTA 4L3EA 3NFNA 4RVBA 1HN1A 1MIML 4WI0B 1DZBA 2QR0A 3TT1L 3HG3A 2IBZX 4WFHE 2X4UA 5D7SH 4HKBA 3X3FL 3CMOH 2DLHA 3W3BA 4IOIB 2E75C 1V3KA 2VCOA 1RVFL 2CDEA 5EZOH 4JFDD 5DJ8A 4WSGA 1SMOA 1QRNB 4JR9L 4PBXA 1AE6L 3QC5X 2WKOA 4FG2A 1NMAL 3F7KA 3WKPA 1KMGA 4LVHB 2WP3O 4QXWA 3PP3H 2H1LM 1K3ZA 4M7LT 1OGAE 2QQLL 2GJZA 2EICA 4F7EA 4UQ2A 2WCPA 3WTVA 3WUWG 1MSPA 3QEQB 5ANMA 4CC4A 2NZIA 2WKOF 5HJDA 4GFTB 4M93B 4Z7WE 3QUZB 2CUAA 1QD0A 3ZGIA 1KJVA 5DJ2B 3RL1B 3QXWA 4EQ3A 5TGBB 5HHQA 1U91B 3IF1A 3PWJA 3IF1B 1S78D 3GXTA 3HTLX 3UTOA 3K4DA 4QAWA 2Q7AA 5DUJA 1G9NL 4K7PL 2P5EE 4I77H 4K7PX 5C0JA 1JV2B 3TZVA 2VT0A 4WSKA 5DEZA 2Q7YB 4ZW3A 4FFZL 1SXNA 4PB0H 5LVEA 3MV9B 3NH7H 4FYSA 4LFHG 4NP9A 1LE9A 1NFDE 2HRLA 3LKSA 3U7WL 1E4WL 1RKRA 1XV8A 4Z23A 4TVPE 5DD6B 1LO4H 4K23L 4N24A 3OGCA 1T1XA 3UTSE 4FLRA 1U93A 3AREC 1UHVA 3SDXF 3UTPE 4NX0A 1LDSA 5GZOD 4WTXA 2EIEA 3BEWA 4EI5C 1AZBA 3C60C 3K6DA 1P4IH 5SV3A 5FB8B 5KN5B 4JO3L 2QLVB 2B4CH 2J8UB 1HH9B 4YGVB 3UAEA 1NJ9B 4MXVE 4YNYB 2X6VA 1PKOA 1ND0B 2B3RA 1IBYA 5KSVA 1A7QH 3EOAA 4M6OH 3GRWA 2BC4A 5JLZB 4HHAB 3JV4A 2X1QA 2BSEA 1RIVH 3C6SA 4ZD3L 2QSTA 3H4FA 1JMZA 5JHLH 2CDGB 1CE6A 4XCNA 2DLGA 3RURA 3UZQB 3WO3B 3QHZL 3D3VE 5T1LB 2CLVB 1P5UA 3EJZC 3FCTA 2ZCHH 1Q1PA 1G1KA 1T2XA 3C6LB 4WI5A 1VZGA 1HI6A 2EYSB 4NGHL 1QBML 3ZIMA 4RFOH 5AD0A 1AY1L 2VDPH 2CRYA 1EMTL 3S5YA 5J9PA 1E4KC 1KLUA 2PCXA 1AKJA 3BQUC 3UH8A 5E2TL 3CWGA 3K80A 1FPTH 3HIZA 1EVTC 1K8DB 4PLJC 4UNVA 2PN5A 2GC4C 2F8VA 3UG5A 2XFXA 5J4MA 1J8HD 3A24A 2UY7A 1YEWA 4NUMA 4JK0D 2WVVB 1NGPH 2QTVA 1QSZA 3TN0D 4YHMH 1CL7I 4XN8A 4JHVA 4EN2A 2F18A 3D85B 3KE0A 4HD5A 1RZIA 2K70A 1NAML 1FG2B 3CK0H 1A47A 2HMID 4QUOA 3V5DB 4FULA 2J2ZA 2WLIB 4IMLA 5F6HJ 2FL5A 5KYXA 4KKPA 4Q0XL 2IH3A 4YFLF 5ABZA 2BVPB 2HWZL 4G1MA 3W9DB 3QWOA 1PD6A 2KHAA 5IMMA 1AGFB 1EJOH 5BRZB 3AT0A 4LCWE 3PQYA 3ATEA 2XRAH 3CXDH 4HUMB 3HZKB 1CXIA 1JF1A 1OAZH 2IALA 1OL0A 2X4QA 2EVJA 3T4YB 2CZNA 2DYSB 3HR5A 3VFGH 1CLOL 3MV9A 3CHOA 5FGBA 4WI7A 2ADFH 1RUKL 2AFNA 3MRIA 1S7TA 2ZYHA 4YLBA 3QZNA 4BFIA 5K9KB 2NY6C 3WL9A 1X3DA 4F5CE 2DMBA 2RFXA 3R06A 2BVTA 1CFNB 3QR1A 1VDGA 5HYJE 3GMRA 3BGFC 5E5UB 1O7VA 2X6UA 4OCXL 4Z3HA 4HAGA 1HCZA 2K7QA 5DDHB 3FU7B 3BP7B 3I6GA 2X70A 1E2WA 3UBXB 2LU7A 4JM0A 2Y0SA 3LKOB 2VXTH 3EJTA 5IW6B 1TO4A 4F2EA 1EHXA 2B2XL 5IF0B 4ZFOA 3F3HA 1ZHLA 3TYGH 4CMHB 2DQDH 5D7IA 4KV5F 3NSXA 3PFUA 1O6SB 4PRBB 1VAHA 2X9YA 5HHXH 1R3LB 2OFQA 3BVXA 2VXVH 4JUTA 5EN3A 4F33B 2MTAA 1N6VA 1UKSA 3MLSL 1CF8H 2LABA 1D9KA 3B2MA 3O2DA 4IRSB 4XP1H 4AKPA 4ODHH 5DJZA 4DP0X 4BSVA 5JORA 4U1GB 5HHOD 1IGIH 1RVFH 1SHXA 3QNYB 3VFPB 5E4IA 3RE0A 4FZ8H 3BCDA 1DL7L 3AREB 2YEZB 1LNUA 2G5BB 2LU4A 3LS4H 4WUUB 5T1JA 2EKJA 1OGAB 2MNUA 3AQZA 1GCFA 1JWUB 1QLEB 4LIQH 1XGRB 2C8NA 3T2NH 2OYLA 1FYTE 3TOPA 5F2FA 2R0ZL 2FATH 1XB6A 4PW4A 4DKEL 4LSPL 1FNGA 3L3KA 4K5PA 1R0AH 5KVGE 3ZE0E 1OSYA 3TYFB 1NGYA 1X5ZA 2EDMA 3P9LB 3ROOA 1MZYA 2OMWA 3H9HB 4WIQA 1I9RL 4HFWA 4PGBB 4KZEH 2F1BA 4OCYH 3W1ZA 3KD4A 4HWEH 1N26A 4NZTH 3NEEA 5L7XL 1MRDL 1U2HA 4M43H 3T3MF 4Y4KD 2JB6A 3NMEA 2BVPA 5KJ4A 3SDAD 3T0XA 1NA8A 3A4AA 1AKJD 5F7FA 3IJYB 4OQTH 4AYID 3OX8A 5KYNA 2ZCZA 2F53A 3WYRA 2RFXB 2DQFA 3R06B 1U95A 1WIOA 3RFRA 2BP8A 3L3DA 5D7JC 4C54A 1P4LA 5JR1H 4ZW7A 5E5RB 3U7WH 4QTFA 3HAEH 4GKLA 1WCQA 1G1YA 1U8NA 1KN4L 2ED7A 4K3EL 4JHUA 4E41A 4BFIB 5K9KA 3P4LA 4HEMA 1B9ZA 2E7HA 1N9PA 5EF2A 4HK3N 3AG1B 4YXKL 1F2XK 3VI3E 1SUJA 2XN9E 4P2RE 5JPMC 1W72L 4NQDD 4XN4A 5KUKA 3N1QC 4DEPB 2DV6A 4NI6A 5A6MA 1TJIL 1X6LA 1XF1A 1A6ZB 4N0UB 1KULA 3OR6B 3STZB 4TNFA 3G5XB 4I18A 1BZDA 3L5IA 1W8NA 1ACCA 2GKIA 4WWNA 5T5FL 3ZSSA 4F8PA 5KS9E 2OMYA 4U0RB 1UT9A 2R9HD 3O3EB 3O6LH 4IS6B 5D7LA 2YEZA 4WUUA 3QEQA 4KDTC 4J2XA 1GR7A 2AKRB 3UC0L 5C0CD 1RAMA 3RY4A 5JHLL 3HNTH 2OX5B 5DJ2A 4P5TD 3VD0A 3NABL 3DWTA 4NCDA 1TTUA 2HKHH 2FECI 2ZCHL 1BLIA 3F7QA 4OCRH 1QNIA 5E2WH 3GJEA 4R26H 3J8F7 5D7LE 3QCVL 5FA4A 2BPBA 3HB3C 5AYUL 1TCRA 5FYLL 4O02L 5F7YC 4ZUTA 3VCLB 1WTGT 5HDBE 3V0WH 1F8TH 1EFXA 1VFAB 2Q20A 1BXAA 1JGDB 4R4BB 1NGPL 3ARGA 3GSOA 3ZL4L 1BQRA 2I25N 4CVXB 3SPJA 1VFUA 4MX7B 2XG4A 2C9XA 2IV8A 4Y4HA 4OCWL 1LE5B 5FW7A 1KNOB 4N25A 3L17A 4P4KC 5L4FA 1QG3A 3RJQB 1QWHA 2FTAA 3SDXA 3IJ8A 2B1HH 1L9PA 4HC1L 5CN3A 3V4VA 3LDBC 1YEEL 2UZYB 4GI8A 1ZTMA 2ZAGA 4W68A 1OANA 3FT4A 1S7RA 3KDMB 2F6AA 4NIKB 5BW7C 1KYAA 1R5WA 2BVOA 4JFDA 2ZXCA 3HMWL 1K4CA 4JKNA 1JNJA 1T1WA 4FQXA 1VFBA 2ZYIA 4R96A 1YY9C 5FEBA 1FN4A 1TJMA 2B59B 3TZVC 4YEFA 2WXPA 4B7LA 4D0BA 3ABZA 4YSRA 1X7SA 1ZA3A 2WXNA 2BJML 1OB0A 1E50A 4LASH 2ADFL 4OLZL 5D7JD 1L7TL 1RUKH 1V8HA 3MJGX 4YR6B 2XJKA 2AGJH 4RETB 1HHJB 1HE8A 3QJTB 1YMMA 3I50H 4N28A 3BP6A 2WIIA 4NQEB 3U4AA 4HDIA 5DRWA 5H4YA 4L2LA 1RSYA 3FKUS 1PNCA 4P4RA 3JWOL 4FYTA 3QUYA 1FAIH 4NZRL 4PJ5E 4P3CL 4NLHA 2VR8A 2XBZA 4HP5A 1HSBA 3O11A 1MW2A 2FHFA 4JW3A 1S7UA 5BS0A 2ORBL 1WHOA 3HAEA 2E56A 4P48A 1KLFB 1HH6B 2R29A 2X4NB 2X9ZA 2WV3A 4W9ZA 5DSCB 4JQIA 3BRGC 3AROA 5FOBA 4K15A 1BZQK 3H7BA 3D39E 4UQ9A 2YKKA 3OPZL 4AOFA 3KLQA 5DD0L 4NO0B 4LT7A 4XZUA 3IU3B 2D0GA 2W59A 2WK2A 4LCUA 4XP9H 2R23A 4ODHL 2BSBA 3CZEA 1GAFL 1NM4A 1JP5A 4A2DA 4BE6A 1WTLA 3TESA 4FZ8L 5JDJA 4PJCB 3H7LA 4IU2A 4KTDH 2C9AA 1PLBA 1MFBH 2AMUA 5BZDB 2H9GB 5DEGB 4Y0GA 5EB9A 1VCAA 2YLKA 2P52A 2X4SB 3O6MH 4KFZC 1V55B 5DVNA 3NPSC 4AT6A 4I5BA 4I0KA 3IMBA 1AFVH 1JF1B 3L6FB 3BPNC 1NMBL 3H85A 5B38B 3HR5B 4GO9A 4AUJA 3GBLA 4UWQB 1UUSA 5AAWC 4AVJA 2P48B 4G43B 1NIBA 2P8PA 1CFMA 4L4VB 4CW1A 4PJFF 1EJFA 3P3SA 4H8VA 2Y69B 2FR4B 2J56A 1H8OA 2DMCA 2YQBA 1I9RH 5T1KD 4ZG1A 5ICZB 5AOJA 2PKDA 2Z8SA 5DO2C 5HHOA 3V4UL 1MVUA 4W6XB 4J39A 5L7XH 3GMRB 4S2SA 3NCBB 2MPVA 5HYSB 3BEVB 4FQ1L 3EJUA 3KLAA 4XC1L 3UAJC 3QUGA 5MEND 3M8OL 3MRQB 3MOAL 1I1CA 3EO0A 1QW9A 5HDBB 4C83B 2H5UA 4F2MA 4L9DA 2R4RL 1J10A 2NYKA 1NC2B 1E7UA 3HE6C 3AB0C 5INDA 2WLNA 3L3IB 2APTA 4PV8B 5DZLA 2GUOB 2JKLA 5FA3B 5HHVL 4QRPA 3BH9B 5EC1B 5FA3A 3NDZE 5CCKL 4FHJA 2Q3AA 5AEAA 2DEWX 1ZVSA 5CZVH 3WFEH 3AITA 1QHQA 4RFEB 3WEXA 1X5MA 3MGAA 5I1DB 5T1DL 3O6FB 4XODA 2HN7A 5LBSH 4O4YL 4JHBA 2ZTBA 5C0FA 1USZA 2JSFA 2I7OA 2JI1A 2EO9A 5LBGA 1T3FA 2VXUL 4UT9A 1S7VB 4LVEA 4K94H 3MV9D 4FFWD 1E28B 1ZA6A 5FECB 1PZ2A 5D7IF 2YBRB 2ADJB 5FM8A 3QO1A 4GUCA 3ARGD 2PMZA 4Q7DA 1KB5A 1CI5A 3TH4T 2L7UA 4Z0BH 2IG2L 5GZNA 1LTXA 1YY8A 2BNQA 3IPBA 4U1MA 4M1DH 4ZAKA 3EYQD 4HGWA 4AEHL 3V95A 1SJMA 3SKJL 5CJQL 4XAWL 3VDAA 5FKAB 1I1AB 3CSBA 5CLXA 1ADQL 1DR9A 1IAOA 4XMWA 1T04A 1YUKB 4KVCL 3STLB 4X6DE 4R26L 2Y5TB 3QJVB 1DVTA 2OMVB 2VWEC 2H9GA 5DS8A 2MFNA 3OHXA 3JQOB 4D9RD 2ROXA 2FEEL 4P2QB 3QEQD 1F8TL 4KDWA 3PDDA 3WUWB 1WIUA 4OR1A 1IZJA 1IGCH 1L9SA 3MRDA 5E0FA 3ZL4H 4LPYA 2BVUA 3Q0HA 4WEMB 3X17A 4I1RA 4MA3B 1DN0A 4P5SA 4HK3J 2J8HA 4XMKL 3KPSE 4YOKA 2VDLL 3OC5A 5FUOH 4DN3H 3NRPA 3TV8A 5LNDA 4QYOA 3HPJB 1BM7A 3ZHLA 1OW0A 5CD5D 4GG6A 3TNMB 2BVYA 2B14A 2E6PA 1FFPA 1AGEB 3U4KA 1J86A 2VKWA 3ZUNC 5E24E 2YJQA 1OB1A 1GPOH 5D8JH 2Q8BL 5F96L 5K9JH 1UFGA 4QRAA 4X4ME 3ZL2A 4JRXD 1I8LC 4WWKB 5FCSH 2DM3A 4M7LL 4UYQA 1OSZB 4NKOA 5EWIH 4HT1H 3T0ED 1DEEA 1F11A 3VXTA 3JVGA 4F9LA 3V0FA 3D6GA 2YMOA 3NCJH 2IEPA 1NQBA 1VLXA 3P4MB 2VR9A 3RDJA 3VXRE 4AXWA 3S48A 3TONA 4OLZH 1JPST 4RA0C 1L7TH 5IIEB 3S5LB 1RMFL 5JHDE 4XP6H 2W60A 1ZVSB 5CEYA 4D9QE 2R0KH 32C2A 2F1AA 1BPLB 4LVNB 2IBZY 4AVKA 4N5UA 2WBJA 4MB1A 4NQXB 5TQ2H 4M8RA 4OZGF 3B6SA 1CT8A 2FGZA 3OR7B 15C8L 2QR0B 4WO0A 2R1XB 1OE2A 1SJHB 1UZ6F 3HC0A 5TK4A 5DJCB 2ATAA 1P7QD 2EJ1A 3FFDB 3DXAE 3L9BA 4X7EC 5E1HB 1TO5A 3MLRL 3CVHB 1IAOB 3HBZA 2R2CA 3EDKA 2AXFA 4J3TA 1F58L 4C47A 4Y8DC 2AEPH 3TZVD 3HS8A 3P2TA 1OM9A 1MAKA 1MFUA 2J1YA 5DD0H 2WQWA 3S3PA 4CVXA 1JGUL 4F9PA 2QPUA 2KZWA 3EO9L 4Q6IA 3WBDA 3GJFK 4LHUG 4GRLD 4X98A 3MRLB 1Q90A 2QVMA 4PJ7A 4ZZKA 1I1AA 3D12B 3MRLA 5I1AB 3WUWA 4U2ZA 3KBPA 3BGMA 8FABB 4MVBC 2GIXA 4AYEC 4QGYA 5DI8B 4Y2LA 5IFAH 1ZTXE 5I17A 1JNNH 1XEUA 3RGVB 1A2YA 4W81A 1FLRL 1LO3L 3QUXC 4NNYB 3W11D 5K9QI 5ID0B 1RJZA 5G4OA 3V5KA 2FQGA 4LCWB 4LO9A 5I0ZA 2A9CA 2IBGA 5IB3A 4WI2A 1JG9A 3B5GA 4HCRL 4PRID 5F9DC 1I3GH 1TVDA 2NY1B 3AXHA 2XVBA 4AZUA 2QFPA 3DROB 3IS1X 3RUGE 3WN5C 4APQC 4YC2B 1FWXA 3A6CL 1E5BA 4V2CB 3BVUA 3MBEC 1TQCB 5D4IA 1XAUA 2BIPA 1DUZA 4Z7WA 1WCBA 4XHJD 2XG5A 3VD2A 4AXWB 4EN3C 2UY6B 4N3TA 3WMPA 1QX1A 1UD8A 4XBPA 3S3BB 3M8OH 5F0MB 1U21A 1G6VK 4I2XA 1TQBB 5D1QB 3AW5A 3QORD 3PQYE 3AY4A 4FQXC 5DXWA 4GJTB 2E7MA 1LP9B 2X4TB 3GSNA 3P77B 1BAFH 3BUBA 3O9WD 4N8UA 4R90L 4N0YL 3E6FA 2RJMA 2A9BA 2IQ9L 4LHUB 3TV3H 1EGJH 4X83A 4LKXA 4AQZA 3ALXA 2YPLD 1HILB 5EIIG 5CCJA 1QUNA 1U93B 4KOCA 3GF8A 4UF7C 5KYUA 2X4PA 1HL4A 2IANA 5AW0B 4BE5A 1SN0A 4F57H 4IRJA 3NIDF 1SN2A 4NBZB 2OM5A 3NIDB 2DWEB 1KEGH 2ZCKL 3DTUB 4ONFL 3VRIB 3FFDA 3D2UB 1X5XA 1VACA 4DAGH 5ES4B 2XBTA 4EPSA 4I5BB 3ATBA 4KJQD 1BECA 2MJWA 2YSSA 2ZSWA 4DP1X 4Z6AT 3ARYA