4J5VA

Crystal structure of p19 in complex with double-helical rna 19mer p(cag)3c(ccg)3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 38
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2013-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j5vA01
4JGNA 4KQ0A 4JNXA 4J5VA 1RPUA 4KTGA 4JK0D 4KNQA 1R9FA 4J39A
chains in the Genus database with same CATH superfamily
3SDCD 3OAUL 1OCZB 4K8RL 1T21B 3TH2T 1KYOK 4PJ9C 3RFZC 1OOAA 1DZBA 1U8QB 5E51A 1PKOA 2C5DC 3IFOA 1PZ5B 4L37B 4LLMB 1P7KB 4W9JC 4DFIA 4GG6F 3LZNA 5L4IA 1U8NA 2BC4B 3L13A 1FNEB 1II4E 3VSUA 1NMBL 3ATDA 1ECYA 1UKQA 6FABH 3REWB 4OFYA 3R06A 4EIGB 4X4YA 5F3BA 5DA4A 4Y5VC 2V5RA 2WXGA 1A7NL 4A7GF 2JIXB 4JAMA 1A7OL 4UM8A 2DKSA 3NH7L 2ADJB 1G7MB 2YXFA 4Y5YA 1L9NA 2BIMA 4M1GL 2AXWA 2ALWA 1NDGA 1Q9LB 1IGYB 4RAUB 3KAAA 1C08A 4ZW3A 3QEGL 2YUVA 3Q8FA 2EIEA 4H20L 1HN1A 2VSMB 2R1XB 2CUHA 4LK4A 5E1AA 4S1QL 3RTQC 3VXSD 3NZ8A 1KY6A 1RJLB 4TVPD 3LN9A 4OIBA 1D5IL 5DYOA 1A6WL 1CXHA 1UT9A 1ZY9A 4IBQA 5AWNH 1SOXA 4E9YA 2FIRT 4JO4H 3ZX1A 4X5PA 2UWEE 3K5RA 3QHFH 3UYPB 2ALAA 3V0EA 4MQXD 3P4MB 4AT6B 2R2HB 3O2DA 4TVUA 4LCWE 1AGFB 1JPSH 2NY4D 1N6UA 5HPMB 5H35A 1EVUA 5L2KA 1L9PA 1A66A 1AHWB 1L0YA 2E86A 4MYWB 3GBNH 4OF3A 2ENYA 1E9OA 4G80A 3LKSB 1VB9A 3NP3A 2G3XA 4XXCA 3IFNH 3MLVL 2B0SH 3PWJB 5DZLA 5IROA 2ATPA 4AEHH 4XRCB 1H8OA 2WM0A 4CJ1A 1NCHA 1G7LA 4WO0A 5AVRB 1F4YL 1SHMA 3O6LH 3OX8A 4IBUA 3GKWH 3ZTNH 4YSCA 3IS0X 3VXME 2N7BA 1AKJB 2VXSL 3QZWA 5C0IB 4Z6AT 4PS8A 2XTJB 4DERA 3RVTD 1J18A 3KLKA 1BZQK 2D4FA 2YK1H 1CFQB 3SYPA 3MJ8A 4L1SA 4GMSH 2CLVB 4DN4L 3GO1H 4QRTB 2VDKL 1YN6A 1U3YA 4CMHB 2Y7NA 3KLAB 1SQMA 3GKZA 2NTFA 4DPRA 1VSCA 5F7EL 4HCFA 1BM7A 1NMAL 3EYQD 1OPGH 4MMYB 3VMNA 3FCBA 4MHHI 1I1YA 1UXWA 2B4CC 4LT7A 4A7UA 1FCCA 4HIHA 5IBUG 1AGDB 2CGZA 2VL5A 1WD9A 4UNTA 2CRZA 2WLLB 1IEAA 3BAIA 4NDMB 5EZOL 4ZUUA 4L9LB 1C8PA 3VFMB 3EJZD 1T21A 1OE3A 1KGYE 4JFYA 2OQJB 5IQ7H 3FHQA 1DN0B 1SN2A 4HIPA 4LCCB 4FABH 3VXQB 3IGFA 1J87A 3EJYD 3N9GH 5C0EB 2B20A 2D31A 1T7XA 2ICWJ 3CHRA 4XMLH 1S46A 4PLOB 3T0BA 1XGUB 3UZVB 1A2YA 1JPTH 3D1MC 4GIAA 4ONGH 4YDKL 1X7SA 3DK2A 4YFLF 2WLIB 2ZWYA 3JVGC 1DQQA 2KDYA 5E2TH 3LS5H 3V5KB 1F45A 1A9BB 1QRNA 1UM4H 4G5AA 3MV8D 3VFPA 3KEDA 3QNZB 2VN6A 3O6FD 3D3VE 3MLYL 1CF8L 3BFWA 4PS4L 3S3PA 1JAEA 5SX5H 4WU5B 2X4TB 1YYCA 5DQDL 5KYWB 4FXKC 2CWRA 4BHUI 3G6DH 3GSOA 3OMIB 4K8RC 2IAMB 1MFEL 3IU3A 1MFAH 1DCLA 4EDXA 4P2OB 5I74C 3MOBL 3ULVH 1WFMA 3F58L 3VFUA 2QQNH 4WHYG 1DZ0A 1I8KA 1QSED 5T3ZL 2ADGA 4R4FL 3DPBA 2G60L 3FQXA 3ATAA 3LNFA 4Y2DB 2Z1KA 4G7QB 4ZT1A 4K7FB 2CBOA 3Q01A 1INEH 3LHPL 3B9AA 1MWAL 3BKML 5KWYC 5TD4A 2D3JA 3K4AA 3MMEA 2M83A 2YPLA 1FH2A 1PX8A 4MWFB 1S7RA 1Y0LA 3DV6B 3QFJA 4GW4A 2HKAA 1U8PA 4PJEF 4AZ8B 1ORQB 4FLQA 1ETJA 4N8VA 1NZRA 2XV0A 3ARDC 1UZ8A 1KEGH 3GT6A 3L8QA 2H6PA 3EJCA 2X12A 2E27H 5JOFB 3CZFB 4H2CA 2F54A 3F84A 4AGOA 3RX7A 4RLDA 4F7TB 4IBVA 4X9BA 1AS6A 2ZXWB 1TXKA 2C9XA 3EG9A 2VITB 4H8HA 3PHOA 3ARVA 1VZIA 1ZLVK 5FR3A 3D4ZA 3ZSTA 1KJ3L 1VACB 2FECI 4FFYA 3ZLQC 2DL9A 2FB4L 2Q6WB 3VU2A 3HG3A 1FG2B 2VDQH 1ZA6A 2QFRA 3FCSB 3LNHA 4JFDB 4LESA 5EUKB 3REVA 3ZT6A 2I26N 3TTSA 2H3XC 2IDCA 4S11A 5C6TL 3FQ4A 3ZDYB 1KXQE 1Q1JH 4ONHB 4W9IC 3ZE0E 2BIPA 5FYLE 2ZUWA 3LRLA 2HRHA 3LEVH 1CI3M 1TZIB 3G08B 5D5MA 4DEPC 1R47A 3MNVA 2EXYC 5GSVA 4LLMA 2O6PA 5IGXL 5CGYD 3TVMC 1IGJB 1AZRA 2VXQA 1S7RB 1Y0LB 1MCFA 3FFCA 3VA2C 5BRZE 3KZ8A 4MVBD 5HGHA 1NFKA 4RMWA 3H1ZA 3P0YH 3FO0L 1DQJA 1UOKA 4JHAL 3UTZB 3W9DA 3HG1D 1IC4L 1KBWA 5IEHA 3NZSA 2BFVH 3EOAA 4V1DD 1H3XA 1XAUA 2RA1A 3R7RA 4DCQB 3S8FB 2Y72A 4WK0B 3NIFF 4RH4A 5L88L 1YMHA 1KIPB 3LQMA 5EOCL 2WQWA 1XX9C 1F5WA 4NENA 3UYOD 2HJLA 2C9SA 5BUPA 2FX9L 5FKAA 4R6UA 1RHHB 4N0UB 5CZRA 3RVVC 4BSJA 3PWNA 4TV3A 4L4JA 3E6FA 1TTBA 2F53A 2X5PA 5CJXC 3VUAA 5GRYA 3X11A 3OZ9H 4HJJH 3RBSA 2ISDA 3EFOB 1WBXA 4JY6B 1BV8A 4MVBC 4ZO6A 1JHLL 1I7RB 2NSQA 2Q3ZA 4PJ6A 5HHXH 1KJVA 1U91A 2BNUA 3IU4H 1OT2A 2KYIA 5ITBH 2A0LD 3ZIMA 1I3VA 2NY4C 2VLKB 3ZMRA 3A21A 2F15A 2WNKA 4DFHA 3GSNB 2A9MH 4YPGB 2VR8A 3ILQC 1XCWA 3CBRA 2NQ3A 1HHIB 4NO0D 4QXGL 4W4NA 2UXTA 3O4OB 2GJZB 4PRIB 2I5YH 1XBDA 4DNLA 4HG4K 3OB0H 1EZSA 1J1OH 2IPTH 5C7XH 3RNQA 1MG2C 4ABVA 1TZGH 2AK4D 1WQVT 1SVZA 3LSOB 4HHAA 2DJSA 4M7LH 5DUBA 3K4ZA 4UQBA 1JHTB 1OGTA 2OL3A 2VJ0A 4PSPA 5EZLA 1PAMA 4QHKJ 3FU9A 3ORJA 5AW3B 5KN5A 3L6FB 2IDFA 5J06A 2CG9X 4QHPA 2GK2A 2DICA 2Z7YA 1A6AB 4RDBA 3RTQB 1EXGA 1VGEL 2R2EA 3EXLA 2CIIA 4APXB 4IK7A 4Q7DA 4B50A 3AQZA 4IRJC 2ZUVA 2IQAA 1WBXB 2FR4A 1C8QA 4I85A 2CA4A 3MJ9L 1K3ZA 3GRGA 3RUGA 2IWFA 1JGLL 1L7TL 2WJ7A 2Q76B 3HS9A 4PRHD 3W0WB 5IB2B 2YJQA 1BEXA 4H4NA 2Q8BH 1XQ4A 1TR7A 1TYJA 5GGRY 2UZPA 5DFTA 3HFFA 4EE2A 3WIIH 1TJGH 5JOPD 4IBSA 4WUUA 4MJIB 5IVZB 2E46A 1LK2A 3RG1C 5I2IA 4Q2ZA 1KCWA 2XWRA 2WQVA 4JVWA 5EU5A 1T03L 5IK3B 1GPOL 5IJDC 5GISL 2HN7B 4NUGL 4H2AA 3VQ2C 2CO1A 4GXVH 3ZL4L 3BQUB 2EC9T 1ZSDB 3K2MC 3ESOA 2GAZA 5T1LD 2A77H 1E8YA 3GRWL 3LNDA 4MNGB 1EJFA 1N3NA 4HKJA 4FKHA 4JZOA 5F88A 4MASA 3FTVA 4NN7B 3CC1A 3T2OA 4BZ1H 2XWDA 3AT8A 4OTXH 4AE0A 4M7LL 1TQBB 2AP2A 2OM5A 1FZKB 2GC4C 2Z35A 3FH7A 1JGVH 3ZKMD 2BSED 5JW3L 3SZKC 5IFHL 4UDTA 1ID2A 5ISZA 5TE4L 2J8UA 3V6OC 2J6EL 1KLUA 5DWPA 2XKUA 4UT6H 4O9HL 4G8GD 1YUKB 5MERB 3HBZA 2W38A 4NRZB 3KPSD 2L7QA 2BXYA 3QUMA 1KTDB 3VQ1C 1X5KA 2X1PA 3PFUA 5FS5A 4X2UA 3UTSA 3BLBA 1YJDL 2GFBB 4HWBL 5IJCC 4YL4A 3TNMA 2ZOTA 3VXMD 3IAPA 3RBGA 4AQ8A 1JZ2A 2EVIA 1AKJA 1MWAA 3EOYG 4Y1AE 1J9TA 5HYSA 4NJAH 3PHQB 1NEZB 5GGRA 2AI0L 1TJIL 2DYRB 4JUSA 1Y18B 4HKJB 4F7PB 3H9HA 3GXIA 5JDJA 2LTQC 3ARDD 2IPKA 2D4DA 4K3DH 4KDTA 3RURA 2AANA 1DVSA 1G4RA 2EH8L 4ZAKB 5F1KC 2LVCA 2O5XH 1CLYL 3EO1A 5CXPA 3SQRA 1BF2A 1Q4NX 4JY4A 3GS4A 1T1XA 3T77B 1I8MA 1AD0B 4U49A 5H94A 3LN4A 3HG5A 5DJAA 1IC4H 3EYOB 3AMLA 2YQ2A 4OF7A 3TWYA 2R4RH 3U0TB 1PS3A 3BKYL 1Y6KR 1TMQA 5LDUA 2LHAA 1QTYT 2HMIC 1RUML 1A8ZA 4X5WB 1Q9WA 1ED3A 4JRYD 2ARJB 5GGVL 3S4SB 3UZEA 5TFSL 4B5ZA 5J6GB 7TAAA 5EOQH 2Q2EB 5J12B 1WBYB 2MFNA 4X9IA 1J5OL 5E5UB 4BH8A 1L0QA 2WZPA 4Z8FL 4G2AA 1P1ZA 3IMVA 4LEBA 1DYZA 2ZYSA 4PJXE 1P2CA 3NEXA 2ORBH 1JGUL 2QQKL 2P5EA 2VDOB 5GGQL 4XP9H 1Z3GL 3Q0HA 3RTQA 4NJ9L 3VGGA 3LAFA 3VFTA 3A67H 2Z92A 1TQCB 4PJBB 4XO9A 1PZ3A 2XKSA 4TUJA 1NBZA 3H6JA 1KEML 2OAAA 4JFQA 5HGDA 2FO8A 2DJMA 1GZHA 3U9PL 5D96C 4R2GD 5D2NC 3KGSA 1BQRA 3POHA 4AGLA 4ABQA 3NJJA 3W1ZA 3VB9A 3BVTA 5J6HA 1XF2A 3WMSA 2LAAA 1FO0B 4QJ5B 3LNEA 1BXXA 4YDJB 2X6CA 4AEFA 4JJ5A 4MJ6B 3SDAA 2YBRB 2CJUL 3REVB 1XXDC 2X4UA 3WEAA 4CVXB 3A67L 5CBAB 2A6DA 1K4DA 1MWAH 1EH9A 1KYFA 2BHZA 4QTFA 5GGQH 4AWJC 3QXTA 1OLZA 2Y23A 4NM8H 3STLB 3KDMB 2GUOB 5CSBA 4ZXBC 2ROYA 5HY9B 4Z3FA 3QJHA 4DKFH 1WA0X 3KLHC 3FQ1A 3G5WA 5KVFL 2R9HD 1THAA 3OJDA 2IMNA 3BVUA 1AI1L 3FUHA 5DQ9B 3GMNB 3ZJAA 1IAIH 1ZDQA 2FX7H 4I77L 2NXYC 3QYCA 1G9NH 2IH1A 1GZHC 3QA3B 1CFTB 3FT9A 3KPOA 2DMCA 4ZO7A 3CHOA 2FDBP 4PWHA 3KD4A 3KR3H 4PJFE 3T6QC 1KIPA 3C6LD 1N0LB 2E6QA 2R4RL 3SO5A 5HYQB 4Z3HA 3LRSA 2LVEA 1Z9OA 2BVEA 2NY3D 2ZF8A 4WHTB 2ZOOA 4L3EE 3CJJA 1YNKL 2VE6A 2WANA 2WLHA 5F7DA 5BV7L 4F7CA 1X9RA 3ZKXC 1G6RL 4OFDA 2EH8H 1G7JB 3QAQA 1O9VA 1RZIA 3VXNA 2DDQL 3QRFM 4K3DL 1TJIH 3OKDB 1AGCB 4AX3A 5IQ7L 4JQVC 4XVUC 1J8HD 5FYJD 1U8JA 3KXFD 3BVNB 3ILEA 3KM1A 2Y2TA 1YJDC 3OJMB 3KBEA 4M8QB 2MWCA 2KC0A 3ALWA 3Q2NA 1MH5B 2GTWB 4J23A 4G1EA 1MCQA 4BFIB 2XG5B 3SPVA 5BRZB 5ISZE 1F6LL 4KUZH 5SWZE 5I16A 1FA4A 1GHFL 3D39E 3IJSB 5DXWA 1CFQA 2DQJL 5DC4B 1WAEA 3DOHA 2WNWA 4IGBC 5I8CB 3RE0A 1SXSA 4O9HH 4XMZA 3TLRA 4PGBB 4DN4H 3CFKB 5KN5B 3STBA 2XN1A 2Z9TA 1OD7A 3D25A 3EBGA 5L4JA 1DANT 3EADA 4Z3EA 1NDTA 5E99H 2KL6A 3BPOB 4XNZB 5FM4A 2C7FA 2BP3A 3QJFB 4ZODA 2VDML 4AYSA 4OTXL 3BSZH 4HIHB 4FS0A 4MMZB 3SE4C 1H0DA 3CAFA 3DSNB 1GS6X 2XG4B 4YFLI 4XMTA 3FQXB 4XI5C 2OS7A 3HG0A 2GTZA 4XO3A 2CJTA 4C56D 1UD6A 1IJNA 2VM4A 2BOCA 4FF9A 1S5HB 2OX5A 2Q0ZX 3MLVH 4PGEA 1DE4B 3IFNL 5C0BA 1FNHA 1JWUA 4NUGH 5GISH 3CDFA 2VZ1A 3FSVA 3BZ5A 1GJUA 1F13A 4QRUA 2GTWA 4KQ0A 4P0DA 1P4IH 4AQ1C 1VPOH 3BZ4A 4KK6C 1W0WA 4L8SC 5EIIG 1AYOA 3V4PA 4JZJC 1TJGL 4N9GA 2WVVB 3BHBA 4M3KB 3ZTCC 1J05A 1SN0A 4V11A 4ZUVA 1MI5B 1NBYB 1DQML 2NPLX 4GKOA 1XMEB 1RULH 3GJEA 4JRFA 2DS4A 3U1PA 5C2UB 4EO5A 2NYZA 2UY6B 3DI2B 4P49A 4TUOA 4LIQH 2ID5A 3UERA 2YN3A 5CUSH 4B60A 4A2EA 3GK8L 2FVNA 3IFLL 4MMZA 1F3DH 3AS1A 4GQRA 5DJYA 5BZXA 5LHDA 3FQWA 4G7RB 43C9A 1KLGB 4LKCA 4XP4H 4NI3A 3JVFC 4HUUA 1RZJC 2E6PA 3DRTB 4AW7A 1DL7L 2YUZA 4AYID 3CFDB 1FP5A 1WFNA 3KWXA 4JFOB 6FABL 5J13B 4L3ED 2C3VA 5D1QD 1K72A 2OMUB 4I8DA 3MNDA 5C08E 1CE1L 3L3DA 3QRGL 5H37H 1NIAA 4W9KC 7FABH 4P2RB 5C7ZA 1NIDA 2I5YL 1XH3A 4P3CL 1H5BA 1H3TA 2QADC 4OW6A 3V8CA 3WKYA 4QXGH 1NGXA 4XPBL 1NCUA 1XIWD 1JDAA 1QRND 2L7JA 4K8RH 4KRNA 4B27A 1UURA 4YH6A 4L1TA 4E0RB 4DZBA 1TSHA 1UCBH 2IDUA 3K4DA 3WY1A 1SF5A 4B9FA 2R29H 3EG9B 5EMYA 4AQAB 2W9DL 4UMGA 3QT2A 5J13C 5EC1B 2K8QA 1R17A 1YEFH 12E8L 3BEWA 2OYMA 1BZ8A 4IBWA 4B3VA 2ZKHL 1IJ9A 1JHLH 3VXRA 1K8IB 3I6SA 2WOBA 1S9VB 3WY2A 5BV7C 4QHUB 2WB7A 4XX5A 2ZG2A 2DMBA 1JGDA 1KN2L 3KG5A 1BMWA 3T77A 2PTVA 4R8WL 2LAGB 1AGEB 4ETYA 1RK0B 4XC3H 3F05A 2IF7A 3G5YB 1ILUA 1JK8A 2WBJA 4LGPB 2O30A 2FQFA 4LHJB 2R83A 4O51A 1LDPL 2K1MA 2UX6A 4TN9A 3A4DA 4KTEH 2BFVL 1FQ9C 4YBQC 3VDCA 1H5BC 1U2HA 3SGJA 3SOTA 2FGZA 3FO0H 4GKZB 2R2HA 1WBYA 1WAAE 1KG0B 1ZA3B 2Q76A 3TNMB 3FFDA 3H3PL 1XGZA 3V4PL 1NFDB 4AY0A 4PGBA 2VC2L 3CVIL 2DLEA 3QCVL 4I9XA 1OTTC 4NWTH 4PP2B 3NEOA 5SX4I 3RUGE 1HXYB 3ZE2F 4FL4B 4G7YH 4WSGA 4AITA 1OALA 3V4PB 3V7MA 1Q1JL 1WFJA 3W9EA 1M1XA 1E4WH 2F61A 4HQQL 3M45A 2YA1A 4XMXA 1ORSA 4ZOBA 2WO3B 2ZP9A 3HI6L 1IAKB 4HCRA 4H7VA 1AOZA 2WGXA 3HVDA 2IDTA 5DC0A 5AVSB 1OAXL 2C9PA 3HAEG 3L5IA 3QORB 2AJYH 2VT0A 3H7BA 4MCYB 4WWID 1TTUA 3BWAA 3N1MC 3SY6A 2WINB 3RI5F 4LL1A 1DO5A 3MXWH 3OAZH 4X8CA 4IMLA 4IMKA 4MMZC 3MLRL 3VWKD 4GQPH 4K55A 5JZ7C 3BD5A 3JUZA 4MD0A 4ECNA 3L3GA 2BC4A 3Q5TA 3ETBF 1KEGL 1YMMA 3CN4A 3AQDA 5B1JA 3LH9A 1IM9A 4PJEE 2GJRA 4XNQB 3VNYA 4PS7A 4TULH 3KPRA 5KUKA 2F74B 5AAPA 5IK3A 3AREB 1FIGL 2XJLA 1NGPH 2FEEI 4LSTH 4N2OA 1WITA 3WNOA 1NCNA 3D39D 4LLVB 1QHPA 4GUQA 5IBTH 1S9YA 1H8LA 3S35L 5F93C 1FN4A 4G3YH 4FHBD 2DY2A 1HXKA 2IADA 4GMTL 2E4TA 4XN1A 3PABA 2WQUA 3GPEA 5F97E 1VFBA 5FUZH 3NPSC 4LPUA 2X6MA 2X0VA 1K6QL 3QXWA 1A25A 1W15A 5BS0B 2JXMA 5E8EA 3FUNA 4PWKA 3D3VA 2VLLB 4HUVA 4GG8A 1MFAL 3V0VA 3HBQA 1MFEH 5C0IA 1GC1H 1I85C 3MNZA 3RP1A 2FEJA 1WBZB 3F01A 2JE8A 5TJWK 3TFKD 4A63A 3H9ZA 3L95B 5B1AB 3T65A 1PBYA 4G8FB 5KUMA 5IEKA 4Z7WF 4H8WC 4HKXA 4YHOL 4H26B 3N42F 1UM4L 5KBPA 3L9RA 4OJCA 4ZAKA 4CN6A 4GOSA 1OAQL 2DEYX 2H0JA 2VRKA 1BD2E 2PF6A 1K5WA 2EKJA 3RPIA 1IZKA 1RUPH 4XNQA 4PJFF 4YFDB 5IP4A 4TTGA 3K6SB 2QPDB 5M95B 3DXAA 1BW8A 4N26A 5TE6H 4HETA 3ROOB 3SY0B 2EDWA 3N9GL 1HHGB 2CIKB 3ULVD 3BUQA 1E5CA 2CLRA 3NN8B 1V05A 3VFMA 1SDAB 4AG4H 3GC3A 43CAB 1JVKA 1BD2B 2BVPB 4QCIA 4J39A 1MQKL 4NZJA 4X7EC 4H40A 4NHUB 2FGWH 5AZ2L 1A6ZA 5HDLA 2JELH 3MGOA 3UGEA 1NLDH 2YPLD 2CBMA 3WFBL 1C7TA 1JG9A 2NTFB 3TYGH 2VXVH 4C8XA 1E3FA 3T0EE 2C4XA 1HZKA 1MW1A 1C12B 3MBWA 1JXKA 2J8UB 2VDKH 3UXFA 4LCWD 1LJMA 4XP1H 1SVCP 1MN4A 3BXNA 4K94C 4KO9A 1UUNA 2AV1B 2APWA 1T1YB 3O8XC 3Q2CA 4P46B 4OI9A 2DLIA 3LIZH 5J6HB 3ROLB 2J43A 5CHNA 2L0DA 5IQNA 4CAGA 4HJGB 5DJCA 1QBBA 4J12A 3KPSE 1L3WA 1QKZH 2J1YA 4WAFA 1ZHBA 3MUHL 3MROB 1F4YH 4MDIA 3S5YA 5K39A 2ARJQ 2MMXA 1EAPA 1HL8A 2BHFA 3FFOA 4QEGA 4ZQTA 2FHFA 1AS7A 1QRNE 1QHQA 3O45A 2UUDK 4BUGA 3H9HB 2IWKA 2VL4A 3X1GA 3IJ9A 2XC8A 4FQJH 2J5WA 1EHAA 3T3PF 3ZO0A 2QPSA 1IAKA 1WFOA 5GSVB 1J05B 1GS8A 2VAJA 1GIGH 4UV4L 4OIIH 1AD9A 1NC4A 2DM2A 3HNVH 1BIHA 5I0YA 4FG2A 5IROC 3QHFL 3S5LA 2P26A 5CINH 1GC1C 4KDTC 4FYTA 5BMFL 4O2CA 5I6XB 1A3LL 2KZ1B 3CVHA 3H2QA 4UT9H 2WYIA 2H2SD 1CGSH 3UBXI 3WV0A 2RJMA 2A38A 4Z1PA 1JYWA 5J9PB 2IAND 3KPPA 2XWCA 4DP4X 2APXA 3J8F7 4ODXB 4Z7OE 1I3GH 3STLA 4BWUA 3K5SA 3LVEA 2BMKA 4XVSL 2V7HB 2L04A 3KPRB 5F21B 4QRSA 3WELA 5DS2A 1C5DB 2VW7A 3SB3A 3MRMB 4YDVB 3CN0A 2PCFA 3EGDA 3PP3H 3Q6FB 2C3VB 4KK6D 2Q1EA 3W82A 1AKJD 1U95B 1O7DC 3CZUB 3NIGF 5FO8B 2HKFH 4N0FA 4ZUUB 5F96L 5F89B 3CZLA 3R06B 4X4YB 1KJ2B 3L17A 2CRMA 1UH3A 4FDWA 2WN2A 4L1LA 2FSEA 5D5MB 2YMXH 1DVYA 3VI3F 4UTCA 5CU5A 2DQIL 1I8UA 2SEBA 4PGDA 2DQHH 3SPVB 3US9A 3I84A 3FDWA 1GCFA 4JR9H 5LQBH 3DUUA 3T04D 3EDDA 3ZR6A 2ZUYA 3LH2H 3POCA 1CK0L 1I3RB 1FO0H 3KPNB 4P5MA 5K59F 5E7BA 3OAYH 3MGOB 4LLYB 4GLRH 5F7WC 3MA9H 3ZUCA 3MNWA 5TPWH 1KB9K 3QQ3A 1XCQA 3ZQWA 4Y2OA 1CS6A 1B4TA 3AY4A 3LYRA 4NC2B 2H2PD 4NS0A 3NPZB 5D1QA 2DW5A 2AMUA 4OJFL 2WXIA 1MPAL 2D7OA 1BFOA 3V7AE 3C5ZA 1JNNH 4OF5A 4Y1AB 4YHPB 4ZOEA 5FV2A 5CEZE 2K70A 3FUEA 1U93B 3JTBA 3M7OA 4G42A 4ZO9A 4AH2A 3L9BA 3EOBA 2EO7A 2GTZB 2MIZA 4XHJC 4OZ4B 5EOTA 5F0PB 4OLZH 4DP5X 3MRFA 4NPYA 4DETA 3FCGA 2BVQA 5AW4B 3K71B 1E8ZA 2F74A 1SFDA 5JLZB 2FLMA 1AQKL 4LU5L 1PGRB 1HWHB 1CLOL 4M43H 2HN7A 4Y5YC 5GIRA 5C09D 1KCVH 4G9FE 2UVEA 3N41F 1O0VA 3BZDA 1FAKT 1KBBA 1NICA 3AWGA 5IR1B 2GITA 4G6MH 4KXDA 4U0RC 3L2MA 5JUEH 1JK9A 3T08A 4IRSA 4G6JH 5SWQB 2F58H 3FB8A 1A64A 3SKNB 2QVFB 3PRZA 4F7MB 3AZUA 3LPGA 3AFLA 2BNRA 4OM0H 1G87A 3EZ8A 2AV1A 1JPEA 3QI9D 5BXFA 5ICYB 3QORD 4QRBA 3CHSA 4Z77A 1VACA 2I25N 3O11A 3JWNC 3Q5YA 2ZX6A 5GJSH 4OZIE 2Q5BA 1IGFL 3ARSA 5G4NA 1FLTX 2BX5A 1MREL 3L7FA 4FFZL 3UTTA 4YXHL 2VISB 4DKDC 3RNKB 2YN5A 3BZFA 2WP3T 2HRGA 4N0RA 5EC2A 1YQVL 4XPGH 5HD8D 3EXJA 2IH3B 5IFJA 4HWUA 3B5HA 1MSPA 1ZTXH 1YN7A 4IU2B 5HBBA 3PU7A 2F7PA 4ZX6A 1WICA 5G4OA 3TIDA 4M1CD 1NCTA 5HHVH 3KVDD 3U4EB 2XCMC 1GYVA 1IL1B 1ZLDA 2WQXA 4JPIA 1DBAL 4OGZA 1ZXKA 1JGEB 2QQLL 4YXLL 2NXZD 3JYCA 3LPWA 3UCRA 5JW5A 2R2BB 5LAXB 4B95C 4E68A 3I02B 2IDQA 5F0MB 5EV7A 3TBCA 1B6DA 4L4VB 1J0ZA 2BWDA 2Z91B 1YY8B 3SBWA 1MJ8H 3HS8A 1RSYA 4B9ZA 4L3AA 2YXVA 3U7YH 3AY2A 2UZIH 3O3UN 4WI0B 3N1PC 4WJ5A 1CDCA 5EO0A 4DUXA 3AABA 4JJOA 2ZUUA 3P4LA 4XXWA 3FMGH 1NWOA 1NAMH 3QZPA 4JFDE 3SE4A 3Q5OA 5AAWC 5IW1A 1NKGA 2VDOH 4JX0A 1EAQA 1U8OA 2PXYB 1ZT1B 5DJ6A 3EGXA 5CEXB 1I8MB 4J3OD 1HKFA 3NOIA 4J3SA 3GXNA 1OD9A 3VXRD 1OSPL 2QKIC 4FTVD 4ORZC 2GJ6A 5MEPB 5F9WB 1QSEE 3WIHL 2YD9A 3FRUB 5I17A 5K5YA 5SWSD 2A9NH 1ADWA 1HX0A 5TK4A 4AKPA 5I6LA 1A3RL 1F0LA 3OKMB 3FSOA 4L8SA 1J9CT 1NUDA 5DUPH 4GAYB 1JUFB 2XTJC 3KEHA 3V4VL 4PGJA 4H0IA 4PJCF 2AS5M 4DVRH 4Y2NA 2GSGA 4MS8D 4ZX3A 2PW1B 2E7LA 3QXVA 4DEPB 3FOMB 1VZHA 4J3OH 4YHIA 5AKRA 2BNQE 1B0IA 3IXTB 1CGTA 5CJOH 2Q2LA 3WNKA 4OFQA 5TDPA 4E41A 3NSYA 1MW3A 1RIUL 1L9SA 1T2QL 4ZAKD 2BSDA 4Y19E 1GMIA 4JDZA 3CMOH 4HIXH 1ZLSL 4AEIH 5A7EA 1ZA6B 3FCSA 4LOUC 1QMUA 1YUHA 5EUKA 3RY6C 4ISVB 4RRPG 2JKJA 4GT0A 5D93B 2V5YA 4LLAA 2VB5A 1NCDL 3ARUA 4NZRH 5D1QE 5FYJU 1KBGH 3LKPB 4PR5B 1H5BB 1LL1A 4FERA 4TVPH 1E43A 5EF1A 3QDJB 4IOSA 4Y4KC 1WT5A 4O00A 3B2VH 3TT1L 2UZXA 5EG6C 1Q0YL 4Y19B 2CIKA 3ZZLA 3BKJL 1IM3B 3KMDA 5IMMB 4HLZH 2IALA 5SV3A 1EXUB 5HYJB 2NNXA 2WC7A 2G5RA 1FH5H 4U0QB 1JK9B 2HT3D 4CSPA 4AL8L 3EJRA 1BLNA 5DMIH 1IQWH 3E6HB 3MMEB 3DTDA 1GYUA 1YMMD 4GBXB 2YWZA 1AXTL 1NCWL 2C1OA 1TLKA 1P2CB 4YHMH 2V17H 1DTUA 4LQ1A 3SDDC 3T3MB 1I9IL 5HHNB 4GAGL 4W9FC 2PWEA 3RY6A 3FBKA 5DJDA 3D39B 3SDXF 4X98A 3H3KA 3S96A 3S88H 3A6CH 4A2DA 2QV4A 1PD6A 3DLQR 3CUPA 1Q9KA 5DHDA 2P8PB 1WA1X 2Z31A 4N2CA 1HHHB 5KVEL 3R18A 2ESVE 1U3ZA 3UPRA 2DM4A 2V2TB 1LO0L 3O3DA 3QQDA 1X5MA 4JE0A 5E6IC 4BQ6A 1ZT7A 1J8RA 1KWKA 3AREC 3NA4A 2XN2A 4P05A 5F1IA 5LBSH 2G30A 1XL4A 3LIZA 4N85A 4NQDA 3P11L 3EF4A 2QKIA 3RUGF 3TO2B 4KDVA 3P40A 2W95A 4AMKH 2FBOJ 1A6TB 1FVEA 1NGXB 1PNDA 1N8ZB 4FKEA 4UM8B 3NJXA 3GGWB 1NSNH 5T33H 1U4EA 3KYOB 4RFOL 3HBGA 1FLRH 1IKFH 4KNQA 4GJTB 1YSOA 2XQ0A 3IDIB 2CHZA 3VXSE 4CC4A 2E5EA 4KY1H 1KTRL 4LEEA 1E8WA 4NYLB 3PS6A 1KC5H 1ROWA 3KCPA 4KO6A 1OB1A 2JH2A 1SDDA 1XR9A 2BCMA 1N5AB 3QIBD 3SBWC 1KV7A 2FD6H 2QSCL 1YNTF 4K8RD 1BA9A 1J0JA 5GRJL 1HYSD 5DRXB 2AJXL 4K94L 1GW6A 4DAGH 1YEKH 4JB9L 4YSPA 1SDYA 1SYSA 2J4WH 3PHAA 1IBYA 5M7QA 1S5IH 3GSXB 4WSKA 2FAUA 4YX2L 3U4BH 1EDHA 1TJXA 5DZPA 3VI4B 5FAAA 5MP6L 4S2SA 1Q9WB 1SLVA 4AV5A 1KCSH 3HUJA 5EBMA 4UB0H 2ICES 1REIA 2AJUH 43CAA 4U3SA 4NB7A 3ZE1E 1T5WA 1AGCA 4WJKB 3GSNH 3WO4B 2WZ6A 1X5ZA 2YLKA 1L4IA 1QSFD 3ILPB 1AG6A 1PDKA 4K5LA 1F02I 3B6SA 3QVAA 3J7HA 3HPJB 3SGEI 2R1WA 4P3WA 3HZVB 4WTQA 3UO1L 2DQEH 3WN5B 4S0SD 4ETQA 4Z3GA 4PY8I 3L4YA 1ZSDA 2XICA 1P6FA 5GZNA 1P7QB 4R97C 2Y5TB 1G5AA 4M1DH 5I8OH 3VXOA 4U6YA 1HSAA 1UWXK 2JB6B 3ZTDC 1I7ZB 3D52A 2CAKA 3OKYA 3WHE1 3K0YA 1BJ1J 2EXWC 4JQIH 3LSOA 4X6CF 5DUBB 2VQ4A 1KB9J 3VI3A 4P2YA 5FA3B 5GRXG 2G2RA 1YECH 2FT6A 1T89C 4W1TA 4DGUA 4Z7QF 1MIEH 1ZHNB 1Z9SA 2FWSA 5CHNB 1N4XL 2W1NA 1NDMA 2WZ0A 1HWWA 2YFNA 3B9EA 2F7QA 5ANME 3AMKA 4MNHA 5FC9A 3EGSA 2GG1A 4W6YB 3R4DA 1UA6L 4JY5H 2WXKA 5DD6A 4WKZB 32C2B 4LRIA 4X5XA 4X4ME 3ARQA 3QHZL 5EC2B 3LZRA 4KQ4L 3ZE2E 2YS4A 4BXVA 3QNXB 4TUKL 1AGBA 3PPSA 4KRMB 1T0PB 3VG9B 1AXSA 2JB5H 4LARL 3QNFA 2R51A 4WF7A 1Z0MA 4AL8C 3GZOA 1BIIA 1PKQE 1DVZA 1RP8A 3D85D 4W9HC 3P9WB 4BCYA 2OW7A 5C70A 3OPZL 2ENQA 3NFSL 1XF3B 4XO8A 4J8QA 5IKCB 4ZBJA 3UAAA 1ZGLB 4BD4A 3S37L 4EIZC 1IEBA 1XDTT 4ZFZB 1AY1H 5DHMC 3D09A 4NBXB 3S9DB 1JOIA 1QWNA 1J48A 4LDCA 2Z7UA 3HC0B 3AY4C 1RZJH 3BQUA 2IPUK 3LEXA 5IESH 1OGPA 2DEXX 3C5ZC 4ATWA 3O2WL 2L3BA 1I9RH 2CXKA 4LHUG 3ZO9A 1QEXA 1JK8B 3TPKA 1VFUA 1FYTA 4QO1A 4H26A 3BRFA 2ZP0T 3GIVA 5CP7B 4Q58C 2X4SB 2CDGB 1H3WM 2UUDH 1VA9A 2OYLA 2Z31C 3LNIA 2GCYB 4RMVA 1AHWC 1LK2B 3SGJC 1MNUH 1KPRB 5G55A 4GUPB 1A4JA 5IB4A 4HIJA 3UABA 5ID1A 3APMA 2JKIS 1OARH 1SMAA 5EO1B 4U1SB 3FT2B 3Q2WA 3QUMB 5DLMH 3TZVA 3M46A 4Y2DD 3D2TA 4GKZA 5B3NA 2R1XA 4QTIH 2IBBA 5BOPA 1HQRB 2I60L 4PSRA 3C75A 1KFAH 5GGTH 1DR9A 2R56H 3D2UB 1IGCH 2YUWA 3N1GC 2BSTB 1E4XH 5IQ9A 4H44C 2IAMD 5GXBB 2VN3A 4N2NA 3QARA 5D9SB 3NYKA 3TV3L 3MV8A 2W0PA 4PRPE 3K1DA 2RAMA 1L6PA 4B9IA 2A6IB 1FVDB 4X6DF 4Y7OC 1M6UA 3HZMA 1JV2B 3U36B 4FQIH 1UXWB 5T1LB 2A9AA 4ZNEE 5GGSB 1BZ9B 3BT2L 3V55A 4P5KA 3P54A 1T1YA 1LDSA 1TJHL 3STZB 3INUL 1LQBC 1NANI 4JS7A 4U31A 3RPIB 4AKQA 1LM8V 4GRLA 3QUXD 4P99A 1HIML 3CC5A 1U2CA 5MEPA 3TV3H 3A24A 3GLEA 3MLUL 4LSSL 3MLSL 4HWZA 4QF1B 5F1IB 3WE6A 3HZVA 4BCZA 5JHLA 5FW8A 5SWZB 1UM5H 4GSXA 5KJ7E 3DKHA 3V6OE 2O61A 5EORH 1JF1B 1IV8A 1M7UA 1WS8A 3FU0A 2BWIA 1CO1A 1CVRA 4E9WA 4I87A 4D9LH 2DL2A 1LO4L 2WCSA 5I0XA 3FOMA 3KGTA 3TURA 4XCYA 1BPVA 1HH9B 1U8PB 1TTGA 2VJ8A 3RWFB 4Y7MA 4BA0A 1CR9L 1WF5A 3N91A 3PWUB 4WHTA 5I8KH 3SO3B 4B3EA 5KAQF 4PJGF 5T5FL 5GS1B 3EOTH 2AQQA 3BESR 2EIDA 5FX3A 1MELA 1BVOA 5ALCL 3E8UL 1KB5L 4ZW5A 3JTTA 4NP9A 4O2FA 1DJXA 4HDIB 3SGKC 3UBGA 5I6KA 4BV1A 3DX1A 4E42B 2OQJA 4GINA 3BZEB 2CU9A 4CVUA 2I9TA 2HRLA 1EVTC 2BINA 3O41B 1PF3A 3EO9H 3MZTA 4G6FB 1YN7B 4IOIB 4LL9A 3SDDA 3RWHA 4R96A 2AQRA 1ZLEA 4ZXBA 5IFAH 1M05A 3T9WA 4A7SA 4ZMTA 4NERA 4LRIC 3FAWA 2IALB 3BUBA 3RWEB 4EPSA 3EYFB 5JORB 2NY0B 2G3MA 4ELMB 4G8AC 4LZKA 4V33A 4R2GB 3GEWB 2X6UA 4OGXL 3DIVA 3OPZH 3D07A 4JCMA 4KY2A 1B6UA 3BN3B 3GXMA 3IE4A 3AQXA 1FN4B 4GKNB 3WEOA 2OR9H 2KPWA 4M4RA 5CIPH 2Q86A 3ME0A 3X1BA 4BSWB 1QR1A 3GMRB 1U8CA 1A6AA 2VKWA 5AKTA 3ULUF 2VABB 1SJHB 4OZIF 4KJYB 5F7KC 3X1EA 1O5PA 4WDIA 5T3ZD 2ZX8A 3B9KD 4N20A 3AVEA 3C9NB 3AXLB 3MRGB 4TRPH 1TNNA 4AM0Q 5BV7B 3RX8A 1YEGH 2B1HH 4GQ9H 4E42A 5CAYB 5GZOD 4N0CC 3QFJD 4O2EB 4HK3J 4P5RA 4QRSB 1KPVA 2DJUA 2IFFL 2ITCB 4HSAC 4PP1D 5LNGA 3D6GA 3IPEA 1SNRA 4RX4D 4ZG1A 2AJZB 1RERA 2NY1C 2ZNXA 3AXHA 2DQGH 1OP3K 4A39A 1RZGB 1ODUA 2W0KA 5FB8B 3TBSB 1CB4A 5G5DA 5I8OL 2VLJA 3QWRA 1JZ5A 1N26A 4L5FE 2DI8A 4FI6A 2BSRA 3QZWG 4FQQA 2R7EA 3UO1H 3QJRB 4K71B 2X2HA 1F1DA 5JMOC 5H4ZA 5A2AA 3MNZB 4U1GC 3SOBH 1IBGL 1C7SA 4A6YA 3IS1X 5A40E 3A4FA 4LPXA 3V6ZB 2E4FA 5AB9A 2WLYA 2VMJA 2P3YA 5L7XH 3ECBB 5D93C 3UAJD 1CDIA 4OKVA 1HKLL 5TDOB 5ENWB 4YX2H 4QDGA 4GRLB 2VKXA 5GHWL 2J4WL 2VQ1A 2ESVD 1EJOH 5IHLB 2DLFH 2ZWSA 2W91A 1HI6B 2IG2H 3B3IB 4ZFOB 2XXGA 2YPKB 4LHQB 3SJVE 4F57L 4WU7B 1GTNA 4BKTC 3DXAD 4W6WB 3TCTA 3KM2A 1DEDA 2WLLA 2ZT9C 5I1DA 4X4XA 1U3HB 4WENB 1J5HA 3N6YA 2IANA 3MRRA 3MQIA 3X3GH 4I7ZC 2WW8A 4DP6X 2NY5H 1RP9A 3VU1A 3IBOA 2P52A 3QUZC 3FQ2A 1G9HA 1NAMB 2A6JA 1U6AL 4U3CA 4L23A 1FLRL 3PE9A 1BF8A 4JGUA 1M2OA 4Y2DC 4YVUA 3ZHDA 1YYMH 3NABH 5K9KB 4ZQKB 1JHKH 1GAFL 2A5UA 2OV0A 1F58L 2JK5A 1SXNA 1XL6A 3P4NB 4JRLA 4U7MA 2V7NB 2YR3A 3FTWA 3NEEA 1D3CA 4FQCL 4KI5F 2E59A 3TASA 5EF0A 4YDNA 2LFGA 1OM3L 1TTFA 1GYWA 5E1HB 4MNGA 5LAPA 2MEJB 2VWEE 3TA3A 1UOWA 3EYOA 4NQCE 1T3FA 1DUYA 1E67A 4PJAE 3BI9X 1MAMH 2EEXA 4KK5D 3LZLA 1P4BL 3TF4A 4LBEA 3TL5A 2YAHA 9PCYA 3FQWB 3QUYB 1TO5A 3VFWB 3U82B 4KKLC 4MCMA 5EOTB 7PCYA 4K7FA 5HDWA 5ERWA 3VX1A 4DW2H 1A7QH 4Z7WE 1KPVB 3A22A 1SJEA 4E9VA 1D6EA 1EMTH 1NCCL 2PPDA 3CPLA 4IRZA 4L3EB 4PFEA 4PLKD 1NKRA 3GJFK 3EYSH 4ZUWB 5E24E 1AVAA 5CIPA 3JT2A 4KJWD 3GBLA 4HD9A 5AYUL 4ZMAT 2AK1H 2M1KA 4ALAH 2OMBA 4R97B 2G2NA 4DKTA 1XF3A 3ZZQA 2XVLA 2OMVB 1FNFA 3DIDA 4NKDB 5JO5A 2VDNB 1ODAA 4E5XG 4N6RB 1RZ8A 3FTZA 4HISA 4XN9A 5DZNA 3FQRB 2I32A 5I71C 1ND0B 4HMDA 3AU1A 4Z7WB 1QA9B 4FQQB 2XWTA 4ZUSA 1T1ZB 4IIZA 1JNHA 2YGQA 4O02B 3U6RB 5BO1H 3H9SE 4JJHA 5HI4D 3GQFA 4GRWE 2DI7A 4TLTA 5KW9L 1KPUB 2BZ7A 1E28A 2FBRA 4AXWA 4M3HA 3OMNB 1U3HC 4NQCA 2XTJD 2X3BA 1ZVNA 4CVXA 4L4TE 4JM2D 5EIIB 1XV8A 1RH8A 5ESQA 5C07E 5A2LH 3UPAA 5D7LD 1QFWL 1QFWH 1ZHNA 5B3JE 2PPEA 3H9SB 4HJGA 5C0BE 2ZKWA 5HXMA 3IFOB 4A2GA 4YHYB 3HBPA 3VH8G 2GBAA 4XPFH 5JIPA 4PJDE 4DUVA 4FFVD 1DJWA 4B96A 3BO8A 2BSCA 1URLA 1GGUA 4LNVA 4RX4A 3JVGA 3WL9A 4KFMA 2ODIA 5F0LB 2WNGA 3N0AA 1P7QA 2PW2B 3F5WB 4R0LA 4XBEH 2ZPKH 2DIJA 1ACCA 5LLIC 1NBVH 5FGCE 5C0DB 3T6VA 5CZVH 3NQIA 4PJ9D 2BP5M 4ZMLA 2NYYC 4MFHA 3MLTB 3ECBA 4TQEH 5CR1A 4HV8A 4H8WH 3VFOB 4P57A 2WO2B 1FNAA 4FNUA 4FNQA 4XO5A 5DI8B 4NNPL 5LXVA 2YARA 4BFOA 4JFWA 1P4UA 2I85A 5DRZA 3ZHNA 1JS4A 5HYJE 2ZSVB 4X5WA 2VDOL 4H1LG 5JIIA 2A4CA 1AQMA 1XGRB 1E4JA 3RZCA 1Q9OA 2O5YH 3MR9B 2MRYA 4UI2A 2W60B 2I9TB 2DLHA 3WHXA 4HOZA 2AFNA 3NJLA 1NCGA 4L0ZA 3IJEA 4OLVL 4BKLA 2HP4A 5L2KD 3GIVB 1LE5B 2FWUA 2ZJSL 3U7YL 2H47C 1F2XK 2YFOA 4NZ8A 3FB7A 4XAKD 1UOLA 3NQKA 4BSVB 4R0LC 1F11A 1PPIA 4H8UA 3LS4H 3PL6A 4GG6E 1L9TA 1OM3H 3QUZB 1Y18A 3VG9C 1I1CA 4AW4A 3L3HA 4PLJD 4L3CA 1R24A 4LEOA 3T8XA 4YXLH 5JW4N 2BHYA 4FQCH 3VRLE 2H1PH 1QZNA 1PG7H 2VDPB 3VRJA 1LWHA 4JE4B 3A6BL 3F65A 4YDIH 3EHBC 1JFQL 4XMPH 3VFOA 1TZ8A 2AAVA 3IEAA 1J9QA 5LKNA 1VFBB 3D4GA 3U1SH 3ARFC 1A6VL 3S48A 3MV7D 1DQDL 2J1XA 1HESA 4MAYD 2AITA 1EO8H 1OT1A 1SFHA 3NA9L 1IAOA 3PQYA 4WFHD 4D0CB 5CN3A 2NY5L 2IH9A 1IEHA 3IXTA 4H0HB 4R26L 1T4KA 3KLSA 2WXJA 4ZS7H 4O4YH 3N2JA 3EJPA 1A4JB 3I85A 4H88H 4E41D 1QYGL 4PV8B 5C0BD 1ICTA 2NW3B 4HA1A 2GJPA 3F64A 3CN1A 2DLFL 1OE2A 4Z3TA 4AVJA 4JG0H 1JZ7A 4EDWH 3TBBA 3ZDXF 3VD0A 4PREB 3ZMNA 2RQEA 3M17A 2XHNA 2X2IA 5D1QC 1VHPA 5JUEL 2QELA 5E5RB 1SRDA 2J88L 2Z92B 4XVTL 1Y6NR 2VZ3A 3QUZD 1S7TB 5FGSA 1Z0NA 4LRNL 5IQ9B 1FG9C 2JV6A 3B9VA 1F41A 4X5LA 5T5NF 2Q8AL 2IAAC 4CU7A 3LRSB 4Y4FC 4RGNE 4UAHA 1BEYH 3DX9B 4DTGL 4ZPVB 5HVFB 2HTLD 4NO3B 2HLFD 3HN3A 1V3LA 4F8OA 4LPYA 4OQTH 3OLDA 4JDTL 1MZYA 5JW4R 2FJUB 2ESVA 2I69A 2ZSWB 4B0MB 2OMXB 1HHHA 4WWNA 5DEGB 1MPAH 2DWDB 4QHKI 3MGTB 5FUCE 2X0WA 1RZKL 2E9GA 2QVIA 2ZXQA 2VLRA 5E2WH 3C8DA 4GPVA 3U0TA 2CALA 4QHNB 1Z9NA 3OG6B 2VMFA 4B9PA 4P9HL 4R90L 3CDCA 5JQIB 1IRAY 3LH2L 4X6DB 1JE6A 4WI8A 1DQJB 3ESUF 2JTDA 4JM2A 4OFIA 2IMMA 4G8EA 2HLFC 4TRPL 4KUCF 2FT8A 4L8DA 3HI5H 4HXBH 3VD5A 5I5MA 1IKNC 4GRWH 1E5UI 1EFXA 2K6YA 3Q1SH 4AYGA 3DV6A 3NTCL 4F8QA 1J1PL 2D7NA 3CFKA 1MWAB 1MW2A 3RWJB 1MW0A 3ULSA 3DUSB 2AJ3B 2KBGA 1IQDA 1IIIA 5FIEA 4CW1B 1K2DA 1IUZA 2V7NA 1A4KB 3HRZA 2HJKB 4Y5XB 2O6FA 4NO0A 4PJBE 4PRDB 5CLTA 4WCYL 2X6AA 5I5RA 4QXTB 3OAYK 4ZW7A 3KPLB 5E8PA 3T4YB 3VWJD 5HHOE 3QGVA 5CEZD 1S9KC 3CFTA 1FAIH 5KVDL 4MXQD 1MRDH 3F7QA 3VE0B 1NUNB 1M05B 4BM7A 1THCA 1TYEB 2OI9C 2Q7YB 1Q9KB 4JM2C 1FDLL 2VERN 1GKEA 3HUJB 1FZKA 4I3SH 2LLGA 4IBYA 4JFEA 1TVDA 3O6KL 4UT6A 1JPFA 3D8MA 1R24B 4LEOB 3WNMA 1SJEB 1I4FB 2MQGA 4ILDA 1DJZA 4XE5B 4UV4H 1QSEB 4AIZA 4WWOA 3BH8B 3LDBC 1KGIA 4OD3L 5FYLL 1Q0XH 1HTYA 1CR9H 3TC9A 1HSBB 4RWYH 3FQYA 2DMHA 3TEXA 4XNMB 5EEVA 4LCCA 4N2HA 4ZMPA 2IXQB 2V3EA 3QJFA 1IBZA 4DKEH 1CBVL 3A6OA 3ERXA 4XPTL 4ETQB 3C9NA 3IT8D 1WFUA 2C3WA 1QLFA 3PWPA 5BUAA 1UM6L 4UTBH 3PHQA 4NQCD 2BW5A 4BGLA 3BEWB 3B7TA 1CZ8H 3CFUA 3HG4A 4MXVE 3CSGA 3HS0A 2EYTB 1NGWA 4NQCB 3MLUH 3FZUD 4LSSH 4F8TA 2VW4A 1QRNB 2B5IC 2X4NB 3RWIB 3VFPB 5JDSA 1MCPH 4QRUB 1WUNT 4QRTA 1CD8A 1O7VA 2QKIB 2P4AB 3UZQA 3U46A 4FADA 3I3EA 3V9FA 4LOUD 4NGHL 1A7BA 3G9VA 2XLLA 1F8TL 1SYSB 3OMZA 5CN2A 1S5HA 2OX5B 2XZAH 4ODBD 3TBYB 3T2NL 3JWOC 4L1BA 4ELKB 3K8KA 4U6HA 1SEBB 2QMJA 4XC1L 5GRZA 2DI9A 1JGEA 1U3HA 2ZOLB 2R0WH 4PJ9A 2VDRB 2IBGA 3MBEA 3G6AA 1IMHC 2JWYA 3C2AL 3FK3A 3GLDA 4HGKC 4KKCC 2FO4A 4DJMA 1CLVA 3CH1A 5GGTA 1P6AB 2LQRA 4MJHA 2XQYG 1E4XL 2J71A 5F7YC 3RLSA 4OKDA 5DYFA 1UQSB 4HUNB 2XPGB 1HILB 3O3EB 4PJXF 4JFFE 1UB6A 1M7IA 4GQZA 2ZIDA 3T0DA 3GXFA 1F86A 3CZGA 1CXKA 1UWGH 4U6YB 2ETWA 1BD2D 3VWJB 1K5NA 3SPHA 3U6XS 2CGRH 1OARL 3RFZA 4YHPA 3L9RB 1QBLH 2FX8H 1J8HA 3N50A 8CGTA 1I7RA 5SX5K 4YHOH 1OGAE 2X4TA 4MQ7B 5I0DA 5CEXA 2K7QA 3N5AA 3RU8H 4ONHA 5F9OH 2PWDA 5FYKE 1KPRA 2V2TA 4KK8D 1P5VB 1X9UA 3ARZA 1P4LA 4JM4H 1M6OA 2JKLA 3W0WA 5IB2A 2D03L 3CXHJ 1GYAA 1SEQL 1BF5A 2VH5H 2BSRB 3F7PC 3QDGA 4FXLA 2YEZA 2OSWA 4ZYKA 1ASQA 2J44A 1MCHA 3L1GA 3H6AA 3IXAB 4IW4C 1UZGA 3O2WH 4YLCA 3ZRSA 1AJ7H 2PNDA 2Q7AA 5D7IA 2F19L 5FUZL 3IWUA 4FNRA 3SODB 1R3IL 2LU3A 2P49B 2FEDC 3FU8A 4NC1E 5FHAH 2WZ5A 3C87A 3LKQB 3QNYA 5D7KE 5IESL 5CGTA 1BMZA 5FWRA 4EZLA 1F00I 2ZXDA 4JRYA 4W9DC 1KENH 1ADQA 1GR7A 4BFFA 1FIGH 2WBKA 4FLSA 2WKGA 1DQVA 1WZAA 2ITFA 3BVWA 3QJXA 2CR6A 4AIEA 1RZ7H 4OAWB 4S1RL 2AXHA 2NY6C 2A6IA 5E5LA 1T3FB 2XFGB 1ZANL 3D7PA 4WV1B 4KKRA 4NM4H 3PXHA 2GK0A 4F8PA 1T22B 5EDXA 3BD4A 3NRQA 5B7EA 2Y36H 4XVJL 3MNWB 4XBPB 1YEHH 4HXAL 4PR5A 3MXWL 1CL7L 4L48A 1RXLA 2VJXA 2AQPA 4M3JA 4N1EA 5KSAB 4V2CB 4N1HB 5DVPA 5B7MA 2NY7L 4Q0XH 5IREA 3L1FA 2E7BA 3HE7B 3QDGB 4HJ0D 3QQ9D 3QXDA 5LN4A 4YBQD 1ZT1A 3SIKA 2FJHB 4I48A 4O5LH 3UIZA 4M8RA 3N44F 4FP8H 1PCSA 5K9JL 2PUQT 1CLZL 4UZGA 4KJQC 5TK2A 4FNLL 4JQIL 4XZUA 4KI5D 1NMCB 2FJGB 5HJ3B 1KIQB 4TLSA 3T1FA 1FBIL 5DFVD 3CQQA 3ILDA 5BW7A 5F3HA 4APQA 4ZFOA 1RY7B 2E9IA 4NQDE 2Y5TA 2GABA 1HXMB 2NUTA 4N8VG 4XP6H 2JI3A 1QLRA 3DBXB 4LXFA 4PB0H 3JTSA 4PB9H 5EN2B 3MRPA 1EEZB 2NXZB 4N22A 5FYJL 1P5UA 4FA6A 4KKQA 4DK6A 3VFRB 2R8SL 1GRWA 3MO1B 4PMEA 3BEVA 3KPPB 2WLZA 2EXWD 2QDVA 2J25A 2W80C 2YKKA 4HJ1A 2APVA 3MA7B 4JQVA 1FPTH 3RHWF 3VG0H 1NCBH 1KCSL 2FYYA 3RL1B 4NZDA 4D0BA 4Y4HC 3T1WA 2IGFH 2EKSB 4AQ1A 1CFMA 3JWOL 3WFEH 2I7OA 5MHSD 2AKRA 4RAHA 2CE6A 1B4RA 1NIFA 2XIDA 2D9QB 2CKBB 1T83A 5JPMC 5KJRH 3TBVA 2UVFA 5AOKA 3TN0A 3PP4H 4PWIA 4LSVL 3NP4A 2C7UB 2R69H 2ZONA 4BDVB 3BW9A 1KZYA 2R0KL 1QQDA 1ESOA 5KTEL 1CXEA 5E8DL 4HWZB 3WE6B 3G7TA 4NFCA 3UTTD 4LCYB 1E50A 3TONA 2NY6B 3O3BA 5KBMA 2X2JA 3VAEA 2ZWZA 2OP4H 3EYFA 4DQOL 1KC5L 2WKOA 4MA7H 1ZVHA 3NJFA 4HD5A 4NZUL 4OLUH 5IB5B 4F7PA 2HRPH 5KBLA 5C07D 5C3TA 2ZCLH 1S3RA 25C8L 7FABL 5E2JA 1EHXA 4QI3A 1PJWA 5I73B 3F00A 3FKUS 3GMPB 3WO4C 1UT1A 2WAQA 2B2XH 1RLWA 1N9PA 3MRDB 3AXLA 3MRGA 4BH7B 1UACH 2WWKT 5F9DC 3MBXH 3MHZA 1OHQA 4P3DA 4CSSA 4N8CL 1DBJH 4OQ1A 2OI9B 2PWGA 5D1XB 1HI6A 1DBBL 2UV3A 1HHKA 1AO7B 2LT9A 3JWNH 2ED9A 4NP4L 3C5ZD 5AYQA 3UEZA 3QQ4A 3E8VA 4KQ3H 2EVGA 1YZZA 3GK8H 3IFLH 3MRKA 4FZEL 4XBGA 1EJ6A 4HUXA 3F6JA 4NQEA 1U3NA 5KSBF 4I3GA 3WTXA 4XWGL 4M61B 3GRBA 4W68A 3ZKQD 3RDTC 3GI9H 4PRNB 5IBUB 5I28A 2LFEA 4HIJB 2EO9A 4U1IB 2ZWNA 4M9OA 3RVTC 4FJYA 1CXFA 2ODHA 5IQOA 1RZPA 3BOVA 3TX4A 3QS2A 3U9UB 2BP0A 3PY9A 4KK5C 3F7YA 1MCIA 1Q90A 3GXUB 1J12A 4WGVB 4ALAC 5ESAB 4ZFFA 1KV3A 3MC0A 1RK7A 4LKXA 1VPOL 5DRWA 3TVMA 4X9GA 2JJTC 1SHXA 2BIQA 3FAXA 2FUTA 4PRAA 2YGVA 2HG5A 4AL8H 4XBMA 2Z1PA 5ALBL 1PKQA 3U48A 2X10A 4ZK8A 1TZAA 3FL7A 3L4CA 3AITA 3QJZA 5L2JB 2HWZH 2IPKB 1B2YA 5TQ0H 2PMZA 1AP2A 3C12A 2XX1A 4MJ5B 2AV7B 4UNVA 1ECZA 2G5BA 5T1KD 2VDMH 5GRUL 2FJHA 4JVPA 1RUQL 1HOEA 1AZCA 1NCDH 5CO1A 3RJOA 3E1F1 3QCTL 4FQXB 2LOEA 1FVEB 1TJMA 2C3HA 4KKBC 1JNJA 4F8NA 4QLRA 4FOMA 3U6XA 1FRGL 4GKLA 1RU9L 3QRBA 1HEZB 3MV9D 2DH3A 2DQUH 2UY7B 1I7UA 4NRXB 2VDLL 3QBTB 2X4OA 2VDPH 4ZTPL 5MHSE 1BBDL 3OF6D 4AK1A 5C0NC 5J6GA 1RZQA 2FEDD 1T0MB 4N6RA 5FECA 3PPEA 3CN3A 2YQBA 3ZT7A 2AEPH 3WFDL 3AROA 4D9RE 3PGCB 5DO8A 4OJDH 4G43A 1SXCA 4MNQE 2P5WD 1OAKH 2X0UA 5I71B 4HMEA 5FYJE 1GJWA 3H4FA 4HHWA 3FZUC 2VN5A 5DUPL 3R8BB 2GI7A 1GW0A 5KBNC 1HK6A 4PJ7A 5CP7A 4MQXC 1RJYA 4N87A 1G7JA 4QPEA 1RPQA 3CD4A 2H7WA 3RIFK 1XZ0A 3RY4A 2IIJA 3HKZA 1GGTA 4TNGA 3OD3A 4X6DA 1C5BL 4KAQL 3GXPA 5DC2A 1LMIA 3ZXAC 2BDNL 2CM6A 4BDVA 5HPMA 4QXUL 1NBCA 3EO0B 1QBML 4LVHC 5JPMB 2QGDA 3HPJA 3SGKA 2N7SA 2F9BT 3IDXH 1KMGA 3ARWA 3S4SA 3SDCB 3WKNA 3HHSB 2X4PA 1H8SA 4NKDA 2E9BA 3BSZA 5BZZA 1UFGA 3QPQC 3AM8C 4NSKA 2NYKA 2O5NA 3VMPA 3D2UD 3O2DH 4ACPA 4I18C 4DVBB 1CIUA 3DTXA 4KTDL 4FEMA 4ZFQA 3AXIA 1N5YL 3QIWC 4LCWA 4KUCD 5H94B 3F83A 3QDJE 3KPLA 3K6FA 4YVNA 5EWIH 5HYSG 4ODWA 1GZQB 4NM8L 1YEEL 3NJKA 5DU7A 5GS0D 4YSTA 2AK4B 4PTUA 5AENA 1YEJH 5D2LF 2GK0B 2B08A 3KJ6H 4HF5L 4FQXC 3DHPA 4JHZA 4N2KA 2QADB 4Z7UB 3STZA 2BS9A 4W70A 3QEQA 4NC0B 1M71B 2HFEB 3GZQA 3HZKA 4QAMB 4HUUB 4CGTA 5J1SC 4B5EA 5C8JA 4UQ2A 2HH0H 2OJEB 1OF0A 4KI1A 4J6RH 2Y5QA 1MCBA 4HUWB 2YKLH 2AERT 3UG3A 1IC7L 3HE6A 2EYRB 2HAZA 1T7VA 1WPCA 3U9PH 3B7RL 4LBAA 4PRIE 5GJSL 3UC0L 1HNFA 4BFRA 4Q6IA 1Z5LB 3QH3A 1O6VA 3C09B 4FLRA 2RCSL 4FCHA 4DP8X 1MEXL 4NQED 1H8NA 3VWKA 1JN6A 1Z3GH 2YRPA 2VRQA 2UWEB 2B1OA 2HJFB 4MS6A 1JGUH 2R23B 5C09B 4XX1E 2BNRB 3CQPA 1HEZA 4PG9B 5LGJB 4V2BA 4WTZA 4AGMA 4K07A 4PYGA 4B0MM 1L0XA 4F7TA 3N04A 4JFHE 1BG1A 5M94B 3TZVB 4K3JH 4N0YH 3O9WA 3WUWG 3ARPA 2P5EE 3MVSA 4CBPA 2AEOA 2BHUA 2R4SH 1A9BA 3D39A 4Y1AD 5GGVH 4G8IB 3PWVB 4GRWF 4M8UA 1AE6H 4MJ5A 2IQAB 1Y6MR 2G2RB 1OVZA 4NENB 5JR1H 1TO4A 3GNML 3BKYH 3ZT5A 3TS8A 4EJ1C 4ZD3H 2NNFA 1T7YA 3TP4A 4Z76B 3ILQD 5GGSY 2WBJB 1NLBH 5IWLC 1A1OB 3L4VA 3ZQ9A 4HJTA 3FRUA 5I17B 3FJTA 3B8SA 1MCWM 3JWNG 4FXTA 5I15L 1LGVA 5CILH 1OL0A 3OM3B 5E8NB 5HGHB 4PCKA 3KH4A 1VFAA 2JFCA 3GM0A 4OD1L 3MR9A 4FLOA 1JD7A 3GBML 1W0VA 4WUUE 3H9SA 1VCBC 1FCGA 5IHUH 1NGZB 1WDAA 2GBTA 2Y3NA 3MA9L 4U1NA 3VXPB 4NJAL 3TM6A 3F85A 1IFRA 4KVCH 2IGTA 1BFVH 1DEEB 1RL1A 2X4RB 1FGVH 3FFCD 3O3BB 4G43B 3Q9QA 1LNUA 1BAGA 2YWYA 5EC1A 4XNXH 1FIEA 4OLYH 5I16B 2BZCA 1QFUH 4R83A 5DCCA 1ORSB 3OKLB 3LKNB 3FONA 4JKWA 5JA9A 2Z91A 3QIWA 1QSFB 2KERA 3CZFA 4ISVA 1SGKA 4GAJL 4I4WB 2CM5A 4RMUA 3V6FA 1KCBA 4I0CC 2YMXL 2CKBH 4OUOA 4WSJA 2J6EH 3KNBA 1WO2A 3CNKA 1BBJB 5IIEA 2DKMA 4PJDF 1WAPA 2OZNA 4HKBB 4HS8H 3I6KB 4FYQA 1ASOA 1F1AA 1CD0A 4Y4HB 1I1FA 3C2SA 1QUNB 3L3GB 1ILSA 1KUMA 4IRSC 3PQYD 4BZ1L 1QD0A 5FK9B 1KLGA 3ISWA 4B41A 3QDMD 5AZUA 3GHEH 3MRFB 4NPYB 5I1HL 1E90A 5ECJE 3DDFA 5I8CA 5B38G 4DVBA 3FYIB 4FQ2L 4GXVL 2KT6A 5C0AD 2OMWB 3W3BA 1GPOH 4Z7NE 4R9HA 2WAHA 1VFOA 3QUYD 2RMNA 5ESAA 4ZFFB 1F4WL 5C2BL 3ATFA 4MS8C 5JXEC 3VXRB 1UT2A 3HNVL 4LASH 4CKVX 3D3VD 3FQRA 5FFLA 1CJYA 4NN7C 2FATH 1G94A 1J8HB 2BRRL 4HJUA 4DGVL 4ZMVA 1FZMB 2PXYD 4FQJL 2P8PA 2Z31B 2ZG3A 4D7PA 2WLKA 4HP5A 4MQ7A 1T1XB 5E6RB 5JHLL 5DUMH 4KPHL 1ZTXE 1JGLH 3UJTL 3P3YA 1TQSA 3GS0A 2FH6A 1KTJA 4F20A 1WWCA 2E0PA 3EHBB 1A1NB 1N59B 3BAWA 4BXSV 1N6QL 4AJWA 4HIIB 4IHOB 4HLEA 5CKAA 1UH2A 2Y2YA 1UA3A 2OL3L 3OKKB 3VRIA 4A67A 4R5XA 5DC9B 1BVNP 2TRHA 4UQ3A 4I9WE 3VFNB 2E7HA 1CICD 1FFQA 5HJ3A 3DRQB 1FFOA 5FXCH 3VGEA 4NDMA 1Z5HA 2DKUA 3MOAL 4WO4A 5D6CA 1CD1B 3M7FB 5F7BA 4LPTA 1XD0A 2N0KA 5TF1H 3ME0B 3O0RL 2Q86B 4RGMB 1TCMA 5KSBA 1KULA 1F3JA 1IE5A 3OXSA 4LCUA 3UAEA 2XSKA 1J88A 4OF6A 1K3IA 4KOBA 2PPCA 4RBPH 4F8LA 4HOMA 2YIHA 4XNYL 1A6ZB 4JKNA 1W72H 1PG7W 1B88A 2H0EA 2QTVA 2XBTA 2XPYA 2KLRA 3KLAA 3NACH 1MQKH 2IV8A 3DC0A 3O6FA 3QJQB 4MAYA 3KS0J 1TQUA 1MLBB 2BPBA 1BECA 2JCCF 4A6YB 4X5RA 3IU4L 4ANXA 1ET7A 5ITBL 5KEZA 3NIFB 2DWYA 3MZGB 4JJ5B 3WDIA 4WFGE 2OMUA 4C4UA 3C60C 4FTVA 5LCVA 5I1LB 1MFVA 2F7RA 5DSCB 3HHRB 4TL4A 2B5IB 2EICA 6PCYA 3LN4B 2ATPB 3TT3H 2IWEA 1S7QA 3GDCA 4PJHE 3C6LA 3WU1A 1OAQH 4AC4A 2YPLE 2YPKA 3DDGA 3ZSSA 2NY4B 1RJZA 5E6IA 3FO9A 5L88H 5L2KE 4F33A 3LKSA 1H6UA 4P4RA 2R1YB 3L9YA 2BVOB 3BWSA 4N3TA 4Y2DA 1GOGA 5GGRB 1O6SA 5AFAA 3W9DB 1NOFA 3U2JA 2VN7A 1JPFB 4DP0X 4Y4KD 4X6CB 1OAUH 3ET9F 3DWTA 3D0VB 3Q2VA 1XGPB 5LGHH 1S7WA 3MRBA 3WXVL 3NFPA 4PJ5A 3KNBB 4E9RA 3H7LA 3VFGL 2TSBA 4M56A 4B9JA 2AXGA 3S35H 3C60A 2PO6B 3V0DA 2GYSA 4X83A 4XB3A 4ZMZA 1E3ZA 3II2A 2Y6SD 1DVUA 2GHWB 4PRDA 1W2KT 3H53A 1FC1A 1ITBB 4RMQA 5T1MA 4H8VA 4QXTA 4XNZC 4IRJD 4IDLA 3M1CA 1U8JB 2OJEA 1Q38A 2K9FB 3CGTA 2ITEA 4ABUA 2WUCH 3UO8B 2MPVA 4HLZG 2BW4A 4J2XA 2K0RA 1V7NH 2X1OA 5KSUA 5C0FB 5F89A 4AJ0A 4S10A 3HB3B 1HZLA 1TZHB 1EZVY 5BZWB 4Q4IA 3FNKA 4OSUL 1NBZB 5ICZB 4L4VD 3H7BB 2QADD 4RRPM 4KKPA 5AAMA 4PRAB 3ZL1A 3PV6B 4BK8A 3BKMH 2QPFA 5EHFA 4QRQA 2GUYA 1MCEA 3U2SA 2K8MA 2PP9A 4LGRB 1BZOA 3ZHKA 4JO3H 3V0GA 5ILTH 1HQRA 1KGXA 2VC2H 3CVIH 4RMTA 4NFDA 4NHUA 3F7KA 2QQNL 5DD6B 2ZSWA 1MCCA 3FT0A 3QZMA 1HT6A 4LPVA 4L18A 3FW6A 1CBJA 1WP6A 3MLWL 4KRPC 4WNQB 3CFBB 2G9HB 1XCQB 3GSOB 4F93B 2CDFA 6TAAA 1QASA 5HHME 3GB7A 4FD0A 2ZAHA 5C3LD 1D6VL 2VDKB 4GRLD 1D6EB 3SDDB 5D1ZB 2B8OT 2P5WA 2PYEE 2HFFA 1OKEA 5EH1A 5GZOC 1JZ4A 1GY1A 1BVNT 1F11B 3WNJA 2EUZA 1NFDF 4P2OD 1MVUA 4R8WH 2YOCA 2XXCB 4OVVA 4I0KA 4X4MA 3T6WA 5E2TL 5E9DE 3BQUD 1WZMA 4FX5A 1MI5E 2ZCKH 5AOJA 4HUCA 4HZLB 3FRPA 5I82A 3II1A 5C0EA 3VM5A 2ZX9A 1U8NB 3LEXB 4BRVA 1KCRL 2GVYA 4HBCL 4NQVB 1ZE3C 1IGML 3C5XA 1YEFL 3CFNA 5IT2L 3B7UX 3CV5A 2XTJE 2ADYA 1U8MB 2R29L 4KO5A 5JXED 5ADPH 1ETB1 4E9LA 2DBJA 3P4NA 5EZIL 3S4SG 3BD3A 1TETL 1LO3L 1MOEA 5J8OA 3WIFB 4XPBH 3MKGA 4HV8B 3SBQA 4KROC 5F7NC 1BZEA 1NMAH 3NCWA 3PFQA 5D70H 2H8PA 3FUJA 2DWEB 4FNSA 3C60B 4X5QA 2YD2A 3MOAH 1KLUB 1FGNL 2DWTA 3P3RA 1T7ZA 4LGSB 1DLFL 2WZPD 3B9KB 4GMSL 4LAJH 1T66D 1FL6A 3MPCA 4LF3A 1A9EA 4NKOA 5H8DA 4XP4L 5HDOA 4KJWC 1PZSA 4Z0XB 4FYSA 4UQ2B 4JVUA 1FSKB 5IVXB 4I18A 4BUHA 3CX5J 4Y4HD 3QWNA 1HYRC 5GS0L 4HAGA 4R96B 2X70B 1BWMA 1PZCA 5ICXA 1NINA 1F90L 3SE3A 4FQLH 2E76C 3UTZA 3AG3B 1ETZA 3N55A 4XNMA 1RULL 4AEHL 5I1CL 3I6LE 5KS9E 4LKXB 1AZVA 1DQMH 2W88A 4NHCH 4W9LC 5DURB 3GBNL 5DD0L 4Z95H 4KXZH 4LLUA 2VLKD 3T1FB 4YPJA 5HYQA 2B39A 3EBHA 1NQBA 1Q9OB 5KYWA 2WHVA 3W56A 5C97A 1T5KA 4QRRD 4O2CB 3T3PE 3ASWA 1DBMH 4G6AD 2XWJB 1L5GA 4PQXA 4JFDA 3VGAC 4K3HA 4HULB 5KS9B 3V0JA 4V1DA 1GZPA 2OSLA 3ASOB 1JZHA 3ZE0B 3BSHA 4PHXA 1SJVA 5EUOA 1OPOA 3QO0B 2YRBA 4X8GA 3WJLA 3D85A 4M93B 1Q72L 2XV2A 3GSXA 3ENEA 4OZHB 1BQ5A 4BZ2A 1BFSA 5E03A 3BSZL 1DBKH 1U8HB 4Z7UF 4E5XB 2QEJA 5E6IB 4C59B 2XN9E 5EZLB 4HHGA 3HG1B 5A16B 3WL9B 1TQVA 3L1EA 2WB1A 4OCSL 4HUMB 4WHDA 4X8JA 4X4KA 1ORQA 1MAJA 1YPZA 2VXTH 2KMWA 3M17B 3X1FA 1DVXA 1A7NH 3OGOE 4HX1B 3PWLA 2QVTA 4GW5B 1FGNH 5ETUA 3AGVA 3X13B 5HI5C 4GAJH 1S78D 3SKMA 5I1KH 3GD1C 4C4KT 1VCAA 3N40P 4HC1L 1KIRA 1R3LB 1S3KH 1UC6A 1QI4A 5AOMA 5CFHA 1X5JA 3MAWA 4NQQA 1USQA 4BQ9A 3OAUH 3MRMA 4ZMWA 2I9LA 1MFCH 3NESA 1I8LA 4L3FA 5F9WC 5ABZA 4NQEE 1BFVL 5C0ND 2K4WA 5IW6A 2C3GA 5INCB 2KZBA 4CDHA 4QLWA 2RB8A 3QO0A 1HCZA 3GXTA 3L4WA 1IGMH 1OTSC 3PGDB 4HWNA 4YGVA 1J11A 1P5VA 2AABL 1PLAA 2VLRB 3GBMH 3MCKB 3EW3B 4XGZB 4MNQD 1J86A 5HTSA 3JQOB 1G6RH 5I15H 4XTRD 4Y4KA 2YJLA 3SZ6A 2JNZA 5I1DB 4NC1C 1RURL 1J1XL 3ARYA 1LEKB 4GAFB 2P47B 4XOAA 1N3NB 4X7SL 1CFBA 3K71A 1VKXB 1QLRB 1NGQH 2E9WA 2Q3XA 2XWEA 3GNMH 2EIBA 4ODSH 5K9OA 5CWSA 1IAMA 2BY1A 3C6EA 3WTTA 1PAZA 1FFNB 1AE6L 4UUJA 3OR7A 3AGWA 3X3FH 2ICEA 3KWWA 4IKNA 3V9EA 2OMTA 3M88A 2AQ2A 1W8EA 4HS3B 4YOKA 4EI0A 4TL5A 2ZXAA 3ESMA 4ADGA 5IEKB 4RESB 2W9EL 4WDIB 1WIUA 4F91B 2VLJD 4F1SA 1OCWL 4U4BA 4KRPD 4BELD 2YMOA 3N85H 5ILTL 3SCMB 5FOBB 1XSOA 2G9HA 2WSPA 4QAWA 4MNQB 5E8PB 4YE0A 1ZK9A 4YAQB 5D7JD 1A22B 4GRWB 2HKHL 2X7LA 5A2JH 1TTAA 1KLFB 1U8KA 3CMGA 3KWTA 3TBTA 1RZGA 4K7PX 5JORA 3C8HA 2AJ3A 4P2AA 4M7JL 2FSEB 1NFIB 1JZDC 5CZXC 5CZKA 1H6TA 5ICZA 2P8MA 2UWEF 2WUCL 5HGDB 5FYLD 1AZUA 1IL1A 4AJVA 3SYAA 1FFOB 3MRDA 1D5MB 4PRHE 3V0WH 5D7IF 4PJIB 2FO1A 3L45A 4XP9L 5K1NA 2KS0A 1CGYA 1QAWA 5HHNA 3VTAA 5I1EL 5J89A 1QPPA 3WUWB 2ZXBA 5DJZB 4Z7AA 3D2UA 3MRPB 4NBZB 5IVNA 4JKPL 3RX9A 1FZJB 1I1AC 1NCAL 3GJFB 4Q9RH 2MKWA 1I8KB 3FN3A 1E6JL 1UXMA 3DX0A 4OKVB 5JMRA 3ARBD 4AT6A 4PJBF 3WGUB 5I6XC 4H8QA 4PTTB 4G5ZL 1PIGA 4TSBL 4TQPA 2XZCH 4OCWH 1QNIA 2BOLA 5CLZA 1P5UC 5LGHL 3W11D 4Y19A 3VXTA 2W92A 4FQXD 3ELAT 4Z7NF 3WNLA 1Q94B 1BQSA 3LKPA 4FQ1L 2VDQB 3HZ3A 2VCOA 1KG0A 2HJFA 2XVBA 3DYMA 1OQXA 1NAKL 2EUVA 1YY8A 1JZGA 2ADIA 2OTUB 5DDHB 2H45A 5I1AB 5KBDA 1DSFH 2EJ1A 1D5RA 2WWMD 4FE9A 1TKWB 3TT3L 1BOGA 4UYQA 1NCIA 1P7BA 3AUVA 4HIEA 4P9MH 1WEJH 4WV1A 1OAKL 2NLJA 4ZPTA 4Y4FD 1RCYA 3UFIA 3QEQE 4MHHG 1JNLH 1DP0A 1UXSB 4Z7UA 2XDHA 1EEYA 1WWBX 3QIUB 1W72B 4LKCB 1BBJA 3RVWC 5IIEB 3P9MA 3VRIB 4LMQI 5D2NA 4HKBA 2VAAB 2J20A 1P6WA 1SY6A 3QEHB 5GJTL 4UBDD 5DRNA 3VE0A 4UT6L 2F53E 2QGBA 5D4JA 5HJGA 1MVFA 4Q97A 1LD9B 1AO7E 3UAJC 2F8VA 3HE6C 3ZTJH 1BPLB 1ADQH 3O0RH 3ISRA 5TF1L 1HWGB 3QCTH 2XXFA 1C16A 4ORGA 3H85A 1S8DB 3OF6A 3SKJH 3ZKND 1KZQA 5GRUH 3QYNA 5D1XD 4XT1C 3M8OL 4MB3A 2EYRA 2F5BL 4XN5A 4QYAA 2BM3A 4E2OA 4IJ3B 5TQ0L 3SDAD 3BQVA 3KHQA 3GTNA 3AB0B 3K7UA 4P2QE 4J4PC 2EZ0D 1XVSA 3U36A 1RAMA 2BJMH 4NKMA 2NQCA 1NH6A 1X5IA 5IUSA 2VO8A 2HG5B 2NY1D 1ULVA 3TNNA 4GSUA 3QORC 4L2LA 5D2LE 5DUML 5TGBA 2W60A 1JP5A 4TMPA 5D6DA 2YA0A 2HG0A 1D7FA 4JPKL 3WIIL 3A4AA 4FLHA 4FXKB 3RWGA 3ABLB 3C08L 1VRSA 3DOSA 2WQRA 3QFJE 4ERSH 4Y1AA 2Q8BL 1X3DA 2QSTA 1SN5A 2QKSA 2DMKA 4YLQT 1L7TH 2OTWB 4UCFA 3DVNA 3PIQA 1A9EB 5HVGB 1YEIH 2MCPH 5BS0E 4EF3A 3BIAX 3WS3A 2DOCA 3GTTA 4YR6B 3IDYC 1NTDA 2QPUA 3F8UB 1JWMB 1MJUH 1MUJB 1GGBL 2A83B 3OHXA 4U05A 4Q9QH 1DBBH 5BRZA 2EDFA 4LLDB 1HL4A 2PW2A 3THML 3RGVB 2H9GA 5KG9A 1J0KA 4B9YA 3NZHH 4N86A 4ZXBD 2OKMA 3FO1B 2BH0A 3JV4B 2YAFA 4GI9A 1I9JL 3SKMB 5EFIB 4OFKA 3RDTB 2IPTL 2X09A 3DSNA 3QZWB 1H15B 1MHPH 25C8H 2PTUA 3UMNA 4AE1A 3P0VH 4KOCA 3COOA 4A2FA 1F56A 1FVDA 1HINH 4TVPE 1INDH 3D69B 4CC0A 3CLEH 1BAWA 1D9KD 5DD1H 1LMKA 3DARA 3FB7B 1F6FB 1E42A 5E8DH 3OKEB 1BQHG 2HZHA 4KK9C 2F1EA 3B8YA 3RGBA 1G6RB 4YUEL 3D85B 1ML0A 2VQ1B 4NLHA 5HGGS 3P2DA 4XR8C 2YQGA 1RMFL 3W2DH 5KJRL 1EDQA 2LE9A 3UG4A 3R1GH 2C34A 4M7LT 3S36H 4ES9A 4PRBB 1OB0A 3CVHL 5DJ2A 1BGXL 2L8AA 4JHWH 4X5XB 2FZ3A 2IGFL 2GIMA 2V2WA 5KYUB 2IH8A 3MACL 3FQNA 3GSRB 4J3OF 4MBOA 3VG0L 3X12B 4F9PA 5ACZB 4JRYE 1KCUH 2A6KB 3PL6C 4I89A 1DUZA 2R8SH 3H2PA 3MO1A 1QLFB 1NLBL 4OB5H 5EPMA 3MRLA 4GO8A 5HHOA 2VLKE 3BFQG 3QRLA 4JHAH 2Y69B 1FYTE 1NM4A 5I1JL 1OANA 2A9BA 1BGXH 3V95A 2WXLA 4U6XB 3IFPB 3TV8A 3BUPA 3IMSA 1DQLL 5BVJA 3L7EA 3R1GL 3ETBJ 3V6OA 4MRCA 3HC0A 3WJLC 3WS6A 2MNWA 3TH4T 2XG4A 3L5XH 1B0RB 1A4BA 2I24N 2NNAA 1KB5B 3AG1B 4CVWA 1CLZH 5DFWH 2CQVA 4OD2B 3NCYP 5T3XE 4M4PA 5C92A 2VQTA 3SDXE 5FFGA 3CXDH 1I1FB 4TS6A 3B2MA 5DD1L 5I75C 1ACYH 4ICXA 2FB4H 3NMEA 4U4IA 3UIYA 1W8OA 2DZEA 1NANH 3W5MA 3K2UH 3P0VL 4LVNB 2X4OB 4K5PA 2IH3A 5JHAA 1CL7H 5F3FA 5JPNA 1G5GA 1UKSA 3UC0H 1S2EA 1RLBA 1Z1WA 1IC7H 3B7YA 3QIWB 1CC3A 2UZYA 1JWMA 1ZAGA 4U6VL 1S9YB 2ZKXA 2EVJA 3N44B 3WAJA 3FH5A 1IB5A 1P84J 2WIMA 3KPRE 1BX2A 2YD6A 3FBQA 3NIDF 1PD0A 4J4PA 2OMVA 1RZ7L 3OMAB 3PWNB 4NQUA 5JO5B 3V4LA 3EYUH 4PJAF 4WW2F 5D7SH 3TA4D 2CGYA 4FKKA 2OJ1A 4M6MH 4MXWH 3B1TA 4WY7H 5D7JC 5I0WA 4MB1A 5DJYB 1IT9L 1INEL 2A74C 4XODA 3CFCH 1EHKB 2RIKA 1S7VA 4YXKH 4MD4B 5EWIL 1YEIL 2MCPL 5CD3A 4K9EC 5K33A 2Z7ZA 5C0CA 4UQAA 1AIFA 2F19H 1N5YH 4L8DB 1PY0A 1CVSC 1N8OE 2DWXA 4UBDC 4CADB 3ULVL 4ERSL 3O2DL 5K39B 2HFFB 5ANMA 5ELIA 2WD0A 4JPKH 4N2BA 5I19H 4XMVA 3EGXB 2BK8A 3F7YB 3EOBB 4UIKL 5I2IB 4M62L 1QSZA 3LDBB 5T3XH 5B3SB 2A74B 3IDXL 5C6WH 3IDGA 2PLTA 3K0WA 1J5CA 1Z66A 1B3IA 2VLLA 2XETA 3GUFA 1MLCB 4HUVB 2YD7A 4ATTA 1RIHL 2DQTH 5C6PB 1NFDE 5EO0B 3S36X 2VLME 3D08A 3M1BA 4PCSA 4MTMA 4HFWA 3OQRA 4LSDA 5D1XE 3SGEH 4BK4A 4DK3A 2QGCA 2F18A 4NO3A 5E1AB 4X6CA 1SMDA 4JGJA 4UYPA 4NWUH 2DLGA 3P2TA 3MUGA 2V4LA 1ZS8B 4QGTA 2J56A 4UV7L 5D72H 2V3FA 3C2AH 3KJ4C 3CZKA 4K23H 2ZCHH 4P3DB 4PJ5E 5EZOH 2VTFA 1DQKA 4K4KA 1H3GA 3FT4B 5DLLA 3SE8H 3WCYA 2AEPL 2YD0A 4XC1H 1CN4A 4P5KB 1ZLWH 1CICA 5HHPA 5E08H 3E3QC 2RFXA 3NCEB 3T0AA 2VDPL 5E7FA 4S0HA 2PTTB 1M4KA 4B9CA 5CF3A 3BAYA 1A6TA 1GGCL 3KE0A 4C55A 3QDJA 5GS3A 5FGRA 1EGJA 3CBKB 4YC2C 5GS2D 1T5XB 4PY8J 1FRGH 3L2NA 1MCPL 2P1YA 4XHJD 2Y06L 1ZSHA 3OHXB 5DEZA 3ZUNC 4I0PB 5E1IA 5K9KA 1ZT4A 4FFTA 3T65B 1TCRB 2VXSH 4OLXL 4PCTA 4EUPB 2XX0A 3CFJB 2E75C 1E30A 1CQYA 1J9SA 3BPNB 2GSIB 4LCCC 3LPOA 2Y1AA 1AZZC 1TIUA 3ARTA 1UD3A 1V7ML 2ED8A 3AACA 2OMXA 3BUIA 5DEGA 3KLDA 1KYDA 3S5LB 4KGJA 4HH9B 1G4MA 1OAYH 4JL2A 3KYKH 4OAWA 4Y1TA 5IVXE 4CMMA 5J11B 4UT9A 4PN6A 5FYLH 3S96B 1KIUA 2NT1A 5MENE 4MLSA 5IVXF 3FO9B 5D7LE 4G5ZH 5J1TC 4TKWA 4XOEA 4AGNA 4RMSA 5EB9A 1LEKA 4JK0D 5CLWA 2YC1A 3P4MA 1OP5H 3QG7H 4KZDH 3VWKC 4LOFA 4GW1A 5I75B 5F8RC 1NCAH 2EADA 4HK3N 1K4CB 2HTKC 4C83B 4Z7OF 1IGJA