4J5VA

Crystal structure of p19 in complex with double-helical rna 19mer p(cag)3c(ccg)3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
total genus 38
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2013-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j5vA01
4KTGA 4J5VA 4KQ0A 4JNXA 4J39A 1R9FA 4JK0D 4JGNA 1RPUA 4KNQA
chains in the Genus database with same CATH superfamily
3K81A 3OL2A 4EDWL 4YHKH 4N2AA 1ID5I 3RDTC 2EUZA 1B0RB 4XXCA 4DO6A 1AZVA 5DJAB 5FW6A 4DW2L 4I5BB 2P5WA 3TBWB 1HEZB 2D7TL 2RCSL 3L81A 2OKMA 2GTZA 1U8PB 2FD6H 3AT8A 5ICXA 1QSFB 3DUSA 3GXPA 2Y24A 4N8VB 4YLQT 4OF5A 3VFGL 3DOIA 4FXTA 3Q06A 1CFVH 3FFOA 1R5VB 2EDKA 4HWNA 3QIBA 4FYRA 4HPYH 4WV1B 3O41A 4WI8A 5JXEA 3W0WA 3C6SB 4G8AC 1B2YA 4WWKD 2LT9A 3IMWA 5AVSB 1I8MB 2AQTA 3QK0A 5T1LA 5BQDA 1T0MA 3U6RA 3ULUL 3UJTH 2E0PA 3TN0D 4Z7IA 3TPUA 3ASNB 1QSEE 1S9VA 3MLZL 4QXGL 4OLVL 1AMXA 3P11H 3ROLB 1WRFA 3GF8A 4N5EC 4W4OA 3ARFB 2MJWA 3O2DL 2AEWA 1EFQA 3L3OB 4JDTL 3UEZA 4NCC1 4ZBJA 3SYPA 3WHE1 3MJWA 2L0DA 1IAIL 1TQVA 2X41A 2QQQA 3VG9B 3PWLA 4P06A 2VIRA 5KVGH 4KNUA 4L4VA 1A3LH 3QXVA 4M1CD 1JTTA 4L4JA 2X6CA 2CKNA 2PMZA 5HJGA 1M57B 3FSZA 1TQUA 2GSMB 2UXGA 1BREA 2AV7B 1U3NA 3BLKA 2X89D 3H85A 3ABLB 4HEPA 3BDXA 4C47A 1U3HA 5IROA 1CK0L 1CE6B 5TQ0L 4KY2A 3IPBA 4MRCA 2O61B 3U9WA 3V4PB 2VW4A 3EW3B 3KCPB 3ARYA 3MZTA 4MJIB 4U6XA 3TT3H 4XVSL 2C1PB 2M26A 4G9FE 1D5MA 1FHGA 2XFXB 3I9PA 3HZ3A 5E6IA 2D7NA 4Y4FB 1KTLB 3U6XA 4UQAA 1TU2A 4K7FB 3O2VL 4GRMA 5EOCH 1Z3GL 1YLBB 2HFEA 1WA2X 3HC4L 1NBCA 1PLCA 3QJOA 2OZ4L 1TQCC 3EOAB 4M61A 1TJHL 4ZTPH 4CW1B 3O4LB 5EO9A 1ZHBB 3PIQB 1B3JA 4PLJC 4PJEA 5ETUA 1MWAA 2VW6A 4L9LC 1DJSA 2BJML 1CF8L 5FXCH 5DURD 1UD3A 4MNQE 2A6DA 2X4SA 5E8OA 4GXUN 4JUTA 3ZUCA 2LV4A 5L0QC 1GIGL 2FB4H 1KB5L 1WWWX 1M71A 3QR1A 3QO0B 4EI0A 1S9YB 5KW9L 4I8DA 4NP4L 4QXTB 4JDEA 2AABH 3FQ2A 5IJCC 1Y18A 1HDMB 4NC1E 1MJ7H 1C8PA 1OQOA 2X3AA 2G5RA 3HR5B 5KJ7E 3HPLB 4A2GA 3MA7A 2CBPA 3ZIMA 5HYJD 4JFEA 2HX7A 3KPTA 4L1LA 5IBUG 4IRZH 5C6TH 4NERA 2RFXB 1F4HA 1KDJA 5C97A 2F68X 3ULVF 3MRPB 4NB7A 1VZIA 2F7IA 3E7JA 1AGBB 2CQVA 3VI3E 3TIEA 3FT4B 1QFPA 2Z8SA 1YA5A 3RVTC 1UA7A 1YO4A 1BVLA 4NBZB 2ARJQ 3IWUA 4M7JL 2X4PA 3BPNC 3RLSA 4P9HH 4CSTA 1AD9A 2MSPA 3OBAA 1OAZH 4Z7UA 2IH9A 2ZOOA 4G2AA 4YVNA 5EU6E 4QF1B 1BYPA 3WE1A 2AJUH 5EU5B 1W9XA 1GZQA 1VPOH 2QSTA 3BH8B 3H54A 5EZJB 3W11D 5ID1B 5C09A 3QG7H 2R15A 3P4MA 3VTTA 2VO5A 3HVDA 3TVMB 2IIJA 2LTQB 4U1SB 3BT0A 4QXUL 1E3XA 4Q97A 5IMLB 1MLBA 1DFBH 5C0BE 3HRZC 4JFOA 4XP5H 1B4LA 1BSIA 2XQYK 4JO8A 3K74B 5LGJA 3JWDH 4FLQA 4WNQA 1HHIB 5D4JA 5D2LB 3E6HB 5SX4H 3SDYL 4HZLB 3RL1B 4O2FB 4DUVA 3SDAB 2Q8BH 1Z9NA 3NA9L 3BAWA 1Z9MA 3MR9B 2BNQA 4YE4H 4GEJA 1IAOA 2PXYC 5T5NF 2Q0ZX 3PQYA 4BA8A 2GIMA 3DOSB 4X6FB 4Q9RH 2MH4A 1EQWA 1A5FH 2RD0A 4UT7H 1YY9C 5GS0C 1J5DA 3KDMB 4OCWH 1FFNB 4PCTA 4ZS6D 2GAZA 4W9KC 2IFFH 5DRZB 1OAXH 2C34A 1HL4A 4YUEH 2XIBA 4PP2B 2YD8A 3Q5TA 1OE3A 2OMXB 4Z7WF 3MOBH 4GG6F 1SVZA 1OD9A 2X2UA 1AYRA 4U1IA 3HG1E 1GGIL 3OGOE 3VFPB 1JE6A 5D5MA 5B1CA 3FRUA 1NFDB 2XU9A 5LHDA 3RJDA 4NLHA 3GRGA 1AQMA 1EAQA 4QXVA 3NJMA 3RGVC 1KN2L 3ZPDA 4DWHA 2XQBH 4PJAE 3AXIA 1DZBA 1QLEB 1ET5A 1QO3A 3B9EA 3DV4A 5KWYC 4UM8B 1EGJH 5JTWA 3UZQB 4LCWE 2BXZA 4Z77A 2ODIA 2BY0A 2KI6A 2XKNA 1U4FA 5F9AC 2FYYA 3DJZA 3F7LA 2NNXA 4LCVA 4LARL 4NQDB 3GXTA 4IHBA 5T33H 4G6JH 4HPOL 4JHBA 5F3FA 4ISVA 1XGZA 2PP9A 3NIFB 4P3DB 3BT2H 3IETA 4X42A 5C0RL 4PB9H 4X5WB 1SEBA 4FL4C 1LHZA 3QFJD 3B34A 1BQHB 4N9OB 5DMKA 3UBFA 3VDCA 3T3PE 1UXSB 4X80H 4Z0BH 4LP4A 1H9VA 1RUKL 1MFAH 2XYCA 2Y7LA 4NQCA 3V5DA 3Q44A 4U1GC 3GUFA 5I9QB 2OMZA 2WP3T 1T80A 2NYYD 5B39A 1I82A 1UADC 5GS2H 3G6JB 5KYUA 1WFUA 3OM3B 3DI3B 1U6AL 3B5HA 2DW5A 3WDIA 4JM2F 3HZKA 1T7YA 1IEAA 2V4LA 5BPPA 3MCKB 4XGZB 5CJ8A 3KPOA 4HKXA 2IWKA 4K73A 4PIRF 4HC1L 2XZQL 5H94B 1IGMH 4QRAA 3RWCB 3D39D 1AHWB 1SY6H 1INEH 1UATA 4ODWB 1UKTA 1B0WA 2FWUA 3BDYL 3FF7A 3GKWL 3RE0A 4OZIA 4JKNA 1XXFC 3G6AB 4DPBX 3DECA 3CFUA 1U2HA 3F7VB 1Q1JL 4P46A 1J9RA 1M05A 2FX7L 4ZO8A 2EIDA 3FUFA 4DEWA 3HMWL 2RACA 4P46C 2ADFL 1MHPL 2X4QB 1ZVSA 3CZFA 4ZD3L 3H9YA 4LU5H 3BI9X 3O3BB 4A04A 2UY6B 5F21B 2XICA 1UEYA 5CJOL 4BHUI 5AVXB 2HWZH 3GD1C 3KBHE 4U0RC 4ELMA 3M8OH 3NN8B 4N0YH 4PR5B 3AW5A 2F7RA 5IVOA 5JHLH 4LSQL 4JHUA 5E5LA 5KS9F 4TUOA 2YD7A 1UWFA 5JIPA 5HJBA 3K72A 1Q0YL 1SYVB 5C08E 1HK6A 3IRZA 4N1CA 4AVHA 3HUJF 3JVGA 3BXNA 4L37B 4LVHC 4UAOC 4IJ3C 1G7PA 4RGNB 1Y1UA 1AZZC 2BP5M 4JPWL 5LN4A 4QRRA 2B9BA 3MJ8B 3KJ6L 4YDMA 1MF2H 4PJ9A 3QIUD 1XAKA 2AXFB 5KYYA 2JF1A 1T5WB 4PJ9C 2DWEB 2DKUA 2BSBA 2WIIB 2Y07L 4R2GD 3PGCB 4ZSOE 4S1RH 5HVWA 2J72A 2ZUQB 2H32A 1MRCH 1QEWB 1NBVH 2HUEA 3TS8A 3L3JB 4DEPB 1MVFA 1VENA 4HZAA 2YUZA 1DL7L 4N0RA 4HS6B 2VLJB 4I87A 2XUWA 5J06A 2XTLA 2XN2A 4AYEC 2AK4B 3VXTA 1KY6A 2ZJSL 1FFOA 2GJ6A 2GSIB 2D7OA 3MNVB 1JZ8A 5I26A 2DI8A 3AT9A 1VACA 2R4RL 1JRHL 2Y3AA 1J87A 3BSZA 2HFTA 4OLZH 4XP4H 4PTUA 4N2KA 4IU2B 4NOBA 4IMKC 4QAMB 3X3GH 5AYUH 4ZFGH 2PCPA 1EWHA 1FNFA 1JNNL 2QFRA 3N2JA 4FI8A 4BWTA 2QFPA 5ACZB 3OAWA 1G87A 2CJUH 4M02A 4F80A 1TVBB 3UO1H 4S11A 3Q8BA 4TNVK 4I0PB 2E7BA 1DSFH 1VZHA 3EJTA 4Q6IB 4A6YB 3RURA 1QFWH 3V4VH 4PJBF 5JO5B 3FT3B 2WLJA 4XBMA 2COQA 1MY5A 2EC9U 3QORD 1PKOA 3EO9H 5AB1A 3K6SB 4OZFH 3S96B 3UYRL 3BP7B 1AI1H 2AW2A 2R27A 5HHXL 4MMXB 4GRWH 2WBJA 4ALAH 3BUBA 4H4NA 1N4XL 5DRNB 2JWYA 4JM4L 2JH2A 1KCUH 2AQNA 1S7WA 3FPXA 1LO0H 2WBJC 2YKKA 4NRZB 2OJ1A 2HG0A 4WHCA 5MERA 1A1OA 4DP9X 2GK0B 2NY5C 2YGPA 3RX7A 5DRWA 3ARBA 2FX9L 4LAJH 4G8GA 1RZJC 2HKHH 1EHLL 3B7SA 4AGMA 2X70A 3GO1L 1ZJAA 3KLAB 4HWZA 3VGAC 3LS4L 3SO5A 2FTAA 2V8LA 4HISA 5J12C 5E4EC 3LIUA 3UGEA 3WHXB 2QADB 4M8VA 2ENQA 2XTSA 1VIWA 4UTCA 3DVNA 2DQUH 1R33A 1EANA 5FB8B 4EN3A 4I3SH 3RILA 5TJWK 1A9BB 3R1GL 4GRLB 4DUXA 3CH1A 4EN3C 2GQHA 1XIWC 5ADOL 4QTIL 5DZOA 3BQUD 4G8IB 3KPMB 1UKSA 2X1PA 3P3RA 3UTTD 5KEZA 2NY3D 4L0PB 2OW7A 4KQ3L 3E1ZA 1SDYA 4QCIA 2YK1H 3SCMA 2LLNA 2K9FB 1WBYA 1D2OA 4F5CE 1YJDC 3CUPA 4N0CD 5TDPB 3K8MA 4FTDA 4OTXL 1NDGB 3SCMC 3VFWB 5ID0B 5J1TC 1EXGA 2P9RA 5CAYB 5D7JC 4AQ1B 3FULA 2XBDA 1EJOL 3MLUL 4PJDA 1ILUA 3D4GA 3T8XA 3IDNB 3L3KA 4M48H 3P9LB 4XZUB 3L95B 4MZ3A 1ACZA 1YEEL 1HOCB 2V5SA 4CMHC 2FO8A 4JG1L 4WW2F 2VDRB 4ERSL 4LSPH 3VD7A 1YPZB 2ICEA 3HFMH 4ZXBD 2N7SA 5BS0E 5FEBA 3WNJA 1J9QA 2YUVA 3NK4A 4MA1C 4NQVB 5D6CA 4ZPTA 1KBPA 1NFAA 3IFLH 4CDGC 3B2DC 3D50A 1XF4A 5C0AE 5B1AB 1MZZA 3IBOA 4YXKL 2CIKB 4HIIB 4MKMA 3RJOA 3QUZA 1HNGA 2X05A 1XF1A 1OCRB 1DVUA 3W1ZA 5AFAA 1FGVL 3RY6C 1FH5L 3QUZC 4NC2B 2PUQT 4OZGB 2NY7H 3KM1A 4GT7A 5CINL 2W81C 4ZK8A 3FQRB 5DURB 3SOBH 3M7FB 3RDJA 3HMXH 4QMEA 4OIFA 2CH8A 4I9WD 3L9YA 3VH8B 1TTCA 3SE8L 5CHNB 5LBSA 2F9BT 5EBLB 2D2OA 4XMLL 1DE4B 3TJEL 4JFFD 3PAZA 3QRGL 3QUXD 5DWUL 1K8IB 3IMSA 4KI5D 1M7DA 1WTGT 4FEIA 1KT2B 5CGYC 3RP1A 1FIGH 2NZ9D 3GNML 4LLYA 2Z64C 1F6FB 5BCAA 5I1DB 1UYWL 3ECBB 4I0CC 3VWKD 4M8QB 1MIEL 5JUEL 4IOFC 2NTFB 4B97A 3DV6A 5E2TL 4ATWA 2FEEL 1KELH 3VX0A 5D4QA 1OGAE 2IAND 4POZC 2Y1AA 4OZ4A 2VN5A 4DGVH 4QHKJ 4MD4B 3WIAA 1WYJA 4Y4KC 2ESVD 3NCJL 1AOHA 5AW5B 4EXKA 1EERB 4OJFL 3ZZ1A 1C9SA 1XGYL 2J71A 2F5AL 2CO1A 1BQ5A 1MFEL 3DJ9A 1MJUH 1QRNB 1IBGH 4ANUA 3KYNB 2EIBA 1FHNA 3VWJC 1K5WA 1RZKH 4I4WB 4Z23A 1L9SA 1T1YA 3NT0A 4Q4IA 5FO8A 5SWSA 5GJTH 5KTEH 5ESAA 3U9PH 2GI7A 4HWBL 4G3YL 3TFKC 2EXWD 4KKQA 2X87A 3IPFA 4R3SB 3HZMB 2OR9L 2K3TA 4XE5B 1NMCC 1IQWH 3VRLE 1KGUA 4NQXA 1SNRA 4BV1A 1A4AA 4LGSB 3KDPB 1KCRL 4R26H 3PG2A 4ZPVA 4ZFFB 2WXHA 4IGBB 3RWFB 1FWXA 4UT6A 2EE3A 3TO2B 4WFEE 3V9CA 4AXWB 2EYRB 1ILSA 4LDOB 1INDL 5DA0B 4ODSL 2BWIA 2BHZA 4GBXA 2ITCA 4ONFL 5E8EB 2F58H 1AE6L 2HLFD 3BVXA 4DOHB 4GBXC 2VDOB 2VW7A 4HUNB 3IBEA 1HIML 5DC9B 5IQLA 4E41B 3F85A 3TNNB 3PS6A 2DLFH 3CZGA 4TN9A 5LWYH 1FPTL 5LUMA 2WWKT 4U1LA 2J1YA 4ZW3A 3SE3A 1F4XH 3UABA 1IIIA 3VFVB 1ZY9A 2YGOA 1IM3A 3SE3C 2HJLA 3LD8C 5FF6B 2XC8A 4PYGA 4XX5A 1UC6A 5F3BB 3Q8FA 1QFUL 3CFJA 4KGJA 3QQDB 3S88L 4MNGB 3VCLB 1JK8A 3FHQA 4DP1X 3BAEH 3EH4B 2GTWA 2NY6D 5EOQH 5I18L 5KANI 5F1IA 1J5HA 4AGLA 1N6VA 3NTCH 4M43H 1OB0A 1H15A 1LEGB 2OV0A 4X7TA 3S35H 2F54B 2A6KA 2WO2B 1CICD 5HI3D 3ARED 3RJQB 4APQB 5JOEA 5EWIH 3K3QA 4AYID 2YGVA 3VW3L 3QDMB 4MQXD 2E6QA 3B83A 3JV4B 5F9OH 2BOBA 4LBEA 4Q52A 1S7TB 4L3EB 3VFTB 3WIIL 1OAQL 1TTBA 4L23A 5AD0A 4OZHB 4FXGA 3H9SB 2DL9A 1UVQA 4LLUB 1TJMA 1QLRA 1WHPA 4LHQB 4KHXL 4ZUVA 5LCVL 3IJHB 4FXGC 2HLAA 4GSDL 5CSZA 2UZPA 3MNWA 1ZWIA 2XRAL 5FHBL 3A3YB 1C5BL 2F1BA 3R4RA 4IRJA 3KWWB 5I8KH 2WZAA 1Q4NX 4XP1H 2M83A 2Y3NA 2FLMA 3F5WA 4IRJC 1U41A 2VR7A 3KYMB 4W9ZA 5GS0H 1F42A 3KPSB 1NMBH 5JXAH 2HX9A 3S7GA 1TQBB 1TJGL 1ZIBA 1WZAA 3VFMB 1ETJA 4UZGA 4E9SA 1TOXA 3C5XA 3FYEB 4YSTA 2H6PB 1S9WB 4TVPL 4CMMB 4X4XB 3FH7A 2UZXB 5I1JH 5IVXB 1OWRM 5H2BA 4JPSA 4J8RB 1RJZA 3I6LD 1ZT4B 1FL5B 2Y5EA 4NN6B 1M7XA 5D1ZD 2VQUA 4LVNB 3VB8A 4PVNA 4GMTL 1I3RB 1BG9A 1K85A 4ORZC 5D1QE 5J1AA 1I1AB 4ZFOB 4M6NH 1IT9H 2JXMA 5DMGD 4TL4A 2O5YL 5FLUA 3SGJC 4LEXH 4K8RL 2HFFA 1BAFL 3UP6A 4PPTA 1BX2A 1KY7A 4BRVA 5D7KD 5FKPA 5DCCA 4WF7A 3BAXA 3VA6A 3SGDH 4WUUA 3ULUD 3EJPA 3TP4A 1X5XA 2WPGA 3QI9A 2X28A 3HHSB 3M1BA 5JQ6L 4K23H 4CC0A 4PLKD 3TCLA 5IGXL 1YMHB 2D4FA 3KXFE 4WY7H 4LSTL 5IIEA 3DXAE 3G5VB 5D7LB 1W6LA 3MMEB 1A6VL 4EDWH 1RZIA 3F6JA 2F8OA 3T0DA 4ZFZB 4MA3B 1A0QH 3V6OA 1S2EA 1KCKA 2HRLA 5AW4B 3T09A 4JFYB 4F2MA 5IBUB 5AUMB 3SJVE 3G6JF 1IBFA 1M53A 1OHZA 4G5ZL 5JIMA 1JPGA 2D7TH 2HRPL 4LF3B 4O2EB 2VJXA 3BP5B 5F7EL 1WIPA 3EUUA 3VFNA 3NCCB 4OLYL 3U0PA 4DP6X 4H20L 1F58L 4TV3A 4LFHD 4PG2A 3LB6C 3L4TA 2DJ4A 4KJQD 3RZCB 3BRDA 2OL3L 1WA1X 2DL2A 2JKNA 3N42F 5EBWB 1W72B 4J3BA 1HKFA 5CBAB 2DQHL 3K6OA 5DFWH 5CZRA 2ZXWB 2QV4A 3X1GA 3CHQA 3MLZH 2WM0A 3O3EA 4PRIB 1FSKB 1DQDL 3T2OA 3NACH 4OLVH 4QWWC 2V2TA 4K3EL 5BOZG 3W9EB 2ZUUA 5A7BA 2XXGA 1NBZB 5HGBB 2Q5BA 2DQCL 3TCTA 4HS3B 1SPDA 3NSXA 3ZL4L 4JDTH 1KENH 5HGDB 3FN9A 1IAIH 3CDGB 5F3HB 1MFDL 3OKNB 4U4IA 3B7TA 3IJEB 4AIEA 4IMLB 5ANMA 2AK1L 2W9LA 2BS8A 2EDJA 5GZOD 1SBSL 2Y25A 3PV6A 2BCMA 5HD8D 2X6MA 4JG0L 4NSKA 4FZEL 4BH8B 3U36B 3L7FA 3D18A 2O4EA 1MFNA 2Q2LA 4HJ1A 1CK0H 4DO5A 2MTPA 1I8IB 5TQ0H 3T6ZA 5A6LA 5LAPA 2LABA 5K5YA 5D4HA 4JNXA 1H8SA 2IPKA 1TETH 1UCBL 2E27L 2WBXA 3GMLA 4H8PA 3WSQL 4AV5A 4K5PA 1JWSA 4EIZC 2DQFB 1YEDB 5DGRA 1XQ4A 5BQ7A 1BFVH 1NC4A 1SFHA 3CBRA 1HQRA 1J9CT 4NCDA 4NIKB 3ZHFA 2IH1A 1ZMYA 2OZ4H 4X5LA 5IHWA 3DX2A 4F93B 1KYFA 1TJHH 3B9AA 4XOEA 4KITB 1U21A 2IBZY 1BWWA 2XT1B 2YWYA 1RSYA 3EFOB 5GZND 1KLGA 1LK2A 2NX5D 1CF8H 4ZUSB 1F86A 2ALAA 2WVVB 3L3IB 3LPGA 1S8DB 4UU9B 1KGWA 3MBEA 1YEKH 2R29A 2X4RB 3PWJA 1IC5H 1GIGH 3KPQB 3MREA 2Z4QB 4Z7WA 1KB5H 3L3HB 1JZJA 5DJ8A 1KDIA 3B9KB 3LKSA 3ZDXE 4F1SA 5T3ZD 1DLHB 5HI5C 1E4XI 3VD3A 2B14A 1D7BA 2I07A 5I74C 1JHKH 5E9DE 5EIIA 1XX9C 5MEND 4YHYC 1UH3A 2DD8H 4ABUA 4BGDA 4K71C 4I2XB 1YCSA 3H6JA 2AJYL 4BCZA 3VMOA 4M5YH 1KPVA 3FCGA 1KBGL 1OP9A 1XCTA 4HGKC 4W6YB 4AT6B 5CILH 4IU3A 1DVYA 1T3FA 1A7QL 4FA6A 1H5BC 1LM8V 3AQDA 4G6ML 4YHML 1L3NA 2L4OA 1Q9OB 3ZE0B 4MDRA 1LEIA 4Y5YB 1A6ZA 2ZP9A 1NIDA 2WAHA 3V0GA 2IEPA 2YC1B 1FE8L 3D4YA 4KXCA 3BUPA 5FO9A 2CBOA 5HDLA 4J1UB 4ANKA 3MGTB 1J9TA 2VLKA 2CKBB 4N2HA 5KSBE 1DJWA 4M7JH 2H2SD 4W9DC 1J5IA 4NZJA 1RZJH 3HI5L 5J11C 1QSFE 2NXZB 1PSKH 3AAZB 1NOFA 4IEFB 2BCKB 4N6RA 4WTZA 3VFOA 1ANUA 4MYWB 3C5JA 2EVHA 2ZQKA 4X6CB 4N2EA 4RZCA 4EI6A 1KXHA 4JM2C 1PNCA 2GITB 4GOSA 4OJDH 3CN2A 4QPEA 3AXHA 1XGUB 5EBGA 3MV8E 1LEKA 3QC5X 1SBBA 3VXPB 4MAYA 2R9HC 4BH7A 2XIIA 4P23A 3RWGA 4FG4A 4KOBA 1OE2A 4MAYC 3SDYH 3QUML 4KX9A 1YJDH 4XTRD 4P2OC 4Y9FA 3QA3B 4U1MB 1XH1A 4EQ3A 4Q9QL 5DC2A 5I1EL 3ZSSA 1A65A 5DT1L 3I50L 3EJCA 2BOLA 5FYLE 3GMMA 1GHFH 5DFVD 3CSYA 2J8OA 2ZYIA 1UZ8B 1YPZF 4GEIA 3CCHA 2Y1ZA 3B6SA 2UWEE 4S10A 2CUMA 4KNSA 1H3UA 1BQRA 3HIZA 5HHOA 3REWA 4TTDC 2GPZA 5HDRA 5KS9A 1E42A 2JLLA 2WTRB 3QDGB 3UIZA 3KJ4B 5AWNL 2ZCHH 4EI5A 4Q58C 3UCQA 1JWMB 4X4ME 1GGIH 3HUJA 1H3XA 4RZKA 3UX9B 3MRRB 4LMQE 4AJYV 3MCG1 3G08A 2D9QB 5EIVA 3V6BR 1KN2H 2RH0A 1B0GB 3C6LC 3HHRB 2VXQA 4P3CL 3N1PC 3LNFA 4K94L 1XWVA 3JTSB 4S0TD 3VYNA 5ISZD 3U9UA 1LNUB 3V4UL 2WV3A 4Z76A 1I1YA 5I19H 3MRGB 1YYCA 2NY4C 4KWUA 2Q3ZA 1UOKA 2ISDA 1P9MC 1YC7A 4PJXB 5I15L 4CVZB 1UJ3B 5IOKA 3IPEA 1AY1L 4E5XG 2OMWB 4MVBD 4LARH 3VU2A 4HPOH 2NY0B 1EDYA 3H7LA 2VLRD 4TQIA 3ZQ9A 4OFDA 5DD3H 1ZLSH 4JRYD 1D9KB 4N26A 1LXMA 2H26A 2OSLA 4P4KA 2VN7A 5C0RH 3DSFL 3VD2A 4XNMB 2WMPB 3K91A 4JFPA 5KYXB 4P4KC 3E8VA 4MB4A 2VDLL 3V6ZB 3QEQA 1CFSB 3QS2A 5CP7B 3IF1B 2DQMA 1LO5B 3RZWA 4OLEA 2MQ0A 3CU1A 3HLAB 5LG1A 5CZXD 2DDQL 2FQFA 3P77B 1EFXB 2DQIL 2WQAA 4Z7OF 4C56E 4AVJA 2DI9A 4NQUA 4D9QE 1JYNA 3QUYD 1BP3B 1JN6B 4PEEA 2XWJA 4OQTA 4Z0XB 2YIHA 3LN4A 1MI5B 3GDCA 4P57A 3KAAA 1A9EB 1ADQA 3KNBA 5HTSA 3LKOA 1FG9C 2WWOA 2XZQH 4BELD 4YHLH 3VFRB 1W0VB 3OGCA 2F53A 3PWPA 4FLRA 4H26A 2QVKA 1UB6B 4OF6A 3Q2NA 3HG4A 4ODTL 1NUDA 3K2UH 3BDYH 1HI6A 3GKWH 3FT2B 1LMKA 3PP4H 3IAPA 5KOVC 3RUGB 2VXUL 1T2QH 3OB0K 2YOAA 4XPTH 3T3ME 3RVUC 2F08A 1R5WA 2K4WA 5JIKA 2EYSB 1Q1JH 2J7LA 1JIBA 2BNRA 4YH6A 1UA6L 12E8L 4WSKA 3CE1A 2EVIA 4HCRH 4G8EB 4FYSA 5D93C 2I24N 3EFDH 1RZ8B 1CDUA 3FYIB 4M93B 3ZT5A 2IAMA 2AERT 3DVGB 4R5VA 1T6VN 1WS7A 5FYKL 3TNMB 2Y5TA 5I8OH 3SBWA 1W91A 3IAQA 1IEBA 2BP8B 4PRPE 5IMKB 5C9JB 5IMMB 2WIMA 3SBWC 2XPGB 4IRSB 2DYPA 4OLUH 4AUYA 5A40E 1ZE3C 1H0DA 4BK4A 2FJGB 3DX6A 4XVOA 5E8DL 1XCXA 3BVUA 4NKOB 3UTZB 4GSXA 5FECB 4JFDE 1B0RA 4UTAA 3RY4A 3VA2C 2B0SL 5DJAA 3KJ6H 4I5BA 5IREA 4FCHA 3IWVA 4EEEA 1IEHA 1HEZA 2H9GA 5BRZD 1WTLA 5F7HA 4JZOA 5J6HB 4N8CL 3MLWH 2Y07H 1U95B 1XZWA 4KKNA 1ZD6A 3HVNA 4BWWA 4KJPD 3NCFB 1I9RL 4FZ8L 1R5VA 3ZTDC 5EEZA 2L7EA 2Z91A 1DL7H 2CXKA 4WV1A 3QEUB 4Y2DB 5E00B 4KQ4L 1IFRA 3C6SA 5E1QA 8CGTA 4QD2E 4JO3L 2ZJSH 7TAAA 3MXVL 1XSOA 2BO0A 2YA1A 4FNTA 2X6VA 1I8MA 3K5RA 3EHBD 1XCWA 2R4RH 2HZHA 1GYCA 2ZNWA 2PF6A 2P5ED 5SWQB 4WW2A 1R75A 3ROLA 4MQ7B 5CSGA 5INCA 4PBWD 1HYSC 1CFTB 4WW2C 3ARFA 3MFGB 3X1BA 2X42A 4Z3GA 1O7VA 2EO9A 3L3OA 4MJHA 3A21A 4OLWL 1PS3A 5E2WL 5H4ZA 2XNAB 4YSOA 4BQ8A 1TJIL 4Y19A 2VE6A 3SYCA 4F7PA 4PRBB 4BEIA 3AROA 4MNHB 2UVFA 1MCSA 3QPQD 3LRMA 2YPLE 5D7IB 3VMPA 1T04B 3SY6A 1GCFA 5D8JH 4X8CA 3ALWA 3PHQB 2XN9B 3PP3K 5C07D 5B3JE 2D3JA 1BBDL 3CN0A 4QRPB 1R17A 4AIOA 1NEUA 1VADB 5IF0A 4Q9CA 3F58H 4RFOL 1JGEB 5I1AB 5HHMD 3WE6A 3UYRH 1ZEAH 4P99A 4NXKA 1CE6A 2AJZB 3CHXA 4YAQA 4URTB 5MEPA 1ZLWH 3D34A 3KCPA 4P2RB 2YEVB 4TQEL 4XMPL 2C1PA 4DERA 1QAWA 3FCTB 1E27B 3G9VA 3DPDA 2XFXA 1RZ7L 4FQQB 1H8LA 1FAKT 3KR3L 3MROA 4IOSA 4JM4H 4EBQH 1KGYE 3V52L 4Y4FA 4EQ2A 1KTLA 2X1WL 4FQIH 3WL9B 4S1SH 5K69A 2EO7A 4K7FA 2OQJA 3ESVF 4TQHA 5I6XB 5FGCE 2W07B 4XNBA 4OFQA 5C0FB 4C4KT 3QXUA 3COOA 5EULV 3EOAA 4ZQKB 4CW1A 2H3NA 3O4LA 1ZHBA 3GO1H 1II4E 1T2XA 3CHPA 1CYGA 3LS4H 5JA9A 4A38A 3MNZB 1HOEA 3WTSA 2ENYA 1OSYA 4AJVA 3VXMB 2W9DL 5AVRB 1F90H 1INQB 4HGWA 4Z9KB 2IH8A 3JWOC 1MAKA 5DJ2B 5LO7A 4OIIL 4GO9A 2CNYA 1MFUA 1FYTD 1A21A 4U4BA 5FGSA 4YDZA 3VXRA 5D7SL 5AOLA 5L9DL 1J18A 4I77H 4QTIH 1FZMA 1UA3A 3LCYA 3TJHD 1MVUB 3BMWA 1S9YA 4IM8A 4KQ3H 4U3XA 2IH3A 2ID5A 3MUJA 4OCLC 4WHDA 1HDMA 1IBYA 3HR5A 3HPLA 2OMTB 4OTXH 2CJTA 4ZYKA 5I1IH 3F04A 4O2CB 1EJOH 2V2WA 3MLUH 3MRHB 5KBPA 3VSVA 2WXGA 3L16A 2RFXA 1E40A 1F6LL 1IB5A 2O6FA 1FDLL 4JY5L 3QWRA 5J1SC 4JW3A 3BC9A 2FATH 5BJTB 3MRPA 3ARRA 2X9YA 4JG1H 2XZCL 4ZX3A 1U8QA 5EOTB 4ZO6A 4B7IA 3RGHA 3FT4A 4GO8A 5BZWA 1GOHA 1OP5H 3SD2A 2G2RB 1OCOB 1SXSA 2MMXA 2EE2A 2Y06H 3N06B 1F8TL 1N68A 1OK8A 1LP9E 2V3FA 3IDJB 3V79C 4JFTA 1CO1A 1FNEA 3BVTA 3L9RB 3Q2VA 2G0LA 4DKEL 4KH2A 1RPQA 4UQIM 4PN6A 1KPUB 2Y7QB 3BE1H 4NI6A 1J5OH 4N20A 1FGVH 2YXWA 1BEYL 1FH5H 2QGEA 4PI0A 4QF1A 3N41B 1UD6A 2COVD 4N90E 4HP5A 5EU5A 2NX5B 2Y69B 3BH8A 5EZJA 4BQ6A 1R6VA 1H3TA 5ID1A 5FIEA 4ZW8A 4GKSB 3ZDYB 3HE7C 2Y6SC 3TVMA 3B2UD 1UM4H 2R0WL 4U1SA 3HZVB 4PHZA 4QOKD 5BV7C 2QGCA 3VD1A 3NDZE 2VSCA 4L3CB 3SE4A 5I8CB 3KPRD 5IB2A 3PAUA 1SXCA 3ZXAC 3J2PA 3AG4B 3GNMH 2LGNA 1R46A 3E6HA 5D2LA 1UYWH 3D33A 3A23A 4U7SA 4HZLA 1ZLUK 3RL1A 5JUEH 3SDAA 5E2TH 3E3QE 3IU4H 2IXQB 3MR9A 2ZONA 1Z32X 4X6FA 1NAMB 3DOSA 3TZVA 1GMIA 5IFAL 1A1MA 2XX0A 3H42L 1LVEA 3E6FB 2XQYA 3ZOAA 3VNYA 3SPHA 3KDMA 2IO5A 4MJ5A 3TZVC 1J8HE 5AZ2L 1VZGA 5DRZA 3NCJH 2XWDA 2TAAA 3FC8A 3ARDC 1XGYH 2F5AH 4PP2A 4Q7DA 1MFEH 4JGMA 2IPUK 1CGXA 1I8LA 1ZIAA 2ITEA 1FQ9C 2OMXA 4LEBA 5E24E 3WO4C 4CN4A 1V27A 1CDJA 4F91B 1IU1A 4OV6F 2XIDA 5KVGE 4G3YH 3WFDL 3K1KC 3MV7B 1NFDA 1R3LB 3L3DB 4A7SA 4E9LA 4RESB 1UQSB 2WGXA 1ASOA 4NYLB 1M3JA 1HSAA 3HI6H 3F64A 5HGGS 3VGEA 2VISA 2ED6A 4UM8A 2Y72A 2AAAA 3ESMA 4NCC2 4UM9D 5HDWA 3UZQA 2AS5M 1JXFA 4ODSH 4J3WA 4ONFH 4J23A 2FSEB 4AL8L 2BOCB 4O9HL 1BOYA 5CCJA 1LD9B 2VZSA 2P42B 3MDJA 3WTTA 4NQDA 3OWEA 3NAAL 5BW7C 1UWGL 5CP3A 4P3DA 2V8MA 4X5WA 4PY8I 5MHSD 3T1FA 3EXLA 3EYVA 5AYQA 4PJ8D 4L8SC 2NXYD 1YN6A 4AYSA 3FTWA 1UXSA 4LSVL 2ZOKB 2CU9A 1OGTA 3GBMH 4BHUA 1A4JB 3NEXA 4Z7NB 2R69A 1KSRA 2M8XA 3I3DA 3BSZL 5JPNC 2BZCA 3G6JA 1KGCD 5AKTA 1LJMA 1ASPA 3D69B 4LOUD 1PBYA 4QLRA 4YXLH 1X9LA 2LOEA 3C5ZD 2NY2C 5C6WH 4K5MA 3MCKA 4XGZA 4TVPD 1A02N 5D2NB 4TXVB 1D7FA 2C7UB 5I6OA 2BVEA 1PMYA 3U25A 3Q8EA 3FBQA 3AQXA 5H94A 3LJ3A 4OUOA 1F97A 1Z66A 3L2NA 3FMGL 1NBQA 1I1FB 4N3UA 2PTVA 1AHWA 4ZAKD 3WJLC 3VW3H 5IFJA 2FSDA 4ODWA 1ZLDA 1T0NB 5AW6B 1CURA 5IM7B 3WIIH 3VXUD 3HTLX 4K8RD 3G6AA 1JZ5A 4B41A 1IM9B 4IIQA 3Q1EA 4KHXH 3GSNB 5LCVH 2WQRA 3VRLF 4GSDH 1I9EA 4ICXA 1KJ2B 2OXGB 4IIQC 5FHBH 4ES9A 4HIQA 3OKDB 2X4QA 4H8WC 4K07A 4XHJD 3ARVA 4MJ2A 3O3BA 4HX1B 3ATDA 1H19A 1KULA 1CXLA 4KROC 3VX1A 1U91A 5DUBB 4O51B 3NFPB 3ARSA 3G5XB 3NN8A 4PR5A 3CV5A 1JZEA 3QNZB 3HN8A 2E9IA 5SV4A 1SYVA 3TCXA 5HHNB 3S8FB 4TVPH 2ZP8A 1PG7X 4LDEB 4C8XA 1E8XA 2YBGA 4YPJA 3MJ8A 5J3HC 4GMTH 3ZKNC 1JDDA 1AFVL 2AXFA 3I75B 3VD9A 3CZNA 1K5NB 5KVDE 1QSZA 4FFWD 1T5WA 4D0BA 4J6IA 2NDFA 2O5YH 5CEYB 5HYJE 2DWEA 2W0KA 3F7KA 5EC2A 3PGCA 4KTDL 4PJXF 4PGEB 4XXWA 3F7YB 3C60D 2ZWNA 1QEWA 3O3DB 3L3JA 4XXWC 3B3IB 4HS6A 2VLJA 2DWYA 3AXLB 3WNIA 2AK4A 3AS2A 4N8UA 4NS0A 5JQ6H 1J05B 5CCGE 2GSIA 3MNVA 4PYHA 3DNKA 3BP6B 4YN3A 1DBJL 4LSTH 3IE4A 4QRFA 3SDCB 3VD0A 2E56A 3FN3A 1A6VH 1IC1A 4CDHA 3V8OA 1A7OL 1YUKB 3LHPH 4IU2A 5JZ7C 4K2UL 4G7YL 3ERXA 4PWGA 1DQLH 4G5ZH 1RVFL 4KKCD 2B3RA 1CLZL 5ACZA 2TSAA 1ZANL 2HRPH 2JKSA 3O3UN 3TURA 1TVBA 5F7EH 4YDVB 3BIAX 1CUOA 3GSRB 4KRPD 5A16A 4WO4B 4OLYH 4H20H 4Q6IA 1RURL 4A6YA 1WAAA 3IMBA 3MRLA 1JNLL 3NQKA 3OTTA 1Q9WB 3MUGB 4Q6IC 3BPCA 2OL3H 5FW7A 1FO0A 3ZE2F 4P3WA 3S96A 1VCAA 3GI9L 3RX5A 1Y07A 2WNKA 2HTKC 3FT9A 4BD4A 4MMXA 1X7QB 1MCPH 4HMCA 4HUWB 4P2AA 3NZHH 4PRHB 1LO4H 5LBSL 3K4AA 1DVFA 1SLUA 1QHQA 2DQCH 2PWHA 3GB7B 1DUZB 4NRZA 3D85D 4LSDA 4WI9A 2GK0A 3OAZK 1DVFC 4L4TB 2OSYA 1P7BA 4J3VA 3BIKB 4M7KL 3CVHA 3O6ML 3D3VD 3KLAA 4DSYA 2AK1H 4WI6A 1BAWA 1R3IH 5MP6H 3HS8A 4FTVD 4FZEH 2L3BA 1F4AA 1ZE3H 2IDFA 3DX0A 2P80A 3B56A 1JRHI 5HI4C 4N0UB 1A9BA 2EUVA 3O0LA 2RA1A 4N2OA 1XCQB 4DIXA 3JUZA 2AJVL 3GEFA 5E56A 5T1KD 4G8IA 4YNYB 3KPMA 4OZHE 4HEPG 4TQPA 2D4DA 3EOYG 3WSQH 3VDBA 5DRXB 4P2QA 3F01A 5H35B 1OXYA 5ID0A 1NDGA 2WNXA 3VFWA 1QP1A 5J6GB 3RVVC 2I32A 2VM3A 4Y1AB 5KG9B 2BVPB 3IDNA 7FABL 3LN5B 1E28B 4NC1C 4XZUA 2EVFA 4OFVA 2RTTA 3L95A 1TLMA 3TEYA 4UT6L 1HOCA 1XF5B 4LRIA 1IKOP 4V1DB 1CE1L 4ZS7H 3QYMA 3CN1A 4KJYB 3N0AA 3QUGA 1YPZA 3P40A 4PV9A 3QFJE 1B4JL 1J86A 4NC0B 4NQVA 5EB9A 1CQKA 5E6UB 3T0EA 2ICWJ 5D1XD 1KJVB 3ULSB 4G82A 3SQBB 2CIKA 4HIIA 4KC3B 3PNWB 4JPVL 3T0EC 3QIWB 1IBBA 3NIGB 1NWPA 4HJGA 4AIZB 2OBGA 2IADB 4GXVL 5D7IF 3ZL1A 4E5XB 1S3KL 1OPGL 1KJMB 2O6DA 3FB8B 4F3FB 4OZGA 4DVBB 3QO1B 2FQDA 3KL0A 1QI4A 4MDJB 1QFWM 4QRBA 5FA4B 2HSIA 1Z9SA 4P0DA 3U4EA 4DGIH 2F74A 1U8MB 4GNKB 2R7EB 1JDCA 2AJYH 1QZNA 2FBOJ 1U30A 3D39E 3U1PA 1X5IA 3VH8A 2IDQA 3AACA 3F3HA 1PG7L 3NABL 3E38A 3OC5A 3ZO0A 1VGEL 5BRQA 5EBLA 3UMNA 3ABMB 3QT2A 2A2QT 3GRBA 1DE4A 2P8PB 3FU7B 4K9EL 4YHMH 3PWVB 1K8IA 1RSFA 3ZX1A 3KVQA 4UV4L 2XG4B 1KT2A 2F5BL 4HBQA 2Q76B 4X8GA 5KYNA 3V0IA 3R0MA 3V0VB 4E0RA 3WTYA 4MX7B 3ECBA 5DZVA 1N59B 4M8QA 3LOWA 5LGYA 1AS7A 5I1HL 2NTFA 3V5KB 2IAAC 1CGVA 5C71A 1S7VB 4LE8A 5I71B 2OJEA 5IG7B 3V6FA 4NNPH 1XGQB 1GSKA 1OTSC 1LK3H 3NFSH 3PHSA 4NPKA 2QQKL 4HKJB 1LTXA 4BK8A 2DF3A 4WNSA 4MD4A 4QI3A 2VWEC 3HB3B 1V55B 1DBKH 4LEEA 1PX8A 1DBAH 4JJOA 5DHVH 1AAJA 4JKLA 5L2JB 3JWOH 1QRNA 2FECI 2ZXAA 3WEOA 5IW1A 3EDKA 3KYNA 5L2KD 2A6JB 2BSSB 2VAAA 3OF6A 4I4WA 1DEEB 5DVOA 1WUNT 3ZGIA 3UTQB 2PO6A 3CQFA 4FX5A 5FUOL 2Q7YA 3BEWB 3WYRA 3N85L 4XPGH 4R3SA 1BXVA 1YMMA 3BLPX 2PO6C 2N7BA 1AZRA 3OSVA 2P5WD 2DI7A 2QDVA 4KVCH 3KYOB 3BD4A 4R7XA 3IAGC 4FYQA 4AY0A 4IDLA 4IGBA 4XT1C 3RWFA 2IGTA 3TO2A 1OP4A 5I1EH 2ZE0A 5CGMA 4AXWA 3BGFB 1DUYB 5K59E 4DHLA 4P4RB 1KTBA 1JERA 3I50H 2ZX7A 4L1HA 4NFCA 4NQTA 1MXDA 3GI8L 2FCBA 3AY4A 3TA3A 4XVJH 1RQ5A 1W0WB 2H8PB 1XD0A 3QIBD 5HHVL 1JPTH 2P26A 3EDDA 5JXED 3AY4C 3W0WD 3TA3C 4E41A 1SLWA 5CLYA 4GKZB 1CD9B 5T1LD 2R2BB 3II3A 1U4EA 4N2IA 3JWNE 2BSEA 4HGMA 1NJ9A 2QHLA 1GYVA 2OPCA 2LQRA 5PCYA 3ZSTA 4ZI8A 4G7VL 1D5IL 3H2PA 1ZA6A 3KL5A 5KSBF 3NH7L 5FF6A 2EH7L 5LXVA 1I8KB 5GRYA 2K8MA 3TEWA 2JMRA 3HJ0A 1GZHA 2DV6A 3SODB 3QQDA 4P3CH 4MNGA 1DBML 4K94H 5MEOB 1UACL 3LNDA 1HYRC 4NHCH 1GZHC 5DHXB 3DYPA 4DP4X 4GAJL 2LVEA 3V4UH 3SQRA 4DGYH 4YHPB 1QRKA 3ZMEA 2YQGA 1LEGA 4IS6B 1I9IH 1EHAA 1E9PB 4CVXB 3APMA 3HN3A 4APQA 4QHUA 4AUJA 5I15H 4LQFL 2ADJA 3BYYA 3U30B 2KHAA 4IBZA 1E5CA 3QDMA 4G72B 5T5FH 5BV7H 1YAZA 3JV4A 5CMAB 5IB3B 3Q01A 4HK0B 4ONGL 1U3HD 2I5YL 3AY2A 5A2AA 1S7TA 4L3EA 5IROD 3EBIA 4ODHL 1HXYB 3GMNB 4RRPM 3L1OH 1T1ZB 3F7RA 2Q87A 1UASA 2FHCA 3H9SA 2PTUA 2EXYD 4LLUA 2G60L 5L7XH 3IJHA 1JDAA 3CHOA 5E6ID 3O2WL 4JRLA 3ULVL 3VQ2C 4FGMA 5J13B 1Q90A 1M6OB 2B4CL 4UM9B 4K7PY 3EJYC 3MODH 3KWWA 2DDQH 4JQIA 3UPCA 4UNTA 2DQIH 1NICA 4WDIB 3C08L 5JOFA 1THAA 5K9QG 3KYMA 4I2XE 3KPSA 5B39G 4Z6AT 2UWEF 5DK0B 5AW9B 1HEJC 1AO7B 3CU7A 1S9WA 4X4XA 4YBQC 2UZXA 1ZGLM 4NRXA 2ZPKL 3ZE1B 1NFKA 4J8RA 3RIFK 1ZT4A 1FL5A 2G3NA 3UTTE 3NVQA 4ZRGA 1I1AA 2WWNA 1RZGB 4YX2L 4AZ8A 2ZKHL 3ATBA 3KZ8A 4QY8B 2LFEA 1J7VR 1UA6H 3ESPA 2ZZUT 4RGMC 3RWJB 4JZJB 5AVUB 4KZCA 1O6VA 3QAZB 8PAZA 4UTBL 4JFED 1Z2KA 3K7UA 1V3KA 5FYKH 4ZSOA 4BQCA 3C8KB 4HJUA 4DVRH 2DQ6A 5JNYB 2H3KA 5GRUL 3HHSA 5ABZA 1F1AA 4WI3A 4Y16C 1YMHA 2J8HA 2BZ7A 2RIKA 3DX8B 4E9XA 3GHBL 2VXTL 1MCKA 3G5VA 5CN1A 2CWRA 1NCAL 3MMEA 5D7LA 2YQBA 5EF0A 5EUKA 3WIFA 3CZLA 4ZFZA 4JY4B 3DA0A 4KVNH 4MA3A 3I3BA 2X09A 2WVSA 4JFYA 4I1PA 5AUMA 5F70A 2I9TB 3L17A 2DZEA 2R29L 4LF3A 3BP5A 1IGIH 2CRZA 2KZKA 5BUPA 1TLKA 2ZSWB 4OW6A 5KVEL 2A9AA 4BFOA 1E5YA 2ETWA 5CKAA 1I9RH 1JZDC 4GP4B 1LDPL 2GBTA 2EUWA 1PLGL 4I9WE 5F7KC 5EBWA 1TENA 1L6ZA 1W72A 2AQ3A 5CBAA 4DGWC 3BJLA 4N1HB 5KSUA 4JN2B 4JFFE 3MXVH 1TFPA 3FTGB 1SMAA 3L7EB 4AJ0A 4MXQD 3FOLA 4KI5E 3IN2A 5DJCB 4J3OC 2DKMA 4PRIA 2B1AL 2Q6WB 3U2SB 1AC6A 2C9PA 1BZ7A 3W9EA 4X9IA 2TRHA 2G5UA 1NBZA 5HGBA 3U6XS 1K6QL 3BZ5A 2WP3O 1SJVA 3O4OB 1G6RH 4HS3A 3GWJA 4OLWH 2KQNA 1YRKA 5E2WH 5HGDA 5I1CL 2IANE 1WO2A 1X5HA 3MRQB 3CDGA 2BNQD 1J9SA 3SDXB 1TJIH 3FSAA 2XBZA 3PQYD 5F3HA 5DJZB 3IJEA 5I1GH 3JYBA 4IMLA 4FQPA 4KV5F 2ESVE 3D52A 1XSKA 3N1GC 5C8JA 2AEPL 3U36A 4XPAL 3NSDA 4M3JA 1OLZA 4BSWB 2HT4C 1OO2A 1XHHA 3T4AB 3VNZA 4RFOH 3MXWH 3VO0A 3FQUB 1NCGA 3O6FD 1TQWA 1M56B 4LSRL 2WWMC 2Y7MA 2SEBB 4TQEH 1YG9A 5CBEA 3KR3H 2J5LB 2DQFA 3ILQD 1E5UI 3A47A 2IG2L 1JSYA 3LQAL 3AM8C 3QC6X 4AQOA 1QEXA 4EIUA 4NGHL 3Q2LA 2VC2H 5AYTA 4Q2ZA 3OD3A 1EEQA 4PUBL 4YR6B 3K2MC 2DLHA 4RISL 4HOZA 3EFOA 2YGQA 3GFUA 4UNUA 2K6YA 3BIBX 2VRAA 2WVVA 3L3IA 1S8DA 4UU9A 1SF5A 1ZCRA 1QMUA 4MCZB 4OCSH 1KLFB 4FXKB 5GIRA 1JHLL 2KERA 4UMSA 3KPQA 2Z4QA 4AQAB 5C0CB 3BUQA 3L3HA 4E9VA 1MDAA 3B9KA 2CGRL 4HIHB 4ZDHB 4EO5A 3FFCB 5G2NA 1DLHA 4NQCD 5B4MD 1CT8B 1RK0A 1OAUL 3CLFH 5C0AA 1MDTA 2DTSA 3CC5B 2AQ2A 3FT0A 4AWJC 4LEOB 3UBHA 3JV6A 1N0XL 4KUCD 4FYTA 2YAQA 3TU6A 2CRMA 3WFCL 4LBAA 3U83A 4DCQB 3T65A 2AITA 3UTOA 1RK1B 2J1KA 3UJJL 1UM5H 1I7UB 3IMTA 4PJFB 5LAXA 4JY5H 3SPGA 4AT6A 1Q94A 4FD0A 2H47C 2J43A 2MCAA 5IESL 3AZUA 3NZSA 4KK5D 2XZCH 1IQDB 1Q9OA 1QASA 2WVTA 4Y5YA 4NAMA 2R1XB 1KIPA 2YC1A 2UYLB 1QWNA 3BGMB 4YHIB 3GZKA 4J1UA 4KNTA 3MGTA 2VITB 5I28A 1HCZA 2XTJD 2CKBA 2UXTA 2NY1D 4YWGL 1HS6A 1J8KA 4Z8FL 3EAKA 4DKEH 3CLEL 1IAIM 1ONQB 5IVZB 1K8DB 4U05A 1BEYH 4KY1L 2P8MB 2QQNH 4BYHA 4PSRA 2A77L 1MFVA 1H9DA 4Q9BA 4BFNA 1HTYA 3RVWC 4WJ5B 2E7DA 2X4NA 3B2PA 3FPYA 4LPWA 4W81A 2ADIB 4E42B 1WAPA 4H44C 4NO3B 4X6CA 1VEMA 4ZZKA 5D70H 2GITA 4ZODA 3I6LE 4OQTL 1OGSA 1XGUA 2G2PA 5D6DA 4W68A 1ADQL 5G4OA 3VXPA 3IFOB 5E95B 4PJ5B 2QZ5A 3WFHA 4QRRD 2KBGA 4PJ7B 5D6DC 5IEKB 2PABA 3KH3A 3M45A 4DEUA 3CZEA 4PJ9D 1WDAA 4W93A 4X6DB 3WS6A 4OJAA 1ZK5A 3QA3A 4U1MA 4NFDA 1WSST 3MHZA 5CJQL 4D8OA 5IZ7A 5D7KE 2C9VA 1KJ3L 3WS6C 4GAYB 3RTLA 3QBTB 1UGNA 1RUQH 1UD4A 2AMUA 2V9QA 3BKCH 3ULUE 2WYTA 3H42H 1DQML 5K39B 3P2BA 1UZ8A 5HYQB 1JPFB 5D96C 2NQDA 2PTTB 1ERNA 3V10A 5K33A 3BN9D 2MCG1 5EO0B 4GRWB 4LOVA 5TE6L 2GJ6D 4KK9C 1P0SE 4JVWA 1J1OL 3ZMRA 5IFHH 5DMIL 2WTRA 3FUNA 1D6VH 2NDGA 2WUBH 3LH9A 1JWMA 3FN0L 3NIGF 3X1EA 3SBQA 2CO3A 1WIUA 3IDYC 1LP9F 2Z9TA 4AM0B 3MRRA 3HNVL 1A1NB 2ADGB 4CN1A 1B0GA 1KCBA 3EGXA 3WJMB 2NNAA 3JTSA 1HHHA 1HHJA 2QHRL 1LNUA 4JY6B 4NM8L 5JW4M 3N9GL 1F6AB 1E7UA 1HJBC 2DBLL 3CGTA 2E7LC 1KOAA 4DKDC 4V11A 1HINL 4JQXA 1M7IB 3MRGA 1OAJA 1Y7VA 5ITFB 4O9HH 4AL8H 4PJXA 2ATPB 4CVZA 1UJ3A 1QFWI 2D03L 4JQXC 3RDTB 2AXGB 3S97C 5L2KB 1N5YH 2OMWA 3T1WA 3O9WC 3NAAH 5F0JB 5DZLA 4X6BA 5CGTA 1DVSA 1D9KA 3WOVA 3NJJA 1XEUA 2GT9B 1N6QL 2ZOWA 3DVIA 3M7OA 4RFEA 2WMPA 1AXTL 4K9JA 3ZMNA 5KYXA 3RTQC 3QHFH 1SUJA 3V6ZA 1AG0A 1XXDC 4OSUL 2AQ1A 5CP7A 3IF1A 3TF4A 1LO5A 4IOIA 1JZHA 3GPSA 1U33A 5ICXB 5LKNA 3DUSB 2EABA 1EFXA 1YNTF 2AEQH 1QBLL 2CM5A 1QYGL 4GIAA 3ARBD 1G9ML 3AVEA 3MJ9L 1BLNB 4G8GD 2BERA 4BIKA 1JI2A 1JN6A 5DLML 3BUIA 4EZMA 1VKXB 3CZSA 1A9EA 4LLQA 3VFRA 1W0VA 1T0MB 3FMGH 4XNYH 4KKBD 1S9VB 4EN3D 1UB6A 5CEZL 4PG9B 5FW8A 2CG9X 2EVGA 3RUGA 1PCXA 3S34H 3PF2A 1HVXA 5DEFB 1D7DA 2EYSA 25C8H 1A2YB 1UZ6F 2O5XL 3QEGH 4OM0L 2GJJA 4G8EA 1I53A 2PPAA 3V4PL 1PIGA 1MHCB 4L4VB 4Y5VA 3WN5A 4W9IC 1RZ8A 4PJCE 1GAFL 1MSPA 4OR1A 3I9AA 5D1QC 5EBMB 2J6WA 3DVGA 2RJMA 4Y5VC 1FNGA 3WN5C 3LIZL 2EINB 4Q56A 2EEFA 2NX5E 1P53A 2VXSH 5C9JA 1G9NL 5IMMA 2XPGA 5ICUA 3SGEH 1R24A 4XX1E 1KV7A 4HHAA 2JELL 2OM5A 2YZ1A 4WKZB 5KBKA 3PJSB 2FJGA 4U6XB 5LN8A 1PY4A 5T3ZE 1Z1WA 1C08B 1FGNL 1PF3A 1SQMA 3TONA 1MN4A 1TQCB 4U3SA 3RI5K 1BDYA 5T8IA 2KKQA 5I6NA 1H3WM 3SJVA 4XCFL 1GJIA 5MENE 1P4IH 5AOMA 2DM7A 5C0NC 4M61B 3FTZA 4L9LB 1U95A 4KTDH 2XV2A 2CO6B 1MWAB 2FVNA 2K70A 3A67L 3TO4A 1NINA 3QQNA 4NJ9L 1T66C 3LZOA 2IBZX 3IU3B 4UZSA 3TO4C 5F7UA 1ZGLB 2EDWA 3QEUA 4Y2DA 4QJ3B 3BH9B 1NA8A 5L0QB 4MD5A 5E6SB 1FFPA 3FO9B 4J6RH 3PY9A 5E23A 3RFZC 3ECQA 3LTVA 4GMSL 2WWKO 2WXQA 5ILTL 1YUHB 2YRZA 3L3GA 4X5RA 5SWQA 1M71B 3RPIB 4HJTA 4MQ7A 5EMYA 1CFTA 4JDEB 2I9LA 5IQ7H 4G7YH 5MI0C 1CGYA 3V0WL 1ZANH 1EK3A 5FDYA 1MWOA 1JBJA 1MHEB 4B0MM 4FQXC 4DFHA 4MNHA 1RURH 3DOHA 1TCRA 5D7IA 1T04A 2XN9A 3ZR5A 1ORQB 3P3SA 2CO4A 4QRPA 3ZE1F 1G7HB 3ZQWA 2K8QA 4JZNA 1QUPA 2AEIT 1JGEA 1DQKA 1SOSA 5I1AA 4WI4A 1SEQH 3QS3A 3TIEB 1EZVY 3MYJA 4ADGA 1F3DH 2ZSVB 4P2RA 4AE1A 3BPNB 4LNRB 1BVLB 3FS9A 4LCIL 4NM4L 1E27A 1T83C 4HMDA 1CDIA 1UHVA 2YEZB 3MQIA 4FQQA 4F58L 2WLLB 3X12B 5GZOC 2ZKMX 1RJCA 5BVJB 4YDJB 2W07A 1KEGH 2B16A 3C6EA 3D2UB 3IJ7A 4N2LA 4GAAA 1SHXA 2YMTA 5AB9A 5I30H 2M2DA 4M7KH 4MQSB 5C09B 5EEXA 4DP8X 4DQAA 4F2FA 3FU6A 3HRZB 3PGFH 3MNZA 1TSRA 2E76C 4ZFQA 1P84J 4JFZH 4F9PC 3VXMA 1X4XA 1V7MH 1FUNA 1MRFL 4JFOB 1U8NA 1F4WL 3A22A 4NUGL 2ICES 3S6CA 2OS7A 5DJ2A 3QQ9D 4M1GH 1MCEA 2KMWA 5E9AA 3CDCA 3BHBA 1B9KA 4G59C 4X8JA 5E51A 1AR1D 1OOWA 3A6CH 5IMOB 1HZHL 3VAEA 1B0IA 4CBZA 1MOEA 1CI3M 4TRPL 1MCQA 1L6XA 2PXYB 3BX7C 4N2DA 4FERA 1KTDB 2FT7A 3ZHNA 3OJDB 4E9QA 5ISZE 3PQYB 1NKRA 2OMTA 1FV1A 2F8VA 5DD5L 1BD2B 4AQ8C 4X4YB 4M1DL 1E90A 1QG3A 3MV9B 4XNQB 4O2CA 3TPKA 4LT7A 4XO3A 1O9VA 5SWZB 3DO7B 5DQDH 1QLEL 7FABH 2BW4A 2GY7B 3G7TA 2LU5A 4U6VH 2IQAA 4UT6H 2VLRE 4AQEB 2YD6A 2EZ0D 4JRYE 1CE1H 2WB7A 4JRXA 5C1MB 4J3OH 1S5IH 5EOTA 5T5NG 1B4JH 1EJ8A 1GPOH 4GAFB 2CBQA 3RGVB 1I85A 2YSSB 2OLDA 1CMOA 2G2RA 2AZAA 4HCGA 4FADA 3IDJA 1B90A 1SOQA 4LPUA 5K9OA 4YQXL 3L9RA 1L7TL 1ACYL 4MTMA 4JPVH 1GC1C 1QO3B 3GKZA 4OIBA 1KPUA 3HNSL 2Y7QA 3K4DA 5A1AA 3BKYL 4GXVH 5DVNA 5I0XA 1OPGH 2OMUA 1PKQE 1UT2A 3ZDZB 5IV2B 1G7QA 2K7QA 2G3XA 3GLDA 1JPSH 3CDYA 4AMKL 3GTTA 3TWCL 1R1CA 3E2HC 1YNLL 5EIIG 4FL4B 2FK9A 3F83A 4J7RA 4UUJB 1JUFB 4RBPH 4N5UA 1PG7H 3OKLA 4M5TA 1VGEH 1ETA1 1FF5A 1NGXA 4K9EH 4U1GB 2VB5A 4L3CA 1UTDA 5I8CA 3EJSA 4BBWA 2BMKB 4AJWA 1XT5A 2APSA 4ELDA 5TDNB 4G6KH 4JGJA 1KACB 2X3CA 1M9WA 5KYUB 3DURA 1AP2A 3MX0B 4L9DA 3D07A 2WANA 2IXQA 1PIFA 2EDLA 2QSCH 4FDWA 4GAGL 1IEAB 2BVTA 2ZKWA 1N18A 4J12A 2LLGA 1NAMA 4HKXB 2QQKH 3WXVH 4ZUWB 3GMPB 4WJKB 4QTHB 3DSNB 4WUUD 1KTRL 2XWBB 1RJYB 3QI9D 3SGDI 4ES8A 1XH0A 4HOWA 2W9EH 3KBEA 5TE4H 1AQDB 4MA8L 4J3XA 4OZIB 2Z1PA 4JL2A 2GKIA 1E4WL 1FL6B 2EKSB 4GO6B 4BZ1H 3E1F1 1HEHC 2NTSP 2X2IA 4OD1L 1NCWH 3QGVA 4P46B 3U4BL 4HUUB 3MV7A 3QJSB 1R3LA 3L3DA 3N85H 1WFNA 1S7SA 4BCXA 2PYEB 5BRZE 1NL0L 1UQSA 4URKA 4NYLA 1OM9A 3ISRA 4PBDA 1IGFL 3X14B 4HQQH 5L8LB 5DMYA 5KYWA 4DKFL 3GLEA 4U0RB 2EC8A 4HXAL 5DZPA 5K9QI 4ZOBA 3DJSA 2EXSA 3CVIL 1HCVA 2FSEA 2YKLL 3GI8H 2BOCA 3TEXA 4TUOB 4H5SB 1LD9A 4CJ1A 4LVHB 2MWCA 4UAOB 2XWCA 5E9NA 4IJ3B 5HHVH 3SKJL 4G8FB 2R2CA 4G9DA 2B08A 1GSMA 3THML 2JB5L 2P5EE 3CSTA 2G4GA 5J5EA 3U0TB 2W1NA 1R3HB 3BCFA 4KDTA 3ULVD 3EYSH 1TZOA 1FNAA 4FOMA 4KKLD 4M5SA 1F00I 4PJ9B 1GL4B 2ZOKA 2Y36L 1D5IH 1WWCA 4XP9L 5J89A 1A4JA 1SMOA 4F2EA 3ZRFC 2EH7H 1UXMA 3VSQA 5L4MA 1OAKH 4GI9A 3EUDA 1WJ3A 1DCEA 2H32B 2G75B 1DBMH 4OF0A 1TZIB 2HT2C 2GHZA 3WCYA 3HR6A 5C07E 1RIUH 3OQ3B 2PWGA 5L4FA 4JHZA 4C56A 2DQJL 1FFOB 4UIKL 2GG1A 5GRJL 3NPZB 2GBAA 3STZA 6PAZA 2FRGP 3GJFH 5JHMA 5HHME 4A6YL 2VN4A 4P05A 2EO1A 4MJ6B 4U1JB 4XNXH 4ONGH 4IBUA 4ABWA 2PCXA 4XBGB 1A6UL 5IM7A 3K6FA 3H3KA 1E9OA 4ODHH 3BZEB 1S46A 3VQLA 2FNBA 2FR4B 1CD8A 2RB8A 4KK6D 1IM9A 3GRWL 2CGYA 3KCWA 3GSNA 2JJWA 3VXQB 3O2WH 2OXGA 2XSKA 3C87A 4G7QB 1BM3L 2W0FB 3HS9A 4KO7A 1DQJB 3VRIA 1XD1A 1NC4D 1U0QA 4HX1A 4BXSV 3FUJA 3C08H 4JE4B 4WHYH 2EDYA 3H1ZA 2ZP0T 3F12A 5FGBC 4O51A 3NFPA 5EFIB 4RDQF 2ZWSA 4O02L 3G5XA 1TUPA 1NDMB 3EBGA 4GIPD 5I1LB 2O93L 3QNZA 2OX5B 2A9DA 3VACA 1R3JB 5HHNA 1X7TA 4NLAA 3E0GA 1SJHB 3GTVA 1FYTE 2H0PA 3B2XA 3MBED 2ZPKH 4PJIB 2WBJB 4P8QA 5C0IA 3NRQA 4ELKB 1I31A 1GGUA 5F93C 4XNZC 1WA0X 1L7IH 1WZ1H 3BKML 5DI8B 1PZ2A 3RAJL 3UYPB 5FV2A 3MAWA 2YS4A 4M7LT 1CBVH 4FQ1H 1MFBH 1N3NB 3WNKA 4DTGL 3QFGA 5A2KH 3I75A 1KBWA 1I75A 1MCOH 1A1OB 1K5NA 2ZKHH 5EDXA 3VGAB 1KXVC 5I17B 5IOPB 5CEYA 2LAAA 5J12B 2E5EA 2AHIA 2FL5B 2X70B 1YYML 4FC3E 5IB1A 3IXAB 5JOPD 1BJ1J 4ZTEA 5KSAC 4IHOB 3O3DA 3DVNB 3V4LA 3B3IA 3QG6B 3MLXL 5I16B 4HS8L 1UD8A 4P59H 1XIWB 2X1QA 3WV0A 2PWEA 5DF0A 5TQ2H 5I82A 3ILPB 4UT9A 5E8NB 1RULL 2VXTH 3SDCA 4HVBA 3HNTL 4XN7A 1JVLA 4QCIB 3ASOB 1QD0A 2VDRL 3DRTA 3SCMB 1ESOA 4FFYA 4JCLA 5A2BA 5IB4B 1WBYB 5D7JB 4KMLB 2VLKD 5FM5O 3IDIB 3PPSA 3K0WA 2AXWA 4YBHA 5F89B 3GSRA 5IJKA 1JGDA 1QNZL 4WO4A 2WK2A 5L6YH 1T2JA 4PCKA 3RIKA 2DTML 4CMHB 4DK3A 5HP5A 2BIQA 5IJKC 1DQQB 5JR1H 1Q9WA 2V0AA 3MLVL 3C12A 5ESQB 2IMMA 4MA1B 4BFJA 2GBVA 4XC3L 4QOKE 1OW0A 2MCPL 1QBAA 4PJHE 3O8XA 4ZPTB 1WK0A 3O6LH 5JW5B 3LSOA 2R9HD 1MG2C 1X7QA 4D9LH 3O8XC 3K71B 2JCWA 4XBEL 4JM0A 3EOBB 3QUZB 4PRHA 1WQVT 4P23D 4HUXB 4RMBA 4O4YL 4AEFA 1K6QH 3GB7A 4G1EB 1DUZA 4YEEA 3VB9A 4O58H 4M7LL 1DO6A 3HG2A 3BIKA 4KDWA 5CJ5A 3MV11 1DR9A 4BE6A 5DWPA 1GS8A 5AVTB 3BJ91 3LEYH 4DO4A 1A7NH 5KUKA 3CK0H 4XB8A 3ABGA 4ENEC 2AEPH 5KN5B 2AKRA 5INDB 4N0UA 5HHOD 6FABL 1M7DB 1FZJB 5DVMA 1XCQA 3WKQA 2K3HA 2WSKA 3S5ZA 4MXVF 1TTGA 4EI5D 3HKFA 4LSRH 4YNYA 4ZMLA 1HJCA 3S3BB 1BZQK 32C2B 2HMID 1D5ZB 3DTXB 3P9WB 5B7FA 3DDGA 5DRXA 2B1OA 4G6AC 4B0MB 4YHNB 2IG2H 4Z3JA 3LQAH 5H35A 3WFBL 3V7AG 3CVDA 1CU4H 3P73B 4Y4KB 5E2JA 4PUBH 1JZ7A 1CLCA 2DWXA 1ZKAA 4HYTB 4Y1AA 2YPVL 3ILDA 2BVPA 4Y2NA 3CZJA 4RISH 1E28A 3VWJB 5CFHA 4K3GA 2O5ZL 4OVVA 3NCYS 1XF5A 3UP1A 4V1DA 2APVA 4X7DC 2EE6A 4KJYA 5FO8B 1SOXA 5SWSB 4KI5F 5MHSE 1ZOXA 1S78D 3HE6B 1YC8A 1NMCB 5CKGA 4P4KD 2ZCZA 4U7MA 4M00A 5DO2D 2XJLA 3W82A 3L8QA 5CGBA 4G7RB 2VDOL 2KL6A 5H37H 4CKQA 1UH4A 2XA8H 3NSFA 3NDYE 1KJVA 5E5UB 2CGRH 3SQBA 2WLKA 3ILEA 3QEQD 1RZPA 5GGRY 4XWOC 3FU5A 1HX0A 1OAUH 4C58B 3QIWA 3IMRA 2WXIA 4AIZA 1A64A 1AACA 1KGCE 3MCLL 2XETA 3A6BL 4HBCL 3FB8A 4F3FA 1RUMH 4GBXB 2ARJB 2ITCB 3QIWC 4LOFA 4OGAD 1FNSH 3QO1A 4TVPE 2NLJA 3ISYA 4P2YA 2WXRA 1U8MA 2R7EA 3NJLA 5F71A 4WWOA 1NC2A 2ILLA 5HYIA 1E4KA 1Q72L 2ENSA 4HXBH 3NJKA 3CMOH 4U1LB 2JKIS 1BYOA 2F53D 3PWPD 4Y5XC 4F7TB 5IESH 1BM7A 1QBMH 2P8PA 3FU7A 3SDDC 4UQ3A 3LD8B 3VXUE 4X98A 3PWVA 3V0AC 3Q2WA 3C09B 3BRGC 5GGQL 2AJXH 4WEBL 1IM3B 4WIQA 5CIPH 4NZTH 2WXJA 2XG4A 2PR4H 4ZMPA 2JCCF 2Q76A 4TKWA 1CC3A 4ANVA 4CILA 4MX7A 1N59A 1JK9B 1BJ1H 4MMYA 3WEXB 3V5KA 5CUSH 4YWGH 4Z8FH 3AWGA 3CLEH 1IV8A 1S7VA 2GTWB 4A66A 1ICTA 1LGVA 5IG7A 1TNNA 4S1QL 2IOIA 1JV5B 3FUKA 2J20A 2DIBA 4HKJA 4PV1C 4X7TB 1ES0B 2IAMD 4PLOB 4Y4HC 3SBRA 4GW4B 5DYOA 5E2UH 5ICYB 5HPOA 2OULB 1XL4A 3U0WL 2J44A 3WNPA 2D0GA 4H88L 4JQIL 1BV8A 5L2JA 2DYPD 4NZ8A 2ZG2A 1YNKL 2DS4A 2JJTC 4LHUG 2BSSA 2B39A 4FXGB 3RKDC 7PCYA 4OQTH 3KLHD 5JLZA 1UVQB 3RNQB 5IHZA 3MNDA 1ADQH 4K3DH 1I3GL 5FWQA 4FFZL 2HLAB 3BEWA 4WHTB 5CSZB 1WBZA 3MNWB 1L5GB 1ZWIB 5ACMA 1BG1A 4EUPH 3UROR 4CU6A 1JXKA 2H1LM 3PUCA 4IRJB 3OG4B 2CIIA 4F7MB 2Q7NA 2ZUYA 2VUKA 2ZYRA 1KJ3H 3F5WB 4X8XA 1DUYA 1QSFD 1GKOA 4P4RA 4KRLB 3EBAA 4ZFOL 1UH2A 2DWDB 4XN5A 5D7HA 2HT3C 2VOTA 3MRNB 1DQMH 1RIVL 3KG5A 3ZTNL 1W0WA 2R8SH 2ED8A 1HESA 2H8PA 1V7NH 5CLZA 2BZDA 5H2BB 2V7NA 3FQ1A 4GKZA 4DN3L 5TE6H 2R2BA 2FAUA 3T0AA 3MLPA 2VJ8A 2E9GA 2W94A 3PGDB 4P2CG 4YC2C 4WWKC 4OI8A 5DZ9A 3WAJA 3OPZL 3DETD 3MLRL 3TN0C 5I5MA 3QZLA 1I8KA 3ARFD 2QVTA 3HNVH 2B2XH 4GW1B 1BX2B 3MUZ1 1C5CL 3TLRA 3IDMA 3S37X 4NFBA 1N8ZA 5C0GB 5MEOA 5FX3A 1XEDA 1WFJA 2XXMB 2QHRH 2HJFB 1CZ8H 2J1WA 4WENB 1MCRA 1KIUA 4Y19D 1ET8A 2MOVA 2DM4A 5CEZD 2GEQA 3VSUA 5F0LB 1E9PA 4CVXA 4ZMVA 3MFFB 4QRSB 4ZZFA 2FHFA 2B20A 1ETB1 2X89A 4PS8A 1AANA 2VKWA 1CCZA 2D3NA 1HXYA 3VD4A 3P0VL 1HQ4A 2DOCA 2WBWB 4F2MB 4KDVA 4MJID 1W72L 3BFOA 5EU7E 1VERA 1X6NA 2B3IA 1RUPL 4CSSA 4AV0A 5F6IC 4IOSD 1JPGB 4OSUH 2VMJA 3QPKA 4Y4FD 5L4JA 2MHAB 1IMHC 3F8UB 2WC7A 1E67A 1M6OA 4IRZA 3RY5A 1JV2A 4C4BA 1QBLH 3D3VE 4WUKL 4XCNA 4APXB 4BQ9A 1G9MH 3MJ9H 4BZYA 4ETYA 3ULUF 1BJ8A 3O4LD 1OT2A 4FTVE 1HAUA 2YAOA 4U1NB 4X99B 4XN9A 3R8QA 3MO1B 4Z3IA 4Q74A 1DVXA 4HOXA 4EOWL 1OL0A 1BBJB 5DK0A 3GSUB 3TF7C 2WJ7A 2G9KA 2JIXA 3D9AH 3AC0A 3L48A 3LRGA 3QJZA 4JQVA 2V17L 1KTKE 4XPFL 4EN2A 3FSWA 5CEZH 4IBYA 4MMZC 2V2TB 4JQVC 5CZVH 3VXRD 4KJWC 4ODBD 4JG5A 4W4NA 1E4XL 1XL6A 3FAXA 5EUOB 4QY8A 1FCGA 1ZV9A 3VSTA 2O5XH 1B2WL 4OM0H 3HI1B 4J4PD 1TF4A 2WXLA 3V4PH 1T20A 4EZKA 1EH9A 4JZJA 3FO0L 3LXCA 4ZOCA 3ES6B 3NSYA 5ANMB 2YD2A 1FLTX 3KW7A 3LQMA 1NANH 1OZUA 1QX1A 5A6MA 1PFCA 3C8KA 5JNYA 2VL5B 1WGOA 4NSKB 2FWSA 3LIZH 3L7FB 2F1AA 4YFDB 2MEJB 2UX7A 2EH8L 5FGRA 1G9NH 5E8PA 3QWRD 2LR4A 1JF1B 2Y0SA 4BQBA 4C83B 4EZJA 4C57C 2MTAA 2JELH 3BISA 2IOOA 2AJSH 4L8DA 2VMFA 1NKGA 1ITCA 3DHUA 4JFSA 4JY4A 3Q6GL 5D1XE 2Z8VC 1RUAL 4QRUB 1JWSB 4AK1A 4HPHA 1LILA 4LIQL 1FGNH 2WNWA 4ADJA 2I9TA 4GYBA 3B2VL 4PREA 4Z7QB 4UBDD 3O6KH 4KAQL 2IH1B 4F8LA 2J1ZA 1A14L 1GYWA 1WG3A 1BA9A 2ZSWA 4A39A 4Y8AA 4FXLA 4R90L 3A67H 1O5DT 2APWA 4I3RL 3QDJB 6CGTA 2Q3XA 5IT2L 2QKIA 4UILH 3TVMD 5FFLA 2N1TE 4OLXL 2QKIC 3VUAA 3W11C 3FTGA 1WFIA 3PWJB 4Y1SA 5ILTH 5CU5A 3PDGA 1ACCA 4GG6B 5J57B 1IGYB 2C3HA 2E3VA 5I74B 2Q6WA 3U2SA 4K0OA 3DGCR 3SQOH 4IBTA 3IRPX 5LXGL 4ZOEA 4YHYB 2ED9A 1EGJA 2I25N 2ENJA 4K71B 5EIIB 3SDAD 1ZVYA 2YUWA 2P47B 4PJCF 5B7MA 2BXYA 4YDKL 1AJ7L 3C2SA 3MRQA 2VXVH 5EC1B 4LPCA 5EORH 2D0FA 1BXXA 5IJBC 5DR5L 8FABB 1Y0LA 3TZVD 5DJZA 1OT1A 2V3DA 1BZEA 4R7DB 1H5BB 4FN0A 4IJTA 2FJSA 2HRHA 5FLVA 1M2VB 4IU3B 1JTOA 3EH2A 3P2DA 1BGXL 3UERA 5FYJD 3GSVA 4BSWA 5K9JL 1BVNP 3T4AA 5L2KE 1LEIB 1WT5A 3A4AA 3GZOA 3FQUA 5EPMB 5DMJB 5FO9B 2I60L 4HOMA 2P45B 4A7GF 5B1JC 2ZAGA 1ZT7A 2XN1A 4LCIH 3DDFA 4NM4H 3N40P 4E9RA 3AG2B 4TPRL 3S37L 5J11B 2P5WE 2E7MA 2NSQA 2J6EA 4TNFA 4M62H 1ULVA 3GINA 2QMKA 1ORSB 3Q2CA 4UIMB 5CWSA 4AEHL 1ZPUA 5BMFL 1UM6L 5I0DA 3EJQA 1OV8A 4YR6A 4PGDB 3UZEA 4G80A 2ZCKH 4JM2B 1I9JL 4BKLA 4TOYL 3EO0B 1Q38A 1SY6A 4PMFA 4A2DA 5C0JA 2Y6TE 4PRDB 5KZCB 2EEDA 3UZEC 4EI6B 3W0WE 1IKNA 4HAGA 4JHWL 4DQOL 3U46B 4NQDD 1F4WH 4NUGH 4R4ND 3TBSB 1LEKB 2ZX8A 4MCZA 4GS7C 4LLVA 4MAYB 5HGAA 4EPSA 4P2OB 1U3YA 4U3HA 4X9YA 4GQZA 5C0CA 4HIHA 4ZDHA 4DGUA 4TRPH 3FFCA 3UAEA 1XZ0B 2FEDD 2MRYA 4F8NA 4OB5H 3SY0B 2WSPA 3CC5A 2MNUA 1WC7B 4KFMA 4LEOA 1GOFA 1WPCA 1GS7A 2AQRA 1KYUA 3QCVL 2EIMB 4AENB 2UY7B 5JHLA 1G1CA 3CSYB 4M1DH 2NYYC 2ZXEB 4GP5B 1OAYH 1OLLA 1P4BH 3CCHB 5AEAA 1TZGL 1K72A 3RHWF 5BUAA 1KTCA 1I7UA 1I7ZB 2F2HA 5EG6C 3QQ4B 4HLZH 3CXFA 2VDNB 4XO9A 4XVUC 5IBLD 3K4ZA 1M42A 3ATAA 1CXIA 4JFUA 1QI5A 1R19A 3VJ6B 5ERWB 2VAJA 3MA9H 2R1XA 1U8LB 3HUJB 1MCLA 3C6LB 2UYLA 4CUCA 3BGMA 3T6VA 4S0SD 3G08B 3SIKA 4Z3TA 2VITA 4KXZI 1IUZA 4K3HA 4OM1L 5LGKA 3PHOB 1L7TH 2VSDA 1BQSA 3IJYB 1ONQA 2NY4B 4RFNC 1PAZA 5IVZA 3QULA 5DD0H 2P8MA 4NO2B 4LZKA 1RIHL 1TPXC 4WJ5A 4J2QA 3BRFA 2YJLA 2J88L 4PJEE 5EOCJ 4AMKH 1T21A 3DX4A 2ADIA 3VXOB 4E42A 1A4BA 4P4KB 4L8CB 1L3WA 2Z31A 3CJJA 3HC3H 4FAAB 4L1BA 4NKMA 4BGLA 4OCMC 3IFOA 4CSZA 2Z31C 4RGND 1DJGA 2BVYA 5BOPA 5IEKA 1EIBA 2OAAA 4X6DA 3LZPA 4CRPA 1Y1DA 3CFDA 4DESA 1ZGLP 4U49A 3T8VA 2DLIA 3QJXA 3NPSC 3V4VA 1CLYL 3FO1B 3G9AB 4JFEE 3QIUC 2OL3B 2A74C 3LNGA 4K7PX 2G5BA 2J3SA 1AQKH 1ZVNA 3KNBB 5BNXD 3LKOB 1T0PB 2J8UE 3FZUD 3LZNA 2F8IA 4R2GC 1PLAA 5DD1L 3RU8L 5HYQA 2PTTA 2W0LA 2ZCLL 4PJBB 2VLJD 2VJ0A 2AK4D 5EO0A 5KVFE 3S4SA 2LU7A 1FL3B 3S9DB 4MA8H 1T4KB 3KGRA 1HI6B 4UAHA 2CCLA 1YQVL 2W88A 3CN4A 3QYNA 3GIZL 1EJFA 1PZ5A 1E4WH 5EN2A 2CA4A 5I5JA 4U31A 5D93B 2BNRB 1DVZA 4AM0A 3BESR 2VH5H 3UZVB 4DN4H 2ADGA 1NL0H 5B8CC 4NWUL 4HIPA 3JWNC 3OKEB 2CCVA 5F88A 5AW7B 4JB9L 4Z7UE 4DKFH 5LNGA 4I0PD 4JY6A 4Q4EA 2EYTB 4GQQA 3FB6B 2ADYA 1NIAA 3CFCH 3CVIH 3P9MB 1A7PL 2QT6A 4EAEA 5ITFA 1DBBH 2ATPA 2R51A 2OCCB 3RDTA 3LEVL 2AXGA 3QW9A 1YEJL 1H0DB 1U8CB 3SKJH 4F1ZA 3DX6B 4Y7OC 3D7PA 2VM9A 4X6EB 1GGCL 3THMH 1QR1B 1KB3A 2GT9A 3L4CA 2CR0A 3QORC 3SN6N 4HJSA 1XDTT 2OCFD 4CC4C 2H9GB 1PYWB 4XP9H 1HXKA 4JZOB 4GXUM 4EF3A 1DSYA 2CMRL 2BNQE 4FJZA 2DPKA 4GFTB 3PQYE 1EEZB 1BLNA 1LE5A 4BDVA 3VXSB 1J11A 2Z91B 1UJTA 1VKXA 2A38A 2F7PA 1AH1A 3EDEA 1PD6A 1NGWB 2QADD 2WKLA 4WW1A 4R96B 4UIKH 5GRJH 3IKKA 2OJZL 4LCUA 2P80D 1ED3A 3HLKA 4PG9A 2A9ML 2NW3B 4WW2B 4UOW0 4I0KA 4GRLD 15C8H 1CD1B 2BSDA 3VRJB 5DS1A 5INCB 2G3ZA 1JVKA 2HCZX 2NNRA 5D5ME 2R83A 5DEFA 4NX0A 1TIUA 1OSPH 1X5AA 4A7VA 3GRWH 4PJGB 1A2YA 1F0LA 3HC2A 1I7RB 3LPFA 4P2QD 3JSSA 4Y19B 2VE6B 1MHCA 3CAFA 3L5XL 3LNHA 3RVVD 2DJSA 2NY3C 1CFNB 4F7PB 5DJ0B 3FU0A 1P7KB 3L1EA 1A47A 5EBMA 2UUDH 4AYMC 3HMXA 3D06A 3SE6A 3H0TB 4AZUA 1IFHL 3QVAA 4N0CC 1W8NA 5IF0B 2ALWA 1XR8B 5FOJA 1RI8A 4O02H 1HKLH 3AJ7A 3UMTA 5CEXB 4ABVA 1L4IA 3WE6B 4RRPA 5GGRA 3D5OF 2BIOA 4UI2A 3MBXL 1JWUB 3N91A 4YAQB 5MEPB 3E8UL 4WKZA 5DYFA 2OYMA 3PJSA 5I5RA 1ZTXE 5E6RB 2C5DC 2WJ5A 3BVVA 4UNIA 5IHHA 2C3WA 4Z5RA 3MROB 1N10A 1Z5HA 3BKMH 1C08A 1S7RB 4NQCE 4UB0L 1MAML 4ZXBC 3RVXD 3T0ED 2OQJB 1RZQA 2Y1YA 3APNA 5DQJB 9CGTA 4YO0A 5T1MA 1MJJB 4PWFA 1ETZA 4MS8D 1Q9KB 3I3EA 3I84A 2H3NB 4J8QA 4L9LA 3S8GB 1IC7H 1YYMH 4MGXA 5KBDA 2CO6A 3GSOB 3N1MC 3H4FA 4JKMA 1IC4L 5HDOA 4D7PA 3IU3A 3ME0A 4HGWB 3MLXH 1ZGLA 2Z7ZA 2YMXL 3BH9A 3WXWH 1B88A 1UXLA 3FO9A 1MW1A 5HVFB 3HFFA 1KF9B 3FCUB 1RZKC 5J0BA 3IFNH 1YUHA 3VXRB 5F1OB 4OZIE 1RULH 2J4WL 1FZMB 2QV2A 4HJ0D 4YZFE 2DWTA 3RPIA 3AMLA 2KZBA 2E8ZA 1H6UA 2XTJE 1E50A 2IH3B 1V10A 1BFSA 1KCSL 5B38G 1TYJA 3QUXC 3ALPA 3VWKA 4K7PL 4KI5C 3LVEA 2D9CA 5KBNC 1UWXH 4UOW1 4ZYKB 2NZ9C 3KH4A 3VWKC 1MHEA 4JREC 4XO4A 1QNZH 2V2WB 1CGSH 4ESKA 4D8PB 5IR1A 2DTMH 5C6PB 5DQ9A 1YEFL 4ELME 1Z5LB 3QXWA 2C9SA 1ORQA 3MLVH 4OCNC 4NO0B 4QRTA 3BZFA 3ZVVA 1G7HA 4WFHE 4Z7VE 1U8QB 1RXLA 1QRND 4G42A 1MJ8L 2R56L 3L9EA 3WBDA 3EXJA 5EF2A 5BZWB 3FQNB 2ZSVA 3IS0X 4H2CA 2FIKB 3L9BA 3ZGHA 5EUOF 2VQ4A 4LNRA 4QRRE 3OKMB 1NQBA 2PO6D 4PU2A 1FNEB 4XBEH 2YEZA 1ECYA 1HH9B 2HX8A 5FC9A 5K93A 2WLLA 4TS6A 3X12A 1KZQA 4O4YH 2H41A 2JCCA 3SE9H 3HJEA 5T3XL 5FM4A 5T3ZL 5BVJA 4FULA 1P2CB 4YDJA 3NSJA 1A4KB 3D2UA 4OGYH 2EECA 4IGBD 1Q0EA 3HE7B 1WUZA 2LU3A 4M7LH 4LHUB 3QZMA 2C9XA 2K9UA 2UZIL 2CXGA 5KVDH 5GRZA 2Y22A 2NZ1A 1CFMA 5BV7B 3DHMA 3HRZA 2XZAL 3TA3D 5GRXG 3FU8A 1EEUA 3MBWB 3WD5L 1AXSB 3G5YB 2GJ6E 1FZKB 1NAML 2H45A 4PCSA 5ECJE 5DZAA 4E41D 2ODHA 2FJUB 2HLFC 5DHMC 6FABH 2V3EA 1XV8A 5IB2B 1BJMA 3HZYB 2Q8AL 2BSED 3C5SA 1DSWA 5IMOA 3DK0A 1ZHLB 4NKIL 1K3IA 1ZVHA 4Z7QF 3WKMH 1DANU 4QNPE 5I0WA 1WS8A 4LLAA 5LQBH 2JK5B 2PXYA 5CD5D