4P9HC

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
176
structure length
167
Chain Sequence
KVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLTIEDSDTYICEVEDQKEEVQLLVFGLTANSDQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLDSGTWTCTVLQNQKKVEFKIDIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 28
structure length 167
sequence length 176
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC02
3V6BR 1MWAB 3BIKA 1RURL 5L8JB 3VG0H 4NJ9H 3AM8C 1AXTH 4YGAB 4F37K 2F74B 1IKNA 1QVOB 2BDNL 1CDCA 4ZQKA 1HQ4A 2GAZB 2JJWA 2CO7B 1BQHG 1ZGLP 1FZOA 4HDIB 3VXTB 3FB6B 4GW1B 2DQHL 2FD6H 4LAJH 1MI5B 1YEJL 3G08B 4JPIA 3AU1B 1HHKB 2PCPB 4M7KH 2VZTA 3MOBL 5HHMB 1OPGL 5C6TL 5HHMD 3HE6B 3HAEG 3PDOA 4UTBH 3OAUH 2D31A 2PETA 1FYHB 4BSJA 1T1YA 3QDMA 4HCRH 3U7WH 4HWZA 4MD0B 5F7NC 3VFRA 1CL7L 2GSIA 1DTUA 4PG2C 3BJ91 4EI5B 1NGZA 3PWLA 2V7HA 4EN3A 4DN3L 1U42A 3VFOB 4JY5L 3TH4T 3ARBA 3ULUF 3OB8A 3N1GC 4ZUUA 4EBQL 1XF4B 4YEFA 3GMLB 4OLYH 5CJXA 4FHBD 2XI9A 4X5XA 5E4EC 3M07A 4YZFE 5IQ9B 4JB9H 2G5BB 1GXEA 2BMKB 3W9EA 3MGAA 3HAEH 5E1AA 2FIKA 4KDVA 2W0LA 3OR6A 3ES6A 3KPQA 5L2JB 5M7QA 1SJHA 3I9GH 3QRGL 4CN6A 2EDTA 1VESA 3VMOA 3QQ4B 3FZUD 3LCYA 1IAMA 1DVFA 2Z8SA 3MXVL 1NJ9B 5DD0L 2CKBL 1YC8A 2AQ3A 3QFJE 3MRGA 4NQEE 5I1JH 1X5IA 3FB7A 2DQEL 4F33B 4H26A 1WZLA 4X6DB 3I6LD 2AK4A 1C12B 1NCDL 2GSGA 4OGXH 3RX8A 4KWUA 4CJ0A 4R8WL 5IGXL 1A7OH 1ADQL 5E08H 2ERJC 1OSPL 4QRPB 2R15A 4LLWB 3G9VA 3IJSB 3IB4A 2VDLL 3EDDA 3WJJA 2ZUYA 2J12B 4X98B 4S2SB 1C5CL 1HDMB 1ZHKB 1C1EH 2YRPA 3SGEI 2UVEA 3J7HA 1G7QA 3LSOB 3IXTA 4ONGH 1T03L 4U3HA 4KHTH 3WHE1 2IF7A 3UTZA 5JXEC 5J57B 3PJSA 1AE6H 4LPTA 2YOCA 3ZO0A 1OAZH 4HFWA 3I02B 5B38B 4M43L 5GGVL 2X5PA 4CAGA 1BPVA 1RZGA 4JFZH 2CR6A 3HUJF 4AH2B 1INDL 5ITFA 1WT5C 4DAGH 4RQQA 5C08D 2IWGA 2XWTB 4WTWA 1JGDA 5BJTB 3V0WL 3VXME 1G7MB 3GMRA 1CDJA 1MAJA 1VENA 4WUKH 3LQAH 3MC0A 3DV4A 5KSAB 4BM7A 4K71C 5DQ9B 2BCKA 3MMEB 5FOJA 3SDXB 4ZS6C 3CDGB 1RZIA 1MFDH 5CEXA 1P7QD 4XBPB 4P3WA 2H32B 4PJ8A 3QEUB 4EUPB 1I8LA 2GFBA 2DICA 3ZDZE 3H9ZA 1NEZA 4XNZB 1JNNL 2HRLA 4MD5A 1DANU 2JIXA 2D7NA 5TDNA 5DHVH 1KTDB 5AAMA 2VDMH 1ES0A 3K8LA 2GJ6A 1WIOA 4LSPH 3QEQE 3O6FC 1M6OB 1U8LB 4KU1A 2XQYG 3CVHB 3SCMC 4PS4L 3MROB 1DLFH 4XBGB 4YDVB 2HT2C 3GEWB 1B9ZA 3MXWH 3UYOD 1V3MA 3KWWA 2XKNA 4NKIH 1UEMA 1PDKA 4MZ3A 4Z7WE 2I07B 2R56H 3LQZB 3NVQA 5T5NG 3G04B 4A6YA 1AKJA 5T3ZD 3P11L 5IFAL 3RNQB 3VJ6A 1DEEA 4ZTPH 5E24E 4AZ8A 2C5DC 1YEHL 1U0QA 3Q6FB 1GL4B 4L4VB 2A74B 3HR5A 4M7JL 1NC2D 4XI5D 1FL6A 4UBDD 3FT2A 5EU4B 3IAGC 1BD2B 2EH7H 4GW5A 4PLKC 3MV7A 4U1LB 3L9RB 3WNNA 3O45B 1GOFA 1NDGA 2R2BB 5I17B 5JOFA 5KZCD 4Q6IB 1OOAA 2OL3H 4H8WC 4IMKC 4MVBC 5JZ7D 2CRZA 4H20H 2P24B 5CD5C 2O5XL 5IW1B 3S96A 5D7SL 4JFYA 4UNUA 2G60H 5C92A 1OAXH 5SWZD 3UO1H 1ZLSH 3BPOC 1U8PB 4Y4FC 1RVFH 2W9EL 1H9VA 5DD1L 2V9QA 4TOYL 3GKWL 4Y89A 4XC3L 1GGCL 3SDCD 1CDBA 1KCLA 1NGXA 3GSWA 3BGMB 1KIRA 2J4WH 5D7IB 1MCHA 1PKQA 2OLDA 4XH2A 1QSEA 5I6XB 1JPFA 3IFOB 3STBA 4R7NB 4DTGL 5ERWA 3JSSA 4I13B 1TCRA 4WFHD 1AJ7L 4N8CL 1OD7A 3STZB 3BFOA 4QGTA 4Z76B 4P2OC 3P4OB 5CJBA 1S9WB 4F3FB 4J7RA 4OFDA 5AZEL 4AL8H 5I71B 1CQYA 5KVGH 2YBRA 3VFSA 4P49A 1SJEA 3FFCE 1IM9A 4YHYC 3VRIB 1F00I 5E2UL 4CVWA 2QQQA 5KANI 5CAYB 3DARA 5HYEA 4HT1L 3OKEB 4NN6C 1WFTA 4NKMB 3FT4B 5C71A 2HG5A 4KUCF 2YD9A 2E7BA 4TUJB 4JY4B 4P9HH 1CFSA 2HFGL 2GJZA 2A6KB 1ACYH 1NMAL 4NO5A 4NO3B 3HG1A 5BS0B 4H1LA 3BP6B 4JKMA 5BS0D 4RFOH 4OF7A 1MHPH 3WHXA 5C0BD 4ERSL 4G9DB 4YQXL 3LB6C 5JW5A 2NY1D 2Z31B 3CFKA 3AXLA 2C3WA 2DQUL 2Z31D 5IB1B 3PG2A 3D85B 2VLKB 1BGXH 3D85D 1CXEA 1E28B 1GZPB 2ATKA 2VLKD 4ODWB 4QTIH 3FONA 4O2CA 4CVXB 3W2DL 3ULSB 4C83A 1RUPL 1OCWL 4LCCA 4L8DB 5KJRH 2F5AL 3QCUL 2V5TA 3LKSA 3LN4B 4NN5B 3HZMA 4S1RH 4C56E 2E6QA 4M48H 2DQGH 2OP4L 4QRSB 5IM7A 3LPGA 4U1NB 2B2XH 2JB5L 4ZODA 2OJEB 4IRJD 4OLZL 3ROOA 3UTTA 1EUUA 3DVGA 4KMQA 3VFPB 3SKNB 3EBAA 3U46B 1UJTA 3D39D 4FFYH 3VXUA 1NGYB 1KLGB 3D69A 2JJUA 3QI9B 5DEZA 3NCEB 2HKFH 3OKDA 1IGFH 5AWNH 3MRCB 2OTWA 1LDPL 1LILA 4CBPA 1AGFB 3NIFF 5FOBB 2OK0H 3IETB 3RGVC 3MV01 4LLDB 4YDLB 3G6AB 5FIEA 3QDAA 2ATPA 4M61A 1AXIB 4F57H 1GC1C 1B88A 5F7EL 4I2XA 5KVFH 4ELMB 1D5IH 3H9SB 1J8HB 3H9SD 5I76A 3G9AB 4XMLH 2UUDK 4Y2DB 2Y5EA 4Y2DD 3V8CA 3WIHL 5KOVC 4K7PY 5SWSB 5SWSD 4LPUA 5DEGA 2J8UF 2APWA 1P5UA 4JFDA 1GPOH 3GJFB 2NTFB 4OD3H 3VXSB 1MWAA 5H8DA 2J8OA 1A6TB 1EVUA 2BNRD 2NXYC 5HDQL 4WJ5B 4GSDH 5B3JE 4PTTA 1T2XA 2F74A 4P5TC 1QVOA 3PV6B 3O6KL 4YX2H 4AT6A 4I4WA 2ZG1A 3DRTB 2GAZA 4O00A 1YNKL 1EH9A 4P2CG 1E4KA 5C07E 2OZ4A 1FG9C 4HDIA 3VXTA 3FB6A 4F7CB 4GW1A 2ESVE 1MI5A 1U3ZA 3G08A 5I18L 3AU1A 3PABB 1HHKA 2PCPA 4HEME 1CZ8H 1NL0L 3HE6A 1TQBB 1ZWIB 2PO6D 5DJ8B 3KPSE 3ZKQD 1DUYB 2R4RH 3LVEA 3OKYA 4LASH 4MD0A 1Z9OA 3WCYA 1KCVH 5HHPB 1T66C 4EI5A 5TH2A 1QLRB 1EEYA 2ZUSA 2D0FA 2R8SL 3MBXL 3VFOA 2XIDA 1F8TH 1EEQA 4M3KB 3ARXA 1XF4A 1AHWB 3BDYH 3GMLA 5DJYA 4OBSA 2XZAL 3NACH 4XVUD 1AH1A 2D0HA 2HMID 5IQ9A 4MJID 2WBKA 4M6NH 5J11C 2G5BA 1CIUA 2DQDL 2ZP0T 2XPGB 1G7PB 3RVVD 1A3QA 2BMKA 2RR3A 4L8SC 5LKNA 2OSLB 3C08L 3HZYB 2AJSL 2FL5B 3A0OA 5L2JA 4ZPVA 1QP1A 3QQ4A 3LPFA 3QQ9D 3PL6D 3ARZA 1NJ9A 3GDBA 1Y0LB 3NIDE 5JOPE 1YEFH 2NW3B 3MYZA 4AENB 2VJXA 3SN6N 2J88L 3CFCL 4F33A 3IJHB 2AS5M 5IFHH 2AEPH 4X6DA 1N4XH 1TCMA 5M94B 3VXPB 1C12A 2EYSB 1U58B 1YMMD 1FFNB 1YYLH 3GBLA 5C0RH 3CVIL 3W81A 4QRPA 4PV9B 3LZFL 4LLWA 3IJSA 2WP3O 4F7EA 1CT8B 1KJMB 4FXKB 4U4BA 4X98A 4V2CB 1HDMA 2WWMC 8FABB 5GZOC 3V0AC 3ZT7A 1EO7A 1MPAL 3G6DH 3X3GL 1B4JL 1QSFD 1IC7L 1YEGH 1YQVL 2RBLA 5E9DB 4KXZI 1FNEB 1IAII 3JUYA 5E9DD 1JZ8A 5DRXB 1KTLB 3QH3B 1QA9B 4JFFB 5ISZB 2G9HB 4KRMB 5MP6L 5F6IB 2QADB 5JLZB 4H0IA 4NCDA 4J2XA 2QSCL 4WI2A 5B38A 5FCUH 2X4UB 3RI5K 5HVWA 3ARSA 1IAOA 2AQ1A 4YO0B 2I9LA 4X8XA 3DO3A 1J1OH 4AH2A 3NA4A 3THML 4FQCH 2XWTA 3O6MH 3TESA 3S9DB 3Q5YA 5BJTA 1G7MA 2ZWLT 3B2VL 3QDME 1C7TA 5DQ9A 4RFNB 3MMEA 3SDXA 3EJZD 5D96C 1NKRA 3DYOA 2WBWB 3CDGA 3QHTC 4XBPA 4B7LA 2VR5A 3MV9D 2BSTB 1JBJA 2H32A 1KN2L 1DBAL 5GS1C 3QEUA 4EUPA 1K3ZA 4GKSB 4BZ2H 1Q9LB 4UB0H 4K9EL 5BQ7A 2Y06L 1ZT4A 1VFOA 1OT1A 1KIPB 1BIIB 1KTDA 5E7FA 2ZUQB 4PJGF 4ZFZB 7CGTA 1U8LA 3D5OF 3TVMD 3MROA 1OAKH 4YDVA 2VIRA 1OP5K 4BH7B 3VI3E 3IKCA 1X44A 2I07A 3LQZA 3DMMD 5E2TH 3G04A 3OAZK 4W68A 2HVKB 4WO4D 3CPLA 3GSXB 4ZUSB 4YWGH 3KAAA 2Q3ZA 2DM7A 3RNQA 3LMJH 2EO1A 3GRWH 4OD2B 1KYOK 5IEKB 2A77H 3Q6FA 5FHBL 4L4VA 1G6RB 2A74A 3JV0A 1KB9J 1MIEL 1JHLL 3RY4A 2EIZB 3QCTL 5EU4A 1BD2A 3ARUA 4U1LA 2Y72A 4WY7H 5DGRA 2AK4E 2P5WE 2P47B 3O45A 2R9HC 1ZMYA 2R2BA 3DOSA 4Q6IA 3EYUH 5F9AC 5D7KD 3V5DB 5EO9B 2P24A 4NN7B 3RL1B 2NY2D 1A02N 5IW1A 2NY6C 3QEGH 3RP1A 2XXCB 3GO1H 4EJ1C 4WW2F 4DVRH 2AJXH 3T0DA 4Q9QH 4ODSH 4XAWH 2P8PB 4Y19E 3T0EB 4JZJB 2ICWB 2AEQH 2XXMB 4HUWA 1RU9H 2XG5A 3ALWA 2MQ0A 3BGMA 3ZDYF 4MHHG 2GEEA 5D7IA 4GOSA 2C4FT 1QLEH 2O5ZH 3T77B 4R7NA 1QFWL 1U8QB 3M17B 2CPCA 1A7NL 4KQ4L 3IT8D 4RZCB 3OGOE 4YK4C 4JRWA 3VFUB 3STZA 1JNJA 4Z76A 4HXBL 4WNQB 4F3FA 1XEDA 4UU9B 2X9WA 3QSKB 3HTLX 2BHUA 4NGHH 4XPGH 1DBBL 4QYOB 4LQFH 3Q5TA 5SX5K 3VRIA 1JZ6A 2AJYH 2RCSL 3KS0H 3HMWL 4KHXH 2D7TH 4KAQH 1T21B 3RQ3A 3OKEA 1CU4H 1ZKAA 5DJ6B 1LK3L 3EKCA 4NKMA 3CMOH 2BY2A 3FT4A 3P0YL 4G8FB 4TUJA 4JY4A 3MNWB 2GJ6E 5KVMC 2A6KA 4HKXB 5CCKL 3LS5H 2Y6SD 4NO3A 3KPLB 1J11A 5BS0A 1BVLB 3BP6A 1EA9C 1M7DB 4FQLL 3OR7B 4WW1B 4XPTL 1LP9F 5D1ZB 5C0BA 5D6DA 2UZYB 5HYSG 2Z31A 4ZUVB 2DL2A 2VH5L 4X6BB 5IJKC 4XWOD 5IB1A 3D85A 1BF2A 2VLKA 1E28A 1GZPA 3WIIH 1GC1L 2IANE 5C6WH 1H5BC 1MNUH 1VFMA 2DQTH 2VC2L 3U9PH 3FQXB 5GQBA 3SDAC 1DBJH 4O51B 1JPSL 3LN4A 3BPNC 3OSKA 4QRSA 4ODHL 2X4OB 1JL8A 1GHFL 3VH8B 4U1NA 1XR9B 4TUKL 1RUQL 2ICWI 4YE4H 2E8YA 2Q86B 3SKNA 3D39A 5B4MD 5K9QG 3U46A 1MF2H 1C5BH 1NGYA 2ADFH 5E8DH 1JPGB 1W72H 4LHJB 1V05A 3MRCA 2VXUH 3O3BB 4FQ1L 5ECJE 4K7FA 4I0KA 1AGFA 5FOBA 2QV2A 3AMKA 4OIIL 4S1SH 4Y5YC 1IC4H 3IETA 1N26A 4LLDA 3G6AA 1CLZH 1NBQA 1T6WA 4YHZH 5LQBH 4C4KO 1FYTD 1PSKL 1TZHB 3QNZB 1NAML 4ELMA 4EVNB 3H9SA 1J8HA 4P23C 3UROR 1A1OB 1PKQE 4Y2DA 1GVIA 5GRWA 4QRTB 3RTQC 1EMTH 4OLEA 1YPZF 3MOAH 4NQSB 5SWSA 2H6PB 5DUMH 1A5FL 1EUTA 1RULH 1CDYA 4HKZB 4TSAH 3GJFA 1CTNA 4M8VA 5DRZB 2OBGA 1Z3GL 3VXSA 5DK0B 2F8VA 1A6TA 2BNRA 1F2XK 2DLGA 4M5ZL 1FORH 4GUPB 3JVGC 4LOUD 4WJ5A 5CZVL 5F9DC 4A6YL 3SQOL 1T3FB 1F02I 4LPCA 3PV6A 3QCVL 4HZLB 3DRTA 5HHOB 1AFVH 4GKOA 1R5IB 1UM6H 4NNPL 5I1GH 3RAJH 2IH1B 1WFNA 4LVEA 4F7CA 3A6BL 4JFHD 1BOYA 4YIQB 1N5AB 3HZKB 3PABA 3OXSB 1MCIA 3F7PC 2BNQD 1D6VH 4KTYA 4X7TB 1ZWIA 5DJ8A 4GQ9L 5IMMB 5CGMA 1DUYA 4IRZL 3QA3B 1NCWL 1W0WB 4YNYB 1OF2B 1NCAH 3JXAA 4DKEH 4QHMB 2WZPD 1M7XA 4RISH 4JN2B 1X5FA 2NY4B 1MFCL 2NY4D 3SO3B 5I1HH 2OMNA 4R4ND 4PR5B 1AQDB 1DSFH 5FB8B 2ZCKL 4M7LT 3RZWA 3CIQA 2DI8A 1MEXL 4R0LC 1AHWA 2PXYB 1IQWL 4CNIB 5I1EL 4MJIA 1MCFA 4UBDC 3UTTE 1P6AB 1X6NA 2F53D 1JRHL 5FA3B 5L9DH 1UJ3C 2XPGA 1G7PA 5FM5M 5GS0H 3ULUD 1FNLA 1WTGT 4N0RA 5KW9H 1PG7H 2H2PC 1R3HB 3HZYA 1WIUA 2FL5A 4HWEH 1F5WA 1QG3A 2Z0BA 3STLB 5ICZA 3KPNB 2VLJB 3JZ7A 1MFBH 3EDFA 3PL6A 1MJUH 2E7LC 2PYFB 2X1WL 3SGDI 2NW3A 2OR9H 4K8RD 3UZVB 1NGPL 5EU5B 1JHKH 5I75C 3RIFF 2JELL 3GJEA 4I2XE 4MNQB 4NQDD 3BVNB 3ARRA 4MB5A 3IJHA 5IMKA 4Q9BA 2D7QA 5D71L 3SDCC 4ZFOA 3VXPA 2EYSA 1U58A 2VXQL 2D03H 1FFNA 3CUPB 4RBPK 1WAAA 4LSQL 4JFOA 4ZOAA 4R4FL 4WGVB 3C6LD 3SDYL 4PV9A 2WSKA 3WLWC 1CT8A 4JFDE 4UINL 1KJMA 4FXKA 1DN2A 1UVQB 4LSUH 1JWMB 8FABA 1RK0B 4OI9A 3U9UB 2BVUA 4HIEB 2PW1B 3MODH 4MX7B 5E9DA 2WQ8A 1Q8MA 1FNEA 4KI1A 1KTLA 4ONFH 4Y1AB 5JR1H 3QIWB 3QH3A 1VADB 4Y1AD 4TVPD 5HHNB 1QA9A 1KCUH 5ISZA 2G9HA 5JLZA 3PHQB 2DTML 1QNZL 5CIPB 4ALAL 4DKFH 3U0TB 2X4UA 4JQXA 5DUPL 1ZLWH 1AGEB 1CI5A 5KSVB 3K3QA 2ICEB 4YO0A 3ZE1E 4OZFB 1KACB 3WS6C 2DAVA 1FZMB 1EJ6A 4DWHA 5HHME 4KJYB 4L3ED 3RVTD 1P1ZA 3L6FB 1I7TB 1UWEL 3L5WB 5CJOL 3HUJB 4YBLB 4RAHA 4G6FD 3TWCL 3VD7A 4GAGL 5I66B 2BSTA 2NY1C 5GGTH 3W5NA 5ALCH 4GKSA 3RJDA 5DFVD 1JPTH 1Q9LA 4RWYH 1LE9B 3LQAC 1FGNH 4TSBH 4MYWB 1F58L 1KIPA 2FHBA 4E41D 1BIIA 2MOVA 6CGTA 1TQCB 4FNLL 3H42L 3S7GA 4PJIB 2XN9D 4BH7A 2ZG3A 1R3IH 1AP2B 5CD3B 4IRJC 2VXTH 3WMSA 2R2EB 1YECL 3RVUD 3U82B 4RSVA 2X1QA 5BRZE 2HVKA 3B6SB 3GSXA 4ZUSA 4ZDHB 1TLKA 2MTPA 2HJLB 4HK0B 4GRWE 5IEKA 4POZD 2UY6A 5D4QA 1TJGL 4D94A 3E6HB 2EIZA 3MRDB 3I6LE 1J1XL 4ZUTB 4FXLA 4OLXL 2BSED 2P49B 3U6RB 5ITBH 4MA3B 1JGVH 2NX5B 4PJCF 3CSPA 4KRNA 5DZOA 3WFDL 3V5DA 5EO9A 1IBGH 2CK0L 5HDBE 3CVHH 5MEPB 3RL1A 4R6UA 3VRLF 3OZ9L 3RIAK 3RL2B 4WI9A 5FDYA 4MQSB 3QPQD 3DIFB 1ZVSB 3WFZA 4GMTL 4I3SL 3S35X 3U2SA 4JFQA 4RGMC 3TZVC 2P8PA 3D18B 4CUCA 3T0EA 2ILLA 4NZRL 2EDWA 4JZJA 2ICWA 5LWYL 4ZS7L 1JN6B 5F8RC 3KLSA 4HH9B 2W0FB 4J8RB 5EBGA 1MLCB 4TNVK 2VQUA 5BV7H 4OUUB 4M7ZC 4G7VL 4V1DB 1SY6H 5DJ2B 3VFVB 3T77A 3WD5H 2ZJSL 5IESH 1B6DA 4MCYA 5M95B 2ARJB 4WWKD 1RD6A 4NYLB 5C08E 4PJHF 3VFUA 5ESQB 3REVA 5CMAB 4KK9D 4MQ7B 4WNQA 1DQQB 1IKFL 3REWB 1GOHA 3OPZH 4UU9A 5MEQB 3HZVB 2PO6C 5D1QD 4FZ8H 1CF8H 4QYOA 2R0KL 4PD4J 4FRWA 3UYRH 4PJ7E 2J6EA 3MZGB 2X1OA 2WIMA 3BAEL 4DGYL 2HRPH 3V4PH 4I3RH 3QISA 1T21A 1TXKA 5DJ6A 2DLHA 4HXAL 2ZUUA 5KSBE 4G8FA 4JVPA 3ZE0E 3SE8H 3MRRB 3MNWA 4CU8A 2FJGB 4HEPG 1Q0YH 4HKXA 3VA6A 1VHPA 3KPLA 2HP4A 1BVLA 4MQXD 1M7DA 2CO6B 3OR7A 4WW1A 4HFUL 5E94B 1AO7D 5A2KH 4M7LH 5D1ZA 4KUCD 2HMIC 3UDWA 2AGJL 1S5HB 4JPWH 4LHQB 2UVFA 3H3KA 4P9HC 1U3YA 4G42B 4ZUVA 5T3ZE 4X6BA 4Q9RL 1MJ7H 3BT2L 4FTVD 4JHAL 5K9JL 2XG4A 4XPFL 5IWLA 3P9WB 3ARDB 1O0VA 4HIXH 1NBYB 3FQXA 5ACZB 3GBMH 4S1QL 1V7NL 3FN0H 4Z78A 3HI1B 4JRXB 5BXFB 4FQJL 4O51A 4JRXD 3QYCA 2NZIA 3QR2A 4Y4KD 1UCBH 25C8L 1HXMB 2YXFA 1EVTC 4X6EB 4UT7H 2X4OA 4RAVB 3VH8A 1XR9A 4F9PC 3Q2CA 5F44A 1WTLA 2XZQH 2VXSL 5EN2B 2IFFH 1JPGA 3PWUB 2BVTA 1JGLL 4JR9H 5SWZE 5D1XD 2MPAH 2XY2A 3O3BA 5CILH 4GKZB 1KJ2L 3JWDH 1L0YA 3WLBB 4QLRA 4JM4H 4JKWA 5GGRY 3W0WB 3L3IB 3TBWB 4MD4B 3NCMA 1I1YB 1TZIB 3QHFH 3HPLB 4R2GD 4QXGL 1KENH 1X9QA 1IE5A 4NJ9L 5HD8D 1TZHA 1AXTL 3QNZA 4EVNA 1U8JB 1CICB 2FIRT 1A1OA 4NBXB 2YR3A 5D7IE 4PRAA 4QRTA 2FYYB 4U1KB 4HAFA 3UJTL 2NZ9D 3P40A 1U8OB 3A67H 4NQSA 3UP1A 1LK2A 4WFHE 2H6PA 1XF2B 2VAJA 1RIVH 3ABZA 1A3RL 5C9KA 2I60L 4I3GA 5DK0A 4RGOH 3I2CL 4M7KL 2H3NB 4NM4L 3FFDB 2DM3A 1XGYL 2EICA 3MJGX 5LGKA 4GUPA 5T3ZL 1KELH 1KB5B 3NZ8B 5ESAB 1T3FA 3B9KB 4NHCH 5HJ3B 4HZLA 2YPLD 4Z7UF 1UB6B 4TUOB 3VFGH 4J4PD 1R5IA 4DQOH 1EO8H 3O8XC 1DCLA 2V2TB 5C0IB 1T89C 3G5VB 1K85A 2KKQA 4PTUB 5EO0B 4KKLC 1INEH 4XCFH 4YIQA 1N5AA 3HZKA 2H26B 3OXSA 4X7TA 5HI4C 5CBAB 5BS0E 2HJFB 4OLYL 4U0RB 1L7IH 5DMIL 4R90H 5IMMA 2YSSB 1FBIL 1KEGH 4U6VH 5C0BE 3MRLB 1MCEA 1W0WA 3TVMC 4JB9L 1Q72H 5KTEH 4FQXD 1OF2A 2OI9C 4QHMA 4QXWA 4UQ2B 1U8NB 1ZANH 3S6CA 3OKMB 2VLKE 3C5ZB 2C4FU 4JN2A 3C5ZD 3DMMC 2DM4A 3BWAB 3MJ7B 4N8VB 5I8OH 2FATH 3TJEL 4WO4C 3ARVA 4PR5A 1AQDA 1SHMA 5FB8A 4KJQD 3JWNC 2MWCA 5KVEH 2PXYA 2CJUH 4CNIA 2EKJA 1L6ZA 1ZSDB 4JAMB 3RWIA 4KDTC 2X1XR 3D39E 5FA3A 4HLJA 2B5IC 2HJKB 4LDLB 4URTB 4IOIB 4OGXL 3BGAA 1R3HA 5IB4B 4QRQB 3EO9L 3H9YA 2E9WA 1BZ7B 3S37H 4X80L 4TSCH 3STLA 3HFMH 3KPNA 2VLJA 3U7AA 3BP4B 4PG9A 2NY2C 2PYFA 4XCCH 1CK0L 1N0XH 4OGYH 5J1AB 4D9QD 4U1GC 5ADOL 1C1EL 3LDBB 4OF3A 4RCAA 1OQXA 4O2EA 3BVNA 4ELME 2VDPH 3H9SE 2FNBA 3S3JA 1M1SA 1P4BH 2QHRH 1OAZL 1I85A 4P59L 5H2BB 5SWSE 4B53A 3ARQA 4LVOC 4NWUH 4XXCA 2VDNL 3PE9A 5BMFH 1PYWB 3IU3B 5IROC 1JTPA 5CSGA 3VCLB 4JFZL 1UVQA 3WFEH 1JZ5A 4XPBH 1JWMA 5ICYB 1LO2H 4ODUB 1NKOA 1WZKA 4ORZC 4DAGL 2BNRE 3U9UA 3QJFB 4HIEA 4KVCH 4MX7A 4GXVH 4WUKL 2GY7B 4Y1AA 5MERB 3QIWA 1VADA 5HHNA 4XZUB 5IKCB 2VWEE 3PHQA 4G80B 1XIWC 5CIPA 1U41A 3SGJC 3U0TA 4JHWH 1CG9B 2DL9A 1AGEA 5KSVA 2NPLX 2ICEA 3TN0B 3SY0A 3K4ZA 3HLAB 1ZTXL 1FZMA 1UH4A 1R24A 2VDML 4IM8A 4OFYA 4LAQH 4KJYA 4P3DB 1WBXB 3MV11 4MLSA 1NGWB 3GNMH 3L6FA 3EFDH 1UXSB 1TJHH 1DLFL 1XH3B 5IBUB 3HUJA 3GJFK 3O3UN 4J3XA 4OIBA 2E9BA 5EH1A 6FABL 1VFUA 2ZOKB 1U6AH 5I66A 2A38A 2R56L 4Q0XH 5DSCB 1QBLH 4XWOC 1F6FB 2VLRB 1LE9A 1C08B 2Y7QA 3I6GB 4ZTPL 1RZ7H 3CXDH 4RIRB 1ZK9A 5I16B 4P46B 4K94C 1B0WA 1R5WB 1WWAX 4LCIH 1F4WL 1LWRA 4MJIE 4LEOB 4PJIA 2EH7L 2NXZB 5FUZH 5JXAH 2NXZD 1AP2A 3LS4L 2QLVB 3P73B 4PJGB 4JN1H 2R2EA 4HF5H 3QQNA 1N8ZB 3B6SA 4H20L 1P53A 2B1AH 5F7MC 4ZDHA 5D8JH 5JUEL 2G60L 3QUMB 1AXSB 3HS0B 3UO1L 2HJLA 4JJ5B 3HB3D 4HK0A 4LF3B 1QD0A 1OLZA 1QHPA 3DLQR 1SYSB 2RFXB 4DZ8B 3E6HA 3NN8A 3MRDA 2NR6D 4ZUTA 1T22B 1MRCL 3VGBA 3U6RA 1YMME 5T1DL 1M05B 4B7IA 5GPRA 4MA3A 1WAAE 3HHRB 5D9SB 3VI3F 2NX5A 1NANI 2EZ0D 3CFDA 5IBLC 3MRKB 1IAIL 5MEPA 1FCGA 1OVZA 1OL0A 5LAXB 2Q87A 3RL2A 5JHDB 5GHWL 5I15L 3PP3K 4UV7L 4CW1B 3DIFA 2ZCHH 1ZVSA 1QSFE 4JM2C 4DN4H 3HPJB 5E9DE 1CGXA 1JI2A 4I1NB 3D18A 2PYED 1JN6A 3QP3A 1U95B 4HH9A 5DQDH 2W0FA 4J8RA 4PLOB 3LKPB 1MLCA 4LOUC 1NDMA 4AL8L 1T6VN 1YY9D 3V4VH 4OQTH 4OUUA 4YUEL 4PYHA 4OCWH 1I8IB 2HFFB 4V1DA 5DJ2A 1IGCL 3VFVA 2IALB 1WF5A 1RZJL 4WWKA 1RUAH 2ARJA 4S0TD 1X5JA 4P2QB 3MLXH 4NYLA 1GZQB 4YHKL 2FBOJ 1SJXA 3NZHH 4P9HL 5BZDA 5ESQA 5C09D 4OV5B 5MEOB 4JRYB 5CMAA 1ACYL 5HYJB 1ODAA 1S7WB 4OIAA 1QOKA 5HYJD 1DQQA 3REWA 2B1HH 4U6YB 5MEQA 4RFOL 1MHPL 4WDIA 3F6IA 3MV9E 4KVNL 3FRPA 3RDTC 2CLZB 4J23A 1XF3B 4KGJA 1J7VR 5L0QB 3MREB 1TNMA 3X17A 1YNTB 1N6QH 4QTIL 3T3ME 2YC1B 3R0MA 3HC4H 3MRRA 2QR0B 4GMSL 5IHZB 2FJGA 4ZFOL 1AD0B 4QT5B 5KJRL 3EO0B 4J12A 3MJ9H 5EBWA 4S1RL 4M48L 1AO7A 2DQGL 2FEDD 5E94A 4PGZA 5EUOB 2VXVL 2B2XL 3T4YA 3WHE0 3LEYH 1S5HA 5J0BA 4FFYL 4G42A 5F7KC 4R7DB 3S34H 3QIBB 1LP9B 2HKFL 1CFQA 1IGFL 5AWNL 3ARDA 4YFEA 4JO2H 3C09B 3ZHKA 1NBYA 1T7XA 2IG2H 5ACZA 1OP9A 1AIFB 3HI1A 3O81A 3K1KC 4JRXA 1RIHH 4Y4KA 2OK0L 5BXFA 1HXMA 4G6AD 4X6EA 5HDLA 2HLAB 4RAVA 4F57L 1SVZA 2FBJH 3EZJB 1HSAB 4MA7H 2UV3A 3EYQD 5TF0A 5D7KE 1H3GA 3LV3B 4JJHA 4XMLL 3ZE2E 4RA3A 5EN2A 2WUBH 4W4OA 2P1YA 3CU1A 3C8HA 3C6LC 3TYGH 2YZ1A 1IRAY 3ECBB 4DGIL 4GKZA 1KXQE 3WLBA 3B43A 3W0WA 3TBWA 4UI2A 3ARGB 3BZDA 4MD4A 2QQKH 5K9OB 1I1YA 4RMTA 1TZIA 5EG6C 3NPSB 2YKLL 5JQ6L 5GISL 5I2IA 3VXRD 1CICA 3NCFB 1E4XH 2DOCA 2FYYA 4G8GD 4M93C 5ETUB 2DBJA 1FNFA 1U8OA 1XF2A 2ORBH 5J56B 2WP3T 3HI6H 1OGAD 1CFTA 4W6XB 4DFIA 3QG7L 3NFSL 1RZ8A 3SKUD 2H3NA 3FFDA 1SEBB 2A0LD 2MKWA 4OF6A 3WUWB 2WBJB 3O3EA 3WV0A 5D72H 1KB5A 4X9HA 1BJMA 2WBJD 3NZ8A 3B9KA 3P0VH 5HJ3A 5DK3A 4OLWH 2XNAB 1TENA 1TITA 4LASL 2P7TB 5IQ7L 3OQ3B 1UB6A 4J4PA 4I0PD 2IJ0C 2PUQT 1KCVL 4TUOA 2W9DH 3G6JF 4Z8FH 1HK6A 1N6VA 1TTFA 3M8OH 1IFHH 1K5NB 3BH9B 1TPXC 1I8MB 3KJ4B 5C0IA 3G5VA 1LE5B 4PTUA 5EO0A 1DP0A 4OGZA 4YHLL 2H26A 1F8TL 4R97C 4M6OL 4IIQC 3M45A 5TFSH 5CBAA 3BDYL 3VWKB 3NACL 4GJTB 2YSSA 3MRLA 3Q6GH 3S35H 2GHWB 4FQXA 4M6NL 4Y5XB 5H94B 2Y36H 4UQ2A 1MCPH 2VLLB 1U8NA 1NUGA 5ILTH 3OKMA 4KH2A 3C5ZA 3V4UH 4KRPC 1JVKA 5IHUL 3RVUC 3MJ7A 3PGCB 1UFUA 2X6MA 1HQRB 4G5ZL 4KDWA 4MCZA 2BJMH 3JWOH 1YEFL 3GMPB 3OL2A 4XVTL 4POZC 5DGQA 3EOBB 1JHTB 4LSTH 1U93B 2HT3D 4Q74A 1ZSDA 5FO7B 4JAMA 5D2LE 5IFHL 35C8H 1ED3B 2AEPL 1N4XL 3KG5A 1EHLH 2HJKA 4LLUB 3SE3C 2F5BH 4IOIA 2L7JA 2NY3B 2IEPA 3GSVA 5DMJB 5SX4I 4KK8D 3TBYB 5C7XL 4JQVC 5IB4A 1Q9WB 1AGBB 5HI5D 1BZ7A 3CLEH 3G5ZB 4PJ9C 1Q94A 3VFNB 3BP4A 3FQTB 2R0LH 5J1AA 3UPAA 3ME0A 5GS0C 4QY8B 1FYTE 1B3JA 3G6DL 2ARJQ 4P4KB 2J6EL 2FX9H 1JP5A 1YEGL 1A1MB 4P4KD 5I73B 5CP7B 5DA0B 1PEZA 1ZAGA 2H45A 1QO3B 1AQKH 4F7PB 3AB0B 1CL7I 5H2BA 4NKOB 1FZKB 3HKFA 1OD9A 1PYWA 3IU3A 3VCLA 1BQUA 2JJTC 1J1OL 4MA8H 5ICYA 5C70A 4Z77B 1ZS8B 4ENEC 3V79C 4WWKC 4N1CA 2YZ8A 1T80A 1X6LA 3QJFA 3O6ML 4K23H 4XNYL 1R3LB 4KK9C 4M5YH 5CEZH 1CLYL 3U0WL 5MERA 1BFSA 1F42A 3TGXA 2CLVA 4PGEB 2YD6A 4W70A 4XZUA 5IKCA 4LCWD 4G80A 5D1QC 4QKXB 4MDIB 3E0GA 4TRPH 2UWEE 3QFJB 3BQUB 5CZKA 1MCRA 1CG9A 3BQUD 3DHMA 3B5GA 5IVZB 4JFHE 3MZTA 3TN0A 3BXNB 1X4XA 1FNSH 4TPRL 2BNQE 3HLAA 1A14L 1GRWA 1UZ6F 2ZKHH 3NGBC 2BY0A 4KKNA 4LVHB 3H2WA 1CGSL 2IAMB 4P3DA 5AYUH 1NGWA 2YPVH 1UXSA 3VGEA 2AJUH 1XH3A 5FYLL 5B39G 3FO0H 1KPUB 4DUWA 2XTJD 3MRBB 4NO0D 2ZOKA 3DXAD 1WC7B 1MUJB 3QPXL 4HAGA 1G7LB 3WN5B 1YJDH 5E2TL 5DSCA 4CGTA 4YH6A 1K4CB 1C08A 1D5BB 3GBNH 1RSFA 4YWGL 1U9KA 3DX6B 5HVGB 4QXUH 3I6GA 4LL9A 3C9NB 3GRWL 3T3PE 2EDNA 4RIRA 3ZE1F 5I16A 4P46A 2X05A 3U36B 3BEWB 1U3JA 3BUYB 2E7CA 4Z0BL 5DEFB 3L5XH 5EU7C 3KPOB 2F53E 4LEOA 3DX9B 4MNHB 4ODVH 4XP4L 4GQPH 3P73A 3GI8H 4DCQA 4PJGA 5DZLA 2BHZA 3Q5OA 5DT1H 3ZKMD 1EZVX 4PY7A 2D4DA 3EYUL 3KLHD 1N8ZA 3QUYB 3QUYD 3VXMB 2A83B 1D9KB 3QUMA 5D1XC 5A2FA 1AXSA 2OYPA 3HS0A 4F37F 3ZYIA 4JJ5A 4LF3A 4DVRL 2AJXL 3WEXB 2HN7B 5DYOB 1JNLH 4XAWL 4NQDE 3TO2B 1TETH 2RFXA 2OQJB 3BKJH 3QZWB 1K6QL 1I3GH 1T22A 5I8KL 4UNTA 3HRPA 4WU5B 1M05A 5KSAC 1OB1B 5J7CC 4K55A 3GGWB 5D9SA 2VL4A 1IM3B 1ZVHA 4R26H 3MRKA 1QLEL 2O5ZL 3GHBH 2L0DA 3QEQB 2C1PB 5LAXA 3GMQB 1YEIL 5ENWB 3TLRA 4PV8B 4AY0A 2MFNA 2R1XB 2J2ZA 2YUWA 2XA8H 4KI5D 3HPJA 1P6FA 2Z93B 4Z7WB 2PYEA 1EGJA 4Y1AE 4TVPE 3SGKC 1BFVL 2DDQH 2VDKL 1U95A 1EBAA 3JV6B 4C4KT 2VN7A 4ACPA 3BE1L 3LKPA 4WW2A 4HJ0D 3MGOA 5ANMB 4XPGL 1WISA 5CEYB 5I74C 4BJLA 2I9TB 3AAZA 4I9WD 1I8IA 2HFFA 4ZXBB 3T8XB 4KHXL 1INQB 4QRUB 1J1PL 2D7TL 1BREA 2IALA 1CU4L 4BQ9A 4KKAD 1MCLA 3Q1SH 1I75A 4P2QA 3DHJA 1GZQA 5C0DB 5GRVL 4L3EE 4FOMA 3ULUL 15C8H 4CDHA 4RMQA 5MEOA 4JRYA 4OV5A 4LLYA 5HYJA 5KG9B 1IGIL 1RJLA 4WCYH 4FFWD 3HUJE 5EORH 3BP5B 3M1BB 3VWJB 1BJ1J 4U6YA 4U2YA 5DFWH 5F89B 1N64H 2ENSA 2PTUA 3IDYB 5DFTA 1XF3A 2AQ2A 3NCJL 4U1JB 3MREA 4K8RL 4D0BB 3OJMB 1H0DB 1YNTA 1G9NH 4E41E 3IDIB 3INUH 1DQLL 3QXVA 1H3PH 3ARFD 2QR0A 4WFED 4KJQC 2NY0B 5IHZA 2JJVA 1AD0A 1DBJL 4QT5A 3QUZB 3EO0A 2MQCA 4GAJH 5KVDH 2DD8H 3QUZD 2XN9E 1NLBH 4JREB 4EDWH 5A3ID 3AROA 3IAPA 5EUOA 5E56A 4LVNC 4GLRI 1ZGLM 5BO1H 4YE4L 1TJIH 4AG4H 3BPLC 4WEBL 1MF2L 1C5BL 1CGTA 1JTOA 2ADFL 4JANB 1UM5H 4R7DA 3QIBA 1W72L 1LP9A 3DX8A 4ELKB 2BFVH 2VXUL 4FABH 1QHOA 2CUMA 3IDNB 2FRGP 4TVPL 5F6HI 1MQKH 3LN5B 1AIFA 1MCOH 4S1SL 1NMCC 3FFCB 1CLZL 2DJ4A 2E27H 5LQBL 2HLAA 3UPCA 1L7TH 1HSAA 2VQTA 1QLFB 3LV3A 1RZKL 3F65A 4NBYB 3QXWA 3MOAL 3W39B 1L0QA 5DUML 4MAYD 2FB4H 1NQBA 3ECBA 3DUUB 1B90A 2L7UA 2CLRB 2EECA 4TSAL 4TVSa 5HVFB 1S9VB 3BW9A 3ARGA 1M4KA 1GGBH 2FLBT 1FFQA 1J8KA 4NP4L 1TVDA 4QXTB 5FYKD 4MGXA 3FQNB 1NAKH 4JFED 3QUKB 3JWDC 3JV5A 4LSSH 4H8WH 4FP8L 4LSDA 1AFVL 5ETUA 5E4EB 1U8HB 1PLGH 5HGGS 3GSNB 1MCDA 1A6PA 5F1KC 4C56B 3MBEC 1G0DA 4QHUB 2VQ1B 3HR6A 1OGAA 5LXGL 3RPIB 3TNNB 4KK6C 2JJSA 2NY7L 4CJ1A 3V6OA 1D6VL 5JA9A 1SEBA 1QPXA 3WUWA 2WBJA 4U1SB 3D3VD 1UG9A 1NCAL 2XNAA 5DXWA 2AABL 1ZXQA 2P7TA 1YDPB 1EJOH 2RQ8A 4LFHG 1BEYL 3QI9C 4YC2C 1K5NA 3BH9A 1PKOA 3N1PC 3SJVB 1LE5A 3QO1B 1T1XA 2EH8L 5ACMA 3SJVD 4OQTA 4IMLB 4PRHB 3LRSB 4PRHD 2ERJB 1RFDL 4OB5H 4YDLC 3VWKA 1AO7E 1AI1H 2D9CA 1P5VA 1QYGH 2ITCB 2OJZH 2OX5A 4XAKD 1A6AB 5INDB 4Y5XA 3BKMH 4FTVE 2VLLA 5H37G 5KW9L 1PG7L 3VD4A 4YPGA 3NA9H 4B41A 3TBVB 1Q9KB 4HWEL 3WJLC 1AR1D 4CMMB 1BHGA 3PGCA 1MFBL 2YRLA 3F8UB 4K3GA 5F72S 3SDDB 3P0GB 5TE7L 1NH6A 4JRXE 5EBLB 5FM8A 3K2UH 3GMPA 1BVKB 1FN4B 1QACA 2OR9L 1RUML 1UADC 1JHKL 3EOBA 1JHTA 4NFCA 2X89D 5C07B 5FO7A 2NR6C 1HINL 3HNSH 3EYFB 1F4XH 2ESVB 1ADQA 5F9WC 5A2LH 3RHWK 3BMWA 3WFBH 3TBYA 4ZTOL 4PP1D 1Q9WA 1AGBA 2XA3A 2HTKC 3G5ZA 4K71B 1MCSA 4X83A 1RUKH 3EYOB 3VFNA 4I77L 3O2VH 2FDBP 5H37H 4ZFGH 3KPSB 4ZS6D 4HS8L 3FQTA 4PY8I 3R8BB 4FZEH 4LPXA 4QY8A 4KQ3H 4P4KA 3OGCB 3EYVB 3DYPA 4AEIH 5CP7A 4ONFL 3QDJB 3BI9X 3IDGA 3OHXB 3NPZB 1QPPA 3QDJD 2CXGA 3F58H 4JPKH 3O6FB 5L8KB 3SCMB 4OQ1A 4LHUG 4QNPF 1E6JH 4DKFL 1FZKA 4OBRA 4X5LA 4LGSB 3OKLB 2BVYA 3O0RL 1X3DA 2BVEA 4DW2H 3B5HA 1R6VA 2FHCA 4NIKB 3N1MC 1HHGB 1YEKH 2HLFC 4B50A 4Z77A 1VGEH 5IW6B 3TO4D 5D7JC 1OARH 3D9AH 1IARB 2J8UE 2YUVA 1A64A 1R3LA 1HHJA 2YPLE 4PGEA 3AVEA 1IZKA 3S4SG 5FYKU 5FGBA 4MDIA 3QFJA 5BW7C 3BQUA 1QSZA 5ALCL 5C2UB 4NPYB 5IVZA 1JPTL 3S36H 5L7XH 1N6UA 4RWYL 1IGTA 5LCVH 5I8EB 2FSEB 3BXNA 1Z9MA 3FKUS 3O2WH 4MVBD 3SE9H 3FQWB 1AGDB 4Y4HD 4N0UE 4BFBD 3SE4A 5INCB 2IAMA 2X4TB 2P46B 5GRYA 3UJJH 5C2BH 3BPOB 5A16B 4QO1A 4YAQB 4HPYH 1B0RB 1CE6B 5T5NF 4PPTA 4HGMA 2FEDC 4Y4FB 4JDTL 1KPUA 1YC7A 1RQ5A 3MRBA 4HWBA 3DXAA 4NBZB 2R2CA 2VXTL 2IGFL 3ARPA 2DMKA 4MJ2A 1MUJA 5DVKA 3UEZA 1S9KC 1G7LA 4TTDC 3WFCL 3WN5A 2YK1H 5CGYC 5FYJH 4NQTA 3VMNA 4BYHA 1K4CA 1CFVH 3DX6A 1KLFA 3C9NA 2APBA 2W9LA 4K7PH 3BEWA 3BKCH 4WI3A 1IGYB 3BUYA 5DEFA 1AD9B 3KPOA 1I9JH 2MCPH 3VDAA 3DX9A 4JG1H 4HBCH 4P2OB 2Q7YA 3QRFM 1O7SA 4GH7B 4YBQD 5BOZG 1ONQB 3NIGF 3QUYA 3U4BH 3KHOA 3VXMA 3TT1H 2A83A 4WUUB 1D9KA 4EEEA 4WUUD 4D9QE 4U2ZA 5SWQB 3IGAB 1KB5L 3WEXA 2HN7A 4Y7MA 5DYOA 4HWZB 4ZOCA 3OJ2C 3TO2A 4NN6B 5HGHB 2OQJA 3QZWA 2V7HB 5CLWA 1YNLH 4HQQH 2CUIA 3DGGB 2MMXA 1OB1A 4RFNC 3GGWA 1W8NA 4LEXL 3NAAH 2HAZA 4NKDB 5JA8B 5BV7L 1IM3A 2B8OT 2V9TA 2VYRE 4UQ3B 1NLDL 3WD5L 2MSPA 2EYTB 2C1PA 3GMQA 5IESL 5FGCB 1K8DB 5CP3A 2YA0A 4PV8A 3ZTJG 1JYNA 4P2RD 4PJCA 2R1XA 1JMXA 4JKLA 4GBXD 2Z93A 5E1AB 4Z7WA 3FB5A 3OR6B 3RKPA 3BD3A 3ES6B 4GG6F 5CKAA 5F1IB 3FCTB 3PXHA 5BCAA 3B3IB 3JV6A 1YEEH 4NQVB 2VERN 5J13C 5ANMA 2DQJH 1CF8L 5CEYA 3CC5B 4PUBL 1FNHA 3UYRL 1N5YH 1QQDB 2OXGA 3ESVF 2CD0A 4HKBB 1SVCP 3T8XA 4ZXBA 3IDMB 2HRPL 4G8EB 4I0PC 3V4PL 1INQA 4QRUA 4DKAA 2V2WB 3UBXG 1KBGH 2DJUA 4K3JH 2P5WB 1FAIL 1KXTB 5C0DA 3OKNA 2FX7H 3JUZA 3TFKC 1Q0YL 3P4LA 4J3UA 4U7MA 1A9EB 5KG9A 1M71B 3ZTJH 2YN5A 3VI4F 3BP5A 1JZ2A 1NGQH 3VWJA 4M7LL 5J12C 4PJHA 3RGVB 5F89A 4XP6H 5F1OB 5C0JB 3H7BB 2LAAA 4U1JA 2E3VA 3WSQH 3WXWH 4D0BA 1IZJA 1KC5H 4Y19B 1H0DA 3OX8A 3IDIA 4LNVA 1OW0C 2DIBA 5C0GA 3GBML 3FN0L 3QNYB 3L7FB 1SEQL 4ZAKD 4L8CB 1G84A 3QUZA 4JKPH 5L88H 1DBKH 4DKDC 1GH7A 1UCBL 3V52L 2H1PH 5IP4A 3NH7H 1PBYA 3B9AA 1RZGB 2R39A 4LHUD 5FV1L 4PJGE 5ITFB 2XZQL 2NXYB 4JANA 4U6XB 1ROWA 2NXYD 1EX0A 3AM8A 1JGDB 1ND0B 4NO2B 1VPOH 3GMRB 4P5TB 1UWXH 4ELKA 2AP2A 3CLFH 1QFWI 5D6CB 3MNZB 1MFNA 3IDNA 4GW4B 2BCKB 3T3MF 3JWDL 1I3VA 2XZCH 1A21A 2F19H 3HN3A 2RGSA 4JM4L 1D7FA 2C3GA 5FYJD 5AG8A 3FFCA 4XTRC 3VFWB 3N06B 1NAMB 3QHFL 3RI5F 1EAJA 4G3YL 1KENL 4D9LH 2BVPA 2JIXB 4YHOL 1QLFA 5TDNB 3SPVA 4HMEA 3ZKNC 3IFNH 1D5ZB 1ES0B 1NCUA 4PJEF 3QNXB 3MYJB 2Q7NA 3A67L 3W39A 5F71A 1V7MH 4XHQA 1Z0NA 1RIVL 2FX8H 3DUUA 2CLRA 4PG2A 1T66D 1T1WB 1S9VA 1PY4A 2R2HA 4FA8A 5B39A 2PYEE 5GIRB 1T7YA 5IF0B 5C9JB 4RGOL 2IANB 1KELL 4QXTA 3L5HA 3FQNA 4NHCL 3QUKA 4C55A 2DQIL 2DYPD 1U8HA 4OM0H 3GSNA 4M62H 1J10A 1XAUA 3T0AA 2OS7A 4GKNA 4QHUA 1L0XA 2VQ1A 4TQEH 3MLPA 2YWZA 4L8SB 3RPIA 3TNNA 1INEL 4XCFL 5C09E 3VA2C 5D7LB 5C0AB 5HI3C 3QXDB 5D7LD 5C0AD 1IQDB 5IR1B 1L7IL 5JOEA 4X7SH 3A6CL 1KEGL 4U6VL 4UT9H 3D3VA 3JV4B 1Q72L 2WM0A 5KTEL 3QUML 4EXKA 2F54D 1YDPA 2XTJC 1RURH 1ZANL 4M1CD 2Y07L 3O2DH 4QHNA 3R0NA 5GJTH 2BDNH 3SJVA 3RBSA 5I8OL 3QO1A 3LKQA 4HJJH 4IMLA 4PRHA 3LRSA 4Z7UA 2FO1A 1KEML 1R3KB 1KIQA 5KVEL 3G6JB 5JQHC 3CDFA 5T1LB 1J18A 43C9B 1S3KH 4J3SA 2RB8A 5GGQL 5DK2B 1KPRB 2M26A 1YEJH 2ITCA 3DJ9A 3Q3GB 4YXHH 1A6AA 3T0XA 5INDA 1XGUB 5GZOD 1AY1H 1YQ2A 1B0GB 3I6KB 3MOBH 4X0KB 4KKBC 3WNLA 1NUFA 3ZDXF 4M1DH 3TBVA 1Q9KA 4NC1C 4CMMA 3S37L 5JXEA 4KZDH 3UPRB 2ZPKH 3GSRB 1EGJL 4QTHB 4F7MB 4GRLD 1PX3A 5C1MB 5EBLA 2HH0H 1N0XL 4I5BB 1BVKA 1FN4A 1U2CA 4KPHH 2EO9A 4DN3H 4HUNB 5C07A 4ESKA 2B4CH 1UA6H 4RMUA 2VDPL 1WT5A 1XF5A 3EYFA 4OM1H 1P4BL 2UZXB 2ESVA 2QHRL 4MS8C 1IL1B 3PIQB 4X8JB 2GJZB 3JWOC 2ZOLA 2ZCLL 4LRNH 4H1LB 3EYOA 3DECA 3K74B 3QIUD 4NWUL 3U0PB 5D96B 5BMFL 3B5TA 3KPSA 3U79A 3SKOA 3UC0H 3WFEL 5GS1B 3GI9L 1LO2L 2XY1A 3AXLB 4KI5C 1V3JA 5E6ZA 3OGCA 3MXVH 3SKJH 3VXRE 1T7ZA 2CKBH 3QDJA 3OHXA 5LG1A 4G8GE 1G0XA 3O6FA 3SCMA 3PQYD 2DQEH 3HZMB 5EDXA 4JHWL 3OKLA 4OCXL 1OGAE 4MB3A 1HHGA 3HA0A 3O3DA 5JHLH 5K9KB 2P45B 3O4OC 3WS3B 1OSPH 3MUHL 1YPZE 3V6OE 3FHAA 4LAQL 1FL3B 2AJVH 3FAXA 3GNML 1HILB 1A6WL 4FFWC 2VDQH 1S7TB 4G8IB 3CD4A 4HS6B 3MLSL 1AGCB 5AZ2H 4Q0XL 5AD0A 1QBLL 1UENA 4NPYA 4F7TB 2AXHA 4NC2B 3VXNB 4I2XB 5I8EA 2FSEA 4IMKA 4JM2F 5I76B 1HH9B 3CXDL 1FLRH 1FO0H 3FQWA 3L3OB 5T3XD 1QRND 1GSMA 3ARFC 2NY6B 4CADB 1IMHC 2X4TA 4LCIL 2DQCH 4O58H 5A16A 3LKNB 4YAQA 1B0RA 1CE6A 1INDH 5FUZL 4OLVH 4Y4FA 4JGUA 4KZEL 4HX1B 4JFDB 1N2RA 3MTRA 4H88L 3U7YH 1DQJB 1L4IA 1DEDA 1CXHA 2UWEF 3QQ3B 3OXRA 1PG7W 4OF0A 2E8ZA 3MUGA 5CKGA 5D8JL 5L2KB 4PTTB 5L2KD 1YEDB 4AT6B 3TPUB 4I4WB 1GIGH 2VDRL 3CK0L 3V5KB 5TPWH 4UOW0 1IGYA 5F8QC 3S5LG 1YJDC 1JNNH 5T33H 1AD9A 1J87A 5CSBA 5IHBA 4YK4B 2GT9A 1JZ4A 4IDLA 4P2OA 2XICA 4PS4H 4DEPC 1ONQA 1QZ1A 1A7PH 1FE8H 3BZ4B 4JO4L 4WUUA 4I18C 4ZO7A 3X3FH 3V6ZA 1J0JA 4IDJL 2ZSVB 5SWQA 4MAYC 3IGAA 1I1RA 2ZCHL 1WZ1L 3K7UA 1UWGL 4X99B 4HIJB 3T3PF 2X4QB 3P11H 1I8KA 3UTSB 2YA2A 5HGHA 3DRQB 1S8DB 5GXBB 3UTSD 4CU6A 4KTEH 4W6YB 5D2NC 1WJ3A 5TH2B 4DUVA 1EEYB 5DURD 4G9FD 1PW3A 3ZHDA 4YBLC 4BELD 3DGGA 4JZNB 5EWIL 2SEBB 3V4VL 3C60C 1I9RH 4OQTL 4P2YA 4NKDA 5DJYB 4KGLA 4OCWL 4UQ3A 2MQ3A 3FOLB 1ZT7B 2EYTA 4KROD 1MJJB 4J3OC 1K8DA 2YHGA 3MLXL 2VAAB 4NQXB 1MH5A 2O5XH 1H5BB 5D7SH 4PGCB 3DNKA 5E2VH 4WHCA 4ZPVB 5F1IA 3FCTA 5BRZB 3B3IA 4NQVA 5BRZD 4LCWE 3E3QC 1FVEB 5HHVH 3SDAB 5F9OH 3IDUA 3OG4B 3SDAD 1S9YB 2W9EH 2YXMA 3B9DA 4HMDA 3CC5A 3BPNB 3GZKA 1QQDA 3GKWH 4GRWB 4TOYH 5MHSD 8CGTA 4HKBA 4XC3H 3VXOB 3R8QA 3IDMA 4G8EA 2V2WA 1N6QL 4WU7B 2EDEA 2P5WA 3WO4C 1IC5H 1S7RB 1CR9H 3V5HB 1A9EA 1M71A 1V3KA 4LGRB 1FGVH 2XTJE 2RAMA 1A4KB 4F7EB 4N1HB 3DXAE 3RGVA 1SBSL 3K46A 3LEYL 5C0JA 2OCFD 3H7BA 1LGVA 4L5FL 3RZCC 4M02A 5AZEH 3TH2T 4N9GB 3S34L 4BQ6A 4Y19A 1N3NB 4P23B 4P23D 1AR1C 3KHQA 4JO2L 3ESUF 1MFAH 3PHOB 3RTQB 3T0VA 5E2UH 3RWCB 5HY9B 3RTQD 4WRLA 3QNYA 3L7FA 4L8CA 1FLTX 2G5RA 1RIHL 2GYSA 1KYOJ 4HT1H 4YXKL 1IAOB 4N9OB 2JF1A 2IFGA 3T08A 3IFLH 4Y16D 2I9LB 1G9NC 2FBJL 4U6TA 4MA7L 4NC1E 5DRNB 5MEND 4KTDH 1WFUA 3PGFH 5C08B 4U6XA 2WUBL 3CSBA 2I26N 1Q38A 1C8PA 1ND0A 1CS6A 4NO2A 4PP1C 4P5TA 1XZ0B 2IBZX 1KJ2B 5D6CA 1XGPB 1MCQA 1P7KA 3MNZA 3TYGL 3BMVA 4GW4A 4WVRA 4F8QA 5BOPA 1P7QB 2XKSA 1Q0XL 3BD4A 3S4SA 4PJ7B 3T2PA 3VFWA 2QQKL 3DURB 2DIAA 1NAMA 5T1MB 5BQ7B 3K81A 1BBJB 3W2DH 1ZT4B 1RUPH 1OCWH 5C0CB 2VABB 1E4XL 2EDLA 1EAPB 5C0CD 1T2JA 5KSBB 2X42A 1D5ZA 1G9ML 1MCWM 1NFDE 3QNXA 3DX7A 4M6AA 2CQVA 2FH8A 2P42B 3MYJA 4PJBE 2A9NL 1JFQH 2VIRB 5FXCH 4KI5E 4PJCE 3IKCB 4GAYB 2MJWA 4Y5VC 3U48A 1T1WA 4RGND 5GIRA 4GO6B 4V2BA 1VB9A 5C9JA 5IF0A 4HWBL 3H6JA 3VRLE 4CVZB 2YPKB 3TO4C 4L9LC 1ACZA 4BFEA 1VEOA 3CPLB 2IANA 5ANME 5D72L 1I3UA 5CLTA 3BN3B 3P0VL 3BP7B 4R0LB 4BFGA 3TT3H 4OLWL 2APVA 4PJAF 4I9WE 1NC2B 3EOTL 3LIZL 4WTZG 1FP5A 2EC9T 3M8OL 2FLRT 1IFHL 1UJ3B 1BQHB 4ORGB 4L8SA 5E4IA 3W82A 4XP1L 5KZCB 2H2PD 3WIHH 5D7LA 5C0AA 3QXDA 1BAFL 1IQDA 5TFSL 2FCBA 4Y4HC 5IR1A 1K2DA 4JO3H 3HMXH 4POUB 5SWZB 4PJHE 4PJDF 4X9BA 3JV4A 1MRDL 3S35L 3HAEB 5J8OA 2JB6B 4K2UL 4MJ4A 1KN4L 1X4YA 2F54A 3CGTA 4HMCA 2Y36L 5I75B 1MCPL 4CMHC 4MA1C 3O9WC 1VKXB 1DLHB 3SDCB 4HUWB 3ZT6A 1UCTA 1UM4L 4WFEE 1J88A 5JNYB 4MMZC 1W8OA 4MSWA 1R3KA 3G6JA 3NCCB 5T1LA 2UUDH 3RWGB 1NCCL 43C9A 3L3KB 4YHPB 3X11B 3WLWD 5DK2A 1KPRA 3Q3GA 35C8L 3RIAF 1XGUA 1EHLL 2LFGA 1B0GA 3I6KA 4X4MA 4X0KA 4UT6L 4YHNA 5I1CL 2ADGB 4YBQC 1PG7X 2WWKO 3MLYL 3UPRA 3GSRA 4APQD 1S9XB 2D7MA 1YUHB 4QTHA 4F7MA 3LRHA 5JW4M 5E8EB 2CDFB 1VFBB 1NMBL 1XFPA 2R0LL 4I5BA 4TNVF 5DR5H 3F7VB 1YY8B 4QHLB 5J6HA 3KDMB 2R8SH 3F7QA 5HVHC 3Q48A 3BN9D 4X6DF 4ZD3H 1AQKL 2VZSA 2LU7A 4M03A 1IL1A 3PIQA 4UDTB 1L9MA 4X8JA 1KFAH 4F15C 5EIVA 2VR4A 5I1IL 2LE9A 2OTUB 3ALXA 3U0PA 5CWSA 2AXFB 5C0BB 3C08H 5GS1A 3L1OH 2NY1B 4MA8L 4FQQB 5I1KL 5F3HB 4GBXC 4BFIB 5DC4B 4PBWD 4U0RC 5FYKE 4JFEE 4ZO9A 4FQIL 1WEJH 3MLWL 2ED9A 1GYAA 4TRPL 1E4WH 3KS0J 4PRID 4XVJH 4IRJB 3QWQB 3QDHA 4IRSD 5DHVB 1J0ZA 3D39B 3CVIH 5K9KA 3WS3A 3ZLQC 5FUCC 4C59B 1OAUH 3E3QE 3LZFH 3EAKA 5CUSH 1FL3A 1OLLA 3MA9L 1HILA 3D3VE 2YPVL 3QUXC 1XGTB 2EXWC 2I27N 4M4RA 2R4SH 3RVXD 3EDEA 1S7TA 4G8IA 4HS6A 4K7FB 2AXJA 3X3GH 1B4JH 5HBBA 4LSVH 4M6MH 1AGCA 5IT2L 3BOVA 2J5LC 4LSRH 1YJDL 2APFA 3SJVE 3MACH 4F7TA 4HZAA 3VXNA 5BZWB 4PRHE 1EERB 5BVJB 4Z7UE 1VEMA 4AIOA 1HH9A 1P9MC 3CFBB 5ID1B 1MHHA 1QRNA 1X5GA 4LLQB 3L3OA 4CADA 4ZAKC 4MXWH 4XAKE 3S97C 1F97A 3LKNA 2B39A 4MAUH 5EOQL 4RGMB 5JPNB 4HX1A 3TZVB 2OL3B 3GI8L 4PJXF 1FSKC 3TZVD 3FRUB 5DT1L 1KULA 1DQJA 2BNRB 3FHQA 2DB8A 2P48B 1TDQA 3QQ3A 4J3VA 5L2KA 1QKZL 3MUJA 1EO5A 2DQFB 1YEDA 2P5ED 4M7ZB 1KN2H 4OZGF 5FYKL 1E6OH 3O2DA 3TPUA 1JI1A 5K93A 2ZUWA 3V5KA 1NEUA 2BP3A 4K9EH 1TETL 2MHAB 2Y06H 1I3GL 2VN4A 1BM3L 1RZFH 3GSNL 1CD1B 3ARED 4U33A 2R69H 4K3EL 1DE4B 3TA3C 3WXVL 2BX5A 4R26L 1J0HA 4OZ4B 3WYRA 2PO6B 1ITBB 2YD4A 3GHBL 3BZ4A 4JDZB 2JE8A 5MI0C 1KSRA 1QFOA 2ZSVA 2IH3A 3SHSA 1NCTA 1J9CT 3S3SA 3TYFB 4X99A 4HIJA 1WSST 2X4QA 2OR8A 3UTSA 3DRQA 1S8DA 3D1MC 3RA7L 2DMBA 2X4RB 3TJHD 3QDJE 5IBTL 5T1KD 4JZNA 2SEBA 1EHAA 4LPWA 4LIQE 5ADPL 3RPKA 5HHXH 3QCTH 1JGEB 4HV8A 1LNUB 5L6YH 4FFZL 2GI7A 1F90H 1LO3L 3OAYK 3FOLA 1AR2A 3O6LH 5DRWB 1ZT7A 4MJIB 5IEHB 1MJJA 4ONHA 4OFPA 4BUHA 2X40A 4JCLA 5IJKA 2A73B 3D0LA 4S1DD 1OP5H 2AV1B 4I48A 1DBML 2VAAA 3D2UD 4NQXA 3G5YB 1FDLH 1H5BA 4FQPA 4PGCA 1I1AC 3OAZH 2VE6B 5BRZA 5A40E 5ICZB 5EORL 1MY7A 1FVEA 3PL6B 4XP5H 3G5XA 4P5KB 5C0EB 3SDAA 5B8CC 4UOJA 1S9YA 2RJMA 2FGZA 4F8TA 1Q9OA 2C1OB 4GG6B 3PF2A 3VXOA 3MLZL 1UQSB 4M1CC 3GJEB 4XVSL 3KYMB 5IMKB 2J8HA 2W59A 4WU7A 1G9NL 3QG6B 4EXPX 1PEWA 4ZFOB 1YMMB 5HXMA 4CU7A 1H3PL 1S7RA 2A6IB 4W4NA 5E6ID 4JFOB 3V5HA 4GAJL 5KVDL 2DD8L 4EDWL 3MV8D 3FO2B 3L7EA 4KQ4H 1A4KA 1EFXD 4Y5YA 1QFPA 4NDMB 5BO1L 3GHEH 2X9YA 3PWPD 3BUTA 1QSFB 4QRRD 3MLTB 1OGTB 5GGUB 3JBG7 1UM5L 4EOWL 5HYIA 3L3GB 4N9GA 1KPVB 5CHNB 5DJ0B 5F97E 1N3NA 4P23A 4YHMH 5GRJL 4OI7A 4FABL 3PHOA 4LCUB 3RTQA 5HY9A 3PXJA 3RWCA 1MQKL 4GRLC 1F4YL 3GK8L 2X4PB 3BH8B 5DMGC 2CR3A 1LK3H 4LIQL 1CIDA 4NSKB 4LP4A 3RWDB 5ELIA 4KY1L 5MENA 1FO0A 2EDQA 1N59B 5E8PA 5DRNA 4LDOB 5CCKH 1OAQH 5C08A 3ZTNH 1SMAA 3IVKB 4XPTH 1BX2B 3JVGA 5FKPA 1P1ZB 1F3RB 4PREB 2BNUB 3IF1B 1XZ0A 4WUUE 3MLUH 1KJ2A 4OCSH 1XGPA 4LPYA 3QIUC 4G6JH 1P7QA 3MRFB 3MV9B 4K94H 3O8XB 4LGPB 3GIVB 4PJ7A 3O8XD 3ZKXC 3BDBA 3KPMB 5SX5H 3DURA 2W60B 2VR9A 4KKLD 5T1MA 4GXUM 4MJ6B 1BBJA 1NPUA 4A2MA 5C0CA 2VABA 1FZJB 2CRIA 5SV3A 1EAPA 1NEZG 5DWUH 1JPSH 4N0YL 5KSBA 5HI4D 4H8WL 4O4YH 2IQ9H 1DFBL 1GHFH 4XCEB 1PLGL 3TVMB 1RUQH 1T7VA 4HIHB 2CUHA 2IC2A 5FGCE 3VW3H 2OI9B 2A6DB 3QB7C 1ZV5A 1MAML 3DUSB 4P2RE 4ZMAT 3N50A 4FG6D 3VGHA 4GAYA 4PRPB 3DMMB 4N90D 4PRPD 4Y2OA 4CVZA 4WO4B 2YPKA 3FN3A 4LARL 1HCFX 4FQ1H 4ZO6A 2ZNXA 3OF6D 4HCRA 4OIIH 3BP7A 4R0LA 2EYRA 4N5ED 1II4E 3QXAA 1FFOB 1NC2A 5E7BA 1EJOL 1PSKH 2Z92B 3EJYC 3LRGA 1UJ3A 1CFNB 1BQHA 2B5IB 4ORGA 1WIPA 2W0PA 2YRZA 5EFIA 4NM8L 2ID5A 3ISWA 1Q1JH 3KJ6H 1ZEAH 4J1UA 2KQNA 1CBVL 2CDEB 1QFUL 1A5FH 2NY2B 2E7LA 2VZ3A 5SWZA 1F3JB 1QYGL 4MQTB 1Z3GH 4U1GB 3HAEA 4OZHF 4Y88A 4HG4J 2JB6A 3BKML 5ID0B 1UH3A 4DVBB 4E42B 3U2SB 4JFQB 1A3LL 1VKXA 3GIZL 1DLHA 3NA9L 5CZVH 4A6YH 5F7WC 3SDCA 4G7YH 3E2HC 5JNYA 1EHNA 2IMNA 3RWGA 3L3KA 4YHPA 3X11A 1N0LA 3S8WA 3DVIA 4MCYB 3S88L 3H8NA 1J86A 4U7SA 2NTSP 1I7RB 1R5VB 3FMGH 3WFBL 3REVB 5GS2H 1RJCA 3UTPD 4NRXB 4BK5A 2ADGA 1JF5A 1S9XA 3E8UH 1YUHA 4Z18A 3S37X 5E8EA 1XIWB 2CDFA 1VFBA 3RWHB 1XIWD 1AC6A 5FYJE 5FO9B 3RVWC 3F7VA 1YY8A 4ZFFA 1U36A 1VEPA 1QBML 4QHLA 1XCQB 3KDMA 4KQ3L 2ZCKH 1E0OB 1DVFD 3WS6A 2BRRL 3GSQB 2N56A 1TMCB 3CU7A 4UDTA 3UTQA 4JPKL 3GMNA 5DLML 2NMSA 1S78C 2OTUA 4UAOC 1BZQK 4PFEA 3T2NH 3HE7C 1T04B 1F45A 2B4CC 5KS9E 4JHBA 3CSGA 2AXFA 4KROC 1YEKL 5TF1L 3ULVH 1XR8B 3QXUA 1VGEL 4FQQA 2EDRA 2WLZA 5F3HA 4BFIA 3H9HB 4AQOA 1ZLVK 5HHQA 4UTAH 3BWUC 5DUBB 4KMTH 4Z78B 2LQRA 2JELH 4M9PA 2YN3A 4L4TD 3MR9A 4PRIA 4X4XB 5D71H 4IRJA 3S36L 4LCYB 5LCVL 5DHVA 5D2LB 5D7LE 4JCMA 5C0AE 3CX2A 4R4FH 3U4AA 4IS6B 3SDYH 5F88B 1BBDL 3I50L 5GGVY 3UJJL 4UINH 1XGTA 5I30H 2F54E 5JIKA 2ZSWB 4WFGD 1C7SA 5FYJL 1FYTB 4U05A 4F9LC 3MFFB 4O5LL 2DKMA 5BZWA 1CFVL 5BVJA 1P7HL 5LGJB 2DTMH 1QNZH 4ALAH 3G6JE 3HNTL 3CFBA 2Q3AA 5ID1A 4LLQA 4UV4H 4PRAB 5EULV 5IBLD 3BKCL 4RMVA 5FF6B 4RBPH 3VDCA 1LK2B 2MCPL 3UYPA 3R1GH 3WIFB 1F4HA 4HK3J 1IVLA 4JM2B 4X4ME 2DRUA 2YA1A 4JM2D 4HHAB 4Y16C 3TZVA 5JPNA 2OL3A 1H15B 4HBCL 4JG1L 4JZOB 3AB0C 3T04D 3FRUA 1UWEH 5E70A 2OTPA 5CJOH 4XRCB 3U4BL 3TWCH 1HOCB 5JIIA 2P5EA 1MJ8L 2DQFA 5LJYH 2CRMA 2X09A 1F6AB 2Y5TB 1DQDL 4KKCC 2UWEB 1HKLL 2MHAA 2Z8WC 5AEAA 4XNXH 7FABL 5DMYA 3CX5K 1F58H 1CD1A 3MGTB 2UY7A 2EEBA 2R0WL 1DE4A 3MCLH 4FNLH 2BNQB 4O02H 3NAAL 1SBBA 2E7MA 2I5YH 4NNXB 2K7QA 4OZ4A 2PO6A 3MV7D 4YXLH 4JDZA 2R29H 5CJQL 4HS3B 3RDTB 1TZGL 5KSUB 3RDTD 4RMSA 1YECH 2V5MA 1VFAB 5GS2D 3TYFA 1MWAH 4LVHC 2PNDA 4RGNC 1T83C 2X4RA 3BSZL 5ICXB 3TBSB 3RKDD 1TJGH 1F4AA 2DQJL 5JW4R 3PQYE 3MRPB 1TNNA 1JGEA 1LNUA 4AM0B 2OZ4H 2GCYB 1W2KT 4GT7A 5DRWA 5IEHA 1V5JA 2F53B 1H3VA 1KBGL 3L5IA 4MWFA 3RWIB 5L8LB 4XMPL 5EU6B 3SGEH 4OV6F 2A73A 5EU6D 3WFDH 2AV1A 2FX7L 3G5YA 1QSED 1OSZB 3OZ9H 5F96H 4DK3A 4NCC2 2GY5A 2VE6A 2F58L 1NGQL 4PG9B 1JTTA 4GMTH 5C0EA 4P5KA 3ULVD 1UZ8B 5GGSB 4NZRH 2C1OA 3AS1A 5LWYH 4GG6A 4EKXA 4OUOA 4BSWB 1UQSA 5DC0A 4F9PA 4O2EB 4NQDB 3MCG1 1KC5L 3KYMA 3QG6A 3KLAB 1G7JB 3PDDA 5T3XE 1KTKE 1QRNE 1YMMA 3T4AB 4HUVA 4TNWK 4QWWD 4XC1L 3KXFB 4G7VH 2A6IA 4ZO8A 3PWNB 3KXFD 2ZJSH 2PKDA 4JKPL 4LLMB 5L88L 3C6LB 3BPCB 3MV8A 4MJ5B 3D6GA 1RIUL 2H1PL 3FO2A 1EFXA 1SM3H 3NH7L 2JCCE 5E99H 1UZ6E 1LD9B 1W0VA 4KK5C 4NDMA 5IV2B 3B4NA 4OTXH 1G9EA 1D5MB 4QRRA 1W72B 1N7MH 1QSFA 3MLTA 1OGTA 4JQIL 5GGUA 2HYMA 3HG1D 5HYSB 1EXUA 3L3GA 1KPVA 5CHNA 5DJ0A 2QQNL 1VPOL 5L2KE 2K7PA 3CLFL 1V8HA 3KNBB 4APQC 3OKKB 4M93B 4LCUA 4MB4A 4PJ5D 3WNPA 1FPTL 4DGYH 2F19L 1A4JB 2X4PA 3BH8A 1CGUA 1FL5B 1IEBB 4G6KH 3C2AH 2LU4A 2X1PA 4NSKA 3RWDA 4DOHB 5GZNC 3SY0B 5B38G 4D9LL 3AUVA 3BN9C 1N59A 4CDGC 2XRAL 1RJYB 5GJSL 1MCWW 3UMTA 1R24B 3IFNL 3CH8A 3IVKA 4L3EB 5JTWA 3KGRA 1BX2A 1X5AA 3NBNA 4LKCB 4PREA 2BNUA 3IF1A 3TCXA 4NQCD 1O7VA 2AGJH 1V7ML 4D9RD 4MHHI 4G6FB 4LRIC 4BA8A 4LDEB 3VXUD 4JHAH 5K9JH 1ZE3C 3MRFA 3MV9A 4K3DH 3T2OA 3UTSE 4I8DA 3O8XA 1TPXB 3VDBA 3GIVA 4PB0L 1T89A 3KPMA 1I1FB 2WANA 4G9FE 2W07A 1X5KA 2W60A 1JNHA 4MJ6A 4MNGE 2Y7QB 4KUZH 3ALPA 5HSFA 4EUPG 4R97B 4E41B 2YUXA 4IIQB 1FZJA 4UZGA 1NFIB 4PJFF 3DTXB 25C8H 1UKTA 3DBXA 1MFEH 4LNRB 5T3XL 4XCEA 3TVMA 3H0TB 4HIHA 4M62L 4Z0XB 2XN9B 2A6DA 4PB9L 3DUSA 3IU4H 1T2QH 4IRSC 4PJEA 4PRPA 1JGLH 3DMMA 4KRPD 4OFKA 1MHCB 3LN9A 5EOCL 3B8SA 4WO4A 3EUUA 5KANG 2N1KA 4X7SL 4XBEL 3GSOB 4UT9L 4IOFC 5MHSE 1PX4A 3IDXL 1UKQA 3RVXC 1FFOA 1HSBB 3B83A 2QQLH 4JVUA 2H32H 4QXGH 3O2DL 3NN8B 2Z92A 4KDTA 4EUPH 5FEBA 1NFDF 1X5HA 4R96B 1CFNA 3MOQA 5GJTL 1KJ3H 4NZUH 4HJJL 4PJBF 3PWVB 4PJAB 3UJTH 1KXVC 4KI5F 1A7QL 4PJ9B 3UCRA 4PJ9D 3CFDB 2CDEA 4FXGB 4UILL 5HPMA 2EIEA 1S3KL 4ZPTB 1A3RH 4XXDB 2WV3A 2I60H 3DSFH 1MI5D 1F3JA 3ZYZA 1DQML 4YXHL 1FRGH 5GS0D 4TN9A 2KZWA 5ID0A 1AY1L 3I2CH 4DVBA 4NM4H 1RMFL 1FIEA 4E42A 2F8XC 1XGYH 3K4AA 1F3DJ 4F2MB 4RAUB 3HE6D 5T3ZH 4M1DL 4M1GL 4PJDB 4KZDL 5K9QI 2ZPKL 4N0CC 3D48R 1UACL 1NDMB 4E0RB 2VL5B 2I25N 5ACLA 4RMWA 2HH0L 5DO2C 3NABL 4KPHL 3WDJA 4EI5D 5IROA 4O2FB 3RNKB 1MVFA 1J0IA 3QAZC 2Y9RT 1QFHA 2B4CL 1UA6L 1P4IH 5MENE 4WWKB 1UH2A 4ENED 3RWFB 1X5LA 4OM1L 1I7RA 1S7SB 3AREC 2IQAB 1R5VA 5BZDB 5DMIH 3RY6C 2YD8A 4HGWB 5IOPB 4NRXA 1FBIH 1IC1A 1OT2A 1XF1A 4LRNL 1WUNT 3P30H 4U6HB 5E1HB 4XGZB 5D1QB 1KOAA 1XIWA 1HHIA 4WDIB 3RWHA 2A9MH 3SGJA 3UC0L 5C3LD 5FO9A 5IHLB 1XCQA 3BO8B 2VKWA 5FA4B 3TJEH 5A2JH 3IRPX 2FEEL 1DN0B 3SKJL 1HN1A 3GSQA 4YDKL 5C0CE 1F11B 3TJHC 3NGBB 2CSPA 1BMGA 1EDQA 3N85L 3SBWC 2YD5A 3IS0X 5TQ2L 3P77B 2BOCA 3WE6B 4TULH 1MCKA 1QR4A 5EBWB 1A0QH 1T04A 1BLNB 1AO7B 1S7VB 4RX4D 1JF6A 3QBTB 4HD9A 1C5DB 5E2WL 1FIGH 4RGNE 3W5MA 3T4YB 5I0DA 5JHLL 1XR8A 3EO9H 2GK2A 4S1DC 4FTVB 5D70L 4X80H 4R3SB 3H9HA 4QRPD 3DI3B 1HNGA 2AJVL 3NTCL 1CFQB 1CK0H 2YEZB 5ADOH 2VDQL 5DUBA 4MDJA 3WUZA 3KR3L 4Y4KB 1BP3B 5AZ2L 4L4TA 1U3HC 1M7IB 4X4XA 1FFRA 2CMRL 2ED7A 2ICWJ 3IKKA 2DLIA 2UZIH 4UMGA 1S7UB 5ALBH 3HI5H 4LCYA 2ZUVA 4X6CF 5D2LA 2DI9A 1KG0B 1OM3L 4OCRH 4XCNB 4P59H 3SDDC 1ZHBB 3B8YA 1ZGLB 1MREH 4XT1C 1FLRL 1FO0L 4IS6A 5F88A 2VDNH 2G2RB 2W91A 2DQCL 5D1XB 5E6IC 4O58L 1IAKB 2EDYA 1JWUB 4M9OA 4OLVL 2V17H 4HIIB 4OD1L 4Z9KB 2P4AB 3P4NA 4JG0L 2ZSWA 3U7YL 3C5SB 2XT1B 3BGFC 4DK6A 2N7BA 4R2GB 1FYTA 1U8MB 3SEPA 5I9QC 3MFFA 3GRWA 5KSAD 3VG0L 5I2IB 4D8PB 5LGJA 3HC3H 4FFVD 3HCVB 1GIGL 2FGWH 3CJJA 5TPWL 2ZUTA 3KYKH 5FF6A 1KT2B 5T33L 2CK2A 4PJIF 3QJHB 3T2QA 1VGKB 3AY4C 3WIFA 1ZTXH 4JM2A 2FD6L 4HHAA 1CFTB 3EZ8A 1H15A 4JZOA 4UOW1 1RZ8B 2VUYA 1KGCE 4ZSOE 2E5EA 4XRCA 1A7PL 1FE8L 4NHUB 2J8UB 4UTBL 2Z35A 1YN6B 3O3EB 1HOCA 3OAUL 4Z7QE 4EQ2A 5I74B 2Q76B 3X3FL 6FABH 4PJXB 2XYCA 2YPLB 1PJ9A 5AAWA 3S98A 4HCRL 2KZ1B 4H0GA 3U7WL 1F6AA 2Y5TA 2KL6A 1RV6X 4WHDA 2UWEA 4KTEL 4WV1C 5CINH 1UEYA 4LK4A 4DGVH 3MGTA 1G1YA 4OZGB 5BV7B 1OWWA 1WCBA 2BNQA 3LEVH 1I9RL 4L4VD 1F4WH 3WNOA 1FNAA 4N0UB 3DO7B 4K9EC 4NNXA 1BD2D 3LS4H 4MZ2A 3TEUA 3K8MA 4HS3A 3RDTA 5KSUA 4FQXB 5EPMB 2CDGB 3GJFH 1VFAA 4FG6C 4NQUA 1ZHNB 5HGBA 5E2VL 5JUEH 5B21A 1CE1H 1KJVB 5F70A 3I9GL 5ICXA 3QFDB 4DFHA 3TBSA 4EI6B 4Z7VF 5DJZB 4AIXA 5HHVL 5F9OL 2F9BT 4ZYKB 4MCZB 3MRPA 3V8OA 4WENB 5DS8B 2Q6WB 5JDJA 2ED8A 4N5EC 4AM0A 4PRIE 2GCYA 3K1DA 4LVNB 1MRCH 5EO1A 5I1JL 5T1DH 4P3CH 2F53A 2B20A 3BPLB 5EU6A 1Z9LA 3ARWA 3F7RA 1IKNC 4QNPE 2C4XA 4KJPD 4KXZH 1IAIH 3GSVB 1IC5L 4HUMB 1OSZA 1CR9L 2C26A 4XNUH 1A7OL 5E08L 2IPKB 4AMKH 1ZHLA 5GHWH 5I15H 3BRGC 5D5ME 1Q94B 5DTFB 1FGVL 4UV7H 4OT1H 1NMCB 1UZ8A 1LDSA 3MUZ1 5GGSA 3WNKA 4P57B 4LBEA 5DVNA 1H8NA 4BSWA 4NUGH 4AJ0A 4NQDA 2D0GA 5FDWB 4ONGL 2PTTB 4WWID 4YFLF 4KHTL 3KLAA 1G7JA 4YUEH 3MCKB 3T4AA 5FK9B 1MFAL 1AE6L 4GS7C 4XMKH 3WDHA 3KXFA 3QWOB 1IGCH 3RHWF 3PWNA 5GSRB 4LLMA 3C6LA 1J05B 3DUHA 4JGMA 3BPCA 1RZJH 2FZ3A 4MJ5A 2PW2B 4EN3C 3IFLL 3QHZH 4YHKH 1LD9A 1D6EB 5IV2A 3PP3H 4OZIE 4KTDL 3ARBC 1D5MA 2YMXH 3PGFL 1W72A 4H5SB 4WHTB 3UJIH 5HYSA 5CJXC 4WHYG 2XWBA 3VXQB 1MLBB 3LQAL 4KVNH 4L3AA 2P5EE 2GIYA 2CLVB 3KNBA 2VDOH 5FM4A 3OKKA 4PJ5A 4P4RB 4X7CC 5KN5B 4YDIH 4XCYB 1MFDL 4GG8B 1P84K 1A4JA 3MBEB 1FL5A 1IEBA 3MBED 1GGIH 4K3HA 2VSCA 5ESVB 4KK6D 2JKXA 2BY3A 2X44D 4GMSH 1DVFC 3DI2B 1RJYA 3TIEB 5F1SA 4L3EA 4OAWB 4AEHH 2VXVH 4HUKB 4LKCA 4LSPL 4NQCA 3MPCA 3LD8C 1Y6KR 2XQYK 3C2SA 2WWKT 5C3TA 1JFQL 1VACB 4KMLB 3MXWL 3V0VB 1I4FB 2DI7A 3C5JB 4WHYH 4NKIL 2QHLA 4YC2B 3JTSB 3MRMB 3NIGE 3BHBB 5DHYA 3GM0A 3QI9D 1I1FA 3KYNA 4Q2ZB 3FO1B 5KOMC 4HPOH 5EIIB 1BFOB 3WJJC 4E41A 4IIQA 1NFIA 3TT3L 3DTXA 2N7AA 1VA9A 3CXHK 4LNRA 4U1MA 1NBZB 2NYYC 3ELAT 3H0TA 4Z0XA 2XN9A 4HSQA 1A7RH 1J8HD 1H8SA 1X4ZA 3PUCA 1JYVA 5J3HC 1W0YT 4DCQB 4W81A 1U8IB 1F3DH 1MHCA 2OL3L 4PY7B 1T5WA 4UIKH 4OFIA 1Z9SA 4DGIH 3P9MB 2X10A 4JO3L 3UZEA 3C8KB 3HMXL 3GSOA 1VDGA 1HYSD 1OAXL 1YYMH 4PYGA 1ZLSL 2ZG2A 4O9HH 3UXFA 3MRIB 3VXSD 4GG6E 2WMPA 1HSBA 1RVFL 3VGAB 2YKLH 3B9VA 5GISH 5JQ6H 4TTGA 4R96A 4FS0A 2W0KA 3SE3A 5IB2B 2CH8A 5F9WB 1E4JA 4WI8A 3PWVA 4PJAA 4JQVA 3BIBX 3QXTA 2J4WL 4PJ9A 2HTKD 3MV8E 4PJ8C 4FXGA 2A1WH 4ZPTA 2VTFA 1I8LC 3FOMB 3QG7H 4XXDA 3NFSH 3PWPE 1QUNA 5JIHA 1NCBH 1QFWM 3T0BA 2CRYA 4QRRE 5E03A 2M1KA 3WKMH 2N4IA 2BSRB 2V5RA 1TTUA 4F2MA 5DHXB 4RAUA 5F7LB 3VI4E 2PYEB 3FJTA 2E7HA 4PJDA 4OZHB 1UYWH 3IS1X 4GRMB 4WW2B 3FTGB 5IQ7H 1T4KB 3MGOB 4E0RA 3X12B 2VL5A 3RWEB 5KVGL