4P9HC

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
176
structure length
167
Chain Sequence
KVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLTIEDSDTYICEVEDQKEEVQLLVFGLTANSDQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLDSGTWTCTVLQNQKKVEFKIDIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 28
structure length 167
sequence length 176
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC02
5FB8A 4WDIB 2GI7A 1X5FA 4AY0A 4Y4KD 2E6QA 1H8NA 1L0XA 4OLWH 5AWNL 4YQXL 1BECA 5IGXL 4BA8A 4MMZC 1PQZA 4XTRD 4ZXBA 4OZGF 3WKNA 3GIZH 1WEJL 1QFWM 2DQCL 1AI1L 2EDXA 2W0FA 3PWPD 3RVUD 5J4MA 1MCDA 4ISVB 5IIEB 5D1ZB 4KK8D 4YX2L 1LO3L 3ARTA 1JE6A 1JGVL 2A9ML 3RIAK 1SJVA 3MBED 3PDOB 2CGRL 4H26B 3BN3B 5JO5A 1D6VL 4IJ3C 3GSUA 2VDLH 2UY6A 1QSEA 5ISZA 4MS8D 3QCTH 1F6LL 3RVVD 2PYEE 4PJBB 2AVGA 3DVIA 3S4SG 3KHQA 4PBVC 4NPYB 3VXME 1QACA 3BVNA 5FOJA 4RX4A 4QXUH 3JV4B 3O6KL 3O3AB 1EO8L 5GGVY 5KBNC 3G5ZB 4XMLH 5DWUH 5KN5A 4DW2L 4HKJB 4YHPB 3S36X 1DN2A 2FJFA 3BN9C 2HKFL 3ZT6A 4CVWA 1A4KB 2CDEB 5DRXA 1SM3L 4F58L 4JFED 2H2SD 5D1QC 2Q76A 3WXWH 4AEIH 3IDGA 4Y5XA 4PRDB 3HI6H 5GS0C 3MJ6A 3ISWA 3THML 1QLRB 3BISA 3F7VB 3QNXA 3KPTA 3AAZA 4I3GA 1H3PL 3BO8B 3MO1A 3QEUA 1U0QA 2NY1D 3E8UL 5B4MD 3AFLA 3HLAA 4P46C 4X6CB 2DQEL 4OLUL 1XMWA 3MRLA 1C5BL 1ZV5A 1T04B 2R2CA 4J6RH 5I1KL 2HFFB 3K2UH 1QFWL 4MQXC 3QIBA 3BQUA 1ERNA 4Y16D 1CDHA 5ITFA 4NNPL 1XZ0A 5IBUG 4Z76B 4I0CC 1MIEH 3OF6A 3ZHDA 4XVTL 1Z6JT 4ZOEA 2HTLC 1PG7W 3O4LA 4K71C 1KT2A 5J1SC 4LSVL 4PJFE 3UZVB 5HVHC 4NKIH 4Z95H 2P43B 5FYJD 3UTPE 4G8GE 3TIDA 2Z8WC 3QXDB 4WTXA 4F9PA 1HHKB 1XR8A 2V6HA 5DJ8B 2P48B 2JELH 3MRMB 4F7MA 1B0RA 3BJLA 2A6KA 1YEDA 4XHQA 1J05B 5DSCB 1WC7B 4DZBA 4LLMA 5MP6L 4ZS6D 4ZSOA 4U1HA 4RFNC 2AGJH 2PYEB 4DKFH 5DMIH 3ZTNL 1JFQH 3KYMA 2N1KA 2EZ0D 5GJTH 4Y5VC 4GAYA 3FB7B 2M26A 3RKPA 1J8KA 3VG0L 5EZJA 3NIFE 4GRWF 5D7LA 3EYUH 5L9DH 2GFBA 2AJ3A 3KPSE 4P4KD 1NFIB 1IEBA 1FRGL 1SY6A 2OK0H 1RMFH 1ZT7A 1DBAL 4NOBA 1A7BA 1MHHA 5CSZA 2AJUH 4N0UA 4RNRA 3RZWA 3SQOL 5C07A 3QI9A 3QNZA 4Q74A 4WEUD 1U8LA 3GSWA 4XGZA 1VCAA 1YEFL 5EO0B 1VFMA 2GEEA 3O2DL 2AJYH 1B0GA 3QWOA 1MCBA 1XGYL 3GNML 4KKCC 2IPTH 4JG0H 3HC4H 1KIPB 4D0CA 3U0WH 1EZVY 2YMXL 5E2TL 2H8PA 2JIXD 1NGZA 3GSQB 3GEWB 4NO2B 3LIZL 5JDJA 2M1KA 3FMGH 1KTLA 4YEFA 1ORQA 4X4YA 1QQDA 3CSYA 4HXAL 1HSBB 3NPSB 3CX2A 4NQCD 5FDYA 2BNUB 2X4SA 4PJFB 4R4FH 5BRZA 8FABB 3JWDL 2Z4QA 1QHOA 1PAMA 2DQFA 5DRNA 1QFHA 2XICA 1BD2E 3DTXA 5T1LD 5EOQH 1WV7T 2F53A 2WIIB 3B8SA 3TZVA 4QHNA 3CXDH 1OD9A 3ARFB 2NX5B 4N0CD 5IFHH 4X9IA 2FDBP 1JL8A 2B2XH 4HFUL 2QHRH 4L29A 4HGWA 1E6JL 3RVTD 3ZKMC 1YY8A 1ZT4B 4PJCF 2XY2A 3V8OA 4YO0A 1EK3A 2XN9B 3HZMB 4ODXB 1BZ9A 2CK0L 4HUWA 4NP4L 3KPSB 4D9QD 4RMSA 3CLFH 4ORZC 4HXBL 4U7SA 2NW3A 2LQRA 4S1DC 2MQ3A 5ERWB 1SQ2N 3QIUC 1JVKA 2FEEL 1KTDB 3G6DL 3FO2A 3KPLA 4NFBA 5E8PB 4O51B 1Z9SA 5I1EH 4F15C 4Z7VA 4FQIH 2QTEA 1QBMH 3BSZH 4R96A 4XAKD 4YHIA 2QSQA 2I07B 1NDGB 3NH7H 2DM3A 4Q0XH 3BXNB 3P0GB 4WHYH 3ROLA 1CLYH 4APQA 4XPAH 3UTSA 1T2QL 3C5ZB 5M95B 2DTML 3FAWA 4M7KL 1A21A 1H3GA 3TA3C 3QDMD 3A6CH 2Z31B 5HDQL 4PG9A 1DQDH 5IB5B 4WI7A 3QJFB 3CLEL 3TBYA 5FM4A 1FV1B 2OL3L 3DUUB 2R1WB 1H3XA 5GRVL 3KPQB 1RVFH 3LEVL 1KB5L 1MFBH 4PP1C 4AENA 3H9SD 5TDOB 4X5WA 4UNVA 4UOW0 3HRZB 4CMMA 4LSPL 3S35X 4K94H 4YDJA 4KZEH 2J4WH 3EGSA 5DRWA 3IFPB 4M5YL 1PDKA 2J5LC 3F62A 1GIGH 1R3KA 2PETA 1ZWIA 4ORGA 1V3KA 4TULL 4CW1B 2GTWA 2X4RB 4YHYC 5DJCB 1K2DB 1OQXA 2ZCLH 4HV8A 4PJGE 4ZQKB 4NQUA 2AEQL 3O2WL 4MCZB 4ZFFA 1FFRA 4MAYC 1G6RB 3E2HC 3JV6B 4HX1A 1IM9A 5IT2H 4BSJA 1T21B 3RVXC 3KJ6L 2X4OA 4PY8J 4S1SH 2AQ3A 2ZUSA 5JORB 2R4RH 5DGQA 1MQKL 5K9JL 3S5LA 3T4AA 1A6TA 4PJ9C 4YBQC 5DHVH 3HAEG 2X7LA 3GMQB 4FOMA 5IQ7H 2ADJA 1RZKC 3CPLB 4FQHB 1NLBL 4JRYA 4XWOC 2EIZB 4Y4HA 3MV9D 1GGCH 4MXQC 1B6UA 1WBXB 4FXGA 3NAAH 4GG8A 4ETQB 4NQVA 1ED3A 2PO6A 3EJJX 4LCUB 1ZTXH 2VC2L 1M71B 4CN4A 3DVNB 2EXWD 4MLSA 1T5WA 1A7OH 1FL6B 4MWFA 4HIHB 4J1UA 3SDXB 3TBWA 4CBPA 4LKXB 5D1ZC 2P5ED 1UM4H 2BNQE 3L7FA 3WJJA 2EDNA 3MZGB 8CGTA 1U3JA 1SJHA 1BJ1H 5KSBE 3NMEA 5KZCB 4YE4H 3U9PL 4LGSB 4U33A 3GBML 1OLLA 1EFXD 3WIHA 4XCEB 4N1HB 2M2DA 4RRPG 1BIIB 1QVOB 2LFGA 1D6EB 5BVJA 2YKLL 2MWCA 3PGFH 2VLKB 1JGDB 5CP3A 2X1PA 1K85A 1FO0L 4R0LA 1EEYB 1QBAA 1OPGL 2NYYC 4K23H 2R0ZL 4PJGB 5D7JD 1SMOA 3MACH 3HG1D 1MUJB 3MLWL 4WTWA 1X7QA 1E4KC 2DD8L 3SKJL 3RRQA 1D5MB 3EO1B 4UTAH 5ICZA 3TO2A 5A3ID 5DVMA 1KCLA 1AGEA 4YHKH 4B7IA 4NUJA 1T03H 3OKMB 1JHKH 3CU7A 4DTGL 3FKUS 3VE0A 1QBBA 3H9HA 4LPYA 1LK2A 3TBVB 3MRQB 5D7SH 2IG2L 4NQSA 1QLEH 32C2B 4GAGL 1AFVL 1FQ9C 4UB0H 2R1XA 3M17A 4X6BA 1QFUL 2WINA 5JUEH 2A73A 3BD5A 5HVFB 3L3IB 5CD5D 1TPXB 2BNQB 4NRZA 5IBUB 4FN0A 4BZ1H 5HHOD 1LO0L 5GRJL 4UV4H 1WCBA 1LMKA 3OGOE 4HSQA 3AMLA 5BMFL 5B38G 1NC4B 4QTIH 1U3HD 4PJHE 3EYSL 4NJAH 1KACB 2J88H 5D8JL 4WW2F 3TIEA 3FQUB 5CJ5A 4P46A 5FYJH 4OV5A 3RGHA 4N0RA 1MHPH 4KUZH 4XPGL 4H20L 4OB5H 5DXWA 3ZE1E 4BH7B 2R0KL 5HGAA 3V6FB 5EWIL 4X80L 4BZYA 4PRBB 1IVLA 1TZIB 1Z2KA 4YZFF 1G84A 3Q6FB 3F7YA 3KDMA 5MEPB 4JDTH 4X6DB 5JHDA 4LFHD 3IU3B 5K33A 3FT2A 4OQ1A 4JFYB 4M7JL 3EYQD 1NC2D 4G6FB 2QADC 3B2UC 4JQVC 3KWWB 3CFEB 4G3YH 2DDQL 2R2HA 4N1EA 2ADFL 5J7CC 3LKPB 3ARBC 4JN1L 2CLVB 4GOSA 2XT1B 4F7TA 1E4JA 4GW1B 5LBSH 3V4PH 4AH2A 1DQML 1NL0H 3BESR 4LLWA 4MJ5B 2B39A 1A7QL 4YHLL 4K3GA 3GI8L 2IQAA 2UZIL 4Q9QH 1RJCA 5EOCL 4Y5VA 4BQBA 3NPSC 4QHKI 5M7QA 1I1YA 2O5XL 3VRIA 4OQTL 4P59L 3IFOA 4LLUB 4P9MH 4QRRA 5E5MB 3PDGA 4PS4L 2WV3A 4L3EA 1D5BB 1NMAH 4BFIA 4KJWD 3NIDE 4HC1H 1X5HA 4HKZA 3UXFA 3VFOA 2HJLA 1UT9A 1YNTA 3FQXA 2GCYB 2RIKA 4LOUD 2O5ZH 4LLQA 3QO1B 2BY3A 2RCSH 4ZUVA 5GGTA 3UYRL 3WN5C 4EKXA 4YHZL 1U8QB 4ODHL 3ARFC 5GZND 3MQIA 3VWJD 2QLVB 3LD8B 4WO4B 3PHQB 1RULH 4K8RD 5E03A 2AAVA 3PNWA 5ISZD 3MNZA 4HW6A 4U1GB 2JLLA 3EBAA 3WEXB 2XZAL 3S8WA 3MC0A 4X6EA 2DN7A 3GM0A 4M1CD 3QUMA 4HAFA 4R97C 2CIKB 4KJQD 5I1CH 2F5BL 3QNYA 3WLWC 1JIBA 3T65B 3HC0A 3PQYA 2DKSA 5B3JE 1T1XA 3VRLE 2Z35A 1U93B 1QRKA 3T0EE 4FQJH 5I1IH 2FD6L 4HPOH 3O3UN 3MJGX 1KIQA 1YN6B 4OZIE 1JGUL 3MRDB 4LRNH 4CVZB 3W9EB 2YRLA 1T3FA 3U36B 4FZEL 1C12A 3IAPA 5D70H 4V1DB 4ZS7L 4JY6A 3O6LH 5FKPA 4Q7DA 3TN0A 4PJIE 4FP8H 4TQEH 3NFSH 5C0DB 3C5ZC 2GITB 3EYVB 4QXTB 1KJVA 1AC6A 4HS3A 1RUPL 1IT9L 1Y0LA 1QEWA 3T3ME 5F8RC 1TJGH 2Z31C 1UKTA 4P2OB 3UJJH 3BX7C 3QIBD 1S78D 4P4RA 5I9QB 3NBNA 1IQWH 5IBLC 1MWAA 1G7QB 3OF6D 5GIRB 4O9HL 2VLMD 1OB1B 4WY7L 1BIHA 3DUSA 3TJHD 1N3NB 1KPRA 3QIUA 2VXVH 3RPIA 3T2OA 4OI9A 1IRAY 3BP5B 2CLRA 5LQBL 3V79C 1X5JA 4PJXA 3ZDXF 1Y6NR 4XVSH 3S35H 3KR3L 5F1IA 3MSPA 3RY4A 4WFFD 4KQ4H 1I8KA 3STLA 4QRPA 3T4YA 4KI5D 3ULVL 3IDJA 5H2BA 3QCVL 4PJ7F 3KJ4C 4LARL 2LAAA 1I85C 1F3JB 5EZOH 3TA3A 5HYQB 3CU1A 12E8L 4I0KA 1I1AB 4UOW1 3TP4A 4P2CG 1JNHA 4LPCA 3RNQA 1OT2A 2XG5A 1ZE3C 4NFCA 5DD6B 4E0RB 3WSQH 5GGVL 5D4QA 1WBYA 3D1MC 4HAGA 5T3XH 2D7OA 2F54A 3OJDB 4PRPE 3LH2L 4GRLD 1MCQA 4PJ8B 3R1GL 3ALWA 3QPXL 1X5GA 3K2MC 1JUFB 4N90E 4G9FB 4KTEH 3HI1B 1YY9D 5IW1B 2G75A 1U8NA 3SDAB 3V5HB 5ESAB 1X6NA 4MXVE 4Q58C 4PJIB 1YPZF 1UQSB 5DJYA 3EJYD 3ZKQD 5DDHB 4JJHA 4QHLA 5HGDB 2GT9B 3G6JF 4NKMA 2M8XA 5DFVD 1TJHH 1TVDA 4GKNA 3O0RL 3F6LA 3L5WB 1CFNA 3L95B 2W65B 4G8IB 5GSVB 2J1KA 1NBYA 4AEFA 4LVOB 4IOIB 3STZA 3C9NB 3JTSA 3OKDA 3BD3A 3HE6A 5FO9B 5E2JA 2ICWA 4BSVB 4S1QL 2GQHA 2XWBA 2ADGB 1S9KC 3DBXA 4R2GB 3Q6GL 5E95B 4PJ9A 4KKAD 1DZBA 3BKCL 1S7QB 1S7WA 4HIIA 2Y7QB 4AG4L 4OBRA 2QQLL 1NBVH 3LV3B 4YAQB 3WFDL 3HE7B 3HS0A 2A6JA 4LGRB 3SKMA 3KVQA 5E6IB 2FO4B 1KYOK 2K3TA 1EMTL 4WDIA 4K3DH 5CJXC 4MJID 3RWIB 1X44A 1FP5A 2DQIL 5F8QC 3KYOB 1L0QA 2IQ9L 5CUSH 1AD0B 3NTCH 2VLRE 1A6WL 4JPKL 5CLTA 2BDNL 2BY0A 1OL0A 1CFQB 2NY7L 3P0VH 4ISVA 5E99L 4F2MB 5IIEA 5D1ZA 5DJXB 3MJ7B 2IC2A 4HUUB 1BM3L 2NXZB 4P9HC 3PDOA 4H26A 1FNFA 3MJ9A 4TTGA 3IJSB 4BH8B 5EA0H 5KS9B 1CYGA 5IFJB 3MXVL 3EUUA 3FAXA 4PJBA 1EGJL 1XIWB 3BOVA 4NPYA 3S3SA 2WMPA 2VISB 3JV4A 1MJUL 3RL2B 2C1OB 3O3AA 1U8PB 1AO7E 4X98B 1VESA 5CJBA 5TE4H 3G5ZA 2FEEI 3FOLB 3B5GA 3QSKB 1FNSH 4HKJA 4YHPA 2VR4A 4JPVL 4UINH 4MNGE 4APQD 3ALPA 1EHLL 1A4KA 2CDEA 4AJ0A 1O0VA 5EBGA 4RWYL 5T33L 1TPXC 1I7UB 1Z9LA 1QLRA 2JB6B 3F7VA 1MEXL 3REWB 2V7NB 2HKHL 3BO8A 4LNVA 4H88L 5C6WH 1RURH 4GQPH 4MCYB 2AXGB 4PUBH 3VI3E 4X6CA 5I0ZA 5DUMH 4JG1L 1T04A 2Z8RA 5SX4H 4ALAH 4JFFD 4ZUWB 2X41A 4EVNB 2HFFA 4LASH 4NJ9L 4RGNB 4R26L 4MDIB 5EBMB 1LP9F 5TDPB 5F7LB 3QDGE 5B38B 2C3HA 3MLZL 2L0DA 4Z76A 1LO4H 4C55A 5JOPE 2ZOLB 3P40A 3BIKB 2GY7B 4NQEE 1A9EB 3K80A 2VLRB 1T4KB 1M7XA 3QXDA 1HHKA 1BQHG 4FFVC 5FDWA 5DJ8A 4XMKL 4IS6B 1N4XH 2XRAH 3MRMA 1HINH 5FGCE 4YXHL 1IM9D 1ZHLB 3GMPB 1TNNA 1ZOXA 1LDPH 4BFBD 2DF3A 1J05A 5DSCA 1W72B 4JRXE 1AH1A 4K8RL 1ACYH 1WC7A 5GGSB 5E1AB 4NDMB 3WS3B 1DE4B 4JZNB 1LGVA 2PYEA 1XF3B 1CTNA 4Z7QF 2PN5A 3CDGB 1OAKH 5C0FB 5DT1H 5GJSH 1TJIH 1A1NB 3CFKB 1XEDA 4Y4HD 3O8XB 3KPOB 2YWYA 2VKWA 4QOKB 1SHMA 3I2CH 2PO6D 1R3LB 3UEZA 5DMGC 3ZO0A 1F3DJ 3PWLB 3NCJL 1FFQA 1NFIA 1GHFL 5EFIB 4Z7OF 3SDDB 4XNQB 3TCLB 3FJTA 3C8KB 1J1OH 4O02L 4IOFD 1IAMA 3NFNB 4Q97A 1WTLA 4JQVA 2F19H 3FONB 4WCYH 2NQCA 1RY7B 4GLRH 4XNZB 5EO0A 5SWQB 3HZKB 3FCTB 4M03A 4KRPD 1K6QH 4D0BB 5DO2D 1X5YA 4ZO8A 2G60L 4WO4C 5GRYA 4I3SL 5I1JH 5DEGB 3L1OL 4U1GC 3X3FH 4HLZG 1KIPA 1F90H 2DBLL 4UQ3B 3GSQA 5DR5H 4NO2A 2BVYA 3QDGB 4LCWD 2VL5B 1WWAX 5C6TH 1HSBA 2VXQL 3C08L 4FG6C 2D03L 2EH8L 5KVDH 4LGPB 4OV6F 2BNUA 3LY6A 1QRNE 4PJFA 4ZTPL 8FABA 3ZZ1A 2HFGL 1JN6B 5IVZB 3IKKA 5D1XC 3GSXB 4RMQA 5E08L 4X4ME 2BERA 1CBVH 5FGCB 1DQLH 5KTEH 4U1JB 3VXTB 1M1SA 4U6VH 2WIIA 3HMXH 3O4OB 3ARFA 4CUCA 1GAFL 3FRPA 5ELIA 3KLHD 4GFTB 2CUMA 3GK8L 3WCYA 2ZWLT 4I77H 1N0XL 4JZJB 3L9RB 4G7YH 4R4BB 1ZT4A 2K7QA 3ARSA 4PFEA 1CXFA 4L4VE 1DEDA 2CUIA 2XN9A 3HZMA 4ODXA 1ONQB 4Q9CA 4H0HB 2VAJA 3VMNA 1AR2A 1YEGL 2Y9RT 3WS6C 4U6TA 3KPSA 4K9EH 1AQKH 4XXCC 1ZLSL 5J6HB 1SY6L 3LKQB 1NSNL 3UO1L 5ERWA 3C87A 4XP1L 5FYLH 1KTDA 3QDHA 2WUCH 1F2QA 1SJEB 1FNGB 4LSSL 5E8PA 1F4XL 5D9SB 4O51A 5C0RH 3FFCE 1LO2L 2ZKHL 4J23A 3DX9B 2BSRA 2BVOB 3HRPA 1BEYL 2I07A 2PYFB 3ARDD 1HHGB 3BH8B 1NDGA 1P7HL 1NBZB 5EU7E 2H3NB 4NRYB 3BXNA 1IAIL 4TTDC 1WAAE 5LKNA 3C5ZA 1KYOJ 2D4DA 2GHWB 1I3GL 1NGWA 2NY2D 2Z31A 4QRSB 4IHOA 3C60B 5IB5A 3WHE0 3IS0X 1JHLL 3QJFA 2AJZB 4P23C 4OLYH 3T08A 3ZDYE 4KK6C 3FO0L 3ARGB 1QRNB 4NGHL 3DUUA 3PV7A 2R1WA 1DLFH 5DURB 3KPQA 3T0EC 1D5IL 1A1OB 1CGVA 1YEIL 3FO1B 5TDOA 3PF2A 1OTTD 5CBAA 3HFML 3WFCH 4PJ8C 1SBSL 4XNYH 2IH1B 2ERJB 3T77B 3HRZA 2Y25A 3SKNB 3TV3L 1MCJA 3AS0A 3SDAC 3IFPA 1PLGH 3O3DB 1D5XB 3IDMB 4CW1A 2X4RA 1NFKA 1ND0A 5DJCA 4I3RH 1K2DA 5C0JB 5F6HI 1FIGL 4ZQKA 5F21B 1I85A 2DQHL 4PTTB 3RL1B 3U7YH 3D2UB 1TVHB 2J7LA 4MCZA 2HYMA 5I8OL 4L4VB 2QEJA 1G6RA 3JV6A 1MCPL 5F72S 2XKNB 3QUZD 3KXFE 3BJ91 3MRKB 3O2VH 4QRRD 3IYLW 5HD8D 1NGYB 3A6BH 5JORA 2B4CC 5I1LB 1CDIA 3MR9B 3GUTB 4Q9RL 4P3WA 4FABH 2F8OA 2YXFA 3GMNB 4J12A 3GMQA 3TESA 1AR1C 1NMCB 5CINH 3SKOB 3SDYL 3CPLA 2EIZA 1KEMH 5F9OL 1WBXA 4ZO7A 2W60B 1B9ZA 5E6IC 4ETQA 1T0PB 2BSTB 4PGCB 1V3LA 2WWKT 4LCUA 3GB7B 4YQXH 1M71A 1U95B 1H8OA 2DKMA 3DVNA 2BVPB 4FFWC 3JTTB 4N9OB 1FL6A 2MKLC 2DQCH 4HIHA 1AI1H 4NN7B 1G7IB 2BRRL 4LKXA 5C09E 1ZHKB 1HILB 3C6LC 3KPMB 4YX2H 3QULB 2NXZC 1LO3H 5JXED 2AS5M 2VSDA 1D6VH 4YHML 4ZAKC 2D7NA 1CICB 4RAHA 4XCEA 3MV8B 3RIAF 3RZCB 2YZ1A 1BIIA 1QVOA 1D6EA 5GQBA 4L9LB 1NCAL 5J56B 4Y2DB 2ED9A 4XPBL 1JGDA 2CRYA 3O6KH 3HZYB 3R4DA 3BW9B 1K8DB 2IAMB 5CMAB 3LKRB 1EEYA 2BCKB 3ARZA 3CC5B 2GJZB 3Q0HA 3TN0D 3UJTH 2BOCB 5EIVA 4PJGA 5KAQF 3RY5A 3S4SA 3TT3H 3U1SL 4D2NA 2Q7YB 3MREB 3FQWB 2W9EH 3VI4F 2HKFH 4XZUB 2PTTB 1MUJA 1BQUA 4OIBA 5MEQB 4O5LL 5BO1L 3BGFB 2NZ9C 1UZ8B 3THMH 3KXFB 1D5MA 4Z0XB 3F12B 3EO1A 1VACB 3HUJF 4JFDE 1YNKH 3VFTB 1H3PH 3OKOB 1AHWB 4QF1B 3F58H 3EFDL 1NJ9B 2CO7B 1TQBC 2DQEH 1MCSA 3OKMA 4P2QE 1C5BH 3UMTA 2ATPB 2EDBA 4WI6A 2QL1A 3HR5A 1ZEAH 1QFWH 2EEAA 4LIQH 4ZPTA 5D7IF 1AC0A 4PV8B 1FE8L 3TBVA 3MRQA 32C2A 2Y36L 4XVTH 3LEYL 4JO3L 1XCTB 5CBEB 3KLAB 2XYCA 1KLGB 1M7DB 4HGMA 4DJMA 4OLXL 2Y06L 2I9TB 5IMMB 2B1HL 3L3IA 2MSPA 2BNQA 1UH3A 1FBIH 4K3EL 1X5KA 3BPOB 2UVFA 5KSBA 1NC4A 3WIHL 4KH2A 4AEEA 1IBGL 3FQUA 4X7FC 1BQHB 1XGUB 5C0ND 4Z7NE 1JMXA 3O9WC 4KQ3H 1KLUB 3JWNC 3V2AR 2NY3B 1BOGB 4OFYA 4BH7A 3PWPE 3JV0A 3VG0H 2X89D 1KEGH 4PRBA 3W5NA 1TZIA 3Q6FA 1XGPB 5CGYD 4JQXC 4ZUSB 5MEPA 1BREA 1YJDH 4OUOA 1OTSC 2GUOB 2Q87A 3W9DB 4JFYA 2EDHA 3L3OB 3QIWC 2CMRL 4NM8H 3KWWA 4M7ZC 1B4RA 4GXVL 3CFEA 4XI5D 1JZ6A 1UXWB 2IPKA 3M8OH 1RIHH 3F5WB 3LKPA 1R3JB 1MCOH 2CLVA 4YNYB 4UDUB 5ALCL 1MCFA 2PKDA 3HE6D 5FM5M 1XGYH 4GW1A 1CDYA 3GNMH 4R4NC 2NY0B 4P2QB 4MJ5A 2XFXB 4QY8B 5DI8B 1KOAA 5DK3A 1NCUA 4WHTB 5DHVB 3A6OA 1KTRL 5E2TH 3IJHB 3V0AC 3ZMRA 1UXSB 3LIZH 5F7WC 4TUKL 1QPXA 1DQQB 1OVZA 4GH7B 4JFEE 4L8SB 4P5MB 4XWGL 2A38A 3CCHB 1DQJB 3EHBD 4GXUN 4LLUA 3QHFL 1L6ZA 5E5MA 1D5BA 4NM4L 4Y5YB 5ALBH 3DOSA 5D2NE 3K4AA 3JWDH 4YXKL 1LE5B 1KN4H 3T09A 2GCYA 4XPTL 5E00B 3X14A 3QO1A 1UB5B 1ORSB 3WIFB 3VFUB 1WZ1L 3O4OC 1INEL 5C70A 1P84K 4YIQA 5HI4D 4DGIH 5L2JB 3ULUH 1N6QL 1QR1B 4FFYH 4WO4A 3PHQA 1JYXA 1IFHL 4AL8H 1KF9B 5CIPB 3WEXA 3ME0A 2CIKA 5FYJE 3FT4B 1E6JH 2HT3C 5TDNB 4IRJB 5I6XB 3QBTB 3MNVB 4HQQH 3LDBB 3T65A 4V2CB 2DQTL 4HBCL 1U41A 5AYUL 5JW4R 4BJLA 2CK0H 4NP4H 2JJTC 2YPKB 5IHLB 1FSKB 1U93A 2DOCA 1L9MA 1WBZB 3VFSA 1YMMB 1I1FB 2YBRB 2E5EA 1K4CB 1DBMH 3QUXD 1YN6A 4GT7A 4KK5D 3MRDA 5L7XH 3W9EA 1TZGL 2OBGA 3U36A 5J1AB 1H3WM 1S7SB 1MAML 3BE1L 1ZMYA 3F65A 3OXSB 4V1DA 1T1YB 2ICEB 2RR3A 1IGFL 5CKGA 1VB9A 5C0DA 4TSBL 4QXTA 2GITA 1HHIB 1T2QH 2DTMH 4M7KH 4NFDA 2FBJL 5ID1B 3UPCA 3C60C 1P7KB 5HDQH 5ICYB 4JFEB 1MJ8H 1ETZB 1A3LL 3ARGC 3DUHA 1G7QA 5GIRA 4NZUH 1FH5L 3WS6A 1OB1A 4XXCA 2A77L 1GC1L 2OL3H 1N3NA 1F4HA 3KPPB 1C5CL 2NY1B 3BP5A 5GGTL 2C3XA 5MI0B 2Q3ZA 4H8WC 43C9B 1CD0A 4QHKJ 5CFHA 4H25B 4Y16B 4R7NB 3V8CA 3WHE1 2H45A 3MV11 3OJMB 4X6FB 4TULH 3FRUB 5D2LE 3QUML 2EXYD 1FGNL 4Z7UF 1HQRB 4JPIB 4OM1L 1F3JA 4LKCB 3WFHB 5HYQA 3QRGH 2FRGP 2MJWA 4CRPA 3S37L 3BP6B 4BYHA 1RIUL 4P23A 1ZGLB 4HPYL 3KJ6H 3RA7H 4W4NA 5DD6A 4RFEB 3UBXG 2R39A 1MQKH 5IHZA 1IC4L 3MA9H 3QHZH 1KELL 5GRVK 4OZIA 1NMCC 1MRCL 5IQ9B 3LS4L 4PJ8A 3DX7B 3RNKB 5KANI 4LFHG 2X10A 1JUFA 4G9FA 3SY0B 4OF6A 5IW1A 3LB6C 4OJFL 1OAUL 3LVEA 4ZPVB 3S96B 2FX7H 5HI3D 3SDAA 1U8JB 1G7PB 5EU7C 3V5HA 5ESAA 3IS1X 5F1OB 4PJIA 3NA9H 4U3XA 1UQSA 5DDHA 4D9QE 3RVWC 2VC2H 4OUUB 3HAEA 5HGDA 2GT9A 1CIUA 2BZDA 3CH8A 1QO3B 2IMNA 1T89C 2E6JA 4UV7H 5ABDE 1MWAL 3L5WA 2V5MA 2W65A 3L95A 4G8IA 5GSVA 3BPNC 2VIRB 3STBA 4IOIA 5BS0D 3C9NA 4L4TD 3W0WB 2C1PB 2J8UB 4XAKE 3NIFF 1CICC 3BGAA 4BSVA 4KUCD 3GBMH 4QXGH 1Q0XL 2ADGA 3HMWL 4LPUA 3RZCC 3P0YL 3S9DB 1S7QA 4HBQA 2Y7QA 4L9LC 4Z0BL 4XX1G 5FHBH 4WI3A 1JPFA 2YKLH 1IGTB 3QDME 3LV3A 3SHSA 4YAQA 5J9PB 2V9QA 3HE7A 1MRDL 1EIBA 4P5TB 1L7IL 5T5NF 2IAMC 4GSDL 5E6IA 2FO4A 1FO0H 1PFCA 2NX5D 5D2LB 4HK3N 3RWIA 2ZG2A 5CZKA 2FYYA 3KYOA 4XHJD 1J1XL 2HJKB 4RRPA 1A6ZA 1AD0A 4G6ML 3PGDB 2UZXB 1R5WB 3CMGA 2LTQB 3H9SE 1CFQA 1DDHB 4F2MA 1UEMA 5T1LB 3BIAX 2XN9D 5BZWB 5DJXA 3MJ7A 3ESUF 4HUUA 4JM2C 3ZYZA 3L5JA 4CL7A 4DFIA 3IJSA 4BH8A 3D0VB 4J3WA 4JFPB 1AHWC 5KS9A 2XZCL 4ZAKA 3MOAL 1FFOB 4PRPA 5IUSA 2R56L 1XIWA 3U0TB 2VISA 5A2FA 3RL2A 3RPKA 3P30L 5DA4A 5IB2B 2C1OA 1UA6L 2UUDH 1U8PA 4HIEA 4X98A 4CJ0A 3QR2A 4GAGH 1AFVH 3GI9L 5EUKB 2DYPD 3FOLA 5HI5D 1ZAGA 2VZOA 4GMSH 3MLXH 1QFUH 3CK0H 4O2FB 2MNUA 3VGAB 3MNWB 5FGRA 1I7UA 1PW3A 3GJFB 1EZVX 1LO0H 3LRSB 3REWA 2APVA 1IAII 2J6EA 2MOVA 2X9YA 2V7NA 1KPVB 3MV9E 3TEUA 1NEZG 1HEZB 4DKDC 3EYSH 4MCYA 2VUOA 3KPRD 2AXGA 4GRWH 4EQ2A 3OKKB 4GQ9L 2EIDA 4ZUWA 4EVNA 2DI7A 2BHYA 5TGBB 3QDMB 4MDIA 5EBMA 5TDPA 4H20H 2NY3C 5B38A 4OCYL 1NGQL 4HEPG 2G9HB 2P5EE 5EWIH 4X80H 4M6OL 2FHCA 2ZOLA 4URTB 3ZTJH 4UI2A 3HI5L 2ID5A 3BIKA 2AI0H 1A9EA 3HZVB 2VLRA 2X4NA 3DPBA 1T4KA 1RZ7H 2RB8A 1V7MH 1E4XL 3H9SB 5IHUL 2XTJD 2K1MA 3BZDA 4IS6A 3VD5A 4P2YA 3G9AB 4FTVD 4M7JH 4M9PA 4F8TA 2ZSWB 4KI1A 1ZHLA 3GMPA 4RMWA 5EC2B 1AE6L 2DDQH 3MJ9L 5GZOD 1W72A 4JN1H 2ZJSL 2HN7B 3HB3C 5GGSA 5E1AA 3WS3A 1DE4A 5K59F 1MFEL 5TQ2H 4U1NB 4JZNA 3EDEA 2NY0C 1XF3A 3F7PC 4OGAC 1GZQB 1IKNC 2AK4D 4QTHB 3CDGA 4OLZL 2RHEA 1A7QH 5C0FA 1A1NA 3GI8H 1IE5A 3CFKA 3MRPB 2NXYC 3O8XA 5IVXE 5I30L 4Y4FB 2IFGA 3HG1E 4MJ4A 5HYEA 2X09A 1AP2B 4QOKA 2ATKB 4P59H 1WICA 1V7NL 1R3LA 5CEYB 4MNGA 3PWLA 4Y5YC 1ADQA 4N9GB 5EFIA 3RWHB 2VTFA 4RFOL 5DK2B 3SDDA 3TCLA 3C8KA 5JMRA 3T04D 3WL9B 5DD5H 3FQRB 4DN3H 3NFNA 3FONA 2JCCB 2DQJL 4HUVB 3BRDA 3CVHB 4JZOB 5SWQA 4DCQB 3MV9B 3HZKA 3FCTA 4YHZH 4ODHH 4D0BA 5KZCD 5DEGA 1IGYB 4Y4KC 1Q8MA 4QKXB 4MD5B 1KXQE 1AGCB 4KJYB 4UQ3A 3AREB 4XTRC 5T1MB 5I6XC 4XPHH 3U7AA 3QDGA 3RVUC 3VFMB 3LDBC 1Y18B 2VLKD 5FCUH 3RTQD 2VL5A 4EDWL 4LF3B 4KK8C 2P5EB 1NUNB 5HHOE 1FORH 1EVTC 3MBEC 1OAQL 5D5MF 3VJ6B 1ITCA 4HT1H 4JPWH 3BUYB 5C71A 2FCBA 1JN6A 5BXFB 5F7KC 5IVZA 4MS8C 3RVVC 1EERB 3GSXA 1EFXB 4NBXB 5ILTL 5EC1B 2FD6H 1YQVL 4WV1C 1CGSH 4U1JA 5C0IB 3VXTA 1I9JH 4W6XB 4JRXA 4LSUL 3BRGC 2AJVL 2CH8A 4FZEH 3OKLB 2VITA 1TETH 4NKDB 3TBTB 4ZS7H 4YUEL 1B4JL 2XOTA 3DSNA 5KSBF 2X40A 2YZ8A 5A43C 4F3FB 4G7VH 4FNLL 4Z8FH 5D7JB 1RUPH 1JPSL 4JZJA 3L9RA 4LU5L 4R4BA 4Z5RB 1NKRA 5C0GB 1Z0MA 3CZJA 5IVXB 2H2SC 4PYGA 3NA4A 1ONQA 2YUZA 5TPWL 1MHEB 3MLUL 3T2QA 1B90A 3UTOA 4WY7H 3MLSH 5J6HA 1S8DB 5EO1B 3LKQA 1RIVH 2FEDD 5D2NC 1A6AB 5HDOA 3AUVA 6FABH 2NY1C 1KLFA 1KXVC 5B4MC 2VDKL 2KL6A 4G43B 4NOFA 1FNGA 5D9SA 5MI0C 2BNQD 3DX8B 1AD9B 5C9JB 3V7MA 3IFLL 2WUBH 1MELA 2BVOA 3DX9A 3GDBA 4Y16C 2Q8AH 5ADPH 1N6UA 2PYFA 1ZXQA 1HHGA 1WGOA 3BH8A 4IRZH 1NBZA 4XCFL 2H3NA 4NRYA 3ULVH 4H1LH 4HKBB 1CK0H 3RDTD 1S9YB 2QQKL 1IGMH 5DS8B 3LQAH 2Q1EA 4XP5L 2BJML 3PWVB 3D6GA 3BRFA 4Q6YA 4QRSA 4XX1E 3UC0H 3C60A 5JPNB 12E8H 3V0WL 5MENB 3VFGH 2AJZA 5EUOB 1A47A 1S7RB 4LK4A 3OAUL 3ARGA 1QRNA 4OKVB 4JO4L 1BAFH 5HHPB 2H32B 4TVPH 5GGVH 1A1OA 4Y1AD 4ZS6C 3BWUC 3FO1A 2CIIB 4AT6B 4JEGB 3WV0A 4X4MA 3QG7L 3QISA 2IH1A 3T77A 1CI5A 3SKNA 3QPXH 2EZ0C 4P3CL 3KS0J 2E7LC 4JR9L 4LEXL 1PG7X 2BVUA 1OARL 4F7CB 5T3ZD 2Z0BA 3BYYA 4LMQI 5F96H 2V5YA 1T2JA 4PD4J 3UBXB 1D5XA 3IDMA 3Q48A 4W4OC 3CX5J 4P4KC 5H35B 1EJ6A 3WFEL 5C0JA 4PTTA 3RL1A 4NC1E 4PJHF 3D2UA 1TVHA 5GGSY 1W0VB 4KRNA 5CS7A 2NTFB 4P48A 4L4VA 2OQJB 3WIIH 3O0RH 2HJFB 4JY5L 3U4EB 4XC3L 1WIUA 1CLZL 4ODSL 5F89B 2XKNA 3AGVA 4JLRB 3MRKA 5FECB 1RFDL 5L88L 5EN2B 1YC8A 4LRIC 1MI5D 1NGYA 4ODUB 3W2DH 5I1LA 5GS2H 1W0WB 3MR9A 1Q94B 3GUTA 1X4ZA 1A0QL 3V52L 4K7PH 3GMNA 1P5UA 4FQCL 1UYWL 4JY4B 3UTTB 3SKOA 3EFFB 4ONFH 3BKCH 3KHOA 4FHBD 4N8CH 2F58L 3OPZH 2BHZA 1TTGA 2W60A 1S9WB 5TH2B 3CXHK 2BSTA 4WEBL 2C9AA 4PGCA 2FHBA 3K74B 3KLSA 3L3GB 4BSWB 3P9LB 3GB7A 2VLME 4HIXL 2FATL 3GMMB 1YEHL 3CGTA 1U95A 5FHAL 2VNCA 4DQOH 3JTTA 1A6WH 1NGPH 2LTQC 3SCMB 2CSPA 4L5FL 5DUBB 4XBEL 1G7IA 1KB9J 2NY7H 1ZHKA 25C8L 1HILA 1A3RL 2DLIA 3KPMA 1UWGL 3QULA 4Y19B 1BM3H 4GKOA 3K4DA 3QUYB 1E4WH 1X5AA 4WFFE 1MIML 3VWJB 3H7LA 1FLRL 4PJAF 4N0CC 1CICA 4ELME 1VPOL 3MRFB 1G0XA 4KI5E 3MV8A 3MXVH 3RZCA 4GG6B 1EGJH 4QLRA 2DIAA 4PG2A 3NIDF 4L9LA 3RVTC 4JANB 3GM8A 4XB8A 4Y2DA 3LMJL 1YYMH 3SEPA 3V7AG 3Q5TA 2I60H 3HZYA 4U3HA 1XCQB 3BW9A 1K8DA 2IAMA 3UYOD 5CMAA 3LKRA 3QO0B 2BCKA 3CC5A 4V1DD 2GJZA 2WWKO 2LABA 3B9EA 2BOCA 1EUTA 4RMUA 2Q7YA 3FQWA 1G6RL 2UWEE 4MA8H 4XZUA 2PTTA 3VGAC 1CVSC 4RWYH 5MEQA 5J13B 4JB9H 5T33H 4P2OD 4B7LA 3LAFA 5EZLB 2XZQL 4LDEB 4N0UE 3KXFA 4LPWA 4Z0XA 4HH8A 3F12A 1VACA 4LSRL 5CEZH 3VFTA 3FB6B 3OKOA 4GS7B 1REIA 1AHWA 2E27L 3ZE2E 4QF1A 1NJ9A 4J3SA 3VRLF 1AXSB 1Q0YH 3MOQA 2ATPA 4JG1H 1CU4L 3CSPA 4NJ9H 2OX5A 4R26H 4KPHL 4PV8A 4TVSa 4OZIF 5DJAB 3TWCL 1NEZB 2A1WH 1XCTA 3D39D 5CBEA 1IGCH 1G7MB 2NY5H 3KLAA 4ONHB 5JZ7D 3T8XB 1KLGA 1TQCB 3G08B 3NCFB 1M7DA 2EYSA 5EOCJ 2MCPL 3VXRB 3SE8L 2I9TA 4PP2A 5IMMA 1Q9KA 3TJEL 1GGYA 5ECJE 4M1DL 4PGJA 3ZSSA 1CG9B 1I1AD 1RZ8A 3I3BA 2HG5A 2D0HA 2OTPA 3K3QA 1KENL 1NDMB 5GGQH 2DLFH 5E2WL 1R3IL 4WUUB 4ELMB 2OR8A 4KHTL 1BQHA 1WWCA 4MJIE 1XGUA 5E8DL 4OZHF 1CDJA 2YEZB 4G9FD 1KLUA 3JZ7A 1BOGA 1MH5B 1Z5LB 1BGXL 1XGPA 4M9OA 4K3JH 4KVCL 5IWLC 4ZUSA 4TUOB 3LKNB 4YH6A 2GUOA 3LKOB 1FVDB 5FCSH 1NCDL 1OAXL 2UWEB 2Z8SA 3W9DA 4YDKH 5HY9B 3L3OA 4O02H 4YHOL 2VXSL 4GRLB 4G42B 4QRTB 5SWSB 1UXWA 4LHJB 4JDZB 3F5WA 2E9BA 1R3JA 4YNYA 4RDQF 4UDUA 3AS2A 4CADB 1SEQL 4N5ED 2AABH 4Z7WE 4HWZB 2G60H 1VADB 4PGDA 5E4EB 1NCCL 1I4FB 5F6IB 4P2QA 3PHOB 2XFXA 4R2GD 1AIFB 4QY8A 5DI8A 2EXWC 4MDJB 4WHTA 5DHVA 1URLA 3IJHA 2DWDB 1UXSA 5EU4B 1I7ZB 5GHWL 4L8SA 4P5MA 3CCHA 2Y72A 3HE7D 1DQJA 1IZJA 2VXQH 4CJ1A 2D03H 2EH8H 2DMKA 2C5DC 2OM5A 5EIQA 4Y5YA 2HFGH 1LE5A 3VFPB 3QYCA 4O58H 1LK3H 5IMOB 3MZTA 4I48B 1WITA 4UT7L 5E00A 1UB5A 3H0TB 1ORSA 2RGSA 4JFFE 1WWWX 2MPAL 5C08D 3VFUA 1YECH 1ZK9A 2WQRA 2VLLB 3FFDB 5L2JA 3UROR 1QR1A 4XNUL 1KCRH 3W81A 1LVEA 1NFDF 3OKEB 5EBWB 3BYTA 4MJIB 5CIPA 3GK8H 5D7JC 1XIWD 4HJ0D 1U58B 1N0XH 3FT4A 5TDNA 4IRJA 4NBZB 3K8KA 4NBYB 3MNVA 3N06B 2R4SL 5DD0L 3EOBB 1HQ4B 1DP0A 2F15A 4RBPH 1RZJH 3MBEA 2YPKA 4C4KT 1ZLSH 1SY6H 1EHXA 1WBZA 4U1LB 2V2WB 1BWWA 4YPJA 5CILL 1YMMA 5A3IC 2YPVH 1I1FA 4WU5B 2YBRA 5ETUB 5INDB 4Z77B 1K4CA 4HGKC 5HHXL 2X42A 4JO1L 1W0YT 4BELD 3ZSTA 4F37F 2ZKHH 5J1AA 1FDLL 1S7SA 4Z7WB 3GFUA 2FO1A 1BEYH 1S7TB 3UJIH 1R0AL 3OXSA 4AIZB 4YDIL 2P7TB 1T1YA 2ICEA 3LPWA 3VG9B 4AK1A 1RUKL 1HHIA 3VD4A 5ID1A 2X2YA 4PJDB 1FAKT 1P7KA 2XNAB 4RGND 5ICYA 2ICWI 4JFEA 4ODVL 5CD5C 1FFPA 1ETZA 1WFNA 1DN0B 3FO0H 4Y0GA 2EE2A 3R8BB 3LOWA 4NGHH 4Q2ZB 1U3HC 1C5DA 1EEZB 4RBPK 1D5IH 3KPPA 1YEIH 5C7XH 4S1RH 5HPMB 4HS6B 1HH9B 3SKUD 1FJ1B 4M3KB 4JFFB 3MRHB 2Q8BH 1DBJL 43C9A 3TV3H 3CSGA 5F1SA 2OZ4H 2IH3B 3RY6C 4H25A 4Y16A 4R7NA 4LCWE 3IB4A 4YBHA 3D0LB 3VMOA 1E4XI 4X6FA 5KOMC 3FRUA 3ZTJG 1HQRA 4JPIA 4E42B 3CUPA 1FIGH 4P99A 1CIDA 4LKCA 3WFHA 2DQHH 3MCLL 3NIGF 2Z92B 4M6NL 5FUOL 3S34L 4ZOBA 3BP6A 3S37X 2YUWA 3O8XD 3EYQC 4LMQE 3V7AE 1MCPH 1ZGLA 4QOKD 3VU2A 4A2MA 2VDRH 1JNLH 5T3ZH 4U1IB 3N9GH 4RFEA 1KTKE 1LILA 4Q9RH 5D96B 3WD5L 4MAUL 3SDDD 1HDMB 2HLFD 3MGTB 5IQ9A 5EBLB 4YC2B 3DX7A 3RNKA 1KCUL 4KDVA 1IEHA 3OKYA 3SY0A 5H8DA 3HNTL 4ZPVA 5IV2B 3S96A 5MHSD 1AJ7L 1RPQA 4JVWA 1U8JA 1G7PA 4M7LL 4KHXL 1EJOL 5DF0A 4WTZG 2OTUB 3EDJA 3FB5B 4W4OA 4OUUA 1H9VA 4KJWC 1QO3A 4YPGB 1HXYB 4OT1L 4AMKL 5EB9A 3OKNB 1CLOL 1X4YA 3J7HA 2VABB 2LU3A 1CR9H 4MJ6B 4LOUC 2BRRH 3FQNB 3PE9A 5AZEH 2VIRA 3I50H 5GZNC 3VWJC 4DAGL 5F88B 3W0WA 4KRPB 2C1PA 2J8UA 4RGOH 5JHLH 4S2SB 4K8RC 2A6IB 1RV6X 3HN3A 4HC1A 2FL5B 4M1CC 3MYJB 4LHUD 4KJQC 2JIXA 1AXTL 2YA1A 1IGTA 2XWTB 4YWGH 5J9PA 1G9MH 4XPBH 2FH8A 4LCWB 4P5TA 3IRPX 4LCYA 5I18L 1IL1B 5D2LA 3KNBB 5C0CD 3DWTA 4U31A 1F58L 4NC1C 3PGDA 2DB8A 3U1SH 4B41A 4B5EA 1R5WA 1RUQL 2B5IB 5FYJU 3IDIB 3T0VA 4O5LH 1DDHA 5JOFB 3S97C 4RZCB 5A16B 5T1LA 1GOHA 4Y5XC 5HBBA 5I1GH 4UAOC 4M62H 5D72H 5EORH 4A2LA 4GS7C 4ZOCA 2V5SA 1VEPA 3N85L 1FFOA 4KDTA 2Y07L 4UNUA 2JE8A 5HHQB 4UT9L 3EFDH 3U0TA 3PWNB 3IGAB 3GBNH 2D7MA 2ZNWA 1ZANH 1LWRA 1ZA6B 5IB2A 3QIBC 1S78C 4AZ8A 4C56B 5TF0A 3LCYA 4DVRL 2YUVA 2C4XA 4OZGE 5DQJB 5IBTL 1CE1L 2Y36H 3EW3B 5EUKA 3MLRL 1MRFH 4DKEL 2YD1A 1UVQB 3JXAA 1KJMB 3TJHC 3VMPA 4QRRE 4CU6A 4O2FA 4OLXH 3MNWA 2B1HH 2P4AB 3GJFA 3LRSA 3VWKD 4JQIL 3FTGB 1FIEA 4OSUL 2B4CL 1KPVA 5B39G 4PRIB 3V4VH 5DURD 3ARDB 3OJ2C 3WIHH 4KI5C 5FA4B 3VFRB 1IBGH 1MFCH 5DFWH 4GMTH 4H1LG 3OKKA 5DJ2B 4JKWA 4NN6C 1UKQA 3O6FB 1YEKL 5TGBA 3QDMA 5CP3H 2NY2B 5J12C 3C5JB 1NCBH 1N64L 3MCKB 2BVTA 2G9HA 4XMPL 2I5YL 4XNXH 3QP3A 4TSCL 1JTOA 3ZHKA 1WZKA 4L3CB 1HH6B 3HZVA 3FL7A 3WFBH 4DK3A 1OAZH 4MSWB 4OLVL 3DLQR 4DOHE 4JFQA 3H9SA 4D9RD 5DYOB 4GRLC 1WAAF 1VHPA 2ZSWA 5F9WB 2CMRH 4GXVH 3MLPA 1XH3B 1YY9C 5EC2A 1GL4B 3JUYA 3SDCD 2HN7A 5ALCH 4TRPH 2HWZH 3FB8B 4IM8A 4U1NA 5E4EC 1D9KD 2EYTB 3EJYC 2OJEB 2IANB 2DQDL 4U0RC 1GZQA 4QTHA 4OD2B 3TGXA 2VRAA 3ET9F 5DFVC 3ZLQC 3MRPA 5E8NB 4BFGA 1RUMH 2VKXA 4OZGB 2V9TA 3RWCB 1D5ZA 2ATKA 3RKDD 3QUZB 1KNOB 1MCLA 3O3EB 1DFBL 1N8ZB 5I2IB 3BDBA 3K81A 4NM4H 3F7QA 4N9GA 1QHPA 3CFBA 3RWHA 5HYIA 5AZ2L 5DK2A 5CEXA 3HKFA 3BDYH 4KVNL 3RAJH 4C83A 1MFDH 5GS0H 4KKAC 3WL9A 3OHXB 4XPTH 3FQRA 2J6EL 4HUVA 2JCCA 2R15A 3UZEA 3CVHA 4PJXE 1H5BB 2QSCL 4JZOA 3LQZB 4DCQA 2YPLB 3MV9A 3MUY1 1INEH 1N6QH 1I8LC 3TNMB 2Z93B 1IKFH 4WJ5A 5C0AB 1IFHH 1IGYA 1TZHB 1KCKA 1DL7H 3MV8D 4JM2F 4MD5A 3BGMB 1AGCA 4KJYA 4FQ1L 3AREA 4X5XB 1OP9A 3EKCA 3TYGH 2V2XB 3VFMA 4Y2DD 4E9LA 1Y18A 5L0QC 4LF3A 4DKAA 5IM7A 2P5EA 4HBCH 3WDHA 3VW3L 3VJ6A 1FO0B 5IVOA 3IETB 3BUYA 1KC5H 2WLZA 5BXFA 1EFXA 1FG9C 5EC1A 3PJSB 4KK9D 2AV7B 4XCCL 1UWXH 1R6VA 3CJJA 4TSAH 5C0IA 1W72L 5HVGB 1PZ5B 2J3SA 1JV5B 2QBWA 1TZGH 1WTGT 3O45B 3KXFD 3QPQD 5F7EL 2OR9H 4NKDA 4RCAA 4RWHA 3TBTA 4OCRL 3BE1H 1KV3A 1KFAH 1Q72L 1L4IA 1G9NL 1NAMH 4APQC 4TSBH 4M43L 4F3FA 5D7JA 1CFVL 4RISL 2ILLA 5C0GA 5IVXA 3HG1A 2V5TA 3DNKA 1RK1B 5GGUB 1FZOB 1MHEA 2QSTA 1JGLL 3D85B 4HMDA 1ADQL 4DFHA 2ZP0T 1S8DA 5EO1A 1M05B 1MCCA 2OP4L 5EU5B 1A6AA 4M1GL 2D9CA 1BFOB 1C5CH 1TNMA 4WW1B 3GSOB 4IDLA 5L8JB 4G43A 5GGTH 1IC7H 5KG9B 3DX8A 5C9JA 3EOTL 5C86A 3VXQB 1UWXK 4DUVA 1F00I 4RA0C 2APBA 4JJ5B 1T7ZA 2FX8H 2UVEA 4HKBA 2XXCB 1Z0NA 1S9YA 5DS8A 3QUMH 4P5KB 3G6AB 4GRWB 1JNNH 5JR1H 1AKJD 1F11B 3PWVA 5E2VL 3SOBH 1KJ2B 4CKVX 2Z91B 5JPNA 3BUTA 4KV5F 2C3GA 3S3PA 1HN1A 5EUOA 4WENB 1N59B 1S7RA 5DJZB 3RJQB 4B0MM 3NACL 2NMSA 2EH7L 4OKVA 1IEAB 3VGFA 2N7BA 1WZLA 5SX5H 5HHPA 1U3HA 2H32A 4Q6IB 5D96C 3GIZL 2CIIA 3PV6A 4AT6A 1IQDA 2VN4A 5A2IH 5I19H 1WT5A 1KELH 4YC2C 1NEUA 4PLOB 1MRCH 3LS4H 4PLNC 4Y4HC 3QQ9D 3JWOC 3FO9B 3BPLB 4OJFH 1OAUH 4F7CA 2HFTA 2GJJA 4Z9KB 3UBXA 3VXPB 5DMKA 5K9QG 2PO6C 4HJJH 4PB0L 1DEEB 3IXTB 3NFPB 1H3TA 3OR6B 2ZUQC 2WIMA 4QXUL 3GZKA 1W0VA 2NTFA 1HCFX 2OQJA 2UZYB 4IOFC 1MWAH 2HJFA 1QNZL 3U4EA 1NC2A 1J1PL 5F89A 1R3HB 4G8EA 3U30B 4JLRA 1DTUA 4XMLL 5DWUL 4EDXB 5EN2A 3BWAB 4KRPC 4OFKA 5DO2C 4D8PB 4ODUA 1W0WA 1Q94A 5CGTA 1EPFA 3EIFA 4XPFL 5SX5K 1PVHA 3WXWL 4JY4A 4AEIL 4PPTA 3C6SA 3HI6L 2ZCKH 3P0YH 3EFFA 1MHCB 1INDH 3KAAA 1MRDH 1S9WA 3OV6A 2OS7A 1L7IH 2VLJB 5TH2A 2CO6B 4GSDH 4R0LC 4OFVA 1EUUA 3L3GA 4BSWA 3P9LA 3RGVB 3QCUH 4NQDD 3IDUA 4PJCB 3GMMA 1JZ3A 1J1XH 4M8QB 3K2UL 3HCVB 4NHUA 3SCMA 4KAQH 3FN3A 1MNUL 5DUBA 1CGXA 4NN5C 4IRJD 3BKML 5DJDB 1G6VK 1H0DB 4Y19A 4G5ZH 4YBLB 3QDJD 3VDAA 4MA7L 3VWJA 3T3PF 5TE7H 2VO5A 3KLHC 1HE7A 3MRFA 2W9DL 1YMMD 2R56H 2JELL 1EH9A 4GG6A 5F9JB 4H8WL 3NPZB 4JANA 2L7UA 3B6SA 3HMXA 2Q3AA 5JW3L 1XCQA 4PJ5D 5FKAB 3QO0A 4DKFL 2AGJL 3GI9H 2YSSB 5DMIL 4CNIA 4R9HA 1IILE 3AB0B 3SE9H 1DCLA 5HJ3A 3I6KB 1DVFB 2HP4A 2DL2A 4NNYB 4YGAB 3QUXB 1JI2A 5EZLA 4BQ6A 3C2AL 5TF1H 5L9DL 2VE6B 4BM7A 3SGDI 2ADIB 3FB6A 3ARDC 1HI6B 1R5IB 2AXHA 4EJ1C 1F8TH 2O5YL 4XRCB 4MZ2A 4NRXB 1EV2E 4U7MA 1AXSA 4GQ9H 1RZKH 3L3KB 1WUNT 2NY2C 2DJSA 3KPNB 2AJYL 5B39B 3QXWA 5DJAA 1NEZA 4M6OH 1G7MA 4ONHA 4JG0L 3HC4L 4NNXB 3HI5H 5BS0E 3G08A 4H1LB 4NZRH 1I3VA 4L4TE 3OBAA 3T1FB 2YD8A 4ZNCD 1G0YR 1OTTC 5BCAA 2G5BB 2PCPB 3CVIL 3W11D 1JF5A 4HCRA 1V3MA 3GSVA 5FYKD 1CG9A 2OSLB 5KSAD 1NAKH 2JJSA 1LEGA 3MJ9H 4UNTA 1C08B 3HPLB 5C92A 4R4FL 1NDMA 3CSBA 2R2EB 2D7QA 4ELMA 1BF2A 1MFEH 4WHDA 3QG6B 4O4YL 5FF6B 2NX5E 3VGDA 5A2LH 4FFZH 1VGEL 2FECL 2AK1H 1EBPA 3FHAA 1J86A 3CXDL 4EXKA 2AEPH 3KYNB 1MH5A 1Z5LA 3MV7D 3PWJA 1FNLA 5F3HB 5JIPA 3QUZC 2XN9E 5HD8C 4TUOA 3LKNA 2QHRL 1MCRA 2ARJQ 3LKOA 1FVDA 1J8HB 1P9MC 2UWEA 5TFSL 5B3NA 2ITDB 1GC1C 2EEBA 5HY9A 2AXJA 4FQQB 4PRHD 2OTWB 4GRLA 3RUGF 1FG2B 4G42A 4QRTA 4ZFOB 5EPMB 5SWSA 1H5BC 1UM6H 4JDZA 4OCXL 4CADA 3B43A 1T7XA 4HWZA 3W0WD 4LCCB 4ZUUA 1I4FA 3BD4A 1QKZH 4M93C 3PHOA 1AIFA 1KULA 4AEHH 2HT4D 2X70B 4MDJA 3TFKD 4YZFE 4FQIL 5EU4A 1QBML 1I7ZA 3BSZL 1LDSA 4GW5B 4MQSB 4P5TD 5E9DD 3N1PC 2IPUK 4HWBA 3SE4C 4YFEA 5JXEC 2QV2A 1OAQH 5BS0B 1YDPB 1GPOL 4L4TB 1G9EA 4UIKH 4R8WH 1QSVA 2LAGB 3MFFB 1O7VA 3VFPA 3WNKA 3KPRE 2XTLA 1PSKH 5IMOA 5ILTH 4I48A 4RAVB 3U9UA 2VDNL 4KXZI 1YQVH 4OFDA 4OBSA 3BZFB 3H0TA 3IF1B 3GSNH 1P69B 5I1AB 4PJEF 5D93C 3FFDA 2VLLA 2WANA 5KSUB 2AJVH 1TITA 1I8LA 1RVFL 4XVUD 4K55A 3OKEA 5EBWA 3TN0C 4U0QB 4MJIA 1B4JH 2WBJD 3QQ4B 2GKIA 1U2CA 2HT2D 4FNLH 5J8OA 1U58A 3MLVH 2XZZA 4LU5H 4KZEL 2XTJE 1PKQB 3EOBA 4CN1A 1HQ4A 4FTVE 2EDQA 3MLUH 2FWOB 1SYSB 5HSFA 2ZCLL 4LVNC 2H41A 5FO8B 5ID0B 3P11L 4U1LA 2V2WA 3C2SA 1QFOA 1CS6A 4WU5A 3CIQA 3G5VA 5ETUA 3W39B 3GHBL 5INDA 3NZHH 3TO4B 4OCSH 4Z77A 4LHQB 2RFXB 2AK4E 5IT2L 3V0VB 1L7TL 5CWSB 4OFPA 5CLWA 4R3SB 1OSZB 1A22B 3MLTA 5C3LD 4WW2B 5L8KB 3IFLH 3QA3B 5IEHA 4Z7WA 1S7TA 2APWA 5IW3A 2P7TA 4M61B 4RGMB 1T7WA 2DYPB 3LSOA 4LP5A 1P6AB 4GUPB 3KYKH 4WRLA 5IB3B 2BJMH 2NY6D 5FK9B 4PREB 4PJDA 2XNAA 1GGCL 1BLNB 1B6DA 3X11B 3V0WH 3D25B 3RP1A 3NAAL 1DN0A 3SDXE 2X4TB 3OAUH 2P46B 4XCYB 3VD9A 4Q2ZA 3WHXB 3MOBL 4C4KO 4JO4H 3UYPA 4Q6IC 1EEZA 3U46B 2DLGA 4WFGD 2DM7A 1A7OL 1PQZB 2FR4B 5HPMA 3KPRB 4HS6A 1HH9A 5C0NC 1FJ1A 2VAAB 1AGDB 4DVBB 3QUKB 1UM4L 4JFFA 3MRHA 3B3IB 1FC2D 2PXYB 1GGUA 1CN4A 3GO1H 2IH3A 4JR9H 4LEXH 3RX8A 2BOBB 2VLKE 3BEVB 1F02I 3D0LA 1P6FA 3C5SA 1QSEB 4NO5B 1JPST 3PP4H 4PRNB 5CGYC 5T3XD 3MRCB 2BNRD 1K8IB 1JK8B 2Z92A 2CKBB 4XC1H 3PGFL 2XTJB 3WXVH 4Y4FD 2A9NL 4FTVB 4XI5C 4XC3H 3ULVF 4ODSH 1CLZH 5IFAH 4TNVF 4U1IA 1LQSR 3N1MC 5L88H 3HE6C 2E6PA 4BQ8A 1OAYH 5F7UA 1QBLL 1BZ7B 4HUKB 2FLBT 1A0QH 3NCYP 4FQCH 1HDMA 3MGTA 2Q76B 1UYWH 2AK4B 5EBLA 1OM3L 4KKLD 4PJ7E 5IV2A 2GK2A 4FRWA 5IJKC 3EHBC 4RIRB 1J9CT 4ZFZB 3DYPA 4ZO6A 2CR3A 4JREB 4YLQT 1PEZA 1UCBL 2GJ6E 5FV1L 2OTUA 2N7AA 2COQA 2DICA 1TXKA 4YPGA 5BZDB 5FHAH 1HXYA 3OKNA 3ARED 3CH1B 4P3DA 5EOTA 2VABA 4MJ6A 1FYHB 2NR6D 4XBEH 1HHHB 5IEKB 5D7SL 3FQNA 1LD9B 1QLEL 25C8H 4JGUA 3GIVB 1UWGH 4UB0L 3QAZB 3RI5K 4K07A 3O41B 5HI4C 4XP9L 4TTDD 5ITBL 5F88A 2B1AL 1MIMH 4ODTH 1FLRH 2I25N 2KZ1B 3BEWB 2A6IA 2GSIA 3MBXH 1MAJA 4BZ1L 2FL5A 3MYJA 2ICWJ 4UV4L 4KK6D 3R0MA 2AJXL 1YPZE 1ZVYA 2XWTA 3ULSB 4L8BB 3LMJH 4LCWA 4MJ2A 5D6CA 3RTQB 3X3GH 3G6JE 1TCMA 4LLMB 1IL1A 3IDYB 2R23B 5JMOC 3KNBA 4M5ZH 4CMHB 5FYJL 2KZWA 3S36H 2ESVD 4I1NB 5C1MB 4Y1AE 4OB5L 2DQUH 4X6DE 1CF8L 3IDIA 4Z6AT 1NANH 3QUXC 4KK5C 5JOFA 2P8LB 4RZCA 4YFDB 5A16A 4GKSB 2AQ1A 5JPMB 1IARB 2AJ3B 5HTSA 4LSRH 3PL6B 3HC3H 5T3ZE 2Y5TB 1TMCB 4JHWL 15C8L 5HHQA 3PWNA 3IGAA 4IIQB 2PR4H 4G3YL 3EO9H 1ZA6A 4PJ7B 3OXRB 5I73B 4KPHH 4HIJB 1A5FH 5DQJA 2GJ6B 5LBSL 3TWCH 3V4PL 5BV7H 1CGYA 1UVQA 4IMLB 1U91B 1KJMA 4QXWA 2MFNA 1MI5E 2X5PA 3LQAC 5E70A 2H8PB 4Q9QL 3SE8H 2B0SH 2XKUA 1KTLB 1T2XA 1WK0A 5MEND 5FIEA 4UILL 4M1DH 4S0SD 5B21A 4OM0L 1NMAL 2WLYA 4PRIA 3ARDA 4HC1L 1R3IH 5FA4A 3VFRA 4QYOB 4E41B 2XQYG 1E6OH 2EXYC 4KHTH 3RDTB 1HNFA 2JF1A 5IB1B 5DJ2A 4CDHA 2PNDA 2O5ZL 4ODBD 5E8DH 2AV1A 3O6FA 1N5AB 1YPZB 3OB8A 2Q86B 3RBGA 3M1BB 3C5JA 1X9QA 3PP3H 1CT8B 2P24B 2WBKA 2D0GA 5FYKH 3G6JB 2F8XC 1FC1A 2HH0L 2Z9TA 4FZ8L 1RULL 5GRUH 5KW9L 5JIKA 4L3CA 1HH6A 4MQTB 4MSWA 4A6YH 1NCDH 4Y1AB 1TIUA 4X7EC 4X99B 5I1CL 2VQ1A 5DYOA 3DO7B 4ODWB 3B9KD 1XH3A 4P9HH 5ENWB 3V4UH 1DUYB 2L4OA 1BBDL 5HI3C 3NZ8B 2NW3B 3FB8A 4P49A 2NY4D 1AGFB 1NGXB 1W8OA 3L3JB 4FQJL 5I1IL 1LP9E 4V1DE 2OJEA 2IANA 5HGGS 4OD2A 4ENED 3EYOA 3QQNA 4LRNL 4NO3B 3UTTD 5E8NA 2H9GB 2V17L 4FXKB 2YS4A 4U49A 3AC0A 4OZGA 3PP3K 4I13B 4HK3J 5CZVL 3QXVA 4FP8L 3QUZA 1KNOA 5CJ8A 3O3EA 5I2IA 1N8ZA 1KGCD 1MI5B 1CGTA 2ZUTA 1EX0A 2GSGB 5DQ9B 4KGJA 4KJPD 1P9MA 2R69L 3VRJB 3UJJL 3SCMD 3V6OE 2MCG1 4EBQH 2HVJB 3AXLB 3KG5A 3OHXA 4UT7H 4X7SH 1IQWL 4WHCA 3TBYB 1DLHB 1H5BA 1S5IL 5I8KL 3LQZA 2YPLA 3S6CA 4Y19D 2XQBL 4Z7QE 5F7MC 5KAQG 2RAMA 1BFVL 1UM5L 3QUYD 3TNMA 4WWKD 2Z93A 4LLYB 1QR4A 3CFJB 1J12A 5C0AA 2VXVL 3D39E 1I3UA 1TZHA 4XHJC 3BGMA 3ZKSD 3DETD 2G2RB 4X5XA 4PGBB 1A8JH 2XV6B 1RZIA 3Q5OA 2V2XA 1F3DH 3C09B 3F7RA 4DUXA 4LHUG 3H3PL 5IESL 1JZ5A 4ERSL 1YQ2A 2P42B 2D7PA 4I8DA 3SE4A 5JXEA 3RWEB 1BP3B 3IETA 2VZ1A 5CILH 4PY7A 3K8LA 1S9XB 4XAWH 1IAOB 5DZOA 2VH5H 3PJSA 4MNQB 4PLJD 1DJSA 5B8CB 3RWJB 1BMGA 1PZ5A 5SV4A 1JV5A 1H3UA 2X4OB 3O45A 3PGCA 4G9FE 1CTOA 1FDLH 2DIJA 1ZT1B 5T3XL 4YDIH 1LP9B 3P4OB 5HI5C 4HEME 4ZOAA 4MB5A 3KYAA 1RUKH 1GVIA 2X7LB 5LGKA 3SGDH 3O81A 5HVWA 3GMRB 5FYLD 5JNYB 3LHPH 4KTEL 2WP3T 2LE9A 1DBKH 1CQYA 1RK1A 5CJQL 5GGUA 1FZOA 2FH6A 1ED3B 3AM8A 5ICXB 4BZ2H 1RD6A 3D3VD 5IMKB 1M05A 5EU5A 1HSAB 4JHZA 1BFOA 4WW1A 3VXRD 3L5IA 2YOCA 3VXUD 4BQCA 3TPUB 3CVHL 2EO1A 3DI2B 2ENYA 4S11A 2VDPH 4BFEA 4P2RD 2OJZL 4JDVB 5I76B 3VXQA 3FT3B 4QNPF 3ARVA 4JJ5A 4WUUD 3LKSB 5E94B 3D39B 2A0LD 4EN3D 1P4IL 4JVUA 3TVMD 1XF5B 4P5KA 1DANU 3G6AA 1OY3B 1CZ8H 3MCLH 1KJ2A 2Z91A 2XTJC 1A7PL 3EOAA 1NBVL 3FOMB 4J3XA 4TUJB 5FUOH 3S34H 3ZE2F 2MQCA 2X1OA 1RU9L 1N59A 5DJZA 5GZOC 1IEAA 5C08E 1UGNA 2FECI 5DUPL 1OWWA 4Q6IA 1J87A 4MAUH 5KS9E 3MXWH 3L5XL 2IFFL 1S5HB 4FQLL 1X7QB 1YEEH 5SWSD 5EG6C 3QQ3B 3FO9A 1QD0A 1AJ7H 4JREC 3VXPA 4HWEL 4IJ3B 2X89A 1GGIH 1EJOH 1T22A 1DBBL 1DEEA 3MODH 3IXTA 3NFPA 5LCVL 1F4YH 5J0BA 4C54A 1MFAL 4OKDA 3U82B 1JTTA 3H9HB 4U2YA 1IMHC 1Q9OB 3MMEB 1CLOH 2P49B 3EJZD 4KTDH 2JK5B 3OL2A 4X8JB 1R3HA 5TE4L 5FM5O 2BY1A 4U3CA 4WTZA 4EDXA 5J3HD 1FNSL 3BWAA 4D8PA 5C8JB 5BVPL 5H37H 1WIOA 3GRWH 4X0KB 2GYSA 4NWUH 5D1QB 3LN5B 1MHCA 3P4NB 5DJ6B 3RWDB 4RGNE 3RTQC 3WO4B 5IJKA 3IDYC 5I18H 2C4FU 4OIIL 3RGVA 4CMHC 4LAQH 3OTTA 4PJCA 1I8IB 5DUML 4Z7VF 4ALAL 1F58H 3EYFB 4LASL 3UTQB 4U6HB 4NT6B 5DJDA 4ZFGL 4W81A 3P2TA 1LO4L 1MF2L 1H0DA 3O6MH 1NUDA 5F7DB 4KMTH 5C08B 1F6AB 3F7YB 3NN8B 1P1ZB 4CN6A 5HVHB 3IU4H 5JOEA 3N85H 3FT2B 5EH1A 1N4XL 2R29L 5F9JA 3PG2A 4R6UA 2DS4A 4D9LH 3JBG7 1ZLVH 4HF5H 2R2HB 4QRQB 5I73C 4GO6B 1E27B 4FQ2L 7FABL 4DVRH 5FKAA 3CFCH 1G7JB 2IBGA 5IBTH 3NCYS 1CE1H 5ANME 4CGTA 3HAEH 4QOKE 2YSSA 3SE3C 2AEWA 4RFNB 4DKEH 2FEDC 1NAMB 1OAKL 3WJLC 5GJSL 1TJIL 2IQAB 3I6KA 1DVFA 2EC9T 3H8NA 3DRTB 2NW2B 4KTYA 3SQBA 3VGHA 3MUHL 4NNYA 3QUXA 4PRDA 4F57H 3ARXA 3I2CL 1X5ZA 2VE6A 4JQIH 4RA3A 2CJUL 2B4CH 1JTPA 2ADIA 5MHSE 4P57B 1HI6A 1R5IA 4I4WB 1F4WH 3VXSD 2HJLB 3RDTC 1J1OL 1OSPH 1YNTB 1KUMA 3WNNA 3SGKC 3BI9X 1CXIA 2PF6A 2O93L 3DSFL 3PWUB 4WHYG 3L3KA 5IW6B 4WCYL 5AEAA 4NQXB 3KPNA 1K6QL 2VJXA 5B39A 1N64H 4IRSD 5D7KD 5HHVH 1ZLVK 5I1JL 1HKLL 4NCDA 4XMPH 5EZIH 5KVFH 1IZKA 5D71H 4NNXA 3BMVA 4H1LA 3T1FA 1F4AA 2G5BA 2PCPA 4HJGB 3GMOB 5C6TL 1YYLH 3DI3B 2OSLA 5KVDL 4U6YB 4NZTL 4X5LA 1C08A 3HPLA 3ORJA 3K0WA 1YA5A 2R2EA 3LPFA 4ACPA 5FF6A 2HMID 3QG6A 1BF8A 1U8OB 4OZ4B 4XBGB 5D7IE 2H2PD 5C0CE 1DQLL 3HTLX 4U6VL 3HMXL 4MHHG 1PJ9A 2PUQT 3KYNA 3DIFB 5HGHB 3FB7A 1I7RB 5F3HA 5ANMB 2D4FA 1HYSD 2CDGB 3WBDA 2BY2A 5DC9B 4I77L 1NCTA 5AZ2H 4G7YL 1YZZA 2ITDA 2G5RA 5T5NG 1OLZA 4JM4H 4FQQA 1EAJA 3DYOA 4P4RB 2OTWA 3RU8H 1FG2A 5EDXA 2J6EH 1B3JA 1NMBH 5EPMA 4ZFOA 1ODAA 4K9EL 2CXGA 2QSCH 5EU6E 2DLEA 1JPGB 4AIOA 4I5BB 4D94A 3LD8C 1T80A 2WUCL 2FX9L 4HULB 3CFDB 4FQ1H 5C0RL 4U1MB 5GS1B 4LP4A 4GW5A 2AXFB 3TC9A 4FMFA 1FGVL 3QEQD 3B9VA 3ULUD 3DV4B 5BS0A 1OP5K 2W0LA 1YDPA 1IAIM 5HHMD 4L4TA 3BAEL 3TBSB 2V9RA 3QH3B 4Q9BA 3ZKXB 3MFFA 4HCRL 3HUJB 4RMTA 3ZDZF 4X83A 1GGBH 3AMKA 2P44B 4RAVA 3QEGH 4OLYL 4XCCH 5DLML 3BZFA 4LHUB 3IF1A 1FHGA 4J2XA 3WKML 5I1AA 4PV9B 5I1HH 1QSFD 2VR5A 3B4NA 5KSUA 1GYAA 1DLFL 2APFA 2EKJA 4OCRH 2NX5A 1UACH 5D7IB 4MVBD 3WFCL 1BVZA 2YN3A 3AS1A 5C0CB 3QQ4A 2P8PB 4M43H 2YXMA 3ILQD 5I15H 1CFVH 3NOIA 4D9RE 4P2OC 1MJJB 4UUJB 4C56D 1UCTA 5I9QC 3QRFM 2J5LB 2DMBA 3I3DA 5DHYB 2FWOA 1JGLH 1P4BL 1SYSA 3VXNB 1MSPA 1OP3H 5ESQB 1FCCA 2OP4H 5FO8A 5ID0A 5FO7B 2PTVA 1C1EL 4M1GH 3V6OC 3W39A 1GJIA 4F37K 3TO4A 5I0DA 2RFXA 3V0VA 4MAYB 5CWSA 3E2HB 4YHNB 4R3SA 1OSZA 2VWEE 4WW2A 1N0LA 3EOTH 5EU6B 4DGVH 3HA0A 1P7QD 3U0PB 3VFVB 3IFNL 1XGRB 3JTSB 3ES6B 3QA3A 4HHAB 5T1KD 5T5FH 5HYSG 4M61A 4PRID 4YFLI 2X4QB 4FABL 5JZ7C 5I75B 2DYPA 4LSDA 4GUPA 4HFWB 4G6KH 3T0BA 5IB3A 4HIIB 1S7WB 2BFVL 5F7YC 4PREA 3O6FD 3JUZA 3U6RB 2R8SL 3UTZB 1BLNA 4J4PA 3X11A 1D3CA 5GXBB 2YA2A 4HWBL 3D25A 5LWYH 2FB4L 2X4TA 1I1AC 3VWKB 3NACH 2EH7H 4W68A 4UTBL 4XCYA 1FV1A 1K9TA 2DM4A 3WHXA 1BQLH 3DYMA 3U46A 4O2CB 2ICCA 5HDBF 3AY4C 2FR4A 5DC0A 4OI7A 2APXA 1QOKA 1T7YA 1OP3K 4MB4A 3KPRA 4JCLA 5CZXD 1E28B 2VAAA 1AGDA 4DVBA 3MV8E 3QUKA 2VZSA 4GJTB 2CQVA 3B3IA 2PXYA 5MEOB 3UDWA 1OTUD 3X12B 1PG7L 2BOBA 3BEVA 1BPVA 3T2NH 4NO5A 4PRNA 4PB0H 2IAND 1VERA 5F3BB 3MRCA 1K8IA 1JK8A 2OCFD 2CKBA 2DTSA 2HTKD 2VDQL 1PGRB 2FNBA 4FTVA 4L9DA 1QNZH 4NUGL 1J1PH 1T20B 3V5KB 1ZA3B 1T21A 4X7TB 3UJTL 4LVOC 1CXLA 4JKPL 3OGCB 3P73B 4EIGB 3SDCB 4WI9A 4N5EC 3TT3L 2QSVA 3U4BH 3DMMD 2W9EL 1B2WH 2ZCHH 1BZ7A 3VDCA 4LBEB 3ECBB 4XPFH 4OLEA 1D9KB 4Y2OA 5DEZA 3MLYH 4R2GC 2AK4A 1CVRA 1GGTA 3MRRB 3QZWG 4OD1H 2HRLA 1Q1JH 4FQHA 4Z7UE 3S88H 1YNKL 2YPLD 3HE7C 3WO4C 1A14L 4RIRA 4ZFZA 3DJ9A 1NCWH 2V7HB 3F58L 5C0AD 1ES0B 3CNKA 1XGTB 5BZDA 5AWNH 2VMFA 1ZEAL 1GZPB 4LIQL 5IGXH 3CH1A 1SMAA 1MNUH 1WEJH 1HHHA 5F44A 3BKMH 5IEKA 3SDXA 2RQ8A 1LD9A 3GIVA 4K7PY 4NKQB 3O41A 2VDOL 5FFLA 5JIIA 3DROB 4YDLB 1JGVH 2A9MH 4MA7H 2CGRH 2H1PL 2EDOA 5I66B 3BEWA 4LL9A 5FDWB 2W9DH 3LN4B 1XIWC 4HJ0C 5LGHL 4H8WH 1FBIL 3V95A 3MYZA 4B50A 3ULSA 3QEHB 4JHBA 4Y7MA 4L8BA 4LCIL 3SO5A 3GSNB 3RTQA 2VLKA 3K1DA 2P8MB 3FN9A 5JW3H 3Q3GB 2UY7A 1EO8H 2R23A 4PJXF 5C9KA 1A6PA 3VXMB 4DW2H 4LQFL 2Y5EA 4KQ3L 1NKOA 1SM3H 4MGXA 4F58H 4GAJL 4UZGA 2P8LA 1KEGL 4GKSA 3NCMA 4FS0A 2Y6SD 3ARWA 1X5XA 3C2AH 5JPMA 4HMCA 2ED8A 3D85D 3C8DA 2DWEB 3EO0B 1DUZB 2BSED 1YJDL 3PL6A 2Y5TA 2O5YH 3JSSA 3E8UH 4WI4A 2R0WL 4NM8L 1HKFA 4IIQA 4OLUH 2QADB 2B20A 3JWOL 4RGNC 3M8OL 1RIHL 2MHAB 4PJ7A 5I1KH 3OXRA 1MCOL 4Z7UB 4HIJA 3ARBB 5TE6L 1VFBB 4KY1L 4QRUB 2F9BT 4NNPH 4UIMB 2GJ6A 4IMLA 1U91A 3SE3A 3QJHB 1YEJL 3V5DB 1FAIL 3WJLA 1FPTL 4I9WE 4LSVH 3VGEA 1WSST 1PX4A 3OQ3B 3CVIH 5LG1A 1SYVB 1P2CB 4ZNEE 1F3RB 1A9BB 1K5NB 5ALBL 4L8DB 4G8GB 4E41A 4QGTA 4QYOA 4O4YH 2AJSL 1KN4L 5MP6H 4WGWB 3RDTA 5CCKL 1XF1A 5FUZL 5IB1A 4LPVA 5DHXB 4NQDE 3UAJD 3SGKA 1VGEH 4RQQB 3G5XB 1G9NC 43CAB 5LVEA 1AKJB 1N5AA 1KBGL 1YPZA 3ZTNH 5LXGL 2Q86A 3M1BA 3WN5B 1JF1B 1CT8A 2P24A 4HG4J 3O8XC 5DD1L 5GRWA 3G6JA 4DGIL 3ULUL 1UWEL 2OZ4A 3B8YA 4FFYL 4EOWL 4GBXD 3V6FA 4AL8L 4OAWB 2VQTA 3QDJE 9CGTA 1HYRC 4MXWL 1A7NL 4Y1AA 2D7TL 3I84A 3SDDC 4X6DA 4R97B 4X99A 5TFSH 2GK0B 4HQQL 1FRGH 3IU3A 2HLFC 1YMME 3DO7A 3GBLA 1UZ6F 1EHAA 1DBAH 4ODWA 2KKQA 5DD3L 5HYJD 2O61B 3GKZA 3SQOH 1N7ML 5ENWA 4NYLB 4ZO9A 5ACZB 3QHTC 4OCXH 1NLDL 1DUYA 3GMLB 4XNZC 1J88A 4QWWD 3NZ8A 1QP1A 1YEFH 2IADB 3O2DH 1AGFA 2F74B 4PJ5E 1NGXA 1EAPB 3L3JA 2ZUYA 1GOFA 1FVCB 1F13A 3UX9B 5LGJB 1DBML 4NO3A 1VGKB 5JA8B 5L7XL 5IJVB 2BC4B 4H0GA 2FZ3B 5KJRL 2YMXH 5GS1C 5DJ0B 2H9GA 4FXKA 2BSRB 4PJBF 1FZMB 2VLJD 2WK2A 4HXAH 5C0BD 3RGVD 4POYA 1MI5A 1CFSB 1GPOH 2GSGA 5DQ9A 1AQDB 1WJ3A 1NGWB 3ZKXC 5H37G 3VRJA 2MQ0A 4IHOB 4NWTL 1MJ8L 5KVMC 2R2BB 2HVJA 3AXLA 4PBWD 2VDNH 3O11B 5K59E 1PY4A 1WLHA 1DLHA 4NZUL 4DEPB 1SEBB 5CD3B 1VKXB 5SX4I 1U8QA 4LDOB 4LLYA 3ZE0E 3MA7B 2O26U 2XWJB 4POUB 1L6XA 3CFJA 3ZYIA 4NQDB 1BD2B 5CBAB 3DX6B 1HCVA 1BQSA 2G2RA 4PGBA 3AVEA 1Z9OA 4HFUH 5DRZB 1FYTE 4JZJC 3P3YA 2YA0A 5E6ZA 3MUJA 1IAKB 2VXUL 1M7IB 4X6CF 3V9FA 1MY5A 5FYKE 4G6AD 5I74B 3DRQB 1ND0B 3RWEA 1W8NA 3QDJB 4GKZB 3KJ4B 3H9ZA 5KVGL 2XPGB 3P11H 1SBBA 3QRGL 4HXBH 3VH8G 1PY9A 1S9XA 1INQB 1IAOA 1DVFD 3UBXI 1PD6A 1N2RB 2H6PB 3GHBH 4MNQA 1U3ZA 3HPJB 1L7TH 3G6DH 4POZD 5B8CA 3RWJA 5C2BL 1M4KA 4CVZA 3RA7L 2GW5A 1ZT1A 3MV7E 4PJ5B 1S7VB 1LP9A 5I75C 3IAQA 3MA9L 3P4OA 3QHZL 2I26N 3IT8D 3EYVA 3GMRA 5JNYA 1U92B 4G9DB 1BJ8A 2QQNL 5D5ME 2VB5A 4MD4B 1VENA 2FX7L 2APTA 2C26A 1OCWL 4P2OA 4PRHE 3VWKC 3NA9L 5HYSB 3CLEH 5ICXA 4HLZH 4AM0B 5BV7B 5IMKA 3MFGB 3BPCB 3MOBH 4U6XB 4X9FA 1HSAA 4CAGA 3ULVD 4F33B 1FZKB 3W0WE 1U9KA 5HHNB 2J8UE 4XP6L 4GLRI 3V6OA 4UV7L 3LEVH 1KB5H 3TPUA 3DXAE 4TOYL 2ERJC 4JDVA 4YEEA 5I76A 3FT3A 5FAAA 5DTFB 4NQTA 4LSPH 4FQXD 2W92A 1BZQK 3VA2C 5E9DE 4M5YH 4QXGL 5CIPH 3LKSA 5E94A 3D39A 4TVPD 1XF5A 2IBZX 4JFZL 4MD0B 5FHBL 3FZUD 4DUWA 1FYTB 2WP3O 2P5WE 3FOMA 4RDQG 4TUJA 2AEQH 3SO3B 3O2WH 2ICES 2A9NH 2EDJA 2WBWB 1I1AA 5KSAB 3MV01 3SDCC 1CD9B 1DSFL 3TPKA 4GXUM 2OLDA 3S4SB 4E0RA 1BFTA 3AY4A 1J8HD 4HS8L 1QBLH 3TH2T 4Y89A 1D9KC 4ONOA 3OSKA 2R1YB 3A67L 4MNHB 4A6YB 4F7EB 5K9JH 3OJDA 1S5HA 1OM3H 2VWEC 4PJFF 1VFOA 2A2QT 1MREL 4KUCF 3QQ3A 3HI1A 1NLBH 5H94B 3MV7B 4I0PD 5CJOL 3RKDC 1UCBH 2K7PA 1C8PA 1YMHB 5GS2D 4XVJL 3MRIB 2EDWA 3B5HA 5L2KD 3QZWB 1Q9OA 3MMEA 3HR5B 2DMCA 1M6OB 5D5MB 4ZPTB 4QO1A 3TT1L 1EO5A 5JQ6L 4NN7C 4PRHB 2JK5A 1S7UB 4X8JA 4EUPH 4FA8A 4EIZC 4GMSL 4YDLC 3MLXL 3CK0L 3M45A 4XP9H 5ITBH 5C8JA 5E8EB 2B1AH 5FO9A 4X0KA 3GKWL 3U9PH 3KS0H 4LEOB 3OX8B 3DXAB 3RI5F 4OTXL 5D1QA 1P5VA 3LN5A 2W0PA 3P4NA 4PG2C 5DJ6A 2AJXH 3RWDA 5KSBB 4Y2DC 2V2TB 1RI8A 5E9DB 5GPRA 3CZFB 5IOPB 1I8IA 4WNQB 1KJ2L 1OPGH 3EYFA 2L7JA 2EC8A 3UTQA 4WFGE 2R0ZH 4U6HA 2P5WB 4NT6A 1CF8H 4KK9C 3RWFB 1KN2L 2WNGA 3BGFC 3MLWH 3QPQC 5F7DA 3OB0H 2DD8H 5C08A 1F6AA 3SKJH 2AI0L 1HWGB 4PB9L 5SWZD 1YNLL 1ZHBB 3NN8A 4OCWL 1P1ZA 4O2EB 1RZ7L 1V7ML 3QFJD 1A64A 4JHWH 15C8H 5IFJA 4ONGL 1F42A 4TNWK 2FJHB 2WBJB 3TO4D 5I8EB 1WWBX 3U48A 5T3XE 1MJ7L 4L4JA 4DGYL 1QZ1A 4QGYA 5AG8A 4DTGH 1T66D 2BNRE 2IPKB 4QRQA 3FN0L 1A6UL 4PD4K 1E27A 3P4LA 5KOVC 4JFHD 4R7DB 3CX5K 5TQ2L 1G7JA 1J0YA