4P9HC

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
176
structure length
167
Chain Sequence
b'KVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLTIEDSDTYICEVEDQKEEVQLLVFGLTANSDQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLDSGTWTCTVLQNQKKVEFKIDIVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 28
structure length 167
sequence length 176
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hC02
2GTZB 2CO6B 3MLWH 3MODH 4LCUB 4OGXL 4NN7C 3Q5OA 5HDBF 3UTSB 1DN0A 2N7AA 1KIQB 3BXNB 3U4EA 1MEXH 3D69A 5E2WH 1NEZB 3EDDA 1JWMA 2R2CA 5DJCB 2X1WL 3BDYL 5HGAA 3LSOA 3T0EC 2DLIA 1TETH 4MAYD 3UCRA 3C2AH 2R9HD 4YE4H 4M48H 3QXAA 3SDCD 2V5YA 2HFGL 4U6HA 3H42H 1A47A 4W6XB 4PYGA 4ZTOH 3VH8A 1TJGL 3F6LA 3ULVL 2UY6A 1AJ7H 4HG4K 3U6RB 2ICES 1QLFB 4PJ8D 5IHUH 4PRIB 1BBDL 4OFDA 4RMTA 3WFHA 3D87B 3PNWA 5SX5K 1MCHA 5B21A 3T0BA 3NA9H 4QXTA 4M6NL 3TBYA 5JQ6H 1OCWL 3ARFC 2NY1B 5I0ZA 3MLZH 4YFLF 1DQLH 1QHOA 1N2RA 5IMKA 2O26U 3UEZA 1E28A 4P5MB 1KTRL 1UZ8B 4K7PL 3C08L 2ED7A 5E0QA 4D9RE 1K5NB 4YHNA 3PHQB 5LGHL 3NZHL 4ZAKA 4N68A 4RAHA 3DO7B 1ROWA 2YKLH 4AYFA 3TZVD 3KLSA 3BGMA 1RUKH 1U3HA 1O7SA 4PGDA 4NWUL 5GGTH 1P7QA 4M43L 4GLRI 2NX5B 2RAMA 4YBLC 4G7YH 4BK4A 2FJFA 3SE9L 3OQ3B 3TBWB 3TN0B 5BS0E 5CMAA 1L6XA 1H3TA 1UYWL 1KN4H 3PWUA 4BQ6A 3DRTB 4XRCB 5F1NB 2UZIH 1IC1A 2HWZH 3NCFB 4HIJB 1MREL 5DURD 4Y5VA 2NY0C 1T1ZB 4U1MA 4WU7A 4JRYA 5KSAC 4YH6A 4WO4A 4KKBD 1LQSR 2D7NA 2VZUA 3QPXH 4PRAB 4DUVA 1C7TA 1GH7A 3BH8B 5C0FA 1AR2A 5E99H 1HQRA 1I1AB 4FQHA 2P5WE 3PWLB 2LABA 3QUXA 3ABZA 5JHDD 1CQKA 4XCCH 4GW4B 4YUEL 4DCQB 4XNYH 4YGVB 3I6GB 2YPVL 5IBUG 1G7LB 4HUNB 1NCNA 3MV9E 1YNKL 4OLXL 2BNUB 3X11A 4J12A 1C5CL 4WI2A 1I8KA 4RMWA 3TEUA 1KPVB 3SKNB 3RKPA 4WUUA 5KSBA 2ZPKH 3IF1A 4NQSA 1QNZH 4QRPA 5H35A 1KXQE 3JWDC 4WIQA 2VXTH 3WHXA 3KHOA 1YN7B 3ROOA 5DJDB 1KJ3H 5E00B 4TSCH 1QSEA 3SGKA 4WHTA 5DK3A 1FNSH 5GGSB 4YIQB 3DXAE 3DV4A 1MRCH 3BIAX 3CC5B 2Q8AH 5FCSH 2EIEA 4Z7WF 2ZUWA 4Y2OA 3MYZA 3CDFA 2NTFA 2B0SH 3BN9C 4GMSL 1U3YA 2HLFC 5DJZB 5I1KL 3MJ8A 2ZG3A 1B6UA 1J9CT 2YD6A 3F12B 4Y5YA 4MSWB 5TDPA 1D5ZB 2R1XB 3EO9H 5F21B 4F7CA 3NCYS 1T1XA 1CICA 4XI5D 4NPYB 3VGHA 2GUOB 4G6FB 3EYFA 5I74C 1N59A 1FIGL 1TQBC 3R8BB 2DAVA 2CK0H 5FYLL 2X4QB 3FRPA 5CCKL 5E6YA 4QTIH 3DGCR 4GRWE 1Q9LB 1A4KA 1NFDE 1DQDH 3SEPA 3WN5C 4PGEB 3PIQB 1FNLA 1CYGA 2XZQL 3BP5A 1CIUA 2CJUH 2NY2B 3UYOD 1ZVSA 3GMRB 4Q6IA 3B9DA 5F89B 2EDEA 5FB8A 3G9VA 4H20H 5D7SH 3FO0H 3K3QA 2AJUH 4U2YA 5IEKA 3GEWB 1HSAB 1DUZA 3VI3E 2VXVL 5TQ0H 4LLMB 3RWEA 3T8XB 2XN9D 3SGEI 5F96H 3GZKA 4OCXL 3T65A 1FNHA 3BP6B 3MXWL 3GSQB 3JV4B 5D8JL 4MD5A 4BH8B 4QTHA 3U7YL 1YMME 5EUOA 5F9JB 1LNUA 4FFVD 1AO7A 3EJZD 4LCWA 2Q6WB 2MWCA 1A0QH 3CDGA 5C86A 4NNPL 3HZVB 4OGYL 4LMQI 5D6DC 4NSKB 5I1AA 3MV7B 5FO9A 3PWPE 3EO0B 1NANI 4OTXH 5T3ZD 1FCGA 1KLUB 1NANH 3VGFA 4EDWH 5LWYH 5H37G 5F3HB 4G6ML 4KJQC 1F45A 1HH9B 3MRMB 3DUSB 2V7NA 4R26L 3ZTNL 4OI8A 1MSPA 5FOBA 4Z77B 1W0YT 1JGDB 1K2DB 4D3CH 1XF4A 3KXFD 4MCZA 3D9AL 3S37H 4AMKH 4HG4J 4GAGL 4JFDD 4PJEE 5I75B 3RGVC 3ZLQC 4CVXB 2EYSA 5FYJD 3V8CA 5HPMA 4PJCE 4FFYH 4QEGA 5J1AA 2BJMH 3MUHL 2OQJB 1JGEA 1RZKC 3FOLB 5IFAL 2ED8A 1N4XH 3Q1SL 4GMTL 3SJVA 3T0DA 1EA9C 4RAVB 1UACH 5HVWA 1M7IA 2NY3B 4BH7A 2ZUQB 1RU9L 1QSZA 2ZZUT 3W11C 3UBXB 1BJ1J 4JHZA 2D31A 4OKVA 5IBLC 4XP1H 1WICA 2AK4A 3TP4A 3KPSA 1F13A 2D7MA 1WCBB 2E8YA 1HQ4B 5C09B 2DDQL 3DROB 1Q9KB 3K81A 5E1AB 2CLZB 4HAFA 4HFWB 1I3RA 2Z8VC 3NOIA 2WUBH 1JGUL 4DKEL 1S5HB 3HI6L 1IQDA 5E8NB 4UQ2B 4P46A 3CXHK 3AB0B 4X5WA 4KVNH 1LK2B 4DOHE 2FNBA 4BSWA 2QHRL 2O5XH 1FVEB 1Z3GH 4OFVA 5EZOH 3FMGL 3O4LD 3H6JA 4XPFH 3D39E 1HEZA 1VACA 4M7KL 3OAYH 1DJSA 3S7GA 5FV2A 4XWOD 3NFSL 2IPKB 2Z92B 4LVOB 3GHEH 2IQ9L 1UWXK 3LKSA 3CFCL 4TNWK 1ULVA 2VLME 3D18B 4XAKD 3HCVB 1TIUA 5HDQH 2H45A 3P73B 4N9OB 1EHLH 2DN7A 2DQFA 5JO5B 4UTAL 2YEZA 1MFBL 1OSPL 3QIWC 1RJYB 1YECH 1W8OA 1A7BA 3HNVH 3IFOB 3L5HA 4NJ9L 1I75A 4IRSD 5TE7L 3G6JE 1ITBB 5EBMB 1X5LA 5EH1A 2VDLL 1HINL 1NCDL 1NFKA 1AFVH 4PRPB 5EIVA 5D1QD 2HN7A 3P11H 1UZ6F 1J05A 4PLJD 3BT2L 4QYOA 2Z4QA 5E6IB 1RV6X 5JW3H 1YY8B 4TVPD 2EXWD 2IQAA 5GRZA 4WHDA 5BMFH 3U46B 2YD7A 3H7LA 4JQVC 3VXRA 4ODVL 4ZQKB 3W0WA 3MBEA 4LHUD 2HFGH 4R97C 1HK6A 5MENB 5I1DB 2OZ4L 5GSVA 1Y6NR 3LKPA 1FVCB 2W0KA 4QNPE 3IXTA 3ULVH 4OZFB 4WHCA 1RUPL 1YQVH 3CH8A 4I0PD 2F54A 2VDNH 2OJEA 1DQJA 1G7JA 1MJ8H 3DJ9A 3HI5H 3MRQA 4V2BA 3KPPA 2MSPA 3B4NA 2R0KL 4GG8B 4NRYB 3TBTA 4P4RB 5CEXB 4N1EA 3RVUD 1SM3H 5DUBB 4XXDA 3GJFA 1IKFH 2Q20A 4ELMA 3KPOA 4HXBH 2YD3A 5J13C 1LP9F 1HOCA 1NC4A 2HVKA 3LHPL 2J88L 5I19H 5A3IC 4G6JL 4LQFH 3QUZC 1NC2A 5IOPA 3LKQB 4N9GA 4LSPH 4X9IA 3C6LA 4ELKB 3FQWB 4P5TC 5DZLA 1UM4L 3K46A 4Z7VE 4NQDB 2VUOA 1EEUA 1MFDL 4PJXB 3EJYD 1FZMB 3VXUA 1MY5A 5D1ZD 3PWJB 4D9QD 3U7AA 3DGGA 1KB5A 4FXKA 1HHIB 3EUUA 3O6LL 3TPUB 3IDJB 4M00A 1IC4L 4XCNA 1NAMA 3BRFA 5A2JH 2Q86B 4RFEA 1LO4L 1NCWH 4DGYL 5M94B 5ICYB 5DEGA 4JFFD 4X6EA 4XP4L 3TT1H 3PWVB 3VD7A 5AUMA 3NPSC 3X12B 2VRAA 1D5XA 4RA3A 1DBAL 1JN6B 1KTLB 4YBHA 1Z2KA 3W9DA 3EOTL 1VGEL 4JRXB 4U1LA 3DVIA 2JB5L 4N0UB 2UYLB 2FB4L 4XPTL 3T0EA 3CXDH 4H8WC 2YPVH 4EI5A 2IG2H 3UBXI 5JNYA 4CVZA 2R0LH 3NCJH 1KOAA 5KS9E 3ZE0E 3VXQB 3SDXE 4QKXB 4IOIB 3BP7A 5CD3B 5GRVL 1U8OA 4PJGF 1JTOA 1IAOA 2DWEB 1CXFA 1KPRB 3BJLA 3KS0H 4JLRA 4TYUA 5DMIL 1W8NA 4H25B 1U8MB 3MRPB 5HHOB 2C3WA 1UFUA 1MHCB 1IVLA 3ARFA 2VH5H 3PP3K 3QJHB 5D6CB 2DIJA 5MERB 2HYMA 4GW5A 3GSNB 4BFIB 4KTDL 1CFTB 5CBAB 5BJTB 1VEMA 2EDTA 5J12B 4QXUH 1OW0A 2W9EL 1P2CB 5ACLA 4G80B 5JDSB 1G1CA 2CK2A 5DDHB 1U8KA 2EE9A 4HC1H 4X6CE 3SDAD 2GSGB 3THMH 3C9NA 4GBXB 3WEXB 4JHAH 3V95A 3BKJH 3F6IA 1IM3A 2X4RB 4FA8A 1FIGH 2W92A 2EDOA 1WBZA 2MMXA 2EDRA 1ZA3A 1FRGL 1RVFH 1XGPA 3TNNA 4Z76A 2V7HA 1LEGB 5DHVA 1F3JB 5H37H 1M05B 2CIKB 2IPUG 1XCTB 4ZOEA 4U1GC 3EFFB 3MLYL 4U05A 5ERWA 3P30H 5CBEB 35C8L 1ZGLP 3GBML 1MI5B 4WU5B 3S5LG 3SDDD 1RZJC 3VFMA 1U95B 2ESVA 3CK0H 4WENB 2P5EE 4N8VB 4NUJA 5C0BE 3ARDB 1MJUL 3KVQA 3N06B 1KCRH 4NYLB 2IALB 4LKCA 3PV6B 2P42B 4EN3D 3LQAC 5B39A 1I4FA 3VRIA 3WXWL 4BSVA 3OSKA 1M7XA 2P8MA 4OCXH 4GKOA 3FHQA 1TCRA 4OZFH 4U6VH 5DK2A 5E2VL 5EDXA 2AJZA 4U1IA 3WLWC 2YPLA 3PF2A 4G9FA 1PW3A 2X09A 4KMTH 1I8MA 1XGUA 5DS8B 5EWIL 1FGVH 2AJ3A 3BX7C 4PRNB 3D25B 3LQMA 4O4YH 3VMNA 4XNZC 1ZT1A 3KPMA 4WFFE 1JPSL 1HHHB 1JYNA 3REWA 2Y6SD 1YEDB 1QBML 3I02B 2BCKA 2YBRB 4ONOA 2WK2A 2XQBL 1A6WH 2WBJB 4G6MH 4KGJA 2NCMA 1DQML 3ZT7A 4R26H 3ZTNH 3KYOB 1DVFB 1LE5A 3EYOB 2JK5B 1BHGA 4E9LA 1XF5A 3D9AH 3RHWK 1JV5B 4QRSB 3GSOB 5DJXA 5TPWL 3VU2A 1EFXA 5LGJA 3EOBA 1A9BA 4PB0H 2XZCL 4IOFD 3FQXA 3W9EB 2F53E 2OXGA 5IFAH 1MCOL 1WWCA 5DR5H 1LILA 1RU9H 4RCAA 2APWA 1SEBB 3MV8B 4ZD3H 3PJSB 4U7SA 3PE9A 1F4YL 4Q9RH 4RNRA 1KBGL 2AEIT 2MOVA 4RGOH 2FO4B 3DHJA 1F4AA 4I8DA 2H32B 1UC6A 2N4IA 3D2UA 4X7EC 5EZIL 1LK3H 5L2JA 1TFHA 3IKKA 5T1MA 3QUYA 2CD0A 1E27A 4PG2C 2CMRH 2RIKA 4D9LL 3S4SG 2W59A 2KQMA 3C60D 4J1UA 3KG5A 3MFGB 1J5OL 4MVBD 1VADA 4NGHL 5J06A 2VLRB 5T33H 1S3KL 2E9WA 3O6FD 5SWSA 1F4WL 4P49A 4JJHA 4JZNA 1J10A 3SO3B 1R0AH 1FFPB 4KVCL 5D6DA 3GSNH 4L3CB 1JWUA 4DQOL 2NY5C 3MYJB 5I73C 4TTDC 2OR9H 1UVQA 4BELD 5CEZL 5I9QC 5JW5B 2QBWA 2C3VA 5CSGA 4NZTL 4PJ5B 3L3HB 2CKBB 1F4HA 1I8LC 1RJLA 4BSJA 3GKZA 2Z93B 3L95B 5HHMB 3NZ8A 4X0KA 4MDIB 4ZAKD 5I8OL 1K8IB 2MCG1 4ZFFA 4NWTH 2DIBA 2DQIL 1U3HD 2YWYA 3EYVB 1A7QH 4DEPB 3RPIA 5EOCJ 3WL9B 3UO1H 1DE4B 2Q3ZA 2HJKA 1G0XA 2O5ZL 4MA1B 1INEL 2XYCA 3H8NA 4DKFL 1MPAH 3GI8L 3NH7L 5ANMB 4LLWB 1M4KA 3VE0B 1CN4A 1EJOL 3H3KA 4KI1A 2ITDA 2CDFB 4WNQA 4HGWA 4PJDF 4L8CB 2R0KH 3LRSA 1A6UL 4WO4D 3IJHB 3QDHA 4LU5H 1I9EA 3FQTA 1U8NB 3T4AA 4UDTB 1DLFH 2HH0L 5EN2B 5HHVH 4L1HA 3ZDXE 5JOEA 5L2KD 1MHPL 5GJTL 4MA3A 7FABL 3QCUL 3MTRA 4JO4H 2J88H 2OTUB 1EH9A 2UWEA 3RWIA 1E4WL 3ZDZF 3QULA 1TVBB 4R2GD 2NR6D 3C5ZB 1FH5L 3OR7A 1SY6A 1FJ1A 3MOAH 1ZT4A 4YZFF 4MMZC 1QRNA 1YMHA 43C9A 2CPCA 5A16A 4JZJB 1PEWA 3G6AA 3V0VA 3GB7B 3VA6A 4HJGB 1QQDA 3HRZA 4WUUD 4QRPD 1A4JA 2GW5A 3VFNA 2DQEL 4Z7UF 1G6RB 4IS6B 1FYTB 1AGEB 2AI0H 4XMKH 9CGTA 4KROD 3U9PH 1QSED 4QY8A 4QRRD 2ZOLA 3FT2B 4E5XB 4Q7DA 1F5WA 4P5KA 4X6DF 1KJMB 5FO8B 5GS0H 3STLA 3DECA 3ARBC 1BOGA 3QDJB 4PJAE 1OAYL 5GIRB 3GI9L 4NT6A 3EOTH 4LDLB 4KHXL 2IANE 1R5VA 4TQEL 3MRKB 2XKNB 3N9GH 3QIBA 2JB5H 4DK6A 3DX6B 4JFEB 1H8NA 1CICD 4GG6B 4CMMB 2F15A 2Y5TA 1I7RB 2B2XH 4OT1L 5I1CH 3HAEA 1QTYT 1KXVC 2R4SL 4LCIL 4CGTA 1YUHB 3O9WB 5DMIH 3AVEA 5D7IB 5E5MB 4LASH 3WNMA 5I8CA 4KK9C 1WK0A 2D7OA 1UM5H 2NY6D 2YZ8A 4XGZB 3SKJH 4JFPB 3VXOB 4I18B 1RIUH 1FLRH 4OGAD 2DM4A 1A1NB 5C07B 3WFCL 4NJAL 1M6OA 4O2CB 4YDIH 4DTGH 4HWBA 2JKXA 1FZJB 5AYUH 1FZKB 1I9RH 1CXIA 3MUJA 3AXLB 3T1FB 5D7KD 1KACB 3ES6A 3QNXA 3JWOL 2ZUXA 4XBGB 4Z0XA 1XH3A 5F1IA 2A6DA 2VIRA 5DLML 1ZA6B 2BSTA 4RFOL 4KXZI 4JY5L 1L0QA 1KN2H 4P5TA 4R8WL 2N7BA 3DRQA 4M5YL 3R1GL 4W68A 3QWOB 3IVKA 1VDGA 2MTPA 4KQ3L 3MRHA 1T5XA 2QR0A 2VL4A 2HJFA 5I1EH 4J6RL 4QWWC 2VDRH 1FE8L 1AO7D 5DO2C 4LCWD 4NKMA 1OARH 2AV1A 2GEEA 3SCMB 2YUWA 3AREC 4AH2A 3HC4H 2BRRL 3OX8B 5JUEH 4K94C 5D71L 3MLVH 2F8OA 3LMJH 3A67L 4WDIA 2CKBH 4TUKH 3GRWA 4FN0A 4MB4A 3MLYH 3MGOA 4PJFF 3GBMH 5JXAH 4JJ5B 3GSUA 1MWAB 1BQLL 3AMKA 2CQVA 4J3UA 3OAUH 3BWUC 3U0PB 2IPTL 2OBGA 1Q9OA 3KWWA 1GZPB 4P23B 4PJBB 4LNVA 1ZLSL 5D5MB 4WUKH 4Y4FD 3HFML 1D9KC 1Q0XH 3RWCB 4XP9L 3G6DL 2FEDD 1L7TL 1A7OL 5INCA 3INUL 4I3RL 4LNRB 1W72B 4XX1E 5E2VH 4QHUA 2GITA 4NO5B 3KJ6H 4ZUVA 4TTGA 2VDPL 2VQ1B 3FT4B 5EWIH 1SJEB 4WW2B 1ZT7B 1RURH 1UH4A 4X6BB 4OZGB 1AP2A 2LV4A 1UA6L 2AK4D 3TVMB 1HKFA 2X4OA 3KPSD 3OB0K 5TGBA 2C1PA 1LEKB 2DS4A 5HXMA 3SO5A 4RGMC 3ESVF 1QBMH 4H1LA 1CE6B 3FONA 1WIPA 4WHYG 1A6AA 2I24N 3BZFB 1CT8A 4HHAB 3KDMA 1IM9B 3K7UA 4P46D 2FATL 3QAZC 2YXMA 1XR9A 2XFXB 5IB5A 4Z78B 4M61A 1RAMA 3FFCE 2J8UE 1AGBA 1BFVL 1ZLUH 3WHE0 3MNVA 3JVGC 1WFOA 4LAJH 1WWBX 1AGFB 5FECA 2R29H 3MA9H 4BYHA 3RAJL 3VXMA 3GNMH 1YNTB 5IVNA 3CUPA 5DEFB 1CD8A 5KG9A 4OCMC 5BS0D 3RWHA 5H94A 1J0HA 1U8LB 2BOCA 2ZOKB 4GW1B 2FD6L 4I77H 4JN1H 4X4YB 1L0YA 3WFBL 4FQXC 3GGWA 5DRXB 3VFSA 4JR9L 1TENA 2QSVA 4KJYB 2GTWB 2XTJE 3OZ9L 1X5GA 5DQDH 1K3ZA 2DQGH 4HIEA 3MV9B 4BQ8A 4ZPTB 2E3VA 2DTSA 5IVZB 5T3XH 1MVUA 3UX9B 2XWBB 3VCLA 4P57B 3V0WL 4F7MB 1AKJB 3WNNA 1YJDL 4MB5A 3MJ7B 2P5WD 5C2BL 4BK5A 3UTTE 2WINA 3TO2A 1VPOH 3UXFA 3W0WD 4HBCL 2WSKA 1HHGA 1HDMB 2HTLD 5DRNB 4FZEL 2Q8BL 3DXAB 1MIMH 1JK8B 2E7MA 4JO3H 1F4WH 5L7XL 4U1HA 4MDJB 4G5ZH 2YD4A 2EO1A 1I3UA 1KIRA 4CJ0A 4ZFGL 4W4OA 5EFIA 3U2SB 2C3GA 5IMLB 5CEZH 1WGOA 1CDYA 4AEHH 5I6XB 3S96B 1TQCC 4UUJB 4HUXA 1UXSB 4POZD 3GSWA 1YEIL 2VISB 4K8RD 1N7MH 3LEVH 3BRGC 2GK0B 3PGCA 3VXNA 1EGJL 2DBLL 2OX5A 3LV3A 2C26A 3C6LD 1VFUA 2R56L 4MNGE 2Q76B 3L3GA 3OPZL 4GRWB 3TO4B 3PP4H 4M4PA 1UXWB 1NFDB 4RMUA 3VXUD 1ED3A 3CZJA 1HHJA 4NQEA 4K3JL 3SJVE 2ZCHL 4R0LC 4WWKB 3ARGC 3QG7L 5HVHC 5GSRA 4WI5A 4R6UA 4S1RL 2DWDA 3PGDA 4HGMA 5C9KA 4OCWL 3BUYA 4NCDA 1R24A 3BEVA 3UZQA 3VWKC 4O2EB 2HKFH 2Z91B 4PREB 1MHPH 3WIHA 1MCKA 5DF0A 4AIZA 1E4WH 1YMMB 3ZHKA 2ITCA 3C09C 4UT7H 5KJRH 2WBKA 1JHTB 1GC1L 1VB9A 4GRMB 4L5FL 1ZANL 3BZ4B 4YPGB 3T0ED 4XC3L 3RIAK 4QHKI 2OTWB 3HI1B 5GISL 5IW3A 5LG1A 4HCRL 4MD4B 3PWPB 4ISVA 1WIOA 2C4XA 5GZOD 1YEFH 1N3NB 4QT5A 1GGTA 3FRUB 1Y0LB 2A9ML 5J1TC 1T20B 4E41A 1S7TA 2DQEH 3J7HA 5FGCB 4F9PC 2PO6A 1CTNA 4PJ7B 5C8JA 3AM8A 1JTPA 2OTPA 3RNKB 3ARFD 1J1OL 5EZJB 5FYJL 4PJEB 4F2MA 3H9YA 4JDVB 5CWSA 2V9RA 1UKSA 4OZIF 2W38A 3VXSE 5I8EA 3GI9H 4XCEA 4YDJB 5FDYA 1D5BB 4ETQA 3KR3L 2PN5A 5FYKE 1NMCB 5H2BB 4R9HA 2WLZA 3NABH 2G60H 2OK0H 4OLYL 1P69B 3U7WH 3DMMB 4PJIB 5E4EB 4OLUL 2XXCB 4LSQL 3QHFH 4PY8J 1PY4A 4ZO9A 4OT1H 3C5SA 2Y5EA 3TNMA 4M93C 1CDCA 1GGCL 3L3JA 3VXRE 1OOAA 3WS3B 3OKDA 3PQYA 3LZFH 1CLOH 4YWGL 1ZWIA 3B83A 3O8XB 1Q94B 4OLZH 1R3LB 5BOZG 2J8OA 2VR4A 4AG4H 3VFUA 1C1EL 3BGFB 2AQ3A 4I9WE 3WCYA 2A9NH 4P9ML 1A6VH 2NY0D 1FP5A 5KSAD 2AW2A 5AAMA 4L3EE 4UTBL 4JANA 5IFHH 3E6FB 2KPNA 4JGUA 4OGZA 2EYRA 2V9TA 1RZ8B 4MJ5B 5JW4N 1H15A 2ESVD 1P4BL 3JWOH 3L3KA 1V3MA 4LBEB 5BRZA 4ZFZB 1EV2E 3U9UB 2HJLA 1AHWC 1VFAA 4MHHG 5EPMA 1C8PA 1PQZB 4TNWF 1G9NL 4ZOCA 2V2TB 1RUML 1MQ8A 2Q7YA 1EJ6A 3LKNB 4HSQA 5L8LB 3D39D 3MRJB 4G9FD 3ZTJG 1I3GH 1E6JL 3QDMA 4NQCA 4YXHL 3R4DA 1DL7L 1MF2L 3F7PC 3G6JB 4LSSL 4EOWH 5EO0B 2J6EL 4TULH 2BRRH 1EEYA 4YX2L 5CKAA 4AT6B 4L8SB 3HR6A 2AV7A 1MNUL 3GMMA 2PXYC 4WHYH 2CIIA 5F9OL 3CFJA 1MRFL 5K9OA 3I75B 2Y36H 5F88B 2X4SA 3BN9D 3G9AB 3ULUH 3GMOA 1KCUL 1M71B 1NGYA 2JCCA 3DWTA 3K1KC 5IMMA 2AJSL 1AD9A 1F2QA 1OP5H 1G7HA 1KGCD 5HYSA 5JW4Q 1WF5A 1YC8A 2AKRB 2EH8H 4FRWA 5D93B 4C83B 4XP9H 3MRGA 5E9DB 1H3PL 1L7TH 4Y19E 5HHQA 3EW3B 2GHWB 3T2NL 1VKXA 3CVHB 4L4VE 4OV5A 1TZIA 2AQ1A 2X4PB 3BO8B 4TRPH 5F97E 3QJFB 3MCKA 4OF7A 2AEPL 2CUIA 2QADC 4X80L 1A7NL 5GGQL 3IYLW 4EXPX 1X5XA 1OAKL 4NKDA 5AAWA 2GJ6B 4I0CC 4PV8B 4KZDL 2E7BA 3S35X 1JL8A 4MZ3A 4Z7VB 1HXYB 3VMOA 1PD6A 4OZHA 3FO9A 2I5YL 2I60H 2XWTA 3S3JA 4LHUG 2MFNA 5IW6B 1S7WB 2BNQA 4I2XA 1DN2A 2CR3A 5CILL 1T7YA 5E95B 1FO0B 4QRQA 1CFNB 3LS5L 2C1OA 3L7EB 1X4ZA 4XP5L 2HAZA 4JY6A 1OGTB 3SY0B 5JMRA 3RTQA 5DUMH 4LVNB 2R2BB 4LCCA 2IH1B 2R23B 4FXGB 5HJ3A 3MGAA 3MR9B 5BVJB 3TIDB 1BFOB 2A0LC 5SWSD 2V2XA 4TSAL 4JFXA 3WO4C 2WP3T 2PCPA 1OSZA 3VD3A 4DVRL 3NMEA 1F3DJ 3WFBH 4HK0B 3SKMA 4AEIH 5GGVY 1RUQH 3OZ9H 4KJQD 3L5WB 1ZLWK 3SQOH 4BFBD 3L3IA 3MLRH 4WI4A 3AROA 3ZSTA 5KS9B 3CPLA 5CP7A 2ZKHL 2D7PA 3TA3B 3ARQA 3V0WH 1A9EB 1CXHA 2VN7A 3QFJE 1D9KA 1P5VA 3RGVD 3R06B 3MUGB 2F5AH 3SKOA 2FJGA 4GKSB 1MCEA 2A6IA 4Z7NE 4MXQC 4PJ9B 5J4MA 4HBCH 5EBWA 4L8DA 3E3QE 3UC0L 4U1SB 2Q8BH 4I5BA 3KYNB 3MRDA 4FMKA 1WT5A 3IRZA 3W11D 2YPLE 1QSVA 5DWUL 2MKWA 5IBLD 2VITA 1FG2A 4P2OB 3FQNB 1S7VA 5B38A 4X99B 1QFHA 2KUTA 1D5MA 2VXUL 5TE6L 1YEKH 3ARRA 2YA2A 3LN5A 4GKZB 1PZUB 4KPHL 1VFMA 4RQQA 3DNKA 4LFHD 1N0XH 4MD0B 4PGBB 2LQRA 2IFFH 1YNLL 1QFUH 1MH5A 1XF3A 1CI5A 2X7LB 4JCMA 2XA3A 5K59F 2WQRA 4N0FB 3IFNH 3OPZH 2OMNA 1QRND 5HHPA 1IKNC 5KZCD 4YEEA 1S7SB 3JVGA 3OKLB 2IH3B 4MA7L 4MXVE 1NGPL 1RZGA 5LCVL 4PJHB 3QDGA 1NDMB 4G43A 2F19H 2LVEA 3RL1B 4LLYA 1T03L 1KUMA 2AXGA 3P4NA 3RUGE 3QIWD 4QHLA 1IGML 4QOKA 3KLAA 1JHKH 2P5EB 1DANT 3ZT5A 1B4JL 3ZMRA 4BZ2H 4HS8L 4QRUB 4XPHH 4NZUL 1KG0B 3DX7A 3DI2B 4AJ0A 2AK1L 3H9SA 1DLHA 5ISZA 2NXZB 5D7JC 4JHBA 3VFVB 3CSGA 2MQ0A 2IAMC 2IJ0C 3QQNA 2OM5A 5EA0L 3REVB 4O9HL 3VD4A 2BNRA 3VI4F 4TPRH 3P9WB 5KSBF 1FHGA 2BOBB 3I9GH 2F58H 2YSSA 2X42A 5F7FA 5BXFA 5F7DA 3GBNH 4XC3H 4JFHE 4R4FH 5C0BD 5GISH 5T3ZH 3S36X 3ZYZA 1B0RB 1FLTX 2VKXA 5SX5H 3RNQA 4P2QE 3MJ6A 3EYUL 1TCMA 5F1KC 4XCYA 3D0LB 4OLWH 1BREA 2DQCH 5HVGB 2VZTA 1LDPL 3ZZ1A 4NBYB 1NGZB 3O4OB 4G8EA 3OJDA 4WFHD 4WW1B 3LIZL 1JPGB 5J3HC 4WFFD 5EZLA 4L9LB 2EE3A 3RHWF 1XCQA 3D0VA 2QQQA 1BLNA 3RZCB 2F53B 3BPNC 5C9JA 3PL6B 4C56E 4EBQH 1QP1A 5A3ID 1T83A 3QUZD 3FB5B 1ADQH 3V4PL 2A1WL 1PYWB 4P5TD 5DD3H 4UNUA 3C6SA 4OB5H 3ISWA 3G5YB 4OLUH 4IIQB 2GJZB 3VXTA 1FL6B 2NNAB 4HX1A 1KT2A 1IC5H 3LPGA 1W0VB 3UTPE 5T1DL 4Z7WA 2OI9C 3FJTA 1OQOA 1DBJH 1NFIA 2R39A 3E0GA 4YWGH 1DEEB 4P48A 4R0LA 2EICA 5ILTH 3IETA 1FAKT 2BSED 4X4XA 1RUAL 5I17A 2UZYB 4G6AC 5C0GB 4JM2B 1JNHA 4Y4HC 5DSCB 4MJIE 2A73B 3QB7C 5IP4A 4KRPC 1CU4L 4BFGA 1DQQB 3G04A 2OZ4A 3BQUA 4BZ1L 1FL5B 5CUSL 2HFEA 1ZGLM 5EOQH 4P3DA 3IDYC 3E2HB 2J8HA 2D4DA 4D8PA 5HGBB 3BE1L 3OR6B 4HFUH 3HKFA 2GFBB 3AUVA 4MMXC 2VLJA 4PY7A 1OP9A 1S7XA 3QG6A 3D5OF 3M1BA 4HJJL 4QRTB 1RZ7H 4ZXBC 3U30C 2Y06L 4LCYA 2FGWH 4HIHA 5JOPD 4I3GA 3CFIC 2MPAL 3WYRA 3QEHB 5FK9A 4OF6A 2ZSVB 3SBWC 2HKHL 4LLQB 3EYSH 4JZOB 1CFQA 1DCLA 4KZEL 2LFGA 2EIBA 4RISH 5K9QI 1AQKH 3BYTA 1BQHA 2DYPA 2FH6A 3K4AA 4TVPH 4L8BB 4OUOA 2XACC 2J3SA 4GAYA 1A02N 1R3KA 3OXSA 3NCBB 1JFQL 2J2ZA 4OBSA 1BM3L 1ZHNB 4I4WA 1WLHA 3GSRA 5CSBA 1U91B 5I1LB 3QUML 4ZO7A 1X5FA 3O41A 4PV9A 2WMPA 5F6IC 3K2UL 3FQUA 2XWJB 1ETZB 5T1LA 4YC2C 1YA5A 2VWEC 3I2CH 1F6FB 3D3VE 1L9MA 3OKEB 2LAAA 5C0CA 3HG1B 4V1DE 5CZKA 3VH8G 4LLUB 4KI5C 5KTEH 1OAQH 4NQVA 3ZDYF 1W0WB 5IEHA 1Y6KR 1L9NA 5ID0A 1YEGL 4DFIA 4K9EC 1NDGA 4HIIB 1JBJA 3HR5B 8CGTA 1TVDA 3MPCA 4LSVL 2DJ4A 1RHHB 4P2RE 1NL0L 3WUWA 1ZHLB 1OAKH 3MRCA 4MQXC 4DZBB 5EU6E 4MJ2A 1NBYA 1C16A 1VESA 1MQKL 1AI1L 4PS4L 1VCAA 1DFBH 3KPRA 1RMFL 2VABA 1J8HA 3LKOB 4FXLA 4KDTA 4POYA 5C0NC 1E4XI 5DQ9A 1K85A 2XA8L 3VRLE 4IRJB 2VE6B 2I5YH 1INQB 3WKMH 1YPZA 4AIOA 2FJHA 3P40A 5HHNB 1O5DT 1PZ5A 4HUUB 5CILH 5A2LH 4MLIA 4F15B 3MMEA 2FH8A 4X83A 1CR9L 2B1HL 2LU4A 1OGAA 3LS5H 4CW1B 2UVEA 4S1SL 4AIXA 1NQBA 1RFDL 3IJYB 3B3IB 3QNZB 5F7EH 2DI8A 3P4OB 4LQ1A 2NY1C 1MRDH 4OFPA 4NBZB 4EVNB 4U6YB 4TOYL 1FN4B 1CVRA 2KZ1B 4PJAB 2B1AL 3HE7A 4QF1A 1I7UB 1PG7W 2PYEE 4XNUL 4R3SB 2F8VA 3E6HA 4DVRH 1B0WA 3O3AA 1G6RL 3RRQA 5GRYA 3U4EB 4C4KO 3D69B 2AXFB 2HFFB 4OUUB 3O0RL 5EU3A 2L0DA 1JWMB 2HLAB 1BWMA 1A7PL 2V5MA 1B0GB 3BP4A 5HGAB 2C4FT 4KHTL 1NMAL 5IMOA 1UADC 2E9BA 1T4KB 3QXAB 3TN0C 4HWZA 3IDMB 3HNSH 3VDCA 3P9MA 3U4BL 4U2ZA 2W65A 2DICA 1V7MH 2LU3A 2IAND 1EO5A 1CWVA 1NBZA 3I84A 5ID1B 4FQCH 4B41A 4JKMA 3PNWB 1KSRA 1R5IA 2X6MA 3G5XA 5FV1L 3MA7A 4ELMF 4XNQA 4BQBA 2AJXH 5IMKB 3OXRA 5D2NA 1I7ZA 2XQYK 4A6YA 1E28B 1I1AC 3HUJE 1I9JH 2Y7QA 1JGVL 4N90E 2BY1A 3N85H 1GVIA 1KTDB 4Y89A 2LU7A 2Y07L 1KJVB 4ZAKB 2AAVA 1IMHC 1FFNA 4G8GA 4M7LT 1BIIB 5T5FH 5IESL 1UWGH 3NIDE 1NBVH 5KVGL 1P7QB 4LRNH 4P4KA 4HT1L 1MLCB 2FJFB 5CGYC 1DBKL 2QQNH 4ZSOA 1BFSA 5CMAB 3RBSA 2PR4H 3LOWA 4IRZH 1NMBH 1UWXH 4YHLH 3PUCA 3RIFK 4YHOL 4LF3A 5HYJA 1IAKA 3S4SA 4H5SA 5BV7B 3V5KA 3V6OC 4JQIL 4Y5VB 5DFVC 3IDNA 3CSYA 5CINL 3WIIL 4U1MB 4WU7B 3UJIL 4JRYB 5JOFB 1V7NH 1FGNL 2H8PB 1BQSA 1KEGL 1XMWA 3A6CH 1ZE3C 3DUUA 5C0FB 3WLBB 4Q9CA 1B4JH 3G08B 4TTDD 1HQRB 5I1GL 5DD0L 3OV6A 3QUXB 2AEWA 3QO0B 3P0VL 4NO3A 5EULV 1CK0H 3RVWC 1ZV5A 3AU1A 5JXEA 1KEML 5GRWA 1HYSC 1MWAL 3D85B 5F7HA 1FC2D 4KI5E 4CBPA 1IGFL 4HK3J 3X11B 3IFPB 2IFGA 2DLTA 5L6YL 2AQ2A 4LEOA 1IBGL 3UTSE 5H35B 3WHXB 1W72L 3EYUH 3CH1B 3GJEB 1FPTL 4NRXB 3ROOB 2NY2C 3HMWL 3PQYD 1XF1A 3DV4B 3UPCA 1LE9B 1WISA 2NTFB 2BP3A 3DV6A 2FO1A 1CDBA 1VENA 3EAKA 1XF2A 2AGJH 2QJDA 3BN3B 3MJ8B 4KH2A 4KAQH 3FFCB 2J8UB 4OI9A 4M7LH 1EVTC 5IB4A 1CTOA 5DMYA 4OM0L 3NFPA 3KNBA 4PJCF 4PJGA 3GO1L 1GGBL 4KK8C 5TH2A 4XHJC 3EYFB 5BRZD 4WV1A 5DRWB 1N59B 3RBGA 3SHSA 2QSCH 1NGQL 3OGCA 2VSDA 3TGXA 25C8H 2X5PA 1IKNA 3FOMA 3GMQA 5J6HA 5GRUH 4NHUA 3U0TA 3ZE1F 3BD3A 1A4KB 3WJLC 3QDMD 4XVSH 2XTJB 3BP5B 4RIRA 5SX4I 2DM2A 5C08E 1ZVSB 2IBBA 2HVJA 2A6JB 3TV3L 3TYFA 3TIEA 3N1QC 3D6GA 5I75C 4JFQB 1DUZB 2JTDA 3ARBD 3RWEB 1NLDL 5JPNA 1A1MA 5HGDB 4CU6A 2FL5B 2D2OA 4FZ8L 1FORH 2IADB 2XRAH 5JPMA 4QXGL 3T65B 5BZWB 4NP4H 2NY3C 3V8OA 4MD5B 2ZUQC 1U8JB 5EUOB 1LNUB 3CLFL 3DBXA 3FQRB 4YXLH 4HJJH 4ZNEA 1X5HA 2XG5A 3CDGB 4Q0XL 1RD6A 4H88H 4HQQL 3PDOB 2W60B 4J3WA 1QR4A 5E8EB 4PG9B 3UTTD 4HK3N 5INDA 5I1AB 5EOCH 3IDXL 5FO9B 3WD5L 5LXGH 1GCFA 1IC7L 5KN5A 3H2WA 2ICEA 3TYGH 2GAZA 1MUJA 4KK9D 2ZCKL 1PKQA 4E41E 3AB0C 2V7NB 5SWZD 2E27L 3CDCA 3LD8B 3LN9A 1V8HA 4OFIA 1BVKA 5FIEA 2DTMH 4MNGB 3STZB 1G9NC 4Z5RA 4MCZB 4H26A 2ADFL 3OKKA 1NBQA 3QUMH 3ETBF 2EYSB 5FYJU 5C6WH 4M7JH 5HPMB 2EEBA 2K7QA 3K2UH 4ODSH 2VZSA 1EXUB 2FYYA 2R2HA 4PGZA 4LVOC 4PRHA 1JGEB 2BNQD 1JF6A 3SJVB 4JGMA 1FNGA 4TSBL 5C0AE 4QNPF 5BV7H 4MJ6A 3WFDH 3BYYA 1NAML 3CZFA 1UGNA 4JB9L 1E0OB 2D31B 4G42A 5CHNB 3JZ7A 4LARL 2YA1A 1CZ8L 4Y16A 2EECA 4GXUN 2PW2A 4QWWD 2FSEA 5DO2D 1C5BL 1C08B 2EDLA 5EC1B 3ARED 5DD6A 3O11A 2FR4A 3H3BC 2X9WA 3UTZA 4I1NB 3FCTA 2VL5A 4KWUA 5IBTH 4X98A 4M8VA 1CXLA 1I3RB 3I85A 1IQDB 5E6IC 5EOTA 4PS4H 5D7LA 4Y4HA 4LLDA 4E42B 4BSWB 4DZ8A 1N5YH 1P5UA 5D96B 4APQA 5HI4C 1F58H 4X9FA 5FYLD 2VZ3A 3HC3L 5GHWL 3MZGB 5IJVA 5IGXH 4Z9KB 1D9KD 1DDHA 2E7LA 3ULVE 3FN9A 5MHSE 3HLAA 3HA0A 4ODUA 4S1SH 1RFDH 3L5JA 1ORQB 1T1YB 4YJZL 1HH6A 3LKRB 43CAA 1CGSH 2A6KA 2P49B 2DQFB 2YEZB 3B2VL 3OG4B 4NZJA 4MJ4A 3QO1A 4M1CC 1OF2B 4M62H 3SBWA 5JHLH 2B1AH 3B6SA 1SJVA 5F7UA 4GUPA 5H8DA 3F5WA 3VXSB 3QEUA 3UPRA 2Z31A 5LQBH 4HS3B 3QA3A 1F6LL 4RMQA 3AFLA 2HN7B 4DKAA 4OV6F 4QYOB 1EMTL 2Z4QB 4RBPH 2OL3L 3F7YA 1EZVX 1IAIL 2VLKA 1IEBB 3MBXH 4OJFL 2R69L 3VXRB 4XPBH 1S9WA 3MBEB 2FWOA 5GSVB 3ZE0F 4J3SA 4RAUA 3SDXF 5ESVA 1JGLH 3LKPB 1CD1A 3G5VB 4HAGA 1B90A 1YDPA 4OM1H 3RWGA 3S35H 2F54B 3LS4L 4J3OC 2BFVH 4MAYA 1V3KA 1AE6L 2OJEB 1G7JB 3MRQB 4L3EB 2ZSWA 3MFFA 1KCVL 4OF5A 3SDCA 2GTZA 1F2XK 3KPPB 4LCUA 5IW1A 4YHML 3TBTB 4XH2B 1KIQA 3LEYL 5IIEA 2V5RA 4PRDA 2UWEF 4XXDB 3GJFB 1A14L 3BXNA 2AJYL 4PJ8A 4NO2A 1NEZA 1RK1B 1RULL 1HOCB 1NC4B 2HVKB 4FQXD 5DJCA 5GRVK 2ZJSH 2DQDL 1NC2B 4I9WD 2X4NA 1VFBA 4WFGD 3I3DA 1CGUA 3CX5J 5IHBA 3EYQC 4X6CF 2BNRD 1SBSL 1DP0A 3CFKA 4PJDA 3UTQA 3JWDL 4OQ1A 1QLFA 1XGQA 3QWRD 4PRIA 4GAFB 3CFBA 4NCC1 1KB5B 4FXKB 3TZVA 4CDHA 1IGIL 1KLGA 2EDXA 1MCQA 32C2B 1BVLB 4YNYB 3TH4T 2R0WH 3I3BA 5CINH 3NCYP 5C0IA 1SEQL 3UJIH 1FGNH 5IF0B 1QO3A 4P5MA 4X8JB 1L7IL 5J12C 3I50L 4KK5C 1K5NA 3DVNB 5ESAB 3PHQA 4Y5XA 4MQ7B 3ZYOA 4M1GH 1FZOB 4U1LB 1KYOK 5KAQF 2HT2C 4HJ0C 4M4RA 3V5HB 4GBXC 2JB6B 3I6LE 3CCHB 2NX5A 4UT6L 4UINH 1FG9C 4EI5B 5AEAA 3O2VL 3DX8B 4CVZB 1EO8L 4HW6A 1NGWB 1MIEH 2YD9A 3BP7B 2DJSA 2Z35A 5L6YH 5JHDA 1IAOB 4JLRB 5BW7C 1S7QA 2VC2L 4XRCA 5DQJA 5F1NA 2JJUA 2R1YA 5EC2B 2D9CA 1T1ZA 4W81A 2XICA 4Y19D 4PRPE 3CVHL 5D1XB 4PRAA 3WHE1 1FC1A 5GRJL 3BH8A 3ARGD 3JUZA 2VQTA 4KJWC 5F7WC 4NN5B 1I1AA 3PWLA 3RDTB 2YD5A 3HZKA 3VW3H 3L3OB 4RWYL 3ARDC 3QFDB 1X5IA 4K23L 3BDBA 1KELL 4LRIC 5MENE 3HE6B 5E2TL 3VWKD 4DCQA 5I0DA 1U8KB 2NY4B 3LCYA 2YRZA 1A6ZB 4OM0H 3C9NB 2GI7A 2BNUA 1RJCA 3GO1H 4FFZL 4MNQD 3S88L 2APXA 3MCLL 1KPVA 2VLJD 5E8OB 1MAML 1HIMH 1ZA3B 1XGPB 4MAUL 4JO2H 2D7QA 3TNNB 2DOCA 1YN7A 1FO0L 2V7HB 2ZUYA 3NTCL 4Z76B 1JZ8A 4EUPG 2HMIC 5GGSA 3K80A 3V6OA 3QQ3B 3O6KH 4ONGH 2WBJC 3U1SL 5FYKH 3OJ2C 5ERWB 2A83B 3DSFH 3KAAA 1DVFC 2P43B 4KKLC 1EGJA 1KFAL 3TV3H 5GS0C 2DYPD 5DJZA 4X7SH 3VFMB 5GS1A 4XP6H 2MCPL 3QFJB 3F12A 2EE2A 3S36H 3RU8L 4MSWA 3T0XA 4DW2H 4LLVB 2MHAB 4NUJB 1RZKL 2BVQA 2YN3A 1S9YA 4LKCB 3QCVH 1P4IL 4FZ8H 4MWFB 1MCNA 1GGIH 4XMPL 4NM4L 5B39B 1I4FB 5I1JL 4BSVB 1D5IH 4J23A 3AC0A 4UAOB 5I1HL 1TCRB 4X4ME 4U1IB 5DGQA 2COQA 5C0CD 2YPLB 3QZWB 5TDOA 3CLFH 1CDGA 1JYVA 4HKBB 1B3JA 4UOJA 5AG9A 1CVSC 4KV5E 4KTEL 1WAAA 5ALCL 3PIQA 1ZT1B 4PJFA 5IR1B 3GJFH 3PG2A 3U48A 3P9LA 3HPLA 4QGYA 4K8RH 3MRIB 4DGVH 1WC7A 4NC1C 3K74B 2UY7A 1ZTXH 4N0UE 4FQIL 2CRZA 4Z7OE 2ADGB 1HSAA 4HUVA 4HWEL 1LE5B 5DGRA 3VGAB 1IILE 3U79A 2NZ9C 3KPRD 2J7LA 1J8HD 4HCRA 5IVXF 3T2PA 1EFXB 5LGJB 3BP6A 4L4TA 3ZKNC 2DD8L 4BZYA 3BKCL 5F9JA 1KB5H 2Q6WA 1OGAD 3V7AE 2JIXD 3HZVA 1NAMH 1NAKH 3RUGB 3SO3C 4L4JA 4OIIL 4NSKA 3MV7A 4LARH 3IJSA 5DEZA 4UNVA 3WXVL 3WJLA 5LJYH 5F3HA 1SBBA 1HH9A 2XZAH 1OTUC 3D2UB 5L2JB 4Z0BL 2PXYD 4K7PX 4LFHG 1K2DA 2DBJA 5T1MB 2XOTA 3QUYB 4OLVL 3EOYG 1E27B 2VDKL 4F7TB 1ZMYA 2ZG2A 1R3IL 4Y8DC 4Q9QH 4DEPC 3BZDA 4R90H 1S5IL 2X70A 4NKIL 3HC3H 5GHWH 2YUZA 4MA1C 1VADB 1EDQA 4YK4B 2W9DH 5K9QG 4PIRF 3VFGH 5EG6C 1E4XL 5M7QA 5EIIA 3WS6C 5BQ7A 2E9IA 3B9KB 2AP2A 4DAGH 2HT4C 4QO1A 4WFED 1MI5E 1GIGH 3O4LA 1WCBA 3UJJH 4F8TA 3B2VH 5C09A 1KYOJ 3GKWL 3OB0H 4G8FB 4FFWC 4XC1H 5D9SA 1QFPA 1JWUB 1QFWH 3NBNA 3T1WA 2PF6A 2QADD 2LVCA 4P2QD 2FX8H 2J5LB 1S5HA 5DMGC 1LO2L 3H3PH 4UQ2A 3MROA 1HKLH 1RJLB 1E4JA 3C5ZC 1EMTH 4N0YH 3NZ8B 4NNXB 4X0KB 1WEJH 4JHWH 3QRGH 1LDSA 1FVEA 1IAIH 1WFUA 4IRSA 4G8GD 4UDUB 3QUKB 4JM4L 1J86A 4JZJC 5IT2L 5KAQG 3MRRB 4JY4A 3RPIB 3V52H 2IPKA 2Z92A 2I27N 3Q3GA 2B4CL 2J6EA 5LAXA 3OKNB 4ZUSB 1JPTH 4N5UA 2ID5A 3HAEG 1YYML 3D18A 3FB6A 5DHVH 1Q1JL 1A3QA 3HCVA 5E8DH 2QHLA 5GJSH 5JO5A 5HYJD 5IQ9B 3LS4H 5DJYA 3ZO0A 5J6GA 2EDJA 2ITDB 3IFOA 1AE6H 4WNQB 2GT9A 4EIZC 1HXMA 3H9HB 1QSFE 4OD1L 4D0DA 3DURA 4MJIB 1BEYH 3LRSB 4XNXH 5I8KL 2A0LD 3VG0H 3FQTB 3T4AB 4RMVA 3RI5F 4ZYKA 5HYQB 5KVFH 2NLJB 5FFLA 5J0BA 4I0PA 4MA3B 4MYWB 3DETC 3HZYA 4C54A 1YY8A 3C2SA 3RWIB 1YN6A 1PVHA 2DQDH 3QULB 4H8WL 5A43C 3UJTL 4ENEC 4O00A 2ZP0T 4U3CA 1ZXQA 3OR7B 1FJ1B 5DUPL 3MV8E 1ZT4B 5KZCB 43C9B 5A16B 2Y23A 1FL3A 1KNOB 3G6AB 1JHLH 1D6VL 3OJMB 3O9WC 5T5NF 4XPAH 5LKNA 2HA1A 2UV3A 1T66C 3OKOB 2CLVB 4MXQD 1MY7A 4K7PY 1A4JB 3GK8H 1RIVH 4I18C 5F7MC 4GG8A 5DI8A 3OTTA 1CFBA 5GRXG 4ZO8A 1SEQH 4QY8B 3ZKXB 5C0EA 1MFCL 2G9HA 3RGHA 2A77L 4P5KB 4XNMB 5F72S 3STLB 3AY4A 1D6EA 2I9TA 1P84K 2ZUSA 4QXWA 5HD8D 1EFQA 3D3VB 1KJ2L 4V1DB 1R5VB 3MLUH 3QIBB 4FTVA 4NQDA 4PJXA 3E8UH 3C8DA 1EBAA 3LDBB 3MRFA 4WJ5A 3PWJA 1JIBA 4ZNCD 3WV0A 1EHAA 3SGJC 1DBBL 3T4YA 2YPKB 3SCMC 5FGSA 2YK1L 1HCFX 2R4RL 1HHIA 4JCLA 4P2RB 1AXTL 4IHOB 1RIHH 2YA0A 5LGKA 2FIKA 5EU6B 2VDQL 5I8CB 5B8CB 2VAAA 1U8HB 3KYMB 4OCLC 2ICWI 3B9AA 4OZIA 2FX9L 2HRPL 1NSNH 5ICYA 2CDEA 3W82A 2NQCA 1U8PA 3WJJC 1D3CA 3S34L 1U3ZA 4P0DA 1M6OB 1S8DB 3X12A 4N8CL 5TE4L 3MRNA 3IU4H 4CVWA 1UZ6E 4EXKA 1JN6A 4KTYA 1Z9LA 4JRXA 4P23C 4RWYH 2X89D 3N50A 3ES6B 5IG7A 4Y1AE 3LQAL 4Z0XB 4YHIA 1XH3B 2B5IB 2R1WB 2A6DB 2UYLA 2VIRB 5E2TH 5F1IB 1F90L 2BSTB 2DKSA 5D7JD 3VXPB 1F3DH 3DRQB 5ANME 2IAMD 3FN0H 4KDVA 3W39B 2DQTL 5J8OA 4FFZH 1S7RA 1JYXA 3MRHB 4Z6AT 1F8TH 3KYKH 4WW2C 2HJFB 1ZEAL 3CU7A 1U8MA 5JTWA 4NKMB 2AV1B 3MRPA 3IKCB 5HHOA 3TVMC 4AH2B 4F58H 1MCLA 1MAJA 5ECJE 3SDAA 1FDLH 2XPGA 3QJHA 3GIZH 4DWHA 4WDIB 3TCLA 3WSQH 5FA4A 1QLEL 1LP9E 3MGOB 1CFTA 3S6CA 1KFAH 3GSUB 4OCYH 4G80A 3KWWB 5JDSA 3QXDB 5AZEH 5J3HD 2PYED 3GIVB 5AWNL 1RZFL 2NW2B 3UMTA 5L9DL 4GBXA 3WEXA 3BSZH 4YR6B 3HN3A 2WUCH 2YC1A 2OR8A 3IFLH 4B53A 5F71A 3B5GA 1S78C 2BXYA 5INCB 4KRLB 4PRHD 3SDDA 4OFYD 5CD5D 2VJXA 1CL7I 1IT9H 4LL9A 1FYTE 4KY1L 3AAZB 3EOAA 5K93A 3BPCA 1NUFA 2XIDA 5C70A 1LEGA 1F3JA 1SYSA 2G2RA 3O6ML 2EH7H 2CIKA 3CMGA 3HUJB 3QDJE 4G6KL 1AP2B 1YEEL 1B2WH 2X2YA 5FUOH 3CIQA 1P1ZA 1U42A 4H1LB 4JPWL 5BZDB 1F4XH 1A6AB 1U95A 2NY7H 4K3GA 3KDMB 2V2WB 1I8IB 5T3XE 3FB8B 1U9KA 3EZ8A 3PWNB 3NIFF 2RCSH 5FCUH 4UU9A 4Y4HD 4NYLA 4PTTB 3PV6A 1XR9B 4WCYH 3CMOH 4KRPD 5IB5B 4ODXA 4KQ4L 1HWHB 1B88A 3OAYK 1AGBB 1XGYL 4KUZH 2Y4SA 3UP1A 3BKCH 1LO0L 3A6BL 4JO1L 5K9KA 2XKUA 3MNVB 2JELL 4RWHA 2PW1A 5FECB 1QYGL 4PRNA 1EBPA 3NCCB 3VXMB 2ZCLL 4LIQL 4ZXBD 2NY5L 4OIIH 3L5XH 2AJVL 4MXWH 5DMKB 2X1QA 5LVEA 1YEDA 4J7RA 4UOW0 5CEZE 4BUHA 5I6XC 4XWGH 3GGWB 1G7IB 3VFSB 4ZFOL 3O2WH 3EYOA 1T5WB 2R9HC 1T2QH 4K3EL 2GSIB 3Q6GH 1JV5A 3RA7L 2YMXH 3GSOA 1DUYA 3ULUC 3RVVC 5ITFB 1MVUB 5CSZA 2NTSP 3VCLB 3BESR 5GGVL 3W9EA 4BKLA 2J4WL 4XZUA 3TO4C 1KC5L 3HAEH 8FABB 4X8XA 1N6QL 2WINB 3RP1A 4UV7L 1UCTA 1MJ7L 3KPQA 2VXSL 1OWRM 3ZKQD 4P59L 2ATPA 1IGTB 1SEBA 4WWKC 1G7MA 3PJSA 4KI5D 3C60A 1F02I 1X6LA 5T1KD 4JFOA 4HXAL 1PY9A 4PUBH 5T5NG 2FO4A 4CKVX 3U36A 4OSUL 4JPVL 3GKWH 4JKPH 4G9DA 4HWBH 2H32A 4GFTB 4XB7A 1TZHA 2WLYA 1CFVH 3UTSD 4PJBE 1Z9MA 2F8XC 1WWAX 1J0IA 2BDNL 5D5ME 2N1KA 1TITA 2DQJL 2PETA 3O6FA 3O45A 3MGTB 4R7DB 4HF5H 1F42A 5KSVA 4HWNA 1FQ9C 3V4UH 4RMSA 3PGCB 3VXNB 2KL6A 5C0ND 3WIFB 4YQXL 3LV3B 1BZQK 1E6OH 4YXKL 4LGPB 2ZG1A 1CLYH 2C9AA 4OZGE 15C8H 1CF8L 4YDLB 5CIPA 1HHJB 3BW9B 1INDH 4NQEB 2L4OA 1OT2A 5C08B 4LEXL 4U1NA 4PRID 4XX1G 4PLNC 3L9RA 4ODWB 3GRWH 2R8SH 5TQ2H 3I6KA 5GSRB 3MYJA 2NY1D 2DWDB 3PGDB 3QUMA 5D2LF 5DXWA 4PD4K 1AR1C 5I8KH 3BUYB 3F58L 4PJ5A 3L3HA 5EU5A 1R24B 5I30H 4WEBL 3U0WH 4KGLA 5EORL 1HSBA 1UEMA 1ZLWH 4ODTH 2Z93A 4LPWA 4GQPH 4MDIA 1NMCC 4AIZB 5LBSH 3L7FB 3W2DL 3DMMC 5E4EC 3MLXL 2DL9A 3WL9A 3JTSB 2NX5D 1EHNA 1UM6H 2P8PA 5L2KA 2IWGA 3TN0D 1EIBA 2ADIB 1QACA 5F9AC 4ISVB 5CLWA 1A1OA 3MJGX 3QEQE 4LPTA 5E2JA 1WSST 4QT5B 3M8OL 3O8XC 4MA8L 4U4BA 5A1AA 3UDWC 2CDFA 2IBZX 2VDMH 4PR5B 3BGFC 4E41B 2ORBH 3QH3B 2PO6B 4H1LH 5DRZA 4L8CA 2H2SC 1P6AB 2FEEI 2VXQL 4WRLA 4MCYA 5C8JB 4O58L 3IJHA 4XBEL 5ADOH 4UDTA 2VN4A 3LPWA 1MFCH 5EN2A 3B5TA 1BD2E 4GH7B 5CWSB 2ZWLT 2BVPB 1I1AD 2OTUA 5HVFB 4IBLT 4Y2DB 5FAAA 4FQ2H 5I8EB 3P77A 2KH2B 3X3FH 4ETQB 5HYSG 4FABH 1MCIA 3MO1A 5C0AB 4YFEA 4QRRA 2CSPA 2E7CA 2V5SA 3BKML 3MLSH 3NAAL 4DN3L 2GCYB 3K8MA 1MCFA 4BA8A 4JZJA 1KCLA 4PB9L 1T89A 2X4TB 4UT9L 1KPUA 3GB7A 5CGYD 3EDJA 4JN2B 1I1RA 3L3JB 2YK1H 4FQJL 4X4ZA 1J0JA 3OKDB 5CJOL 4K94L 1AD0A 1AXTH 4L8SC 1G6RA 2FHBA 1AGEA 1G84A 3SGDH 1PX3A 1XGRA 4P9HC 1UB5A 3SOBL 3DYPA 4NFBA 5DFVD 4JG1H 1RZJH 3IXAB 2XQYG 3ULUE 5GIRA 5C7XH 1UKTA 3G5ZA 1MJJB 1X5JA 2C7UA 3CNKA 1H15B 3PGFL 5C3TA 1FVDB 4HMEA 1QBAA 3MRKA 3V4VH 3N1FC 4W6YB 3LQAH 5D93C 1QG3A 2YHGA 1OHQA 3RVWD 2HJLB 4GG6A 4G6FD 3GSXB 2FBOJ 1I7RA 2WAHA 1HYSD 4MQTB 4EZMA 5F93C 5KW9L 1NCAH 2CGRH 3CVIL 2Q7YB 5C92A 1T22B 1YUHA 3GMPA 5D7IA 3SN6N 5E5MA 4NQCB 3QEGL 4GOSA 4M6OH 4I3SH 4XGZA 3K2MC 1EEYB 1K6QL 1RZIB 4JFPA 3VXOA 2P4AB 5L0QB 3O2DL 2AV7B 3GMMB 5FHBH 5JW4R 2AEQH 5IBUB 5MHSD 1IJ9A 5FUZL 2CIIB 2NY2D 5C07A 4F57L 1IZJA 5K9OB 4O2CA 3ET9F 3TF7C 4DGIH 3R0MA 3P0YL 4X5LA 5ICZB 3AXLA 2VOTA 2RGSA 2CRYA 3ZDZE 3GMOB 1NGYB 1GZQA 2JCCB 3WNLA 1K3IA 5IMMB 1ZA6A 1NCBH 3ILPB 1A3RH 1GHFL 1QR1B 1AD9B 1G7HB 4BFEA 4YZFE 5L9DH 1ZHBB 3MRGB 2IBZY 5JR1L 1U6AL 4L4TD 3HC0B 5HHQB 5FGCE 4KK8D 4XHJD 4LVNC 1VKXB 1T0MA 4PJ7E 1E4KC 4GAJH 5DC0A 1HN1A 2BX5A 5MEPA 4OV5B 1TZIB 3SCMA 2QQKL 2ARJA 1IGYB 4JFYB 5FF6B 4CVUA 1UWEH 4Y4FA 4Z7UE 5HDOA 1MFEL 4YLQT 2PYFA 5JHDE 3MV7D 5IWLA 2EYTA 4XCFL 2D7TH 5FA3A 1PG7L 3M17A 5B38G 4DN4L 4OCSH 4X6DE 1T6VN 4S1QL 3WIHH 2DLFH 5ADPL 4JJ5A 2W07A 1MWAA 1Q9WA 4AL8H 1YPZF 4ORGB 4HPYL 1PGRB 4H0GA 5E6ZA 1WQVT 4PJIE 5ITBH 4OZHB 3FO9B 1T21A 3TA3C 3VFPA 1A6TA 5JIIA 2BY0A 3TBSA 4LNRA 1W72A 4PJ9C 3O3EB 4NO5A 2FLBT 4QRQB 4Z7QF 4OZ4B 2C1OB 2EXYC 4P3CL 3HB3C 4JO1H 3SE3A 2NY3D 5KANG 2PTVA 2BC4B 4ERSL 3RTQB 2CUMA 1SJEA 3FAWA 1ZT7A 5CP3A 4LCCB 3X3GL 4OFKA 5HJ3B 4FP8L 1YYLH 1UQSB 3LQZB 3UPAA 3WFEL 2EDKA 4O02L 4P2OC 1H8SA 1LEKA 5C0JA 5C09D 4XAWL 2PCPB 1OSZB 5DTFA 1BZ7A 5D72H 3QCTL 1A3LL 3IGAB 5JLZA 1CE1H 1J1XL 4JEGB 1BF8A 4HHAA 1IM9A 2IGFL 5BS0A 5ELIA 2R2EB 4N0CC 2XFXA 3L3DB 3UYRH 2R0ZH 4FQLL 3CPLB 4LSTH 4OGXH 3HMXL 1IFHL 3GMNA 2XG4A 2D03L 3LRHA 4NDMB 4UV7H 1MJ7H 2H6PA 2VXSH 4JRWA 5EBWB 3IDGA 4L8DB 4JPIB 3I6LD 1YNTA 4I5BB 5DEFA 3BHBA 4XPGL 3BDYH 1TTUA 1U8LA 2ZOKA 2P5WA 4GW1A 1JNLL 2VITB 1TTGA 2XN9E 1FG2B 1RJZB 3ULSB 1S7VB 5DRXA 2LTQB 1D5MB 2GTWA 2UZXB 1IARB 5EBLA 2NXZC 4ZUUA 1TJGH 2DQJH 4RQQB 4ZOBA 4EDXA 4UILL 3MV9A 1VEPA 5E9DE 5IVZA 1ACYL 1BBDH 5E6ID 4HS6A 1SQ2N 4L9DA 1QBLL 1OAUL 4HKJA 2BSSB 4M6NH 3MJ7A 1OCWH 1XF3B 4X7CC 5HI4D 1LMKA 5T3ZE 1HDMA 1CF8H 4K7PH 3C08H 3DXAA 4MX7A 5GZNC 2QSTA 3FHAA 1Y6MR 5EB9A 5LGHH 5HGGS 3NZHH 2GJ6E 1RZGB 1T1WA 3QDGB 4MDJA 3KXFE 4LLYB 3O4OC 1BF2A 4NWUH 4G7VL 2AXGB 4JFDE 3P4NB 4M43H 3VFTB 4WI7A 3S9DB 4QOKB 4M1CD 3HS0A 3SE9H 4NZDA 1QUNA 4L9LC 2BY2A 3S96A 1R3HB 1Q38A 1Q0YL 5J11B 3RZCC 3DX7B 2B4CC 2VISA 1TZGL 3H9SB 2FBJL 1UYWH 1JRHL 3PL6C 5ISZB 4PTUB 5CJXA 1MREH 1X44A 1YQ2A 4JDTL 3QNYA 2NXYB 2Q76A 5CJQL 4FTVD 4NQDD 4QHMB 2EDDA 4IIQC 2YSSB 5DYOA 4ZG1A 1UXWA 1NFDA 3CLEL 1TLKA 5BXFB 3WNPA 4F8QA 2M2DA 1MCCA 5DA0B 1U2HA 1UJ3B 5EBGA 5GPRA 1EAPA 4MA8H 1GL4B 1NLBL 2BSRA 3JUYA 4YUEH 4OCRL 1N64L 1GYAA 5JIPA 5HHXL 4NRZB 1BQHG 4JM2C 1GAFL 3ARTA 1YNKH 4OLXH 1C5CH 1IZKA 3N1PC 4O2EA 1HZHL 2Z91A 5E4IA 5EZLB 3ARZA 1QEWA 5TDNA 3D0VB 2ADJA 1YMMA 3E2HC 3PHOA 4JRXD 3MREB 4M03A 1ZGLA 5C9JB 3V2AR 2HG5A 4XAKE 1JHTA 3PDGA 4ZUTA 3QIUB 2WQ8A 2HP4A 5I15L 2H26B 3L1OL 5JA8B 4GJTB 4N8PA 2OTWA 3HI1A 3C6SB 3EYQD 4DN3H 1WJ3A 3CGTA 4UV4L 3VDBA 5IHZA 3VXTB 3PWPA 1MCPL 4GMSH 4CMHB 5K9JL 4HX1B 1A64A 5B22A 2EKSA 4Z7WB 3FRUA 4FQJH 1Y0LA 5I1KH 2C5DC 5JORA 4PP2A 5D70L 1NFIB 5HHOD 1HI6A 1WBXA 3ELAT 3IETB 4TVPE 3RNKA 2OL3A 3WUWG 5I17B 4PJEA 5DK0A 3BISA 2W91A 4AEFA 4PJCA 1KF9B 5A2KH 5FYLH 3T0WA 1F11A 2CUHA 3BIBX 2Y72A 4KK5D 5CJ5A 3CXHJ 5CCKH 3G04B 3VRLF 4YDJA 3BQUB 3PGFH 2HFEB 4B7IA 4F37K 4ALAL 3MLPA 2IMMA 1L6ZA 4RGNB 2XZQH 4D8PB 4YDKL 5DT1L 3V0AC 4EKXA 2HT2D 4HJ0D 5KSAA 3DMMA 4GBXD 4WI8A 4PJHE 4PY7B 1S7XB 2PTTA 12E8L 2EEDA 3QG6B 3M1BB 5KW9H 4E0RA 3RFZC 2FGZA 4WTZG 4X9HA 3CVIH 2H2PC 5CJBA 4HIHB 1TNMA 2ILLA 4HKXA 2VXVH 3O8XA 1R3LA 3QEGH 1OTTC 4A6YL 3VWJB 3UDWA 4WTXA 1CFQB 3BAEL 5MP6L 3MXWH 1IGJB 2WWKT 5D8JH 4F57H 3U7YH 2XV6B 4GAYB 4F33B 1MI5D 1R3KB 3OXSB 1FAIL 3D39A 4IRJC 5GS2H 4I4WB 4KJWD 4D9QE 2ZNWA 4NNPH 2P44B 3O41B 3BFOA 1F6AB 1H3XA 4NO0B 5J7CC 1SMAA 3ARDD 4OGYH 4LBEA 1GHFH 3CFDA 4F15C 4EIGB 5T1LB 1PQZA 2EZ0C 4YFLI 4GS7B 1RQ5A 1QHPA 5JR1H 4Y0GA 2I9LA 3LKNA 4NQVB 5I1IL 1QSFB 5IEHB 3WNKA 1ZLVH 4WGVB 4JFFE 1IQWL 2PUQT 3G6JA 4YHKL 1J7VR 3RY5A 3Q6FB 4K3HA 5K33A 4GAGH 5C6TL 4AT6A 4L8SA 3BDXA 1UKQA 3UZEA 2HMID 4WI9A 1P4LB 1CL7L 1PG7H 5MI0B 4CN6A 3MRCB 3Q1SH 4GMTH 1CFSA 5J9PB 5F88A 1C5DB 2WBJD 5ADPH 4OZIE 2BMKA 2I07B 1DVFD 1FCCA 4KKLD 5DQ9B 5GS0D 5A40E 3B2UC 1WWWX 2XTLA 4EUPA 2FJHB 1PZ5B 3WN5A 4C83A 1G0YR 5IJKC 3EIFA 2DDQH 4U7MA 4K2UL 5ACZA 3MMEB 1I1CA 1OGAB 1OWWA 1JGUH 3CVHA 4AEEA 4DKEH 4P3CH 3HI6H 3S5LB 2XY2A 4G3YL 3MV8D 3QJFA 3X3GH 2QHRH 1JZ2A 4LVHB 3HE7B 2WIIB 3NFNA 4O02H 4QF1B 2K1MA 3FMGH 4WY7L 1NCCL 1UH2A 4M7KH 2OR7A 4IDLA 4KMQA 3E6HB 1TJHL 3NFSH 4PV8A 1MLBB 4ZAKC 1MFAL 1DSFL 2IQ9H 4Z7VA 1J1XH 2EDNA 1BX2B 5EU3B 3CFCH 4Y4KB 3RWJB 4GQ9L 3BP4B 4GSDL 4UTAH 1MFBH 1OSPH 4FS0A 5IW6A 1S7WA 5IMOB 4FQLH 2NZ9D 1S9VA 4KI5F 4NJ9H 4HWZB 1FO0A 4DVBB 1IFHH 5TE7H 3L7EA 4KRNA 1S7UB 5C0RL 3P9MB 1RHFA 2D03H 2VDLH 4LPUA 1OGTA 1HINH 3SY0A 1NCDH 3BKYL 1NBZB 5BV7C 2HTKC 2R2BA 3T3PE 2VLRD 1E4KA 2R23A 4Y5VC 3BT2H 1BFOA 2FECL 5DD1L 3G5XB 3MA7B 1M1SA 3QI9B 3MLWL 3MODL 1JI1A 3RGVA 2DJUA 4IJ3B 1ES0B 2W0FA 5ESQB 2EC8A 3F8UB 4ODVH 5D2NB 1MEXL 4Y1AB 4ZS6C 5E2WL 2OZ4H 3QUXC 1T04A 4PJ5D 3T3ME 5F3BB 1OTUD 1RUPH 3HG1E 4J3VA 3C2AL 4WGWB 5KS9A 3SDXA 5HHMD 4ZTPL 4RFNB 3TA3A 3V6ZA 1A9EA 4P4KB 3R06A 4IEFB 3MUGA 3BH9B 3H42L 4ZTOL 5F44A 1IE5A 1QPPA 3OF6D 1AJ7L 4PJ9A 4JAMA 3NVQA 5IHUL 1X7QB 4U1SA 4LF3B 1CD9B 1H3GA 3NA9L 3LHPH 5GGRA 3IDUA 1IAKB 3S4SB 4G6JH 5JQ6L 4K7FB 4YHYB 1LP9B 3IDNB 4OQTA 3MLZL 1BWWA 1DQLL 1UM4H 2HT4D 5F1OB 1MFDH 2OXHA 4X99A 4NC2B 4FFWD 4U0RB 3DUUB 1XIWB 4GKZA 4X6CA 4MD0A 4YPJA 4PGBA 4F80A 5DMGD 2YKLL 3VD5A 2DKMA 1UCBL 4NO3B 5ABDE 1RUKL 2W1NA 5HGHB 5GGTL 3O6LH 3QIWA 4G7YL 3C5ZD 1IC4H 2YUVA 4HV8B 4N0FA 5MEOB 1JF1A 3FAXA 1LO4H 4DGYH 4Q2ZB 1XR8B 4JDZB 4XP4H 1ND0B 1S7SA 1KN4L 4LEOB 3OKLA 2UZIL 2HWZL 4XVJL 1DBAH 1CS6A 2XTJC 1NDMA 1VGEH 4OIBA 5EUKB 4ZMAT 3QPXL 1CXKA 4PLKC 1FYTD 3H7BA 1N64H 2FB4H 4XPTH 2P5EA 5C0BA 4JQVA 4GXVL 5E99L 4DUWA 2FCBA 2D0HA 1U8QB 4R96B 1REIA 3QDJD 1XF2B 4XCCL 3VFVA 1WVZA 4XNYL 1LEIA 1AIFB 1ZVYA 5IB3A 5IB4B 3DETD 3NFPB 1DR9A 3REVA 3KNBB 2FEEL 5DA4A 4PJGB 3ZKSD 4JFED 4WV1B 4ENED 5T3XD 1AXSA 5CGMA 1A2YB 4UV4H 1QNZL 3T09A 3ARXA 4KTDH 3FOMB 4YHPA 3GMQB 5J6HB 3NN8B 5K9JH 1U92B 2SEBB 3KLDA 4NHUB 3U0TB 1KJ3L 3O9WD 3OHXA 3V6BR 2W9EH 3QUZA 1FNSL 3D0LA 1T66D 1MRCL 2Q8AL 4UQ3A 2B0SL 2HVJB 1ODAA 1J88A 1V3LA 2B7DT 3LD8C 4C59B 3SPVA 3JTTA 3TIEB 4WW1A 5C07D 4C58B 1Z0MA 1K4CB 3DIFB 5ETUB 4CADA 3RZCA 2F53A 1FRGH 1SVZA 3EO9L 1AXIB 3JWNC 1T0NA 5JPNB 3MOQA 1OP5K 5JPMB 1I1FA 5K59E 5DT1H 1BQUA 1MHEB 1WAAF 3G5YA 2CK0L 3VFOA 4IIQA 2GJZA 35C8H 2NNAA 5L88L 1UB6B 3DBXB 3EO1A 4JRYE 4K9EL 4MS8C 1CGVA 3EJJX 4QTIL 3W5MA 2DM3A 2QL1A 2XNAA 5IB2A 1NKRA 3SCMD 1DEEA 1IL1A 3MOBL 4K71B 5I76A 1MJUH 2CJUL 4XTRC 4A6YH 3NIGF 4JFZL 4HULB 2ZUVA 4YHZL 3BAEH 2ICEB 3WXWH 4H20L 2GAZB 1MUJB 5D7SL 2O61B 4FHBD 3FO0L 4P99A 2AJUL 3L6FA 1G7PA 5FOJA 3WDHA 1BVKB 1FAIH 5TQ0L 4NN6B 5D96C 4Z5RB 3CAFA 4UIKL 4OI7A 1X9QA 5F96L 4P23D 3VI4E 5F9DC 2VQUA 4WUUE 3OR6A 2CH8A 4QRPE 5FDWA 2FYYB 1JPSH 5KSBE 5FKAB 5F6HI 2GFBA 4JREB 4BQCA 1CLZL 1FNGB 2XQBH 2E9JA 1A0QL 1TNNA 2P45B 1QSEE 4QRRE 3ARYA 3WNOA 1DQMH 3CZFB 2VDOL 3X14B 4PRBB 2RB8A 4G42B 4YHKH 2X40A 2ZSVA 4LPYA 4Y16B 4OTXL 2VR9A 5KSUA 2FSEB 4UI2A 4EDWL 5TPWH 5LWYL 3O11B 3TVMD 4D9RD 2XZCH 3F7VB 4ACPA 4Q97A 2VL5B 1KJ2A 4X98B 5IVXA 4DFHA 1MCOH 1WZKA 4D3CL 1NEZG 1P7KB 1EX0A 5EOTB 1ZHKA 4HUWA 3S37L 4AMKL 5D7LB 4LLDB 2H41A 2VB5A 1IM9D 4DZ8B 4FFYL 4APQB 2BJML 1J0ZA 2VMFA 4AQ1B 3MBEC 1F4YH 1ETZA 1KBGH 1FV1A 1N4XL 3RWDB 3QEQB 3OKEA 4XBPB 5IJVB 1UACL 3Q5YA 3WDIA 3QHZL 4W6WB 1DDHB 5EZIH 1W0WA 3HLAB 1M7DA 1S78D 1VGKA 4ODUB 4XP1L 1J18A 1GRWA 3HZMA 4HIIA 43CAB 3J8F7 4D9LH 5F7KC 1X5ZA 3N1GC 3GUTA 5D7KE 1OP3K 1BD2B 5FKPA 4GUPB 2WUBL 1ZHLA 1J5OH 4S11A 4O5LL 4UIMB 2Z31B 4YEFA 4NGHH 3LKOA 1MFAH 4GRLB 1QPXA 1S3KH 5KVMC 2O5XL 4GKNA 3QXVA 5EUOE 3MV9D 5EZOL 3GSVA 4GQ9H 2VLKB 4XPFL 2NMSA 3RL2B 1JI2A 1AO7E 4LCWE 3V6FA 5IB1B 5EO9A 4KVCH 4PP1C 1AKJD 2DB8A 4DQOH 1JPFA 4CU7A 3QDAA 4KC3B 4YO0B 4NZTH 1H5BB 1MCSA 1J12A 3B3IA 5HDQL 5FYKU 3BKYH 1YDPB 3RWGB 1EHLL 1X5YA 2AXJA 1JUFB 1YECL 3DXAD 3VFWB 4EVNA 4U6YA 4MAYB 3HNVL 5FM5M 2P7TA 4PJAA 5DD1H 1A7RL 2ZSWB 3SDCB 5I8OH 1I7UA 5IW1B 2DQIH 1MHHA 5IFJB 4R3SA 2BHYA 5IIEB 4PRDB 1X3DA 1AFVL 2IANA 2AXFA 2HFFA 1AGDA 3P11L 2O5ZH 4NO2B 4OUUA 4HZLB 4PJ8B 1INEH 2HLAA 4DKFH 5JW3L 3VJ6A 1B0GA 3GI8H 3NH7H 3C8KA 2X4NB 1O0VA 4MLSA 5DVLA 3X13B 1VFBB 2VLLB 3VFRA 5BMFL 2YXFA 1J87A 1EJOH 4EI5C 4ZTPH 1T4KA 4UNTA 2E7HA 5TJWK 3ULUD 3RVVD 3IDMA 5SV4A 5IJKA 5GZOC 1A6UH 2AK4E 3KPSE 3CFKB 4PJDB 3TO4D 3UTQB 3ZDYE 1MCWW 4I48B 4PGCA 2HH0H 1OTSC 1XGQB 1YQVL 3DI3B 3MNWA 5ID1A 3CFBB 5GJTH 7FABH 3QCUH 2VDNL 1MCJA 1MJ8L 3TZVB 1I7TB 3HI5L 5IV2A 2ARJQ 4PG2A 1KLGB 5D1XC 2RHEA 4F7PA 4WWKD 3B8SA 5C0IB 1FH5H 1SM3L 1IKFL 3ME0A 4HXBL 4NN5C 1AQDB 1QO3B 3RDTC 4CJ1A 4PBWD 4LLAA 4Y5XB 5I19L 1KTDA 1OW0C 1Z5LB 1KJVA 3HE6C 4LQFL 4PJXF 2G75B 2BXZA 2NY4C 4LSPL 5DURB 5BCAA 2B8OT 1Z0NA 1BIIA 1UCBH 1YMMD 2H3NB 3KYAA 4GLRH 3QT2A 1MLCA 3PXHA 3BJ91 2YD1A 3BPLB 3HHRB 4EEEA 2OJZL 4Z7UB 2MJWA 4ZDHB 2F74A 2G5BA 2Z35B 1RI8A 5JHDB 5SWQB 1OAYH 3PWPD 1S7QB 5DQJB 1I8LA 4KV5F 4FG6C 2R1YB 3A0OA 4XVJH 4KKAC 4X6DB 1FSKB 4ZFOA 1FBIL 1NUDA 4F3FB 4KHXH 5JOFA 4TQEH 1NCWL 2H8PA 4NC0B 5C71A 1KCSL 3TT1L 3DOSA 4LSUL 3ZE2E 4JKKA 3CX2A 3WLBA 1ERNA 4GXVH 3G08A 1EVUA 1T3FB 6FABL 4Z7OF 3HZKB 1AR1D 3QO0A 3W0WE 2R4SH 1U58B 4LCIH 4URTB 2DKUA 4UOW1 4XMLL 3E3QC 2CDGA 3CXDL 3D85A 2IG2L 4UAOC 5HI3C 5KVEL 2R0LL 4J2XA 3NCJL 2F54E 5DC4B 3IFPA 3DMMD 4AZ8A 3WFCH 4M3JA 4NJAH 2APFA 4U1KA 1UENA 3GJEA 3CH1A 4NRXA 4ELME 1BJ8A 4BQ9A 4M8QB 2VH5L 3O8XD 5DLMH 2CO7B 4RFOH 4JY5H 1HWGB 3EKCA 1LE9A 4R8WH 4M5YH 4QCIB 1QLRB 3R1GH 4NBXB 5E1HB 1V05A 1N6VA 2H2SD 3VGAC 3MRBA 2OSLB 4KQ3H 4QXUL 4B50A 3KLHC 5GS1B 3FFCA 2J8UA 4J6RH 1FE8H 1G9MC 3IDIB 3CSBA 3VXUE 4HC1L 5A2FA 1BZ9A 3THML 2BVQB 1S9YB 4JHAL 3BKJL 1N5AA 5I71B 5D71H 5DRWA 3A67H 4F7EA 2VLMD 1G7QA 1CD0A 4NQTA 4LOUC 5E5UB 1RVFL 3UBXG 5L88H 5TDOB 3ARBA 4K9EH 5E8PB 1BQLH 2WANA 2XN9B 1JJUA 5I2IA 2IPTH 4M5ZL 2HLFD 4PJFB 5IQ7L 4U6XB 4EI6A 3S3PA 3MOBH 5E94A 1ZLSH 3P9LB 3HFMH 3HPLB 4H0IA 4JFZH 3P30L 1SJHA 2A6JA 4YHZH 3G6DH 4HLZG 1WC7B 1A7OH 3QUYC 3INUH 1P6FA 4I3RH 4A2LA 3T0EE 2O5YL 3W5NA 3CK0L 2VDPH 2XKSA 4HUVB 4JFQA 5ENWA 1SYVB 3UTTA 5EO1A 5HGDA 3LEXB 1KCRL 2C3XA 2X1XR 3EDEA 1PLGL 4UIKH 2FL5A 5F70A 2IADA 3SGEH 5CFHA 1N26A 1UA6H 5BZWA 3ZL4L 4U6VL 2NPLX 4L4TB 4YK4C 5CZXC 1U8JA 5SWZA 5E9DD 5DJ6B 4KMTL 3FQRA 1CLZH 1FGVL 3NCEB 1BJMA 4ETYA 3KXFB 3B9KC 3B8YA 4O4YL 4JFDB 2VDOH 3PDOA 2W60A 1OQXA 5E8EA 2ZUUA 4PG9A 3BVNA 2FATH 2PNDA 3IJSB 1Y18B 5AZ2L 4CNIA 2J5LC 1A6WL 3T0VA 1L0XA 5DHYB 1K4DA 4ZPVB 3JV5A 1BFVH 1ZS8B 2GJ6D 3DX9B 3B9EA 2RBLA 4HKZB 4MNGA 3STZA 2N56A 1F3RB 4U1JA 3RAJH 2O93L 2YRLA 3AREA 4PB0L 4X7TA 5E7FA 4NNYA 1EXUA 5FO7A 3KHQA 2X70B 3QQ4A 1HHKB 3HNTL 4WEMB 2FD6H 2DQHL 1J1PL 3BIKB 3U4AA 5DR5L 3QHZH 4OZFG 4PGJA 4JR9H 3MSPA 3V79C 3OAZK 4ZD3L 5EIIB 2ZNXA 2APTA 5CHNA 3ZE1E 5BQ7B 3PXJA 5AD0A 4Q9RL 4RGOL 3O4LB 1C08A 2D0GA 4OD2A 1X4YA 5EC1A 1S9KC 1OAXL 3WE6B 5D9SB 2ESVE 5SV3A 2BHUA 1YJDH 1LK3L 2EC9U 2EIDA 5C2BH 3T2QA 1R6VA 2L7JA 1WITA 2EDYA 1C12B 3MROB 1N8ZB 4O5LH 2CMRL 5KOVC 4HUMB 3GDBA 4HEPG 5JMOC 5ALBL 3P3YA 4E42A 4FZEH 1J11A 3MX0A 1R5WA 4MGXA 2YRPA 4IRSB 4G9FE 5I66B 4HDIA 5L7XH 3NPZB 3TA3D 1IEHA 4JY4B 3Q3GB 4ZFGH 5LAXB 5T33L 5D1QB 3FT3A 4NFDA 1U93A 3O2DA 3FB6B 4R4BA 4PJ9D 1ORQA 1T1YA 3LKRA 2EXYD 3HB3D 1YEIH 5FM4A 5DJYB 5J6GB 3VRJA 1R0AL 4O51A 2OP4L 2XT1B 3GSNL 1OF2A 2GT9B 3ZKXC 1A7RH 1HXMB 1EGJH 2DBLH 4LHUB 2OR9L 4D0DB 3GM0A 3DURB 2R56H 3VXSA 1JZ3A 2WNGA 4TUOB 1KGCE 3ZSSA 2X4UA 4P2OD 4X5XB 3MNZA 4HS3A 4ZYKB 4D0BB 3ROLB 4I0PB 1EEZA 3ARPA 3HZYB 5EU4A 3BEWA 2WP3O 4F37F 3QIBC 3VGDA 4K3JH 1IEBA 1YN6B 4FQQB 4NWTL 2ZCHH 3LDBC 4Q6YA 1A7QL 4KJPC 3QG7H 3UO1L 4IMLA 3O3BB 4N0CD 4S1RH 1FL3B 1MPAL 4OCWH 2W9LA 2A38A 1A22B 4FQXA 4DUXA 3G5VA 4LPXA 3QPQC 1CGXA 5D2LA 1U8IB 3VGEA 4L1DA 4M7ZB 3C87A 5B8CC 4L3EA 2ATKA 3V7AG 5DI8B 2AXHA 4XH2A 2QKIA 4LU5L 1GC1H 7CGTA 1QA9A 3BMVA 4L5FH 5D1ZB 1ZANH 5C0EB 1DLFL 5HHVL 2G9HB 1A6PA 3QWRA 2P5ED 2F5BL 1D6EB 3LRGA 1GPOL 1RK1A 4JO4L 2I9TB 1FYHB 1CIDA 1H3WM 4HCRH 2B5IC 1JWSB 3FB7A 2XI9A 3JV0A 5HY9A 2NXZD 3MLTA 2A9MH 1LD9B 2P46B 3ECBA 4FTVB 3MOAL 3NGBB 5L8KB 2DQUL 3MRFB 3EFDL 3WUZA 4JFFB 3QBTB 5SWSE 4WJ5B 4LP5A 1J1OH 3IAGC 3TJHC 5FYJH 2OJZH 4HIXL 3T4YB 4AM0B 1I1YA 1OB1A 2Q1EA 32C2A 2NZIA 1QFOA 1BVLA 1EAJA 1HYRC 1KIPA 2AI0L 2VSCA 4JVPA 4XMKL 4YNYA 2FIKB 4MHHI 3KPLB 5GZND 3U9PL 2X1OA 1FBIH 3KR3H 3ZHDA 2VAAB 3ZT6A 3PABA 3RVXC 4OZIB 5IF0A 5GS0L 5GXBB 4X8JA 2CDEB 1FFOA 2DF3A 1KCSH 1U8PB 4OLYH 4LSUH 2QSQA 3DVNA 5ESAA 3DPBA