2V6HA

Crystal structure of the c1 domain of cardiac myosin binding protein-c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
DDPIGLFVMRPQDGEVTVGGSITFSARVAGKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOSIN-BINDING PROTEIN C, CARDIAC-TYPE
publication title Crystal structure of the C1 domain of cardiac myosin binding protein-C: implications for hypertrophic cardiomyopathy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v6hA00
2CLZB 2RQ8A 1D3CA 3M1BA 4KK9C 4XP5H 5KAQF 2HFGL 1SJEA 4Z18A 1NGYA 1UWXH 3IRZA 1C5BL 4OZGE 4WNQB 1IARB 4LKCA 3U30C 3HR6A 1A8JH 1FZOB 4L4VA 4D9LL 4YHKH 4I3RL 4PS4L 3DXAA 5DMIL 1ZS8B 1DE4B 1NFIA 3FO0H 3FQXB 1INEL 3EFFA 1MFEL 4WVRA 4H88H 1PSKH 4UT7H 3FQNA 3FQTB 4XH2B 3AY4A 1FIGL 1KG0B 4KROC 2DMCA 1RUPL 4QHLB 1FCCA 5I8EA 1P4IL 4NQCB 1DZBA 4TSCH 3VH8A 3VXRB 2Y5TA 4CN6A 3ARWA 1CFNB 4WTWA 4OM1L 4Y4KD 3ARBC 1FBIH 3OKNB 2L0DA 4MNGA 2OL3H 3WUWG 5IMMA 1T7ZA 4Q9RL 3EDFA 1PW3A 1FNFA 1IKFL 1BX2A 1R3IL 1DP0A 3DUSB 3ARDB 4J8RB 5LGHL 5BVPH 5I8CB 4WJ5B 3VFMA 4IIQB 2A0LC 4OM0H 1IAII 3MGAA 4G8EB 3AS2A 1FZMA 3LKRA 5HVHC 5ESQA 5H37G 1T0MB 1TXKA 4OIIL 1LK2B 3EOTL 2ARJQ 3S9DB 1FVEA 1H5BB 2OP4H 3V8CA 3LKQA 5ID0A 4LMQI 4XNZC 5F1IA 2E6JA 1DUZA 4NDMB 1W0WB 4P23B 4U6VL 5T1KB 4HJGB 4KY1L 3U0PB 1JGDA 5ACLA 3WHE0 4DEPB 1TETL 3ZSTA 4GG8A 2ADGB 4XXCA 1S7XB 4WDIB 5CEYA 2C4FT 1TJIL 1LNUA 2CDFA 3EKCA 4CNIA 4J1UB 5IIEA 4XNXL 3MCKA 2D7QA 2AK1H 3JZ7A 2A73B 1JBJA 4QT5B 1C1EH 1MCEA 2WW8A 4UI2A 1M7XA 2V7HB 3MRNA 3PWJA 1YN7B 4YDKH 1RAMA 4X6FB 2EC9T 5D1QA 4OZHF 4P4RB 2VLRD 3ZYIA 2QQKH 2Z8SA 5GSVA 2A83B 4HIHB 4L8SC 4U0QB 5E2VL 5F7YC 1T83C 3FAXA 1XZ0B 3TA3D 5IT2H 3Q48A 3PQYB 4YDIH 3V4PL 3QIUB 3TJHD 1YEFL 2AERT 2JTDA 4EDXB 1RZKH 2XZCH 1UQSA 2CK2A 3MRBA 5MERA 4NKMB 1DL7H 5DEFA 4MJ4A 4FA8A 1FSKC 1P1ZB 3ULVC 5ANMA 2DQDL 4PV8B 4JR9L 3BZEB 5TF0A 5JQ6L 4MDJA 4ODUB 2KUTA 3LQZB 1N6VA 4ZUTA 2IQAA 4HEPG 3U1SH 1QR4A 2D3VA 4QHUB 1FFPB 1G7LA 4H0IA 4PLKD 2B20A 2OTWA 4OUUA 4UIMB 1BEYH 4P2RD 4LVNC 3UXFA 1UYWL 5FV1L 5D2NE 1CICD 3MNVA 2Z91B 3ULUD 1KULA 2FX8L 2E8ZA 3LPWA 4NRXB 1J05B 3D85B 1F4AA 4X4ZA 3GSRB 3EJJX 5MHSE 3LKOA 5HYSG 4R0LB 3D1MC 2BVEA 2CD0A 2OBGA 1DANU 3K2UH 3MRLB 4JKWA 3V6OC 1P5VA 4NC0B 5C9JB 4YHIB 4KQ3H 2XA3A 2YRLA 3QO0A 1YMHB 3FT4A 4HW6A 1ZANL 2ADIA 2DQUL 3VXQB 3RVWC 4JFXA 4ZPVA 4D0BA 4X4MA 4NWUL 3P9WB 1TZIB 3QIBA 4HWBL 1L7IH 5DRXB 2LQRA 2Q86A 1B0GA 4UNTA 3K81A 1UKQA 4OJFL 5CAYB 4GH7B 4RFEA 3ESVF 1I3GH 3FQWA 5MENB 1EO7A 2PW2B 4FFVD 5I1EL 4K3HA 4J3SA 5DF0A 1RJZB 3TVMD 4PB0H 4ZG1A 4ZFFB 5IWLA 3BH9A 3QPQC 4N8VG 3BPOC 3G9AB 1LO0H 5F3HA 3B5GA 4RGNC 1DQDL 5D7LB 1CGYA 1XCTB 2DBLH 3H3BC 3OXSA 4QXGH 4YHYB 3Q5YA 4LKXA 4XC1H 2SEBA 3GIVB 4A6YL 1KJ2B 5LBSL 4EVNB 2YA0A 2KH2B 5J1SC 1XGQB 2X4NB 2YD9A 4Y19B 3UP1A 2VKWA 2ORBH 3MROA 5FO9A 3U7YH 5DMYA 3NFPA 2I9TB 5MEPA 5GIRB 4U6TA 1AI1H 3MZGB 1FYTB 4HC1H 1GZPA 5CGTA 2FL5B 3WLBB 4QF1B 4U6YB 4GLRH 1I1AA 2Q8AH 3ZDXE 1UG9A 1BM3H 4WW2B 1TNNA 3RX7A 3EO1A 2GK0A 1NCBH 2PTTA 4IBLT 3GMLB 1HWGB 3QSKB 5CEZD 3HB3C 1KLGB 1JWUA 3UCRA 3BKMH 2BY2A 3R4DA 3C8KA 3VXME 3PGFH 2ZCKH 1JGEB 5JHDB 1T66C 1A9BA 5E6IC 1ZHNB 4R8WL 4OD2A 4XP1L 1NSNH 5EZOL 4GW1B 3TN0D 1RZKC 1KB5B 1T6WA 1S9YB 2XPGA 4JFYA 3MRRB 2OR9H 3C6LD 5C07E 4MA8H 5DRZB 1T20B 5C8JB 3CSYA 3OAUH 5FGBA 3BSZL 1H9VA 4ENEC 3HZVB 3O6FD 3ORJA 1H3PL 3K8LA 1MWAA 3BKYH 5ALCH 1RUAH 2OR7A 5I17A 4PRBA 2DQHL 1KSRA 1CDCA 1UZ8A 3QAZB 1HQRA 2FB4L 2QSCL 2EYRA 1I3RA 3B2UD 1IEBA 1T1WA 2R4RL 3NIGF 4G8FB 5IB1A 2VQ1A 3HE7A 1D9KB 3C5ZD 4G9FE 3VGAB 1FORL 2A6JB 1M7IB 2BVQA 1QYGL 3MLYL 4OBSA 4XWOC 2CLRA 1ZT1B 1T5XB 4YJZL 3AROA 4DKEH 3KPPA 1UKSA 3FB8A 3D5OF 2IH3B 4UV4H 4GG6A 1NGQL 1XEDA 4HGKC 4WY7L 5IVOA 3X14B 1G7MB 4Z78A 5EORH 4LNVA 3WS6A 2PW1A 3HC0A 1KTKE 3ARYA 3D39B 1VSCA 5E9DE 2IBBA 1KIQB 5JXAL 1KJMA 3TBWA 5L9DH 3HR5A 4LVOB 1D6VL 3VXNA 2MHAA 1MFNA 5C1MB 5KVFL 2LE9A 5I9QB 5L88L 3RY5A 1KIRB 3ULVE 2M2DA 3JTTA 4DZBA 3TLRA 4ZUWB 4WV1C 3K0WA 4TSAL 2BXZA 1J1OH 3RBSA 2HRPH 2BNQE 4JZJB 4S1SH 2W9DL 3FCTB 3B8SA 3QEHB 1MLCB 4HJJL 3STZA 2MPAL 4NO3B 4NQVA 1BVZA 4PLNC 5FXCH 3LD8B 3INUH 4E41E 1LEKA 1I85A 2OZ4H 1OAYH 4FZ8L 3GMOA 2P48B 3KJ6H 5BQ7B 2AI0L 3BP6A 4N1HB 4JFOA 5F97E 1VPOH 4ZUSA 5F9WC 5IK3B 3GMPA 4D3CH 1EGJA 3DETC 2W92A 2YUWA 2HH0L 3EO0B 3R06A 4JQXC 4OB5H 1FN4B 3DYPA 5JDJA 3WUWB 4PTUA 4U1NA 4RX4A 3AMLA 4PRID 4I0CC 4QTIL 3RY4A 2PXYB 3PGDB 3V6OE 3H9SA 1KENL 1NMAH 5EBWA 3QDGA 5E99L 3ARSA 1IFHL 5BO1H 1UT9A 4ZXBB 5FYKH 1JWSA 3KHQA 1Z5LA 1S7UB 1NKOA 3VI4F 3QFJD 4KHTH 2IWGA 4PY8I 3GSOB 1QSEA 3T4YA 5E7FA 4I5BA 1U0QA 1TVHA 1SHMA 4B0MM 3HPLA 4P2RA 1A22B 5C0FB 5GGTL 2DL2A 2D7TH 3RX8A 5HHMD 3FO2B 1BBDH 4ERSL 5EO9A 1IM9D 4JRWA 4IMKA 4WGWB 1HDMB 3CIQA 1FLRL 3LZFH 4PRAB 4RGNE 4F80A 4FXKB 4OUOA 3ARGB 2ITDA 2W38A 3JWDH 4G9DA 4A2LA 1QSFE 4PP2B 5DURB 4NUGL 1IGIL 3MLXH 2V2XA 2X44D 2HFTA 1IGFH 3GRWA 3P4OB 4LRNL 3V79C 3QIWD 3DLQR 3VXUB 3MA9L 3BJLA 3N1QC 5EU5A 2IPKA 5DLMH 2W0KA 4H26B 1S7RB 3QCUL 1A5FL 4JO4L 2R15A 1NFDF 1HCVA 3MNWA 4OBRA 2WV3A 3WFCH 5IQ9B 3TEUA 2X42A 2J12B 3WFBH 1DFBH 5IEKB 4EOWL 3M07A 3VGGA 5J6GA 1DVFB 1ZGLA 4OZHA 2AV7A 2VLKB 3DSFL 4JFDD 1AD9A 2IGFH 1E6JL 4FQHB 1KPUB 2HFGH 4HH9B 1JUFB 3V6FB 4YDVA 3N0PB 4MAYD 4L1DA 1JNHA 3UPRA 3LPFA 4U3XA 4WUKL 2WINB 4OF0A 1P53A 5DMIH 3VXPA 3FONB 3WIHH 4X98A 3BD3A 2QEJA 3P4MB 4XBPB 1NGXB 4HUUB 1INEH 2C3VB 1MFEH 4OZ4B 3O8XD 1MJ8L 1TMCB 1VDGA 3ISWA 5IOPB 4IRSD 1P4IH 5DJYA 2E7CA 4R7NA 4J3VA 2J8UB 4M1GH 1KLUA 2FO1A 2NY4C 5HYSB 4P4KB 4X5XB 5CFHA 1QEWA 2CR3A 4W6XB 2NY0C 5LGJB 1K4CA 5BVJA 1U42A 4Q9RH 4Z7VB 1IKFH 2G5BA 4O00A 4X6EA 1R3IH 1QFWM 2CK0L 5ACMA 4ZPTA 4GUPB 2XTJC 3F7PC 3WFZA 2QADD 5LGHH 5C0IB 3ZDZF 3C6LA 2R1WB 2CIKB 1RHHA 3WKML 1TZHB 2GIYA 4HMEA 4O51A 3O41A 4G42B 2FSEB 4G8GD 2X5PA 3WNMA 4PY8J 3K74B 5DFVC 4PR5A 3O6FA 3OKYA 1QRND 2X09A 4M4RA 1UXSB 3MREB 4OIIH 4XNQA 3EOTH 1F45A 4XMLL 3TV3L 4IRJD 4N8VB 5F7WC 1HILA 3QEQB 3SCMC 3GMNA 4U6VH 3DECA 3L3GA 2IPUG 1HQ4B 1CE6A 4KY1H 4NQSB 1JZ4A 1U3HC 3FO9B 1TETH 5D1ZA 3VFUB 3ECBA 1TJIH 4AIZA 3BN9D 4XNXH 3U4AA 1HWHB 5D7IB 5JOEA 2MKWA 5JO5B 4U1JB 1FZJB 4XNMA 3MJ9A 4OKVB 4XCYB 2BC4B 3QUKB 1EXUA 3H7BB 5F6HJ 1DDHB 3G08B 3EHBD 5BRZE 3JWDC 4UU9B 2FX7L 3VG9B 3I9GL 5I15H 1S78D 3RWHB 2APVA 3CVIH 3NVQA 3QDME 5DDHA 3TBVB 2DM4A 1QLRB 1KJ2H 2VDOL 3NZ8B 1H5BC 3GZKA 4CDHA 2D7MA 3ULSA 1DQLL 3TO4A 1IVLA 1YEFH 2MCG1 3VXSE 2BHUA 4P23C 1KXQE 3S35H 1NJ9B 3X13B 2Z31D 1BQHG 4QOKD 1BVKB 3NMEA 2QSVA 2D03H 4JR9H 4F7CA 4XZUB 2DYPD 2GUOA 3VXOB 3EO9L 1OQOA 4GBXD 1Y0LA 1FZKB 5FKPB 1HHGA 4HX1B 3OTTA 3VCLA 4XVUC 2K7QA 2MSPA 3T04D 1R3HB 5DK0A 1DR9A 1QTYT 4OQTL 3MBXL 5GGUA 2IJ0C 1U91B 1UYWH 2FLRT 1FVCB 5L2KA 3QIUC 4N1CA 5HHOB 1T04B 4JFQB 4M7LT 3TO2A 5IBLC 5F8RC 1QPXA 3MR9A 4I18C 1CQYA 2I9LA 2N7BA 3ARFD 4X8XA 1ZGLM 4JVUA 1F11A 1MLBB 5DR5H 4P2YA 1GH7A 3CFBA 3L95A 3BXNB 2VLJB 3FFCB 4X4YB 3VFWB 1ZANH 4UILH 2DQUH 1SJVA 2VSDA 4U4BA 4Z7OE 4NWUH 1ZLVH 4MA7L 5K59F 1FNAA 4I2XA 2W0PA 2FLBT 4HIIA 2RHEA 1U41A 4OJFH 1C16A 2H8PA 2YPLE 3SKMA 2EDDA 4YAQB 4JKPL 5IR1A 1J1PL 2AK4E 3P4NB 4WTXA 3ZKXB 1OM3L 2EDTA 5AYUH 5I1EH 5I1KL 1BD2E 4AEHL 4Y4FC 5FDWA 5ID1B 4WHCA 9CGTA 1OAUH 3TC9A 1Q9OA 4M7ZB 2PYEE 4MLIA 5SX5H 4Y4HA 1RU9L 3O11A 3MV8A 1CVRA 4K8RC 2I07B 1ITCA 4KKCC 4Y1AE 4A6YH 2E9WA 4LCWA 3QIWA 5LBSH 3AREA 3GUTB 4HCRA 5C0JA 1LE9B 5TDNB 2DQJH 2XN9B 2HLFC 5DC4B 4QRPE 2IBZY 2VXSL 1WC7B 4PJXF 1EAPA 5FCSH 3RWJB 4CVZB 4X5WB 5I8KH 2ESVD 1UH2A 4XCEB 3B3IA 2ZWLT 2VDML 4JPWL 5CD3B 3O4LA 3OB0H 1NAML 5EBLB 3RWCA 4F33A 2ICES 4KAQL 4NNYB 3D18B 3IJYB 4KDVA 3VFSB 3NCMA 2DL9A 1WBZB 5DVMA 5IUSA 2IANA 1A1NB 5FYJL 2H9GA 3OKOB 5SX4H 1T3FB 4YHYC 2FCBA 1BFOA 5DUMH 5HJ3A 2ATPB 5J06A 1BGXH 1JPGB 2FJFA 4HWZB 2XTJE 1J18A 2VDQH 3IKKA 5HHQA 3IDUA 1JZ8A 1N6QL 4XP1H 5EZOH 3QI9A 1DQQB 3A6BL 1J8HB 2M26A 2FWOA 2RBLA 3LEXB 3MACL 4PRPB 4NSKB 4NZUL 4MVBD 5CJ8A 3L5IA 5FYKE 3T8XB 5D7KD 4H25A 4MD0B 3VXRE 4PJBB 3GMQA 1H3PH 2LFGA 5IHBA 1RSFA 3CXHJ 4QYOB 4NZRL 4WW2C 4DKFL 1JJUA 1HK6A 3BP5B 5HTSA 3S37X 5C08D 2F54A 2FB4H 4L4TB 2QSCH 4GOSA 2R4RH 3MLZL 4ZSOE 4DCQB 2CXGA 4L5FL 4UV7L 5BJTA 1NCAL 5TDOA 2IFFL 4AM0B 1V3JA 1QYGH 3MLYH 3PL6B 4WWKD 1EHXA 1T22B 5EO0B 1I3UA 4Y5XC 5EOTA 1C5DB 3BPNB 1FPTL 4UAOC 3PJSB 3TNNA 4WY7H 2BNUA 4Q6IA 2W0LA 3O81A 4U6XA 1Z9SA 5JXAH 3K8MA 4QKXB 2AVGA 1D6VH 5I1GH 4M6OH 4YDLB 2ED9A 5DGRA 5DSCB 5HDBE 3UTPD 4M03A 1U3JA 5L88H 5CHNB 2Y9RT 2EE6A 1Q8MA 3D6GA 4OF3A 2ZUYA 5D72L 1P9MA 3REVA 1AQKL 3IXAA 4XVSH 1D9KC 3VGAC 4TSAH 1GHFL 1I7RA 2NY1D 4PJEE 4PJFE 3U7AA 1OARL 2W9DH 4LHJB 1DSFL 5C0EB 4HJJH 4Z76A 2MPAH 4J7RA 2B5IB 4U1IB 3S4SA 3UTSA 1VGEH 4V1DB 3ROOA 4N68A 4UTBH 4N0CC 5EC2A 4X9BA 3C6SB 3RIAF 5C86A 1UEYA 5CEXB 1VCAA 3L9RB 5IB3B 5EZLB 2AI0H 5E4EC 1Q0XH 3PQYE 4LLUB 4G5ZL 1X4YA 3TWCL 2HH0H 2XXMB 3SJVB 5I9QC 3B83A 5FKAA 2H2SD 4EN3A 4NIKB 4NQUA 5HDLA 2Z31A 5CBEA 1I7TB 1E28B 1UA6L 1RMFH 4QRRD 3L7EA 2HVKA 1IFHH 3GSVA 5FUCC 3DYMA 3BOVA 4JZJC 1WF5A 4LCYA 4OCSL 1MCWW 32C2B 3VWJC 5B3NA 3FO1A 1M71A 3QWOB 2XFXB 3G6JF 1TQCC 2RCSH 2VZOA 3W39A 1KCLA 5F1NA 2DOCA 3IYLW 3VFRA 4HWUA 5GGTH 5D7JB 2AXFB 5E5MB 4ERSH 1VADB 3LIZL 4JFFE 1WICA 1VENA 4ELKA 3CMOL 1P84J 1FLRH 2R0LL 3GDBA 3HAEB 1T4KA 1T5WA 2KL6A 3OKLA 3Q6FB 2PXYC 3DUUA 3D25A 2DQEH 2GJ6E 1MH5B 4MX7B 2IALB 1JZ7A 4YXHL 4ZXBC 4ODTL 1EFXA 3TJEL 5TE6L 1IGIH 2K9UA 1CLZL 1K4DA 4LRNH 4XNYL 2NYYD 5SWZB 1U58A 2EYSB 4OV5B 3EZ8A 3MA9H 1R6VA 5DK2B 5A3IC 1OY3B 1TCRA 1XR8A 1A5FH 4JO4H 4PBXA 4U3HA 3CSGA 4POUB 3MMEB 3U79A 1FYHB 4BM7A 5LQBL 3DRQB 2QBWA 1FGVL 1VFAA 4KMTH 2VLLA 4HHAA 1LGVA 3G5XB 1EVTC 3E2HB 4LLVA 1DCLA 4EOWH 5KZCD 5I73C 4Q2ZA 1VFOA 3UTQB 1U8PB 4XBEL 4WTZG 1BQHB 5EOCJ 3DSFH 3ARGC 2D31A 2AW2A 5IV2B 4D94A 1NL0L 3D0VB 4Z7WB 1EAJA 2AJYL 4Y19E 3U4BL 3GSUA 1MHEB 1QP1A 4U7SA 3ZDYE 3PG2A 2X4SA 4Y2OA 3OF6D 1CDIA 4QCIA 1SVZA 5E6YA 4CVXB 3E6HB 4GKSB 4NPYB 3U36B 3AB0B 2L7JA 3OKMA 4HK3N 3VDCA 1CD0A 3IFPB 1MJ8H 3LN4B 1HYSD 4UUJA 1A7RL 3CK0L 4LCUB 3CVHB 5KS9F 1CDBA 1GGTA 2R2HB 3SDDD 4JO2H 1DVFC 1FO0B 2H2PD 2G75B 4P46D 5HYIA 2BZDA 4JGUA 4KJYA 2XQYG 5DQ9B 3QNXB 4R6UA 5JXEC 2HT2D 5JHDE 1JN6A 3QFDB 1BOYA 4KRNA 4MJIA 1NBQA 4N0UE 5C0NC 5DJDA 1PY9A 1YC7A 3HE6C 1NUDA 5FO7A 3DX9A 4PGDA 5DD1L 3M8OL 4XAKD 4ZO8A 2NX5A 3CZJA 5DTFA 1A14L 1XR9B 5I1IL 2XACC 2MWCA 3RFZC 5J11B 4KFZC 1H0DB 1NMCB 4O5LL 3MV9B 5KTEH 1LK3L 2XWJA 3AS1A 1SBSL 1QLFB 4FMKA 4ZYKB 3BAEH 3ZDXF 4HUKB 3WFDL 2NXZB 3D2UD 1RZIA 5BS0E 4LU5L 5H94A 1O5DT 2WBKA 1WAAE 3I2CL 3CDGB 3TZVB 3CFEB 5HI4D 2R69L 1MF2L 3UTTE 1XAUA 1RUMH 3TCLB 4WWKA 3WXWL 4P3DB 2CIIA 4KRPD 3KPSA 4HKBA 5DJXA 5MEOA 3IDNA 3DBXB 1YC8A 3WFEL 1T1YA 5ABDE 4LHUA 3WS3A 3VWKC 3CD4A 3O9WB 5FDYA 4KGJA 4AT6A 4PJ9A 4ONFL 4HIEA 1T6VN 4NUJA 1T1ZA 2FX7H 3IGAB 3I9GH 2V2WA 4JHZA 3BKCL 3MSPA 2UWEB 1AGBB 4PY7B 2VDOH 1J11A 1OGAE 1JE6A 2EZ0C 3U4EA 5IF0A 2DDQL 5TF1H 3RDTD 4C56E 4G6FD 1HHJA 4PJXA 5J89A 4WFHD 3GK8L 2HTKD 4TTGA 1EZVX 1G6RB 1GZQB 2YD3A 1MWAL 5FUCE 3BX7C 4WFFE 1ONQA 3F65A 2OI9C 1V3LA 3BZFA 1N5AB 4OZIF 2ZUVA 1RIVH 1MJUH 3RVVD 5F6IB 5GGQH 1DJSA 3BZDA 3V4VH 4FQXB 5JDSB 2BVOB 2VMFA 3MRCA 5J0BA 3VG9C 1XF3B 3NIDF 5CBAA 4OQTH 4IJ3B 3MBXH 4HULB 1KLFA 1LHZA 1CFQA 3MNZB 2OQJA 3V0VB 1FG9C 1IAKA 1PZ5A 4XXDB 5IVZB 4NZJA 1VERA 2C1OA 5ELIA 1LDPL 4TUOB 2FZ3A 2ENSA 1U2CA 1D5MA 2VIRB 3MYJB 3OAYK 4LLQA 2D7PA 3MX0A 4M3KB 1HKLL 3KYNB 1JV5B 4IS6B 1VACA 3PIQB 5EOQL 4S2SB 4Z0XB 2E6PA 3WBDA 2OTPA 2NXYB 1H8SA 3K8KA 2DI9A 4BKLB 4G6ML 2DTML 4C54A 4IOIA 5SWSB 1C08B 3BDYL 1IT9L 2NY3B 3GBLA 2P5WD 1C8PA 4E42A 1R3JA 4TOYL 2B1AL 3KDMB 5DHVA 4G7VL 4JKPH 1J1PH 1BVLA 3I50H 1OM3H 4JFPB 2FIKA 4NKDB 3Q3GB 4DZ8A 5I1KH 3SQBA 4AEHH 5HGBA 5T33L 1FG2B 1GVIA 4FQ1H 5IKCA 1G7JA 4TVPL 5BW7A 3SE4A 1MJ7L 4R3SB 3IETA 4G8IB 1EGJL 1RU9H 1X5JA 4OZFG 1N7ML 5I76B 4Y16D 4KI1A 3WJJA 4PJDB 2NR6D 4HQQL 3HCVA 4ORGA 3LAFA 1IMHC 1DUYA 1YMMD 3RY6A 2FR4A 5AWNH 2OMBA 4G6JL 4ODVH 5CUSL 3GJFH 3CDYA 5D8JL 1IZKA 4U0RB 1F00I 3QUZD 2ADJB 1AGFB 3E1F1 1J0KA 3LQMA 4AH2A 3ZKXC 2ED7A 2Q6WA 4Y4KB 1NAMH 3HI6L 4GRWF 4LPTA 4KAQH 4LSPL 3AM8A 3BWAA 5IFHH 1UM4L 5J1AA 2VL5A 3BPCA 4M7ZC 1P84K 3B6SA 1L6ZA 5FYJH 4OCRL 4EI5D 4M6MH 3E6FB 4U1MB 1NFKA 4BYHA 4FNLL 1HSAA 2A6DB 3E3QC 2CO7B 3OR7A 4QXWA 3L1OL 3Q1SL 2EE2A 4YHOL 1N6QH 2J5LB 2VQTA 3L7FA 4PG9A 1QO3A 3WNKA 3T4AA 3A6BH 5FOBB 4JPKL 1MUJA 2NCMA 5IMKA 3L6FB 4ZQKB 3V7MA 3HI5L 3GRWL 3N85L 4NZUH 1J0HA 5F7DA 1RUKL 2HTLC 4QEGA 1SEBB 4J4PD 2VISA 3ELAT 1TFHA 3UZQA 3B9DA 4NZRH 5HPMA 5I1CH 4DKFH 3KPNB 3G6JA 1OB1A 4Z7VE 3P0GB 3KPQB 4ALAL 1MREL 2ZOKB 1CGTA 1WFOA 4JDVB 5I18H 3BP7A 3RNQB 2DI8A 3ILQD 1BF2A 1SEQH 4R4FL 3O3DA 2VLRB 5IQ7L 4U2ZA 2I24N 2VR4A 1OOAA 1JF5A 2VZ1A 4M8QB 1W0YT 5IHUL 2JJTA 3HAEH 4HGWA 3H9YA 4WI3A 4WFGE 4NO2A 3TA3B 5B8CB 5GZND 4LDEB 1FPTH 4Q9QH 1OW0C 4O9HL 4MSWB 3JV0A 5DD6A 4HKXB 3BHBB 4ZTOH 3V2AR 1DQTA 1QA9B 4J3OC 3BPLB 1ZLWH 2CDEB 1S7VB 1ZA3A 1MFBL 5IW1B 5D2NA 3P9MA 4BSVA 5D72H 1AQKH 5DO2D 2D0HA 2NTFB 5D2LF 4P5MB 5D7IE 1N59B 3RWIA 3PL6C 5D96C 5DRWB 3A67L 2X4OB 3MLRL 3RVXD 1Z9LA 3L5XL 2QL1A 1AGDB 4QRQB 4IRZL 4LF3B 3BPNC 1CICB 1RQ5A 3T3ME 4X6CE 4NNXA 1A6UH 3QEGH 4JFED 2GTZA 4EUPA 3TFKC 4K71C 5C0CD 4AG4L 4G5ZH 3QDJD 3TWCH 4OLWL 2F53A 4YDLC 3KLDA 2X05A 3GHEH 5CSGA 1XGPB 4H1LG 4P5KB 3TPKA 3KXFD 3E0GA 2YK1H 1UA6H 5DRNB 3P9LB 5DJAB 4RIRA 3JV4A 1P7KA 4ODBD 1LDSA 5B22A 5KS9A 1UADC 1CFVL 2D7NA 4OCSH 4M4PA 4GQPH 4ISVA 2WP3O 1Q1JL 3DIFA 4PJ7B 1AGCA 5KVEL 2B5IC 3B9KD 1FO0H 3RVTC 1MCQA 4DW2H 3TVMB 5E1HB 3MZTA 2BJML 2ZUTA 3MJ9L 1BFTA 2XWBB 3ZL4L 5I16A 1B4JL 2QR0A 4YXKL 3C5JA 2XQBL 5IB5B 3LIZH 3CMOH 4N5ED 2R0LH 4L9DA 3O3AB 4ZODA 5ESAB 3PDGA 4YDVB 5DEGA 2DN7A 3IDYB 1MAKA 2OYPA 5J9PA 3T1WA 2APBA 2J8OA 4YXHH 1J8KA 4ODTH 4CJ0A 2F9BT 2KQMA 1MVUA 3CAFA 2UZYB 2Z4QA 3I02A 1CLZH 4WO4D 4FABL 4XNYH 3GI9L 5KG9A 4IOFD 3OKDB 5E5RB 4JY4B 1SYSB 1IEAA 2WSKA 3L3JB 3OX8B 1PQZA 3SDCC 4R9HA 8FABB 2OTUB 1NCCH 5C09D 1HXYA 1A6WL 1AO7D 5A40E 3LSOB 5CGYD 1FGVH 3VJ6B 3K4DA 3C08L 1I1YB 5EO1A 1HIML 1QFPA 4QRTB 4U1LB 5T5NG 1KGCE 3DO7A 3T65B 4Y16A 3UJTL 4XBEH 2GTWA 4G3YL 3ILPB 2WUBL 4ZPTB 3TN0B 3I3DA 1BIIB 3E3QE 3S5LG 3SDAD 3PXJA 5HHNB 2GCYA 3BWUC 3ZKMC 5EIIB 1NL0H 1PEWA 3P11L 1YMMA 3U4BH 1R3LA 2G60H 1KF9B 3RL2A 4ZS6D 4JM4L 4CW1A 2H26A 2KBGA 43CAA 1XGRB 3QZWB 3UBXG 1XGTB 3EOAA 3D9AL 1YNKL 3GB7A 2FX9L 5KSAD 3QXDB 4QY8A 2GT9A 1WJ3A 4JHAL 5CLWA 3C09B 3BFOA 2J6EA 4OZIA 1JWMA 3LRGA 1YEEL 1VEOA 3E2HC 1A7RH 2NLJB 4YBLB 1N8ZA 4XPTL 3C5ZB 5DT1L 3FOMB 1U8JA 5DJ6B 2C3GA 1KN2L 1ZLUK 5J8OA 1JYXA 1VKXA 2DM3A 3LDBC 1Y18B 3JUYA 3D0LB 5C6WH 3QPXL 2A77L 1ND0B 5B3JF 1J8HE 3IFLL 1IBGH 3U9PH 4P2QE 4XP9L 3MRIB 4KQ4L 3M8OH 2VUYA 4PRPE 4YNYB 5E4IA 2AQ2A 1A14H 2Y07H 2HJFA 2IH1A 2F15A 1CF8H 1N4XH 5EU4A 3AB0C 3RGHA 2EDKA 4HCRL 1SBSH 3RWEA 2FGWL 2G5RA 4JKKA 5D9SB 3V52L 4C83B 4K94H 5HYJD 3B2VL 3PWUA 4GW5A 1KCRL 1X7QA 1PKQA 3VG0H 1U8LA 3IKCB 4L4TE 4OZFB 3WN5B 4LU5H 4FN0A 3I2CH 2DI7A 3T0AA 1MF2H 1ORSB 5HYQA 3IJSA 3VRIB 2QTEA 3NACL 4FZEL 3QUYA 3CSPA 4TSBL 5CJQL 4XTRD 4YHNA 1CFTA 3FQRA 3HZYB 5J6HB 3MRJB 3HZMB 2XICA 5C71A 2R1XB 5D1QC 5L7XL 2ITCB 2P46B 4F8QA 1CIDA 4QTHA 2EIDA 1HI6A 4F7MA 4LPCA 4HSQA 4ONFH 1QD0A 3BP4B 5DJ0A 3QH3B 2YMXH 5C0AD 3BKCH 4PRIB 2NY6D 4NHUA 4JQIL 2NXZC 5JR1L 1FNHA 5DGQA 2UY6A 1EO8H 3BVNA 1NC2D 1P7HL 2HLAB 3MRFA 5JPNA 3FHQA 2GITB 4JRXD 1BBJA 1MWAH 4NQTA 3QFJB 5B39A 4X80L 4U2YA 4FMFA 2A6KB 1IQDB 4NC2B 4OLYH 4LPWA 2O5XH 1JPTL 3K1DA 3LS4L 5DMKB 1A4JB 1INQB 4JJ5B 2BDNL 4HUWA 5F9JA 5FYJE 3O9WC 3FTGB 5C0BE 5EUKA 1TVDA 3RKPA 2R23B 4HJ0C 3K3QA 3LKPA 1IM9B 3NABH 3PGCA 4MQ7A 4MA3B 1CU4L 3SJVE 1YQ2A 3UO1L 3OWEA 3JBG7 4AJ0A 2JIXA 1F4YH 2X4PB 5CJOL 5F93C 4GQ9L 1LDPH 3ES6B 2P24A 4JRYE 2J2ZA 3B8YA 4NT6B 3RA7L 5DA4A 5EWIL 4AL8L 1CDJA 3LS5L 5EOQH 4NQEB 1CCZA 1B0RA 4GS7B 3GSQB 4BFIA 3MODL 1RJLB 5E8NA 4JGJA 3QG6A 2FBJL 1H3TA 1LEGA 3JV5A 4G6MH 2DTMH 1EPFA 2H3NA 3OG6B 2VDLH 1P5UA 2HN7A 1IT9H 3L5WA 3QA3B 4M48L 4NOFA 4P2OA 2DQFB 3MUGB 2IMNA 2B8OT 1WZ1L 4IJ3C 1FL3B 4UT9L 5GRVL 3ZE2F 5IWLC 4IEFB 2EO9A 5T33H 1WWCA 2VDNH 3UJJH 4JFDB 5FA4B 1KNOA 3QWRA 3PWLA 3CCHB 4TVPH 3HPJB 1MJ7H 4KXZH 3MLTA 1YPZB 3W2DL 1NBYA 1EGJH 3BO8B 4MAYB 1N7MH 3S35X 1Q0YL 1ZA6A 3GI8L 4L4VE 3C9NB 4M62L 3AGVA 1KJ3L 4WO4A 4K94C 4HQQH 3FFDB 4NHCL 4L8DB 3U7WH 3O8XB 2EEBA 4G6JH 2NY3C 4IRSB 3KYOA 1LO3L 1KTRL 1OPGL 5C09A 4PRHB 1AO7A 1I1AC 5FK9A 1UH3A 3ARDD 2R2EB 3CFDA 5I75C 1AXTL 1IZJA 2XT1B 5E1AA 4BJLA 4I77L 1CT8A 2IF7A 1B2WL 4LSPH 2NY2D 1EERB 3RBGA 3TBTB 1UM4H 3VH8G 4HLZH 2HFEA 4MWFB 5T1MB 3H2WA 2QADB 4WHDA 3RKDD 5GRJL 4PLJC 4Z7WE 3L3IB 1NGZA 3C2AL 5F9OL 3VRJA 4GAJL 2GW5A 3L1OH 4AENB 4G8GB 4YHOH 3PXHA 5A1AA 3FT2A 1QRNB 5GS2H 3PV6B 3GO1L 4MJ6B 5CSBA 3CC5A 4JPKH 3TBYA 1BLNB 3OKEA 3QJHA 4JANA 3CPLB 4U0RC 4IRJB 2D9CA 3V5KB 2Z92B 5KSAA 5DJCA 3HI5H 3GRWH 4C58B 2V7NB 4CL7A 3BEVA 1RUKH 4LSRL 4Y4KC 2VERN 1PG7W 3P73A 4N9GB 5FO8A 2KDGA 1QLEL 2AV1A 4XBGA 3VMPA 3RZCD 4CJ1A 1NFDB 5BRZA 2C9AA 4OT1L 5K9JH 1OAQL 1Z0MA 1LE5A 1CZ8L 3HE7C 4GRLD 4LLMA 5FYLE 5BZDB 1WCBB 4DK3A 5CP7A 5FF6A 4GXVH 3MGOB 2J1KA 2CKBA 1T0PB 4JZNA 4K07A 1S9KC 1XF4A 1CG9A 1QRKA 4R4FH 4UT6L 5IQ7H 4OCXL 1P4BL 5CIPA 3FOLA 4P5TD 1CD8A 2DD8L 5IHUH 3WS6C 5IHZB 3MV9E 3O4OC 4J3TA 1AY1L 1HHIB 2H32B 3AAZB 1U92B 1YNLL 2X4QB 5JW5B 4WW2F 1UM6L 4O9HH 2ZKHL 2C3HA 2UUDH 3LHPL 4YIQA 4PJAB 1UVQB 2OSLA 1GL4B 1LO5B 4QOKB 5E8OB 4LASH 4F7TA 4MD5B 1NCUA 2FYYB 5KN5A 2DYPB 2R29L 3S5LB 1QBAA 2APTA 4XI5D 4EKXA 4GBXB 5DYOA 1XH3A 1MFBH 2R0KH 2FJGA 3LKNA 3G6DH 3H9ZA 1EHLL 5GS0L 1C12B 1ZHLB 4HS3B 5ERWB 5CEZH 4X6DB 1RZFL 1I85C 1JRHI 1U93B 3A67H 1WIOA 2ICWB 2J8HA 3MLRH 4HS6A 3UBXB 3L5XH 3MRGA 5CINH 2MKLC 3MUJA 3F12A 1TNMA 2W60A 4IRZH 3TA3C 1YNTA 5B8CC 4KKAD 2OLDA 1I4FB 2DWDB 5C0AA 4LSTL 1UB5B 5EPMB 1HEZA 4OSUH 3HUJB 1N5YH 1P7QD 5TDPB 5GISL 4AG4H 3F7YB 2G2RA 4OLWH 1WAAF 3ARFB 4GO6B 1YY8A 2YPLA 5EZIH 4HKJA 1JYWA 1CIUA 2YWYA 4X4ME 3RHWF 5F21B 1I1RA 4XMKL 5I1DA 3DPBA 3SHSA 4MA1B 1I8MB 1MQ8A 1ZVSB 3CDCA 3DI2B 4JN2B 3SGJC 5F7HA 3DMMD 3PABA 4PLKC 1CFVH 4Z0BL 3CUPA 3KYKH 3O2VL 1FNGA 4R26H 3OKKA 3CGTA 2OJEB 1JGUL 3ULUC 4UQ3A 1XF1A 4Y1AA 2RAMA 2CQVA 5I19L 1UB6A 3JTSA 4I1NB 4WENB 3MJ9H 4QRPA 1B4JH 1GGCL 2DLEA 2Q7YB 2XQBH 1MFDL 1MCOL 4X99B 2R2BB 4JREB 2NW3A 5F89A 4PGBA 5E8DL 4FFZL 2DQGL 3D3VB 1AHWB 4RWYL 4EBQL 1YECL 1JHKL 2ESVB 5ESVB 4JO3H 5HHXH 5SWSE 2W65B 4FABH 4BSJA 4OZFH 3RPKA 4J3UA 4FFVC 4GW4B 4KDTA 4WNQA 3H6JA 4KUCD 3HFML 4I48B 1FZOA 5T1DH 4TNVF 4FXGB 1A6WH 3JUZA 1ZS8A 5EZJB 1DE4A 1G7PB 1KIUA 1UFUA 1E4XL 2C26A 3GHBL 3FQXA 5T3XL 5CSZB 1MY7A 3C08H 4FQPA 1J88A 1HIMH 2VITB 5GGVL 3S34L 3FQTA 3KLSA 4XH2A 1BOGB 4XT1C 1KG0A 1DBJL 2WQRA 1NC4D 3L3DB 4QHLA 4X6BB 5FCUL 3S8WA 4NQCA 2R56L 3VXRA 3ZTNL 4G3YH 3IDYC 5I71B 4PJDE 2WUBH 2CUIA 5ICXB 1CFNA 4OCLC 1X6NA 3ARXA 3K2MC 3OKNA 1EHAA 3KLHD 3LCYA 1MCCA 4NQXB 1OWWA 5E8PB 2P43B 3KYAA 3V6ZB 4JM4H 3TT1H 1CGVA 4M5ZH 3DUSA 3SGEI 1S8DB 1P6FA 1MHCB 3ARDA 1ACYL 4KPHL 4Q9CA 4RGMB 4OLUL 1YNKH 4WJ5A 5I8CA 2FX9H 4IIQA 4JHAH 5C08B 1KIPB 4G8EA 4M9OA 3MLUH 5E08L 5F88B 1YEEH 2E9IA 1FAIL 4Z7NF 1CDUA 3VFNB 4M1CD 1T0MA 4DN3L 4XPTH 1LK2A 2XZZA 5DT1H 2DIJA 4LLAA 1H5BA 3TN0C 4KMQA 3MRDB 4NDMA 3C6LC 1W0WA 4P23A 1G7HB 5D70L 4HJGA 3O3BB 3HNVL 5D7SL 5GRXG 5T1KA 3QPXH 4GG6E 3EJYD 4NKIH 3U0PA 3IFLH 1DBML 4XP9H 2JCCB 3O6FC 2ADGA 1S7XA 1W8OA 4WDIA 4H8WH 5MEQB 4J1UA 4X7FC 4KTDL 5KVGL 2A73A 4QT5A 1LVEA 2V7HA 4ONGH 4HCRH 1YN7A 1UACL 2JKXA 2FGWH 4BZ2L 3HS0B 4X6FA 4HUVB 4YHMH 3B2UC 4OCMC 4P4RA 3V52H 3B2VH 3J7HA 2GSGB 3BMVA 3NPSB 4YBLC 2A83A 4HIHA 5DUBB 1KCRH 2FBOJ 4HAGA 4ZFZB 1XZ0A 5EBGA 1HXMB 3PQYA 2X4UB 5T1LD 3QIUA 3MRKB 4EDXA 4WUUB 3VDAA 2VLRE 3NACH 1MRFL 1S7QB 4TSBH 5CJQH 4KK5D 4NKMA 4UDUB 3HNSH 1P1ZA 3MV7D 5L7XH 4TVPE 3BGAA 5KVMC 5DJ8B 2RFXB 3BZEA 4AMKH 2WMPA 4ODUA 4QNPF 4OV6F 1CLYL 3LQZA 2J8UF 4M61B 4PG2A 1JVKA 4G80B 3TO4C 5C0DB 2FEEI 1IKNA 4WHYH 3FJTA 4QHUA 1FFPA 4JQIH 3H9SE 2VDRL 2ILLA 3QDGE 4UIMA 4QRRB 3WN5C 4EXPX 1G0XA 2Z91A 3GMRB 4NRXA 1V8HA 1J05A 3D85A 1ZV5A 3UTZB 3GSRA 1VHPA 5IW3A 3GSWB 5CZVH 4X80H 3EOYG 4XWGH 4HD9A 3GFUA 4R0LA 4ZFOB 1GOHA 1JPTH 4P2RE 3U0WL 3FB6B 3MRLA 4GMTL 5C9JA 3LH2L 4TNWF 4YHIA 3ULUE 2W59A 1QG3A 1YMHA 2AAVA 3VXQA 1W8NA 1JF1B 3ARTA 1TZIA 5DRXA 1BZQK 4DGVH 1CU4H 4BUHA 2Y5EA 4OD1L 3V9FA 3FRPA 3MXVL 4G6AD 3QUXD 5MENA 2PW2A 4OF7A 4XRCB 2X89A 1ITBB 4GQ9H 3WO4C 2O61B 1RJZA 4ZFFA 5D7IF 1TLKA 2IAMD 3RA7H 5IG7B 5EWIH 4AL8H 1A2YB 5CJBA 5D7LA 4D0CB 1XCTA 1NUNB 1A6PA 3RIFF 3EGSB 1J10A 3V8OA 2WIIB 3MODH 4KTEH 4L1HA 3GIVA 1G7IB 3SOBL 2FBJH 1KJ2A 5IGXL 4DN4L 2Z93B 4EVNA 5INDB 4M48H 3PP4H 1SYVB 5KZCB 1XGQA 1PY4A 2GHWB 2X4NA 2P44B 3DX6B 4Y19A 1XCQB 1WZ1H 1CGWA 4UT9H 1MCWM 3Q2CA 2I9TA 2AP2A 1YEKL 1KCVL 4Y4HC 5GIRA 3GNML 1OD7A 3EAKA 4K3DL 4YHLL 1Y6KR 1FYTA 4LSQL 4ZAKD 1F90L 2FL5A 3WLBA 1HCFX 4H8WC 4QF1A 1QHPA 4ODXB 4U6YA 1Q94B 4BQ8A 3BRFA 3QIWC 2XNAB 3AREC 4WW2A 1XIWB 1Q0YH 1U95B 4BQBA 4M62H 2VZTA 3GMLA 1KLGA 4QXTB 4GS7C 3ZE0F 5LVEA 1H8NA 1MCFA 2ZUUA 1INDL 2JK5B 5BZWB 1AD0B 4PJGB 1JGEA 5JHDA 4M9PA 2MOVA 4P9HL 1ZHNA 2JB6B 4L9LB 1EMTL 4GW1A 4CDGC 5HPOA 1OF2B 3SDDB 1KB5A 3MRRA 5CEZE 5T3ZD 5DRZA 1AXTH 4P46B 4RAUB 1T20A 5C8JA 2CDGB 3WMSA 2VNCA 3HZVA 3X3FL 2ICWI 3UBXI 1UEMA 4MAYC 1MPAL 5HI5C 4NO5B 5GRJH 3MV01 3UAJD 3VD9A 4MZ2A 2I60L 3C2AH 2RIKA 1DEEB 4GAJH 2XTLA 3MTRA 4X0KB 1WAAA 4G8FA 3WD5L 4AIOA 1D9KA 2AJXL 3GO1H 1U8HB 5SV3A 2A6JA 1M7IA 1ZXQA 2V9RA 5GSRB 5IFJB 3D2UB 1ZT1A 1T5XA 4APQD 1JCKA 4QGTA 7FABL 3VXTB 2E9JA 3VFTB 4LSRH 2A1WL 2IH3A 1ZLVK 2APXA 4URTB 1GGYA 3X14A 1G7MA 1ADQA 1I9RL 3OGCB 3D39A 4OT1H 4RGOL 1OAQH 2VZVA 1CZ8H 4KRPB 2QADC 1FHGA 1WIUA 2VAJA 3QBTB 1T1XB 4KROD 1KIRA 4UT6H 4ZUWA 1R3KB 4OCXH 5SX5K 1OCWH 3BI9X 2AQ1A 2DD8H 4Q6IC 4JZJA 5IB2B 4IRJC 2ZPKH 3FCTA 5EU7C 3QEHA 3ARBD 4CMMB 1MLCA 1AY1H 3DX8B 5FA3B 2F19L 1YNLH 3KPLB 4NO3A 3RDTB 4YXLH 2Q3ZA 5KBNC 3SPVB 5F3BB 2ZKHH 5CWSB 3W5NA 5IW6B 5JW4R 5A2FA 3OR6B 3VXMD 4MXQD 5BQ7A 1EJ6A 4I9WE 5CZXD 4I3SL 1P9MC 5IK3A 3MRHB 3BN9C 2BOCB 2R29H 2BY1A 2J6EL 3EO0A 4KRLB 2V2TB 1FN4A 3H3PL 4YDJB 3OB0K 1MCJA 3WUWA 3T1FB 5JIPA 1EHLH 4K3EL 5HHOD 4QHMB 5HYFA 4PJ5B 1EEQA 4RQQB 2PXYA 3R1GL 3PGDA 3SE8L 1CLOL 1S78C 1RZFH 2FGZA 2ED8A 4ZXBA 4PJBF 5I1JL 3FFCD 1ZT7B 2MQCA 4BUGA 5L2KE 1IM3B 3I6GB 1S7UA 1U2HA 4LSTH 3KS0H 4PRIE 3ET9F 5HGAB 2BXYA 3ULVL 1NANH 4JPVH 3GSOA 2MCPL 2R0ZL 4LFHD 4EN3C 5BXFB 5GISH 2FNBA 2Z31C 4IOSD 4M6AA 4NC1C 4AIXA 4X9FA 1XT5A 5C0FA 4NKOB 5FGRA 2AJSH 4EI6B 2FRGP 1IL1B 5EULV 3FO2A 2BVPB 4GBXC 1NCNA 1ODAA 2HP4A 1HDMA 4KJQD 4XMKH 4I2XE 2GKIA 4P3CL 5E95B 4XP5L 2BOBB 4PRAA 1LEIB 4FXKA 3BQUD 4WFEE 2P5WB 3NIGE 4X7CC 3ARGA 1PQZB 4Z0BH 3FB5B 5HHME 1AGEB 4PP2A 4YHKL 4ODHH 3P4OA 1QR1B 3FO0L 5FGCB 3VXUA 4H88L 2UVFA 2XN9D 4J3XA 5I19H 1JTPA 4R97B 1GC1C 4H26A 1S7RA 3S3PA 8CGTA 4TSCL 4ODSH 1GGCH 3WKNA 1MFDH 2B1HH 1MCOH 5IQ9A 5I30L 5J13C 1G6VK 4LVHB 4WI9A 5ETUB 1HHKB 1FBIL 5IEKA 1K9TA 5E8DH 4W81A 4MA1C 1N3NB 4LLWB 5D6CB 5DJ2B 1DVFA 4M1DH 1ULVA 4RWYH 4FG6D 2VLKA 4EBQH 1QACA 1XFPA 1YECH 3QUZB 3L3HB 3LEYL 5JXEA 4FQHA 1IGCL 1KPUA 4HH9A 1JUFA 3V6FA 1WFNA 4OM0L 4HV8B 4GJTB 1MHPL 1OSZB 2E9BA 5DD5H 3HFMH 3MLSL 1TTGA 2WINA 3EJZD 3FONA 1N8ZB 2DLHA 4BSWB 4JFDE 4EI5B 3GHBH 3P4MA 4XBPA 1NGXA 4HUUA 2C3VA 1IJ9A 3S34H 5GGVH 1ACZA 4MNQD 4OZ4A 5IOPA 2WBJD 4EXKA 2ZZUT 3SY0B 2J8UA 1F2XK 2CPCA 3HKFA 1RK1B 1VGKB 1Q9WB 1NEUA 1AHWC 5HYSA 4P4KA 5DHXB 1L0XA 4X5XA 1A7QL 1SQ2N 3MGTB 5LGJA 3OPZH 3MUY1 4Z7VA 2NY7L 3FQUB 4GUPA 2DJUA 4YDKL 1A7OL 2VDKL 1RVFH 5C0IA 4KPHH 3VI4E 2R1WA 2CIKA 3QB7C 4H20L 1TZHA 3VRLE 3W11D 5L8KB 4G42A 5FGSA 2FSEA 1UWEH 4NWTH 5E08H 1FAIH 5IT2L 3DTXB 4DN3H 1UXSA 3MREA 5D71L 5DHVH 3QULB 5I71C 4E5XB 1GIGH 3DVGB 4N8VA 1FGNL 2JJWA 3S98A 2IPTH 4M3JA 3QEQA 4G8GE 4MB3A 4F7PB 2V5MA 1FE8H 3HMWH 5D70H 5D7SH 3HNVH 4YWGL 1TQBB 1HQ4A 1QRNE 4OFPA 4NQSA 2EEDA 3FO9A 1DBMH 2ATKB 3L3KB 3V7AG 2N4IA 5EU7E 3VFUA 3ETBF 3H0TB 3MCLH 1G9ML 5LJYH 5KVGH 5D7IA 3HB3D 5JO5A 4U1JA 1FZJA 2EDBA 1EH9A 2WAHA 4KK6D 1NQBA 4OKVA 1UACH 4XCYA 5EU6D 2BC4A 3QUKA 4BZ2H 3H7BA 1DDHA 1NFDE 4JM2D 3G08A 4R4BB 1ZGLP 4UU9A 4V1DD 3RVUD 5FB8B 2AJVL 4RZCB 4OCWL 2F74B 4J12A 3RWHA 3TBVA 1QLRA 3NZ8A 3EYFB 1CK0H 3GMMB 4Z7WF 4JVPA 4LBEB 1LO2H 4WWKC 3QQ3B 1CD9B 1L4IA 5DJZB 5D1XD 3HG1B 4WI5A 1H3GA 3UTSE 4B7IA 1NJ9A 1MRFH 2KQNA 2Y72A 4KQ3L 5JOPD 4ENED 2XWTB 3X13A 1BVKA 3EYVB 4HFWB 4JFEB 4HPOL 4OLVL 4XZUA 5TFSL 5C0CB 3VXOA 3RIFK 3HN3A 1A9EB 3QDJB 4PD4J 1FZKA 5L0QB 1CLYH 4NJ9H 4WCYL 1I3GL 4NBXB 1A3RL 5FKPA 3V5DB 3ZT6A 3KXFB 4QOKE 3NPSC 2B2XL 1R3HA 4NC1E 2VDRH 3DURB 4PB0L 5K9KB 2NY1C 2AEWA 1U91A 3WJLA 5HHVL 3TBSB 1FVCA 1GYAA 4D8PB 5D7JD 3T0EB 3UMTA 1T21B 4Y8DC 5HHOA 1T04A 4JFQA 4DGIL 3B9KB 4FTVD 4X6DE 1BREA 1JI1A 1NCWL 1N0XL 2W1NA 1MLBA 3U0WH 3IDXL 3BXNA 2VLJA 3FFCA 3LH2H 3CJJA 4X4YA 5C3TA 3VFWA 3O6MH 1X5XA 2CKBL 3CX5J 3ZDZE 3H9HB 5E94B 1MRCL 1AI1L 2G9HB 2H2SC 4GAYB 3NA4A 3PWLB 4JN1L 1IRAY 1EDQA 4JKMA 3T3PF 4YAQA 4OD1H 3RL1B 3P4NA 3MXVH 1CXIA 4RFOH 3CXDH 3OG4B 1ZOXA 4Z7UF 1N64L 2ICCA 3LV3B 4U7MA 3UROR 5J56B 5ID1A 1A02N 4MCZB 1OLZA 3MBED 3EFDH 1OAKH 1QBLL 2WBWB 4U49A 4W68A 4FFYH 1OGTB 2XG5A 3PGFL 3DETD 5TGBB 1MQKL 3QDMD 1NSNL 5MP6L 3ZHDA 1F97A 4AY0A 2YWZA 2I07A 3SOBH 3WLWD 5IGXH 2UWEF 4KUZL 1FRGL 3SKNB 4MA8L 5D2LB 3VXSD 3GUTA 4X7EC 1LE9A 5TDNA 2VZUA 2XN9A 3OAUL 1WC7A 4CVZA 3RWJA 5BW7C 4X5WA 3SE4C 2BCKB 2FD6L 3GNMH 3QCTH 4XCEA 2VB5A 4K3DH 3PWVB 2HKFH 4YHLH 4B53A 5ALCL 3GJEB 1RUAL 5CD3A 3WJJC 4LSQH 1A0QL 4S10A 3DV6B 1F90H 5EBLA 3SDAB 4XPHL 2HJKB 4F37F 1H15B 4NNYA 4EUPH 3D18A 3IJYA 2NYYC 3NCYS 1I8LC 3VFSA 3LKSB 1WBZA 1IGTB 2VXQH 1QOKA 3CZFB 1X3DA 3MJ7B 1A1NA 2ESVE 4WI4A 1F42A 3BW9B 3RY6C 3OKOA 1T3FA 2ZSVB 1BQUA 4NKQB 3F7VB 2ATPA 3QDAA 2BSSB 1JPGA 4HWZA 1INDH 4P9HH 1EMTH 3FMGL 1VFUA 4YC2B 1DQQA 5DK3A 5IFAH 1J8HA 1J87A 3AM8C 4LSDA 5EORL 4LRIA 3ROLB 3LEXA 4PRPA 1JYVA 4NSKA 4YE4H 4KK8D 5L9DL 3T8XA 1ZSDB 5IBUG 4MD0A 4PJBA 1CDGA 4MJIE 3HHRB 5ADPH 4QYOA 4HPYH 1MPAH 2HT3D 2CRMA 4JY6B 3BP5A 1I9IL 4ONOA 1G0DA 2I60H 3IS1X 4L4TA 5BV7L 2HRPL 5D7KE 2C4FU 3PV7A 5KVDL 3W0WB 3TZVD 3WD5H 4DCQA 4B7LA 4YEFA 4AM0A 5HYJB 3PL6A 3WO3B 5K59E 3TYGL 2OZ4L 1T22A 2EC9U 2PYED 1OAYL 3SDDC 3EUUA 7FABH 2H2PC 1X5ZA 1VPOL 4P46C 2A1WH 4D3CL 1C5DA 3GM8A 4FOMA 4NM8L 2HT2C 3PJSA 1EBAA 4KZDL 2VE6B 1I9RH 3QNYB 4RGOH 4PJDF 2YRPA 4OFKA 3PHSA 3ZMRA 3QWQB 5JUEL 4P57B 2H6PB 2HFFB 5DSCA 3S88L 2JJTC 5CHNA 2FEDC 2NMSA 2VRAA 5ECJE 2JCCE 3NZHH 4P0DA 1BQSA 1KCUL 2PETA 3O3EB 2ENYA 3NCEB 5C0EA 2NY0D 4IMLB 2F19H 4E0RB 2KZWA 1QFWI 4PJXE 4U1IA 1YYLL 4V1DA 1NC2B 5F7UA 2D7TL 4XAWL 5HI4C 5LCVL 2W9EH 1RZJH 1BBDL 2AKRB 3C6SA 1TITA 4R2GD 2XV6B 5CEXA 4JRXB 3L9RA 5IB3A 5EZLA 1J86A 1V7NL 4K55A 1QVOB 1R5VB 4I3SH 4LLUA 3GJFK 1M1SA 3LZFL 4KRPC 3DROB 5E2JA 3SGDI 3TIEB 1JNLH 5EUOB 2J6EH 4X9HA 1QZ1A 3SJVA 4F8TA 1FC1A 3H3PH 3JWDL 1XGYL 1MI5B 2A38A 4K3EH 1D5IL 1YDPB 1I7TA 3MLXL 1E28A 4KXZI 1IGFL 3R1GH 3NN8B 3RUGF 1CLOH 3HC4L 1LWRA 2EDYA 4LSVL 5I1JH 3L5JA 5D5MB 5ADOL 32C2A 1F8TH 1UJTA 3UTOA 4DUWA 1PX4A 3CMGA 3QWOA 4W4NA 1FJ1B 2XFXA 3WFCL 2HTKC 2MCPH 4QRRE 3QUMB 2JELH 1NEZG 1NAKH 1NGWB 3MRMB 5D7JA 4ZDHB 2AXFA 5E5MA 4IHOB 2F8XC 1VADA 4R4ND 1HYRC 4LPUA 1KPVB 3RVVC 4OQ1A 4P3CH 3HAEA 2IGFL 5ICYB 1I1CA 3Q6FA 4D0DB 2YA2A 1K6QH 1AFVL 4QWWC 2BFVH 3GEWB 4NBZB 3QEUB 3QHZL 1MH5A 4MX7A 2IALA 2IG2L 1JF6A 4PJHB 1QQDB 4GKZB 3WIHL 1S7WB 2AGJH 2APWA 4XPGL 4PD4K 3O0RL 1ORQB 2ZJSH 2EYSA 5IROA 5SWZA 4OV5A 3EYSL 5DK2A 3H42H 5HGGS 3KPOB 3TH3T 3G04B 4LNRB 4XP6H 3MMEA 3K4AA 4PPTA 3MLWH 4M1GL 4JFZH 1W0VB 3DRQA 2MFNA 2XKSA 5I30H 1UXWB 3G5XA 2Y36L 1TPXB 5DXWA 4CU8A 3UTQA 1U8PA 1BQHA 1UM5H 3LY6A 3ULUF 3LEYH 5IV2A 3W9DB 1IGCH 1BWMA 3D0VA 4Z7WA 1ZLWK 4GRWH 1MHEA 4NBYB 3CX5K 2NY2B 1MHPH 3MLSH 4IDJL 4OGAD 4K8RL 1PZUB 4EQ3A 4CVXA 3ARQA 3E6HA 4GKSA 4NPYA 3U36A 4Y16C 2OR8A 3NFNB 5I1AB 1F3DH 3IFPA 5IJVB 4RFNB 3LN4A 1MFAL 4LCUA 3UEZA 3CVHA 3L3OB 5JZ7D 3PWPD 1AKJD 2R2HA 5LKNA 3R0NA 4CVUA 1I7ZB 4MD4B 1FO0A 4PJ7F 2G75A 1A7QH 1RZJC 4RAHA 4ODWB 1FL6B 5DQ9A 3QNXA 4ZOEA 1Y6MR 4Y4FD 2NY7H 2ZSWB 4DOHB 3U46B 1N0LA 3QFDA 4UTAL 5E0QA 1A7OH 4PGZA 3RZCB 2VDKH 1M4KA 3A6OA 5I15L 1XR9A 4GRLB 3G6JE 3MJGX 4H20H 3CVIL 4EI5C 1KJ2L 2GJ6D 1H0DA 3MV9A 4XGZB 1QLFA 2Q87A 5CD5D 1OTUD 4ZYKA 1KN4H 5IVXB 1IGJB 4ELMB 5D71H 2EDWA 5LG1A 3TESA 2HLFD 1F02I 2UVEA 4XAKE 3S35L 1WISA 2ARJB 1FGNH 3F62A 3GIZH 3CFIC 2PF6A 5D6DA 4F58H 4P5TB 2PO6D 4KMLB 2D03L 4FQIH 3CDGA 3TZVA 4YWGH 1KV3A 3CFEA 2CMRH 4Z8FL 2C7UB 2K3TA 4J4PC 3TCLA 1RFDL 1J0ZA 4P3DA 5F7LB 1A1OB 1KTLB 2PN5A 3DBXA 3PNWB 1G9MH 3LEVL 1NH6A 3O9WA 4W6YB 3NH7H 4JY5H 3IGAA 2KZ1B 2EIZB 2AJVH 4DVRL 4OCWH 5DHYB 1OT2A 1KB5L 1AGBA 2UWEA 3ILQC 4PY7A 3QUYC 3WFHB 2I25N 1KUMA 2E7MA 3Q5OA 1GGBL 1J5OL 5DR5L 5GZNC 2IMMA 2YKLH 1G6RA 1I7UB 2E7HA 4UILL 1GZQA 2P7TB 5DVOA 1W72B 4EJ1C 4NRYB 4R7DB 4XX1E 1RURL 4HPOH 1CI5A 4LHQB 4OLVH 5TFSH 3X11B 1N5AA 1P7QB 2F53E 2GY5A 3MXWL 4WFHE 5GPRA 4WCYH 3IFNH 1A3RH 1PYWB 3BISA 3G5ZB 4FQXA 5JDSA 2BVOA 3RWDB 5AYUL 5IBUB 4OIAA 2GJZB 2B2XH 1XF3A 1D5ZB 5DO2C 5B38G 2E6QA 1OAUL 5AD0B 1BMGA 5KS9E 4DK6A 3DMMB 3MNZA 5HHVH 3V0VA 3T2NL 3RVXC 3LRHA 4XXDA 5IVZA 2Q7NA 2P5EB 4DGIH 4NNPL 3KG5A 4HUMB 4TUOA 3VA2C 43C9B 1KBGH 4U1GB 4XP4L 2VIRA 3MYJA 1BFVL 3V4UH 2E27H 1NCWH 1N0XH 1JV5A 3KYNA 5J3HC 5C2BH 2DQJL 3IDXH 4IS6A 3WEXB 3PIQA 3SEPA 4S2SA 4PV9B 2AEPL 4Z0XA 2CKBH 4CMHC 3CH1B 5I8KL 3C60B 4BKLA 2ZUSA 1MRCH 3NCJH 2VL4A 4HG4J 1MEXL 2X1PA 5SWSA 5TQ0L 5CIPH 1C08A 4E9LA 3UTTD 4JN1H 1J0YA 1MCIA 3KDMA 1UKTA 2PR4L 4N0YL 4JFPA 4NKDA 3Q3GA 1N64H 2X6MA 1FG2A 1I9EA 1E27B 4M7KL 5DUML 3F7QA 1YJDC 3B9KC 1BGXL 1QBLH 4R3SA 4G8IA 2VDQL 3AS0A 4TUKL 5I76A 4NQDD 1MQKH 3N1PC 4P2OC 2Y7QB 5MP6H 4HS8L 4PJDA 1EEYB 4Y5YB 2D4DA 4KUZH 1FRGH 4C56D 5IB4B 4N5EC 3STBA 1NC4B 1WWAX 5KSUB 1GGIL 1VEPA 5DFWH 2ADJA 2FD6H 3SKJL 1AGFA 4BK5A 1KFAL 3VWJD 1Q72L 4Y4KA 1A0QH 4XPHH 4OLXL 1YMME 4WO4C 1G9MC 2E7BA 1VFMA 3QXAB 4IOFC 1RD6A 2XKNB 1ZAGA 4HLJA 1HSBB 4YH6A 4EIZC 1FDLL 4CBPA 4BFBD 3E6FA 4LOUD 4U1MA 2VSCA 5E03A 5E6ZA 1U9KA 2A6DA 4OZIE 5CGYC 5J57B 1BHGA 1UCBL 1JPFB 1E0OB 1ZVHA 3FMGH 4HEME 5GS1B 4LFHG 2K1MA 5FOBA 1I8IB 3L6FA 5C3LD 4ZQKA 1CD1B 5CMAB 1NEZB 4JCMA 3NIDE 4YBQD 3MQIA 5FHAL 5I1GL 2AJZB 2BERA 4M6OL 3UPCA 1SEBA 2Z8WC 2F8OA 5CJXA 1O0VA 2N1KA 1EV2E 4ZS6C 1EK3A 1AP2B 3KPNA 1I9IH 1FFNB 4XVSL 1G7QB 2ADFH 5BV7H 2FJHB 3KPQA 1BJ8A 2ZOKA 5KSAC 5KVDH 4JDVA 1S9VA 2GAZA 2A9NL 3RNQA 2AQ3A 5I8OH 4L3ED 2QHLA 4F15C 2QQLH 2J4WL 2P47B 2VLRA 4Y2DD 1VGEL 4UTBL 1TTUA 3TYGH 3RWFB 1PKQE 4M8QA 2A6IB 4OZGB 2BSTB 3OQ3B 3TA3A 1Q0XL 1YEHL 5B8CA 4NFCA 1YPZF 5T1LB 4NM8H 4TN9A 4N0FB 4KZDH 3MOAL 4MSWA 2HA1A 4KZEL 4HKXA 2R0WH 3BHBA 3MV7B 4O2CB 3PHQB 5JUEH 1QA9A 1RMFL 2NQCA 2C4XA 1WVZA 2W07A 5F7FA 1F58H 3S88H 1S9WB 4I0PD 4OFYD 2CDEA 1S7VA 1T89C 2YD1A 1PFCA 4FP8L 5IW1A 3MRPB 5EFIB 5F7EL 1BF8A 1KCUH 1E6OL 1FV1B 2P45B 3PE9A 2NTFA 4K2UH 4P5MA 3SGJA 1N59A 1NPUA 2Y4SA 2DKUA 1QFOA 5DRWA 4PFEA 3VRLF 2X4OA 4WWID 3ZTJH 1X5HA 2YA1A 2RCSL 1AGDA 4QRQA 2J3SA 4LF3A 3BIKB 1YYLH 2BNRD 1CICA 2P8PB 2R1YB 4XAWH 3NA9H 5LCVH 3X12B 2FECL 4FQLL 4HIJB 2FHBA 4XTRC 1V7NH 4GRWE 4O4YL 4O02L 5ILTH 2Z0BA 1WV7T 3VFVB 4MNHB 1XGPA 2DQEL 1XGYH 1T2XA 1MY5A 4LMQE 4P5KA 4KWUA 5TE7L 1D5IH 5IEHB 3R8QA 5DRNA 3P9LA 5DJAA 1G9NH 5C0CE 5C9KA 3HC4H 1SMAA 5F6HI 3QDJE 2NY6C 5ENWB 4LSVH 5ADOH 2ERJC 5H35B 4NQED 1G0YR 3KXFE 3QUXB 4PJ7A 1F3RB 4JHBA 5JLZB 4F2MB 4KMTL 3TVMA 3SKUD 2X1WL 1WTGT 4U33A 2IAMB 2Q76B 4PJIB 1CYGA 3ZHLA 2YXMA 2XWBA 3VWKD 1KCSL 4V2BA 3IT8D 5IB5A 2NY5H 3KVQA 2QV2A 3O3AA 4S1RH 5IBTL 5ESAA 1AFVH 4JPIB 2EZ0D 4HWBA 3QHZH 1WBXB 1U3YA 2IG2H 5T5NF 3AVEA 4PJAF 4WU5B 4XPGH 5HVFB 4M43L 4ZAKB 1YEJH 3O0RH 3VD3A 2F5BH 3OKDA 4JY4A 1KT2B 1SYSA 3EYSH 4U1SB 3L3JA 3OX8A 5BV7C 3UDWC 8FABA 4JZOB 2OTUA 4CU6A 4YGVB 5I2IB 5HD8D 4PRHD 2VDPL 3NGBB 4JO2L 5C0GB 4NO0D 3LSOA 3D48R 3IU4L 4Z95L 3VJ6A 1B3JA 4YX2L 1I1YA 4GMSL 3RZWA 3QHFL 4NOBA 4X6DF 2Y36H 4QRTA 4U1LA 3UX9B 1F2QA 1IAMA 2UUDK 4UOJA 1JHLL 3T65A 2XRAL 1IGYB 5C09E 3ILPA 4PREB 1AO7E 1MAML 4KDTC 3TN0A 1BIIA 1NCDH 3PDOB 2VQUA 5HHNA 5D2LE 5EIIA 5SWQB 1I9JL 4I0KA 2WWKO 3HUJF 3T77B 4HXAL 4JO1L 3SBWC 5KTEL 3ARVA 1OAXL 4IDJH 5JOFB 1XGRA 4YHPB 3BAEL 3QZWA 4HG4K 4K8RH 3V0WH 1XGTA 2JLLA 4NYLB 3QXDA 5F1SA 2DMKA 1S7SB 5BMFL 1K8DB 1MFAH 4XCNB 1TPXC 2RJMA 2NLJA 4I4WB 5F96L 2X9XA 4Q9BA 5T5FL 4KH2A 5I1LB 1Z9MA 3C5ZA 3FOMA 1RUML 4LCCB 1NBZB 5D93B 5DJ6A 4LSSH 4C59B 1F6FB 3ARDC 4APQB 1S7TB 2MJWA 1Y18A 3D0LA 2NNAB 2P8MB 3QQ4B 4IIQC 4UTAH 1ND0A 2NY2C 3MRIA 1J0IA 4G7YH 4YNYA 3U30B 4MJ5B 3BZ4B 5KSBB 5INCB 1TVBB 3RKDC 3RI5F 4XB7A 35C8H 4YPJA 1G9NC 3FT3B 5DD0H 5D9SA 5TF1L 3DSNA 6FABL 4KROB 4C83A 2ZG3A 1J0JA 1TIUA 3B9AA 3VGDA 3IKCA 4OZFA 3AU1B 3R0MA 3T0VA 1KC5L 3WN5A 4AQ1B 4DEPC 1LP9B 4OTXH 4PRDB 2VABB 1DBAL 3ARBB 1ORSA 4Z8FH 4GKOA 4W70A 2EH7H 2YD6A 3VRIA 1UWGL 2E5EA 1RFDH 1RIVL 4V2CB 1ED3B 1MJUL 3HZYA 5GGQL 5J6HA 3HZMA 3MRJA 3V4VL 1AR2A 2R1XA 3ZKSD 2ITCA 2NY5C 3VXMB 1U8KB 2R9HD 3LEVH 1X4XA 1L9NA 1T7VA 2P49B 1OLLA 2GK2A 1ZTXL 3BP4A 1OWRM 4HF5L 3QH3A 5TH2B 4YLQT 1A64A 1A47A 4DVRH 1KB5H 3WIIL 4PRIA 4G43B 3GSNB 4LIQL 4PUBH 3NIFF 4OFYA 1GGBH 1J5OH 1BQLL 2HTLD 3RU8H 2HLAA 5GGSB 1CR9H 2GITA 5C0AE 1JGVH 4O2EB 3QFJA 2NW2B 3C5SB 4PG2C 2A6KA 1IQDA 1RURH 1IKNC 2R8SL 4YFDB 2JE8A 4PJ8D 5DMKA 1A4JA 1INQA 4JJ5A 4G9FB 3MXWH 3FTGA 1UH4A 2Y06H 2R23A 3I50L 4XI5C 2YUZA 5GS3A 1IM9A 4MA3A 4FQ1L 1N26A 3K46A 3BQUB 4XCFL 2BRRL 3I84A 4L8SB 4M00A 1S5IH 2IEPA 5DQJB 4OGZA 1E4XI 3T2NH 4R0LC 5E9DB 3EYQC 2X4PA 1SBBA 2JCCF 3I6KB 4JG0L 4NNPH 3ZKND 1X5FA 1ADQH 4KKAC 3ES6A 4XP4H 1BFVH 5A2IH 1MCPL 2V9QA 2YR3A 2DRUA 4NT6A 3WHXB 3D3VD 3NOIA 5AWNL 4ODVL 5B3JE 4NQEA 2AEPH 3GSQA 1RJLA 3GKWL 2BNQB 1MEXH 5TQ0H 1WCQA 2VYRE 3QA3A 2XY2A 4W6WB 3I3EA 2DQFA 3MUGA 4L3CB 2PR4H 5C7XH 3KAAA 1FL3A 4E41B 1KB9J 5IFHL 3R8BB 4N0YH 2VXVL 2HAZA 3DMMC 3AXLB 3KS0J 4M6ML 4JFDA 5DI8B 5FA4A 4M5YL 4M7KH 3CCHA 3QNZB 5H2BB 5EC1B 3HPJA 4LARH 4U1GC 1YPZA 1TZGL 4H0HB 3BO8A 4MAYA 4TUKH 2ZUWA 2NZIA 3C9NA 4S0TD 5DC0A 4HS8H 5EIVA 1N6UA 1NGPL 2HG5B 4LEOB 3S36L 3D69B 2YUXA 4K7FB 3SDYL 3N1GC 1MCLA 3FFDA 3OMZA 4L8DA 1U8QB 4MNQB 2WUCH 3O8XA 5ISZD 4NQCE 1GGIH 3CH8A 2WBJB 5LGKA 4IRSA 2B0SH 2VKXA 4FQQB 2EKSB 2OL3B 1U8IB 4PRHA 3U48A 4X7TB 3SKJH 2B7DT 2R2EA 5I1CL 1KFAH 1CXKA 1Q72H 5HGHB 1C7SA 1AXSB 4OLXH 4KJWC 5FYJD 5H37H 2FO4B 3RVTD 3G5VB 4U31A 2BRQA 3TBTA 5HY9B 2OK0L 2AJ3B 1T0NB 4U1KB 5I18L 3SGKA 4MWFA 5T1MA 2F5AL 2XZAH 1FDLH 1PG7L 1SEQL 1NCTA 2CO6B 4LPXA 3L3IA 4MXWH 1VB9A 1K2DB 3WNNA 4AENA 4G8GA 4D9RD 3VFOB 1QSFB 1UCBH 4YGAB 1QRNA 2BSRB 2DBJA 3PV6A 4MJ6A 4Q9QL 1MJJB 5IM7B 1BLNA 1X44A 2EICA 3CPLA 4JRYD 4IRJA 1M6OB 3J8F7 2Z92A 3V5KA 3OXRB 3WV0A 4HAFA 2V7NA 3S6CA 5EOCH 1A21A 3KR3L 5FHAH 4ZTOL 2HJLB 1OP5K 2BVYA 3KLHC 4N9GA 4PLOB 3QAZC 5CKAA 2VXTL 3SDCD 1NFDA 4ZNEA 2YD5A 3B9EA 1D5XB 3BGFB 5BZDA 1WCBA 1CFSB 1Q9KB 3PHOB 3WDIA 3MGOA 3KWWB 5EU6B 4WUUD 2A9NH 4ZD3L 5LXGH 2AXGB 2KPNA 1GSMA 4JM2B 1KPRB 2J4WH 4M1CC 4G6KL 5E6IB 3N06B 1XF5B 1A1MB 5IHZA 4HDIB 1A6UL 3QEGL 1QNZL 4HBCL 1YEHH 5DMJB 3DXAD 1HHIA 1MCNA 2H32A 3AAZA 4ELME 1MHHB 1U92A 2X4QA 4LVOC 3ZE2E 5JW5A 5D1XB 4AQOA 3RNKB 3MOAH 4P3WA 4LAQL 3GHEL 4KZEH 3MLVL 3EJYC 4X8JB 4PJAA 1UVQA 1LO5A 4QOKA 2YK1L 5E8OA 3SO5A 5GRVK 4MD5A 2FYYA 3QJFB 4DTGL 1TENA 4PJGF 2DYPA 1Q9LB 3S5LA 1EEUA 4GBXA 1HHHB 3UYPA 4FP8H 3CVHL 4LDLB 5F7EH 1E6OH 3WE6B 1C12A 1ZHLA 4RAVB 4HS3A 5ERWA 1FO0L 5GXBB 3LD8C 3QR2A 4X6DA 2EYTB 4HXBH 4DW2L 1U93A 2ICWA 4ONHB 1SY6H 3UBXA 1SJHB 5FYLL 1I4FA 2DWDA 1LQSR 1BJ1J 1UB5A 4FQLH 4U05A 5EPMA 4KKLD 3BUYB 4FTVB 3HUJA 4O4YH 4OGXL 5TDPA 4ZNCD 5KSVB 4O02H 3F7YA 3ARFA 4NN6B 5F1OB 2BX5A 3OHXB 1GCFA 4ZMAT 4GXUN 5KJRH 1D6EB 3LQAC 3EYUH 2X10A 1U8OB 1ZKAA 1AR1D 5TE7H 1I8MA 1ZVSA 2GFBB 4MDIB 4WV1B 3IDGB 2BSED 4JN2A 4HFUL 4ZO7A 4BH8B 4UINH 2X7LB 1AIFB 3EDEA 1NCCL 5MENE 4HK3J 2VLMD 2OJEA 3MBEB 4OI7A 1WSST 2DWEB 5HVGB 3BD5A 5D1QD 3RRQA 2DMBA 2WQ8A 3CFKB 4L8CB 5D7LE 1O7VA 3VI3F 5FECB 2Q7YA 4GFTB 1KCSH 3QDMB 4X99A 2R2BA 5DMGD 4XB8A 3OJDB 2D9QB 5IBTH 1A6TB 3VXSB 3O45B 5KOMC 3D3VA 2G60L 4QHNB 1AHWA 2FHCA 2CUHA 1XIWD 1YZZA 1CQKA 5F1KC 3IAGC 5JMRA 2ESVA 5ESVA 4YQXL 2H45A 2W65A 1FYTE 1G6RL 4G6AC 3QUXC 4M43H 4UDTB 4Z5RB 1MCDA 4GW4A 4Y0GA 3NBNA 3IVKB 1HKFA 4I48A 2X41A 2IAMC 4FXGA 2VDPH 1U3ZA 5EZJA 1EO5A 1G7PA 3IU4H 4Z95H 1JZ3A 5CSZA 4YX2H 4GMSH 2VITA 3SKOB 3QHFH 2MNUA 1BOGA 4LGPB 1M7DB 3QCVH 4JHWH 4X6BA 3L3DA 4XCCL 5JNYB 3KPRD 1JHLH 1HNFA 1JPSH 2XRAH 1RZ8B 4P59L 3BRDA 4WHTB 1MAMH 2X1QA 3ZYJA 5ICXA 1REIA 1IBGL 3U9PL 5IP4A 4K9EL 1I9JH 2Y07L 4NQXA 5E8PA 1CF8L 3EOBB 1N4XL 4HXAH 4JO1H 3V6ZA 4ZAKC 1OAXH 5EB9A 3UJIH 4BELD 2Z35B 3QIBD 2CJUH 5JW3L 1MCRA 1S8DA 1MHCA 2CRYA 2EDHA 4K94L 3DYOA 4JFHD 4RMUA 3VG0L 1ZT4B 1MRDL 3HA0A 5BMFH 4P4KC 1KB9K 2VAAB 5C08A 1KIPA 4X4XB 4BA8A 5F88A 2AK4B 2EKJA 3VFNA 4L8BB 4YPGB 5IMOB 5CJ5A 3LVEA 3P0VH 5F96H 5T5FH 3BDBA 4ACPA 3M17B 3I6LD 3F8UB 4Z7UB 1Z3GL 5F71A 1ZHBB 2PYEB 3MRDA 1ZWIB 1WLHA 1SVCP 4XC3L 1G7HA 3O3BA 1R5WB 2XY1A 3HC3L 2JCCA 3D39E 3ZYZA 1KEML 1I1FB 3BE1L 5JORB 3VFGL 2YMXL 5MEQA 1ETZB 4ETQB 2J88L 3RTQD 4BQ6A 4HUXB 3UAJC 5JA8B 5C92A 1CS6A 3HS0A 1LD9B 1WT5A 3WIFB 4HUVA 4RMVA 3U2SB 6FABH 1EO8L 1MCBA 1WBYB 1RIHL 2GSGA 5DUBA 3TPUB 3ARPA 3BGMB 1I1AD 1KC5H 1OP9A 4LCCC 4ZFZA 2HWZL 1S5HB 1X5YA 2YUVA 1HXMA 2X4UA 4OLYL 1DBAH 4APQC 3MRKA 2O5XL 2NY0B 4WUUA 1MCKA 3ALPA 1UWGH 1S7QA 5IMLB 1EUTA 5FUOL 4UDUA 1UCTA 3MOBL 2XTJB 4R2GB 4PJ5D 5DJ8A 2RFXA 3NABL 1B6DA 4Q74A 4WEBL 2UZXB 2ZCHH 4PLJD 4MQSB 4YR6B 4CN4A 3QG7H 4K3GA 4XHJD 1ZTXH 4OKDA 2YHGA 4HF5H 4M61A 1DQJB 4G80A 5C0DA 1F4YL 1EA9C 3MV7E 4NFBA 3WIIH 1VFBB 6CGTA 1A7BA 4QRRA 3HLAB 4LIQH 3IU3B 4NP4L 4X5LA 2LV4A 3KLAB 1BQLH 1X5AA 1U6AL 3GMRA 2AABH 3SCMB 3H7LA 1GJIA 2X70B 4ZFGL 5LAXB 3UTZA 3FN3A 3IDIB 3GSWA 1A3LL 1CN4A 1RZGB 1U3HB 3HE7D 2VDLL 4ZSOB 3VFPB 2R8SH 4ZFOA 3PWNB 5D4QA 4MXQC 3FB6A 1QBMH 5CZXC 2A2QT 2N56A 2VOTA 1RZ7L 3W9EB 2EXWC 3BT2H 1NUGA 1JF1A 1BZ9B 2A74B 4MMZC 5DA0B 1UJ3B 3WJLC 3JV6B 4RNRB 4KRMB 4LP4A 2VDNL 3B5TA 3UJJL 3OB8A 3THMH 4Z7NE 4M8VA 4XCFH 2BRRH 1FL5B 4K23L 5E2UL 2Z8RA 5DD3L 1JP5A 4MHHG 4XRCA 4IDLA 4JG0H 2O61A 4OIBA 4R96B 1MCPH 1I8LA 4P9ML 4XVTH 3VXUE 2VH5L 5IG7A 2RR3A 3U7WL 1A2YA 1FFQA 4D0CA 2YBRB 4FXLA 3EGSA 5C0RL 4WI8A 1PLGL 2WIIA 2HVJB 3GKWH 1CGUA 1G7IA 4KKBC 4PJEB 4PJFB 5DUPH 1FH5H 4DFHA 1CTNA 2Z93A 5INDA 5K9OB 4KJQC 5K9QI 1SYVA 3DX6A 4PJIE 3FRUB 5C6TH 1KEGL 1XCQA 1HNGA 3BQUC 4NZTL 4TYUA 4BQ9A 4TVPD 2VLKE 2VXVH 2ARWA 5GGRB 1BIHA 2Z9TA 3ULUL 2CRIA 4M5YH 4PGCB 4YO0B 4ODXA 4PRNB 2HMIC 1Q94A 4DFIA 4O2FB 3SQOH 3B43A 4YFLI 2XNAA 1TZGH 5FV2A 4I18B 1XIWA 1U95A 4RX4D 3OF6A 3DVNB 5EIQA 1F4XH 3VU2A 1VA9A 4OI8A 1NGPH 3H9SD 4S1QH 2EDRA 3QDGD 4LP5A 4LSUH 4QXTA 3S36H 5A2LH 4RMRA 3SDYH 4HT1L 2JK5A 5BZWA 3RUGB 1AD0A 4PJGA 2PYFB 2JB6A 4QNPE 4L9LA 4B41A 3PWPB 2J8UE 1AKJB 1OF2A 3SDDA 3RIAK 3MYZA 1QSED 3G5YB 4RRPG 1R0AL 1KOAA 4FG6C 1BPVA 5K9JL 4NM4H 4P46A 3RJDA 4RAUA 3GGWB 3EIFA 4EDWH 2CDGA 4J6RL 4Y4FB 3KPRA 5E2TL 3S96B 2VN7A 2OK0H 4JLRB 4GXVL 1S9VB 4JFFB 2GAZB 5HHPB 1TJHH 2F5AH 4XPAL 1LO4L 1PG7H 3OJVC 5HI3D 4ZUUB 5T3ZE 4NO5A 4PYGA 4HWNA 3EJZC 1EBPA 1F13A 5GS2D 1OAZL 1IC5L 1DEEA 4LRIC 2GJ6B 1R5IB 4X0KA 3N50A 2WWKT 1FFOB 4F3FB 4ORZC 3KHOA 2EXYD 2LAGB 4K7PY 3G6AB 1U8HA 2WBJC 4BZ1L 3HI1B 3ESUF 5GSRA 5IFJA 3D2UA 4GRMB 3QEQE 4X7SH 3VXTA 4KI5F 3KR3H 3VFTA 2PO6B 3FN0L 4LASL 4CUCA 1QPPA 2VXTH 2Q3AA 3OGCA 2R0KL 3G6DL 4PTTB 3F58H 3CNKA 3OJMB 3FL7A 1F3DJ 3UYRH 1JRHL 5ICZB 5CEZL 3UC0L 5DVKA 3W11C 2MQ3A 1P6AB 5CINL 3HG1D 4ZD3H 5AZEL 1T1XA 4XMPL 1KYOJ 1DLHB 2YPKB 4G6KH 5KSBE 1R3KA 3PP3H 4GXUM 5TE4L 2QLVB 4OSUL 5IB2A 1QNZH 3RTQA 4HBCH 4OFDA 4CMMA 1N5YL 2WLYA 2WWMD 5KW9L 3IJHB 3DX8A 5FA3A 3U6RB 5FYKU 3KPLA 3RDTA 1D5BB 3SPVA 3TT3H 5F3BA 5CWSA 4LAQH 5EZIL 4RISL 3MLVH 5GJSL 5IW6A 2D4FA 3P4LA 3OR6A 1LP9E 4GLRI 1R24B 1RUQL 3BGFC 3MRHA 1UC6A 4DTGH 3T2PA 2BOCA 5CCKL 2B4CL 4UBDD 2V2TA 4HK0B 3CVHH 4YDJA 3KYKL 4KK6C 4R26L 3T0ED 4DVBB 3T1FA 4QHMA 1A7PL 1HN1A 4JM2C 3ZE0E 4PJ5A 4RQQA 3RVUC 5JW4N 3FB7B 1L7TL 3O2DA 1JK8B 4JQVA 3DVIA 4N0UB 5FYLH 3WYRA 1RULL 1ZT7A 2BY0A 4Y5XB 1IM3A 3I6GA 1DLFL 4UQ2B 2O26U 4ZO9A 4J2XA 3BKJH 5D1XC 5HHOE 2CGRH 4UAOB 4QHKI 5HGAA 1ERNA 4GAGL 4OGXH 5BXFA 4N0RA 4S1DD 1HH9B 3F5WB 2VLJE 3FFCE 4NKOA 2XA8L 1IAOB 1IL1A 2CSPA 4EI6A 5L8JB 2BVPA 5EH1A 5BS0B 1IC7L 1WITA 3P77B 4K7PL 2P8LB 4JO3L 5HHXL 1LEIA 2BOBA 5M94B 1RPQA 4KI5D 3WDJA 4HFUH 3UTTB 2P5WA 5HBBA 1JHTB 2JB5L 4TPRL 3K4ZA 5D1ZD 3FB5A 1AGEA 1NLDL 2EDFA 3KPMB 4XHQA 5FM5M 5T1DL 1NBVL 1QR1A 5FFLA 5D7JC 3ALXA 5DS8B 4MQXD 4A6YB 5E4EB 4Z6AT 4NN7B 4TUJB 1MNUH 2ZOLB 1UZ6F 4NN6C 4NQDB 1N2RB 1OGAB 2APFA 3S97C 5ETUA 3TO4D 1HHKA 1RJYB 3QXWA 2CLVB 4C56B 2XN9E 1N3NA 2ICEB 4LLWA 5D6CA 5DJ2A 5IROC 4LLDB 3TT1L 1M05B 3QP3A 4I9WD 4M5ZL 3QUZA 1OTSC 5ITFB 2IC2A 3DI3B 3L3HA 4YQXH 5K93A 1G6RH 3VWJB 3BH8B 2OXGA 4U6HB 2VZ3A 1TJGL 3WDHA 4HV8A 3MBEC 1TQCB 1OSZA 3MLUL 5EUOF 1K8IB 4BZYA 4JCLA 4BSWA 4QRUB 3UZVB 4EI5A 4HMDA 3HZKB 3WLWC 1WK0A 2VC2L 5L2KD 4XCCH 5BCAA 5IJKC 2CH8A 2LABA 1V3MA 3SY0A 5D5MF 4I8DA 4P59H 1MFCL 4KVCH 3MRQB 1RK1A 1VGKA 4NKIL 4PJCB 4CRPA