2V6HA

Crystal structure of the c1 domain of cardiac myosin binding protein-c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
DDPIGLFVMRPQDGEVTVGGSITFSARVAGKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords MYOSIN-BINDING PROTEIN C, CARDIAC-TYPE
publication title Crystal structure of the C1 domain of cardiac myosin binding protein-C: implications for hypertrophic cardiomyopathy.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v6hA00
1N4XH 4OLXH 1LMKA 5C0JB 4QYOB 3TCLB 2XQYK 4YDJB 5A3IC 3RWEB 1KEGL 4JDZA 3SE3A 3GSXA 4PRIA 2GTWB 4YX2H 5I2IB 3RGVD 1KB9K 1BX2B 4GH7B 1J05A 2OL3A 2YK1H 4ZFOB 4F7PB 1A1MB 2CGRL 1MFBH 2EYRA 2JIXD 2XN9B 1S8DA 1JZ8A 3NIGE 1MQKH 5FECA 4U1MA 1WSST 3C08L 4N5UA 3ARSA 4AEIH 2AW2A 5C3TA 3ARFC 4DAGH 1MCPL 2OJZL 3Q6FA 1ADQA 2Z91B 3VJ6A 2JJSA 2Y25A 4OZIA 2AJUL 3C6SA 3OZ9H 1CE6A 3GSVB 2AK4B 5TE4L 4NO3A 4YHLL 4JPIB 4I0PC 3K8LA 1I1YA 1QFWI 3KYMB 1GAFL 1YNKH 4J8RA 1MF2L 4PY7B 4X6EA 1CXFA 4JN1L 4OUOA 2J8UE 3QQ4A 2OI9C 5LXGH 1CN4A 3UTPE 1B3JA 1TJGH 2BY3A 3K7UA 4H26B 1ZLUK 4OLWH 4N0UB 2PUQT 4XWOC 3RDTC 3BYYA 5CLWA 2HG5B 2W0FB 3LS4L 4KJPD 3V0AC 4P48A 5EO1B 1OVZA 4OV5A 1BZ9B 1WK0A 1P5VA 4TSAH 3LDBC 2Z31D 2BFVH 3VD3A 1DQDL 4L3AA 3FOMA 2CLZB 1A7PL 4WW2F 3HC4H 5AAWA 1EMTH 4O5LL 2YN3A 3UZQA 5EO9B 2IFFH 3PDDA 5D7JB 2HMIC 4J4PC 2X4SB 2BY1A 4LMQE 1JNLH 2XTJB 4QF1A 3KYOB 5B39A 3VXTB 3FAXA 4AT6B 4QWWC 1MCOH 4LKXB 5IEKB 4XP5L 3T3MF 4B7IA 5I1LA 1RZ7H 4ZO9A 3LVEA 5DYOA 4P9HL 1F02I 2KUTA 2FNBA 3B43A 3MRFA 3RWCA 3MUY1 4NWUH 3SKMB 3PV6A 3FOLB 5EU6D 4AJ0A 4H88H 3KPQA 2HLAA 3NABL 4XP1L 3U46B 2EYTB 1P7HL 3ABZA 2W0PA 1GC1H 1OP3K 3MLTB 4YHNB 4HF5L 3ARGD 1M7IA 5C0RH 2FL5A 2R29H 3D9AL 3QDJD 4XBGA 1VFBA 3RWDB 2DBLL 4PJ9B 4QTIL 4R4NC 2MJWA 5IUSA 2D3VA 1LP9B 2IQ9H 4L9DA 5TH2A 3WMSA 4JZOB 2YUVA 2FJGA 2NY3B 1MHHA 4N1HB 4BZ1H 2PNDA 2HT2C 2VDLH 4PREA 5F96H 1P4LA 3N1MC 4Y4FC 2DQUL 1CFVL 4OV6F 4DN4L 5BW7A 1NPUA 4U1GC 5FA3A 1NFDA 4QHMA 3QEGH 3V7MA 1A14H 3DGCR 1QLRA 1RI8A 1I7TA 1RD6A 3R06B 4Z95L 3RWJB 5M7QA 3IDJB 2EDQA 1MRFL 3BXNA 2AVGA 5EOQL 4YXLH 3UJTH 1D5MB 5D1ZC 3PHOA 2V17L 1F3JB 3BD4A 1T22B 2SEBA 4YZFF 4EOWH 1R3IH 5BJTB 4G7YH 2NYYC 4PP1D 5IOPA 4QKXB 2X1WL 1J1XH 1F6AB 4ZUUA 1VFOA 1MFCL 1X44A 3HI5H 4JFOA 4Q97A 2FIKB 5DD0H 3AMLA 4JG0L 1J8HA 5C0CE 1RZKH 4NM8H 5IW1B 4WRLA 4FQHB 1JTTA 3L3HA 4NO0B 3ARWA 2VSDA 2H26A 1UH4A 3MR9B 2DTMH 3D87B 1TZIA 2VN4A 3U7AA 3LV3B 3OGCB 3K74B 2JB5H 1DCLA 4YZFE 4DVBA 5JLZA 3DTXB 2G60L 3OKKB 1QO3B 4K94C 3STZA 1D6VH 2WWMC 5D7LA 3LRSB 3PF2A 1YUHB 1EDQA 3GEWB 4NNYB 4NJ9L 3VXRB 3CFCH 3KPRA 3EYSL 1JZ4A 3L3KB 1NEZG 1JBJA 4R8WL 4HCRH 2YWYA 5D5MB 5CD3B 2H2SD 1I3GH 2QSCL 5E8PB 4RIRA 5IQ7L 2BVQB 1QRNB 4XC3H 1G6RH 3QWOB 2F8XC 1FPTH 3B9KA 1T1XB 4PJFB 3C5ZC 4OAWA 3WIHA 1X5ZA 5CMAB 2DL2A 3ARDC 1CTNA 5I1AB 3D2UD 1J18A 2F5BL 4M5ZL 3TYFA 1KCRH 2YD7A 3WFHB 1CFTA 3OF6A 4FQCH 4X8JA 1XZ0A 3SEPA 3SPVA 4DGYH 1NGWB 3H2WA 5LCVH 4DW2L 4TVPL 5ACMA 1CGSL 3RY4A 2IPUG 4GW4A 5ETUA 3RY6A 1U8LA 5BVJB 4KI1A 1CR9L 2BRQA 4B7LA 3B2VL 1YECL 1CXKA 2BHZA 3EGSA 2NY4C 3HUJB 5AG8A 5FYLL 5IFHH 1R3HA 3TA3A 1IGYA 5JIIA 3D0VA 3P30L 1XR8B 4JZJA 3SJVD 4L8DB 2BOBB 3BGFC 4L3EB 1AGDA 1KGCD 2I9TB 4ZUTA 3CXHK 2VDMH 3L9RA 4XNQA 1OOAA 3LAFA 3WE6A 3U9PL 3GSWB 3PWJA 3JTTA 3LCYA 1KNOA 2XIDA 5MP6H 5JNYA 4ZOBA 5A1AA 4AL8H 1T0NB 2IGFL 1FL3A 4FTVA 5C0ND 1TJHL 5CBAA 4M1GL 3CC5B 3QIUC 2Q8BH 2VXSL 3MBEC 3CXDH 5BMFL 3HFMH 4JR9H 2FJFB 2VLJB 2A6IB 3WIIL 5HHPB 5D2NA 43CAA 5IMOA 4D3CL 5CSBA 1UYWH 4ORZC 5EFIB 3DIFB 2VUOA 1CL7I 3GSRB 5I15L 1XMWA 1RUML 1BJ1J 4DJMA 1BZ7A 1OW0C 1U8IB 3BISA 3HI6H 3JWDL 2BVUA 4KTEL 2HJFB 4O00A 4P4KD 3CFBB 4L1HA 1OAXL 5EUKB 3H9SE 4LDEB 3UPRA 3BJ91 3B9DA 5EOTB 1YN6A 5L7XL 5JZ7D 4Z77B 1YEHH 4E0RB 4LCYB 4WGVB 2LAAA 1G9MH 3MLWH 3MRKB 3LIZH 2YD5A 2PYEB 3GSQB 3A0OA 2FLBT 2ZUSA 4Y19A 2CPCA 5F7DA 1I8IB 3VW3H 1FSKC 1NFDE 1UENA 1BFSA 4XWGH 4DUXA 4IRSB 2J6EH 3IAGC 2Z8SA 4WUUD 1H3TA 4X7CC 1FL5A 3E2HB 5TQ2L 1S5IL 3OBAA 4FZEL 4PRAA 4N8CH 1NGQL 5DJ0A 2XWBA 1T1YA 4G8GD 3O2VL 1P4IL 2P42B 2AABH 5JUEH 1DDHA 1T1ZB 4LIQL 4KDVA 4UBDC 4QCIA 1EGJA 4WV1C 3HE7A 5D71L 4HUUB 1LE5A 4FQQA 4C56B 1I8MA 4XZUA 4X6DB 1J8HE 2YXFA 1F3DJ 3A67H 4P3DA 5A16A 7CGTA 4LBEB 5TQ0H 2DM4A 4OT1H 4EN3A 2HJKB 5D7KE 4X5WB 2AS5M 1NAMA 3KPPA 4ZXBD 3B6SB 3KDMA 3QCTL 2XZQL 1TQCB 4CADB 5DHVB 1D3CA 1LO4H 4WWKB 5JW3H 1DBKL 3P11L 2M2DA 5FGBA 4MGXA 5C2BH 2Q6WB 4OQTA 4DZ8A 1AJ7H 1DEDA 1IBGL 2I24N 2NY6D 5D7LE 3MRDA 5B21A 4M4RA 3MJ9A 4O4YH 2NR6D 5DJXA 4L1DA 1WT5A 5E9DA 1H8OA 1S7SB 1Z2KA 2JJTA 1DLHB 1NBVH 1U8KA 2G5BA 3KPRE 3MCLL 1E6JH 4KY1H 3PHQB 1AHWC 1WBZB 1LO3H 1YZZA 1F4XL 2R8SH 4PJ7A 4Z7VF 1AXSB 3LZFL 3UJJH 1U3HA 5EDXA 3NAAL 3SO3C 3FFCD 1NUGA 1B2WH 3MRIA 4NO5A 2HH0L 1JV5B 2AV7A 1KV3A 2IPTL 3PL6D 4GAGL 3HNTH 4OB5H 1IGIH 4UINH 5HHNA 1J0JA 1IAKB 4G6AC 1HSAB 4HJ0D 5CJXC 4UNVA 2FEDC 5IW6B 4XP4H 3N1FC 5L2KB 2AXGB 1QFUL 5E99H 4LRIA 4NC0B 3TT1L 5KSVB 3QP3A 1ED3B 1T7WA 4ERSH 2J12B 5DXWA 5IMLA 5E70A 3UO1L 5MEND 3RI5F 1J0ZA 5I1JH 1UJTA 1FFQA 4OI9A 4K3EL 5DQDH 4EJ1C 5CP7B 1G7LB 1Z9SA 2BZDA 4U31A 3MLSH 5F7KC 2YBRA 5GRZA 1OAKH 1ZANL 4BK5A 5I76A 1MHCB 1U42A 4KK5D 4NQVA 4ZNCD 3VFOB 3O8XB 1JTPA 1P7KB 3LKRB 2AEQH 4PJAF 1KG0B 4JGJA 4Q6IA 3RHWF 4EI5B 3MRCA 4JQVA 2OMBA 4LVOB 1HEZB 4WI2A 5KBNC 4YHPB 2FGWH 8CGTA 3FRPG 3LRHA 1U91B 4C58B 4ZTOL 1B0WA 5ABDE 3IDNB 5BV7H 4P46B 4FQLH 3SDCB 1OP9A 5GSRA 3SDDA 1TJIL 3NIFE 4XH2B 3WO4C 4M1CC 4XMKL 3RBGA 1T89C 1KBGL 3HCVB 5SWQA 5HDQH 1S9VB 3CH8A 4Q9RH 3AXLA 2AGJH 3CIQA 4RGMB 1A64A 1ZT4A 4FTVE 4U33A 5DT1L 2CR6A 4MVBD 1FC1A 4MNHB 1Q94B 1OP5H 4U6XB 1MAJA 5D2NE 4N8VG 3QIWB 3O6FC 4JGMA 5F9OH 3CDCA 1NCUA 4U1JB 5H35B 5I8EA 3SCMD 4K7FA 2ZCLL 2COQA 3LPGA 2CUHA 4XI5D 5DHYB 4J12A 3BO8A 1AI1L 4JRXB 5ELIA 4ELMF 5KJRL 1RIUL 1KCUL 2OR7A 1NGZB 1AQKH 1C08B 3MGTB 5ESVA 1FBIL 1UM6L 4JQIL 2QQKH 4F8TA 2VXQH 4Y4HA 3OXSB 1N6UA 5FYKH 4KRPB 3MO1A 3L3OA 5IBLC 2EDOA 4GG8A 3HLAB 3OL2A 3WO3B 3FQWA 3OSKA 1N4XL 2NLJB 4I3RH 4PFEA 5EC2A 3RGHA 4M8QA 2HN7B 4UNTA 4Y19E 5KS9F 4KFZC 1KB5L 1U9KA 3DUSB 4X99B 2G2RB 4OGYL 2FO4B 4HDIB 3U1SH 3MZTA 3WLWD 5JW5A 4ZAKD 1FGVH 2GJZB 5HYJD 2YK1L 2GK0B 4H8WC 5CSZA 5C8JB 1MFBL 3H42H 1MQKL 4E42A 2IJ0C 3S4SB 1ND0A 1W72H 2X9YA 1OARL 3HTLX 4AEIL 4CUCA 5FO7A 2DAVA 5DD1H 1S78C 5EIQA 4WW2C 5DSCB 1JGVL 1CXLA 1JWUB 4LLAA 3OZ9L 3EFFB 3ELAT 5DFVD 3QUYC 3VD9A 3QIBC 4AIOA 5ID1A 4R96A 3GO1H 3VFUA 1GOHA 1DFBH 1IKNA 1MCSA 3HNVH 2WIIB 5F3HB 2N7BA 5DVKA 4FP8H 4K23H 3GMNB 4P2OB 2BVTA 4LP4A 4FXLA 4LVHC 5FA4B 3J7HA 5MEPA 1A7QH 3VGGA 3N1PC 2C4FU 3NFNB 4FQXB 4PGCA 1XGRA 4OLWL 3JWNC 3RA7H 2YRLA 1RUAH 5E9DE 2QR0B 3O9WA 3PQYB 3NH7L 4WFFE 4C59B 3TIDA 1PEZA 1JWMA 1N5AA 1X6LA 5C0BD 2ADIB 3QI9A 3D39B 5DK2B 1KJ2H 4PJ7E 2XN9D 3I85A 5CP3H 1EMTL 4WFEE 4IHOB 2PN5A 1I8KB 4YHZH 4GKSB 1JNHA 3REVB 4DOHB 5MEQB 1K8DA 3NCYS 3CAFA 2C4XA 4EQ2A 4L29A 1RZ7L 3W5MA 5D9SB 4YHMH 4UI2A 1KIPA 4LRNL 4OLVH 2AK4D 5C2UB 5KSBB 2BNRB 1SBBA 3B9EA 4PG2A 4M6AA 3FO0H 1G7JB 1PEWA 1AGCA 2D9QB 3V0WH 1Z3GH 1I4FA 3ULUE 3C09B 2ZOLB 4OCXH 3S7GA 4RGOL 1LD9B 3ULVF 1W8OA 1QBMH 1GC1L 1NMCC 3SE3C 5LKNA 4XBPB 3CVIH 4HJGA 4JREC 4PRHA 2R29L 5JHLH 1DTUA 5HI5D 3QQNA 4IRJB 3T2NH 1MLBA 2DKMA 5BS0A 4PD4K 5SX5H 3MV9A 2E7MA 3CLFL 2VDLL 4KK8D 4TNWK 5F96L 4M03A 9CGTA 1X5YA 4WNQB 4DWHA 4KMLB 1KTLB 2A77H 2APTA 2JJSC 4NRXB 2D7NA 1NLBH 3MACL 5K9QG 3DPBA 3UTTB 2EO1A 2R9HD 3QEGL 3C2AL 1I1AD 1A14L 5JOPE 3B3IA 1Q9LB 1YY9D 3NCJH 5HGHA 1NMBH 1Z5LB 5D7JD 4UOW1 3IS1X 1NUFA 2XTJD 3QO1B 3UJTL 4JRYB 1NEZB 5DJCA 1HHGB 2OZ4H 4CVWA 2B1HL 1H5BA 3AROA 5ALBH 4K94H 4NRYA 1NUNB 2AJ3B 2NY0B 5TDPA 5K9KA 2Y72A 5FYJH 4OQ1A 3SGEI 5AYQA 4K8RD 1D9KA 3CK0H 1PJ9A 4U0RB 1NCBL 3F6LA 3EJZC 4NM8L 2UV3A 3P73A 2PW2A 4PG9A 4XCFH 3DVNA 1CYGA 1EVTC 2ZJSH 2NTSP 5LWYH 4GKZB 1I7ZA 1UH3A 4JFPB 4U1LA 2I27N 3KHOA 4PJ9D 4HWNA 3ZLQC 3ARFB 3HZYB 3OKOA 4MLSA 2NY3D 4Z7OE 5CINH 4FFYL 3X11A 1WCBB 2VDKH 1CGTA 3F65A 1HHJA 3EFDH 3QXAB 1QEWB 2IH3A 3CX2A 3C5SB 5GGVH 1KELH 1MHEA 3CFCL 4I0PB 5EN2B 1OTUD 5DFWH 2PKDA 4HCRL 1KTRL 1NC2B 4LU5H 3E8UH 4LGPB 1FG2B 3SDXF 1RJZB 1I3GL 1D5BA 2D0FA 2BVYA 2GCYA 5KAQF 1S7RB 1KPUB 4HWZB 2YC1A 4XC3L 1T4KB 4OCSH 2RIKA 1T66D 2VDQH 1W72B 4YDKH 2MCG1 5SWSB 5DLMH 5JIKA 1TVBA 3EW3B 4ODSH 5I71C 2F54B 1XF1A 2DIBA 1W0YT 5I8CB 4P49A 3DX6A 4NKDA 3PGDB 4W6XB 2X4QA 3K2MC 4NO0D 5D1XA 1ITBB 4WFGD 4ISVB 2Z92A 1QBLH 1KUMA 5T1LB 4YFLI 5JXEC 3FHAA 4GXVL 3LDBB 1JZ5A 4DGYL 1JNJA 2ZOKB 5DEZA 5LCVL 2XWJB 2A6KB 3QYCA 3NCFB 3IFLL 3TJHD 5BW7C 3LKSB 3QXDA 4XGZA 3WKMH 1A6ZA 4KKBC 1CE1L 1H3UA 1FN4A 4YJZL 3I3BA 2E9BA 5FCUL 2JJVA 2C5DC 4J3WA 4TUJB 4GLRI 4F15C 2MOVA 2VAJA 3CPLB 4LFHD 5SV4A 3HR6A 3VXRD 4X6FA 3DJ9A 3B2UD 3DX8B 4NKMA 3IDGB 4M6NH 3KNBB 5D1QA 3H0TB 3ILQC 3BKYH 2H2PD 5DDHB 4D0DA 5F44A 1ONQA 2VDML 3NCMA 4X9HA 3MJ8A 5BRZB 1EFXB 1QRND 3CCHA 4Z7UB 1J0KA 5MP6L 3LSOB 1WTLA 2Y07H 4K7PY 3I3DA 1P53A 4AM0B 2HWZL 3O6LH 5F6HJ 1ORQA 1NBYA 5ENWB 5B22A 2Q8BL 2VKXA 2K9UA 3WUWG 1JRHH 4JM2F 3AY4A 5GSVA 4LDOB 4IDJH 4B53A 2F8VA 1UYWL 5GS0C 5CIPB 1D6EA 3CVHH 4J3VA 5AD0A 1GZQB 2ERJC 3F58H 3VE0A 4ZO8A 3VXUA 2NPLX 1JPST 3WSQL 8FABB 4TUOA 2R1XA 1N3NB 3O4OB 4YBLB 4U1GB 4JVWA 3U4EA 4PRHE 1OQOA 4QXTB 1EHXA 1HIMH 3QUMH 2ZSVA 1Y6MR 4NCC1 5T3ZD 3HB3C 3KPOA 1GOFA 4Y5XA 5BS0E 3SGDI 1LGVA 2EECA 4J3TA 1YEHL 3MV9E 3FKUS 5DJDB 1G9ML 5EC1B 3MLWL 4FN0A 5B8CA 2EYSA 3LIZL 1JHKH 4KGJA 5GRYA 3CU1A 3ARBA 3EYUH 1MCQA 3VW3L 3ESUF 2CXKA 4XWGL 3OR6B 4NBXB 3B9KC 2VLRA 4JHAL 2JCCA 1J1PL 2ID5A 2Z8WC 1V5JA 4N0CD 4U6HA 2DWDA 4L3ED 4TSCH 1ES0A 3MRHB 1MCCA 1NCCH 5J06A 4K07A 1S9YA 2Y06H 4N8CL 1S7TA 5F3BA 3DV4B 4QRSB 4DQOH 4IM8A 1EEZB 1MCHA 4FQIL 1T7XA 4UZGA 5JUEL 4LEXH 1FZOB 1B6UA 5E2UH 2RJMA 4TTGA 1ZAGA 3QPXH 1M6OA 1DL7H 5D70H 5F93C 3AREA 4OZHF 5ADPH 4KZDH 3CLEH 4WJ5A 5TQ0L 3RQ3A 5I18H 4U1KA 3RY6C 1E27B 2E6QA 1OT2A 1ZHNB 5EZLB 3GSOB 4MA3A 4R3SB 2R2CA 4OCLC 4H0GA 4XMPL 4R4BB 3UTSA 4S1SH 3OAYK 4HK3N 5DJYA 2JB6B 3UBXI 3OWEA 1UWXH 3TA3C 3TC9A 1O7VA 5JW3L 3L6FB 3PWLB 3RY5A 4X5XB 4HX1A 4JZJC 5EU5A 2HKFH 4KDTA 1LO5B 1YEFH 2BHUA 1OLZA 4G8IB 5M94B 2A38A 4TRPH 3VXOB 2PYED 1P2CB 5TDOB 3NOIA 1NBVL 2EXYC 5GIRA 2P1YA 5I16A 3C5ZB 4WI8A 5E2TH 1BQHB 4IRSD 5F1NB 1WEJL 1E6JL 1G9NC 5EPMB 2MFNA 2V2WB 3EO1B 3ARDB 12E8L 3KJ4B 2GUOA 1JF1B 4GUPB 3WV0A 5TGBA 2EDHA 3DYOA 5D2NC 3ILPA 1B2WL 5C86A 1XIWA 2NXZD 4MXQD 2NX5B 4XC1L 4NNXA 3BYTA 3HNTL 3U4AA 2DLGA 1Q9OA 1KJVB 3L3DA 5J89A 2HJLB 1S7WA 5B39G 4C56D 1AXTL 3QNXB 5E99L 1TTUA 5CEZL 4CN1A 4FMFA 1CD1B 4F7EA 4I2XB 4XAWH 5IMMB 3AU1B 1I9JL 3GNMH 3GJEA 1ZHBB 1YJDH 3VXMB 3G6AB 5DEFB 5E8OB 2RB8A 1AO7A 3MLSL 5MI0B 3CH1B 5BZDA 1VSCA 4WWKD 2RGSA 3O3AB 3BGFB 1FJ1A 2CQVA 3VGHA 4HG4K 1LNUA 2N1KA 1OL0A 4QTHB 1W0WA 1FFPA 4LGRB 5DD6B 3NACL 2AEQL 3F5WA 4JFFA 2ARJB 3SN6N 4PP2B 4LARL 4KHXH 5DEGB 3AS2A 1MUJA 5ISZD 5C07B 4OIBA 3MUGB 1I7RB 1INDL 3BQUB 3QIUB 3KVQA 5KVDL 3SY0B 1C5DB 3RVWD 1UXWB 4GBXA 3OKLA 3HE7C 3T8XB 5EZIL 3SQBA 1H3PH 5IB5B 2VDRH 1XGUA 5E1HB 3ZMRA 5HDQL 4JHWH 4XTRD 5IB3A 2ZCHH 1DN0A 2AGJL 4C4KO 4EN3C 4JFQB 3GUTB 1MREH 4JN2A 4ZMAT 5KVGL 5IT2H 3VRLE 4O2FA 3JXAA 4Z7WF 3BP5A 3MRGA 3BUTA 1WC7A 4U3CA 2X4UA 2W9EL 5IVXF 2X2YA 3DVIA 1K3ZA 1ZA3A 1IE5A 5F9OL 3IXTB 3NZHH 5FGBC 4QRQB 3S5LA 4CN6A 3VXUE 1JGLH 2P4AB 4OFYA 3D69A 4GAJH 2CIIB 2VZ3A 4N0YH 3V4UH 1WT5C 1KTKE 4H8WH 2V2TB 5SWZA 1CICA 1FSKB 2JJTC 3C87A 4JZNA 2RCSL 3QFDB 4DZBB 4Z7QE 3VGFA 2QQKL 2VXQL 4IOFD 3RKDC 3MRPA 3O8XD 5FYKL 2APBA 2BVPA 4JY6A 3MRQA 2F53B 2Y6SC 3QUMB 1EK3A 5F7HA 2DM7A 1EO8L 2R2EB 4I3RL 4Q2ZB 5DZOA 4EI5D 1U3HC 3TBWB 4PB0H 5HGDA 3KLHC 1S7XB 4QRRB 1G7PB 3GIVB 2CK0L 4WV1B 3MV8E 2VLRE 2JCCE 3MJ6A 4P46D 3SDCD 4F3FA 2X1OA 5E2VH 3Q6GL 1KN2L 5GGRY 2DOCA 5MHSD 1CGWA 3H42L 4HHAB 5E2WL 4LRIC 4KI5E 3EYOB 3VCLB 3O81A 4NYLA 1KLGA 3D25A 4HIIA 4I0KA 3QDME 1FVCB 1UZ6F 5ICYB 3ULUC 3FRUA 3QIWD 4PJXF 1GGIL 2ORBH 4JCLA 4XVJH 1I7UB 1NBZA 4YO0B 3UTSE 1DLFH 4JRXD 4Q6IC 3MZGB 4KKLD 3MLXH 4I48A 4JQVC 3X12A 2R69H 5IM7B 3REWA 4FP8L 1BZQK 5F7UA 1AHWB 4U1HA 1BD2A 4X5LA 4ELKA 4KRPD 2BSSA 3SDDC 1CGYA 3FTGA 3SO3B 1INQA 1JJUA 1RUAL 5GGRA 2IH1B 1DVFB 5IHUL 2GSIB 4HW6A 3BP6B 1HK6A 2CRYA 1KIRA 4FS0A 5EOCH 1AC6A 5MEOB 3RWFB 1PZ5A 2P47B 4UT7H 1KJ2L 5EBWB 4EUPB 3WL9A 3RIAF 3ZDZF 3GSNH 4F7TA 3C2SA 4ZQKB 4LEOB 1AQDA 1IAOA 4Q9QL 1MPAH 3FB5A 5C0EA 3U83A 4CMMA 4YHZL 3H3KA 2YWZA 3RWHB 4JQXA 3TBVA 2BC4A 2OL3H 3VD4A 1LHZA 2HFFA 4XNMA 2ED9A 2NY5L 3P9WB 4YHML 1QA9A 3K81A 4M7ZC 4Y4HC 3TBYA 3GI8H 3THML 1KSRA 2EZ0D 1ADQH 3FO0L 4ONOA 4RFOH 5DR5H 1PDKA 4S1RL 1Z3GL 3S35L 3RZCA 1AO7E 1YN7A 4OCXL 3PWVB 1JYWA 1UKSA 1A4JA 4UMGA 4P2OD 3WHXA 4XPFL 4QHUB 4XNXH 4KROB 4I13B 1SJEA 4FQXD 4M43H 1AGEB 1YQVH 4Z8FH 3V0VB 1YPZA 1YNLH 4RFEB 3PQYD 3ZT7A 1KIUA 2DB8A 1OM3H 4EIZC 3OKNA 3QDAA 1DP0A 5IF0B 4M6OH 5T1MA 4UTBH 3QUKA 4C57C 4NGHH 3TO4B 3P9LB 3O6FB 3T0AA 1H15B 3D39D 1GH7A 2IPUK 4P3CH 2FR4B 1QR1A 2UYLB 1JN6A 3EOTH 4KVCL 1CQKA 3VXNA 4HGKC 3NCJL 4X6CA 4LCIH 1SJHB 4IRZH 4YXKH 3SE8L 1DQMH 1WIPA 3ARRA 1IKNC 1K9TA 1J0HA 25C8H 4ZYKA 2R0LL 2VDOH 4HWUA 4JDVA 2BNQB 2R0ZH 4DKAA 5ALBL 5CBEB 2DWEB 1L0XA 5FYJL 2P8LB 3MLPA 2Q7YB 2BNRD 3MCKB 3VGAC 5SWZE 4Z0XB 1F4YH 1JNNH 3O9WC 4WDIB 3HE6B 4UT9H 3HS0B 3QFJA 5K59F 3KPMA 4Y1AA 1JPGB 2FX9H 5D7SL 3QI9C 3S3PA 1U92A 2YPLA 2MCPH 1Z9MA 3BP7B 1IJ9A 5LWYL 1JGEB 5DA4A 3CD4A 2ZUUA 1G7QB 1MH5B 3LQZA 3L7EB 5IIEA 4IRJD 2P5EB 4Z7NE 4UV7H 3WLBA 1RZJC 4KKCD 4TQEH 2IC2A 2A6DB 3V6ZA 4WW2B 4NN5B 5E7BA 2G9HB 2OXGA 4GRMB 4O2CA 3DMMA 1KELL 3QIBB 1FNHA 1CDGA 4KRNA 3UTTD 4TVPE 1DBBL 4G9FB 4M93C 3VFNB 1KTDA 1QR4A 3P4NA 2HVKB 5KOVC 4QRUA 2P7TB 4PG2C 3EJYC 3G9VA 3RL2B 4ALAL 4JRYD 4MDIA 1XGQB 4PV9A 2BJMH 4UAOC 2DTSA 4ETQB 1SYSA 5TE7L 4OCSL 2WANA 5FYLE 3PP3K 2NY0D 3HPLB 4YDKL 3TM6A 2C1OB 4KV5F 4MX7A 4ODSL 2Q8AL 4U0QB 3QCVL 1MJJB 3WEXB 1Q72H 3LKPB 1S7QB 4YHIB 5A3ID 5JHDA 5L9DH 5A2KH 5ICZA 1MOEA 2VABB 4R90H 4YEEA 5GZOC 1QBLL 3WNKA 1KB9J 3VGBA 2MNUA 4ZFZB 1CL7H 4Z76B 5HHME 3PV7A 2HFEB 4OFPA 3VFTA 3LS5L 2CD0A 2OXHA 4XB7A 1FVDA 2ZUVA 3BZ4A 3WKML 1ZEAH 4QLRA 3ZT6A 5CILH 1E4WL 3N85H 1BOGA 5GS0H 4WI7A 3VRIB 5FF6A 5F89A 1H5BC 4N0FB 3H6JA 4CVZB 4ZUSA 4CVXB 5FKAB 2OTWB 3U7YL 4AH2A 1NC2D 3ZKMC 1P6AB 4TUKH 1QHOA 3BKYL 1WWAX 5AZ2H 1D9KC 5E7FA 5DRXA 5AWNH 1FNFA 4GRWE 3TN0B 5FHAH 4JDZB 4NP4L 4I77H 2Y07L 4X7FC 5D2LA 4QT5B 1PVHA 4HIJA 1EUUA 5SWSD 4MAYA 1J05B 4XWOD 2F54D 4M7LT 1KB5A 1QVOA 3Q3GA 6FABL 3LN9A 5FK9B 1DQJA 4IDJL 4LDLB 4U1MB 3LKOB 4HS8L 1ZHLA 2UY6A 1HQRB 1WBYB 3CVHL 4YPJA 2ZUXA 2EXWC 3F58L 5GS1B 5F1IB 2DI7A 4MLIA 3WIHH 5T1LD 4GQ9H 4YDVA 3VJ6B 2B0SL 4D94A 4RBPH 3BW9B 5JR1L 4UIKH 1WZMA 1CE6B 3CZFB 4CN4A 4XVSL 3FB6A 1CFQB 3T1FA 5T5NF 4LIQE 4NO3B 5HYFA 1YYLL 4UQ2B 3C6LA 4LLUB 1OHQA 2A73B 3L7FB 1X9QA 4JO1L 1L0YA 3ULSA 4Y4KA 2BRRH 5ID0A 4M1DH 4GS7B 4LAQL 4KK9C 4M7JH 4OF3A 5HHVH 1JHKL 2CMRL 3DURB 4JFEB 4RX4A 3EYUL 3I6KA 5F9JA 4BELD 3DYPA 1VFAB 4X6CE 1JZ2A 2O5ZH 3H3BC 5FUZH 1FH5H 5F8QC 4QXUH 5BRZD 1EFXD 4J1UA 4OV5B 3EDKA 2R1YA 2VR5A 2CLVA 1JYNA 5D1XC 2VLKA 5EIIA 3NTCH 2X4OA 1G1CA 5B4MC 5HXMA 3QJHA 3FOMB 5E2UL 5ECJE 5JXAH 1DL7L 4R4ND 4YFEA 5D70L 1R5WA 3MRMB 4GW5B 2MPAH 4XCNA 3QFJE 3CLEL 3UJIH 5DJ8B 5I1EL 5I18L 1G9NH 1SVZA 2QJDA 2HT2D 3VFMB 2QQQA 5HGAB 4Y1AE 1GYAA 2X09A 5T3XE 5I1LB 1WIOA 1LEIA 5HGBA 1EBPA 4E5XA 4G42B 3WNLA 3NIDF 1KULA 1AR1D 1HXMA 4CW1A 1E28B 5D1QC 3WS3B 1EH9A 2HKFL 1BIHA 1YEFL 4GKOA 4GG6A 1EX0A 4TRPL 4APQB 4PR5B 3BZFB 2IADA 1UM4H 3HPJA 5I71B 3T65A 4GOSA 2FL5B 3MCG1 4XBGB 2G75A 3PIQA 4LSUH 4YBHA 3H9SB 1A9EA 1IARB 5DC0A 3BVNB 3AY4C 3BN9C 5FEBA 5I1DA 1ZK9A 2FJGB 1S9WA 3QJFA 5C0IB 5DRWA 3DECA 2CO7B 1DBAH 2VMFA 3ARYA 3QH3B 4MJ6B 5FA3B 2EICA 1NFDB 4LSSH 1MNUH 1QLRB 1N8ZA 3O11A 1IQDB 2MQ3A 4Y5XC 1CZ8L 1IT9H 4MWFA 4KQ4H 4F15B 1OGAB 3BHBA 4XHJC 5IROA 3S98A 1EGJH 3OKMB 2BERA 3V6FB 4X7TA 3EDEA 2YD1A 1T5XA 2SEBB 5DJZA 4DEPC 1YJDL 4MS8C 5E1AA 2UUDK 4YWGH 1DQQA 3ARBC 4O51B 4ZUUB 3BZEA 2I9LA 1MHPH 1NAMH 4I4WB 1NGYA 2VQUA 2NW3A 4JFOB 3ARQA 3TV3H 3SGJA 3O3BA 4HBCH 1U6AL 3GM0A 3VWKB 1J8HB 3GB7A 2EH7H 5DUPH 4PJEF 4JPWH 3L3HB 2Q76A 4KHXL 4WW1A 3WIFB 3L3IB 4YNYA 4DUWA 4OQTH 4KI5C 3E3QE 1AY1H 1K3IA 3C5ZD 4PLJC 4PJIA 4OGAC 3MJ9H 5LGKA 1KCVL 1D7FA 3ARDD 3DGGA 4OLYH 1H3PL 1RULL 1WWWX 2ERJB 2VDRL 3AREC 3X14A 1HH6A 5EZOL 5ALCH 2ZCHL 5HHOE 3GHEH 5D2LE 3EIFA 2NX5D 3PP4H 1T2XA 5IT2L 4LLWB 2JIXA 2DQFA 3MQIA 1BP3B 1HZHL 1HSBA 3QAZC 4AQOA 4PUBH 5INDB 1IGCL 3SE4A 1LEKA 4O2EA 3NZHL 3WBDA 4L8SA 5T3ZL 4P9HC 4KDTC 2B1AL 2DIJA 4GAJL 4Y5VA 2XPGB 3V4UL 1N0XL 3VRJA 1N2RB 5GISH 3VXMD 3TPKA 3OAZK 3EDFA 4OAWB 5L8JB 3GJFB 5E03A 1DZBA 1RFDL 1B0GB 3HUJF 3CXHJ 1IFHL 4G80A 1FNSH 1MFEL 2Y7QA 4MNQB 4H0HB 2CRZA 1IZKA 5JQHC 3ULUH 2GYSA 1A2YA 2X4TA 5C7XL 1CFTB 4PB0L 1A02N 2ZWLT 4X8JB 5C07D 5LAXA 3F12A 1XZ0B 3QB7C 3MGOB 3BQUD 1UM5H 1XIWC 3QIUD 5ANMA 1U8QB 4Z7VB 3FN9A 3TIEA 4ONFH 4QOKE 3UZVB 4O58H 5E2VL 2L7UA 2LTQB 3QEQA 2R2BA 4J3XA 1HKFA 3X13A 5DZLA 4HK3J 1I85A 1SQ2N 3P2TA 1FV1A 2OS7A 2Z31A 4HKBB 1R3HB 4LSPH 3DRQB 3MLZH 1IGYB 3D0VB 3W9DA 1FZJB 4JG1H 4JZJB 4D8PA 3DARA 2VR9A 3S36X 3RNKB 4OZGA 4U1SB 2L4OA 2B5IC 2VTFA 3L9RB 1UZ8B 5HVFB 5IB2B 1JUFA 1NSNH 3WE6B 1IGMH 3HI1A 3B9VA 1JPFA 3PWJB 3GMMA 1KNOB 2XV6B 3OKEB 3BKMH 3MLXL 4KUZH 4A6YL 4BQ9A 2CUMA 1F11A 1ZWIA 5TF1L 5EU6A 3T3PE 1F8TL 4PGJA 4LHUD 1J87A 3CNKA 2FRGP 4J6RL 5IMOB 2FLRT 2F53D 4GG6E 5DMIL 1WV7T 1ZS8A 3ARGA 4I0CC 4ZDHA 3A6BH 2DJUA 1JCKA 3RWGB 4LSTH 4I9WE 1MCNA 3QDJA 4UU9A 4PLNC 3Q1SL 1CXHA 3W2DH 2VIRB 3C8DA 5F21B 1CVSC 4UT7L 3UPRB 3KLDA 1DE4B 3GSNL 1T20B 2OR9H 4L8BB 4ONGH 4EI6A 1MPAL 3ZYZA 3VI3E 1EERB 1JK8A 3HKFA 3DYMA 3OJMB 1AE6L 3V52H 5GJSL 2K1MA 3VFRA 1ACZA 1TZHB 2OL3L 2KKQA 1REIA 4Y19B 5KANG 5F7DB 4Q0XH 3IDIB 3CSYA 1NH6A 1JGDB 1EHAA 1A4KA 3PXJA 4M6ML 3QDGB 2Z8RA 1A9BA 3IJSA 1MCJA 1X5KA 1FNLA 1VESA 3Q5YA 3HAEA 1ADQL 3LN5A 4QHNA 5ADOL 3SGEH 4RFOL 5DJ0B 1ZT7B 3O2DL 2A6JA 1X5HA 2BHYA 1CD9B 4BH7B 3SOBH 4G5ZH 2A9NH 4QCIB 3HE7B 2XXMB 3IGAA 4XNXL 3MV01 1BVLA 4J7RA 2AXJA 4K55A 2VE6A 4B50A 2X6MA 1YQVL 1WBXB 4Z8FL 3BUYB 4EN3B 1YNLL 4HZLA 4B5EA 1DVFD 4MQTB 3BGMB 4KMTL 4FABH 1DEEA 3ECBB 3KPPB 2FSEB 1OM3L 2P8MA 4PJIE 2VISA 5T1DH 3KDMB 5HDBE 5DA0B 4MD4A 4UTBL 3QUZA 2FEDD 4NGHL 1NMAL 1YDPA 5HPMA 4GRLB 1MRCH 4P3CL 1X4XA 1JL8A 3NPSC 3RUGA 4BZ2H 4DZ8B 3T0EB 1KEML 4ORGB 3EOTL 2Q3ZA 5I74C 5KG9B 4F7CA 2W9LA 5DJXB 2C1PB 3STBA 1OF2B 5E9DB 4N9GB 4YDLB 2VXTL 4LCIL 4IRZL 4YXKL 1ZV5A 1DQML 1QFOA 1U8KB 2NNAB 5H94B 3WXVL 2EO9A 1NCTA 2VDOL 1RZJH 2R0ZL 3O41A 4NHUB 4R0LC 3UTZA 4G43B 2DMCA 2PTVA 1A6WL 3ALPA 3U9UB 1U3HB 4GSDH 5J57B 4NO5B 1F4YL 1JNNL 3GBNL 1GOGA 4UT9L 3BE1H 1FVEB 3FT4A 4H25A 4NNPL 5TF0A 5J6GA 4KROD 1CGXA 1OSPH 2Y5EA 3RL1B 5J6HA 1D5ZA 3D2UA 5EWIL 3PJSB 4HUXA 2YEZB 2MCPL 5GGSY 3JWDC 1FRGH 3ROOA 2DQIH 2DM3A 2XFXA 2PW1A 4UV7L 5F7YC 2R1WA 4HIXH 5ANME 2JK5B 3VDCA 4D9RD 4JQXC 1FNGA 4TQEL 3TO4D 2YBRB 2BMKA 4KZEL 3O6FD 1TENA 1G7HA 4LPCA 3RVXD 3QEQE 4OM1L 5E00B 1G7MB 4NPYB 3CUPB 4NQVB 1Q9KA 1S5HB 5EIVA 4MZ3A 3UTPD 3VFPA 5B38A 3WN5A 2VSCA 1ACYH 3C9NA 3BP4A 3MA9L 5ITBH 3S88L 3MRCB 2B39A 1J5OL 2ATKA 3EHBC 3SJVA 3GBLA 3RZCC 5J3HD 5IHLB 4HT1L 1WCQA 1FIGH 1HH9A 1OGTB 2BNQD 4OZGE 5BXFB 1CLOH 2EEBA 3SDDB 4XVTL 5IBLD 1XGPA 4JJ5A 5EO0A 3S9DB 2MHAB 5E8NB 3SKNA 1HOCA 1C5CH 1Q72L 5SX4I 4OF5A 3HE6D 5L9DL 2H9GA 1WUNT 3E6FA 4JLRA 4DGVH 5B3JE 1CL7L 4UDUB 4FFVC 4LHJB 4O9HH 3DX7B 3BRFA 1UEMA 5CJOH 3BAEH 2O5XL 1S9XA 5I8EB 4HS3A 5INCA 5JIHA 1BBJA 3OJ2C 4K7FB 3U6RB 2P5ED 3IU3A 3BO8B 1ZEAL 4P4KA 4K3GA 4PJ5A 5FO8B 1R3LA 3QDJE 1S78D 5CILL 2OBGA 5I75C 3SGDH 5GS0L 3O2WL 5JA9A 4PJDA 1XF3B 2WINA 3ZKNC 3HZMB 2FYYA 4M7ZB 5DVLA 3SKUD 3QIBD 2XQBH 4NUGL 2NZ9C 2CKBB 3L3OB 4OCRH 4G9FD 3I6GA 3KYNB 3QZWG 4GG8B 1F3DH 5BQ7B 4G8FA 3VFSA 1SJVA 2X4NA 1C7SA 1N59A 2DJSA 4YHKL 4LLDB 3TO2A 1FLTX 2IPKB 5FHAL 4I3SH 4WTXA 1XF5A 1BF2A 3PDOA 2GT9A 1MCRA 2Z8VC 4KJWD 2C3HA 3VFVB 4OBSA 1MY5A 2EE2A 4M48H 2EE3A 4RFNC 1RK0A 1C7TA 4E42B 4G8GA 1QLEH 2N56A 1VPOH 2GAZB 4RAUA 5FO7B 1YC7A 3S5LG 5IV2B 4UT6L 4UIKL 3B9AA 2DI9A 1VACA 2R0WH 4PJHF 2OSLA 3QO0B 1KPRB 5DJAA 3OHXB 3VXPA 2OJEA 3DMMC 2NXYC 1GRWA 4L4VA 5ID1B 1ZT1A 4ZXBA 2LQRA 2P43B 2L0DA 2WSKA 2K7PA 3KJ6H 4WHYG 4U1IA 3DUUB 5ACZA 1A7RL 3IETA 4M7JL 5HHVL 3SDXB 3RUGE 4LSVL 3QQ3A 4PGCB 3VGAB 5DGRA 1Y6KR 1XGRB 2O5ZL 1FH5L 1RVFH 2EDFA 3O9WB 4QXUL 1FHGA 5F71A 1VGEH 4FXGA 5C0GA 3TIDB 1JHTA 3TN0D 1RZFH 2PO6B 1JWMB 3UDWA 5KSBF 4EKXA 4XPBH 3NN8A 1OT1A 4PGEB 2AJZB 1FO0L 2A0LD 3NTCL 4U7KA 1FZMA 1HQ4B 1R5IA 4M00A 5GGUA 3LPWA 3UP1A 3OJDA 4QRPD 3KWWB 1CGUA 1JPSL 2MPAL 5KN5A 3UJIL 3PL6A 3BDBA 1KJ2A 1YEDA 1GGCL 4PRDA 1K8DB 1KEGH 1NCWH 1GPOH 2CJUL 5KZCB 4X83A 4KDWA 3DO7A 2P48B 3E3QC 1QFPA 5ESQA 5GGQL 2CGRH 5AYUL 5K9JL 4NT6A 1EVUA 3HRZA 1FE8H 1FFNA 5EU7E 1IMHC 1AGCB 4NZDA 1C16A 5CEZE 2HRPH 3U0TB 4POYA 2EKSA 4RAHA 5GXBB 4V1DA 2OJZH 4UOW0 3UTQB 2IFGA 4JFED 2VXUH 4XBEH 4JPKL 1ZVSA 2AJUH 4PYHA 4MAYC 3GMRA 1LQSR 2X1XR 5TE4H 4JVUA 4YHLH 4LSUL 4TSBH 1MLBB 4UOJA 1NUDA 1YMHA 3HA0A 1GAFH 4MB4A 1LO0L 1MF2H 4LNRB 5BS0B 4K7PH 3MV9B 5E6IB 3PGCA 4KKAD 3S34H 1RJYA 1YNTA 2IQAA 4JM2B 2H3NA 5I30L 3MYJA 2BXZA 3BH8B 3B3IB 1MNUL 4YIQB 3V6OA 3C6LC 5L6YH 4WI5A 3QNYA 3M17B 3ORJA 4Y4KC 3MMEA 1EGJL 4OF0A 5F9WC 5IFAH 3BFOA 4MQXC 4S2SB 4MHHI 2D4DA 3MNVB 3FT3B 3TFKD 1KYOK 4YWGL 1JMXA 3IYLW 5K9KB 3SCMA 1EEYB 3OKDB 1I9RL 1EV2E 3KHQA 4ZFFA 1NAML 2R4SH 2VLLB 4MD0B 4NOFA 1A7PH 5L2JB 1F4AA 5JW4Q 5TDNA 3TV3L 4O5LH 4PJ5E 4GMSH 3GJFK 4XMLL 1EAPA 3I3EA 5F1SA 4RBPK 1I1FA 4ZUVB 5DUPL 2HT4C 4JHZA 1QFHA 1NGXB 3HZKA 3P73B 4APQD 4PJDE 4PG9B 4WHTA 1QBBA 2K7QA 1C12A 4L4TB 4P9HH 4X98A 4LK4A 1A0QH 1N7MH 4U1LB 2C3VB 3T4AA 1P7QB 4OLYL 3H9SD 2BCKA 1KIQB 4NZJA 5DO2C 4PYGA 3OKOB 4PRNB 4NM4L 5ALCL 5JXED 4XP1H 4Y8DC 3W5NA 5HDLA 3ZE0F 3GHEL 5IMKB 3N9GH 4ZAKA 1CF8H 3SE9H 2F5AH 5HYJA 3IF1A 3PP4L 1QOKA 3CDGA 3I02A 3HMWH 4HKZB 4P57A 2IH3B 1MHEB 3T4YB 5GRUH 4PUBL 4KKBD 4G8GE 3D9AH 5KVMC 1OAQH 2DBLH 4BQ6A 3RI5K 1OGAD 4ODHL 2GCYB 4XNYL 3U0PB 4BFIB 5CEXB 5IK3B 1KN4L 3P4LA 5I9QC 5IESL 2NY2D 2YC1B 3WUZA 1E4XH 1HHHA 5C0DB 1UEYA 1UJ3B 4WO4B 4L4VE 5IVNA 2P44B 4DN4H 3ILQD 4RQQA 3H9HA 4NKIL 3DX6B 5E6YA 5EUOA 4BH8B 3VWKD 2EDBA 4EDXA 4Z95H 1KLUA 3FT2B 3RHWK 2X4QB 1MRFH 3G04A 5EOQH 1U2CA 5M95B 4ZO7A 5D7KD 1ZLVK 2CDGA 2ED8A 4DGIH 3ZTJG 1UM5L 3E6HA 2ZP0T 1MEXH 1JF5A 3MSPA 4OIIH 3LOWA 4AY0A 2RAMA 4ONFL 2JTDA 5I1IL 4R4FH 4LCWA 5C0JA 1BBDH 1MFCH 4N1CA 3QXDB 2F8OA 1A6UL 4QYOA 1A6ZB 1FN4B 4YDJA 3TCLA 3RWEA 1UWGL 1MJUL 5K33A 2X7LB 5C0BA 2IBBA 3QHZH 2LAGB 5IROC 1BX2A 4C54A 3RRQA 2EC8A 4F7PA 2V2XB 3PG2A 3MLZL 2XN9A 3MLVH 1U95A 1FC2D 4JG1L 3TVMC 1ZLSH 3D18A 4XXDB 5D1QB 3WCYA 1XAUA 5C09A 2F58H 2NCMA 3IU4L 1N5YL 1ONQB 3SGJC 2P24A 3V6BR 1NSNL 1H9VA 3WFZA 4GT7A 1IGML 4MJIB 4WEBH 5IBUB 1GJIA 4YXHH 3BKML 3V5HB 4R6UA 3GSVA 1BQLH 2AK4A 4JPIA 4F8QA 1SMOA 4X6BA 3V8OA 1JI2A 2EC9T 1LEGB 4PB9L 4YBQD 3EYSH 4PY7A 3VH8A 3VXSB 1NFKA 3GMOA 1B90A 5HYIA 2HRLA 1B88A 3DVGB 3FZUD 3PABA 3QRGL 3SBWA 3QPQC 3TH3T 4V1DE 4ZTPL 1D6EB 4G6JL 4MNQD 4EEEA 4LASH 3IVKB 4TULH 3VE0B 2JLLA 3OF6D 5I66B 3DVFA 5F88B 4PBWD 4WHYH 6CGTA 4H26A 3RFZC 1NFIA 4JAMB 4NUJB 3O6MH 4HJJL 4LSTL 4N0UA 4AYFA 4IOSD 2H32B 3KR3L 5J11C 2RBLA 2W0FA 1RHHB 4M7KH 2QQLH 3KPOB 2FO1A 5F70A 3SE4C 1FQ9C 4Z7WB 5I73C 4ONGL 2HT3D 4L8SC 1UKTA 3D3VB 5IVXB 2OYPA 4DEPB 3V52L 4Y5VC 2GSGA 2G5RA 3ARBB 3M8OH 3FQXA 4KH2A 2ITCB 1I1AA 3ARTA 3MV8B 4J23A 4TVPH 4YUEL 4ZSOE 2AJSH 3V6OE 5D7JA 1Q0YL 2DWDB 1MI5D 5DFTA 5DI8A 3VXTA 2Z93B 1K2DB 4AT6A 4LKXA 3CMGA 1S9YB 1S7TB 2DLEA 5D72L 1OTSC 3B2VH 5FYLH 2ESVA 2ENSA 4NHCH 4YAQA 2YHGA 3BPOC 3SKMA 4G5ZL 4JM4L 3FOLA 2A9NL 4HS6B 3IAPA 1M6OB 3QDMB 35C8H 3NA9H 3RBSA 1OPGH 4WY7H 1Z9LA 4KJPC 3IB4A 1CK0H 5KVEL 3PWUA 3ALXA 1OAUL 4MA3B 3U9PH 1I85C 2YZ1A 1JHLH 1XH3A 1AKJA 2DKSA 4EXKA 2Z31C 1DQTA 3QAZB 3TEUA 5DJYB 3AS0A 3JUZA 1TJHH 5JPMB 4YC2C 4M1GH 4PJ9A 5C6TL 3QG6B 4HX1B 5BMFH 1LP9A 5EU5B 4D3CH 4QHLB 1T04A 3EOAA 4BM7A 3K8KA 5I15H 4NQCB 1RUMH 1FG9C 1QYGH 2DQHL 1OB1B 3JWDH 4PJXB 4HGWA 4JFDD 4R9HA 4U6YB 5D6CB 4JFXB 4Y19D 5I16B 3B8SA 5HYQB 1KT2A 4Y2DB 4MQSB 2X4RA 3PGFH 1RZJL 2AI0H 4ODUB 4HG4J 4WU7B 3O4LB 3QDGD 1G7IA 3A6OA 5C0AB 5TGBB 2VKWA 4OFIA 5DRZB 4NFDA 3N06B 4GRWH 1T22A 1A3RH 1MCWW 4BSWB 5BJTA 1XIWB 4ODWA 4ZS6D 2OTUB 1EHLH 1F6AA 3ARGC 2W59A 4H5SA 4XNZC 1HHIA 2B4CL 3DSNA 5EUOE 32C2B 4MNGA 1OAZH 3U48A 3V95A 5IW1A 4KKNA 5TQ2H 1S5IH 4NO0A 2DQIL 4QNPF 4R26H 4EN3D 2FJHB 1A8JH 4TPRL 3N0PB 4S1DC 3MA7B 4HIXL 1E0OB 1PYWA 3GJEB 4QXWA 4PJBA 3NZ8A 2DN7A 1AO7B 2WW8A 1PFCA 4HPYL 4LCWE 4L9LB 4LIQH 4YHYC 4PJCF 2YXMA 3DTXA 4GRLD 3VFGH 4Y7MA 1FJ1B 3OKKA 5L0QC 1QO3A 1RMFL 1RK1B 3BOVA 2B5IB 1LNUB 1R3JA 3T0ED 1FFPB 5C0BE 1UB5A 4GFTB 4PTTA 4X0KA 1ACYL 4JCMA 4G8EA 1YUHA 2ICCA 4DN3H 2Q86A 4NNYA 1GCFA 5E9DD 5I8OL 5ITBL 1MUJB 1H0DA 2XN9E 4WFFD 3QZWB 3P0GB 3L3KA 4PP1C 3QCTH 3L95A 5D5MA 1FIGL 5C09E 1CLOL 1DBKH 3P11H 5E8PA 1X5JA 2BVQA 1OWWA 1QRNA 2VZOA 3MXVL 5KW9L 1U3HD 3KLHD 1W0VB 3CU7A 3C60A 5HY9B 1AD0B 5IB3B 1DN0B 1F13A 1C8PA 3QWOA 2AK4E 4XRCA 4PJFA 4JN2B 4Y88A 1CLYH 4WHDA 2HTLD 3BP5B 3MRGB 3QEUB 4MDJA 5CMAA 3KYAA 3QUZC 4HWBA 5CJOL 3WFHA 2EIZA 3BAEL 3UC0L 3S5LB 2XNAB 4MSWB 3QXWA 5JO5B 2VZSA 3K1KC 4BFBD 1T0MB 2QKIB 3D69B 2WUCL 1NGWA 3O6KH 5T3XH 2ICEB 4N0UE 3BPNC 3U36B 5BVPH 4PJGA 4QY8A 2BDNL 1A6AB 3ULUD 3ZTJH 4OZFB 2DYPB 3MUJA 2F19H 3WFDL 3V2AR 1YYML 4LLVA 3EOBB 1SEBA 2CUIA 1QLFB 4OCRL 3FL7A 3MRQB 3DHJA 4HKXB 1E4JA 4LVNC 3UO1H 1XR8A 4I3SL 4L8DA 4MJ5B 2BOBA 4P2CG 4L3EA 1ZANH 1BFOA 3SDDD 1A22B 4X9FA 4M48L 4HUVB 1NDGA 2AXFA 1CDJA 3EOYG 3L5JA 2H1PL 4JPVH 5JOPD 3AAZA 2V5SA 3QUXA 4G6KL 2ESVE 3QULA 1VPOL 4NYLB 3CC5A 1KCKA 1WGOA 1KLGB 1WAAA 4BKLB 2XKUA 5EU7C 2FJFA 4ZTOH 5KSUA 1J1OH 2A6IA 3NPSB 3FRUB 5EFIA 1PG7L 5CD5D 2R0WL 1HILB 3KLSA 3HZVB 3GSRA 5I74B 4N90E 1U8IA 4XMKH 2DKUA 3G6JF 3WN5C 1KBGH 4JY4B 3EDDA 3S96B 4JFHD 3JTSB 4I48B 4PY8I 3JV4B 1RJLA 4HFWB 1R6VA 3BD5A 3U7WH 1LP9E 4KRLB 4R0LB 4Z77A 2BSSB 4A6YA 3MRKA 3C5JA 1INQB 2IF7A 2PYEA 2ZCLH 2VZ1A 1I8IA 1L7IH 4IRSA 1AI1H 2ATPB 2YA2A 1R24B 5KJRH 1RIUH 4M7LL 4XPBL 1KCUH 3O3UN 2EDXA 2Z9TA 1XR9B 2HLFD 2HFTA 1FBIH 3NIGF 3OPZH 4JQIH 2LU4A 5D7IA 1JVKA 1O7SA 3WL9B 4F58L 3IRPX 4PBVC 4F7TB 2RR3A 1AQDB 1YA5A 3LEVL 1IAOB 1CD0A 3N1GC 3FB5B 5HHQB 1T5WB 1T1ZA 3TBVB 2BC4B 4DTGH 4P4KC 3GSNA 2HFFB 1KB5H 3FONB 4XNMB 4C56A 4GRWB 4OGYH 2NW2B 4X6DA 5A2FA 4MNGE 2FATH 1NCWL 1GPOL 4LBEA 3NGBB 3UYRH 3HC3H 2HJKA 1A3QA 1IGJB 2CDFA 1M7XA 2GKIA 3G5XB 2YUWA 2J8UF 5IB1A 3B6SA 1FE8L 4PJBE 5DHVA 2HRPL 3RZCB 3LHPH 1OARH 4WWKA 1A4JB 3DV6A 1V05A 2VXUL 2XICA 4XBEL 5KSAA 1JGVH 3O2DA 1IAIM 1DLHA 3O9WD 5ISZA 4TSBL 2QADB 2EE9A 4WHCA 3MRBB 4OGXH 3VG9C 2XQYG 4CU8A 2PO6D 3DROA 4K7PL 5F7WC 1BEYH 3S34L 1WBZA 1RUQH 2VRAA 3CFJA 1MCFA 1AXSA 3MV7A 5ILTH 4MQ7B 4CNIA 3VXNB 2WQ8A 3LRGA 3WS6A 4KJQD 1JV5A 1UG9A 5L6YL 4N1EA 3NH7H 4ZXBC 4U3XA 1IAKA 3W82A 2J88H 5IFAL 4ZPTB 4OD1L 2FBJL 4JKMA 4FMKA 1ED3A 4LLMB 5KZCD 3ZHLA 2FD6L 4OD2B 2YPVL 2R4SL 2NR6C 3G9AB 3K4ZA 1EHNA 3OJVC 5CP7A 4XPAH 5JDSA 4GMSL 4PJGE 4FNLH 5HI3C 5T3ZE 4GJTB 1I3VA 1UXSA 4QEGA 3EAKA 3FO1B 3PHSA 3UDWC 3VFOA 3O8XA 5AG9A 3FQNA 1P7KA 4S10A 3LKRA 1KG0A 5FUOH 4FQ1L 1DN2A 1EJ6A 3L3JA 4LRNH 1A0QL 4EI5A 3D0LA 1N7ML 2NZIA 2ZKHL 3OG6B 4YHPA 5E8EA 3STLA 3ZDYF 1LK2B 1U91A 2Y5TB 1TDQA 3QRFM 3WLBB 3IDNA 3HMXL 5BS0D 5GZOD 3SDCA 2ITDA 5A43C 1ZSDB 3PL6C 1BJMA 3MV9D 5E6ID 4L3EE 4RGOH 3OXRB 3N9GL 4HJ0C 4ONHA 1CF8L 3SE9L 2F5AL 3HG1B 4JM2D 5LGHH 3OGOE 5E08H 3HMWL 2ZG1A 3GMQB 3DMMB 3HCVA 1S9VA 1IGFL 5GRUL 4LP5A 1KTDB 1RQ5A 1OAQL 1GGYA 4QRUB 3W81A 2CXGA 4MNHA 1WAAE 1Q94A 2E7BA 2NY5C 5JPNB 4JANA 4U6XA 4XCEB 3LKQA 4ZPVA 3QIWA 3ZDYE 3CDYA 1SYSB 3GSUB 3CLFH 4IIQB 5T33L 4JFYB 1E4XL 4KK5C 5H35A 1IC1A 2H8PB 3UTOA 4FXKB 5DHYA 2YSSA 3MACH 3C2AH 3LQAL 4JRXA 2BNUA 5FXCH 2WLZA 1NGZA 2NMSA 4IMLB 1C08A 2PTTB 1EXUA 3PUCA 2XT1B 3W9EA 3V4VL 2B1HH 4DGIL 5E94B 1ZA6B 4L4TD 3HLAA 1MEXL 4LPUA 4OIIL 3VFWA 2PYEE 4R4FL 4HXAL 1BBDL 1FVDB 1P7QD 3BZ4B 4M4PA 4ZS7L 1XCQB 3DUSA 3V6OC 2G2RA 1NCBH 5GZNC 2FO4A 4HDIA 4NKOB 4MVBC 4GKNA 3LH2H 3QHZL 4UILH 5B38G 1T6WA 1U8NB 5D7IE 1LK3H 3NFPA 5FF6B 5C8JA 3V79C 1HN1A 3MLVL 5GRVL 3S4SA 2YPKA 1ZLSL 3SCMC 3K46A 1HNGA 4XI5C 1L0QA 2F58L 2P8PB 1UVQB 4OZIF 5EH1A 4ZUWB 2YD3A 4X9BA 5DHXB 3BPCA 3DWTA 4PRIE 4WEBL 4YXHL 3EFFA 4FFYH 5HHOB 1P1ZA 3PE9A 1Z0NA 1BQLL 2E6PA 2XZCL 2B7DT 4HIJB 1RUKL 4WO4D 1A7OH 1KB5B 4G3YL 4PJEB 3OB0K 4XNUL 5IJVB 3Q3GB 4QRTB 1U36A 1UQSB 1DQJB 5CCKH 2Y4SA 2WIIA 5F3HA 1ZHLB 1TCMA 3N1QC 1Y18B 4W4OA 1EEUA 3FCTA 4LASL 3MRRB 4TULL 2DICA 4P2OA 1FORL 4R2GB 1WZ1L 1BLNA 4YDVB 4BUGA 1TPXC 4JGUA 1IAMA 1X5GA 4CRPA 2UZIH 4OZIE 3TJEH 1PLGL 3O6ML 4ZAKC 1UFUA 2QQNH 2AQ1A 5ERWA 5ISZE 3C6LB 4M7KL 2QQLL 5K9OB 5J12B 4LCCA 4Y4KB 3U82B 5F9WB 2ADIA 5LJYH 5ID0B 3D39A 3KPNA 5DK2A 2EDRA 3V9FA 4GXVH 3MV7E 3M8OL 4P4RB 3UCRA 4NO2B 3BI9X 4OGZA 1F90H 2AJSL 1I8KA 4PGZA 4QOKB 4GKSA 5D1QD 3IFLH 4JB9H 3BH9B 1CE1H 4NQDB 4J1UB 1HWHB 5FCUH 4MJID 2CLVB 4U2YA 5D9SA 4NZRH 4MA7H 2WBJB 3F7VB 4NHCL 5IVZB 1U3YA 4M3KB 1Y0LA 2BNRA 2X4OB 2D9CA 1P6FA 4AEFA 4LLYA 1G7JA 3MRJA 3VXSD 35C8L 1R5WB 1MFDH 3DX9B 3NA9L 1OPGL 2E7HA 4WY7L 2ZOLA 1LD9A 5EA0L 1CK0L 1FO0A 3PXHA 1YEKH 4XBPA 5C92A 1JHLL 1LEIB 3HNSL 1CIUA 4Q6YA 5JORB 2LU7A 4E5XB 3VDAA 2ICWB 2HWZH 3QXUA 4IRJA 4DKEL 3RIAK 1HXMB 3RIFK 3UXFA 2IBZX 4U1NA 3BSZL 5CWSB 4JO4H 4L5FH 1GHFH 2DQTH 4Y5YA 5E56A 3CDFA 5DUMH 5I9QB 3JVGA 3D3VD 1IM9B 1NFDF 1QYGL 5J13B 1KTLA 3WSQH 4NRXA 1WIUA 1BAFH 1JMZA 3ARBD 3SGKA 4HC1L 3UTTA 3T65B 3MV8D 3PGFL 1Z5LA 2AI0L 2C3GA 4JY5L 3EYFA 2R4RL 3QO1A 4Q9CA 4JRYA 3QA3B 3EBAA 2KBGA 1A1OB 1L6XA 3GGWB 3MBXL 3SBWC 5I1DB 3WKNA 2CLRB 4XCYB 1DSFH 4KI5D 4WEUD 2GJ6B 2AJ3A 1A3RL 4PLJD 1EHLL 4OGAD 1VCAA 5IB4A 4HULB 3VMNA 1MSPA 3HAEH 3NMEA 3QDMD 3SDAA 1SVCP 4JHAH 1J1PH 1OAZL 1N8ZB 1CI5A 4MJ4A 3O11B 2O61B 3ZE1F 4R26L 4MWFB 4X4MA 5FM5M 1RIVL 3BHBB 1Q9WB 3K4DA 4P5TB 2A83B 2IMMA 4KK8C 4X7TB 5I1CL 5DJZB 2ILLA 4FQIH 3TVMB 4JFPA 2R9HC 1OTTD 5FGSA 3VFGL 1I1AC 1ZLUH 4DKFH 1LE9A 1NGYB 3HZYA 1PY9A 1HCFX 1X4YA 2NW3B 4NQEA 5D7JC 3UAJC 4PJ8B 4FQ2H 1R5VB 5D8JL 4DN3L 2AJXH 4NQCD 2PXYB 2Q76B 4WW1B 3C5SA 1YY8B 3G5ZA 5IBTH 3ZE1E 4X4YB 5EN2A 4XMPH 4Y2DD 1FG2A 2IANA 1RJZA 4PV8A 3KPLB 4LCUB 3IKCB 4K8RC 4M9OA 5DQJB 1WWCA 2DF3A 5DJ6B 3K2UL 3O4LD 4P5MA 5C0AD 1S7RA 3X14B 1HH6B 5HGGS 3H3PH 1T4KA 2VH5H 2C3WA 5SWSA 1XIWD 4U2ZA 2F54A 1CU4L 1CLYL 5J11B 1OSZB 4F33B 2DQFB 4YFDB 1WEJH 2A1WL 2OP4H 3PGDA 2UWEA 4PRBB 1LEKB 1OQXA 4Q74A 5DF0A 4O2EB 3MROA 4PJ9C 5I73B 12E8H 2ED7A 1ZLWK 4NJAH 2ZSWB 3P4MA 1HHKB 2NY3C 4D0CA 5FO9B 2ZOKA 1JTOA 3O6KL 3WYRA 1EJOL 2VERN 2XWJA 5T3XL 2A6KA 4WIQA 3BKCH 5BVPL 4WTZA 1OP3H 5IEHB 3QR2A 3T2OA 3BEWA 3EZ8A 1AO7D 1DBMH 1B4RA 3QDHA 4XC1H 2XY1A 2J3SA 1OTUC 2F19L 5DMGC 2E27H 1AXTH 1G6RB 3CFEB 3DNKA 4G80B 5HTSA 3T77B 5CEZH 4MA1B 4XVUD 3ZYOA 3CPLA 3CSBA 2ZG3A 5E4EC 3BPOB 2J1KA 3F12B 2E5EA 5LAXB 1I9JH 3DX8A 2IAMB 3NIFF 3KNBA 3TIEB 2IALB 4RNRB 3QEQB 2R2BB 1EFXA 5BRZA 4Q58C 2CIKA 4Z7UA 2X1PA 2M26A 3NACH 4JPVL 5CZVL 1EUTA 3D85B 4LARH 5ENWA 1HINL 2BNRE 2GY5A 4S1QH 4YC2B 2E8YA 5H2BA 1INDH 3P9MB 3GMPB 5KVDH 1J1OL 3TNNB 1B9ZA 4D8PB 4MMZC 1T2JA 5CIPA 3QG7L 3J8F7 4OZGB 4W68A 4K2UH 4KUCF 5EZIH 1BFVH 3OX8A 3OB8A 4Y8AA 1CDHA 1YJDC 3P77B 1N3NA 1IL1A 4QXTA 3FB8B 1R3KB 1EZVX 2HTKC 1QQDA 5KVGH 4RGNB 1NQBA 2E8ZA 3PWPB 4OLUL 2DYPD 3U7WL 4E41A 2W9EH 1CQYA 5C0FA 5EC1A 4KK6D 4C4KT 4DFHA 1FDLH 3I75B 3DOSA 4BK4A 1ZS8B 3C60C 4PGDB 3UTTE 1L7IL 5F6IC 1CT8A 2FZ3B 4XNZB 4UU9B 3DXAA 4LKCB 3T2QA 2RCSH 2YR3A 4EBQL 4JRYE 4X9IA 1VFMA 3OPZL 4PTUB 4LHQB 1X3DA 1RZ8A 4QRSA 3EO9H 1EA9C 1EO8H 2YD6A 1MAMH 3JWOL 3MOAL 2OK0H 4DTGL 2DDQH 1FZOA 5GGVY 2GIYA 2J2ZA 2CK0H 5L0QB 1LVEA 4J2XA 2FATL 5TFSL 1M05B 3MV11 3RTQA 3CSYB 3Q6GH 3SHSA 5CJ5A 3UYRL 3MRLA 1KN2H 3HC3L 1ZHNA 3OAUL 5IQ9B 4X4ME 3O3DA 3BEVB 3IJSB 3WFBL 1O0VA 3UEZA 5E2WH 2EH8L 3B4NA 4QHNB 3W0WB 1BFTA 1ZE3C 5DMJB 3ZE2E 1DJSA 5IR1A 3VH8G 3LHPL 1E6OH 1FNEA 3L6FA 3PWLA 1PZUB 2I60H 5DJ2B 3IGAB 2D31B 4NQEE 4N0CC 1CS6A 1CVRA 1BVLB 15C8L 1QSFB 4C55A 1GGIH 1Z6JT 3VXOA 3ZKXC 3TNMA 3EO0A 1P2CA 5TDOA 4V2BA 3R4DA 2AEPL 3BX7C 2YMXH 2FHBA 4OGXL 1BQHA 5F1NA 3UMTA 3QUXC 4YHOL 2VISB 3EYQD 5EPMA 3RWIB 2V2WA 2YN5A 2IANE 4JRWA 3IFPA 3QUZB 1BEYL 4PJ7F 5FKPA 1RUQL 2I5YH 3R8QA 1ZKAA 5JIPA 1JF1A 4GUPA 5F8RC 1IC7H 3RUGB 2YKLH 1NAKL 5ILTL 2XKNB 1F45A 1BVZA 1T6VN 1ZHKB 4F7CB 5IG7A 5SWSE 2NX5A 4HMCA 5HHXL 3P0VH 3BPNB 2F54E 2JE8A 4PJHB 5IHUH 2W38A 5CEYB 1MY7A 3LN4B 2J88L 3BKJL 3F7YB 4OJFH 1S7VB 5DD3H 3QNXA 1T3FA 2LFGA 2UWEE 3O41B 1CD1A 1ETZB 3UTZB 1MWAH 3TZVB 4CGTA 2ADGB 3DETD 4FQPA 5IMMA 3ULUF 3AU1A 4LVNB 3UZEA 4Q9QH 4PLKC 1ZHBA 4XPAL 5EOCJ 3VXMA 3EHBD 3G6AA 5DEFA 2R15A 5E8OA 4FNLL 3RZCD 3O3AA 2NTFB 1D5XA 2Z4QA 5IFJA 3ROLA 1SYVB 4JDTH 2NY5H 4CKVX 1D5ZB 5D6DA 2V7HA 5FUOL 2WWKT 4PP2A 3IXAB 1AGBA 2EIDA 4WFHD 5DEGA 2XFXB 4L8CB 3M07A 5C07A 2XA8H 3THMH 3MUGA 2QADD 1I7RA 3BQUA 2P5WA 2NXZC 2PW1B 3QIUA 4MXQC 3ULVL 1SY6A 2R1WB 1CBVL 1C5DA 1K4DB 1UXWA 3GMLB 4S1RH 1A6VH 1U8PB 3S35H 3UX9B 5E5MB 1ODAA 2BMKB 3ARZA 2MKWA 4RWYL 5LGHL 5IB5A 5BRZE 4XPFH 5E08L 3CX5K 1FYTB 4Z7UE 2FDBP 3B5GA 1NCAH 3VFPB 4M62H 1XGYH 4JFQA 3GUTA 4CVUA 4OI8A 5HVWA 3C9NB 1CDIA 3MLYH 2I26N 4EIGB 2WP3O 5DK0B 1X7QB 2ATKB 1CDUA 3RX7A 4ZNEA 1TQCC 2QTEA 1XF2A 4DFIA 1BMGA 4WWKC 2ZUQB 5IKCA 1HH9B 3IXTA 4HUWB 5IVOA 2NZ9D 4QRQA 1OAYL 4JJ5B 2YA1A 3IJYB 3ZZ1A 5KSAC 5F7EL 2ZPKH 3M1BB 2CIIA 4AEHH 4KVCH 5BV7B 1F2QA 2V2TA 1TZGH 3QFDA 3LB6D 4CDHA 4DZBA 4Z5RA 2AQ3A 2PETA 1UACH 2H9GB 3SE8H 4K3HA 3RVWC 3VI4E 4E41E 1RHFA 3E6FB 3QWQB 4RMWA 4LHUA 2BSTB 7FABL 2R0LH 5I8KL 1UB6B 2F53A 3DSFL 2FECI 1S9XB 4YK4C 5INCB 3TBWA 1BBJB 4LPXA 4Z18A 3ZKSD 1G7PA 4Z7OF 3GIVA 3D6GA 3WS6C 4PJ5B 3MNWB 4NFBA 2P46B 4RA3A 3DXAE 2DLHA 1KXTB 3LH2L 4UILL 3TGXA 2ARJQ 3HG1D 1LK3L 4PJDB 3DMMD 2FYYB 1CLZH 1KJ3H 4LFHG 5D7SH 4BZYA 2J8OA 4Y16A 1OD7A 1RURL 1N6QL 3VCLA 1ZGLA 5DMKA 3O45A 3VG0L 1AIFB 1FVCA 4N5EC 3ZDXE 4NQSA 2W0LA 1XF5B 3ZHKA 5GRJL 3O8XC 3F6IA 1A7OL 3CFDA 1NJ9A 1I7UA 1TLKA 2Q7NA 2GW5A 1XEDA 3HHRB 4YO0A 4WI6A 1RK0B 1DBBH 3QT2A 5EU3B 1WFUA 4EI5C 1BVKA 5CCKL 4RZCA 4X4ZA 3NCBB 4ALAH 5BOZG 4RAUB 2V6HA 1TVHB 2OI9B 2NQCA 1OCWH 1JPTH 2UZIL 3TJEL 2BSRB 5TE7H 5CGYC 1VACB 2QQNL 4IS6B 5DUBA 2OSLB 1PG7W 4JVPA 1DVFA 3VXPB 3RDTB 2GSIA 4L4VB 2Q8AH 4RGMC 3NCCB 3QCVH 5E2JA 5EBLB 3ME0A 3H9YA 4U6TA 1YEGL 4HEME 5GGTA 2GY7B 3WJLA 5MEOA 2XZAL 5ACZB 1KOAA 5L8KB 3WFCH 4EUPA 4OCYH 5EBWA 3QIWC 3UBXA 4ZQKA 4LEOA 1UCBH 4ESKA 5JA8B 1U8HA 1X5LA 3JZ7A 1NDMB 1F90L 2NX5E 4JKWA 5CJBA 3FFDB 2APXA 1YMMB 3S8WA 2FX8H 3LS5H 1DBJL 5IGXL 4JB9L 2FB4H 3BPLC 4KKLC 1DUZB 2XWTB 4HIEB 1E4WH 5HHOD 4NZRL 5LBSH 4MA7L 1CFSB 1FZMB 4KRPC 1R5IB 5GGUB 3RVTC 2X41A 2W65B 3RPIB 3VXME 3U7YH 1MFDL 1O5DT 1MQ8A 3PWVA 3WNPA 1JRHI 1KJ2B 1MFNA 4XPHL 1YEDB 4QHUA 1YEKL 4R2GD 4PRDB 3BIAX 4LPWA 2ZUYA 4JEGB 4NP4H 4YR6B 4KAQL 4M8VA 2H6PA 1AGEA 2F9BT 2AXHA 2X9XA 3V0VA 3ZL4H 1QSZA 1HKLL 4HWEH 4BQ8A 5C07E 2X44D 2HP4A 2NY7H 2P5WE 6FABH 4NT6B 2O5YL 4FFWD 4JO4L 4L5FL 4Y4KD 4HS8H 1GHFL 2DQTL 3TO4A 4X4XB 5DUML 3O6FA 1U3JA 4V1DB 2EC9U 3FB7B 4D0BB 1UC6A 1KYOJ 2HFGL 1BAFL 4F9PA 2B0SH 4Y4FB 5JR1H 4WI3A 4RRPA 4XVSH 1WF5A 2MWCA 4QOKD 4G9DB 1YYLH 1J86A 2EDLA 1NC4B 1KXVC 1YMHB 4ZNEE 4NQDD 4JO1H 5D1ZB 4W4OC 2BNQA 1DSFL 5CBEA 1PSKL 4MMXC 4P2OC 2DWEA 1CDBA 4LAQH 2WBJD 2P8LA 2CMRH 2H3NB 4GAYA 4YH6A 3MCKA 5J4MA 2IEPA 1IC5L 1IEHA 4Z0XA 2I07B 4ZSOB 4OUUB 3HE6A 3HS0A 1IM3A 5DRNB 3QHFH 1BJ8A 4LCCC 2F74A 2I25N 4K8RH 4HKJA 4P99A 2KH2B 1JPGA 1NEUA 4NQXA 5CGMA 3BP7A 5HBBA 2F53E 1JGEA 1G7QA 1MH5A 3HN3A 4WI9A 2P5EA 2X40A 4DKFL 2W0KA 4K3DH 2VLJD 3WDJA 2MSPA 3MYZA 2A6DA 4FQ2L 4WW2A 5I1EH 1I1FB 2EEDA 3HZKB 2AJXL 1IM9D 4GRMA 2KPNA 1NL0L 3MODL 5IBTL 4G6FB 2GHWB 4G9FA 1C12B 3VFNA 3LEXA 1WTGT 4X98B 1U8MA 4I9WD 2ZCKL 3RL2A 1JGUH 3T4AB 3VMPA 4L3CB 2IBGA 5K9QI 4HEPG 3H3PL 2VH5L 4KJYA 3SKOB 2GJ6D 3HPLA 2C1OA 2BOCB 3I02B 2W60B 3MFGB 5AUMA 3HMXA 1MJJA 3WEXA 3LKPA 3QXVA 1S7QA 2OP4L 4IRJC 4YHIA 5J0BA 4ETYA 1BGXH 2DMBA 3GZKA 2VABA 4NJAL 2DS4A 4KKCC 1S7UB 5I17B 3QBTB 4DCQB 2HVJA 4Y5YC 4Z76A 4P5TD 3S37X 4W6YB 3TBTA 4WEMB 3BKCL 2XOTA 5EU4B 1X5IA 1HHHB 4X80H 3TVMD 1DBML 1KLFA 2CSPA 3SGKC 4KWUA 4N0RA 2L7JA 4RQQB 3T0DA 3H9HB 1K8IA 4P23A 2E27L 1U3ZA 4PJ8D 2CRIA 4AMKH 3KPSA 1KLUB 4GW1A 5EZJB 5GQBA 1QZ1A 3G04B 1CZ8H 2PXYD 2NY4B 4N8VB 5JOFA 1IEAA 2FHCA 1MIML 4N0FA 4I1NB 5FKAA 2OTWA 3NCEB 3E6HB 3QWRD 1MJ7L 2DL9A 3KLAA 2VYRE 4JKPL 4LSQH 4LCWB 3QPQD 2XRAH 4U0RC 1U58A 4W4NA 4Z78B 3SDAC 4OIAA 1P9MA 3TN0A 1U6AH 4KQ3L 1IC4L 1LWRA 5C0BB 3C8KB 3L3GB 3VRLF 4QT5A 5DQ9B 1SBSH 4AK1A 2R0KH 4P2QB 2VDPH 3A6CL 4S1QL 4QRPA 2E7LA 1HXYA 3BMVA 1V3LA 1U95B 3MBEB 3OV6A 5FK9A 1MRDL 3LKOA 3VXQB 3D18B 1KCVH 4HUMB 1HQRA 1WBYA 3H7BB 4ODXB 5C09B 4HK0B 4K2UL 3S97C 5GS1A 1PBYA 5F1IA 3QCUL 1BFVL 1RULH 2P24B 5EZOH 3BW9A 3TF7C 4PJCB 4LMQI 1AGFA 3KXFA 1A7NL 4HWBH 3CZFA 4Z7QF 1CFQA 1J8KA 3F62A 1DUYA 4UQ2A 3VGEA 4LLUA 4X6BB 4BQCA 1QP1A 2A73A 1QSEB 2X89A 3L7FA 1HZHH 1N0LA 5LG1A 3VH8B 1I3RA 3GMOB 4D9RE 4JO2H 1IGCH 1ZMYA 5HVGB 2EDDA 5L2KD 4O02H 3PABB 1FCGA 3IFOB 1FDLL 1OTSD 5T3ZH 3DURA 4XXCA 4JFEA 3FQUB 2MMXA 2B1AH 2JCCF 3V4PL 1N0XH 1NFIB 1VFAA 2IAMD 1QFWH 3CVHB 4ENED 2CDEB 4HLJA 1Z0MA 4KI5F 1BIIB 3QEQD 1RFDH 4MD5A 1WICA 3G5YB 1IFHH 2BNQE 4MJ2A 3MJ7B 5BZWB 5MERB 1VGKA 1MFEH 1CCZA 3EO9L 3D85D 1SJXA 4HUKB 1F6LL 4KU1A 3S4SG 5C7XH 1MAML 1RAMA 2GSGB 2OK0L 3TPUA 2DDQL 3FQXB 5TPWH 1I1AB 3MRMA 4GW5A 3QEHA 4M61A 2QV2A 4PGBB 1ZTXL 5DJ8A 4C83B 3VFMA 1GZPB 5DI8B 5HGAA 4RMVA 4UQ3A 4P2RA 4D9QE 3GRWA 4G42A 3VMOA 2AV1B 2ESVB 4YAQB 5ITFA 1E6OL 4FFZH 2P5EE 4RGND 4XPTH 3VD5A 4OBRA 3PWPD 2I60L 1E28A 5T1KA 4NDMA 3WS3A 1S3KL 1U93B 1GSMA 2VZTA 1M1SA 2OQJA 4KRMB 1PKQB 1TTGA 4APQA 4PR5A 3BZFA 3PWUB 4OCWL 3EKCA 2YMXL 3RNQA 1XH3B 4G9FE 4LLQB 1AKJB 5J56B 3T3ME 2V7NB 3W11D 3RVVC 4A6YH 4LNVA 4YPGA 2I5YL 3V5KA 4EQ3A 3H9SA 5TF1H 1IC7L 3BVNA 2YKLL 1F8TH 1A5FL 4J3OC 5JXEA 1EPFA 4J6RH 1V3JA 2GFBA 1T04B 4S1DD 1FGNH 3EOAB 5F7MC 5C0IA 3L5WB 5DMIH 3P0VL 4G7VH 4RAVA 3K80A 1SM3H 4HGWB 3O4OC 3QH3A 4MJ6A 4YBLC 3B83A 2K3TA 4OJFL 3G6JB 3ZYIA 1AR1C 5DD3L 1KT2B 2X4RB 1U8JB 4OTXH 1IQDA 5DS8B 3Q1SH 2XKSA 1OGAA 4D9LH 1G0XA 3GI9H 1IEBA 1G7IB 4HC1A 1MWAL 3RIFF 3OKMA 1K85A 1EAJA 3PWNB 3V6FA 3DI2B 3W0WD 5E4EB 2WWKO 4NOBA 4GXUM 3WXWL 4ODWB 1AE6H 4S0SD 4XCCL 4O51A 5GJSH 3FAWA 4P5KA 4MA8H 4I4WA 4H5SB 1A47A 5C1MB 3FHQA 1HHIB 3VWKA 4JDTL 2QL1A 4MNGB 4H20L 3KPSE 1QSFD 5DHVH 3AC0A 4M6MH 3QQ9C 3WIFA 3L3IA 1URLA 5EBMB 3BN3B 2XA8L 2JELH 1XF4B 3MC0A 1E4KA 5ADOH 2A74B 1OP5K 1PYWB 1A6VL 3MREA 4PJBB 3UPCA 3NZ8B 3O2DH 4MCYB 3S37L 3QUZD 2PR4H 4F37K 1AD9A 3MLRL 4H1LA 3WO4B 3RTQC 2V5YA 1NCAL 1R3JB 2YRPA 3UPAA 1PW3A 1UB5B 4PTTB 4M62L 4X0KB 1XGYL 3JV0A 4G8EB 4JFFE 2Q86B 2Q3AA 3QHTC 3MLYL 4LLWA 2NY1C 4XB8A 2RFXA 5HYSA 2R56H 4KMTH 4QRPE 1RU9L 1H0DB 1RZGB 3ES6A 2QHLA 5INDA 2W92A 3L95B 1RZIA 2C26A 2J8UB 4OD3L 3TLRA 1NMAH 3BIBX 2E9WA 3C8HA 3FO9A 3I84A 4FG6C 4P9ML 4ODTH 5F72S 3AMKA 5I1HH 2ZPKL 2X9WA 3TZVD 3INUH 1KEMH 4AEHL 1C1EH 2XPGA 2ICES 3KXFE 3C60B 1N2RA 1WFTA 5IHZB 5AAMA 2VITA 5F6IB 1TZGL 2KQNA 3IDMA 4XRCB 2VXTH 4QO1A 1UACL 3OR7B 3GJFA 1A6TA 1IZJA 1M71B 3FO2B 3OAYH 1B0GA 3WXVH 4MDJB 2WUBL 1UA6H 3KJ4C 4E9LA 4MNQA 1HNFA 4Z7NF 2EIZB 3TYGL 4JFEE 1MCEA 4FRWA 2VDNH 1HI6B 2VL5A 1A6WH 5C08A 4FQJH 3MGOA 3VWJA 1U8QA 4Z7VA 1T2QH 3GBNH 3SO5A 5CEZD 4PJGB 4QY8B 4I5BA 3EYVB 4NNPH 1JYXA 1FZKB 2R23A 4MCZB 1M7DB 1FYTD 1CLZL 3P3YA 1KJ3L 4H0IA 4LLVB 5EWIH 4OCNC 3DBXB 1SEBB 4HIHB 3TP4A 4GMTL 3MNZB 1JYVA 1CWVA 1MJ8L 2A9ML 2YOCA 4HKBA 3DRQA 4P2YA 5J1AB 1EO7A 4CU7A 1FZJA 3O3EB 3RAJH 5MI0C 4MAUL 4JO3H 3MRNB 5DTFB 4BSVB 4HH9B 3RNKA 4U1SA 1MI5A 4KZEH 1BFOB 4OM1H 1UZ8A 1XFPA 5IB2A 3QUYB 4YDIH 2HA1A 3ZKXB 1A3LH 1NDGB 2AXFB 4P2RE 1TCRB 2VNCA 5D6DC 4D2NA 3BT2L 3OKEA 5EB9A 1T7ZA 1MVFA 1RSFA 3AAZB 3MA9H 3QUXB 3BWAA 1PX4A 3QULB 5FB8B 3S88H 4PJAA 3BQUC 1UADC 2B4CC 1J5OH 4GXUN 1K5NA 4HAGA 1KENH 5KSUB 1T21B 3NVQA 1OCWL 4LVHB 1JPTL 4ZOEA 4HT1H 5FHBH 4U6VH 4XVTH 5H8DA 4G6ML 3IS0X 4WTZG 3IT8D 3WNMA 1ORSB 4NSKA 1TQBC 3RWGA 4WU5A 2H45A 2IBZY 4PJ5D 3LQMA 2VLME 5JQ6H 4IOIA 1RJLB 2VIRA 3WUWB 3WFCL 3P4OA 2DQJL 3E1F1 3OKYA 4OCYL 4P59H 1BD2E 1DE4A 1T20A 3FQTA 4L8BA 1UCBL 2VB5A 4JFZL 3BMWA 1MLCB 5D93C 4A6YB 3C5JB 43C9B 2O5XH 2FX8L 4GRWF 3S36H 1TZHA 4JFDA 2FB4L 4ZFOL 4Y89A 3ARFD 5GPRA 3V7AE 5FYKD 4TTDC 5CJQL 3IDIA 5FAAA 2VZUA 5C0CB 1JGDA 4OZ4B 2FHFA 5LBSL 2W07A 2DQGH 3QDGA 1OGAE 4ELMA 3O2WH 5D7IB 3ARUA 1VB9A 4I0PD 1H8NA 4NUGH 3I2CL 1ZT7A 2NXZB 3AUVA 4LQFH 1P84J 4TVSa 3L5IA 2QEJA 4BH7A 5SX5K 4OCMC 3T0XA 2WAHA 4YHKH 5E0QA 3GSNB 1FYHB 1NMCB 1YPZF 3GSXB 4PRIB 5KS9A 4CJ1A 1WBXA 3QSKB 1UT9A 3BUYA 5CZXC 4HWEL 4JREB 2OL3B 3ZL4L 3BGMA 3RDTD 1KJMA 3ECBA 4L4VD 2EYRB 5I1GH 2CDFB 1NGPL 2FSEA 2NY7L 4RSVA 4Y16C 1S8DB 5IB1B 4RISL 4K9EL 5FECB 1WISA 1IAII 4GRLA 3DV6B 3I6LD 3Q6FB 3T0EA 4X6CF 4ORGA 4UT6H 5KSAB 4OZIB 4GO6B 3C6SB 5KG9A 2QHRH 5FM4A 2C1PA 1OF2A 1YPZE 4N9GA 1YMMD 1XGTA 4YGVA 5F7NC 5ISZB 5HI3D 1I1YB 2HMID 4J4PD 2NNAA 1AP2A 1LDPH 5H94A 4J8RB 4X6EB 2D03L 1L6ZA 4QWWD 3DROB 4PS4H 1A7RH 3KGRA