2V6HA

Crystal structure of the c1 domain of cardiac myosin binding protein-c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
b'DDPIGLFVMRPQDGEVTVGGSITFSARVAGKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOSIN-BINDING PROTEIN C, CARDIAC-TYPE
molecule tags Cell adhesion
source organism Homo sapiens
publication title Crystal structure of the C1 domain of cardiac myosin binding protein-C: implications for hypertrophic cardiomyopathy.
pubmed doi rcsb
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v6hA00
3RPKA 3R0NA 4YHLH 3O6FA 1V7MH 3EYVA 5FKPA 1CXLA 2E6JA 1RV6X 4R7NB 4K94L 5F7YC 3I75A 1S9YA 2YA2A 3V8CA 3SJVD 1FIGL 2MCPL 4RBPH 3GSOB 1DDHB 3QRGL 5DUPL 5JUEH 2EDLA 2FH6A 2QR0A 1T1YA 3PQYA 1CE1H 4OGYH 3H9HA 4FXGB 1ROWA 1LE5A 3BSZL 3RWJA 3GSOA 2PW2B 3V2AR 4LLYA 3MGTA 4LLUB 5IEKB 2EEBA 2XTLA 4G8IB 3CGTA 4AIXA 3PDOA 4PV9B 4NKIL 5KJRH 1V5JA 2EDYA 3AGVA 2GJZB 2NY0C 4X6FA 1N7ML 2ICWI 4HIXL 2GK0A 3PABB 1SHMA 4MXVE 2NXZB 4WI7A 1SVZA 4K71C 3RA7L 3P0YL 1CFQA 3FO1A 4JDVA 5IB1B 1S9KC 1CFTB 3QIWB 4O51B 1I9JL 5HYFA 1N64L 2N7AA 1NBZA 3VXSE 3UTZB 4JRXE 4K8RC 3TN0A 1T04B 3KXFE 1FYTE 3EYSH 3K2UL 5IW6A 1MHPH 5D93C 2I24N 3NFSH 4FS0A 1KC5L 1II4E 2DLTA 2NTSP 5ID1B 1T1YB 2OJEA 4TSAH 4O58L 2W0KA 4D9LL 3BVNB 3HUJA 1U3HC 2XT1B 1UA6L 1GOGA 1PBYA 2ZUTA 1MIEL 4HKBB 3RX8A 4XP4L 2QQKH 2XN9D 2B4CC 1PSKL 2HFEA 4R7NA 1ZGLP 1N0LA 3KWWB 4GBXD 5IJVB 1AD0A 1RUQH 4JM2D 4OAWB 1YEHL 3C5SA 2Q6WA 1QUNA 5E94B 3FFCE 3QI9D 5IESH 2NY2B 1DLFL 3GMQB 4LHUB 2Q86B 3DETD 3R8QA 1EVTC 1MRDL 4UZGA 3L7EA 1BJMA 4N0UB 1UB5A 4AT6A 3HE7A 1NMAL 1HILA 2AABH 4L9LB 3RGVC 1AHWA 3RGVD 4GRMA 4GG6B 1N2RB 5HYJB 1M1SA 3TH4T 4NZUH 4R90H 4HJ0C 5DMJB 2ZPKH 3TZVB 3QUZC 3MRNA 4AIOA 5IM7A 2I27N 4Z8FL 5E5RB 5FOJA 3UTQB 4U1JB 3RKDD 3N50A 5D8JL 3O6KL 1S7QB 1S7WB 5E4IA 1IL1B 2I5YL 5E08L 4RFOH 1EAJA 1XIWD 3D2UD 5F8QC 4OV5A 1KTLB 1TZIA 4GXVL 4FABH 4K55A 4Y4HB 3CFJA 2JB5H 1M7IA 5HY9A 5DHYA 4JVWA 1NEZG 5E94A 4LLMB 1WBZA 3KLAB 1G9NL 3RIAF 1BQHA 3FT4A 5BVPH 4LP5A 3FO2B 5EB9A 4LCIH 4ORZC 3HZYB 5I8KH 4XB8A 5FKPB 1GZPA 3SE4C 5DJ8A 2R9HD 1QKZH 5F71A 3RGVB 2R9HC 3OBAA 1P7KA 5DHVB 5JPMA 5JXEC 4K3JH 2C5DC 4WGVB 2FD6L 5CGYC 1JZ4A 3L9RB 4N8VG 1YEGL 1QVOA 3CFCL 1HINL 1BX2A 4F7CB 3FTGA 1DE4B 2D9QB 4YK4B 1BVKB 2F53B 5JORB 1CFSB 1JFQL 3CXDH 3JV4B 4D0BB 1VADA 3KPQB 4Y8DC 1RQ5A 2IALB 2PYFA 2ZUXA 1XGYH 2UZIL 2V17H 3RVTD 2EDQA 3W0WB 4NNYA 1R5WB 1CK0L 5ESVB 3DVGA 1WIPA 4FQLH 2XKNB 1YEFL 2F5BH 4RFNB 2Z9TA 4W6WB 4HMEA 3EHBD 4XBEH 4JFDB 3NPSC 1AR2A 1X5ZA 4JANB 2R2HB 2P44B 2P8PB 3WFDH 4JRWA 4IHOA 1HSBB 1NCAH 4FQLL 3BZDA 5E03A 5E6ID 3U4BL 1Z0NA 4PJBA 5E6IC 4X9HA 2HJFA 1Q9KB 5GRYA 3P4OB 5FGCB 2MQ3A 5KSVA 2BSTB 1AIFA 4ZUVB 5CBAB 3HAEG 2E7BA 2QL1A 4J2XA 3F6LA 1NH6A 3EYQC 1HYSC 4YH6A 3O0RH 5KANI 4Q6IA 2X40A 3V4UL 5CGMA 2Q7NA 3TZVC 2AQ2A 3VXTA 3NMEA 3TZVD 2P24A 5GSVB 2VERN 3O2VH 4Y19E 4NRXA 3QEHA 2VKXA 4XP6L 1T83A 1H15A 2BHZA 3QIBC 4YHPA 3GSVA 3IU3B 4UTBH 4OF8A 3LZFH 1KBGH 1FJ1B 5I17A 2P45B 1ZE3C 5EORL 4LCWA 2E7LA 4RZCB 2H8PB 5AZEL 3CMOH 1S3KL 1MAML 4DCQA 4WU7A 4G8FB 1DVFB 4R0LB 2VDNL 1MVUA 4QHMB 2X1XR 3TT3L 4TNVF 1HOCA 2DQCL 2AJVL 4QO1A 2FYYB 1MVFA 3MLVL 5L7XH 2O5YL 1C08B 4KJWD 2H8PA 5FGCE 3QDMA 3TN0D 5ESVA 4YFLI 2JJSC 1ZHLA 4NNXB 3NIFF 2G5RA 2D7QA 4XAKE 1NMBH 5JW5A 5DJAB 1CWVA 3ALPA 1FFRA 4OLZL 1JWSB 3GBML 3QDJA 1JF5A 3ZYIA 5DWUL 4XCNA 1UJ3A 3TBSA 3GMMB 4XC3L 3MUJA 4I9WE 4NKDA 1A64A 4GJTB 4U6VH 5KVGL 2JIXB 3WN5C 2Q20A 3C6SA 3W5NA 4XP1L 2RCSL 3AB0B 1JPST 4JRXA 3UTSE 1WT5C 4EIZC 4EI5A 1F4WH 1I1YB 3HE7D 5CBAA 3LKRA 3BXNA 3CLEL 3L5WB 2W9EH 4MCZB 1YEIL 4X7EC 1BF2A 4O02H 2D3VA 4DKEL 2CDEA 1CFNB 1KFAL 3UEZA 3MJ9H 1RY7B 2DKSA 5D1ZD 3V8OA 1N5AA 3F6IA 5I74B 1TVBB 1AE6L 4M1CD 4C83B 1FQ9C 1IGJB 2AAVA 5FYLD 1OTSC 5E00A 4AG4L 4PJHF 4B7LA 1OTSD 1MPAH 3B9DA 4Z7WE 3KYMB 5HVGB 3S98A 3LRGA 5DFWH 1I9RL 2EDEA 1NCDL 1IQWL 2O5ZL 4WDIA 1D5MA 4G9FD 5FOBA 1INDH 5DEGA 3K1KC 4QRPD 4L8DB 1QVOB 4U0QB 4X7DC 3C6LD 4YO0B 4JFEB 1FNAA 1JPFB 4PJFA 4M8QB 1IAOA 1JMXA 3SDCD 2JK5B 1NUDA 3SDCC 3C5ZC 1KB9J 4DFHA 4RQQA 4KRPD 4KI5C 3HE7B 1NBQA 1MCLA 4QWWD 4HXBL 4MDJB 1TJGH 3PWLA 1RK1B 3D1MC 1HDMA 3GMMA 2VXTL 4Z76B 1FHGA 3GSNH 1S9XA 3G5XA 5ACZB 2VQUA 4JFYA 1P84J 3TYGL 4PLOB 3PJSB 4O00A 3BO8A 3MLPA 3ZTNH 3O3AA 1IGFL 3QSKB 4ODWA 4OIAA 3UXFA 3F7YB 3CFJB 1I1RA 5DJYB 3NVQA 2V7HB 3U7YL 1DBBH 2VLMD 4ZYKB 3TJHC 5GGTA 4OUUA 1V8HA 2JF1A 4MXWH 4P5MA 5CEZL 5IT2H 1YEJL 4S1SH 1FVEA 3CPLA 3UJTH 1FLTX 1YEKL 3BJLA 2HRLA 3CD4A 4WW2C 3ME0A 4CMHC 4ZXBD 1AH1A 5CS7A 1NGZA 3L95B 3OMZA 1ZA6B 3PHQB 4YQXH 1YJDC 3FOLA 2BDNL 3L3IB 4M6OL 4G5ZH 2ZCHL 4M6AA 3PIQB 1CD9B 1A6ZA 4MJIE 5DMKA 5I15L 1LEGA 3DUSA 4WW1A 2E7HA 5JW4N 1KEGL 1LO0L 4NZUL 4R9HA 5BMFL 3V6FB 2KPNA 5IJKA 1CXEA 4E9LA 5EO1B 5D8JH 3RVVD 4UOW1 1WFOA 4KHTH 3N1FC 4YK4C 4LMQI 1VA9A 4TVPH 5C08A 3EZJB 4HUMB 4J1UA 4NUGL 4NOFA 4XWOD 1A7BA 2DQTH 2OK0H 4JO4L 3MA9H 4FQQB 5EU6A 4Z78B 2ADJA 3MV11 2XXMB 2AXHA 2A9ML 1M7IB 5E99H 3G04B 5J13B 1A9BA 1QHPA 2P43B 1PGRB 2VYRE 5GS3A 4AK1A 5DMIH 2YKLL 3THMH 3MODL 4I4WB 4EVNA 2CDFB 2BXYA 3CUPA 3T0EB 1PW3A 3MRDB 5F72S 1YDPB 1UB6B 2UUDH 3AXLA 5D7IE 4JFFA 4OLUL 3MV9A 4ELKB 5I1LA 1K85A 3EJZD 4L3EE 5HVWA 3EFDL 4DEPB 3EJZC 3WNKA 1Q8MA 3RTQA 3EYUL 1WEJH 4ODSH 1OARL 4BSJA 3FO9B 4GRLC 3O4OC 4ONHA 4WHCA 1ZSDA 3ARUA 3AREA 3QQ3B 4D2NA 2J2ZA 3HG1D 3T4AB 4OI9A 5DYOA 1N6VA 1OARH 2A6DB 4I0PB 3PL6D 1D5IH 4J8RB 2C1OB 4OGAC 5JXAH 2JCCA 3D39B 2BK8A 1IEBB 1KLFA 5D70L 3K7UA 1HIMH 2FECI 1A6VH 1DQML 1EK3A 2HVKA 4IDJL 4P9HC 1N7MH 1JBJA 2OL3L 4I8DA 1T1ZB 2QQLH 4MJIA 4PG2A 2FZ3B 3LKSA 3WS3B 2CUMA 3QULB 1MLCA 2PYEB 3IU4L 4Q6YA 5DT1L 4PJFF 1RZ7L 2ED7A 1KN2L 1DBJH 4XP5L 1VPOL 1KCRL 4CW1B 5F9JB 4JB9H 3D0VA 1FN4B 1K8DA 4IOSD 3T65A 4LBEB 5EZJA 1I75A 5D9SA 5HI5D 3MNWA 5LAXB 4XXCA 1ITBB 5EU6D 1B3JA 3MRNB 5IM7B 1PX3A 4CMMA 3PHOB 1U91A 5E7BA 4NRYA 2BOBA 4PRIB 1UEYA 1A7RH 3QI9B 5EBLA 4XX1G 5L0QC 1PG7X 3MUZ1 2GTWA 2IPTH 4OBSA 1SEQL 4I5BB 2Z35B 4DZBA 2Y5TA 1EPFA 1F4XH 3AC0A 3CLFH 4I0PD 4MDIB 4V2CB 5EIQA 2M8XA 4I0PC 4LDEB 3FB8B 4YHYB 2IADB 1DQLH 4Y19B 4R96B 4ZPTA 2BSRB 1U58A 2A77L 2LU4A 3PXJA 4YX2L 1X7QA 4FZ8H 3U0TA 3IAGC 1OP5H 3FQXA 3HZMA 2F53D 1OAQH 3I2CH 4JZNA 3JWOC 4LCCC 3TJEL 4PJAF 5D7JD 3M1BB 4OZFA 3VFSA 1Z3GH 3P9LA 4Q58C 3TPKA 1LO4H 3BMVA 5E2JA 4P48A 2DL9A 4XX1E 1YNLL 1J11A 4UIKL 5D2LF 2YD8A 3MRMA 3CVHA 2N7BA 1CICB 5TPWL 3DX6A 4HKZA 4M5YH 5MENA 5T3XL 4C56A 2NZ9C 2X9XA 3LH2H 1FORH 1I7UB 1OCWH 4NQDD 3I9GH 3QIUC 4OUOA 2HMID 3AREB 4Y5XC 4IRSC 1Y0LA 2QQNL 1WC7B 4JFDE 1LE9A 1CGYA 2VTFA 4WHYG 4D0CB 5CUSH 3BRGC 1ONQB 1YPZF 4HWZB 1EEQA 3QG6B 2X4NA 4MA8H 1OSPL 4OFYD 4WI6A 5FA3B 4XVUC 2W91A 3AMKA 1JRHL 4NHUB 3P9WB 1JNJA 3FAXA 4YAQA 2X4QA 2EYTA 2P49B 5DI8A 1LK2B 1I9EA 3FN9A 4MXQD 5CEYA 1NDGB 3P77A 2CDFA 5FK9B 1IM3A 2XZAH 3MRGB 2P1YA 2H3NA 3MV8D 2HT3C 3E3QC 2YK1L 4NZDA 4OF7A 1F6AA 1A0QL 3WHXB 3L5XL 1NFDF 4DUXA 4Z0XA 2DLHA 3BAEL 1KLUB 4G9DA 3AB0C 4TSBH 5JR1L 5JQHC 4WFGE 5D2NB 3C2AH 3HI6L 1GIGH 4JZOA 4YPJA 1GC1C 4O9HL 3ARGA 5FCUH 4P4KD 1S5IL 3N1GC 3IU3A 4NQEB 4KVNL 5FHAL 2OTWB 4WY7H 1R3IL 2WSKA 5IB2A 1T03L 4PRAB 4Z77A 4LPYA 2AJ3B 3MA9L 5EDXA 4HC1L 5TDNB 5KSAB 1T0MA 2VL4A 3O2WH 2QLVB 3HC3H 3WS6C 5DJ2B 5IK3B 1ZVYA 1NMCC 1PG7L 4MNQD 2RBLA 4Q9RH 1J5OL 3EDFA 5DWUH 1PKQB 1FGVH 1KT2B 5GGTH 3ULVD 4WI3A 3BWAB 1F58H 3K80A 2IEPA 3CJJA 5HGGS 5E6IB 4AMKL 3BEWA 4HZLA 4F7MB 2ZJSH 2VUOA 3FB6B 3IDIA 1Q9WB 3MV7A 4P2YA 2R2EA 2IMNA 5BMFH 2OMBA 4JN1L 3C60D 3RUGE 3VFUB 4UAOC 1ORQA 4OZGF 1M71B 2LVEA 2VLKB 3HB3D 4YHML 3X13A 4HWEL 3DSFL 3CSYA 3I6KA 1NCBL 5I76B 3R1GH 3MGOA 3CFKA 1JPSL 4P46C 5F6HJ 3FONA 4HX1A 1KCKA 1OTTD 2R0WL 1KJMB 3G5ZB 1NAMA 4I48B 1AD9A 4IMLA 4LDOB 5TQ0H 1F8TL 4X99A 1K4CB 2OQJB 3LY6A 2ENYA 5LGJB 2A9NH 1NUFA 2WQ8A 4LDLB 5HHXL 1U8NA 1VEOA 3AY4C 5HHOD 4QT5A 1NAML 4WO4A 1FO0B 3Q5TA 4Z7UA 4YDLC 1N8ZB 3B6SB 3TBTA 3TM6A 3W2DL 1JJUA 5A2IH 1ZLWK 1T4KA 4GG6F 2P8PA 1FFPB 5FOBB 5JW5B 1QA9A 1UM4H 3MYJA 1I3RB 1MCFA 4L4TA 3H42L 5BVJB 4AENB 1OQOA 3EAKA 1JL8A 2GT9B 4QHUB 3BIAX 3QDMB 4JZJB 1U8IB 5DGRA 4L4TB 1IKFH 5DJCB 5CSBA 4OGXH 3IXAA 1NL0L 2BNUA 3FRPA 4X4YA 5IBLD 3SO5A 1F3RB 4PTTA 5DK2A 1B0WA 1JGVH 3MGAA 4QNPE 1MY7A 3TZVA 3G08A 1NSNH 5ABDE 1GYAA 4HWZA 2Z4QB 3S88H 1QYGH 5GRUL 1X5JA 4LGPB 3RWIB 4F58L 2EE6A 2ITDA 1WV7T 2NY6B 5IMLB 4HG4J 3P40A 1WWAX 2ADFH 4M9OA 4ERSL 3CMGA 5CZXC 1UYWH 4PJ8A 1ZEAL 5CZXD 3KPLB 1MCIA 4GKNB 4MX7A 3QT2A 4IRJB 5D71L 4ODUA 1FNSH 5K93A 2O93L 4WHTB 2DLFH 4CGTA 1G6RH 2HJKB 5CLWA 5KVDL 4JM2F 5I1CH 5KVMC 1M71A 4GAJL 1KN2H 3ARFA 4BFEA 1P9MC 5HPOA 3P2TA 1JK8B 3QEUB 2AKRA 2EH7H 3QULA 1GL4B 4RCAA 4F33A 1U41A 1GC1L 4G7VL 1AKJD 4B53A 1U8OA 3MA7B 3TO4A 2VC2L 4FZEH 1AFVH 1DQMH 1LNUB 2A6KA 5CD5C 2OSLA 3G5VB 4ZPVA 2AI0L 3GBMH 5DZOA 3BX7C 3F58H 2XKNA 2CUHA 2GQHA 4LP4A 1S7XB 2EYSB 2ZKHH 3S5LG 3FCTB 5KS9E 2H1PH 3Q6FB 4QRRE 5D7JA 1BWWA 1KELH 4PRHD 4ZXBB 4PLJC 1S78D 5I17B 3KDMA 3W0WD 1XFPA 3ARFD 3HC0A 2EDRA 4AEEA 5C0AB 4MA1C 5IB5B 3BP6A 2X05A 2A1WH 2NTFB 5TDNA 2FHCA 3EFFB 3KXFB 3MLVH 1CL7I 5EU5B 5I1KL 3W9DB 4G6AC 1NLDL 4G6AD 2VLKD 3T3MF 2DM4A 2YPKA 3V52L 4F3FA 5IB4B 4NWUL 4XBPA 2CO7B 4KDVA 3SGKA 15C8H 5DS8B 2BY0A 3IJHA 4M8VA 1OGTB 4TVPE 1UB6A 5DZNA 3KS0J 5GS1C 2F54D 4RISH 3RL1A 4U6YA 2R0WH 3QDMD 3FT4B 3QQ4A 4PY8J 3TVMB 1HSAA 5IHBA 1QFUH 5BZDB 1JF1B 1CDGA 1OD7A 1T21B 3RY5A 3DSFH 3D39D 4TULH 7FABH 1XF5B 4ZFGL 3FB5A 3MXWH 2CIIA 5F1IB 4UT9L 3N1PC 4KMLB 3O6FD 4NUGH 4H0GA 2EE9A 4MAUH 4NQTA 4YHZH 5TQ2H 4CBPA 3VFGL 3SO3C 4TSAL 1ZT1B 2HFFB 2FR4B 3B9AA 3ZDXE 1NCAL 3HPJA 5J11C 1UCBH 4TUOB 4KVCL 4PJXB 1BJ8A 2VIRB 4BA8A 1J5OH 2YUXA 3MNVB 3B9EA 1D9KB 3F7RA 4PR5B 1JZ5A 4KZEL 5KVFH 3C8DA 1HILB 3CC5B 2BHYA 4NKQB 1EIBA 4G80A 5EUOF 3E2HB 2A83A 1UEMA 1CL7H 1S7RB 5KW9H 2XN9A 1FRGL 2RB8A 4ONGL 1ADQA 1HEZB 5HYJD 5FM8A 4EVNB 3PGCA 4LSSH 4M7ZC 5BRZB 3TF7C 5KSBB 3L3JB 3MBEA 1CCZA 5C0DB 2X9WA 3L95A 3PHQA 2YN3A 1ZHBB 3G6DH 3NFNA 4BUGA 5F9WB 3MLZH 4U05A 1XF4B 2LABA 4O9HH 2EKSB 3OTTA 3KPTA 4C58B 5JA9A 4AEIL 4MXWL 4JHWL 2X5PA 4LPWA 1RZ8A 2X4TA 2F19H 3FB7A 1P69B 3ROLB 1FH5H 2C9AA 1IAKB 3RI5F 1CE1L 8FABB 3GSRB 3BUTA 3DMMC 4Z18A 3A6CH 4JHWH 1MWAL 1ULVA 3F7QA 3N06B 4PJBF 3WBDA 3IDNA 2AJYH 4LPUA 1R3HA 3V6FA 1YNTA 2Z35A 4PJGB 1G7PA 3UPRB 1AKJB 1J12A 3G6DL 3ZDXF 5FHBL 1FVDA 5IOPB 4YHLL 2DB8A 3LAFA 3CC5A 4ALAL 5E9DE 1F45A 2I25N 2X1PA 3IKKA 4J23A 4GOSA 1E4XI 5HVHB 2JK5A 1X5AA 3HMXH 5AZ2L 1KENH 1A8JH 4YO0A 4Z7VB 5A16A 3QBTB 4KFZC 3LN5B 5E6YA 5SWQA 2NY6D 4H0HB 1A7PH 2H9GB 4MMXC 1C8PA 1X5GA 3BQUD 4RMVA 2FGWL 4H8WH 2IPUG 4UOJA 4PJIB 5BS0E 2NY5H 2VR5A 4TUJA 1RMFL 5TPWH 4MJIB 4NQCD 3KVQA 2VMFA 3AVEA 1XCTA 1JNNH 4UIMA 3OV6A 3CFBB 1IGCH 1RK0B 3P4LA 1YN7A 2VABB 3ARZA 4UUJB 5IW1B 5C0DA 5I1HL 3OHXA 4YDKH 2OR8A 4LLVA 3CFKB 5L0QB 4OZIF 3S3PA 3MXWL 5JOPD 2Z8WC 5HI4C 5A40E 4WUUE 1QPPA 1NC2B 3RUGB 1LMKA 2A83B 5LGJA 4JO2L 1VACA 2A77H 4P2QA 3W82A 5C86A 4U31A 5GGQL 3RGHA 3HZKB 2K3TA 3QHFL 1R5VB 2ESVB 5KBNC 2MHAB 3VXSA 3KPPB 4Z7OF 4D9RD 2R2EB 3RKPA 3C9NB 5ESAA 5ETUA 1HHKB 3NFSL 5F21B 4G9FE 1MFBH 1YMME 1ERNA 3PWNB 1CF8H 5CD3B 5HGDA 1U8KA 4R26H 1B0RB 3SGJA 2AEQL 2HLFD 4JQVA 4OTXH 4I77H 4MJID 1M6OB 1MI5A 4LCYA 4F37F 4MSWB 3FB5B 1MCDA 2XA3A 1BBJB 5CAYB 4FZEL 1JWMA 1MWAH 1Q9LA 2D4DA 4G3YH 2VZ3A 1A5FH 3G5YB 1HNGA 5DQ9B 1FFPA 3WHE1 4TUKH 2Y07L 4M6NH 4PJHA 3T4YB 2DRUA 5LJYH 5JLZB 5IF0B 1MQKH 1TJHL 4HFUL 3FN0L 1JWUA 1VFBB 4HQQL 5EBMA 2VDKH 1S7SB 1FNSL 2BX5A 2CGRL 1D3CA 4U7MA 4YHNA 1C16B 2ICEA 1T89C 4YEEA 3MLZL 4OZIE 4GKNA 1UYWL 4I77L 5MEOB 2D9CA 1NGXB 2FX9L 4P2RB 5EU5A 3WKNA 1A6TB 5B38A 1TETL 1G6RL 1B4JL 3BPLC 3NOIA 5C0CB 3KR3L 4M93B 4AQ1B 3BKML 3C8KB 2VQ1A 1MHHB 2HG5A 3QJHA 3VCLA 1IT9L 5E2UL 3QUMB 2VLKA 3P73B 4OKVB 5JOEA 3W5MA 3IVKB 4JFEA 1A4JA 1F3DH 1WWWX 4PBVC 4F37K 2HT2C 4Z0BL 3A67L 1DP0A 5JOPE 5TF1L 5JO5A 1FVCB 8CGTA 5JW3L 4P2QE 3TN0C 4HF5H 4K23L 3MO1A 3LEYL 5BQ7A 3FQUA 1K6QH 3MRFB 3RTQC 4AH2A 3ARBC 4NQED 2VXVH 1LE9B 3P3YA 2RAMA 3HZKA 2H2PD 3GKWH 4MAUL 4RAUB 4OI8A 4ISVB 4NIKB 1MI5D 4EOWL 4JY6B 1QA9B 3IDJA 3N1QC 4KUCD 2NY5L 4OLVL 2BFVH 3HAEA 4OV6F 3B2UD 4O5LH 1D9KC 3BZ4B 3K4AA 4U1MA 1A21A 4WEMB 3RBSA 4HEME 2W9EL 4A2LA 1P4LB 1MJJB 2XN9E 1FG2B 4LFHG 5E70A 2EDNA 5EBMB 1ZLUH 5JOFA 4NKDB 4FQHB 3JV6B 5EN2B 3RDTC 4FMFA 5LKNA 2EE2A 1M7XA 4FXKB 2P42B 3C87A 4G8GB 5MENB 4BH8B 5D7LA 2AEPH 4WI5A 5D1QA 1GOFA 4KUCF 4X5WB 5LVEA 4ODXB 4YXHH 3MLYL 3CDCA 2QSCL 3PUCA 1UENA 2DQEL 3N85L 4PB0L 2O61B 3TESA 2NX5B 4YBLB 1IMHC 3WNPA 3KLDA 4U1NB 3L7FB 4M7KL 2W0FA 4H1LH 4JVUA 4X8JA 2YN5A 3ARGC 2F19L 4UU9A 4S1QL 2PCPA 3H9SD 3OWEA 2X4QB 3MPCA 4DCQB 3BDYH 2KKQA 3BGFC 4PV8A 5HGHB 4PJ7A 5HGBB 2RJMA 1ITCA 3DGGB 4JQXA 3LQMA 3HI5H 3BP5B 4NZRH 4HJGB 4KRPC 3SDAD 4GUPA 4U1MB 4U49A 3HC3L 1L7TH 4QHKI 4HDIB 3ZHKA 5I1CL 3V4PH 1E4XL 1T0MB 1MFNA 3C08H 3REWA 4FTVA 3RI5K 1LO5B 4DW2L 3ZE0F 3FO2A 1MRDH 3L7EB 3BP7A 1J8HD 3QXVA 4G8GD 3GO1H 4CMMB 1ZEAH 5FYKU 3JTTA 4KVNH 5IEHB 1AP2A 1HI6B 2BMKA 4NQDB 3L5IA 3STLA 5EZJB 1ZLUK 4JLRA 1RURH 1I8IA 4UIMB 4UV4L 1FL5B 1DR9A 4ZODA 5T3XE 5TE4H 5E8OA 2P5EA 2RGSA 5T1KD 1T03H 4OM1H 1SJVA 3S88L 1Z9MA 4NNPL 1KTRL 2DYPD 1MCWM 5DD3H 4WFHE 1S7VB 5KOVC 4RWYL 1DQQA 3QPXL 3OGOE 2YSSA 4ZPTB 4YBHA 1A9EB 1MHPL 3VFVB 3TO4D 5C8JB 2DWDB 2H26A 5CCKL 3CSPA 3HPLA 3RWEB 3OG6B 1KYOJ 4YDIL 4Z7NE 5M7QA 5I75C 2AW2A 4LLAA 2AK4D 1W72A 3MOAL 2WNGA 4O02L 3VDAA 3CSGA 4HULB 1C7SA 5I1EH 1HKLL 1YMMA 4UDUA 4MA8L 4MQXD 4GAYA 4CVZA 1BGXH 1CT8B 4HUVA 3JZ7A 4WO4C 2GJZA 2LAGB 3RGVA 3DIFA 3UX9B 5AYQA 1HH9A 1YYMH 3ZTJH 3SCMD 5BZDA 4O4YL 3LQAH 2NXZC 1R24B 5DXWA 2ZCLL 3HZYA 3OKYA 4Q74A 5T3ZL 1MCKA 5I9QC 5IROA 1OP5K 4I2XB 5EZIL 4NN7C 1JRHI 5E8EB 4ZNEA 2Y36L 4RIRB 3AS2A 2W9LA 4PIRF 5FO7B 3MRMB 4S0TD 3WN5B 4ZXBC 5EO1A 5INCA 1X6LA 3PV6A 1B4RA 3AS1A 3D9AL 1MJ8L 4N1CA 1FORL 3LH2L 4K7PL 3D39A 1JV5A 4ZTPH 1BQLL 4RAVB 3L6FB 3ZDYE 4OFDA 2WLYA 4YZFF 1J86A 4EOWH 3RWEA 1KLGB 4V1DB 3VFRA 4XPFL 5BXFA 5JIIA 5A43C 1EAPA 1S7UB 3GBNH 1F3JA 4CUCA 5C8JA 1N6UA 1AR1C 2EDTA 4YXLL 3FB8A 1P84K 1MREL 2YPLD 3OKOB 1NBYB 3S4SG 1FPTL 4QY8B 3LV3B 2Y5TB 4W81A 4EDXB 1QOKA 1L9MA 4X98A 2EKSA 2IAMD 3LVEA 3VMOA 2YOCA 1DSFL 2NZIA 4MJ4A 4JJ5A 5E2UH 3H3BC 3Q5OA 4RGNB 1CD0A 2OTPA 3WHE0 3EJYC 3L3IA 4LIQL 1E4KC 4UBDD 1ZT7A 3KR3H 5C0AE 4UBDC 1CG9A 4EI5C 3MC0A 2IBGA 1T21A 3CX5J 4YLQT 3KWWA 4APQB 3L3GA 1OT2A 3H6JA 3TO2A 3ULVH 4UB0H 3VFMA 1OVZA 5E8EA 4CVUA 4HJJH 5EC1B 4XVTL 1EV2E 1X7QB 5TF1H 4OGXL 4EQ2A 1RZGB 3DROA 1JPFA 5SWQB 3WKML 5HGBA 4JDTH 5JMOC 3PJSA 3H9SE 4YJZL 5ESQB 1NEUA 3TBYA 4XBPB 1CT8A 1CICD 1IC5H 5SWZA 1F3DJ 2DWEA 5E1AA 1FE8H 5B38G 4NZJA 4V1DA 1QEWB 3F7VA 1MLBA 4PRNB 4H25A 3HCVA 2YS4A 4WUUA 1T5XA 2BERA 1GH7A 1IGIL 4RGNE 3FT2A 3DBXA 1DCLA 1WEJL 2W65A 2VXQL 2GYSA 2A73A 4UT7H 2ESVD 2EDFA 3O9WA 3S5LB 4P9HL 1GGIL 2KL6A 3FCTA 1PYWA 1G7HA 3QIBA 3SDCA 1OF2A 5TQ0L 5D7LB 5ALBH 5KS9B 2HJLB 3Q48A 3T0VA 4XNMA 2ZG2A 1IC5L 4F7EA 2NXYD 1NGWB 4OZHB 3CVIH 1A6UL 5HYIA 1NLBL 1U3HA 3WFBL 5DJXB 3SDYL 4HG4K 4KJQD 5IB4A 5ANMB 1BOGB 3G6JB 3QR2A 4KJPD 1BIHA 5TH2A 4WFED 2BJMH 1J1OH 2XFXB 5J1TC 3ZKND 3FQNB 2G5BA 1GGYA 3IDJB 5C0BE 3BE1H 4HK3N 2L7UA 4YHIB 2A6DA 2GAZB 4JPWH 2OR7A 1LO5A 4ZMAT 1JUFA 2YXMA 1S7RA 4PJ8C 3KLHD 3SDDC 2A9MH 3OAZH 2B4CH 3HAEH 4ZSOB 4DWHA 4BK4A 2XV6B 1FIGH 1RVFL 3RX5A 3FOMB 5IV2B 4NKOA 3IKCB 4D3CL 2BVEA 1KXTB 4TN9A 3QIUB 2UV3A 3PABA 1AGBA 1RZFH 43C9A 3E3QE 3EFFA 1CLOL 3MRJA 3QXDA 3L3OA 3IXAB 1X44A 4XPGH 2MKWA 3RL2B 4APQD 1QFWM 1UACH 1X4ZA 1A7OH 4P2CG 5INDA 3QDGD 1MREH 1YEEH 3O6LH 5D7JB 3QFJA 4Y16A 4L1DA 5DJ2A 3JXAA 1WCBB 2VLRB 4JPIB 4KAQH 2HN7B 3VD4A 5I15H 1TVBA 5EC2A 3ARPA 1MUJA 1P5VA 5HVFB 2BC4B 2LVCA 4WEBH 1FSKC 1NGXA 3VWJD 1N3NB 4QYOA 2X10A 3L5WA 1VPOH 5F89B 5DJYA 2RQ8A 3GM8A 3D69A 5D2NC 4MB3A 3PP3H 1JYXA 4S2SB 4Y16D 4A2MA 2QQLL 3QXWA 4HUVB 1QPXA 3JWDH 1IEAA 2D03H 4YDVB 4XPBH 1RIUH 2GSIA 1IGFH 5IG7A 1H8SA 4FQCL 2M2DA 3EOBA 4WW1B 5I1IH 2VAAA 2NY0D 1Q38A 1DBMH 4X6EA 2AJYL 1OSPH 5DFVD 5JPNB 3Q6FA 1X5YA 3UC0H 2IQ9L 3TNMB 2YUWA 5FDYA 2W1NA 4XP9L 2GCYB 3PNWB 1W0WB 4NKIH 2Y72A 4QXWA 5D96B 4HGKC 4BQ8A 1EHNA 4QRSB 1U8NB 1DVFA 4JFDA 4WTWA 1U8IA 3JWDL 4JM2A 3BT2L 5T3XH 2NY2C 4AEIH 3C60C 1MFCH 3GUTA 4CN6A 4JHAH 3HB3C 2EXWC 4NJ9H 4AZ8A 2EXWD 3F7YA 1IGJA 3D87B 2WUCH 3VGDA 4EXKA 4M3KB 2F54E 1WIUA 3RJQB 2I07B 2B2XH 3DJ9A 4RA0C 5T5FL 2HT4D 4UT9H 2F74A 1OAQL 3I2CL 4OCNC 4K94H 4RGMC 1MPAL 4U1LA 1S9VB 3VH8G 5HY9B 2Q1EA 5HDQL 4LPVA 3QHTC 1BFVL 2DQGH 1KTDA 1T83C 1ORQB 1B0GB 2JB6B 2FX7H 5TGBB 4QRRA 2YC1A 2WINB 5DK0A 1NAMB 4I48A 4GQPH 1YEIH 3IETB 2HJLA 1XF3B 4XMPL 4QTIH 1VDGA 3MLTB 4XCCL 1H0DB 3INUH 1T7YA 1XGRB 1H0DA 5HGAB 4PB9H 5T1MB 2B4CL 2X4UA 4YXLH 4MCYA 4NZRL 2MQ0A 4Z5RA 3RY4A 3DMMA 2L7JA 2VB5A 3NZ8B 3MFFB 5L8JB 3U46A 1LDPH 2NYYC 3RZWA 4YIQA 4FG6C 4HCRL 3BW9B 5EBGA 5KANG 2BJML 4ZUWA 4BM7A 4X83A 2UZYB 4FQJL 4R4BA 4YR6A 2IALA 2E8ZA 5ERWB 3H0TA 2LU3A 3VGEA 3U4AA 1GZQA 4FP8H 1WTLA 2YD7A 1UXWB 1JPTH 2X1OA 1FL3B 2OJZL 3VG9C 1C16A 2ICEB 3BRDA 4WTXA 1ZKAA 1CXFA 4EJ1C 5B22A 2WBJB 3QG6A 5D5MA 5BJTA 4PBWD 2MTPA 3MLYH 4YXHL 4S1DD 5BS0D 1ZHKA 3WLWD 3LD8B 4XCFL 1PKQE 5H8DA 4GW5A 1MOEA 1NCWH 3R8BB 2FBOJ 5C07D 1OOAA 3N1MC 3SBWC 2CRIA 4XCNB 3TBSB 3DV6B 3TYGH 1IZJA 2K7PA 5ID1A 3ULUH 1J8HA 2CDGA 3L3KB 3F5WB 5AD0B 1PYWB 1ZT7B 5A3IC 3RPIB 1L0YA 4X9BA 4LU5L 1I8LA 4HV8A 2K7QA 3PWPB 1CR9H 5DTFA 5CGYD 1G0XA 1A1NA 4KK6C 4U3XA 3LOWA 1SM3H 1JMZA 1YPZB 4KK6D 5BS0A 3QDGE 4LF3A 5CCKH 1ND0A 3F58L 4G6MH 4WVRA 4PLNC 4MD5B 4K9EH 4TSCL 5D1XB 1AFVL 2BRRH 5C0RL 1VEPA 4HUNB 1NBVH 1IEAB 1B88A 2G2RB 4JAMB 2C7UB 2GSGB 1PJ9A 1DL7L 5DLML 4ODTL 5DLMH 5C08E 1RZJC 3BZFA 3ULVF 4S2SA 4UNTA 3EHBC 4Z95H 5IVXF 1OPGH 4LKCA 4OM1L 2VLRD 3CDGB 4R4NC 3MBXL 5FA4A 4OLWH 3NIFE 1JI1A 1G7QB 5DJDA 4D0BA 1D5ZA 1RURL 4KH2A 5GGUA 1LEIA 4OCSH 1A3QA 3LIZH 2E5EA 3DX6B 1F4YH 5FUZL 1XF4A 5IBUG 1HCVA 3WNOA 2VABA 4NRYB 1A6AB 3SOBH 3QUYC 4GLRH 1ZANL 4LARH 3NZHH 3TA3B 2IGFH 1QNZL 1QKZL 4KHTL 2BY1A 1UH2A 4YPGA 1MCBA 4Q7DA 4F7PB 4HW6A 4RMWA 4CN1A 2ID5A 4J3XA 1SYSB 4ZFOB 1I1AD 5HHXH 4PJBB 4JFOB 5D4QA 1AXSB 3WXVL 2VDQH 3HUJB 3OKLB 4XPFH 5CD5D 2G75B 2VDKL 3T0EE 3O3DA 3WHXA 4KRLB 2CXGA 2QR0B 5GRVL 3V5HB 4LLDB 1T89A 2E8YA 3ARQA 3S37L 2GY5A 4M93C 2EDBA 1NJ9A 2XY1A 3C6LA 4F2MA 4Z7WF 5IWLA 5I2IA 2FSEB 4HLZH 4IIQA 4WU5A 1UCTA 5EU7C 2P8MB 1W2KT 3DRQA 3PWNA 4HIIA 4JFDD 1YEJH 4S1SL 1T5WB 2VITB 4WWID 1SMOA 5TH2B 4X6DB 3QIUA 4LBEA 4IRJD 4L9DA 3WDIA 5J1SC 4Z6AT 1S3KH 2HKHL 4GG6A 3IJYA 1AY1L 5T1LB 1U3HB 5FYLE 2E27H 3INUL 4HZAA 2R23A 4OD3L 4OFIA 3AU1A 5L88H 3MMEA 4NQSA 2J3SA 2DJ4A 5F7WC 3VFMB 1RJZB 2GJ6E 3MLXL 3G9VA 2R0LH 4XC1H 4F80A 2VXTH 4LVEA 3ZT6A 1AGFB 2R4RL 4KKBC 5D1XC 3MGTB 5FUOL 3SOBL 5AAMA 5D1XD 3ARBA 4XNXH 2QADC 5DZLA 4HWBL 2DQGL 4GW4A 2JCCB 1OGAD 3B5HA 5EA0L 5DDHB 1FYTA 3ARTA 3S34H 3V4UH 4R7DB 1Q94A 2FEDC 4OLWL 4FHBD 1QSVA 2JJTC 1CD1B 3QO0A 3AY4A 4KXZI 4YDLB 4H88H 5F70A 1IE5A 1F42A 4EDXA 4R4FH 5DD3L 5IMOA 2G60L 4B0MM 3D6GA 1VKXB 1NBVL 2CRMA 4OZIB 4XNZB 3FQTB 4IOFC 1FFQA 1PSKH 4YC2B 1FGVL 4W6YB 2V5YA 3I6LE 1GIGL 5TE4L 1GJIA 3QDJE 1XR8B 1T2XA 3LKQA 1E27A 3KPMB 1Z6JT 4N0FB 3S36H 3VWKB 2FO1A 5J4MA 3QFJE 4DZBB 5D1QD 2AQ1A 1HXMA 4HT1L 3WE6A 3SJVE 5D1QC 1L4IA 2W0FB 1WBYB 3AAZA 4J3WA 4TRPH 2FBJL 4Y4FC 3WV0A 1MWAB 4FFVC 4G8EB 5C0IA 3PP4L 3ARED 2O61A 4FNLH 3B8YA 5AZ2H 3QQNA 5F9OH 4AQOA 3HR5A 5T3ZE 2MQCA 4HV8B 1AXTH 1Q0YH 4NC1E 2HTLC 4ALAH 3K8LA 2IPKA 5T33H 1RZKC 4XP1H 1BEYL 2JKXA 4IRZH 4GS7B 2OSLB 3G5VA 1CFNA 1Y18B 3BQUC 1RJYB 4KZDH 1OM3L 3MLXH 1XCQA 2LTQC 3AUVA 4GO6B 5DJ0B 4KKLC 3AU1B 4O2EA 4POYA 4WCYH 5DR5H 2FZ3A 3WS3A 1J05B 4PG2C 1Q1JH 1G6VK 2VR4A 3N9GL 4RFNC 1NMBL 3BZ4A 1QSEE 2B1HH 4QRPA 2ZCKL 3OKOA 1UJ3B 3QAZB 2X44D 4NO0A 4R2GD 2WIIB 1E0OB 1GZQB 1VFAB 3MRPA 1EFQA 4GKZB 4N5ED 4OD2A 5J6HA 3VXUA 4BZ2H 3U6RB 5KN5A 2DM3A 3QIWA 4O51A 3S37X 1SBSL 4I0CC 3VGBA 1UG9A 4I0KA 1YN6B 2EDDA 3ZHDA 1CF8L 3LDBB 1CDIA 1MFBL 3IDIB 1FRGH 1CXHA 1UACL 5E2TL 1AGEB 4P2RD 3O3DB 2YD9A 4MNHA 3ZLQC 4G6KL 1EZVX 2P7TA 4ELKA 3WXVH 1BQUA 4E0RB 2X4RB 1AXSA 1G0YR 5DK3A 3T2OA 1KLGA 4YFDB 1FAIH 4L4VE 5DK0B 2GEEA 3QUMA 5A2JH 3O2VL 3TIDB 5DTFB 2DQJH 1T6WA 3H3PL 4ODWB 3J7HA 3VD3A 4V1DE 4P5TD 1RUPL 1I3VA 3QEGL 4X6DE 3LRSA 1SEQH 5E00B 1BD2E 1NMCB 2AK4E 2IGFL 4XNZC 4EBQH 5JQ6H 1AI1H 1IGYB 5C09B 2DQIH 1PDKA 4MS8C 3GGWB 3U2SA 4RIRA 1K8IB 1CE6B 1N8ZA 3BESR 4Y1AB 4HKJA 5HI4D 1LEIB 3TVMD 1SY6H 4RMQA 1OWRM 2VQTA 4JY6A 2H32H 4WENB 2ZP0T 2BNRE 4LSUH 3IFOA 5FECB 2PO6C 3NCYS 5D5MB 5EIIB 3SPVB 5BJTB 5FECA 4MHHG 3QDME 1FAIL 3S36X 4G43B 5HD8C 3VDBA 4L9LC 3VFUA 2YEZA 4BFGA 2JIXA 5DT1H 1YY9D 4Y88A 4L8DA 3WIHL 1J88A 2DKUA 3VXMA 5GRJH 5JW3H 1OT1A 1TQCC 1JWMB 4IBLT 3C2SA 4IDJH 2DN7A 3PNWA 3U30C 3VXNA 3GBLA 4KK8C 5ALBL 4IJ3B 4K9EL 3HMWH 3HMXL 4JZJA 4LF3B 4LSPH 1TNNA 3SDAB 5E8OB 4N90D 4U1IB 1BJ1J 4K7FB 4DTGL 1DUZA 2FH8A 5I1KH 1IT9H 4UNUA 5B39G 1NDGA 4GAGH 1H3PL 2IJ0C 4JN2A 4GW1A 5L2KE 3V5KB 2X4RA 4JO1L 3ULUF 3FO0L 1G7LA 2QTEA 4PJ5B 2EDXA 2C4XA 3TNNB 2VL5B 4KK9D 1E6JL 4NGHH 1RFDL 2P5WE 2NW3A 3V6OC 2XZQH 1KELL 2NY7H 2D7TH 2W60B 4OUUB 4U2ZA 1CLYL 4POZC 3GSNA 2V5SA 4PJAE 5IV2A 4JDTL 2H2PC 4TTDC 3B9KA 1A3RH 1R3LA 3IFOB 1TTFA 3GSUA 1OM3H 5KZCD 1KF9B 4NQCA 4YHPB 5DD5L 4MD0B 5I8OH 3BSZH 2C3VA 5D7SL 4GXVH 4OM0H 3MODH 1TVDA 4OCRH 4QHNA 1RUML 2OI9B 4WI4A 3B3IA 3PWLB 4GBXB 3KPOB 4L4VB 1TIUA 4HWUA 3QIBD 4FQJH 1XR9A 5MI0B 4LLWB 1PX4A 5ADPH 2DQTL 4OZGA 1YPZE 4PJIA 4KJYA 5JZ7D 1RJYA 5T3ZD 1S7QA 4R26L 1VENA 3PG2A 4MLIA 5EO9B 4W6XB 1QBMH 4G8FA 5ICXB 1JWSA 3PGDA 4PB9L 4F58H 4P23A 4JO2H 4XXDB 1KT2A 3U0PA 3TNMA 4D3CH 1T20B 2Z93A 4EI6A 5IFHL 2AS5M 4OB5H 2MOVA 5IVOA 3MLUL 4HPYH 4DJMA 2BNRB 3G9AB 3IKCA 4XMKH 1EEZB 4U3HA 5DRWB 3QXTA 2EIBA 5DD1H 4C56D 3BE1L 3MLWL 3L3HB 1ZTXH 3VXRB 5GS0L 5KZCB 4AIZA 5CILH 2F58L 3UTPD 1N6QL 4N0FA 3VWKA 4P57A 1NFDE 4NZTL 5TFSH 4HIHA 4K3DL 2G9HA 4P3CH 3P4MA 1XIWA 4U1KA 1BVLA 1MIEH 5FGSA 3VI3F 2Q3ZA 1E6OL 2DBJA 5JQ6L 3GJFK 5E8NA 3F7PC 1P7KB 2V9TA 5DHVA 5GIRA 4DUVA 1C5DB 3WNLA 3GK8H 4EI5B 3OSKA 1KC5H 3KPSA 3I85A 4AH2B 1AGCA 4JM4L 3B9KD 5GGRB 1DBAH 1QQDB 3IFLL 4APQA 2BC4A 2XG5A 3SY0A 4D8PB 4PJ5E 2W07A 4NO5B 4AEHH 4U7KA 1G7LB 3LS4L 4UT7L 5HYJE 5ICZB 4JGMA 1U93A 3ARDD 4I18A 1KJ2A 5A16B 1MF2H 5C0BD 1RHHB 1QLEH 2LV4A 1S5HB 2A1WL 3V7MA 3DLQR 4QF1B 3MRKB 3M1BA 4OZFB 3VFSB 5CZVL 5ITBH 4OQTL 1IKNA 3ZDZF 1WCQA 3HZMB 4OCMC 1QSEA 4FN0A 3ARGD 4YDIH 1P7QD 1QEWA 1N5YL 4Y0GA 4PR5A 2R29H 3LKQB 3I50L 1NBYA 5AYUL 2AJUL 3UTQA 2OI9C 2VC2H 2PUQT 1MH5B 4RSVA 3VXUE 4BSVA 5TJWK 1UM5L 3UBXI 4J3OC 5I1LB 3P73A 1EAPB 5L9DH 5DQJA 2B1HL 3FB7B 4HAFA 4U1GC 1GPOL 2WMPA 4NNPH 1I7UA 1VFMA 3VI3E 3T4YA 3SGDH 4UAOB 1UWXK 4R7DA 1GAFH 3MSPA 4FRWA 3VWJB 4ZUTA 4I13B 3HFMH 3MV7E 4WO4D 3S7GA 2X89D 1HH6B 4LSDA 5T33L 4F8QA 5DJXA 4YHNB 4O2FB 2C1OA 2BXZA 2YWZA 1M05B 1MHCB 2CRYA 4MVBC 1WSST 1EEUA 3I75B 4G6FD 5KSVB 2HWZL 3UTPE 1HXYB 2MNUA 4Y2DD 3MV8E 1P5UA 4LOUC 1KOAA 2ADIA 1OPGL 5F3HB 4TOYH 4LOUD 4QEGA 3WXWL 4HS3B 5DJ6A 3DXAB 4LASL 4WI9A 2FWOB 1S5IH 3H9SB 5I9QB 5SWZD 1BBJA 5SX4H 1G7IA 4IS6B 1LO3L 3TO4C 4N8CH 4XPAH 3ZDZE 5E4EC 1IKFL 3ZE1F 5EU3A 4G6ML 4ZTPL 4UT6L 5EOCJ 3SGDI 3GMLB 4NT6B 4XRCA 2LU7A 3VXUB 3GB7B 3D9AH 5IHZA 3HC4L 4PFEA 2J6EH 2AK4B 2WIIA 2Q8AH 5HYEA 4HD9A 3EW3B 4GXUM 1DLHB 3MNWB 3GJFH 3MRRA 4JKLA 1BAFL 1DQJA 2O5XH 1CGWA 8FABA 4YGAB 5BRZE 3SBWA 3AMLA 1ONQA 3MV9E 3SGEI 3K74B 5GGVL 5IBTH 2A9NL 4YBQC 3IFPB 1IGMH 2Q3AA 2NXZD 3WJJC 1WAAA 3DYOA 4F7EB 1OTTC 4NO3B 4OGZA 2YRLA 4W68A 4C55A 4G6JL 2APWA 5CSZB 4YDJA 2RFXB 4OZ4A 1WBZB 3KLAA 1RU9H 5B8CC 3GIZL 5IQ7L 5DRXA 2HKHH 4KY1L 4EI5D 3G04A 4QXUH 2B1AL 4OAWA 5D7LD 5CIPA 4MD4A 5E2VH 4YDJB 1H5BA 2H1PL 3TBVB 4G8EA 1JCKA 3REWB 4CKVX 3P9MA 3OKEB 2ED8A 1XF2A 2X1WL 1HXMB 32C2B 5I1DB 4DQOH 4U6HB 3SE3A 1A1MA 4LKCB 4TPRL 3ZE1E 4U2YA 2OL3A 1V3LA 5F96H 3KYKH 3UDWC 2YPLB 3HPJB 3CK0L 2WWKT 5EUKA 5KS9F 3U9UA 5ERWA 1WGOA 3T2PA 4YX2H 2VUYA 1QBLL 3F8UB 4Z0BH 5IFJA 4DKFH 3BI9X 5IMKB 2PW2A 3NPSB 4P49A 4UB0L 2APTA 4X6BB 4D0DB 4OGAD 3SDXB 3EJYD 3STLB 5MP6L 5E56A 3O0RL 4CVXB 3T0DA 3QEQE 5DD6A 3L3JA 3V0VA 2J5LB 5DUMH 5DA0B 3T65B 1QRNE 2PO6B 3LKNA 3CFCH 4LL9A 1I7RB 4XWGH 4RGMB 2EH8L 4NJ9L 2BRQA 4DZ8B 1GAFL 2DM7A 2XWJB 4HMCA 4UTAH 1UM5H 4YC2C 3X12A 5DS8A 4ZYKA 4ODVH 3MJ9A 1I9IH 5C0BB 4YGVB 3I50H 1PEWA 5HI5C 3O6MH 4DN4H 4X6DA 3BEVB 4S1QH 4X8XA 4HUKB 4U1LB 4ODTH 5BVPL 2F8OA 1T66C 3E1F1 2QKIB 3ABZA 4OF5A 1EO8L 4KK5D 4DQOL 1EFXA 5T3XD 4LAQL 3EYFA 3CXDL 2L0DA 1YUHB 1MRCL 2R29L 1XGUB 3HG1B 1DBKH 2FD6H 3NZ8A 4PLJD 5EPMA 4PGZA 4JAMA 3KNBA 2NCMA 5E2VL 4FFWD 2W0LA 1JRHH 1MFAH 3BUYB 4MCYB 4QRQA 1UM4L 1ZV5A 2A0LC 2IH1B 4FFZL 5D1XA 2ZOKA 5LGHH 3PGDB 1W0VA 3IYLW 3TYFA 3REVB 3NACL 1HN1A 1MF2L 2LTQB 5IVZA 1I8KB 4FTVD 4ZS6C 5DJZB 1D5XA 1DJSA 1D5BA 1TPXC 2HJKA 4MNQB 4HIJB 1F8TH 1Q9OB 2AABL 3JTTB 1CGVA 4KJPC 1BREA 4GBXA 4K3DH 3FQRB 4MB5A 1S9XB 1EUTA 1K5NA 4KKAC 2VXSH 3TBWA 1AGDB 1M7DB 2J6EL 2AERT 3QO1B 2YD2A 1AJ7H 4BSWB 1RIHL 3HC0B 25C8L 2HMIC 1NCBH 2NX5E 2XZCL 3BHBA 3MLUH 3X13B 1EO7A 4ZXBA 1WAAF 1KG0B 2DOCA 1LDPL 3QEQD 4HIEB 4HK0B 3O6FC 4XPAL 5E6ZA 2DLIA 4TYUA 2NR6D 4WI2A 4AM0A 3BDXA 4ZO6A 1KB9K 4NFBA 1TCRB 4O58H 4AMKH 1FDLH 2EYRB 2F53E 5C0NC 6FABH 4MD5A 1UZ8A 1KGCD 4ACPA 3NBNA 4P4RA 2GJ6B 5DMKB 4NNXA 1ZOXA 4PYGA 1DUYB 1U2HA 4ONFL 4MA7L 4Z5RB 5EZLA 2YRPA 5HHOB 1IM9B 3NCJH 2VAAB 2I26N 2AJXH 3KPRB 1NQBA 5D7KD 1FCCA 4LQFL 1MCWW 1MHEB 3UTSA 2BP3A 3BUYA 2C3HA 2QQKL 2DICA 1FZKA 4G5ZL 3WO3B 2EZ0D 4OCWL 3STZB 3SDYH 4OZGB 3T0BA 5AG9A 3LS5L 4WGWB 3WEXB 5C0GB 1K3ZA 2D7TL 3WJLC 2DQDL 1JN6A 2WUCL 2FATL 3QCUH 1WC7A 2ITCA 4GQ9H 4XCEB 3DI3B 1LD9B 1QSFD 1LHZA 4C56B 1DN0B 2VH5L 1LP9B 3QDJB 1MFCL 3LB6D 3OX8A 4L29B 3K2UH 3QA3A 4PRPE 1HSBA 3ZYOA 3VW3H 2BNUB 5KTEL 1UC6A 3BIBX 5F3BA 4U4BA 4RMTA 5IKCA 3L5XH 2AGJH 1WAAE 3NFPA 5CLTA 4HUWB 3ILPA 4JY4B 5J3HC 4X6BA 2WP3T 4WRLA 2CJUH 4X4ME 5CJOL 1D5BB 3GSNL 3S96B 3ARWA 4X7TA 4PTUA 2D2OA 4Z7OE 1P4BL 4QRUB 4KRPB 5T5NF 3VRLE 3TNNA 4PJEB 2COQA 1U58B 1Y6KR 4C4KO 4PRDA 2NY4C 5MEPA 4FQCH 4YFEA 1BZQK 1NCCL 4S11A 5DRZB 5IFAL 4JHZA 4PJDF 3I9GL 3FJTA 1QRND 3C9NA 3MREA 1CD8A 1NCUA 3DX7B 5EZOL 4KVCH 2WP3O 4X99B 3WO4C 4D94A 3QXUA 4L4TE 4U3CA 4ZD3H 5IOPA 4RAHA 4N0UA 3QEHB 4D9RE 4K9EC 3OKDB 4PJ9B 1PAMA 4JPVH 1T4KB 4EBQL 1I4FB 1DE4A 4XNYL 4OCXH 5JNYB 1CQYA 1ES0A 3MOQA 3T0XA 5HTSA 3RAJL 4MNQE 4RAUA 2ZOLA 3OAUH 4M4RA 1I1YA 3D0VB 3RX7A 1AI1L 1A7PL 1KCVH 5D7KE 3Q6GH 1R6VA 2WLZA 3U0WH 3QO0B 1F4XL 3CFEA 5KG9A 5AWNH 2P8LB 2DQJL 2XG4A 1OAYL 5FM5O 5FGRA 1CLOH 4LLMA 3RDTA 1KCVL 2HKFH 5DJAA 1JP5A 2WW8A 3OKKA 1A4JB 4N90E 2UZXB 3QUKA 1LO0H 1TJIH 5GS2H 1BBDH 1W0YT 4NOBA 3CSBA 3M8OH 2H2SD 4PJAA 3U7AA 1S7TA 1QACA 3VRLF 3DBXB 4BELD 5HXMA 3Q1SH 3KLSA 3V6OA 4XCYB 4J3TA 4LVHC 3HR6A 1WWBX 1U8JB 4DAGH 2ZCHH 4FQIH 4NQCE 4NRZB 4M48H 3BKJH 2AV7B 4XNUH 2ZSVB 1CFQB 1MJ8H 3VJ6A 4RDQF 3QI9A 3HNTL 3FRPG 1ZGLA 2DYPB 1HZHL 5I19H 1YEKH 3CXHK 2J1KA 4HFWA 5JXEA 3M17B 3P0GB 2Y36H 3VXMD 1EJ6A 5EZIH 2Z31C 5DMGD 3D48R 3UJJH 5F6IB 2Z31D 4U0RC 1A3RL 3GB7A 5IHZB 5HHOE 3G6AA 4LCWE 4WUKH 2R1WB 2VDOL 1XF2B 5I30L 5HPMB 1X4XA 1AO7A 4C57C 1CIUA 3IU4H 5L8KB 4ETYA 2AJ3A 1Q1JL 3N9GH 2DQDH 1CICA 3KHQA 2XICA 2HVKB 5T5NG 4LHUG 3C60B 7CGTA 3GMQA 4LHUA 4Z7UE 2FB4H 4NFCA 4LFHD 3ULSA 4G42B 2DF3A 2FWOA 3D3VA 4FQQA 4LHQB 1GGCL 1KGCE 3O4LA 5CJXC 4LQFH 5BRZA 4GAGL 4POUB 2E3VA 5FM5M 4TUJB 4TTGA 1D5IL 1FNEA 2BSTA 2AJXL 3O3BA 4P5TA 5IVZB 1I3GL 2EIDA 2NY1C 5E8DH 2XYCA 2V5MA 1FNLA 1KJ3L 1NFDA 1K3IA 3S8WA 1ZK9A 1XGQB 1UCBL 2AEWA 1TVHA 2ZSWA 3PL6B 3RVTC 4XGZB 2W65B 4XHJD 1V3JA 3SN6N 4Q6IC 1JGVL 4P2RE 1IQWH 4QXTA 3VGAC 4CJ0A 2QSQA 2ZSVA 3DPBA 3AAZB 5GGQH 3BZEA 3P77B 4JKPL 2Y7QB 5C0AA 5ID0B 1HWGB 4XCYA 4UV4H 2ICWB 1U8QA 5DQJB 4KJWC 1RAMA 1XAUA 2VSCA 3O2DL 3MRLA 2QKIA 2YPLA 1Q72H 5ISZB 1J0YA 2FJGB 5JDJA 3RDTB 3IJSA 1UKTA 1JI2A 5EO0B 4A6YA 3DROB 4XC1L 2AK1H 4W4OC 2ZUYA 2J6EA 3V6OE 3MOBL 3SY0B 1QSFA 2VZVA 3BKYL 2X6MA 4JFFE 4LVOB 3CPLB 3V5DB 1L7TL 4HKBA 3H3PH 2VLJA 4HWBH 4U6YB 4ZQKB 1UM6L 3DXAD 4Z7UF 4U1SA 4GMSL 1R24A 2R4RH 4LCUA 3VXQA 5HYSA 1U6AH 2IPKB 1CLZH 5JIPA 1EHXA 5IEHA 4YUEH 4RDQG 5GJSH 4FXGA 4K07A 3BPCA 3I02B 3QCVL 5E8PA 2FEDD 5GS0D 5L2JB 25C8H 3MCLL 2XPGA 1SBBA 3GJEA 4GW5B 2CMRL 3MMEB 3T2NH 5J8OA 4OV5B 4K7PX 2R1WA 4LKXA 2ED9A 4LHJB 3RWHB 4ZOCA 3U9UB 1NC4A 3QUMH 1QRNB 1J9CT 5FO9B 4URTB 3TT3H 5H2BB 5IT2L 5CEZH 2XWTB 1TNMA 5H2BA 5D9SB 3OAZK 3BGMA 1S7UA 2AK4A 4PD4K 4X4YB 2ZUVA 4DVBB 3O45B 3TA3D 4LEXL 5EO9A 2H32B 4DK3A 2I5YH 4GAJH 3PWUB 4ZS7L 2P5EE 5C9JB 1KBGL 4Z7NF 2GTWB 3UYPA 5EOTA 1SJXA 4NC2B 4ZFFB 4KDWA 3UO1H 5H94A 4QOKB 1XF5A 3SCMA 3NABH 3X3GH 4IDLA 1KJ2H 3PWPA 1BD2B 4IRZL 2ZSWB 3PL6A 1DQDH 4LIQE 4PRIE 4EXPX 1RUKH 3LRHA 5DUML 4MJ2A 3O2DA 3QQ4B 3ZKQD 1KIQA 3HNSL 3PWVA 5IJVA 2XA8H 3U83A 3MBXH 5IMMA 2GY7B 2I9LA 1U9KA 3O6FB 3B9KB 3V5DA 3RWDA 1NAKH 1K4CA 2JB6A 3IDXL 3MLSL 5D5MF 5F7KC 3BP5A 1XR9B 5JHDE 3MRHB 3TIEB 5GHWL 3C60A 2VIRA 2DTSA 3UTTD 5F88B 1QTYT 3JVGA 3CNKA 2IF7A 5C71A 1VB9A 2HFFA 4XWGL 5JR1H 4M61B 1AE6H 5FYJD 3ZDYF 4YEFA 2AV1B 2XNAB 4YZFE 3GI9H 4KGLA 5GQBA 3KDMB 4K7FA 3LKOB 3KPSE 4LAJH 3PQYD 2DWDA 2YK1H 3GUTB 3BZFB 2BNRA 5CEZE 1CZ8L 1TETH 1K4DA 4KUZH 1I3GH 1CVRA 2IQAB 5E8DL 5J6GA 4NN7B 1TVHB 4NO0D 4ODXA 5KG9B 1YY8A 5FO7A 1QFOA 3WL9A 1REIA 1C5BH 4XNXL 1Y6MR 2CK0H 4XCFH 1RJCA 2X4OB 1X6NA 4NC1C 4HS6B 2EKJA 3LKRB 5TDOA 4HQQH 5F9DC 4L3CA 5ITFB 3QJHB 3CDFA 4F7TB 2FGZA 1H3GA 5D7IA 3ZKXB 1G7JB 5H35B 1SYVA 1ZLSH 4TQEH 4EN3D 5AD0A 2B7DT 4L4VA 4ZUTB 3O41A 3ECBA 1IGML 3VXOA 3U36A 4QHNB 3U36B 1D6EB 3SE3C 4OFKA 1KPRB 1QQDA 5D5ME 2VDPL 3SJVB 3BP4B 4N68A 1OAUH 2DIBA 4MD0A 4FFYL 5DRNB 1KB5L 3KPSB 1T22A 5T1DL 4Q9BA 3MX0A 1H3XA 1VFBA 4NC0B 1AC0A 4Z7WB 3OR7A 4PJ7B 3MR9B 3QB7C 1MEXL 3UROR 3TJEH 3GSXA 1JGLL 4P59L 1A1OB 1KB5B 2KBGA 4IIQC 1CYGA 1Z0MA 5DEFB 5C07E 3WIFA 4Q9RL 1UVQB 1H3VA 4B5EA 3BWAA 1PZUB 1BBDL 1GC1H 4G7VH 3H9YA 1HHJA 3B43A 4CADB 1NFKA 4ZUWB 2EECA 3CMOL 1AR1D 1MCCA 5JHDA 3EYOB 2ARJB 1PQZB 2P5EB 2VDML 2R1YB 4DGYL 1SJEB 3KYAA 1RZKL 3QG7H 1S7TB 4MHHI 4U6TA 1MHHA 2NY0B 4FQ1H 1A7NH 4GRLD 1IAII 1MCPL 3UTTE 1QNZH 1YYLH 4EIGB 3L3KA 5D71H 4P23B 5T5FH 3S35H 3OX8B 3EUUA 4S1RL 1CXKA 5KAQF 3VXOB 2IMMA 3NPZB 1HDMB 5GRVK 5CEXB 5HDQH 5FUZH 3PDDA 3MV9D 4YGVA 5IMLA 3MACL 4Q6IB 1SYVB 4JHAL 2QADB 4WTZG 2IAMB 1NC2D 1RMFH 1TZHA 2X4SA 2X2YA 1Z2KA 5CJQH 1VACB 4P2QB 4RGND 2Y06L 3DO7A 3DARA 5HGHA 3J8F7 1S9VA 4KDTA 5D2NA 3OR6A 2I07A 2IQ9H 3QNXB 5EZOH 2Y9RT 2VZUA 4NQCB 1H3WM 3A67H 4R3SB 5JXED 2YUVA 4U7SA 4FQ2H 2CIKA 2P5ED 3GSNB 1KCUL 5JHDB 4MNQA 3NTCH 1IM9D 4F7TA 4DGVL 1QD0A 4LRIA 5GGVY 1ZLWH 5DJ0A 3HI1A 5MEQA 5JZ7C 2OBGA 3FQXB 4ZO7A 1JGEA 1FLRH 1IC7H 4NJAL 4HH9A 1IGTB 5BCAA 2ZNXA 3UTSB 5JMRA 2ORBH 4R0LA 5ISZE 5H37H 1PZ5B 4X6CA 4F9PA 4Z7UB 4PRID 1U8PB 1INEL 2AJSH 3O4OB 1IFHH 4OF6A 2BVQA 3U7WL 3UTOA 3WIHA 3LMJL 4QOKD 2GUOB 2D03L 4FQXB 1N2RA 5HYJA 2Z91B 3EFDH 4NBYB 2R0KH 3V4VL 4W70A 1DVFC 1SMAA 3H7BA 3SDAA 5IUSA 1B6UA 3LKOA 1ZWIB 5F1SA 2YBRB 3IGAA 4IMKA 4WFFE 2AJZB 1BFOA 2LQRA 2ZUUA 4L8SC 1MQKL 1TJHH 3V79C 3FONB 4JHBA 1WIOA 5C0FB 1F11B 2HH0L 4WV1C 5MEOA 4FP8L 4GRWH 2CMRH 1DN0A 5IVNA 3A6OA 4PJDB 2MFNA 5CZVH 2L4OA 4CAGA 3HNVH 5ANMA 4OZ4B 4XVJH 5IMOB 2CLZB 4M43H 1IAMA 4OSUH 1GCFA 5E2WH 1NGWA 3ROOB 4J6RL 5J1AA 5IQ9A 2FO4B 3OXRB 3KPNB 1JZ2A 3LEVH 2ESVE 2B0SL 5IIEB 5C9KA 5HVHC 1DEEA 1MHEA 3GZKA 5IB3A 2WIMA 3KXFD 1F58L 1P53A 4NUJA 3CLFL 5CJBA 2DBLH 2DBLL 3U1SH 4LPCA 5LXGH 3GK8L 3OJDA 3MJ6A 6FABL 1R3KA 3ORJA 4L8CB 5E24E 1FNGA 2WZPD 1CGUA 1JHTB 4ONHB 5I0ZA 4M7LH 3OKNB 3FTGB 1NANH 4QRQB 4HK3J 4WFEE 4M00A 1HHKA 5SWZB 4M6OH 4X6FB 3BIKA 4TUOA 4AY0A 1A6UH 3MUY1 4HS3A 3CVIL 1WVZA 5I0DA 1AD0B 5F7DA 1JPGB 1KIPA 1CDBA 1Q9KA 4YNYB 2GAZA 3O3BB 3D25B 1FZMB 2DI7A 4U6XB 1N3NA 4XP4H 2Y5EA 1UWGL 4Y1AA 3I6GB 3LKSB 3OHXB 1X4YA 3CVHB 2VAJA 4BQBA 4L8BB 5I1JH 5K59F 4Q9CA 1MAJA 4JPIA 3HE7C 4OIIH 1INEH 4OSUL 1GGCH 4ZAKB 1J1PL 2C3GA 12E8H 2GFBB 3QUXD 4Y4KA 5EOQH 1MQ8A 3FMGH 3QUZA 3QUXC 1H3PH 4X98B 4YFLF 2VN7A 2DMKA 1FO0H 4M1CC 2FJFA 4O2CB 3CVHH 4F7CA 3BH8B 5DC9B 1G7HB 3QIBB 5B39B 5I30H 2MSPA 3JV5A 1P4IL 5SWSE 1F6LL 2FCBA 1OP3H 1FL6A 4PRPB 4Y5VC 2FJGA 3UBXA 2X89A 1VGEL 1W72B 4JRYD 3SE8H 3GMNB 3HRPA 4O2CA 3W0WA 3AROA 1KCLA 3LMJH 1FH5L 2QQNH 4NQEE 5IB5A 4PRHA 1A6ZB 4Z7QF 5IGXL 3QXAB 3M07A 3UPRA 1G9MH 3L6FA 3HNTH 3BOVA 4DN4L 2FSEA 3SKOA 3VA2C 4J3VA 1YZZA 4LLUA 1N59B 3WS6A 4K2UH 3TWCH 1QR1A 5F88A 2XQBH 3SQBA 3I3EA 4JKMA 4M6MH 2B5IB 2BSSA 4UIKH 1LNUA 4JFPA 4QWWC 3RIAK 5C3LD 2HKFL 2NLJB 3GHEH 4JFQA 3VGHA 4F33B 4EDWH 4KC3B 1YEEL 4JFQB 5KSUB 4Y2DB 4QTHA 4JFPB 1FNEB 4NN5B 2VSDA 3VH8A 1EDQA 3O3AB 5KVFL 2VO5A 2F5AL 6CGTA 4CVXA 1U3JA 3NA4A 5DHYB 1BD2D 4HIHB 3W9DA 4D0DA 2RFXA 1NGPL 5J9PB 3VJ6B 4JRYB 1R5IB 4PJXF 5J7CC 2Y7QA 4P46A 4WWKC 1ZSDB 3KYKL 4OT1H 2QHRH 3QRFM 1HYRC 3PWUA 1G7PB 3O4LE 4S1RH 3BYYA 3R06A 1RULL 5D2NE 1JZ7A 2CKBB 2H26B 5FFLA 5E95B 2AXGB 5GGSA 5B39A 3O3UN 2X4UB 3FQTA 4NUJB 3W2DH 4FQ1L 3C5SB 4Z7QE 4LK4A 5DEGB 3ULVE 2DQCH 3HLAA 5L7XL 4LLQA 4NFDA 4U6HA 4PJEA 3R06B 1X5XA 5IVXE 2M26A 2VDMH 1FC2D 3KPNA 1NLBH 4L5FH 4L9LA 1QSEB 5J57B 1NCCH 4O4YH 3VWKC 4XVSH 3ZYJA 4NM8H 3VWKD 2NLJA 5JW4M 3DURB 4L4TD 5CJXA 3DI2B 3MFFA 1JGLH 4P59H 2GIYA 1PVHA 1QFHA 3KPOA 3B3IB 5DVKA 3V0WH 4OBRA 1JPSH 1GGBL 1OP9A 1ACYH 4H20L 3OKDA 4PJ9A 3VMPA 2P8LA 4UILH 3FFCB 4BZ2L 1T2JA 1J0KA 1SYSA 4ZFOA 1RK1A 1Z5LA 2VDLL 4KQ4H 4N0YL 5JOFB 1JPGA 1FYTD 2ITCB 1A7QH 3MJ7B 1G9MC 4LEOB 5JA8B 1RZIB 4X9GA 2WV3A 5CBEA 2VLLB 3H7BB 2IAMA 4HAGA 2V5RA 5C07B 1WQVT 4NQUA 5EBWA 5KVEH 4TRPL 5FGBC 3CU1A 3TEUA 4CVWA 3MJ8B 2K9UA 2R1XA 4PJXE 3L5HA 5GXBB 1MSPA 5I8EA 2CUIA 5J0BA 1B6DA 3H0TB 2KUTA 1YDPA 1LEKB 4KK5C 3WDJA 2W9DL 4WJ5A 4R8WH 2N56A 5EZLB 1X5FA 2BNQB 1MCSA 3D3VD 1KXVC 4NWTL 1CGSH 1ZS8A 2IC2A 5DQDH 2FHBA 1NFIB 3WXWH 3THML 5FYKH 3LHPL 4H88L 4R6UA 5E99L 1A14H 3QCTH 2EYRA 5EWIL 5C1MB 3OKLA 5DD0H 3V6BR 5GGRA 5FHAH 5FDWA 1YEGH 3CAFA 4KJYB 1R3JB 1CFBA 5GIRB 3RVXD 3RVXC 4EN3A 3OJVC 1ES0B 4KJQC 3BIKB 5SWSA 1KJ2B 1HE7A 4JY4A 3KPLA 4TSBL 2KZ1B 1NSNL 3BP7B 3CH1A 4LMQE 3GIVA 3SKMA 3K2MC 1FIEA 2UY7A 1J1XH 1AJ7L 3BPNC 2D0HA 1FZMA 4JRYE 3F65A 4PY7A 5CIPH 3OKMA 1DFBH 4JGJA 2R39A 1ZHKB 3QFDB 3WFEL 1UT9A 4XCEA 2QJDA 2HVJB 2VN4A 1T0NA 1T1XB 1SJEA 1WICA 1MCNA 2J8UF 2R1YA 3WSQH 1S9WA 4EUPH 1FZOA 4JG0L 3RL2A 4BSVB 1U8PA 3S35X 1V7NL 1NGYB 1Y6NR 2V2XA 1BMGA 1NGZB 4PGCB 4XAWH 1MAMH 1KJ2L 5E7FA 5GS1A 4KROB 4IHOB 3WL9B 4BK5A 5CJ8A 2F8XC 1QLEL 4HK0A 3L7FA 1NGYA 3JTSB 4GW1B 4U1HB 3B8SA 1DQTA 1KULA 5SX5K 3QQ9C 4XVSL 1YUHA 4X6EB 3C8KA 3NFPB 5ADOH 3EDKA 2VLME 3S3SA 3QNXA 4U0RB 3UPCA 4YHIA 1NMAH 4JM4H 5SX4I 5I16B 5K9OA 3B6SA 4GRLB 1F97A 5I8EB 1YQVL 1HKLH 4OLYH 4D8PA 3CH1B 1A2YA 4P23D 4AL8L 4LARL 4PREB 3DO7B 2BNQE 2VLKE 3R1GL 4PP2B 3MNZB 1AQDB 1S7SA 4CL7A 1BWMA 2OCFD 1J7VR 3HG1E 4NZTH 4OCSL 5DFTA 3QZWA 1FZKB 3O4LD 2X4PB 5KAQG 3LB6C 2YPVH 3TYFB 2PO6A 3LKNB 3P4NB 3GKWL 5SV3A 4XBEL 3KYNB 5DUBA 4UTAL 3QIUD 1CE6A 1L7IH 4NQVA 1F00I 1ZT4A 3FFDB 2Y4SA 4ODHL 4RX4A 2J8UE 2V17L 4N9OB 3MUHL 5DC0A 4JQIL 1OW0A 4XPTH 3EGSB 3QUYB 4M1DL 2Z91A 1BFSA 2GUOA 3QDGB 4JM2B 1FZJB 5FYLL 1KNOB 3O2DH 5F6HI 4DVBA 4NKMB 2P7TB 5ACMA 4NDMA 1CGSL 1OGAE 4G8GA 5DQDL 3OQ3B 2E7LC 5EWIH 4DKEH 3AFLA 2EZ0C 2VE6A 5TDPA 4DW2H 5C0BA 3CDYA 4KTEH 3IF1B 2MKLC 3CK0H 3RZCB 1YEDB 3QNYA 1B0GA 3DHMA 1JNLH 4BQ9A 2ESVA 2NY6C 4X6DF 3RUGA 1H5BB 2V9QA 3D85D 2CQVA 1HIML 4QGYA 3U4EA 5CP3A 1P2CA 2XFXA 3MROB 1IC1A 5HYSB 2UYLB 3PGFH 4L3EA 3T08A 4DUWA 4LCUB 1R3LB 5BZWA 3P9LB 4LU5H 1R3JA 4XAKD 4KY1H 5L2KA 3FQUB 1G9EA 4QLRA 3BN9D 4N0YH 1N4XH 4MNGA 4U1GB 3V6ZA 2DQUH 3QEQA 4I9WD 1MY5A 4R90L 1AO7E 2SEBB 4N9GA 1GXEA 1VCAA 3ZL4H 1F13A 5E0QA 2W38A 4L3AA 3HG1A 4LSVL 4ELME 3JUZA 4Y16B 1NC4B 5BXFB 1A3LL 4LKXB 1TLKA 1MFDH 3RKDC 1YECH 2BVYA 4GKZA 4OD2B 5I19L 1QHOA 4RAVA 3PQYE 3JSSA 3ES6A 5HHVL 4KV5E 2IFFH 4ZO8A 5C09E 1INQB 4XZUB 3ULUE 4L5FL 1XZ0A 5I1GL 1CN4A 4NO0B 4PJ9D 4OZFH 1FL6B 1AQKH 3RP1A 1IC4H 1OL0A 5K33A 3HRZA 2MHAA 3TGXA 3GMPA 1L6ZA 3D2UB 4WNQB 3D69B 1FNHA 2PTUA 2OS7A 3VH8B 1GZPB 2B2XL 5BO1H 2I9LB 3KPRD 3QWRA 4H8WL 5DO2C 1NUNB 3HZVA 3ELAT 1OAXH 4LASH 5E5MA 3SJVA 1IGCL 3LEYH 2BY3A 1CBVH 3HHRB 1OB1A 3NGBB 4X9FA 1VESA 3S3JA 1D6EA 1CXIA 4BKLB 3HE6B 3OB0K 2EIEA 3PV6B 1HQ4B 3H9HB 4WEUD 4Y1AD 5C2BH 1YMMB 4UDUB 4PYHA 3DVGB 1KUMA 4R0LC 1CK0H 1MIMH 4J6RH 3DECA 2CSPA 3HFML 1DTUA 3Q3GA 4I0PA 4UINH 1TTUA 2C3WA 2NY1D 2CH8A 1FNFA 3UJIH 2C4FT 4UQ2A 1Y18A 5F7DB 4A6YL 3MUGA 4U33A 1JFQH 3O45A 2BSRA 1T0PB 4LSRH 2ZOKB 4NM4L 2CJUL 2JJSA 1IKNC 3ZYZA 5KOMC 1G1YA 3GMRB 3LEXB 1SBSH 3CZFA 3LV3A 4JCMA 2VKWA 2FX9H 4ZD3L 3S4SA 4LCCA 3RWHA 1JHKH 2QSTA 3QISA 4NKOB 4ZG1A 4KV5F 1MRFL 1RZIA 2MMXA 3ES6B 1VGKB 3CFDA 2VH5H 2R0KL 3V4VH 1MLBB 4PRNA 3QYCA 1G9ML 4LCIL 4WU5B 2JIXD 1E27B 2EEAA 2FEEL 2OYPA 3PHOA 4TUKL 3IDGA 3RTQD 4NQDA 2ARWA 1MCRA 1TFHA 4G3YL 3S6CA 3ZKXC 2GKIA 3DX9A 4M9PA 1YJDH 4ONGH 3ZKSD 4WEBL 2A74B 3QP3A 3X12B 4XH2B 1OAZL 2HFTA 2ZG1A 4N0UE 2X70A 4TNWF 3IFPA 3MRQB 4OFVA 3TO2B 4X7SH 5I74C 4LRNL 4RWHA 3RRQA 4ZOBA 2PXYC 3IJHB 5T1KA 4Q9QL 1BFTA 2ARJQ 4PRPD 4PJDA 1P7QA 4GS7C 4PJ8B 4Z8FH 1KN4L 4Y5YC 2WAHA 4J8RA 3SDXA 5MHSE 2Y6SD 2C26A 1MCOH 1FDLL 1JHLL 2Y6SC 5C0CD 1T2QH 4YR6B 5I2IB 1TMCB 2I60L 3CFIC 4OLUH 5LQBL 5EU3B 2NY5C 5DJDB 5TFSL 3F7VB 1D9KA 2JE8A 2WUBH 3QUKB 4PJ5D 2DMBA 4N0CC 4R4FL 5HI3D 1T5WA 5I1GH 5LG1A 5ISZD 4JPWL 1NCTA 4R2GB 2PETA 4M4PA 5FF6A 1YEHH 3BPOC 4RGOH 5FCSH 4FQXD 4JFOA 3LN4B 3CLEH 4JGUA 3FL7A 4TULL 4ZDHA 2GFBA 1I1FA 1RJLB 5EA0H 5C92A 4FMKA 2RCSH 3MRBB 2CPCA 3FKUS 1T2QL 1Q94B 1RZFL 3MRKA 5ALCH 3LEVL 4KKBD 5CP7B 4U6VL 1QFUL 5E8NB 5I6XB 4MWFA 2QADD 3VD9A 4G8GE 2DJUA 3SDAC 4JEGB 3UTTA 2IFGA 3E2HC 1N5AB 5ISZA 1RIVH 1RVFH 4F57H 3EO9L 2ERJB 1UZ6E 3PGCB 3TVMA 4YHYC 1LK3H 4KKCC 2J8UB 2KDGA 4HCRA 4KKCD 4YNYA 4RNRA 2XI9A 1IQDA 3ALWA 1NLDH 3V52H 1CVSC 4TNWK 1DEDA 4UDTB 5GISH 4HDIA 1AGCB 3OZ9L 4KROC 2V2WA 3DIFB 4HFWB 1C5DA 5DD5H 3UYRL 4WFHD 2OZ4L 2R56L 1TPXB 1HKFA 4RA3A 1EO8H 3UBXG 1HHIA 3K8KA 2AV7A 1JTTA 2FR4A 4PY8I 1I8MA 2IG2L 4HS8L 2E9JA 5I76A 1O0VA 1A1NB 4KTEL 4J3SA 2Y23A 3GEWB 1NCNA 3IFNH 2DLFL 2IANE 1RHHA 4YIQB 3OJDB 1EERB 4NQXA 3EGSA 2VDQL 1X5LA 4NJAH 3SDXE 1JHKL 3E6FB 3RY6A 5BVJA 3E6HA 3LCYA 4NQVB 4HSQA 1T20A 5D72L 4NN6C 4FQ2L 3H7LA 3QA3B 4LSRL 4NM4H 4WIQA 5ILTL 4JY5H 2DLEA 2ATKA 5GRUH 1W8OA 1LD9A 5C6TH 2V2TA 3H8NA 4ZOEA 1ZMYA 1QBAA 3O8XA 1J0JA 2XQYG 3I6LD 4KZEH 3C6SB 3DVIA 3NH7H 3SKJL 1U3HD 3QO1A 3WKMH 4E41A 5C0FA 3T0ED 5HHNA 1GSMA 3BPOB 3RNQA 1I1AB 3UZEA 3X3FL 3DWTA 3AS0A 4MSWA 1UKSA 5DRWA 2GK2A 1NKOA 4TPRH 4QXGH 3VG0H 4GKOA 5C7XH 5BV7L 5FV1L 5DURB 4Y5XA 5GSRA 3MO1B 5BQ7B 3EO1B 4RX4D 3MRCA 4GKSA 3WFHA 4QRSA 2DJSA 1LDSA 2LAAA 2Z92A 1U8OB 5D7LE 5ADOL 5CGTA 5LWYL 3HI1B 5MEQB 1GGTA 4RZCA 4UV7H 3SDXF 3TCLA 1OSZB 5KSAC 5CKGA 5KSAD 2EE3A 1FJ1A 3GFUA 1B9ZA 2O26U 3ILPB 5GRWA 3Q5YA 3C09C 3QFDA 5IK3A 3M45A 1MJ7H 1U8KB 2D0GA 3VFOA 4X0KB 2F74B 4JDZB 4K3EH 5EIVA 4BH8A 4X4XB 2IAMC 3P4NA 5SWZE 4JG0H 2JJWA 3CFEB 1AHWC 3BDBA 4MQTB 4GBXC 1BGXL 4PGDA 1JE6A 4LNRA 4YHMH 5B4MD 4QRRB 1EHLL 4RQQB 3OZ9H 4CMHB 3QI9C 5HDLA 1AIFB 1OD9A 4PJFB 3QWOB 5CEXA 5A2LH 4RFOL 2JCCE 4X80H 5I66B 4HWEH 4GLRI 3LKPA 4WCYL 5DR5L 1ZHNA 5CINH 4M7JH 4PUBL 1KNOA 3B2VL 5IW1A 2DQFB 4QRTB 3IRZA 5GGSY 4GRWE 4JN2B 3O9WB 3KNBB 4K3EL 5KSBF 5ALCL 3LRSB 3BW9A 3VXPA 5EORH 1CICC 3MRFA 1XMWA 3JTSA 4CU7A 3TIDA 3VE0B 1CZ8H 1HOCB 2Y25A 3VDCA 4Y4HC 3TFKD 2AK1L 1XGPB 1H9VA 1HHGB 2GW5A 4Y4HD 3SGKC 1VFOA 1W0WA 3TFKC 3U9PL 3WD5H 3HLAB 3MRCB 2FX7L 5CJ5A 1C5BL 4P5KB 5FYKL 4ERSH 4Z7VA 2X9YA 3BEVA 1XGTB 5FYLH 1QO3A 4KUZL 2EC8A 2OQJA 2E6PA 1LWRA 4L8SB 43CAA 3ARSA 2B5IC 4JKPH 3NGBC 5I1DA 3FOMA 1WZ1L 4PRBB 1A02N 1OLZA 4RGNC 5C0GA 3WEXA 4DGIH 1E4WL 1E4XH 5BV7H 3V4PL 3X17A 1K8IA 4D9LH 4PRAA 1MCOL 3SE9H 4M62H 3GM0A 4ZNCD 3HI5L 3NFNB 3MRPB 1IAIH 4HKZB 5L9DL 2EIZA 4DGIL 3TH3T 3TV3L 1WCBA 1JVKA 2XKSA 4UUJA 1NL0H 2BVOB 2CK2A 3T3PE 3EYQD 1HYSD 3BDYL 5D7IB 3O9WC 4J7RA 4EN3B 2UWEB 2C4FU 2F5BL 5KSUA 4OZHA 4UQ3A 4O2EB 2BCKB 1TZIB 3PWPE 4LGSB 4PJHB 5FUOH 5I1AA 4GRWF 1WITA 5C6TL 2R4SH 3BEWB 1LGVA 4LSQH 3T77A 1S7WA 1TCRA 3DXAE 5KSBE 4MAYD 3C08L 4HWBA 1DBML 4MAYC 3IDMB 4AJ0A 4HIEA 5HHOA 5I1IL 4PPTA 1GPOH 2J88H 4JO3L 1T1XA 1QLRA 2CLRB 3DRQB 2NQCA 3NABL 3EYFB 3FT2B 32C2A 1B0RA 3SQOH 3RVWC 1P7HL 1H15B 3QUML 1BHGA 1KPRA 2CXKA 4H1LB 4NP4H 3RNQB 1UGNA 4PGJA 3GMNA 4ZS7H 1N0XL 5HHQA 4X80L 3LQZA 1A4KB 3W9EA 4H0IA 1YNLH 1NUGA 2P24B 3ARBD 5GSVA 5CIPB 1LP9F 3MRHA 3TIEA 3D18A 5FUCE 4PJXA 5SWSB 2BFVL 5GS2D 1V7NH 1XGQA 1ZVSB 2PF6A 4OT1L 4G43A 1EHLH 1VERA 4OFPA 2F15A 3MUGB 1Y0LB 3UYRH 1ZT1A 3MCKB 3PDOB 4PV9A 1J87A 2QSCH 5IMMB 4PGEA 5CILL 3V9FA 2JJUA 4OD1L 2ADGA 3A6BL 3Q3GB 3VMNA 5I18H 1DQLL 2VXVL 5L6YH 1FYTB 3U79A 5SV4A 3TA3A 1IGYA 1KPUA 1QG3A 3JWNC 4HMDA 1KPUB 5EPMB 3QIWD 1RIVL 1R5WA 5EOTB 4OCYL 3MRBA 4ZFFA 3JV0A 3Q6GL 1K2DA 1OAXL 3NZHL 4ZUSB 1HEZA 5FK9A 3NAAL 3RWGB 4J1UB 3ZO0A 5FUCC 1VFUA 3ZT5A 1AXIB 4DOHE 3OAUL 1Q72L 3UAJC 1OGTA 5FF6B 3BKMH 5ADPL 1N6QH 1A6WH 3MOBH 2AXGA 2DTMH 2VLJE 2GITB 4PJDE 3MLWH 5I71C 4OZHE 2A6JB 4WHDA 3LHPH 4XP5H 9CGTA 1DBJL 1YN6A 2NY3C 4XMKL 5IGXH 2DDQL 2NY3D 2IBBA 1HWHB 3GI8H 4ONOA 1RUQL 3P9MB 2P8MA 3BWUC 4UQ3B 2AXFA