2V6HA

Crystal structure of the c1 domain of cardiac myosin binding protein-c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
DDPIGLFVMRPQDGEVTVGGSITFSARVAGKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOSIN-BINDING PROTEIN C, CARDIAC-TYPE
publication title Crystal structure of the C1 domain of cardiac myosin binding protein-C: implications for hypertrophic cardiomyopathy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v6hA00
2IH1B 3SKJL 4M7LL 3X3FH 5DRZB 5CILL 4JQVA 1HDMB 3DRQB 1FQ9C 3HKFA 4X6DA 1H5BB 1UZ6E 3QUZC 5IVZA 4DKAA 1DQML 3JTSB 3CZFB 4Q7DA 3G08B 1WT5C 2L7JA 4Q6IC 3CFKB 4IHOB 4CVZA 5C0IB 3FOMA 4RMQA 1CXIA 3S36X 2P46B 2V2XB 1IGFH 2VLKA 4JPWL 3VD5A 5J12C 2W0LA 1X5AA 3S98A 4AENB 2X4SA 5KG9B 2R2EA 4XI5C 4HH9A 5F1NB 3KR3H 4O58L 1FFNA 3GSWB 3Q6FB 1DFBL 4GRLA 4KC3B 4NJ9H 1W72H 2C3VA 2OTPA 4MGXA 4OTXL 2B2XL 3KNBB 1UXWA 4UI2A 1WK0A 3MBXL 2X4QA 4Y0GA 3VH8B 1TIUA 1BD2B 1XGRA 3TCXA 3U1SL 3WLBB 3UTQA 2H2SD 4BKLA 3OMZA 1N0LA 3FFCB 5IB3B 4EUPG 2Z92A 1KLGA 5EFIB 5F7DB 4LSSL 4NDMB 3S4SB 5EZOL 1MCWM 2NXYC 1F2QA 2OL3A 4ZO6A 4ZQKB 4ZOCA 1HILB 3T3MF 4ELMA 4YUEH 3MACL 2HJLB 3SDAC 5J7CC 2VXVH 4J3OC 1IKFH 3JV6A 1CT8B 4XPFH 4KAQL 3WEXA 1QKZL 1BQHA 4PV8A 4U1JB 2BXZA 4WTZA 4W4NA 3ZHLA 1GPOL 1N59B 2OZ4L 1BIIA 1CXHA 2Z91B 4KVNL 1K8IB 4MX7B 3AGVA 5IGXL 4WHYH 4S1QH 4QHNB 1Y6NR 1Q9WA 3QULB 3R4DA 2P44B 2YBRA 2J5LC 3KLHD 1XF1A 1U92A 2BNQB 1XIWD 4AL8L 4ODSL 4RRPA 1I9IL 3VXPA 4PV9A 5AG9A 5C0FB 2GIYA 4W4OA 1DQTA 4GW1B 5EBLA 4PRDA 4F7TA 5F9OL 4P4RA 2BSED 5EU3B 1F58H 4MD5A 2OLDA 4W6XB 3QSKB 4DCQA 1XEDA 3BKYH 3VFRA 4X6DE 3L5HA 4KRPB 1S5IL 12E8L 3K4AA 3E2HB 5CIPA 2VL4A 4OGXL 1K3IA 3A0OA 2FHCA 5FO9A 4HKJA 5F7YC 5FCUH 2VLKE 1PQZA 4QRPA 4OD1H 2GSIA 5EA0H 3CJJA 3L3KA 4JY4A 2GFBA 5BMFL 4ODXB 2DYPD 2BVPA 3VE0A 5K59E 4KUZH 1SYVA 4MNGB 4EN3A 2NY2B 4TRPH 1MLBB 4AIZA 1IGIL 3L7FB 4JRWA 4O2CB 4LPUA 3O8XC 3HI1A 5GS1B 4LK4A 3QUML 4E42B 1JPGA 2E8ZA 4ZO9A 2QL1A 1ZLSL 5I30H 4NO0A 5TQ0H 4E41A 1OP3K 3TH4T 3EJZC 3EYOA 2V2TB 3UCRA 4LGRB 4XNZC 3VXTA 3MRIB 2E27L 3O3AA 4M93B 5IROC 3LDBC 4NUJA 2R8SL 2ICWI 3FHQA 3STLA 4NKMB 2BMKB 1FNEA 2I07B 5EOCJ 4PYGA 4PJ8A 3DI3B 3VFTB 1V3LA 4MAYD 1OAQH 4LHUB 1JMXA 5GISL 3EO1B 2J4WL 5HSFA 4JDVA 3BP4A 5HI4D 5FV1L 5FO8A 3QUKB 1A02N 3ILPB 3HMWL 3TNMA 1R5VA 3CDFA 4GRMA 3LS5L 4I13B 1YEDB 4L9LC 5JPMB 4K7PL 5FKPA 2DL2A 1NGQL 1FV1B 2IH3B 5DZLA 3WDHA 1FNSL 4Q9QL 4BSWA 5JOFB 4Q6IB 4HX1A 3WS3A 3L1OH 4HXAH 1HSAA 5EUOB 35C8H 4X7SH 2VSCA 4HV8A 2NXZB 5A43C 2WUCL 5J12B 4G42B 2R0KL 4CW1B 4P5MA 4LIQH 5DT1H 4M43H 1OAXH 1U58A 4NN6B 1EA9C 1T20B 5KW9H 3V7AE 1KIUA 2BY3A 1FZKA 4HMCA 3OWEA 3RIFF 2E9BA 3CFDA 2ATKA 4QRPE 3EFFA 4CN4A 2H26A 3BP7A 3KYKH 2XZCL 3DNKA 3IXAB 1FE8L 3O6LL 1JZ2A 3ULVH 2H2PC 3V5HA 1MCHA 2W65B 1U95A 5BOPA 2H45A 1DQJA 4NOBA 3UBXI 3EYFB 4KK8D 5BXFA 1JCKA 3WN5C 4KWUA 1XIWA 3OQ3B 3IJYA 1EEZA 3SDAB 1MEXH 5DZNA 1N64L 4YR6A 2P24A 4OB5L 3NAAH 3LEVL 1ZLVK 1CE1H 5JMRA 3DXAB 4Y2DD 3OKNB 2E7CA 5GJTL 4HBCH 1L4IA 5FUCC 3SO3C 2J5LB 4P3CH 2BSSA 4KVCL 4JFZL 4Y5VC 3HZKB 1MJ8H 1F3JB 4LLYB 1LDPH 1YDPA 1A6WH 4L3EB 4FQLH 1IL1B 1MAML 2D31A 3DRTA 1CFBA 4KI5F 4ZUSA 5I8CA 1PSKL 3UPAA 2X42A 3LV3B 2DYPA 1G9EA 2Q1EA 4OBRA 4HUUB 2UV3A 4IOSD 4KK9C 4MCYB 3U46A 1EMTH 1JWUA 5GSVA 1TJGL 5DHVH 3UYOD 3ZE2F 1ZXQA 2C7UB 1AXSB 2VAAB 3NN8A 3UTSB 4I3RL 4N5EC 2J88L 3NZ8A 1LO0H 2B20A 4YDJA 3ARQA 1SJEB 4QXUH 3D87B 1P4LB 1GAFH 3HZYA 1ZT1B 4R90L 4FZ8L 1W72B 4UU9A 3I3EA 4J7RA 5J13C 1I3UA 3BXNA 3AAZA 3GNMH 4TOYL 1MFDH 4PJGF 1G7IB 1UH4A 3AVEA 4MAYA 3LZFH 1R24A 4MAUH 2VDNL 4XNZB 2J2ZA 1BREA 3MLVH 4YXHL 4ETYA 3LDBB 1NCBL 1J18A 4OF6A 1D5BB 4N8VB 5F7FA 3N85L 4J12A 3MV7B 5DD6A 3OG6B 4LP4A 4R0LA 4UT6H 2NYYD 3AC0A 1I1YB 4NNPL 5KJRL 5LGKA 2AK1L 2OCFD 2YWYA 4BQ8A 3IDJA 4GUPA 1LO3H 5SV3A 4XVTH 3QDMD 2NQCA 1OTSC 1QO3A 2W92A 1IAII 2VDMH 3LPFA 4X5XB 3SKMA 1MWAL 1YC8A 2CPCA 5HHVH 3IFNH 3T77A 2AP2A 2CO6B 1JWSB 4NZUL 3SCMC 5CLWA 1YMMA 3GSNL 1OARL 4L9LB 4JKKA 4TVPD 2GT9B 1ES0A 1AO7B 1F4YL 2AJZA 2W60A 5C0DA 2CLVB 3EOYG 4PS4H 3WJJC 2Y7QA 1TCRB 1XCQA 3U36B 1KJMA 3ROOA 1U3ZA 3CX5J 4Y5XC 1ODAA 2WWKO 3W9EB 2VQ1B 5LAXB 4JZJA 4L8DB 5GRVK 3PGFL 1WFOA 2RBLA 1I8MA 1C08B 4BA8A 4JFYA 4Z0BL 4UDTB 1YEFH 4DGVH 4PRHD 5EU6A 1J88A 3G5VA 3BFOA 3DOSA 1OM3H 2HLFC 5DQJB 4G80B 2Y6SD 3B5TA 5KANG 3O9WA 1T89C 4HWBA 2IJ0C 1KIRB 1WICA 3UJJL 1MFEH 1CFSA 4PJ9D 4AIOA 4MD0A 4HEPG 3CCHB 2E8YA 3HUJA 1A6TB 3QUYD 4Y2DA 3HAEB 1RIHH 4NSKA 5C0GA 4RNRA 5D1ZD 2BRQA 4ZDHB 1B9ZA 2ZPKH 4U6HA 4G6KH 3WN5B 2YC1B 2D0GA 4JR9H 5CHNA 3GSQA 5I16A 1JK8A 5IESL 1HKLL 3OJ2C 2XKNA 3ULUF 1ZKAA 1ZSDB 1ND0B 4OCLC 2PKDA 1NL0L 3TP4A 3MFFB 3D48R 4LLQB 2X4TB 5JW4M 5F7EH 1NCDH 3RWEB 4F9PA 3SO3B 5IBTL 3HPJA 1FVEB 4Y5VB 2ZG3A 3ARUA 1BFOA 4O02L 5I1LA 5JW4R 3C5ZD 5FDYA 5C7XL 5C0NC 1BLNA 4M1DL 5LCVL 3W39A 4PJBA 5JO5A 3MLWL 1CE6B 1V7ML 4ZOEA 1XH3B 1FO0H 3T0EC 4YDVB 3P9MA 4MNHA 1D5IH 2C5DC 5CSZA 5CINH 4RMRA 1YMME 2A83A 3BE1H 2AGJH 3OAYK 1T22A 2OP4H 4FZEL 3BKCL 2AXGB 1EAPB 1FGNH 5FYKD 2VDKL 1AJ7L 1A6AB 1PKOA 1KBGH 4G7YH 3FN0L 1XR8A 5D7IA 4Y16D 4FQPA 5EIVA 4G6FB 3RP1A 3V6OC 3D85B 4XP1L 2VSDA 1MRDH 3EHBC 2R23B 1MHEA 3T1FB 1YNTB 2A6KA 2AQ1A 4YXKH 1AGEB 3RDTB 3FB7A 1E28A 4O2EA 3MC0A 3V52H 4DZBB 3QDJB 3MRQB 4WDIA 3H9ZA 2G75B 4PGCA 4W81A 5J13B 3QJFB 5F3HA 1NGZB 4Z7VB 1UJ3A 2AI0L 4OSUH 3BD3A 1AGDB 5I2IA 4HJJL 2PO6D 1T66C 5ENWA 1BAFL 4KTYA 3EYSH 3QDMA 2DQUH 3QQ9D 3HUJE 2R9HC 3M17B 4EOWH 5DD0H 4J1UB 3CVHL 3IDUA 1MIMH 1S7XA 2CLRA 3CC5A 4NWUH 2AABL 4TQEL 2R0ZL 2E6PA 1MRFH 5DD1H 4UV7H 5I1HH 3CFBA 3JWDH 2FDBP 4JKLA 3OKLB 1SMOA 4M5YL 4OKDA 2ADFL 3SBWC 2QADD 2NY4C 2BNRB 1IGJA 1ITBB 4ZS6C 5AUMA 1T03L 4S11A 2X9WA 1Z5LB 3DROB 4LU5H 2Q8AH 4NCDA 3SCMB 3QPXH 3N1GC 3QZWB 2JB6A 4P2OD 3RRQA 2RB8A 3GSUB 4JG1L 1GH7A 1KB9J 2ITDA 4Q0XH 5ISZB 2NCMA 3D69B 4BQCA 3MPCA 4OBSA 2BCKA 1HK6A 2GTZA 4OI9A 4NQXB 4PJBE 2LTQC 4LOUD 5E95B 4N0UA 4TUJA 3GMQB 4XPBL 4Y5XB 2ZKHH 4FFVC 3HE7A 2A6JA 3EDKA 4B53A 4ZPVA 1ZWIA 5D7KD 5D1ZA 5T1MB 1S7UA 1RHFA 5SWQA 4S1SL 4X4ZA 4X4XA 2ADIA 2NY0D 4LDOB 3B3IA 1A9BB 5HGHA 1FC2D 5GGRY 5D7IE 4TSCL 5T5FH 3U9UA 2GK2A 3GDBA 5GS0D 3NZHH 3GBNH 2FIKB 4JO3L 4K9EH 1EGJL 4J3WA 3EO0A 2NLJA 4YFDB 4GS7B 3OKDB 1FFPB 1P6AB 2YZ8A 3TO2A 3F12B 1MFCL 1JYVA 4KHXH 1T5WA 1WSST 4FNLH 1MFAH 2CLZA 4XVJH 5F89B 5I1JL 1KLUB 4TTGA 5HI5D 4QXWA 2V9TA 5B38G 1OP9A 5IK3A 1TJIH 5HPMB 5J3HD 1KCUL 1PDKA 1RPQA 2R69L 1ZTXL 1D5ZA 1S3KH 4X6CB 5ALCH 5EUOF 4L8BB 3KPQB 4LLWB 1FVCB 3G6JF 3QDME 3OKOB 4OLVL 4KQ4L 5GZOD 4DGIL 2O26U 3UTTD 4MD4B 1X6LA 1JRHH 5FGBA 4LGSB 3HMXL 5KSVA 2NZIA 1BPVA 1VFAB 2YD6A 3FRUA 2W1NA 1BBDH 1WBYB 2HTLC 1X5HA 1XCTB 4FP8L 5DMGD 1GVIA 4R4ND 4TVPE 2G9HB 1HCVA 4JGJA 2AXJA 3O6KH 2I27N 4YO0B 4O51B 2IBGA 4Z77B 1JGVH 3JWDC 3ESVF 3V4UH 4LARH 4Y16A 5DR5L 5E8EB 3T0EB 3VFOA 4TSBH 1JPTH 4LQFL 5E8DH 4FABL 2ERJC 1J1PH 4WWID 3O4LB 2P7TB 4MXQD 5INDA 4KKNA 5JORA 5LKNA 1MCCA 1G7PA 2G2RB 4F7PB 2ICWA 4N0UE 3DV4A 4NJ9L 2QQKH 1H3VA 2OBGA 5AD0B 2CR3A 4HS8L 2JELL 1KB5L 4L9DA 3C08L 1OP5H 2OXGA 4Z7WB 3MLZH 4P5TA 5J6HA 5I17A 1FG2B 2F5BH 3KPMA 3PV6A 2AKRB 2APBA 2J1KA 2UWEB 5T1LB 5DVKA 1KELL 3ILQD 1UCBL 1OD9A 3SGDH 1JUFB 2Q7YB 2OTUB 4R8WL 3P77B 4Y1AD 2CJUH 2QHLA 3CVIH 5D4QA 3N06B 4D9QD 4XP4L 3IKKA 4X7TA 4WFGD 1FL6A 3S37L 5H94B 2AJ3A 3KWWA 1WBXA 3EJYD 4PJDA 3W5MA 3QIBD 4P2OA 1Y6MR 3AXLA 2XQYK 3O4OC 4PJHA 4XCFL 3A6CH 4QHUB 1E6OH 3GKWL 2FHFA 2VXTL 1CDIA 4PPTA 4MJ5B 5HD8D 4L5FH 2FEDC 4P2RB 1G6RB 4NZTL 4Y19D 2NY4B 1RJLA 2A0LD 2X6MA 4G6JH 2WBJD 4R7NA 3BEWA 1JN6A 1N7MH 4FXKA 3SKUD 4U6VH 3NCCB 3V4PL 3AM8A 1RZKL 1T1WA 4JPVL 1BQLH 3EOAB 5FYKE 1B3JA 4BFEA 2QR0A 1IAIM 2DLFL 4BQ9A 3H7BA 1S8DA 3PABA 2LTQB 3H3KA 2ZSVA 5D72L 3F6LA 4JFHD 3SDXF 1ZGLA 4KKAC 2F74B 5JNYA 2VERN 1S9YA 3WDJA 3KJ4C 1NCNA 1QBAA 5GIRB 1G7HB 4P4KA 4OLUH 4GXVL 3RWJB 3OXRA 5KANI 1B0GB 4UUJA 2AV7B 1QOKA 5F1IB 4OD1L 5D5MB 4R96B 3WCYA 3FONB 4M3KB 5CJ8A 5IHBA 1AC6A 2C1PA 3G04B 3ZE1F 1MJJB 1V7NL 2XWJB 3DVIA 5L88H 2XQBL 1K8DB 4A6YA 4IIQC 4YHZH 1IM3B 1GZPA 3QHZL 4RQQA 4G7VL 4QO1A 5TE6H 3UTTA 4JFXA 3E3QE 2IALB 4LCYB 1I9JH 2QQNL 3H7LA 5I30L 3DPBA 2LE9A 4I48A 1YECH 4KROD 3S36L 4CNIA 3MJ7A 5E0QA 2NY3C 2NR6D 3DBXA 1NDGA 1Q72L 2Q8BH 5J0BA 1IGCH 5HDBF 5FF6B 4BH7A 5HGGS 3BJ91 4ODVH 1D6VL 1G7JA 1IILE 1Y18B 2VDOL 5JR1L 3RX7A 2ZNWA 3TM6A 1SM3H 2L7UA 2OL3H 1FZJB 3C6SB 4HK3J 3ULUH 4PJDE 3C9NB 1NFIB 5C6TH 1P7KA 3B9AA 4FQ1H 2Q6WB 4IMLA 1CF8L 3K2MC 5C07B 5AAWA 3BWUC 5F88B 2DIAA 1YEGH 3MLUL 2FYYA 3ES6A 1T4KB 4MS8D 1NEZA 2LU3A 1J05A 1ORQA 2ZOKB 1MH5B 1VENA 3FO1A 3DX8A 1T2XA 4LDLB 5KBNC 2XTJB 2ERJB 3D5OF 1YEHL 4HXAL 3GFUA 3DMMD 5DEGB 35C8L 2QSCH 3IDIB 1GGCH 1MCOH 3D6GA 3ZT7A 5E2TH 3HI5H 5BZDB 1A7PH 5DT1L 4OGYL 4LSPH 3LKOB 2VABA 4CN1A 5IEKB 1BGXH 2WZPD 1IFHH 4GG6B 5AYQA 5FYJH 1FAIH 5L9DH 4DK6A 1J5OL 2KQNA 4CJ1A 4HDIB 1F6FB 3DURB 3T1WA 2WNGA 2FX7L 4OIIH 2QQQA 1A1OA 4S2SB 5CZVL 3VDCA 2I5YH 5FV2A 3DUUB 5D1QD 3ARDC 4KRMB 4HIJB 5E1AB 1HEZB 3TJHC 1DLFH 5D1XD 4EEEA 5GHWH 3FO9B 1YNLH 3BUTA 3W11D 4Y19A 4OLZH 3UTTE 5ITBL 2YMXH 2WBJA 2WIIA 4MNQD 1N2RA 2OR7A 2ZCLL 3KPRD 3PGDB 1IQDA 1OWWA 3NAAL 1CLYH 3TH3T 3VFNB 3G6AB 4GAYA 3O4OB 5FGCE 4LCCA 5IM7B 4M7JH 3UZQA 2CDEA 3MGOB 5C0AD 3CX5K 1NLBL 4K07A 1IAOB 1AGCA 4MSWA 4CU7A 3VFPB 3W81A 4PRNB 2ZCKL 4P3CL 2W0PA 2DQGH 2AAVA 4EI5D 5L6YH 3NA9H 1A6WL 3BQUD 2BC4A 2H3NB 2JIXD 2BNUB 4OCWL 4S10A 4XBPB 4IEFB 5ACMA 1SEBB 3GSVB 4Z7VF 2HFTA 1MPAH 4PJEA 5E56A 4APQD 2IQ9L 2YK1H 5DO2C 3QNXA 2J7LA 3HR5A 4PJIE 3KJ4B 3ALWA 2OTWB 3I75B 5TFSL 2FJFA 3V0WL 2XPGA 1ED3B 5TDOA 3GHEH 5TE7L 2D7QA 2GKIA 3BZ4A 4FMKA 5E08H 4P99A 4XZUB 1Z9LA 2V7NA 1LO0L 1LK2A 5E6IB 2BVQA 4NQEA 3VFGH 4EI6A 3BGFB 2R1YB 1T0PB 3VXSD 4LLMB 1YNKL 4IIQB 3HG1A 3STZB 1T1ZB 4Y1AE 2QEJA 1IZKA 2F58L 4D9QE 3BEVB 1VESA 1HE7A 2A77H 4JPIB 1ZA6A 1XGTA 4HQQH 5IV2B 3M45A 1DN2A 1T80A 1CL7H 4P5KB 6FABH 2V9QA 1L7TL 3WIFB 3MV11 1ZVSA 2NY3B 3MLVL 1FGVH 1PYWA 3BVNA 4KK5D 1AIFB 5DHYA 4M5ZL 1OP3H 1DDHB 4HCRA 4C83B 1UKQA 1B0RA 1ZAGA 3BIKA 4Y19E 4X6BB 2OSLB 2EDWA 1RZ8B 2V2WB 1I3RB 1YZZA 5EN2B 3QCTH 4F37F 4GQ9H 3QUXD 4EN3C 1J0YA 5EUKA 1P1ZA 4Y4FD 3W5NA 5DSCB 3D3VD 1KPUA 1YY9C 1JZ7A 1KPRA 1NDMB 4XNUL 3MLPA 2VDML 3EW3B 3EOBB 4B5EA 1ZT7A 1AR1C 2EDEA 1HHJA 2Q7NA 4HSQA 5DGRA 1L7IL 3B5HA 5CD5D 4JFHE 1FBIL 3RWCA 2O5YH 5J06A 3O0RL 5IB1B 3PP4L 3MRLB 1JBJA 1WFTA 5BS0D 4QXTB 1W2KT 2KZWA 2Z31D 1S7TA 4K8RL 5LXGH 1AI1L 3BSZH 4PJEE 5D1QA 3MZGB 2PXYD 2EC9T 4UIMB 4OJFH 1NCWH 2JK5A 4DEPC 3C87A 3Q6GH 1J8HD 2WQ8A 4W6WB 5D1XA 3CD4A 1YEFL 4DGVL 3K2UL 5I8EA 2HFEA 3DX7A 2VZVA 2P8MB 3H2WA 3RU8L 4X6DB 3KPRA 3MNZA 5I1EH 4MXVF 1JHTA 3IFLL 1DEEA 1F00I 5TDPA 5FOBA 3ARDB 5C0AA 1IMHC 1N4XL 4NM8L 4L4VD 3QXAA 4Z8FL 4LBEA 2VLKB 5JOPD 1CDUA 4NQSA 5CZKA 1FLRL 4K55A 4HLJA 4JFEA 5IVXF 4HH9B 4EI5A 1FFNB 1AP2A 2BJML 2JIXA 4WW2F 4XMLH 3RTQD 3EDJA 4PJFA 1MQKL 3EGSA 3RVXD 1UXWB 4KZEL 5IMMA 3M8OL 3WFZA 3K46A 2ADJA 2X4QB 1TVHA 1XR9A 3NH7L 1CZ8H 4QCIB 4WTXA 5F1OB 4DN3H 1ZLVH 1XGRB 3C2AH 4FQXD 5JXED 1BZ7A 1A4KA 3TN0B 4K7FB 2Z92B 1KLGB 3FT4B 1SMAA 1K85A 4PJCA 1AQDA 1E4KA 1NFDA 4Z7WF 1OPGH 2OL3B 3KLHC 5L7XL 1XIWC 2UWEF 3HR6A 1A0QL 4KKLD 4F7CA 1JNLL 3JV6B 1FIGH 5LBSH 2GUOA 2H32H 5CINL 4V2BA 5E6ZA 1BQHB 2DQDH 3VXSA 2XA3A 3GI8L 1ACZA 1U8PA 1YA5A 1FSKC 2DJ4A 1BIIB 4I0PD 4LVHC 5BQ7A 3LH2H 2GCYA 5IW1B 1Q9WB 2EDLA 2YBRB 4KHTL 4OQTA 3UJIL 2RQ8A 1UZ8A 1HQ4A 4ZUVB 2DDQH 1XFPA 1YN7B 3JV0A 5F7LB 1A7NL 4PV9B 3V0AC 3VXPB 4ZAKB 2EH7L 3TNNA 4YDLC 4FQ2H 4NQDD 4PRDB 4YDIH 1CXFA 1SY6L 3L3GB 1MAJA 4P4RB 3NIFE 4MD5B 1R5IA 4KJPD 1DANT 4DCQB 1QLEL 4C56D 4FXGA 3VFRB 5L2JA 4ZMAT 4CVXA 3KPRE 2IBZY 1KNOA 3QEUA 4UB0L 3QUXA 5FM5M 5HYJD 3VRIA 2JJWA 4I3SL 1MQ8A 3D3VA 5CIPB 5C0AE 4HUMB 1ITCA 4C4KO 4LKCA 5FO9B 2YN3A 2IQAB 4HWBH 3QEQD 4QRPB 2W0FA 1RZ7L 3K4DA 3L3KB 4JFEE 4JY4B 3LN4B 3TBYA 1IQWL 3A6BL 5DMKA 5TJWK 2BVPB 1FCCA 4XP5H 1OAUL 3VE0B 4WUUD 2X4NA 3E6HB 4PJFE 5D5MF 1AD0A 4EN3B 4AIZB 2R4SH 2Z31A 2BOCA 4FQHA 1J1XL 4POYA 5ANME 1F4XH 3U83A 4LU5L 5HYFA 5DK2B 4CGTA 2IG2H 3TGXA 4NO0B 1J8HA 4MAYC 1X4XA 5CUSL 3VXTB 1IEHA 1NCCH 4NFCA 3O3AB 4PJCE 1NFDE 5J9PB 4NUJB 3G5YB 3FO0L 1DBMH 5FUOH 1M4KA 1OAYH 4QRRD 2VQUA 2AK4D 4WHYG 4NBZB 4GG8A 1OAZH 4YZFE 1FNEB 2EDTA 4CJ0A 4R0LC 2EIZA 2V17L 4PD4J 2AJYH 2NZ9D 5EBWA 5F7UA 4DEPB 1HXMA 3VXSE 1KPVA 3X13A 5BRZD 4RZCA 2KZ1B 4L4VA 4JRXA 3BP4B 4HKBA 5FO8B 5BO1H 1NAMA 3OL2A 1WCBA 2CK0L 4TYUA 4YHKL 4FFWD 1CG9A 4HPYH 4OF0A 2JJVA 2ZG2A 1OQOA 4GRMB 3RTQA 5IB2B 5KS9A 3FN9A 4PY7B 2AJVH 5E4IA 5FKPB 4K23L 1RHHB 2PR4L 4QLRA 1GHFH 4BSWB 3K81A 3JWOL 1QFOA 5I1CL 1HSAB 5CJQH 2D3VA 4DVBA 4FQXA 4HV8B 5JXEA 2IADA 4PLOB 2XZQH 4P5MB 3BYTA 2HRLA 4JEGB 4JZJC 4O2FA 1U58B 2SEBA 5C0RH 5DWUH 3MV01 1RV6X 4JFDD 1U8JA 4PRID 4PGJA 3D3VE 4KK8C 5D2LE 4CUCA 1FZKB 1ZHNA 3B6SA 4QNPF 3UPCA 3E6FA 4X8XA 5JW3L 1KUMA 2H26B 5C70A 5LWYH 4GG6F 3UO1H 3U7AA 5IKCB 1CFVL 5DTFA 5IT2L 4X80H 3P73A 3V5HB 4HGWA 3FMGH 4Y2DC 4JQIL 1DQJB 4LARL 4S0SD 5A2FA 5BXFB 4TVPH 3NTCL 1XIWB 4ALAH 1EEZB 1MCPH 3UTOA 1A64A 3VFVB 4UT9H 1PLGL 2XA8H 3ARGD 3ZE0F 2P24B 5TF1L 1J8HE 4NQDA 4YPJA 3EYVB 2FX9H 3AU1A 5MEND 1KT2A 3PHQA 4LVHB 1YEIH 3JXAA 1E6JH 4C56A 4NKOA 3OAYH 4IBLT 4F9PC 3WNLA 1LK3H 2DQIL 2VUOA 5HYJA 3BJLA 1LE5A 3LKRA 3KPLA 3MO1A 2FJGA 1YDPB 4M7LT 3H9YA 2J8HA 3X14A 4L4VE 1YPZE 4HJ0D 4ZUSB 5JOPE 3QEQA 1U91B 5I19L 5KN5A 1PZ5A 1YN6A 4YIQA 2DYPB 4PJ5D 1SJHB 4R2GD 3MUGA 2FLRT 2WWKT 4WUUA 3Q3GA 3QJHA 4KJYA 5KS9E 3QYCA 1LO2L 1C5CL 3U46B 3MNWB 3FQXA 1JWUB 5GSVB 4F57L 4G9FD 3GRWL 3RX8A 2GAZA 1Q9KB 5IFJB 2Y72A 1TZGH 1VB9A 2O5XL 2YD3A 4M7KL 3TV3L 3NN8B 4Q9RH 4LCWD 3RWHA 3A6CL 1GGBH 3SGJA 4YDJB 3OJMB 1MCQA 4G43B 4N68A 1S78D 2X7LA 1A7OH 2V5TA 4L5FL 3WKMH 4XCCH 3HZYB 4NWTL 2AK4A 3VGGA 3VXOB 2DI7A 4NGHH 1PFCA 4CU8A 2Y25A 4YHLL 2NYYC 3AAZB 4ONGH 5LQBH 3MCKB 1UJ3C 3VGBA 5BRZA 1K5NA 4MAYB 1R24B 1ZVYA 1A3RL 4XPHL 3CSBA 4IS6B 1JFQL 3TYGH 3GO1H 4H25A 2YXMA 3PWVB 4L29B 4XH2A 4F2MA 1J1OH 5DD6B 3VXUA 2FLBT 1ZLWK 4R0LB 4RWYL 1JHLL 2EIDA 4M6OL 4G8FA 3BO8A 2X41A 5FHAH 4NQDE 3IDJB 3OR7A 1GZQB 1XF4A 2P1YA 3BESR 1QO3B 3T4AA 4BZ1L 4JJ5A 2F54D 4C56E 4WY7L 4EIGB 3L5WA 3LRGA 3T77B 1EK3A 1QSVA 5C8JA 5HYJE 1UCTA 5I0DA 1MJUL 4JFDA 4MA8L 4K3DL 1ES0B 3RVWD 1IARB 2HJFA 2AJZB 3F58H 4G8IA 3HZVA 5D6DA 2P42B 5DJDB 2VR5A 1I9JL 2Y7QB 1XCQB 3QEQE 4JM4H 2Y6SC 3ROOB 2BY2A 3CDGA 5C9JA 1RQ5A 4PJ9C 3TYFA 3QQ4A 5BVPL 5DK3A 3QHFL 1PAMA 3HE7C 3RPKA 3WFEL 4CL7A 3QUYC 4WUUE 4TSAL 4YHNA 4NZJA 5DJ2A 5D1ZC 1I8MB 2NY5L 4ODVL 4JFYB 5B8CC 5DRXA 1RIVH 2ENYA 1KIPB 5TE4H 3G5VB 5BW7A 2DMKA 1G9NH 1SM3L 3I6KA 1F90L 1KTRL 5B4MC 3ARGA 4NNYA 3ULUL 2VOTA 4OAWA 3GMLA 4PRBB 4DTGH 1QNZL 4MD0B 5MENA 3U0TA 3SDCD 4NUGH 3HUJB 4ZFGL 4Y2DB 2Y9RT 4RNRB 1A7BA 1JPSL 5B38A 5H2BB 1WCQA 4PJXF 4PGZA 2AK4E 4LEOA 5D7SL 4TUOB 5CHNB 3S96A 1EEQA 5DJ8A 1LD9B 1RUAH 3GSQB 5CBEA 3C5ZC 5I16B 3TO4D 5BRZE 1ZHBA 2XKNB 2OR9L 4LSTL 3FT2A 3HA0A 1FN4A 1GGCL 5AAMA 1P4BH 1MJ7L 4UV4H 5FGBC 3HI5L 4RFOL 5DJYB 5K59F 5DUBB 3QUMA 1S9VB 1TDQA 1CFNA 4JDZA 3VXUE 1EFXA 2AEPH 3IXTA 2HN7A 1BFOB 3LEXB 4DGYH 2B7DT 1HINH 1BLNB 1HIML 4G9FA 4H8WH 4LSDA 1ZS8A 1CCZA 3GBMH 4LSRL 5JO5B 4XP6H 3W39B 2FECL 3ALPA 4Y16C 3WSQL 4BZ2H 4OZ4A 2P5ED 3KYAA 1S7RA 3HC3L 4LCWA 5KVDH 3EOTL 2PF6A 3NIGE 3WL9B 2UY6A 1YYML 1QSFA 1I9EA 5EOCH 5CSZB 4Y4HA 3WFBH 1EHAA 3VWJA 2A83B 3MCG1 1U8IB 2CQVA 4JFDE 4PRIE 1VKXA 1O7SA 2P8LA 2ZSWA 5KVGL 1YEJH 4DQOL 2VLJA 3WLWD 4PLNC 3KDMB 5ESAB 4JANB 1XR8B 5D7IB 4A6YH 2N7BA 2P43B 5D7LD 4UTBH 4JFPB 3CFEB 3WMSA 1HNGA 3QQ9C 4I1NB 4M7ZC 3MOAH 3FB7B 1E28B 4XCYA 5I15L 3E3QC 3L3DB 5E2UL 4N0YL 1Q9OA 4P5TC 4PGCB 1DQLL 2DQGL 3RFZC 1VEOA 5CP7A 5HHXL 3TVMD 1LO4H 3K8MA 5I2IB 3OPZH 4HWEL 4PJ7A 5ENWB 4H88L 5MENE 1LILA 3QDMB 2NPLX 2VC2L 4TNVF 2CK2A 5GGSY 3RY5A 5DJAA 3J7HA 2HMID 3O41A 1LHZA 2FBOJ 3SE8H 1Q0XH 1S7XB 2CLRB 4P2OC 4YHOL 4L4TD 1CR9H 3MJ9L 4FFZH 1G7MB 3IGAA 2FR4A 1ADQH 2N4IA 4EBQH 4HG4K 2X1WL 4M9OA 4LOUC 1IJ9A 5GZND 4H1LB 5AUMB 1IGJB 2CDFB 4N1EA 1MVUA 5CJBA 4PJ5E 1B2WL 5D96C 1MCKA 3WUWG 2FIRT 2DQCL 2CIIA 3CFCL 1EO5A 5I76B 1D5XA 2JB6B 5A16A 3TFKD 3AM8C 4DW2H 5CD3A 2ITDB 2VIRA 4PP1C 1FG9C 4PGDA 3DSFL 4Z7UF 4G9FE 2GTZB 4PRHB 3B2VL 5ACLA 3P4OB 2NY0C 3MRNB 3IU4H 5GS0C 4N0UB 4TUJB 3T3PE 1CL7L 4LCWE 3T0DA 4I4WA 3ZMRA 4PJ9B 4B41A 2JF1A 1FGVL 1ZHKB 2A6JB 2BFVL 1V3JA 1C12A 3QUYB 4P4KC 4ZPVB 5D6CA 2YWZA 5D1ZB 1N0XL 1BQSA 3HZMA 5B8CB 2VZ1A 4V2CB 1S7UB 3ECBA 1U0QA 4X9FA 5HI5C 3B8YA 4GKSA 5SWQB 1WLHA 1U3YA 1R3IH 5J3HC 3RWDA 4RAVA 2E9JA 2KQMA 3CUPA 4LSUH 1I3GL 5T3ZD 5HGHB 3U9UB 3D0VB 3EO0B 2NLJB 5LGJA 2PCPA 4M8QA 4UT7L 3N9GH 3TO2B 5CS7A 2CLZB 1I8LC 4EDWH 4HH8A 4NFDA 5IFAH 4L3CA 1WC7A 4J6RH 5DMGC 1Z2KA 4R4NC 5I74C 1D5ZB 3C5ZB 4OFVA 2K3TA 3S35H 4MVBD 4PJ7E 4OT1L 3RI5K 3HHRB 2P5EA 2D7NA 2X9YA 4YPGA 3KVQA 2F54E 1QFWL 5KSVB 2BVTA 1I7ZA 4TTDD 3BDXA 3LHPL 4P9MH 3T0VA 3FRUB 4Z18A 4QOKD 4FXLA 3PHOB 2UZXB 1RZGB 2FB4L 4MXQC 3ISWA 3NMEA 2J3SA 1FYHB 3MYZA 3MLRL 3KYNA 4Y16B 4ZOAA 1WIUA 5D7LA 1WUNT 4WNQA 3VFOB 1X7QA 43C9B 4O00A 3I9GL 1D3CA 2XV6B 3RAJL 2ORBL 5INDB 3UYRL 4G6MH 4OCNC 1I7TA 1G7PB 2ICWB 4ODUA 5F7NC 3DV4B 1MWAA 1NMCC 3ILQC 3F5WB 3R06A 1QBBA 3VW3H 2PO6B 3GJEA 2YKLL 4RX4A 4J8RB 4M7ZB 3GSNA 3MV9D 4JZOA 1UYWH 5AYUL 2XI9A 3QUZD 4O9HH 2YRPA 3EJYC 1JNJA 5I66B 4RMWA 3KPMB 4KK6D 4WO4D 4FQIL 5FUZH 2VJXA 1EZVY 4BQ6A 5D9SA 5HD8C 4RGNE 4OF7A 5JW4Q 1B88A 2QADB 2XWTA 2A0LC 4P3WA 1CFQA 2WBJC 4XI5D 3CX2A 5B39G 3VGHA 4YHYC 3BH9A 3KWWB 1FIGL 5EORH 1KENH 1A2YB 2DQDL 3MLYL 5ABDE 4G5ZH 3EKCA 4P2OB 3NBNA 4DUVA 3N1FC 5FYLH 2GSGA 4JY5H 5IMLA 1K2DB 4LCCC 5IP4A 2QSVA 4ZFFA 4I0CC 3KLAA 2UVFA 2C3GA 3PJSB 4U1NA 4X6EB 2P5EE 2JCCA 5EU4A 3QXTA 1U8LA 4H0IA 1K4DA 5D96B 1L0QA 4R7NB 2D03L 4QT5A 1JN6B 5D71H 4JM2D 3MLSL 2NXYD 1T1WB 1VGEL 2EH8L 2NW3A 2DI9A 2MKLC 4LSQL 3D9AH 4EXKA 1F4HA 2A9MH 3H7BB 3P40A 2NY0B 4M8VA 4AT6A 1IKNA 1S8DB 3PABB 1JZ8A 3HC4L 1FORL 1KN4L 2ZSVB 4OD3H 1CIUA 3UBXB 5GGUA 3CZJA 3FQWB 5D7LE 1ERNA 1R3LA 1F8TL 5JNYB 5ICYA 1QHPA 1S9YB 3CXHK 5F70A 1ZMYA 3S5LG 3OXRB 4UUJB 3MLXH 1T7XA 3NFSH 2DJUA 1JMZA 4U1LA 4FA8A 4AEEA 1IRAY 3EYUH 2LAAA 4KROC 2ED9A 4LLAA 4ZFZA 2DD8L 3AMLA 3WFDH 5DEZA 1AQKH 1E27A 2D9QB 4WEBH 2ICES 4A6YB 4EZMA 3NFNA 2VXSH 1GZPB 5T1DH 3UTTB 4JFXB 2JKXA 1ZANL 5JIIA 1MFBH 4JCMA 2CGRH 4NFBA 4QOKA 1WTLA 1AXIB 4I48B 5FGCB 3MJ7B 3DBXB 2CDGA 1TITA 3BH8A 1T3FA 3P30H 1G7JB 5FB8A 3BRDA 4MS8C 1VCAA 3LQZB 1OTTD 1JHKL 3BAEH 3GK8H 4TULH 5E5MB 4CVUA 2PTUA 3MREA 3NIDE 1P7KB 1BJ1J 1XGPA 3CH1A 3D25B 2EKJA 4IMLB 4KJWD 2DIJA 3O8XD 4ODWA 5HDQH 4OD2B 3U4EA 3MOBH 3WIIL 4WI4A 4NM4H 1I1FA 3RGVD 2CKBB 2JCCE 5GGTL 4U1SA 1NEZB 5D2NE 5IW6A 3CVHA 1QTYT 2RFXA 1J05B 2AJVL 2ITCA 1ORQB 4PJIB 1L9NA 5C09A 5E8OA 3FO1B 4X98A 3DX8B 3H6JA 3MV9A 3KLDA 4LNRA 5KSBE 5EZJA 5C0BD 3B8SA 4JPKH 3B43A 5D1QC 2E5EA 4WO4A 5T3ZE 3PWNA 3FOLB 3IVKA 2HFGL 2VABB 1NMCB 1RZFH 2FEEL 2VLLA 5D1XC 1PX3A 2X10A 4Y1AB 2YPVH 5FIEA 1QBML 2DKMA 2ZJSL 1KJ3H 3W11C 3RL2A 4K94L 2IGFH 2XRAL 4I77L 3ZLQC 1FH5H 4QRTA 4XNXH 1LE9B 4XCEA 2FH8A 3QIBB 3UO1L 3BN9D 5IQ7L 3VXNA 4ZTOH 5JW4N 1I1AD 4YEFA 1Q9LA 3FMGL 1BZ9B 3VA6A 3VGAC 1A6VH 5DQDL 4K7PY 4Y19B 4ALAL 43CAA 4XAWH 1SHMA 3H42H 3RWFB 2WBJB 4YHYB 1N2RB 4EI5C 2XA8L 2X09A 3BQUC 1BBJA 4QOKE 3ZYIA 4QHKI 2GTWA 4GAYB 4BM7A 4M4PA 4LCCB 4MYWB 1EGJA 2CDEB 3QI9D 4JG0H 5GJSH 4JFFD 4APQC 3LQMA 3T0AA 1AGCB 2B1HL 1LK3L 3BWAA 4UNUA 3LKNA 3T65A 5FKAB 4EUPB 4WTZG 1ACYL 1H8OA 1O7VA 1I1RA 3T8XB 5ELIA 4G3YH 1E4KC 3ZKMD 4WW1B 1A9EA 3HC0A 1G9MC 2C3WA 4DVRL 1JYXA 4RIRB 2ZOLA 2ZP0T 4FQCL 4PJEB 1ZLUK 3TT1L 4ZFOA 5KSAD 1QLRB 4TUKH 3MRCA 4RRPG 1TZIB 4UNVA 1KJVA 3HMXA 3QNXB 1CD9B 3EO9H 3Q1SH 3HR5B 5BV7C 1NAMH 1RUPL 4PTTA 5C09E 4XP9H 3MV9E 3GI9H 3A67H 2FJFB 2B4CH 4IRSD 4P23D 3UP1A 4P9HL 5KVFH 2F19L 4JRYA 2AJXH 4QWWD 1CK0H 4KROB 1N6QL 4MZ3A 3QWOA 2V7NB 4KMTH 1OGTA 1LK2B 1DBAH 2BVQB 5ALBL 4EI6B 3V7AG 1WQVT 3QFJD 4UBDD 1QSEA 1X44A 3IRZA 3GGWA 3I3BA 5LGHL 2OS7A 4MA7L 4F9LA 1CLZL 1ZA6B 1XGTB 4BFIA 2Y5EA 3V7MA 4TNWF 3QUXC 3IETA 5HGAB 1DZBA 3PWJA 4Y4FC 5CJ5A 1ZVSB 3S34H 3TJEL 1A22B 3BVNB 3S88L 3T2PA 1YQVH 4N90D 3RGVA 4Z9KB 3GHBH 5JA8B 1KB5A 1WF5A 5CD5C 1B0RB 3MXVL 2Q3AA 3VG9C 2GJ6D 5EOTA 1QFUL 2DLEA 1J0HA 3BPLC 2EDRA 5DLML 3WIHL 2P5WD 3LRHA 1AE6H 5EUKB 1P1ZB 3GMMA 2Z31C 3DMMB 1KPUB 3N1QC 5C0BA 1KPRB 3FHAA 5EPMA 3FB6B 1HHJB 3OR6B 1U42A 1E4XH 5M94B 4U7KA 2PXYC 2BY0A 1MCEA 3RWCB 3RBGA 3W0WD 1FFOA 1NGWA 4NQCD 2YD2A 1E0OB 1PG7W 1HQRA 5CSGA 3X17A 3VXMD 1NGPH 3WXVH 2MCPH 1WZMA 3NFPA 5K9OB 3ULVD 2AW2A 1NBZA 3V95A 3E8UH 3PWUA 4WJ5A 5T1KA 5D1QB 4ERSH 4K3JL 1I1AA 4K3EH 5JIHA 2Q86A 2JK5B 4OFYD 2Y5TA 5D1XB 1F13A 1JI1A 2YA1A 4QHLA 5I8EB 2WBKA 2OYPA 3DX7B 4XPTL 3U48A 1BP3B 1P7HL 3AS0A 4MNQB 1FZOA 1U93A 1PGRB 3RTQC 4PBWD 5C08D 3RVXC 4YDKH 2V7HB 4ORGB 4E5XA 3SKJH 4M7LH 1QRND 5C0AB 3CSYB 5CILH 3QDHA 5CP3A 2A74B 4GXUM 4LVNC 1WBZA 3QXAB 1JRHI 4LBEB 4C4KT 4FQXC 3SOBL 1YUHA 4WCYH 4Z0XB 5JXEC 3O3UN 4MJID 1DQMH 2JJTA 3BMWA 4EI5B 5DA4A 3BQUB 1AP2B 2JIXB 3QG6A 2FL5A 2MFNA 3EGSB 4X8JB 2MWCA 4FFYL 3FCTA 4JPWH 5IMMB 5DRWA 1KFAL 1HI6A 2ADJB 4M1GL 1TVHB 5ANMB 1XR9B 4NRZB 5TH2A 4KKLC 3V5DB 1YJDC 4APQB 4AH2A 5KSAA 4XVUD 4O58H 1BEYL 1F42A 1DFBH 4ORZC 1DSFL 3NGBB 5CGTA 1MHHA 1TPXC 2B0SL 1BZ7B 4OTXH 2B2XH 3GIVA 3MBXH 4K2UL 1AQDB 2FGWL 1NFDB 4JJHA 4IRSA 1C5DB 2VL5A 5T5NG 5C0BE 3V0VA 2EZ0D 1I8KA 3ARFA 1GCFA 1G6RL 3WFBL 4LSSH 3VXSB 4MA1C 3FFDA 5BV7B 1U8PB 1PKQA 1RUML 3CMOL 1UVQA 3MACH 4YQXL 4KJPC 3QQ3A 5IEHA 3FQRB 1NC2D 1FAKT 4KAQH 1FNGA 1QKZH 1UZ8B 4UTBL 4TPRL 3SGDI 1GPOH 2OZ4H 4KVNH 5IGXH 1ROWA 3C8KA 1WGOA 1Q38A 3TNNB 5FECA 1U3JA 1ETZB 2J8UA 3L7EA 3FTGB 5AZ2L 2YPLA 3OGOE 2Y07L 1XF3A 1R5IB 4NO2B 1FDLL 4AL8H 3FZUD 5T3XL 2VTFA 4ODSH 2GJ6A 1I9IH 2X4UA 5L2JB 1P7QD 1HHHA 1UM6L 1KNOB 3QEUB 4WI2A 3QUXB 4Y4FB 2H1PL 4Z7QF 3ZTJH 2OJEA 3MRDA 1T0MB 3D3VB 4WWKA 5D2LB 3JTTB 5F9OH 3K3QA 1YEKL 4Y7MA 5C1MB 3RJDA 4JFFE 5DJCA 3M1BA 1FZMA 1WISA 1Q0XL 1KN2L 2W0FB 12E8H 3W0WA 4NQCA 3TBYB 1XAUA 3SGJC 5DMKB 4OGXH 5E94A 1JZ6A 3VXMA 4FFZL 1LP9A 2YPKA 5BS0B 2PTTB 2J6EL 3D18A 1AD0B 2Z31B 4LKXA 4FQHB 4OZIA 1INEH 4DFHA 5BMFH 1CFTB 4P2QD 5DC9B 2PXYB 2NZ9C 3TBTA 1HHIA 2A6IA 4M1CD 4OFYA 1J8HB 2NNAB 1BVLA 1IGIH 2A1WL 4OM0L 5A1AA 1I4FA 3WE6A 1VACA 3IU4L 3MLTA 2I60L 1ZLSH 4GG8B 3FL7A 4H26A 5C08A 1XF5B 2APFA 4RFEB 2E27H 4G6AD 3PDGA 5EBWB 1T7YA 1KPVB 2V5RA 4NT6B 4Z7NE 2R8SH 5DMYA 1O5DT 3OZ9H 4L4VB 1YPZB 1PKQE 4HKBB 2BVOB 3G9VA 1WCBB 1KEML 5KZCD 4D8PA 2HVJA 3OX8A 3RTQB 1MREL 4DFIA 1DLHA 5GISH 2J4WH 4R6UA 3LQAC 1HNFA 2ICEA 5JMOC 3N9GL 4X7EC 1H3TA 5D6DC 1V3MA 2J8UE 4N90E 4G8GA 4LVNB 3HMWH 4R26L 3WHE0 5A3ID 4DVBB 4FQXB 5FK9A 3AS2A 3LS5H 4PJIF 1JTOA 2IADB 4WV1A 3BUYA 3DIFB 4YBLC 2GJ6E 4K7PH 4Q9QH 1NGQH 4O2FB 1FNSH 1CU4L 5I1IL 1U3HA 2P5WE 2SEBB 2XIDA 4LIQE 1NMBL 1OLZA 1J12A 2WUCH 2R0KH 3O11A 5BW7C 4JAMA 3B6SB 4LP5A 4V1DD 1S7QA 3F8UB 3ARGC 4Y8AA 5HHMD 3W0WE 4NQCE 4PREB 1TPXB 5DTFB 3P73B 4I0PB 3VXME 1LP9E 3EIFA 1JF6A 3ULVE 2NX5D 2XNAA 4ZNCD 1NC2A 3O3EA 4OFIA 4OZIE 4U0QB 2XZCH 4WI9A 3Q5YA 3HNTL 3HS0B 5I1DA 1FE8H 5CBAB 3EYQD 1OF2A 4RFNC 2JLLA 1M71A 3VFMA 4S1RL 4MA1B 4NQDB 1VFUA 4HJ0C 4HJGA 3BIBX 3AU1B 1ZE3C 1RZJL 2MMXA 4HS6A 4C56B 4NKOB 1P7QA 2FBJL 1N64H 4OB5H 2GYSA 5HYJB 3LEVH 5C08E 5DEFB 3LKRB 3IU3A 3KPLB 3ARPA 1ZA3A 1BZQK 1T6VN 3D39D 2DQTL 4LLDB 5EC1A 5GJTH 1UG9A 5EZLA 3QEQB 5KSUB 3IJHA 3NACL 5KN5B 3ELAT 4TVSa 4JFZH 4YIQB 1FFRA 3LN9A 3MUGB 3DLQR 3C60D 4WUUB 4HK0A 3Q3GB 1S78C 4KJYB 4WEUD 1MAMH 3MRPA 3OJVC 1LEGA 1NH6A 1PSKH 4PJEF 3FQXB 4Q58C 4F7EA 1S5HB 1S9XA 2GAZB 2CD0A 4P2QA 5FO7A 1Y0LA 4ZUWB 3KXFD 1KENL 1P9MA 3SJVD 1KXQE 1CTNA 4RA3A 5FYLL 3RWHB 1ZT4A 1F11B 2NY1D 5F71A 3V8OA 1TJGH 5K9KB 2DMCA 2EXYD 1CWVA 4QRRB 1G6VK 2AK4B 3BZFA 3O2WL 1A1NB 4OV6F 1KGCD 4I3RH 2J88H 4LLVB 1UB6A 5BRZB 1K5NB 3ARTA 4GKZA 4FZ8H 4NZRL 3QT2A 3O6ML 3KPNB 4WI8A 2QHRL 1HXYA 4H25B 2FJHB 4OD3L 1T1XA 5DK0B 2KUTA 4XH2B 4F2MB 1QQDA 4DJMA 3UPRB 2HWZL 3RVWC 4G8FB 1I9RL 1KIQA 5D8JL 1NCBH 3P9WB 3EDEA 1JI2A 3OR7B 1NJ9A 1XF4B 1DQQB 3N85H 3JWNC 3EYUL 3N0PB 1CL7I 4XMPL 4DZ8A 1HN1A 1FO0A 2X89D 3L5WB 4EIZC 3WUWA 3SKOA 4NNPH 5IJVA 3WFDL 1MI5D 1MCLA 2ESVD 5KJRH 4JFDB 4ONFL 3KPPB 4PRIB 5EO1A 3PDOA 3HZVB 1MWAH 3KLSA 4V1DA 2XWBA 4NZUH 5DI8A 3I6LE 3CDGB 5C9JB 3GSNH 1OARH 1AXTL 2MOVA 2OXHA 4HUXA 3O6FD 1IGTB 1QA9A 4R4BA 4YBLB 3TYFB 3SDCC 4ZXBD 1F4YH 2X05A 1GC1L 3D1MC 4YHNB 3QA3A 2NX5A 3FQNA 1C7SA 3L3JB 5IHUH 5DRXB 2AJUL 4HF5L 1EEUA 5TDNB 1SY6A 4CMMA 3MZTA 4P2QE 4XB7A 1MHCA 4XNMA 3ARGB 4NNYB 2G5BA 3TIEA 3BP5B 3TO4C 3GMLB 3P0VL 3PGFH 3ETBF 5F8RC 5IFHL 5IOPB 4O5LL 5DQ9A 4N0FA 4RGNC 3NIFF 5FXCH 2K7PA 1EERB 2IC2A 2P47B 3U0TB 5MENB 1FL5A 3H9HB 3BRFA 3QWQB 5B38B 2JB5L 4ZYKB 3QCUL 3W82A 1EEYA 3OHXA 2JTDA 5ACZA 5GXBB 4LEOB 5C3TA 3S96B 3UJJH 1DL7L 4NQVA 2XYCA 3VA2C 4RFNB 3D39A 1ZHBB 4N5UA 3WHXA 4WHTB 3MJ8A 3VFWB 2PYFA 3T3ME 4Y89A 4K3GA 2IEPA 4PJ5B 4R2GB 3CPLA 4HS3A 1WJ3A 3O81A 4OLXH 1RZFL 3QUMB 3MRKB 4JDZB 3SO5A 5E8NB 1NL0H 4BUGA 2AS5M 2EYTB 2EO9A 3O2DL 1QSZA 4G9FB 3WLWC 1UA6L 1PX4A 2H8PB 4MXWL 1CGVA 1FH5L 2RR3A 2O61A 3KXFA 4AM0B 4GMSL 1JV5A 4M9PA 4OZ4B 1JWMB 5IBTH 3SJVA 4LCWB 2HVKA 2YA2A 4O02H 1I3VA 5C7XH 3FO2A 4P3DB 1A1MA 5LCVH 3IKCA 3TBWA 1OQXA 3MLWH 1VKXB 1V7MH 2ZSWB 4HGMA 2Z8VC 1Z9OA 4JHAL 2DLIA 1TETL 4IDJL 3ZYOA 1JPFA 4V1DE 4Z76A 1EUTA 1NCUA 3TVMC 1AGFA 2BHUA 1FVDA 4H20L 2ARJB 4UAOC 4DOHE 1XZ0A 1NGYA 4FZEH 3BKCH 4DK3A 1JP5A 4I2XA 3S9DB 1AJ7H 5HPOA 2HMIC 2NX5E 3T2QA 3FN0H 4X7CC 1LDSA 1Q9OB 3I2CL 4LSVL 3H3PL 2EO1A 4XP1H 4GBXD 1T21A 4G3YL 1CGSL 3GMOA 4KU1A 4PJ7B 2YD4A 4NPYA 3C8HA 5GZNC 1GOFA 3INUL 3P2TA 2M1KA 5DJAB 5L2KA 3TT3L 1DQDL 3HNSL 4XNQA 3O41B 2F54B 2X89A 4HW6A 4XGZA 5DVLA 3VJ6B 3LEYL 2E9WA 4OZHA 2ESVA 4GRLD 2EYSA 4RGOL 2AI0H 5D2LF 3QDGD 3TFKC 4KI1A 1BAFH 5D93C 1F02I 4PTUA 3D39E 5HY9A 2FR4B 1HHGA 4CBPA 3HRZA 1S9WB 4OGAD 1RULH 2AABH 4TQEH 2R0ZH 2EC8A 5D2NC 1CXKA 2WP3O 4JKPL 3O6FA 4KMTL 5FDWA 1W8NA 3R8BB 2OK0L 1D5XB 4ODHL 5HHNA 3WBDA 3ULUD 4M5YH 5C0CD 5CD3B 2VIRB 4ZO8A 1KJ2H 1RJCA 1IGYB 1IKNC 1WTGT 3KXFE 5DO2D 3SJVE 5E00B 4JG1H 5J1TC 4KPHL 3TZVD 3SDCB 3S5LA 1C12B 1U8HB 5D6CB 1YQVL 3GHBL 3HZMB 1GJIA 4GKSB 1KGCE 4NHCH 1IBGL 5DJ6B 4LCUA 3REWA 2VDRH 1IVLA 2XQYG 3CUPB 3CIQA 1G0DA 3TO4B 4UQ3A 2AV1B 1YPZF 4NRXA 4WI7A 2VDLL 4MVBC 1BF8A 4YAQA 1KC5L 5LGJB 1P2CA 3W2DL 4S1SH 1LEKA 3EZJB 4I2XE 1DN0A 4M8QB 4NKIL 3BDYH 3IS1X 5FYJD 1PBYA 3U82B 1CGYA 4TSCH 1HOCA 3GRWA 1DP0A 2ENSA 3R0MA 4JO3H 4R97C 4L3CB 1WC7B 1PEZA 3GSOB 4X4YB 1FC1A 1MFCH 3WUZA 5I1JH 3E8UL 4XXDA 4X0KA 3MRRA 2NY7L 4P46A 4AMKL 2P5EB 3CGTA 3L3OB 2Y1VA 1X3DA 3CK0L 1H0DA 4YPGB 4ERSL 3RZCD 2R69H 4ISVA 5EBMA 1ZTXH 4U1GC 5IMKA 1GOHA 4KZDL 3U2SA 4OZHE 2ESVE 3BRGC 5DJ0A 1YY9D 2CIKA 2UYLA 4J3VA 4KQ4H 1OLLA 4DGIH 3HMXH 3KYNB 2XFXA 3WV0A 2M8XA 1D9KA 4E41D 5D7LB 1AC0A 5ICXA 5DYOA 4EVNA 4P49A 5CZXC 3GSXA 4WGWB 4B50A 5T33L 4P57A 4F15C 5DR5H 5AG8A 1KCRH 2X70A 4WCYL 2BDNL 2WQRA 2DTSA 4KK6C 5F9DC 3RGHA 3UTPD 1OGAD 4WO4C 1I7TB 4GBXA 3TWCL 2A6DA 3QXDB 3ZT6A 4ODUB 3TVMB 3MRBA 1NUFA 4PJ8D 4LQFH 4FABH 1VGKA 4UAOB 3R06B 5EULV 5HHPA 1DVFA 2X1QA 5I6XC 2YUVA 3JVGA 3GSNB 2X4RB 2EEBA 5IB4A 4JZOB 1OSPL 3ZE2E 4QRQA 3DX6A 2IH1A 3FT3A 3QDGA 4L4TB 4HS8H 5DRZA 2JELH 1EBPA 1KB5H 3C08H 3DRQA 4MQXD 5D9SB 4X5WB 1JPST 3MUJA 4PGBA 4BELD 1OWRM 5JDJA 3U4AA 2XWTB 2ZUQC 3JTSA 1CFQB 4Z7OE 3BH9B 3ULSB 4IHOA 2BHZA 4JM2C 1KELH 1UCBH 2JJSC 3QPQD 2GSGB 1IEBA 4R8WH 1ZLUH 3OF6A 5C0CA 5IMLB 5D93B 4AENA 4ZFFB 3N1PC 4QY8A 3KLAB 5DS8B 4XP4H 3S37H 1A7RL 3GSWA 5JXAL 3RL1A 1QR1B 5EU4B 5D2NB 1U8LB 4KKCD 4D9RD 1K4DB 4XCFH 3MGTA 1MF2L 3TZVA 3VH8A 3WXWL 4XPGL 3ZSSA 3GKWH 4NQTA 2VXTH 1PG7X 2VXUL 4JZNB 5KSBB 3HCVB 3FFCA 3V4VL 4NZTH 4JKMA 4LVEA 5F7DA 4AT6B 4NDMA 1JNHB 2FWOA 3F7RA 4XB8A 4ZQKA 1YEEL 5GGUB 4N1CA 4YX2L 4ZS7L 3V4PH 5ICYB 1RZKH 2H9GA 4JPVH 2PW2A 2HJLA 3RUGF 1H15A 2DLFH 1K3ZA 2HT4D 3GJFH 4JY6B 1MOEA 3TBSB 3FRPA 5D72H 5L8LB 1S9KC 4F8QA 5EZIL 1KXTB 4MX7A 2Z91A 3MXWL 4QHNA 1RIUL 5CP3H 4X99B 4GXVH 2WK2A 2CMRL 2OQJA 3NFNB 2EDBA 1INEL 3VGEA 3RZCA 1OTTC 5C0FA 3QFDB 2BY1A 1V7NH 1IM9D 3SKNA 4QOKB 3QDGE 4R97B 2XQBH 5AZEH 4KJWC 3QHZH 5DD3L 4G7VH 2CDGB 4FQQB 2I26N 3BH8B 1T3FB 4O4YL 3KPOB 3RGVC 2QQNH 5FB8B 1DUZB 4JHZA 3I02A 3S36H 4KDWA 4U1GB 1Q72H 4R3SA 4KGJA 3VXRD 1I7RA 3V2AR 3ULUE 3OZ9L 2WIMA 4CN6A 3X12A 1D6VH 3CH1B 5C0CE 3KG5A 2VDOH 4ELME 2FO4A 1DBKL 3QXWA 4ODWB 5JR1H 1CTOA 3U4EB 4JO2H 1I1FB 7FABL 1OGAA 2DQHL 5SX4I 1KOAA 1FIEA 4U1SB 2E6QA 5IW6B 3CVHB 2RFXB 3U4BH 2ITCB 2AERT 1CF8H 2EDHA 3U9PL 4E42A 3SDDD 4J23A 4WUKL 3MV9B 3PE9A 3P0YL 3UZVB 3QUZB 3MLUH 4YHML 3BN9C 2DTMH 4ZUTB 4AQOA 4KTDH 4QHKJ 1I1AC 4WO4B 5F7MC 4CRPA 3PWNB 2BRRH 3MCLL 4XBEL 4RDQG 3IVKB 1WWWX 2VLLB 1YEHH 3U79A 5ERWB 1FPTL 3S3JA 1NBYA 5I6XB 4NKMA 2BMKA 5GGRA 1CGTA 4NRYA 1RZKC 5D70L 5FYJE 1LEIA 1OD7A 3VFTA 4QRTB 1TTGA 4OGYH 4MLIA 1BQUA 1IC7L 4U2ZA 1YMMD 3VXNB 1CDHA 5MHSD 3EDFA 2IFFL 3QI9C 1Q9LB 3BKMH 3ILPA 1J5OH 5C0EA 2FX7H 1YEDA 3WNMA 4Z78A 5CZVH 1P6FA 5JPMA 2ZUQB 1FV1A 1WT5A 2JJTC 3WS6A 1Z3GL 4JM2B 4KY1L 3ZKMC 5EUOA 5FYKU 2NXYB 2V9RA 1CDJA 3G6JA 4G42A 1KTKE 5I8OL 3DV6A 5EU6D 3K4ZA 5ITBH 2WWMD 1NCTA 2ZCLH 5KSAC 1T20A 4E41E 3O9WD 3BWAB 3LKNB 4PRPD 4OZGF 2Z9TA 1M7DA 3WO3B 3L6FA 5C6WH 1NLBH 1MFNA 4XBGB 1A9EB 4IRSC 4P23C 3HC0B 1EHLL 2ZCKH 2ZOLB 4QWWC 3UTPE 1UFUA 1OGAE 1T2QL 1IAMA 4ZFOB 1RURH 4XHJD 2EDOA 3OKKB 2DM3A 4OCMC 2XY1A 4PJ7F 1KJVB 3EYFA 4GW5B 4OCWH 3HNVL 1A3LL 4GRWH 4UBDC 1OHQA 8FABB 4Z5RB 3ZSTA 4J4PD 2F5AH 2FD6L 2IQ9H 1IM9A 3A6OA 3RIAF 3VXQB 1INDH 4MDJA 5TQ2L 3QWOB 4KUCF 1OGTB 1AD9A 1GGYA 3OKNA 3SPVA 4P2YA 1JF1A 1F3DJ 5TFSH 3V0WH 4IJ3C 1UGNA 5MEOA 2APXA 4YWGL 3OKMA 3REVB 5TE7H 3HZKA 1F3JA 3ARVA 2ARWA 5DFWH 3GGWB 1X5LA 5HYQA 1UACL 1IL1A 3PNWB 2I25N 3H8NA 3VXRA 3L3IA 3PWJB 1YNKH 1YY8A 1H3WM 1GGTA 2HA1A 3O3BA 1NC4D 3LV3A 2F58H 3O8XB 1HYSC 3DGCR 4QHMB 3RGVB 2E9IA 2WMPA 1KB5B 4L1HA 4MCYA 2G5RA 5J89A 4D9RE 1L7TH 1LO5A 1X5FA 4EXPX 5EOTB 2VO5A 1I8IB 2WV3A 3SDDA 4UINL 4M5ZH 5EUOE 1H3PL 3ULVC 2IAMD 3GMMB 1AXSA 4UOW1 3G6JE 4NO5A 5C0BB 2QKIA 4GAGL 1U2CA 1RK0B 5DURD 3RY6A 2BK8A 3FB8A 5GRUL 1QLFA 1WAAF 1FFOB 2V5SA 3JV4A 3KYOA 2H32A 2VITA 2BXYA 3MA9L 4XNUH 4RMTA 5DF0A 5GRJL 4IOIA 1PW3A 4OUUB 4WU5A 1NBZB 1L7IH 2VZTA 3PWUB 2VISA 1FBIH 4WJ5B 1T1YB 3Q48A 3SDXA 3ZDXF 1KYOK 4HWNA 3O0RH 5IROA 1I1AB 5BVJA 4GW4B 3PP4H 4HBQA 1D5BA 3P4LA 3KYMA 3QDJD 2Y5TB 2GK0A 1J10A 4U6XB 1X5YA 4AK1A 5IHUL 3CDYA 4K8RH 1AI1H 4OFPA 5MEPB 2ADGB 2F8OA 5K9JL 1BECA 1FZOB 1YMHB 5K9QG 4Q9BA 4X5XA 3K2UH 3QI9B 7CGTA 4JFFB 3VRJA 1W0VA 3RU8H 1GIGL 4XVUC 1YUHB 1IC4L 3IFLH 4PRPA 1AO7A 3DO3A 2C4XA 3HE7D 3IFPB 3DO7B 4MB4A 2CLVA 1U3HC 3VXRE 3QG6B 3U36A 4POUB 1N4XH 4NM8H 5E99L 3C6LD 3FCTB 4Z8FH 4NN5C 1HI6B 1MUJA 2EZ0C 1FLRH 1Q94B 5LAXA 5TH2B 3OXSB 2VDQH 1OB1B 2Y36L 4AH2B 4GH7B 5B4MD 5KSAB 2R4RL 4OLXL 4GSDL 2BJMH 4UDTA 1MQKH 4KZEH 1VERA 3M8OH 4OF3A 4PYHA 3NH7H 4J4PA 5DQJA 4IRSB 3DI2B 4P23B 4HZLA 1QZ1A 1KIRA 3V0VB 3CCHA 4KTEL 1I8KB 3HAEA 3SGEH 4P48A 2YD8A 4W70A 3FFDB 1BJ1H 3WN5A 3QFJB 1UVQB 3SQOL 5L7XH 1AR2A 3QQ3B 5IEHB 1A0QH 5I18H 2IAND 3FZUC 1L0XA 3RBSA 1JNLH 1HHKA 1FNGB 5EU5B 3SDXE 1UT9A 3GI8H 5MHSE 3C5JA 2YSSB 4Y5YA 2X4TA 5GGTA 2RCSL 1NC4A 5GS0L 1M1SA 2VR9A 5B22A 3C8KB 2W9EL 5FECB 1EV2E 2J8UB 3L7EB 1MCBA 4IJ3B 4KHTH 3UJIH 3MMEB 4Y5VA 2P48B 4M6NH 2HTKD 1P84K 1SEQL 4EQ2A 3LAFA 1OCWH 2GJ6B 2X4UB 3ZE1E 1A7NH 1HHHB 4J3UA 5KSBF 2P5WB 1IT9L 2EH7H 1CE6A 5BZWB 2IPTL 2IAMA 1SY6H 2OJEB 3MRDB 1RJZB 5EU6E 5HYSG 2BSRA 3MJGX 3NCYP 3ROLB 4CVWA 1QLEH 1BFVL 5DJCB 1VADA 2ATPA 4OZFG 4UB0H 1B4RA 4M1CC 2A2QT 4PRPE 3W0WB 3IDMA 1TVBB 4NQCB 4I3SH 3QNYB 4Z95L 5ADOL 5E94B 1A6AA 3VXMB 2DIBA 1LP9B 4A2LA 5HDBE 4LKXB 1RULL 4HAFA 4P5TD 1RZ7H 1NAKL 3MR9B 5HBBA 3T1FA 1IQWH 3A6BH 4G6AC 1AGEA 3RDTA 4LRNL 3TBTB 1HHIB 1OAUH 2A6IB 1X9QA 1BIHA 3QDJA 1JL8A 4F37K 4YK4C 4OCSL 1WEJL 1J1XH 3QJFA 2AQ3A 1NGZA 1KJ2L 1QACA 3FAWA 1WWBX 1NBVL 1VACB 2A9NL 3MLTB 4M4RA 3MODL 4U1HA 1AGDA 4HC1L 5EH1A 3DUSA 5C08B 4H26B 4ODBD 5CUSH 1JVKA 3LN5A 1UXSA 2CKBL 3VD4A 3TPKA 1XGUB 2MQ3A 1QRNB 3HE6D 5F96L 5SX5H 3FO0H 4L8SA 4YNYA 3OB8A 3MQIA 4X6FA 5E5UB 5A3IC 4NHCL 4F33A 1OW0A 4MJIB 1LWRA 2VDRL 3WO4C 2UY7A 2V17H 3MRJA 4ZSOB 2HVJB 3LRSB 3ZDZE 4HFUL 3C6LA 2BNRA 4PP1D 2ICEB 5CSBA 1Z5LA 2QV2A 2R39A 3BDYL 4YHKH 2CK0H 3ZTJG 5KVMC 5DHVB 3EDDA 1PJ9A 3PXJA 3GSUA 1P53A 5FK9B 3N50A 3N1MC 4QKXB 5ISZA 3D69A 5I1AA 4K23H 2PR4H 4OLEA 5F44A 2Q76B 4P4KD 3JWOH 2HKFL 5I1CH 4BSJA 2H41A 2XZZA 4P59L 4NN5B 5EO9B 4LHJB 5F3BA 4HWZA 3O11B 4JAMB 4MHHG 3EYQC 3LD8C 1OAKL 5IHZA 3CLEL 5T1MA 5F1KC 1ZGLM 3P0GB 4ESKA 5IR1A 2IANA 4XNYL 2XNAB 2FIKA 1NC2B 3B9KD 3O3EB 5JW3H 5F97E 5SWSD 2ZUUA 3OKDA 5MP6H 1FFPA 1CFVH 4JB9L 3TF7C 2F8XC 3F12A 5I1DB 1OF2B 4NJAL 5IT2H 2BERA 5F89A 4DWHA 4JVWA 3QDJE 5T3XD 3VFMB 1VFBA 4JQIH 2D7MA 4NN7C 3WIHA 1HZHH 4HJGB 1KCRL 1MCNA 1J11A 3NTCH 3LKPB 4HS6B 1UWEL 4JM2F 1P7QB 1PLGH 1JGLL 5TF1H 3C60C 4JLRB 4WU7B 3IU3B 1QP1A 1JGUL 3KJ6L 2N7AA 5E6YA 3PGCA 4J3SA 4XC3L 2GY7B 5INCA 1RUKL 5EZLB 1TZHB 3IJHB 4U2YA 2DQIH 2G9HA 3QIUD 2P49B 2NY1C 3GEWB 1D7FA 1FYTD 1ONQA 1J9CT 2EXYC 3S6CA 5ICZA 3MBED 4KGLA 2BNRE 3MRPB 1LEGB 3OGCB 1KG0A 5I19H 4F7EB 4DKEL 3UJTL 1S9XB 5IVXA 4P2QB 5FO7B 4ETQB 4WI6A 4QRUB 1R3JA 1DJSA 1J0KA 1R3KA 4WW2A 4LCIL 1LO2H 3FB5B 5E5RB 1C5CH 1ZT4B 4K9EC 4F57H 2G2RA 3GRWH 3PIQA 3IB4A 2LVCA 3G5ZA 1MVFA 5GS2H 5CGMA 3JWOC 2O5XH 4M7KH 5AD0A 3TV3H 3F7VB 2XZAL 1AY1L 4HCRL 3RPIA 4EDXB 4HEME 3HE6A 2Y06L 3CNKA 1UB6B 1PEWA 2R0LL 2AJSL 4Z7WA 4YK4B 1BM3L 3TC9A 1FG2A 4NWTH 2FX8L 3PXHA 5JHLH 5CGYD 2IANE 3DGGA 3QQNA 5IG7B 2VRAA 4YHLH 1HXYB 5KZCB 2Q7YA 3QISA 5CEZH 1OY3B 2OTUA 3UC0L 3VD9A 1QQDB 4M61B 3HI6L 5EBGA 4XPHH 5DRNA 1A3RH 3TBVA 3ZHDA 2VE6A 1JFQH 3L9RB 2DQEL 1U8NB 3BZDA 3EZ8A 4QYOA 5K9QI 4CU6A 4QHUA 3KPSD 4D0CB 4RWYH 3O6FC 1JHLH 1FO0B 3WO4B 3WUWB 3SKOB 4M6OH 4ZXBC 3VWKD 5IJVB 5DVOA 3GB7B 1P4IL 1G6RA 3SBWA 1Z6JT 3BD5A 3PDOB 5DDHB 4BZ1H 2KH2B 4WY7H 4NP4L 4V1DB 3SN6N 2IWGA 4H5SA 1CGWA 1XGYL 5HHMB 4DOHB 4QF1A 5AZEL 1MJUH 4HUXB 4MA8H 4UDUA 4K3DH 4OFKA 4NKDB 3LSOA 2WINA 1IAKA 3QA3B 2R29L 5JTWA 2W9DL 2NX5B 2B1AL 2BOBA 4G9DA 3B9KA 3VMPA 1E4XI 5SWSA 5F6HJ 3U6RB 1T5XB 1BOYA 5IVXE 4CMMB 5EC2A 5GIRA 5BVPH 3IFOB 1OL0A 3GUTA 3QHFH 1MHCB 3LD8B 4XNMB 5F1SA 3WFEH 4NQED 2G5BB 3TIEB 3F65A 4GOSA 4TSAH 2AV7A 1J0IA 3GM0A 5D5MA 2NY5H 1F4WL 4N0FB 5DQ9B 5F9JA 3FONA 3HG1D 1CQKA 2W91A 5IIEA 4I5BA 4C55A 1FL5B 2ZUSA 3GSRA 4JO2L 2FATL 5E2VL 4ZTPL 2XWJA 3L5XL 1F90H 5EO0A 5ACZB 4HULB 4QTIL 2LFGA 4N1HB 4L1DA 3QAZC 3V6FB 4PJHE 3U4BL 5ID0A 4Y4KD 3RNQB 1QNZH 4NQVB 3D39B 4ZFGH 3BT2L 4Z7WE 1BWMA 1A6ZA 4NNXA 3WHXB 4NN7B 1JPSH 4URTB 1ADQA 5FOJA 2J6EA 5D7SH 3LIZL 3PF2A 4KRNA 2DTML 5E6ID 3QIUA 2FSEA 1J87A 4KTDL 4GXUN 2BRRL 1G9ML 2DWDB 3B83A 3C60B 1FYTA 1Y18A 2OR9H 1T2JA 3MBEA 1RFDL 4LSTH 2HLAB 5FYLD 3D0LB 1N5YL 3LKQA 1MJ7H 5BV7L 4JN1L 1NFIA 4RFOH 2O61B 3KXFB 4GO6B 5CWSA 5GRWA 1D9KC 1PG7L 1X5KA 4BZYA 4YFLF 3OAUL 3PWLA 2Q6WA 3SJVB 2HVKB 5DXWA 5C07A 4XRCA 3T2NL 3W9DA 2YUWA 1VDGA 2NY1B 3BKML 1HIMH 4MDIB 1CDYA 2HH0L 2EIEA 4JQVC 4PRAB 1QBLH 3IKCB 4LSRH 3B4NA 3TBWB 1T4KA 4JO1L 4N9OB 3WSQH 5CJOL 2HJKA 2EEDA 4KRLB 3HC3H 3EOTH 1MH5A 1JPFB 4OF5A 4U6YA 4GBXC 1YYMH 2I9TA 1BOGB 4PB0L 1AGFB 5DEGA 1FVDB 1XZ0B 1NGYB 1WIPA 4RWHA 1MY7A 5CMAB 2O5ZL 3JVGC 5KVGH 4I2XB 4DQOH 5BZDA 3LKOA 1AFVL 5IEKA 3MUZ1 2EDXA 5SWSE 4GRLC 4GG6A 1PVHA 1MIEL 1N5AA 1T21B 2J8UF 3O3DB 1CVRA 5T3XE 3C8DA 2VB5A 5D5ME 5I15H 3GMOB 5E2UH 4N0YH 4OGAC 3E1F1 3F7YA 2NY5C 4QRSB 5B39B 1DQLH 4JFED 3KPSA 3GMNA 4XNQB 5DMIH 5E1AA 1HEZA 1RURL 4XGZB 3THML 3VWKA 5HHXH 1MI5B 4OZHB 2ESVB 3MTRA 3ZHKA 3FO9A 5DJZB 3ULUC 2CUMA 4HWEH 4H88H 2VC2H 4PTUB 5EIIB 5GRYA 3E0GA 1HHGB 3QRGL 3QH3B 4WRLA 2F5AL 3HRZB 2EE3A 4ZUUB 3MJ6A 1UKSA 3U7YL 3L3HB 4YHOH 1INDL 4MCZB 4XTRD 4F7MA 3O6FB 3TZVC 5FDWB 1R3HB 4ZXBB 3ULVF 3MJ9H 3PWPD 1FYTE 3D2UD 3O45A 4PRNA 4PBXA 4PFEA 2R2HA 2X1OA 5C3LD 3FQUB 1B2WH 1HSBA 3RA7L 2BNUA 2DQCH 2APVA 3CFCH 4W4OC 4XBPA 5FGRA 3WFCL 5C07E 2RIKA 4S1DD 4GFTB 3R1GL 4MHHI 3S5LB 3DSFH 1A4JB 5ITFA 3B2VH 1TENA 1YC7A 1EJOL 5F7HA 1JE6A 2HYMA 1FJ1B 2EDDA 1ZK9A 5IB5A 2PYED 3TN0D 3SDYL 4LCUB 3REWB 4Y4KA 2OTWA 2XTJE 2BFVH 4UQ3B 4JO4L 3NCJL 1ED3A 4OLWL 3CFJA 1N0XH 2CUIA 4YAQB 5JQ6L 2DRUA 1DN0B 2EDFA 2DQFB 5E6IA 3RZCC 4QNPE 1I3GH 4WHDA 3H9SD 1N26A 4GG6E 3QEHA 1T1ZA 1YJDL 1T04A 3QAZB 5BJTA 2GJZB 4HPOL 1U36A 4JPIA 4UT7H 1NMAL 4B7LA 3G5XB 4LPVA 2UUDK 1B90A 4XXDB 4M3JA 4X0KB 3MRRB 3WIFA 1H0DB 1XGQA 3KPSE 5KTEL 2WAHA 4ISVB 2YD7A 5EB9A 1DDHA 5IMKB 3U2SB 4LNVA 1EAJA 5DJ0B 4OT1H 4X6BA 3B2UD 1RJYA 4HKZA 5E2WL 3TCLA 5BOZG 2CIKB 2OSLA 3ARBD 4X6CF 5TGBB 4U49A 1QFWH 2EDKA 3LHPH 4LMQI 4WFED 4PJ8C 5DYOB 4Q97A 4EVNB 1PY9A 4YGAB 2FB4H 3EOBA 1A6UH 3RVTD 3LCYA 3QO1A 5DUML 5I1KL 2B39A 5ESQA 2F15A 1EO8L 3MLRH 4UILL 4P57B 2KKQA 5IVZB 4FQJL 2X70B 5IB1A 1F5WA 3MRLA 4GBXB 3I9GH 4NQEE 5IMOA 3MRBB 4LVOC 4U1MA 3RAJH 3ZKXC 1VGKB 2ORBH 3LKSA 4MQXC 5GSRA 4CVZB 3FOMB 4FTVD 3SGKA 3HG1E 3DECA 4JRXD 4A2MA 5KOMC 3L5IA 4P2CG 3KHOA 3UYRH 1JGDA 2X4SB 2R2EB 3KAAA 3MA7A 2VDQL 4UIMA 4XHQA 5IB4B 1KB9K 4QRQB 3DX6B 4YE4L 4GRLB 2C3VB 1PZUB 3FT3B 3QDGB 3QPQC 2L4OA 4LEXL 2N1KA 2YKLH 2P8MA 2VKXA 2CRMA 1E4WL 3WHE1 1WV7T 4MQSB 5AYUH 4PGBB 4GKNA 4PJXA 3UTQB 4BKLB 5JHDD 3ARDA 4KKCC 1LVEA 3RQ3A 4FQIH 1C5BL 2FZ3A 2ZUYA 4BYHA 3WS6C 2VR4A 3PWPA 3V6ZA 1H3XA 2VXQH 2YD9A 4LAQL 4PGEA 3D2UA 2NXZC 1IEBB 5C0CB 1X5XA 4ELMB 5FYLE 4NC0B 5HHQA 4QY8B 4TNVK 5I18L 4NN6C 1U8OA 1DR9A 1QUNA 3RL1B 3WEXB 3MLYH 4PV8B 4LDEB 3DTXA 1MLCA 1KCSL 3MGTB 3MRGA 3TZVB 4XVSL 4QCIA 1MCWW 1NQBA 1KCVL 2DKUA 4EKXA 4U7MA 1UH3A 2HT4C 4XMKL 1JGEA 1RMFL 3CH8A 2PYEA 1U92B 2VDPH 3I50L 4H0GA 2BX5A 4K7FA 4M6NL 2HKHL 3TN0A 5ID1A 4MQ7A 3FT4A 4Q2ZA 3OTTA 1OCWL 2D03H 2FWOB 1NSNL 3MLSH 1BF2A 5EBLB 1A14H 4F7TB 2EH8H 1VGEH 5C0JA 2H9GB 2PW2B 4LSQH 1H15B 2P45B 1IC5L 2X4OA 4JHBA 2W38A 3HC4H 3O2DA 1FORH 1KN4H 1Q8MA 3LQAL 3V79C 3H9SA 3PQYD 5I1GL 3WFHA 1F8TH 2ICWJ 2QLVB 3T2OA 5IUSA 5IW1A 2XXCB 5JLZA 4CDGC 3ZTNL 3K0WA 4KMQA 5IBLC 3BGMA 4HKJB 5GGVL 5HJ3A 2WLYA 2OQJB 1PQZB 2GSIB 4ZUVA 1YN7A 5IBUG 2GFBB 3RZCB 3X3GL 1ZV5A 1QPXA 4ZAKA 2DD8H 3S8WA 1U6AH 5GGSA 1SYVB 3L3GA 3SKNB 2R0WL 5EOQL 4PLKD 1F45A 4ACPA 3ARBA 3F7QA 3HI1B 3SE3A 1UJTA 1GGUA 1ZANH 1WFUA 1K4CA 3OSKA 3WD5L 1JPGB 4PJXE 5AEAA 4E41B 1CD1A 3EYOB 1TTFA 2V5YA 3I02B 3TA3D 3SY0A 1DE4A 4R3SB 2IQAA 3PWPE 3SDDC 3T0WA 1I7RB 1KULA 4LGPB 3B9VA 5CEXA 3FQTA 5IJKA 4PP2A 3X12B 5DD5L 4PBVC 1NLDL 3LN4A 4DN4L 2FO4B 3HAEH 3STLB 4LRIA 3RY6C 4ONOA 1OGAB 5E7FA 1JHKH 3E6HA 3VI3F 4UIKL 4PJ8B 4DKFL 4FTVA 3F62A 4JDVB 2NTSP 4M48H 4Z7UA 1ZEAL 5DK2A 2H6PA 2HRPL 4ZO7A 3WIIH 4Y8DC 3TNMB 1R5VB 2PYEE 5GGTH 5DFTA 3VXUD 3ZL4L 5J9PA 3G5YA 4HX1B 4LVOB 3GIZH 3ZKXB 3WS3B 3VFSA 1A5FL 1NBYB 4NBYB 5GGRB 1LGVA 4NRYB 5JHDA 1S7WA 4GAJL 5E9DD 1LEIB 3LPGA 1FRGL 1EIBA 4NO3A 2XT1B 3H9SE 2HFGH 3VRLF 4MJ4A 2HT2D 3RHWF 5HGDA 5E8PA 1QBMH 2ZJSH 3LB6D 5EU7E 1CLOL 2WWMC 4UQ2A 1C1EH 4K94H 2XRAH 4I77H 3CFDB 5C0EB 2ATKB 5IB2A 3EFFB 4GMTL 4PY7A 3BP7B 1ULVA 4Z78B 3O9WC 5MP6L 5IQ7H 1Q0YL 3QO0A 1RHHA 2J8OA 1A6PA 3KS0J 1TVDA 3DSNA 1U95B 5JZ7D 3NCMA 1CD0A 1HZHL 2ZUXA 1T7VA 2YS4A 3G6JB 1F6LL 3PUCA 4YXLL 3ME0A 5DQDH 1MHPL 3DV6B 3HTLX 4PR5A 3IJYB 4XWGL 4JDTL 4XHJC 4YR6B 1NCAL 4WFEE 3IF1A 1CDGA 4OIAA 5FAAA 4GLRH 1M7DB 1FSKB 1FNLA 1U8MA 1X5IA 4AG4L 3L6FB 4XT1C 2DQJL 3MGAA 4J4PC 2AEWA 2B1HH 5IKCA 3PQYA 2BSSB 5F7KC 3QWRD 1ACYH 3B9DA 4FRWA 4M62L 5EWIH 4HMDA 3OG4B 4YDLB 1UWGL 2OMBA 4FTVE 2D31B 4JHWL 3DRTB 3QCVL 4JRXE 5I8CB 1BHGA 4DVRH 4LL9A 3VFVA 4Z7UE 4FQCH 1WZ1L 2VLMD 4OZHF 1M05A 3TT1H 1T0NA 1DUYA 3ARED 3EYVA 1IM9B 4FOMA 4MDJB 1EFXD 1RUPH 4Y5YC 4ENEC 1AD9B 1U9KA 3QEGL 3H3BC 3SPVB 1JF1B 4MJ6A 5MEOB 4X4MA 4P9HH 2F19H 2EDNA 2R1WA 3OKMB 1UM5L 5JHDE 3TA3A 5HYQB 1N6QH 3ARSA 3NZ8B 1QSFD 4RMVA 1IZJA 1TLKA 5ALBH 4Y4HD 2OJZL 3VXRB 1CDBA 3VWJD 3L3IB 3VDBA 1UZ6F 3OAZK 2IAMC 3UMTA 1U91A 1YY8B 3O3BB 5HYSA 4UU9B 2ZUVA 5L8JB 4XPAL 5MERA 2VLJD 1SJHA 1U2HA 1N3NA 5JHLL 4JQXA 3BXNB 5LGHH 4MA7H 2WW8A 1CLZH 4OF8A 4OZFA 4NC1E 1M6OA 2M2DA 5CEZL 5KVEL 2C1OA 1NANH 4K94C 2VQTA 3MNWA 3UEZA 1UC6A 1LO5B 2V5MA 4OCYH 3TJEH 1Q9KA 3S88H 3SDDB 5IFJA 1CBVL 1JIBA 3MSPA 5MEQA 4DAGL 3MXVH 4D3CL 5FM5O 4NO5B 2QKIB 1W8OA 1RK1A 4G43A 3FB8B 3P11L 1QFUH 3RDTC 4ZD3L 3WIHH 5DLMH 1QLFB 1KXVC 4GUPB 3JV4B 3KYOB 1IE5A 2H32B 3L95A 3VXOA 2VITB 4Z7OF 3WNKA 3QB7C 4BFGA 1QVOA 4IOIB 5E9DA 3SKMB 4WU5B 4OCXL 3SHSA 3MCKA 5DC4B 2VISB 3PQYE 3SDXB 1YMMB 4IS6A 3ALXA 5BVJB 2LU4A 2W60B 2G60L 5C0DB 3KYMB 2OZ4A 2GK0B 3PWVA 4L29A 4L8SC 3CLFL 3GMRA 1KJMB 4JFOA 1RUQL 1OW0C 5DUPL 5JA9A 3EFDL 5SX4H 3O2VL 2UZIL 3HN3A 4K3JH 4N9GA 4JZJB 3OBAA 4XX1G 1GZQA 2ED8A 2QSTA 2DAVA 3C6LC 1R0AL 2YRLA 1EBAA 2DBLH 5J11C 5EU6B 2MPAL 4XPTH 4YBQD 3VRJB 1W0VB 4GAFB 4X4ME 3IDXL 3O9WB 4PRPB 2LABA 2OX5A 4P9HC 1CFSB 5DJDA 4MJ2A 3G6DH 4X6DF 4LPWA 4NSKB 5C0GB 4RISH 3CFIC 4IRZL 2FO1A 1BWWA 3SOBH 4U6HB 1MRCL 2UVEA 1FL3A 1JNNL 1MUJB 3QWRA 2HP4A 1Y6KR 1JK8B 1HYRC 1XF2A 4RGND 2VLRD 5JUEH 1KIPA 4FFYH 4HLZH 1KFAH 3LMJH 4M1GH 4QTHA 4HXBL 4PRBA 4HZLB 4CAGA 1A47A 2AXFA 1BEYH 2WUBL 3AREA 4GS7C