5TK2A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
KVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome B
publication title Crystal Structure of Uncharacterized Cupredoxin-like domain protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. ames
molecule tags Oxidoreductase
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk2A00
3S3BB 2PPCA 4YSTA 4YSPA 1JVLA 2XXFA 1SHXA 2IH9A 4G7SB 1BXVA 2XU9A 2EIKB 5ANHA 2UXFA 3TA4D 3NJLA 1NWOA 2BWDA 1J9SA 2DWSA 4KNTA 1AAJA 3L45A 1AS8A 1AZRA 1RKRA 3AY2A 1V54B 2VMJA 4YL4A 4E9YA 2AVFA 4DPAX 1PNDA 4AZUA 3NJNA 2PLTA 1KCBA 3ZIYA 1SDDA 2J56A 1AS6A 3FS9A 1PZCA 4A67A 1CYXA 3JT2A 3UADA 2UX7A 4KNUA 1B3IA 2FTAA 1SF5A 1ZDSA 2PCFA 1GY2A 2ZWNA 3T9WA 2GC7C 1NDTA 4UAHA 3H4HA 4QKTA 2GB2A 2FWLB 4DP6X 7PAZA 3FQ1A 1PZBA 4YSEA 1NIDA 1TEFA 3CDZB 1VLXA 3X1GA 2XV3A 3ABGA 2IWFA 2UX6A 2XUWA 4HCFA 5B1BB 2ZONA 2MRYA 2Y69B 8PAZA 4HHWA 2QPEB 2GBAA 2FQGA 1XB3A 1JZIA 2QDVA 3UACA 5B1AB 4P5SA 3X1BA 1FWXA 3DTUB 1BXUA 2NRDA 4KO7A 1NWPA 5B1KA 4BXVA 5I6MA 3EH5B 1OE2A 1MG3C 1PCSA 5TK2A 1KYAA 2FT6A 5D4IA 1GS6X 3FU8A 4BWUA 1ID2A 2P80D 3ZBMA 1PY0A 1SNRA 4BWWA 3PPSA 2VSKB 4A2DA 1ZV2A 3IE9A 4F7KA 2TSBA 1RCYA 4ZK8A 3GDCA 4GP4B 4FA7B 2HRHA 1ADWA 4YSAA 5PAZA 1BYPA 2PP7A 2YXWA 3FSWA 3QQXA 4KOCA 2XVBA 3WG7B 3QPKA 1JXDA 3CG8A 2YAEA 1NIEA 1XB6A 4HAKA 5F7AA 1WAEA 4TXVB 3UABA 2GSMB 4BXSV 1OE1A 1PMYA 3ZDWA 1MDAA 1J9QA 1BAWA 1OCCB 5PCYA 2B3IA 5I5IA 1PF3A 1YLBB 1M57B 2R7EA 1I53A 2DV6A 1AR1B 3AZUA 2FNWA 3AW5A 3MX0B 1TKWA 1OCZB 2BP0A 2FT8A 1RZPA 3QJQB 2OV0A 2IAAC 1URIA 4WTQA 1FFTB 5AKRA 3X1FA 2JKWA 4K9JA 2WO3B 3T71A 1QLEB 2CAKA 3H56A 4HIPA 1NTDA 1HFUA 3PXLA 4RH4A 3RYMA 3GXUB 5I6OA 2PPEA 1X9RA 1WA0X 1KGYE 2WO2B 1AZNA 1BQ5A 2WSDA 1V55B 2AZUA 6PCYA 2CCWA 1PLCA 1R1CA 3IN2A 3NSYA 3D12B 1GSKA 3MBWB 1L9PA 3OQRA 3UAEA 4P5RA 1CYWA 1SFHA 2AANA 4N4YB 1GS8A 4DP2X 2YAFA 1ILSA 3S8GB 1OCOB 1WS8A 3FSZA 1ET8A 2GC4C 4YVNA 3WIAA 2VM4A 1MG2C 1KDJA 2QPDB 2VW7A 4KNSA 2BO0A 4YSSA 1A4BA 1ZDQA 2IDSA 3BVDB 5B1JC 2YAMA 2Q9OA 2BWIA 3OM3B 1N68A 1EHKB 3S3CB 1KV7A 2BP8A 3ZX1A 2FQFA 4N8UA 4BDVA 4NB7A 5A7EA 1UATA 3NJFA 4DP5X 1JZEA 2VW4A 4JHUA 1JVOA 1W6LA 3ABMB 2BHFA 2W8CA 1L9SA 1E5ZA 4F2FA 1WA1X 4M3HA 1GW0A 1BYOA 5I28A 4X4KA 3EH4B 2IDFA 1ZIAA 4HCGA 3T6WA 3FU9A 3NSDA 1OV8A 4MFHA 4DP7X 2J57A 3WNIA 2P80A 2H5UA 1E67A 3V9CA 3FT0A 2IDTA 4DP8X 1NIBA 1PNCA 1E30A 2B08A 1TEGA 2HRGA 2IWEA 3FU7A 1A3ZA 2UXGA 3TBCA 3KW8A 1ASPA 2W88A 1IUZA 1IKOP 5EHFA 2JFCA 1KBWA 1WA2X 2YAOA 3NT0A 2FQDA 2LLNA 3C75A 2BZ7A 2DYSB 2HX9A 4GYBA 3S8FB 3NJHA 4W9ZA 3CVCA 4BK5C 1GS7A 1JZGA 3FPXA 3WKPA 2PPAA 2A3TA 1N70A 1GYCA 2PP9A 3EH3B 4G72B 4Q89A 5B7EA 2FT7A 4DP4X 1CURA 2FQEA 1ET7A 3TU6A 3NSCA 1JOIA 1SDDB 1PLAA 1SJMA 2BP8B 3NJKA 4BDVB 3OMNB 5B3SB 1L9OA 2GHZA 4W1TA 2VW6A 4A2GA 1KCWA 1OCRB 3HEIB 4UANA 1JZFA 2PP8A 1KBVA 2DYRB 3AG1B 4A2EA 4E9XA 3X2QB 2HLEB 4YSUA 3QJTB 2CUAA 2H47C 4HZ1A 1QHQA 5FC9A 1AZCA 2GIMA 3EF4A 2H3XC 3NJGA 4BWTA 2Q5BA 4HCIA 2YAHA 1WS7A 1SF3A 3X1NA 1HAWA 5I26A 3SQRA 3BQVA 2IH8A 2UXVA 3AG3B 2FJSA 2YARA 3ABLB 3DKHA 3WI9A 4EF3A 1AQ8A 4KO5A 3OMIB 2X87A 4AX3A 5AFAA 1ASOA 1E65A 3FU7B 4KO6A 4YSQA 4A68A 3PAUA 1ET5A 4JHVA 4YSRA 1NPNA 1XMEB 4G71B 4KO9A 1SHWA 4CSZA 4Q8BA 4AKOA 4E9RA 1GR7A 2JXMA 3CZUB 2IWKA 2XLLA 4AKQA 4A2FA 3NSFA 1J5DA 4QLWA 4FAAB 4A66A 3FQ2A 1XB8A 4GY4A 1CUOA 3S3DB 3UGEA 4A2HA 3NP3A 2TSAA 1AG0A 1TU2A 2XWZA 4UF7C 3PCYA 3FYEB 2ZOOA 1NICA 2YQBA 3QJVB 1ETJA 1NIAA 3PLYA 4PCYA 4DP9X 1L9TA 5I6LA 1AZBA 3N2JA 4YSCA 1A4AA 3ASOB 2N0MA 3KW7A 2PPFA 2XV0A 3FQYA 1AOZA 4E9TA 1IBYA 1OF0A 2PCYA 3FSVA 1M9WA 1JXGA 5E9NA 9PCYA 2R7EB 3QJRB 1A4CA 1NINA 4PAZA 4E9SA 4CSPA 5LDUA 3TBBA 2UXTA 1BEXA 4NERA 4WKXA 2GI0A 3T6ZA 2BP0B 1AG6A 4G7RB 3NYKA 5I6PA 1X9UA 2AFNA 4YSOA 2YAPA 3T6VA 3X1EA 2XX0A 2RACA 1J9RA 2EINB 1A65A 3OMAB 5B7MA 1W6WA 4GXFA 5TK4A 2XXGA 1AANA 4HALA 1AZUA 2OJ1A 3IEAA 5I6NA 1BQKA 1QNIA 2J5WA 4HHGA 3NJIA 2J55A 3NP4A 4YSDA 1L9RA 4E9WA 2DY2A 3V9EA 2HX7A 1ZIBA 2I7OA 6PAZA 2BW4A 3FYIB 3SBPA 1F56A 3AG4B 3QJUB 2CALA 3ABKB 4AKPA 2XV2A 3EHBB 1W8EA 1JZHA 3IBOA 2PPDA 5B7FA 4YVUA 5F7BA 3FPYA 2Y1AA 2MTAA 2VM3A 4DPCX 1MZZA 3WKQA 1PZAA 3U25A 1DZ0A 3NJMA 7PCYA 1AACA 1T5KA 1EZLA 2X88A 1A8ZA 2HX8A 4F2EA 5I6KA 3ASNB 1NPJA 2EIJB 1J5CA 1JZJA 5D4JA 3SBRA 2I85A 1AS7A 3N55A 1JERA 1ILUA 2XX1A 1E5YA 3AG2B 5I5JA 2XYBA 2IDQA 2I7SA 2QT6A 3H4FA 3NJJA 1FA4A 4KOBA 2HZHA 1OE3A 1J9TA 1IC0A 2VN3A 2E86A 1IBZA 1NIFA 3T6XA 2AZAA 3CVBA 3G5WA 2HXAA 3PAVA 1DYZA 4L0PB 3WNJA 3PAZA 2EILB 1PLBA 4M4RB 2CBPA 2CJ3A 4DP0X 4ENZA 4G70B 1V10A 2DWTA 3DIVA 3GYRA 3QJSB 5D4HA 1MZYA 2IDUA 4E9QA 4E9VA 3ERXA 2ZXWB 1OOWA 2EIMB 2QDWA 4DP1X 5I5MA 2BW5A 3JTBA 1M56B 4GP8B 1KDIA 3CDZA 2YXVA 1CC3A 1ZPUA 5B1JA 2BZCA 1SFDA 1BQRA 4AI7A 2VSMB 1L9QA 3UAAA 1HAUA 4G7QB 1AIZA 4NAJA 3TASA 3OD3A 1GY1A 5AZUA 2OCCB 4DPBX 1JXFA 3SBQA 2YAQA 1BXAA 5IY5B 4JKNA 1PAZA 1NZRA 1ASQA 4GP5B 3HB3B 1RZQA 3CVDA 3FSAA 3IN0A
chains in the Genus database with same CATH superfamily
1ZGLP 1YYLH 3CV5A 4YHLL 5C0FB 1VCBC 5ANHA 2EIKB 2UXFA 4LEOA 3N1FC 4ICXA 4NZJA 4NKMB 3CC5B 1AAJA 3L45A 3B2DC 3ZYJA 5I2IB 1R6VA 3DGGB 5LLIC 3S36L 1U2CA 1U2HA 4OH2A 1FI8C 4ZTOL 2C9UA 4IIQC 1A7OH 3BIBX 2TRHA 4FNTA 4JZJA 4QXVA 4H0LC 5F6IC 3MV8E 4HPYL 4XN9A 4KTGA 4FE9A 1D5MB 3SKOA 1W0WB 1JYNA 3CAFA 1CYXA 1KFAL 2L4OA 4FTVD 4NIYE 1NCJA 5EWIL 3IAQA 4XPFH 1M7DB 3BI9X 2OMTB 4OI7A 4JGNA 4XHJD 4YHML 1DBBH 2OXGA 3UPRA 1REIA 4F15C 4QHNB 4KDWA 4WSJA 5HVHB 5E8NA 4LGPB 1NKOA 5EOTB 1VFMA 5DHYB 2AXFA 4PLJD 4BZYA 5E7FA 1U4EA 4IK7A 2DTSA 4LIQE 2G9HB 3TYFA 4E2OA 3G7TA 2BY0A 1DLHA 1C12A 2Y6SC 1RUAL 3JVGA 1I7ZA 1MHCA 4ELME 1JWMA 2A6JB 3SJVE 4NENA 1VESA 4QLRA 4KZDL 2PCPA 4XPBL 2YJLA 3C5JB 2E75C 5JTWA 1A1MB 3EH5B 4JFDD 4APQD 4AIEA 4BBWA 1RZ8A 5AD0B 1KXHA 1MG3C 3O6FA 1KYAA 2FT6A 1HL8A 1MAML 3F85A 1BD2E 2B9AA 3FB5A 3QWRA 4LHUB 3SOBH 4BWUA 4KK5C 4Q9BA 1LQBC 1Y0LB 3O45A 4MXQD 4PJIB 3P11H 4R4BA 4GRMA 2IANE 1AC0A 2WLJA 2OTUA 3B7YA 3QK0A 1S7WB 1R3IL 2LGNA 5F7YC 1DN0B 3E7JA 1DBJL 5DQJA 2HMID 3F7QA 5ALCH 2WYZA 4G8IA 2HLFC 2PWHA 3KNBA 1E9QB 2C9RA 4WGKA 3GXTA 3MNVA 2BVQA 1R24A 4JHBA 1XF2B 3NZ8B 1KBKA 5FFGA 4TULH 4PRNA 4Q6IA 1R5VA 4JPWH 4KOCA 2EC8A 5CJXC 1QPKA 1TOXA 3GBLA 2A6IB 3TO2B 2HJFA 3DUUA 4FL4C 4PJ5B 4UTBH 3BWUC 5JOFB 3BP4B 5F7AA 4ZFGH 1J86A 1BZEA 4B50A 1FLRL 3V0VB 2O5ZH 1JD7A 2K9FB 1QR1A 1CFSB 3EUUA 4YDKH 3N40F 5ESQA 1ZA6B 4GW4B 5DUMH 2VDQH 4KY1L 4W4OC 3GLEA 3VTAA 4AQ8A 5HI5C 3MO1B 3AZUA 2FNWA 4GBXD 1NCCL 3NCYP 1SN2A 1YNKH 4CMHB 3O0LA 5L2JB 5ADPL 3K1DA 3T0ED 4DN3L 1DR9A 3QHFL 1DLFH 4YK4B 1WZKA 3JWDL 4K3JH 1UT1A 1KJ3H 5D4QA 5CMAB 1NUFA 2ENJA 1F18A 4B3VA 2VDRL 5KBDA 4Z7WE 4I88A 2X1PA 1HU8A 4XB3A 3BEVA 2XXCB 4XR8C 3QXVA 1HILA 4LXFA 4NJ9L 1BQ5A 5CS7A 5AOZA 2JKTM 1VKXA 4GQ9H 1NSNL 4XBGB 3VD2A 4X5WB 5DJ2A 4PJAB 4WFHE 5C70A 1GSKA 1D9KA 3DX7B 3FTSA 3MBWB 5C0EA 3Q6FA 2IBBA 1YNTF 3RVTD 1OAJA 5AG9A 4PG9B 1G7IA 4HIIA 1NJ9A 4DESA 4X7DC 3FRPG 3KS0H 4GJTB 1P2CA 4Y16B 4FQXC 4JM2A 4OZHA 1CLVA 1U8CA 4HWZA 4ODVH 5T1KA 4NRZB 1PY9A 4UILH 3CFBB 5DJXB 3V4PA 1CU4H 2BWIA 4XP4L 2FJHB 2HKHH 4I0PC 4OCMC 4X6CE 4LPXA 3PWPA 5E0FA 4C55A 2F8IA 4BDVA 4XNQB 4JFHD 4IRZL 1EO5A 4QXTB 2X05A 3MLVL 1JVOA 3PV6B 5I8EA 3RGVC 5IQ7H 3E2HB 1NCOA 1E27A 2PWEA 3ARVA 3BO8B 2ZX7A 4YHZH 1OP4A 5EBWB 1RSFA 1WA1X 4V33A 4H7VA 4YE4H 2CA4A 5EC1A 3EH4B 3QHTC 3T6WA 1XXFC 3QNZB 3VGHA 1JI2A 5IFAL 3C60B 3U1PA 4ALAC 3IGAA 3EADA 4JK0D 3WNIA 2XZCL 3U0WL 4XBPA 5HHOD 1OAKH 3QDGE 4PV9B 3NA4A 1BLIA 2OX5A 4AQOA 1OEZW 3AT9A 1JWUB 3PFQA 1PEWA 2BIHA 4IBSA 4LOEA 4LRNH 2ARJQ 2EEAA 4U33A 2IANA 3T1FB 3GS0A 5FAAA 5FDWB 4K94H 3VI3B 1E4WH 4TUOB 4G6KL 2MMXA 1RZGA 5EHFA 3V4VL 4LVHB 5AB1A 2Q8BH 5GQBA 5ACMA 2R0ZH 1DFBL 4CSSA 5DJYA 1X5YA 3GRBA 5GGVL 3MN8A 1U8KB 3C5ZD 3FOLB 2ED6A 2JLPA 5ID1B 4A6YL 1K9TA 4F9LA 1XWVA 1I1AB 1L4IA 2ZP8A 4P23B 4EBQH 3MRBB 5IP4A 2A9CA 3OC8A 4PY8J 1K5NA 3QFJB 2ITEA 5DK3A 2FQEA 2WVTA 3HPJB 5IQ9B 5LBSH 5EU7C 3RIFK 3WJJA 4F8LA 2FWOB 1SJMA 1GC1H 3KGUA 4RQQB 3B9DA 3ZOAA 5C0DA 2J44A 4TOYH 4AENA 5HD8D 1G7LB 4YH6A 1IU1A 8FABB 4JN2B 3RBSA 4KJWD 5EZLB 2DQUL 1VGKA 2J72A 2JB6A 3QIWD 4OLWL 4LF3B 4XWGH 43C9A 4UAOB 4C4UA 5BS0A 2UWEF 1KYUA 2WQUA 4M5ZH 1AZCA 3AGWA 3U1SL 4KC3B 5C9JA 2K70A 2IIJA 1R3HA 1ADQA 1T0NA 3PIQB 1HWWA 4OM0H 3JWNC 2H8PB 3ALXA 4IBLT 3HE6A 3B7UX 2H9GB 4NGHL 2WXOA 1UOWA 3WHXB 4OU3A 2GCYB 1M05A 4PJAF 3BQVA 2E7BA 2IH8A 4HGMA 2D4DA 2BS8A 1GJUA 4BRVA 3VGEA 2KT6A 2IBZY 1HT6A 2VR3A 3PHQA 4UMSA 4PRBA 3D51A 2FIRT 1MH5A 5LGJA 3TS8A 3ZK0A 1YEJL 4Z7VE 1XVSA 1KTCA 3C8DA 3GK8H 4CJ0A 2AK4E 1I1FA 4OGYH 4XXCA 1PZ5A 2FEDC 4XZ4A 3VJ6A 3RKPA 4C57C 3KYKH 2R56H 2BFGA 3QIBA 1XGRB 2V2TB 1R47A 3NCBB 3SDAD 4UQAA 2B4CH 3Q2CA 1E4HA 2P49B 4FXLA 2AJSL 2XKSA 3WKML 2A6DA 3FQ2A 5FYLD 3N5AA 1M7UA 1OAQH 1N0LB 2OJZH 4FG2A 4WENB 1G7JB 4GO8A 3S3DB 2XVLA 3L17A 2H6PB 3VRIA 5JHDB 1H9DA 3S7GA 1JMZA 4HJJL 3SOTA 3H6AA 1E3ZA 1DJGA 4L8SC 1VB9A 2V2XB 2WXKA 3T0XA 1AY1H 4K7PL 5GGSA 3V5DB 3M07A 3VVWA 4N2LA 1ETZA 3N2JA 5MEPA 1L5GA 3KPRA 3QDGA 1NEPA 5C0AE 4UTAH 1WVZA 1K4CA 3SDCC 4S1RH 1IFGA 3V6FB 1NUDA 4S0TD 3VI3F 3FQTB 3D6GA 1B88A 3MJWA 2JQMA 4B95C 1AYOA 4NERA 5KVFL 5MENB 1EDYA 1HQRA 3HHSA 4MKTA 4R4NC 4WQOA 3SQBA 2R4SH 2YXFA 4NP4L 4BHUA 3LQAH 4LLUA 3ZQ9A 1LK3H 1NM4A 2IQAA 3QC6X 1E4KA 4KMTH 5HTSA 4I2XB 1FBIH 3LPPA 3QEUA 1A3QA 1S9XB 1CDBA 5B4MD 1OAXL 3VD1A 3ARSA 3KVQA 5CKAA 5KSAD 3EHBC 2Q86A 1S7SB 2YO3A 2CDFB 3OMAB 4HBCL 2NDGA 1M7IA 4IYKA 3BW9B 4RGNE 5EULV 3N91A 4ZW7A 3W0WA 2YOAA 1QNIA 1MHPH 3VM5A 4S1DD 5E9DD 3TEUA 4KXCA 1CE6A 3GSQA 3GI8L 4XCYA 1H3PH 3DXAD 1N7MH 3MX0A 3BAWA 1RJYB 4Y4HC 1IGJB 2CLVB 6PAZA 4J1UB 5C0BA 4LOUD 3GM8A 1S78C 1KGIA 4DAGL 1QYGL 5K59E 4G9FA 5DHEA 4B5EA 3K8MA 3DX1A 4JG0L 5F72S 1LO3H 3RLSA 4UQBA 4B9JA 3WV0A 3ASWA 4POZC 4HIHA 4FA6A 3FQRA 2YUVA 4YXHL 2YMXL 3W2DH 4OD3H 3WKQA 2OMYB 2D3NA 2DD8L 2RA1A 3CX5J 2CGRH 4AYEC 4P2RB 2Z8SA 1I9RH 1MFAH 3GKWL 4LCCC 1EDHA 2WSKA 4CBPA 5DC4B 5J13C 3WIHH 4CBZA 4X7TB 2D2CC 3RWGA 1QFPA 3ARFA 1QSVA 1T7ZA 4JFQB 1BM3L 4NKIH 3RU8H 2XI9A 1U3YA 4HC1L 4ZS6C 3QG6B 4EDXB 3UDWA 2H1PL 3MNWB 3EJTA 3WCYA 1LP9B 2HJKA 4Z7VA 1FA4A 4KQ4H 4BQCA 3U4BL 2JKSA 2JCWA 4YDIH 4N24A 5FYJE 1YJDL 1UB5A 3V8OA 3OAZH 4ZMVA 3ULUE 4XCFH 2JJTC 1DSFH 1QATA 2ZICA 5J3HC 3DOHA 2NUPB 3QJSB 3OXSB 1B2WH 2AJXH 2NSQA 3MOAH 5DMGD 3OXRB 1D5BA 2MOVA 2JJVA 4M03A 4YDMA 1OSEA 3JTBA 3MLWH 1KDIA 4GP8B 3BPCA 2GBTA 4MNQE 1CZ8H 3BCFA 5IMLA 1K3IA 3KJ4B 5G2NA 1RL1A 1TYEB 3IDMA 2WLNA 4IIQA 1FPTL 1KXVC 2DQEL 3UZQB 3SPVA 1W80A 1MFEL 4R7NA 1AIZA 3UGUA 3G6JB 4LDLB 2DWEB 3B7RL 4OV6F 3BKML 2W94A 5C0AA 1NLBL 1I8KA 1KB5A 4LVOB 4PSRA 3U9PL 2Q3XA 3O4OC 1KY7A 3UTSB 1RZQA 3DLQR 2ZXQA 4UM9D 3IN0A 5HGBB 3J7HA 2IFFH 1PZDA 4JJ5A 4JO2L 4TUKH 1OKEA 2CA3A 3NQIA 3N04A 4HA1A 3D8MA 1EGJH 2BWDA 2VLMD 2XRAH 4FS0A 2QFRA 4LO9A 1YPZF 3B7SA 4PFEA 3TPUB 2PMZA 2JIXD 4AC2A 4F33B 2J6EH 4Y4KB 2RR3A 1PNDA 1KCVH 3HA0A 4YX2L 1PLGH 4Q6YA 1OP3H 4HOZA 5IHZB 5KWYC 4Y5VB 2EYRB 3NCXA 4DGVH 1H8NA 3GIZH 5EBMB 5EEZA 3BP5A 3FS9A 3QZLA 1R3KB 4M8QA 5DS8B 3UEQA 5E6UB 4ZG1A 3X3GL 4L3EE 4DTGL 1ZDSA 4QDGA 1Q0YH 4MDRA 1MNNA 2ARJB 1V7NH 4ZJ9A 1EZVY 1QTSA 3QI9B 4Q0XH 5DHDA 1PU0A 5SWSB 3QIUB 2DZEA 3L54A 2WBJD 3A4EA 3QNYA 3QWNA 3BAIA 4JAMB 5D1ZB 2MJWA 2O5NA 1WIPA 4HUXA 5I1GH 1MW3A 4OCXL 4BK8A 4OV5B 1OTSC 4TQEH 1XSJA 1BP3B 3BXNB 5FM5O 1TZGL 3MLXL 4TLTA 4ZMWA 3MV7E 5CJXA 2Y2YA 4DERA 5J56B 4P8QA 3LH8A 1IAKA 2BIQA 3D52A 2ZJSH 3QZOA 4M6NL 4BUHA 4IU2B 2M8XA 2Z1PA 3PJLA 1SMAA 4WU5A 1JZIA 5G4NA 2EVHA 3DGDA 1LP9F 2BPBA 1QSEB 3VDCA 3HNVL 4W4OA 3HUJE 5C0FA 4HKBB 2ZCHL 1DCLA 1AHWC 3D4CA 4NQEE 5BQ7B 1NCNA 3IVKB 4GO9A 2VDPH 3QG7H 1WC7B 2X2HA 3REWB 3VH8B 1EXUA 1MVFA 4V1DD 4ZMLA 1EXHA 4W9GC 2GJRA 1FHGA 2Y06L 4JW3A 2FJFB 2OI9B 4JFEA 4LLVB 2FSEB 1LD9A 1B4JL 3BKJL 3QDJD 2JJSC 1ZS8B 1IM3D 5LWYL 3E8VA 4JFTA 5CFAA 5E1AB 4WWOA 4XRCB 4XPTH 4HIEB 2ILLA 3NIDF 4MQXD 1NCHA 3G6JF 1XGYH 4RAVB 3SPHA 3KGTA 2C3VA 5F96H 3P9LB 1F4XH 4QRRB 1B0GA 2P8LA 2FO4A 1DJIA 1G5AA 4IM8A 4DVRH 1JHTA 1E5AA 4W9CC 1HQ4B 3V8CA 4FQXA 2BMKB 3IKCA 2P7TA 1IGCL 2OP4L 2R2BB 3L4UA 1GIGH 4FJYA 4OAWA 4QRQA 5DD5H 1R33A 1IL1A 1OCZB 2N7AA 3V0FA 2HN7A 4YDLC 4GKNB 1PX3A 3OKDA 4I0PA 4QTFA 5HYJE 2D0HA 3JZ7A 3VUAA 1BQHG 1NUNB 2F53B 2OSLA 3PXLA 2XKNA 5IBUG 1G0XA 3RGVA 4AEHH 1TUPA 1HEJC 5DDHB 4M5SA 4NQCA 2CO6B 5ANMB 2Z7ZA 2W65A 3HG1B 2IMMA 1JPTL 3P0YH 4RMQA 4W6WB 5DFVD 5D1QC 4ZX6A 2FATH 2PW2A 2QSVA 1UM6H 4JPQA 5ENWB 3DV4A 1Z9SA 4G42B 4E5XG 3VXQB 3G5YB 5KANI 4JM4H 1MQKH 4JRXB 2DYPD 3FN0H 4XVUC 1IEHA 1CYWA 3HE7B 3L3IA 3LZLA 4U0QB 5C9KA 1ACXA 5HDWA 4MDJA 4GW1B 3EYOB 3WJLA 4JO5A 2C4XA 3IPFA 3VGFA 1EEYB 4K8RL 1EHNA 5J6GB 2YKLH 5K39B 2R9HD 2Q9OA 3F6JA 3TONA 3EOAA 4K3GA 4FKKA 1A64A 2ZUUA 5ADOH 2ZXDA 3ATFA 3FO2A 1JVKA 1IC4L 2F54B 1GHFL 4O5LH 4JHUA 1WCBA 4C47A 3IJHA 4AMXA 3MROA 3ABMB 1W9XA 1UKTA 4QYAA 7FABH 1KEGL 4Y9EA 2MOQA 1J1OH 4PV8B 1HWGB 3DTDA 3D25A 1AHMA 3A0OA 3NDYE 2MPAL 3BFQG 4JFOB 2CHZA 4X4KA 1U58A 4JRFA 3O3EB 2NY2C 1FFOA 5C6PB 3QR1A 1LWRA 4G9DB 1SN0A 1RH8A 3CMGA 3D4YA 5CLXA 3FT0A 1BZ7B 1EAPB 3S3JA 4PEEA 4JUSA 4AMKH 1IM9B 3QAQA 4UINH 4B5ZA 3I3EA 4HD5A 3V7AE 5JA9A 1Y6KR 3CH8A 5ETUA 2WXHA 1GL4B 2HFEB 4TUJB 4NQSB 4AE0A 1MWAH 2QADB 3GDBA 3IJYA 4JZOA 3TJHC 3TT3H 1IKOP 1JF5A 1RUAH 4WO0A 1R9FA 3QDME 4HJ0D 1C16A 2BOLA 4GLRH 5TFSH 3CSFA 2AXGA 3Q5YA 3LSOB 4N8VA 3CFMA 5DFTA 4EUPG 4AYFB 3MLZH 4PS8A 5AYTA 1T1ZA 1YCSA 1ZA3B 5I8KL 3TZVB 4X4XB 4NCDA 4KI5D 4HEMA 2XNAA 4Y2DC 3MR9B 4PG2C 4P5MA 5B7EA 1OT2A 2ZWSA 3VCLB 3EH2A 1CLOL 1BXXA 4ORGA 5K9KB 1X9QA 3INOA 1OGSA 4M1CD 5TE4L 3IDXH 1JV5A 2CR3A 3ZE1F 3D9AL 5IWLC 5ITBL 1KCRL 2PCFB 1BFVL 4IS6B 2GJ6D 5I1LB 4MB3A 3FUEA 1N59B 2DQIL 2HFFB 3HEIB 4XI5C 5C07B 3S2AA 5IGXL 4ETYA 4P04A 2F2HA 2HLEB 4DVBA 1W0VA 4HZ1A 3V6OE 2DTMH 2PR9A 3CIQA 2PR4L 2JVUA 4L1TA 3U7WL 2HWZL 2ZCLL 3AY4C 1VSCA 5FDYA 3BFOA 5JORB 1U93A 4WNSA 2AEIT 4J3UA 4L5FE 4JR9L 4FYSA 1JPSL 3P69A 1U30A 5KBLA 4NQXA 4FMKA 4L8SA 2QR0B 4FXKB 4HV8A 3QXDA 5I24A 3ZLQC 4X4ME 5L8KB 5DZLA 1EVUA 5ADPH 4Z23A 1A7NL 1QLFB 5D7KE 4HS6A 1X4ZA 3A4AA 3H9ZA 1K8IA 4KTDL 2MKWA 3SDCA 4HFWA 4JFXB 4JHVA 2OMVB 4PGDB 3BN9D 1JNHB 4NRXA 1EHLL 4G71B 3T0AA 4NXSA 1JZ5A 1FZJB 4MXVF 5FYKD 1UT2A 5G5DB 1T4KA 4AKOA 5F0JB 2VLJB 4DKEH 3TBYB 1SXCA 1IEBA 3VSTA 1S5IL 3MUGA 1L6ZA 2ZYHA 1DUYA 4ZSOA 4WSKA 1HC1A 3VFPB 4U1JB 1FL5B 4X6EA 2G3ZA 3QH3A 1ZV5A 3CFKB 2A73B 4H5SA 2XWZA 3GTNA 4XN1A 4F93B 4A7SA 3I6LE 1OD9A 1GSMA 3G9AB 3NFNA 3UZVB 3I9IA 1WWWX 1SVZA 2F9BT 5IW3A 4X9HA 3TNNA 3I02B 4XP4H 1XGUB 4Y4HA 5F3HA 5LNEA 5I1KH 5D7JB 2CM5A 2PYEE 2YD9A 2HUHA 3QPXL 5DHVB 5BUPA 4MAYD 3U30B 1PJWA 2ZOUA 2BK8A 3QFGA 1F2QA 3FJTA 3QUKA 4IRZH 2EDLA 5FK9B 5AW3B 1AD9B 2D8KA 4G1MA 1AH1A 4PRID 2ESVB 3EJYD 4N20A 4UQ2A 5KBPA 2EABA 4G43B 4J7RA 1QEWB 4X4ZA 4N2HA 4PLOB 2VDRB 1AZZC 2Q20A 3MNZA 4KHTL 2F7OA 5D7LA 2VB5A 4O9HH 4TVPL 1FE8H 4RSVA 4BZ1H 2XN9B 4M7JL 2KZ1B 4LCCA 2JQZA 2MCMA 3HN5A 2EE6A 4EI6A 3R06B 4JVUA 1TQBC 4MNGA 1QWUA 2OL3B 2WM0A 4GXFA 1LJMA 2XXGA 1MNUH 2FUQA 2BNRE 3QJHA 4XN2A 1O9ZA 4QY8A 2BHZA 2OJ1A 5I6NA 1U95A 1NANI 2DLFH 4JQIA 3K71B 4PCTA 2UZPA 3MRGA 5I71B 3WLWC 1YEIH 1HCYA 1WBZB 3LKNA 3GLZA 3V4VH 3CFTA 1LO2L 1MRFL 1NGXB 4HIJA 1XZWA 2VLKD 4WI6A 4ZPVA 3DSFH 2NW3A 1HZLA 1H15B 1AGBB 1OGAA 2BY3A 4O2CB 1G6RH 5GGVH 5CAYB 5EEWA 2JJTA 2EDBA 4LSTL 3NQKA 4I77H 2V5YA 4A6YH 3OG4B 4G82A 3A21A 3KPNA 4G8GD 1A1NA 3FUDA 1BSIA 5DD1L 4BRJA 5CHNA 5DRXB 1EZLA 5I1CL 1T20B 4DUVA 5ISZE 1A8ZA 1SY6L 2VLRA 1Z3GL 1RK1A 1KXVA 2ZX8A 1DQQB 1NOLA 3BQUB 4PJXA 3TIDA 5D4JA 4X4MA 3AU1A 1TVBB 3LIZA 3VFWA 4XXDB 3R8BB 1SJHB 1ILUA 5CBAB 4AEIL 1XSIA 5I5JA 5EU6B 4JO8A 4UU9B 1IBGL 2XWTA 3VGGA 5GJSH 2EO9A 3D06A 4G8AC 4MJID 4WI9A 3T2NH 1B6DA 2HZHA 2AV7A 4CMHC 2QVKA 4UQDA 3UZEA 4A7QA 1KPVA 4HEPG 5T5NG 2V17L 1LO5A 1JSYA 4NGHH 4QJ4B 1CJYA 4Z7NF 2B2XH 3DPBB 2HT2C 3QUXB 4TNVK 3RTQA 2R2HB 3DVIA 4PLKD 3N42B 4X4YB 4WUUB 4OJAA 1TEYA 4FERA 4DH2A 4ELKB 1MRDL 5K1VA 3ECUA 3SYQA 5J6HA 2VH5H 3D3VA 4GT0A 3HC2A 1JCKA 3MBEB 4XMKL 4XNBA 1YEDA 3R1GH 4ZAKC 2WVUA 2BOBB 2Y7SA 2XCMC 2OCJA 4RZKA 3KR3L 4GUPB 2FWUA 1JPST 2Z6FA 3TIEA 4HJ1A 4NAJA 1DVZA 3INUL 3OD3A 4G5ZH 2PYEA 2F08A 2H6UA 4OBRA 3ALPA 3N43B 2AJSH 1MJUL 4CA4A 3WKMH 1SHMA 5B3NA 2X10A 3AUWB 4ONFH 3HB3B 2IADB 1I8LC 4UT9H 4MSWA 4KRPD 2QHRH 3BUTA 1D5IH 3OX8A 4NPYA 4HJJH 3HZKA 2XXFA 2KLRA 1IFHL 4G7SB 4OZ4B 2PO6C 3O8XD 4Y0GA 3U7AA 2R27A 2XTJE 2DWSA 3E2HC 4Y8AA 1AS8A 4KJYB 1FG2B 1HDMA 3AY2A 4NNYA 2WBWB 4KWUA 4R7VA 2VMJA 5D1XD 4ZRGA 3STBA 4HUVA 1BBJA 4F92B 2BHUA 4RIRA 4U05A 1DBKL 4OCSH 4MA3B 5HY9A 1AS6A 4HWNA 4XBMA 1A6AB 4FQIH 4HK0B 4XNUH 1WFOA 3ROLA 4J2XA 1NDGB 2VXSL 4XCEA 1AO7E 2VNCA 4KUZL 3ZKXB 1I3VA 5ILTH 1XEDA 4OF7A 3RP1A 5I19L 1K4DB 2R2CA 4IEFB 3TM6A 4X8JA 4HBCH 4KXZI 2JJSA 3GBNH 1OIOA 1KOAA 1D5RA 5K9JL 1EFXA 1OTTC 2K9UA 2X4PA 3QO0B 2A77L 3GZQA 4RA0C 1HZKA 1M1XB 2DL2A 3M88A 3MPCA 5DEFA 2P9RA 3IDYC 1MXDA 1MFDL 4H8HA 1PQZA 5DRWA 2A6KA 2DMBA 4FQPA 5DRNB 3FTZA 4GG6B 4JG0H 4Y89A 5CINL 4H20L 5CUSL 2VXQH 2EYTA 4E42B 2OKMA 2F19H 4FG0A 4OCRL 5B1KA 2XPZA 2PYFB 2RALA 2YA0A 1ESOA 1PCSA 1VFAB 3HMXL 5IJDC 2WXIA 1LYQA 1CLYH 1EBAA 3KPTA 4MMXB 4Z1PA 2KLSA 4CC0A 5FX3A 1KN4L 2C7UA 5GZOA 1AI1H 4U1MB 3HNTH 4XPGH 2G2RB 1ZXKA 2AJ3B 3N42F 1YEKH 4UAOC 4TS6A 25C8L 2IF7A 4CKQA 4AQAA 1ADWA 5F7FA 5FW8A 3TGXA 2FR4B 3MLSL 1BM3H 4R96B 5D71L 3WTVA 3BWAB 3WEAA 1F3RB 1FNEA 2AI0H 2ADJA 3FCSA 1X5GA 3OB0H 2AQSA 4JG1L 4JFUA 3BPOB 1JXDA 2Q87A 3K91A 2WP3T 3CG8A 5D1QA 3DTXA 2BNQE 3ZDWA 3L08A 2X1OA 2E7CA 5MI0C 4F24A 1GPOL 3EGDB 2N59A 3F7VB 4X9GA 3N43F 1QHOA 2H0JA 3LZNA 4GRWB 4X8XA 4HKZB 3TCLB 4LSPL 2QSCL 3SE9L 3ULVF 4CVXB 1MCKA 1YZZA 4F2MB 3KLAA 5GIRA 4OGXL 4QYOB 2D31B 2GFBA 2I07B 1YC7A 2UY7B 2Z7WA 1IGFH 3DX4A 4NCC1 4AC4A 4BFFA 4EDWH 3PAYA 3QS3A 4FQLL 2DQEH 1X5IA 1O6SB 3NFSH 2I9TA 1MFEH 1RUKH 1EUTA 3BP6A 2OBGA 4ANKA 2DICA 4RCAA 4ZS7L 5I6OA 4UUJA 4FNSA 2HFTA 2YWYA 1KGYE 1FORL 1U41A 2UZIL 3MYZA 3SKJL 2UZXB 1DVFC 3WMPA 4LCYB 3DO7A 2C7FA 2YD2A 2IAMC 2KMWA 1GJIA 3QUZB 4L2LA 5TE6H 3D12B 2G5UA 1J0IA 1UFUA 1ZRUA 3E0GA 5JIQA 1YN7B 1F1AA 3N3EA 2FZ3B 4AYMC 1U8HA 4G7VH 2YSSA 32C2B 3BFWA 4NN7B 4KITB 5IEKA 1BAFL 1LVEA 4Z7UB 2XWJB 2OR9H 3TLRA 4P2OA 3O9WD 4XVOA 2E47A 2FLBT 3QRGH 2J8UB 1ZLSL 1OTUC 3S3CB 3SDDC 1TZHA 2K8MA 3MV8D 2A0LD 3NIGB 4AGMA 5DZJA 3UTTA 1PW3A 5LUMA 2VQTA 5CILL 1X7QB 5IHUH 4ZFZB 2B4CC 4W9FC 3MMEB 3EH1A 4Y2DA 4U1KA 4NM4H 4FG4A 4K3EL 2R1XA 4EVNA 4GG6F 4PG2A 1E4XH 4JFPA 4N0FB 1UXSB 3A6BH 1KPRB 4GKZA 2CM6A 3K6SA 5EIVA 2E9WA 3D39B 4FC3E 2CRYA 1UZ8A 3AC0A 3RUGA 4RMRA 4H8WL 5E24E 3FHQA 1ZE3H 5SWZA 2A9BA 1WEJH 3T2OA 4GRLD 1UCBL 1JIBA 1JPGB 4G8EA 4URTB 4Z3TA 1IGIL 1NEZB 4PJIE 4FFWD 1TZGH 4O51B 5BRQA 2BSED 3FO1A 3LCYA 1F1DA 3JT0A 4PI2A 3RDTC 4XPHH 5EIQA 1J48A 2AP2A 2D2OA 4M6NH 4P9HL 5F9DC 3TBCA 1TTGA 1ASPA 4KI1A 3WFDH 1ES0B 4HULB 5HXMA 5DTFA 3HC3H 3GHBL 3K4DA 1V7ML 3SJVD 5JLZB 1RK7A 2X89D 2ED8A 3AY4A 4ABUA 3GSOB 5DJ6A 4PJ5E 4B9YA 1C5DA 3BEWA 4BE5A 3APNA 1DJSA 3LQAC 2EO1A 5E5MB 4KH2A 5GZND 1OPGH 1T04A 5ITFB 1FFNA 1BD2D 3C8HA 2PPAA 2IG2H 5DI8B 2IAND 3BYTA 3EYVA 4P3CH 5DJZB 5CN3A 5AZEL 2PNDA 1GZPB 3TU6A 4IDJH 1KFGA 2F1EA 2MKLC 5A2BA 2WNWA 2Y24A 3HFFA 3LD8C 3S35L 4D9QE 2ZNXA 5IW1A 1A4JB 4Q56A 2BP8B 2CR0A 3F6LA 4N86A 3OMNB 3UIYA 1CXHA 5LWYH 3NK4A 1L9OA 4QHUB 4W1TA 1HH6B 4MJ5A 4LMQE 3ZTEA 2ICCA 5IVZA 3FONB 2GYSA 3BIKB 4NKMA 2Y22A 1GOFA 3CC5A 5FIEA 3BJLA 3X2QB 3SYAA 4ZFOA 4EUPH 3B9KC 2UWEE 1JGLL 3D1MC 5A2IH 1U8QB 3KJ4C 3D48R 2FE0A 5IESH 2ITDB 4FP8H 2YAHA 3KPOB 1NBYB 2G2NA 4KJQC 4XTRC 5JHAA 5DD0H 1NMAL 3D85D 4PJAE 5B8CB 4LSQH 1Q1PA 5KVDL 2BFVL 3N41F 3SSGA 5IB4B 5ACLA 2LTQC 3K5SA 5BRPA 3EYSL 1OAZL 4JREB 1XZ0A 3AXLB 3FU7B 1NA8A 4Z7UF 5BS0D 1YY8A 5KSUA 3WIFB 4MYWB 2J8UF 1YMMB 2VL5B 4ORZC 4XMPH 2XLLA 3NIGF 3KBHE 4DZBA 3TH4T 4A2FA 5F3BA 3O3BB 5DHYA 5DEGB 5AOJA 2EYSB 3FUKA 3QZBA 5E94B 2DMCA 4WFHD 2ID5A 2JSFA 1DVTA 4G6FB 2WGXA 1H8LA 1F6LL 1TJGH 2A6JA 2X0VA 3SE4C 1R3LA 3FYEB 3L2LA 2ZAHA 3NIFF 1T5XB 4P5TB 3US9A 2ZKYA 1H6UA 1A6WH 1T2XA 4K8RH 5IJVB 3DNKA 4PY8I 3RNKB 1QZ1A 1I3GL 3GSNL 2APBA 1GW6A 5IQLA 1AFVL 1Y0LA 4PJIA 4NYLB 2DEWX 2GK0B 1IC4H 3ILQC 4M3KB 4F27A 3GUTA 1A4CA 5EZPA 1CGSL 3VI3E 3TC9A 5DUPL 3NA9H 1WAAA 3B5HA 5D7SL 3EYFB 3UO1L 2UXTA 1CFVL 3V0DA 1PIFA 2WZ0A 1XF2A 3FB7A 3RQ3A 4PBDA 1X9UA 5HGHB 1MIML 4LSSL 2CHXA 1TTUA 3S34H 2D03H 4WHCA 4L4VA 3X1EA 3EW3B 1JUFB 1NMCB 5JOFA 5LGKA 2J43A 3VFNA 4MS8C 4NZRL 1H5BB 1J9RA 3APFA 3H42L 3QDGD 4M62L 1ETA1 1OQOA 3QFJE 4N1HB 4ZMPA 5IFJA 4CDGC 1CE1H 4C4BA 4MCMA 1ZA6A 5EUKA 1U8MA 4RA3A 5MERB 3PYCA 3MO1A 2XG4B 3RVVC 1GJWA 5E00B 3RVUC 5D8JH 5TDPA 4J3OD 4K9EL 4PJGB 5L2JA 2R0WL 3MV11 4DEPB 4BFKA 4LCWB 5BOZG 4KKZA 1I7TB 1FH5L 3KCWA 2CKBL 1WISA 2G4EA 5AVRB 2COQA 4L4TB 5I8KH 4PRPA 3HAEG 2VM3A 5EZOH 4RMUA 1N67A 5ICXA 1XAKA 1AACA 2VDLL 1HKLL 1KIQB 3PXJA 1MCRA 4ZNCD 2ODIA 3CLFL 3IDGB 4CN4A 4X80L 4XBGA 4FI7A 1QFWI 3SBRA 4GSXA 3DX7A 1P6FA 4UTBA 1T4WA 3HI5L 3ROOB 2WCPA 5D7IB 3V95A 1FO0L 2WXJA 4ZD3H 1DBAL 2FRGP 3ZZQA 4ZXBD 2B5IC 1UM5L 4NRZA 5BCAA 1IILE 2PR4H 4H25B 1I8LA 3CFBA 4R8WL 1JRHH 1DE4A 2AZAA 3OL2A 2YSTA 4EZLA 1U8OB 4XVTL 3P54A 1P5VB 1D5ZA 2V2WB 4IGBB 4DGYL 2QTVA 3HVNA 2XXMB 1ZGLM 4XNQA 1NC4A 2PO6A 1EXGA 2C9PA 4WHYG 4BCZA 3IU4L 4QXTA 3FU0A 3MRHB 4PJBA 3PV6A 3VX0A 4MCZB 5JHDE 1LNUB 1A7NH 1DUZB 1ZK5A 5ELIA 2QDWA 3BO8A 5EBWA 3IDIB 2BY2A 5HHNA 3E6FB 1OT4A 3ARGB 3L4CA 3CFEA 3MRKB 4EI5B 1SFDA 1ACZA 2MCPH 4NHCH 4JMXA 3HRZB 1NLDH 4YZWA 2RIKA 5AKTA 1BREA 3VXSB 4PV9A 5F89B 5GRWA 1OAUH 3U36B 4U1LB 1JGVL 3DBSA 4NOFA 3T1FA 3ZXAC 3CN0A 4Y1TA 3ZL4H 2H0FA 2CK0L 1OCWL 3ZTDC 4OZIB 1K2DA 3VI3A 3VSVA 3R19A 1XIWC 4TUOA 4X5QA 5HYSG 1KULA 2IGTA 2FX9H 5MENE 2EXTA 1AGFA 5AAPA 3LTVA 4G1EB 2K1MA 1DBML 1FCCA 3ATEA 6CGTA 1AP2B 2NY4D 4JFZH 5FHBL 4C4KO 1QPXA 5E2UL 3HHRB 2A1WH 4XN4A 1E90A 1U8KA 3QPQC 3FOLA 1H6FA 3GJEB 1CLZL 2R83A 4GIPD 2X0UA 5ID1A 5I8OH 4PY7A 1RKRA 3GZOA 4U7KA 5C0AD 4NRYB 1UWGH 4ATWA 3QPXH 4F57H 4PW9A 1DQLH 1QFOA 4OB5H 4ZYKA 5IQ9A 3FRUA 3HPJA 5AB0A 2NY5L 4XXWC 2EDQA 3IDNA 3TFKC 2WZ6A 2DQCH 3MXWL 1GGIL 1CICD 3E8UH 4M7ZC 1YC8A 1MJ7H 2NZIA 1E43A 4KNUA 1KNOB 2P5WE 2QL1A 4OF5A 1PKOA 4TF4A 1EUUA 2VC2H 1G7LA 3BVWA 4KTEL 4XP9H 3C6LC 4YR6A 5C2BL 5T3ZL 4WW2F 8FABA 4JN2A 5L2KB 4N2EA 1ZLUK 3E9TA 2HJLB 3E1F1 1H8SA 3LXBA 4M7JH 5ALBL 5EZLA 3TFBA 4B9IA 2VR4A 2E6JA 4J2QA 1I7RA 2C9SA 3LH9A 2Z0BA 4QMEA 4O2FB 3CSTA 2XDHA 2UVFA 4TSAL 4M61A 4RGND 4NNXB 4NUJB 3QXWA 5E6IB 3ABGA 1ZT4A 1B2YA 2EC9U 1MCPL 2XUWA 4P2RE 1VEPA 1YVLA 2ZF9A 3TH2T 1AD0B 3OWRA 3IFPA 3BP7B 2D7TL 5SV4A 1VJSA 2KPWA 2ITCB 1KBBA 1E0OB 5HGAA 4C54A 1XB3A 2WLIB 1MRFH 4P2QA 4X5LA 4PREB 4XBEL 5D7IF 3T8XB 3QZMA 4QHKI 3GSVB 2KI6A 3JTSB 3CFCL 4UZSA 4M29A 2UY6A 1LP9E 2IBZX 4LSTH 1DEEB 3MA9L 5F7EH 1CL7I 3NEEA 1NOFA 4D0CB 2EJ1A 3OKEA 2ADYA 4I3RH 4X9IA 1NKRA 2C34A 3L5WB 4GS7B 4LDOB 4QXGL 2Q76A 3CPUA 4AVKA 5JOEA 3ZBMA 1SNRA 1XGRA 5DVLA 4PWJA 3S4SA 5I1CH 2V2TA 1SY6H 3BCDA 2YPKB 3BN3B 1FFPB 1EK3A 3ET9F 1N64H 3IPBA 4KKNA 4UIMA 3KWTA 4D0BA 1G7JA 5AL0A 2H6PA 3CFNA 3WEBA 3ZRCC 1EA9C 4L1DA 4NZDA 4PJCA 1DVFA 5FHAL 3ZRFC 1HESA 3ZZSA 2V2XA 3IE4A 3QAZB 3SGEI 5J7CC 4XO4A 2YAEA 1UA3A 1U3HD 1XB6A 2IAMA 1BZOA 3NIDE 5CEZE 5C09B 3MLTB 3G6JE 5EU5B 4DQOH 5JNYA 4X8GA 5FYJD 1SBSL 4DKAA 2E8YA 5HHQB 3ULUD 5CJ5A 5ICZB 3BKYL 1TQCC 3V6FA 4OZIF 1WFIA 3FQTA 3EG9B 4JFED 3ZT7A 1AR1B 3UTSE 3BPNC 5CZKA 2Y7OA 3TTYA 2OR7A 3DARA 4WI0B 4CNIB 4GI8A 3ECQA 1J1XL 4AUJA 5AG8A 4MNQD 5KVGH 5H2BA 2O6EA 2VCOA 2HH0L 3F7YA 4L1HA 5IJBC 4UNTA 1J5OH 4PJHB 3SDDA 3SGKC 2CO2A 2JI3A 3LNEA 4K9JA 4I1NB 4I2XA 4LP8A 1S9XA 5EOCH 1FNFA 1M71A 2NXYC 2CAKA 4LE8A 1KSRA 5DR5H 1MWOA 5IQOA 1R34A 2CDFA 3DA0A 1HJCA 3CVIL 2P42B 1RZIB 5B1CA 4A2LA 1X9RA 2N7SA 1SLVA 5JR1L 2N1KA 4B3EA 1Q72H 1MJUH 5IMOB 3ZYZA 3HMWL 3QFDA 3WO4B 1YY9D 2V9RA 2X2UA 4BKSC 2CXGA 2Y7NA 5CKGA 4LVNB 3PF2A 5EN2B 2QQNH 1RJYA 1IGJA 4PJDB 3VFSB 5K1NA 4J1UA 2K7QA 2YGPA 3OZ9L 2IGFL 4HUUA 3D34A 5HI4D 4JZNB 4JRYB 4UNIA 3ML8A 1J8HB 5SWSE 4YEFA 4W68A 3JWDC 3RDTA 3D69B 2B3RA 4KROB 3KBEA 4UTAA 4FEMA 3RGVD 4FADA 3N0AA 1ZDQA 4NQCD 4FXGC 3MGAA 3EFOA 2OMYA 2Z8RA 3BIAX 5GGTH 4AL8H 3FL7A 4WKZB 5AW4B 3VU2A 1NKGA 3L2MA 2JELH 1DBKH 2LE9A 3SZ6A 4M7LT 3ZE2B 2GJZA 5L4FA 4LLWA 3EOTH 5E4EC 4L3ED 1XF3A 4PP2A 3F6IA 1C8PA 2BHFA 1X4XA 3SPGA 4JHWH 1KV3A 5AVTB 3UTPD 4NIKB 1I7UB 1ZD6A 3AROA 4MD5B 2E7HA 3QG6A 1IC5L 4OLXL 4HXBL 1QSEE 3NCCB 4EZKA 2Z7YA 4NWTL 5I19H 4OY9A 2H32B 3BDYH 1E4XI 3NSDA 4KMQA 4FGMA 5E99H 1HINL 5JHBA 1INEH 4PU2A 4TPRL 4TVSa 1QTYT 5K9JH 3LKPB 1N0XH 2R8SL 3MV7D 1G9MH 4JGJA 3SYOA 4Q97A 1E9PB 3P4MA 4JKLA 2YPLB 1SXNA 2BXYA 2NUPA 3OXSA 1P6AB 35C8H 2UXGA 4MQ7B 1XCWA 2J7LA 3B9KA 1ROWA 5E8EB 1QFUH 5FFLA 2Y23A 5CLYA 2YAOA 1CMOA 3HN3A 5FUZH 1EHXA 4W9ZA 4GQPH 4MXWL 1I1YB 1FGVH 1WLHA 4OJEH 4NQED 4GKLA 2WTOA 2DWEA 3FKUS 4QRRE 3U0PA 4NNPH 4YC2B 2DQGH 1YNLL 3WIHA 4GEJA 4M5YH 3NSCA 1P1ZB 3T2LA 1KTDB 1MFVA 2X6AA 3TXAA 3JUYA 5F7DB 1USZA 3G6DL 3HNSL 4HVBA 2QTEA 2VN4A 3ZE1E 5D71H 2DMKA 4OVVA 5HGBA 3PNWB 5FLVA 4PJHF 3CDCA 4FKHA 2NXZD 4IRSD 1UG9A 3QUXC 4JG1H 1UXWB 2GUOB 3MUUA 1ONQB 4KX7A 5TDOB 3BT2L 1HSBB 2F53E 2PTTB 3QORD 3VNZA 3I6KB 5CJQH 5FC9A 2VXUL 5HJ3A 4F33A 3MBEC 3KLSA 4J6IA 1PKQA 5IFHH 1RMFL 3HG1E 4JCLA 2WYIA 4Y4FD 2WWMC 3SE4A 4ZTEA 3EJJX 5EBMA 2H2SC 1CD9B 1SF3A 2V9QA 2WLLB 5AW6B 3U0TB 1R3KA 5DS8A 4PJDF 3X1NA 1A6UL 1YDPB 4LT7A 2ERJB 2DJSA 4JRXE 2MSPA 2FJSA 4OGXH 5IOKA 4L05A 3UBGA 1MVUB 5HYJD 2EUZA 2BSRB 2X87A 3B2UD 2XIIA 1AMXA 3CN2A 3QI9A 3OQ3B 2CZNA 4FQLH 4IKLA 2DWDB 3FN3A 3NH7L 3QIUA 2OYLA 3C5SB 1EZVX 5KJRL 5D1ZA 1UA6H 4NKOB 5EO0B 5BPPA 1EJ6A 5M7QA 1IQDB 3ZE2F 4BFJA 3BXNA 4FNLL 1ZLEA 4TYUA 1CF8H 5DJDA 5FGSA 4WEBH 3KWWB 4RETB 2HKFL 3ZHKA 5JZ7D 4AEFA 3OJDB 3GFUA 4JDZA 1JTOA 4BH7B 5BXFB 1EGJA 5GSVB 1MCWW 4W6YB 1YAIA 1UWEH 4TM9A 1M9SA 5DJAA 1I4FB 4FZEL 3U2SB 1P7QB 2NY0D 3J27A 1MCHA 1ETJA 5FLUA 2J6EA 1Q0EA 4ZT1A 4L23A 4X6FA 5E6SB 3ESVF 3NRFA 2GJPA 4HKBA 5I6LA 1QWHA 2Q8AL 1MIEH 5T33L 5IVXB 3VFTB 3IVKA 1MLCA 1CDIA 4E9TA 2ZZUT 1EAOA 1UD8A 1NBZA 1WC7A 2PCYA 3CBRA 4XP5L 4X6BA 5C08B 1CK0L 3REWA 3VH8A 3ZJAA 1H0DB 4GW5B 1CYGA 3BVUA 4WK2B 3B4NA 1XF5B 2FJFA 3AAZB 5FKPB 2GTWB 4F58L 3BD5A 3I9GL 1S9YA 4DCQB 4PWEA 2FSEA 4HMDA 4K3EH 1ZS8A 3QBTB 3AABA 4HS8H 3EOBB 5L9DH 4XRCA 4BSVB 4AG4H 1OY3B 3LNHA 1A6TB 5CCGE 4X9BA 4N2OA 3QUYB 2EINB 2VAAA 1CD0A 4HWBL 1OP5K 3E3QC 3LS4H 4ERSH 2P5EB 5D93B 4NBXB 3IAGC 4L1SA 2O6CA 3TO4B 3X17A 3IGFA 3FT1A 5MP6L 2MOGA 5ES4B 1HQ4A 4ZUUA 2AK1L 1OK8A 5F93C 3CMOL 1IAIL 2R1WA 4QD2E 4DO5A 3X12A 4NN5B 4W9KC 3QDMD 1KY6A 5D7LD 1ZWIB 3EJSA 4WUKH 3RWHA 2G5BB 2CALA 3ZKMC 4GKNA 4PRHB 4LMQI 5C07E 4H8VA 1ZSHA 3VMPA 2B77A 4X50A 3IBOA 3FAXA 4M93B 2PPDA 5B7FA 2I24N 2Y1AA 5EZIL 1HEZB 4NAMA 5LQBL 2R15A 2H0EA 2X5PA 2ZCZA 1L0PA 1DZ0A 5ANMA 3RY6C 3RIKA 3BPOC 3ZT6A 2X88A 2EH7L 4ODXA 5CIPH 4XB8A 2EDEA 4TSBH 4PQXA 5ENWA 1NPJA 1QBMH 3G5YA 4AQZA 1AXSA 1UJ3C 1WHOA 5F7KC 1OM3H 2HFGL 3MNMA 4GW1A 4UZUA 4MMYA 2QT6A 1T5WA 2ZUWA 3MVSA 1EQWA 1OW0A 1EEYA 4JM0A 4U1IB 1G84A 1LE5A 1XIWA 5JIMA 5K39A 2VN3A 1CT8B 2VLJE 5DK2B 3WOVA 3I75B 1LWJA 3HAEH 2EILB 3FUHA 3QYMA 5DSCA 4DWHA 3D2UB 4Z7NE 2F54A 1IVTA 1T66D 3LKRB 2WQXA 3GYRA 4OZGF 4R90H 2CDGB 3RWJB 3L1OL 4PB0H 2EAEA 5D7KD 2A9DA 1ZV9A 3LS5H 2W07A 3RDJA 5KZCB 1I1RA 3QDAA 4PV8A 2BNUB 4FQ2H 1BJ1H 1MDTA 2ZX5A 3DYPA 4RX4A 4JFOA 4QRBA 3EOYG 3UP6A 3M17B 3SQOH 4UZGA 4RISL 5HYQB 4F3FB 3O3EA 2KS0A 4XXWA 5DLMH 5IBLC 1Q9KA 1T7YA 3QUZC 5IT2L 2D3JA 4G9DA 2Q7AA 3VXOB 5GS0H 3OPZH 3PUUA 1WDAA 3PG2A 1ZT7B 3ML9A 3F84A 3QUHA 5EO9B 1JDCA 2YLHA 1GY1A 3MC0A 1EAPA 4PGZA 3C6LA 3RTQD 2YAQA 3KPMA 1MI5B 1TQVA 3EFFB 3LZOA 2E7MA 4LSVL 2WPGA 4R84A 5CD3A 2E9IA 3L3JB 4JKNA 3CXDH 4PJEB 5H35A 1DQML 4L0ZA 3EGXB 4MDIA 2ESVE 2HFEA 4WHYH 1BM7A 5LG1A 3ZKSD 4HETA 4I5BA 4YSTA 3MFFA 1CFQB 1JXJA 3I6LD 1IBHA 2XWBB 1UEYA 5AYUL 5JW5A 1TPXB 4U4BA 2XN9E 1PSKH 4JO3H 4AYFA 2NTFB 2YZ1A 5J12B 1ZA3A 3HS0C 2PYED 4XOEA 1O5DT 1A5FL 4YL4A 1IT9H 2VRKA 1YAZA 3F58L 4G6AC 4ODTL 4APXA 4HZLB 5JO5B 5K9KA 2J56A 4CILA 1TSHA 3U4EB 4X5XB 3ZGHA 1MCJA 4J4PD 5ACZB 2QPUA 2XY1A 5HSFA 4X9FA 1HHKB 1WBYA 4TRPH 2PCFA 4ONHA 3HI1B 5BV7H 5GGQL 2BJMH 3Q1SL 3K6DA 4FQCH 5J9PB 3CZFB 2DQTL 4U1SA 2W60B 4UQEA 1PX8A 2ZTBA 1VFBB 4PS4H 3FUNA 2ISDA 4E41B 5IB3A 3TEYA 5GS2D 4ZO8A 3U9UB 2BNRD 3C09B 4GQZA 2IWFA 3VD7A 4P4RA 5JORA 2D4FA 1LO0L 1JDAA 1MWAA 1NBVH 2QR0A 3D0LA 4FXKA 3FFCB 5AWNH 3BKCH 3SBWC 5KAQF 4D3CH 1NL0L 1A7RH 1KIUB 1MHHB 3OB8A 4RFNB 5DO2C 3C9NB 4XHQA 2CPUA 3GSNB 5B1AB 1FH5H 2CKBH 2J88L 3QVAA 1SLUA 2J5LB 4PGDA 1JNHA 3T0VA 5MEQA 1FZJA 5G5DA 1OE2A 5IKCA 1EFXD 1BMGA 4LEOB 4KVCL 1ZE3C 3TBYA 1HKLH 4Z8FL 2VSKB 2NQCA 1ZV2A 4NEHB 5FV1L 3SGKA 2VXTL 2KLTA 4U1JA 1FNGB 1IKNC 4AY0A 3RPIB 4ZNEE 4OF6A 4WUUE 2AGJH 3QZWG 4JZJB 3WFHB 3HI5H 2JCCB 2A73A 2YXWA 3Q48A 3ARDD 4OQTH 3SCMB 5KOVC 3UZVA 1UOVA 2XZAL 3QPKA 3FW6A 3PHSA 4MQTB 3P77B 4OCNC 5B8CC 1CTMA 1OSZA 4AK2A 3UP1A 2WXLA 3CQQA 4NHUB 1XGUA 3WTYA 2D3LA 4BYHA 4XVTH 4Y5YB 5DHVA 5E2TL 5GZOD 3EKCA 2R0LH 1NEUA 2OW7A 4DGYH 1KCUL 3FCGA 1QVOB 3MJ9H 5FK9A 3S0PA 2ESVA 3ULVE 4J5VA 5GHWH 4BQ8A 5A7BA 4FXGA 1W91A 4WTQA 1E50A 1ED3B 4HAFA 3WJMA 3BWZA 5FF6A 1N4XH 1SVBA 5GRUL 1QLEB 2ZXGA 1EBPA 2YUXA 2VMCA 1MHCB 3R06A 2VDLB 4NENB 3RRQA 3WSQL 5CM1A 2PCPB 2IDCA 3P2BA 4WW1B 1WA0X 4NT6A 3VRLF 1JGVH 1SXSA 4IOFC 3TJEH 4LCUB 2OMUA 2XQYK 3E6HB 4DIXA 2E27L 5BMFL 2FEJA 3O6FB 4Z7AA 1R0AL 2PXYC 5EC2B 1CR9L 4U3CA 3DX6B 1WBZA 1FO0B 2A9ML 4MA8L 5IG7B 5E2WL 1L9PA 3BVTA 1NGXA 1S3RA 4BINA 3EO0A 1FGNH 1H15A 5LXGH 5DQJB 4Q2ZA 5E2UH 4IMLA 3FSZA 4JEGB 4O2CA 3KNBB 4UT7H 3UPCA 3T2QA 3MNVB 4ZX3A 1R24B 5GGRY 4J39A 5C0ND 4W6XB 1R5VB 2WLYA 4YBQD 3B2XA 4WGVB 1R5IB 2HJFB 5F9AC 3BJ91 3QZPA 1GGBH 3KYNB 4IRZA 3GRWL 4P46D 2H3NA 3IWVA 5DRXA 1NGZA 4IDLA 4WCYH 3MBXH 3B5GA 4NQVA 1FN4A 4FLSA 4MD0B 1H5BC 4GAGL 4JL2A 1QR1B 4GO6B 3WFCL 1TVBA 4BZ1A 1U42A 5ESQB 1AO7D 1KG0A 3ESPA 4KTEH 1C1EL 4OJCA 4P9ML 4XXDA 5CBAA 5DEZA 4GG6E 5ALBH 5EU6A 3EJPA 4P2OD 1PX4A 1YEGL 3CN4A 4S1SH 4IRJD 4QRPA 5CGBA 3AREC 4BFGA 5JXEC 4LKXB 4K8RC 4GQRA 2IDTA 1P6WA 4Y5XC 2WN2A 1NAML 5KVFE 3QUXA 3DPBA 3RE0A 3V4VA 4HKXB 4NJAH 4WUUA 1YEHL 4XBEH 1SLWA 4FFYL 2X2JA 3RKDC 2FX7L 2NY1B 3MBEA 2WMPB 4OUUB 3CFCH 3ILPA 2VOTA 4A6YA 2BOBA 5C0EB 1CB4A 4GUPA 4S2SB 4BK5C 3CXFA 2KUTA 4XN8A 4HIIB 4YHKH 3G5VA 3I74A 1P2CB 3WL9B 4JM2B 2ZD0A 1U8CB 5T1KB 3U2JA 3V4PB 5I73B 2CMRL 1FLTX 2BINA 1PBYA 2JJUA 4F2ME 4FG6D 3FTWA 3TV3L 1BBDL 4BDVB 4NC2B 1EFQA 2VMDA 5FUCC 5TJWK 1VGEL 5EU4A 1TT6A 2NSMA 4DETA 4RFOH 4A2GA 2UYLA 4OZ4A 1JZFA 3T4YA 1BW8A 5FW7A 3Q8FA 2L7JA 3QQ9C 2BNQD 5JMRA 1XX9C 5TGBB 1H19A 4PJ7B 4UDTA 4FQ1H 2GIMA 1GGCL 1UYWL 3BT0A 5EC1B 2KZBA 5HDBB 3FO0L 3LVEA 4EI5C 2ZSWB 4JPVH 4MA3A 4U6HA 4FN0A 1MF2H 4U3XA 2QVFB 1X7TA 1A6AA 2OX5B 2V0AA 4OLZH 3TL5A 1J1XH 1JAEA 4KQ3L 4ODUA 4S10A 2HH0H 2WK2A 5C3TA 3NCEB 3L7EB 3J2PA 2B9BA 1E65A 4YJZL 1KYFA 5E8DH 1RZGB 1UGNA 1BWWA 4Z7UE 1K4DA 1LDSA 5D1ZI 1WGOA 1ZTXL 2J8UE 3EFDL 3CVIH 5IEHA 1KYOK 2AJVH 4AYSA 4ZFQA 1OP9A 2E8ZA 5AUMA 4WF7A 3HBZA 4E9RA 3PL6B 5HDOA 2IWGA 4ZTPH 3VACA 1RZJH 3VWKC 4U6VL 3NIGE 3P0VH 4OR1A 1FUNA 4UT9A 3WNOA 1IB5A 5E70A 1HX0A 3KYMB 1QUPA 2LU7A 3NSXA 1YYML 4AUUA 1Q1JH 3GTVA 2YK1L 1NDMB 3ARTA 4N9OB 2WTPA 5DMJB 3JV4A 5DRNA 4GH7B 1CO1A 3W11C 4UOJA 1ZLUH 3L1EA 1RZ7H 4E42A 5C0DB 4AENB 3AVEA 3TESA 1UTDA 1ZVYA 5IJKC 2PYFA 4YXLL 2VUOA 3RA7H 1ZGLA 4YSCA 3LNFA 1VFAA 3WUWG 3FUFA 2XV0A 3HW7A 3FHEA 2JB6B 1IBYA 1OAYL 3HR5B 4OFDA 4QRFA 4OW6A 43C9B 2DQJH 3F7KA 1JXGA 4U1MA 4D0DB 5FXCH 5C9JB 3QYCA 4YAQA 3QB7C 4AV5A 4ZI8A 3HE6B 5E6IC 4P5KB 1UC6A 5GJTH 4R96A 1NCAH 2GI0A 3QHZH 1WFJA 5ID0B 1I8UA 1TZ8A 2Y2WA 5I6PA 5I1DB 1M05B 1IC5H 2AFNA 3RY6A 5TD4A 3GI9L 1SM3L 3JXAA 2LU5A 5FKAB 1HINH 3BSHA 4LHUD 1T2QH 4PRBB 2X3AA 1S3KL 4FYRA 4JM2F 4OZHF 4TPRH 4Y1SA 2H26A 3K81A 3BSZH 3EGDA 5HHVL 1UJ3A 4KZEH 5GRYA 3IMUA 1F02I 4NO0A 4HKZA 4ZUWA 5BJTA 2FJGB 3VJ6B 3SPJA 4CVXA 1T7WA 3QIBB 3BZ4A 4B9GA 1AVAA 4HJGA 2VXQA 4QYOA 4TMPA 2XZQH 4PJ5D 2VMFA 4M1GH 2A6DB 3ABKB 4PCSA 3TP4A 1V3LA 3RPKA 1NMBH 4LKCB 3FMGH 4WK4B 3MXVH 3NGBB 5D72L 4YVUA 2VDML 3KHOA 1P5UB 2EO7A 4RAUA 5HDBF 2FD6H 1MZZA 4LOFA 4LSRL 1T0OA 3ETSA 4LU5L 2W9DH 2XQYG 1RHHB 1KN2L 3WE1A 1WFMA 5GGSB 4LCYA 1ETZB 2W92A 3SO3B 1YEEL 4F2EA 2DM4A 1L5GB 3KPRB 1G9NH 2FYVA 3KE0A 3QUZA 4HC1A 2XVKA 2M1KA 3NN8A 1U4FA 1K4CB 1QWNA 2IH3B 5I1IH 1YN7A 4L8DB 3VB8A 1UEMA 4WTZA 2FZ3A 1AR1C 4M6AA 4RRPG 3HHSB 3SQBB 4APQB 4R26L 3EYQD 4HSCX 2VXUH 4JO4L 4LLUB 2N0KA 5AVVB 2VRAA 2NY6B 3MJ8A 1ZPLA 5IB5B 4GXVH 4X7SL 4M4RB 4TLSA 1FDLH 1QI4A 3K4AA 4G70B 3VMOA 1Q9OB 2QVIA 1JYVA 2Z34A 3HPLB 4X99A 5EO1B 5BZWA 3WUZA 3W0WB 1X7QA 4ZFZA 3HS0A 4E9VA 3QQDA 1QASA 1D7CA 3GSQB 3L95A 1UXSA 1BFTA 1BVNP 1KPRA 4Y16D 3D39A 1BGXL 5C3LD 4FABH 2EACA 3OSKA 6FABL 3LV3B 4DW2L 2ZX9A 3DI2B 2VWEE 3QA3A 2LAGB 3TASA 5KVEE 2J8OA 2OCCB 3IJEA 3MJ6A 1ZHNA 3BOVA 1BFSA 4P0DA 1AQHA 4HLZG 3FQRB 4K71C 3UBXA 3LN4B 2FYYB 2X3BA 4YHNB 3N44F 4L9LC 4GI6A 3T0EB 1A7QL 1KMGA 1ES0A 1Z2KA 1C7TA 2WUCL 1NFIA 1TTCA 2VZVA 4FZEH 1GOHA 3C60D 2EH8L 2XV6B 3O6MH 3B83A 4FX5A 5B3JF 1NWOA 4AV4A 1A14L 5E5MA 1BQHA 4DGIL 3FOMB 1L0QA 3SBWA 5ESVB 3AXHA 5DI8A 4L8CA 3VXNB 3ZZ1A 5AW2B 4U1NB 1VACA 4MVBD 5I6XB 5LGHL 2NW2B 5LO7A 3UBHA 2JKJA 4MLSA 4U1GC 4YHYB 1PZCA 4E5XA 2CO1A 3DETD 4PMFA 1A4JA 1UB5B 1TJXA 1B3IA 4M6OL 2C5DC 5CR1A 2EQDA 3DX9A 4QHUA 3BUIA 4P2CG 1OVZA 4LCWE 2J4WH 4XWOC 5IVOA 2E56A 3RWIB 1JI1A 3FONA 4BUQA 3D0AA 3D7PA 1D5BB 2DAVA 3BIKA 4DP6X 7PAZA 1XGQB 1XTLA 4L4TE 1I1AD 1PZBA 1XFPA 4P23D 3BPCB 2WZAA 1IKNA 2C9QA 3QFJD 2VZ1A 3IDMB 2JKXA 1U8QA 4IIQB 5F6IB 3SPVB 1A21A 5MP6H 2RCSH 2DQHH 2ITDA 4K5LA 4R7NB 3KPOA 3WYRA 5CO1A 4AL8C 2PWGA 1IAIH 2EKSA 2JB5H 3CPLA 2GBAA 4K3DL 4MA7L 3M8OH 2FQGA 2EP6A 5B8CA 3IXTA 3U7YH 1UH2A 2O5YL 5I15L 1INDL 4LLDA 5D7IE 3QCUH 4JBSA 15C8H 4OGAD 4P5SA 3T3MF 2FGWL 2QEJA 1KCLA 2VE6B 4JJ5B 1ODAA 4BZ2L 4XPAH 1YMMA 2EXSA 3FCTA 2VL5A 1V05A 5LQBH 5MHSE 4UI2A 3TVMC 3ARBC 1DL7H 4S0HA 2WLHA 4ICWA 3PPSA 3B6SB 5DEGA 1UVQB 2FHCA 2MNWA 4XOBA 2EH7H 2BRQA 3EBHA 5E94A 1FL3A 4OBSA 1ZSDA 3QWQB 4CVZB 2X4RB 2JI1A 4OT1L 3JVFC 3S5ZA 5F9OL 2P3YA 2X70A 4C8XA 5JDSA 1DDHA 2JI2A 3BP5B 1H3VA 3FB8B 4M8QB 4G83A 1L6XA 3IMSA 2BSCA 4KK9D 5C86A 3KXFE 3UYRL 2PXYA 4HWUA 4HAKA 3OJ2C 2AJZB 1K8DA 2CK2A 5C3IA 2GK0A 4N0RA 3VG0H 5EIIB 4EOWL 2C1PB 2H2PC 4HUXB 4OZIE 1BF8A 5JHDD 3L1OH 3DGCR 4ZFOL 5FYLH 5E2JA 1I8MB 3FCBA 1MW2A 4B9FA 4FL4B 5IUSA 1IAKB 2ADFL 2V5TA 4M9PA 2W59A 3A22A 4LNRA 1E40A 2YD3A 1RIVH 1H5BA 2FEEI 5IROC 4GINA 2NUTA 3I3BA 4HWEL 1D7BA 4ZUVA 5KAQG 3L4ZA 4XP6L 4YXKH 3OVUB 1QZNA 1DQMH 5D7EA 4I1RA 5MEND 4BIKA 1TTRA 1L9NA 2CKNA 3NSYA 1J0JA 3AREA 4PJGA 2WVSA 1CFTB 3CZKA 1WZ1L 5JXEA 3US1A 3UH8A 5L2KE 5F1KC 1ET8A 1I7TA 1ZT1B 1C5BH 2QPDB 4AVHA 2M2DA 1JPEA 1YYLL 3CFDA 4BCXA 4FZ8L 3WLBB 5B1JC 2YA2A 4EN3C 3H0TB 4J3BA 3S3SA 2F8XC 4XMVA 3HZMA 3K6IA 1KIQA 3QCVH 1MOEA 4F5CE 2C3VB 5H8DA 4KFMA 3I84A 2DDQL 1JZEA 1MFCH 1NGWA 4JLRB 2P5WD 3H9HB 1W6LA 2FO4B 4CJ1A 1CXFA 1BHGA 1A7OL 4HPHA 1L9SA 4LPYA 4HK3J 1IGYB 2BS9A 5E51A 4FQXB 1GW0A 4QRQB 4HCGA 1IL1B 5HVWA 1FZMB 5F1SA 2FBOJ 3RHWF 2HN7B 3OKDB 3H9SB 4H25A 4Q9QH 2LR4A 2P80A 1E67A 4IKKA 1X5HA 2CU9A 4XPFL 3V9CA 4P2RD 3SKNA 1P5VA 2V2WA 4IGBA 2OSLB 1E42A 2XKNB 5L4MA 4WLCA 3MRHA 2N3JA 4MCZA 1LNUA 1DUZA 3HHMA 4P4KC 1FNAA 3MHZA 1IUZA 1J10A 4QJ3B 4H0GA 2PW2B 3VXTB 3MRKA 2X7LA 4GYBA 4JRWA 3NK3A 4EI5A 2IALA 4YLQT 2FCBA 3CSYB 5C09E 4I1PA 1GS7A 5CCHE 1HI6B 1W72L 5AZ2L 3WKPA 3VXSA 2VLLA 4MDJB 3TN0C 3UG3A 3F7RA 5KBMA 3L6FB 4H8WC 4U1LA 5E9DB 4BKLA 5HVGB 1PAMA 3QEQA 2LQRA 4MCNA 1U8IA 4N5UA 5C71A 1F3DJ 3LZFL 1AKJB 1MRCH 1SDDB 5BRZB 5KJ4A 3APDA 1M2OA 1YG9A 1ACCA 3WEOA 3FO2B 3BWUF 4G1EA 5CLTA 4P9HC 2LLGA 3S97C 1AP2A 2VW6A 4PJHE 1OCRB 3ECBB 4JNXA 1WCBB 2P8PA 3EAKA 3IJHB 3NG5A 4PJ8C 5ALCL 2XZAH 1KBVA 3LEXA 5CEZD 1U3ZA 2GTZA 3GJEA 2X2IA 3D25B 3ZT5A 4TULL 4JPWL 3K6NA 1U58B 4D94A 1FFOB 4KGLA 4UTBL 4B7LA 5J8OA 4UNUA 1KCUH 1HVXA 3WU1A 1QNZH 4ZFGL 1SGKA 3UTSD 1WS7A 4N0CD 2O5ZL 1A4KA 4LEBA 5IJKA 4PJDE 3KYAA 4ODWA 4EF3A 5DUML 2VDQL 2OAAA 4JRYE 3KLHC 2WJ7A 3ULAB 2HJLA 3BUDA 1J8HE 5E23A 3F64A 1N5AA 1YNKL 2BIPA 1EMTH 3CCHA 4BCYA 4Y4KD 2XQBH 1SHWA 1DLFL 2ZKWA 3WSQH 4U2YA 4K3JL 3IM1A 4N0UB 4N8VB 5E6IA 1KJ3L 2GEEA 3QUGA 1TPXC 1DQKA 1T1ZB 2FB4H 1XGZA 2ICWI 3ZE2E 3VXMA 1QI3A 2ZCKH 1JNLH 3RY4A 2XNAB 4F5CA 3BP7A 3OMZA 5J12C 4A66A 1CR9H 4JFFE 1CUOA 3CVHL 4MA8H 1BVOA 3BVNB 4Y19B 4HG4J 3NP3A 1IIKA 3T8XA 1J05B 3ZO9A 4ORGB 3QI9D 4YGVA 2Y4SA 3UAFA 2L7UA 5SWSD 3QIUD 4F8OA 4TKWA 2IOOA 3JTSA 1NICA 2HA1A 1CN4A 1DEEA 5D1ZD 3PDDA 4D0CA 4C83B 1MUJA 1L9TA 3O81A 1A3RL 3ASOB 4JPKL 3L5WA 4UB0L 4KK8C 2ENYA 4Y88A 4YWGH 2A4CA 1TQTA 5GS0C 3TBSB 4ODVL 4DVBB 1W0VB 3V0IA 5F44A 4H2CA 3AQDA 4MS8D 4QNPF 2YPLE 2X4QA 4UILL 3SPIA 3KHQA 1WFNA 2LABA 2FECL 3H54A 2HKHL 4QRSB 4CSPA 4Y2OB 5DUBA 3GB7B 4P9MH 2A83A 4L8SB 1QSED 4HV8B 3QXDB 2WB7A 4KJPC 1CGXA 1OF2A 1P9MC 4O58L 2BXZA 5IQ7L 1YEGH 1NAKH 2GJJA 4ZPTB 3U6XA 3MLUH 4YHZL 3HI6H 5C09A 4O2EB 5FOJA 4WHTA 1S8DA 5E7BA 2A5UA 3HG4A 3LMJL 5CLZA 4YE4L 3SDCB 3JV5A 2CDEB 2FBJH 1X5FA 3MRDB 2BC4A 4NRXB 1RZFH 3B7TA 3DJ9A 5LNGA 2J5WA 2YD7A 4ENEC 3BLPX 3EG9A 5EF1A 1JHLH 1OAKL 1V3KA 3CNKA 1L9RA 1R17A 1YEHH 1IEBB 3BD4A 4FFYH 4HMEA 1CDJA 5KYWA 4UV4L 4PJHA 3VI4A 4K94L 1JE6A 1E4WL 2YQGA 3EHBB 4PH8A 4YE0A 3TWCL 5BV7C 3O2WH 4X6EB 1M4KA 3QH3B 1DVYA 2Q8BL 4MA1C 4TNWK 4QRRD 4DUXA 4UOQA 5J89A 1Y6NR 1RZIA 1SY6A 1F00I 3RL1A 4B9CA 3NJMA 3VXUB 2PETA 3SCMC 3RURA 2AJYH 5IMOA 2CO4A 1KJ2H 4R5TA 5AVSB 5DMKB 4KQ0A 5B39B 2X6BA 1LL1A 4AV0A 5EDSA 4AVJA 2YXMA 3MACL 2CQVA 4Y5YC 4ZW5A 4OZFB 4PTTB 2VDKB 3QUKB 1H9VA 5LBSL 4X6DB 2P46B 3MRJB 1E5YA 3T2PA 4MZ2A 1DJXA 1T6WA 1H3UA 3B56A 3FQUA 1GC1L 2F53D 4NO5A 4UQ2B 1GVIA 5CSBA 4TOYL 3CDFA 3MNZB 2BX5A 1NAMB 5DMIL 4J3SA 2D7NA 1DJWA 1NBQA 4KUCF 1NIFA 2N4IA 3HG1D 1TNMA 3WNJA 4LCCB 3V6ZB 4OCWL 2WJ5A 4XWGL 2G5RA 4M5ZL 4DGWC 2JMRA 2D7QA 2HG5A 4JRXD 4OM0L 3QJHB 4GAYB 4QY8B 5IREA 4JKWA 3HE7D 5DJ0B 3ERXA 2E9BA 3BH8A 3PUCA 4OF3A 4DP1X 1I7UA 2BW5A 1RJLA 3FQNB 4WFGD 5F21B 2CR6A 1SJXA 1WIUA 4XH2B 2YXVA 1CC3A 1KXQE 3J8F7 5E2VH 1I3RB 2EXWC 4G6MH 4HIJB 2NW3B 2WB1A 2WXGA 1OGAB 1V3JA 3NZHL 3UIZA 4J3XA 3GO1H 3U9WA 1KGCE 1BFOA 2Z64C 4I18C 3LKPA 5C08E 1DCEA 3GK8L 3GMMB 1UT9A 3MA7A 4DUWA 3I85A 2NR6D 1YYMH 1A1NB 3K8KA 3KYKL 2R56L 4PM1A 4MQ7A 1IAIM 5FA4B 5CHNB 2K3TA 4RX4D 4BKTC 2B4CL 2VLRB 1IAOA 1THCA 4OLVH 5I18H 4ZOAA 1OAQL 1MCWM 2DBLL 2OJZL 2X41A 1LDPH 4N2BA 1ZLDA 3NJLA 4LP5A 4OFIA 3VFWB 1SN5A 4HK3N 4DFIA 2P5EE 2XWTB 1IM9D 2P52A 1BQLH 4PJFA 4AZUA 2G4GA 1UQSB 5M94B 2AV7B 3O4OB 4IOSD 2DMGA 1KTDA 3AWGA 1KPVB 3VFUB 2QADD 4HLZH 5F7DA 5HVFB 5E1IA 2WWKT 1JP5A 2WVVA 4ABQA 3IFOA 5I9QB 3PNWA 5AOLA 2LAAA 3H8NA 3HG0A 3TVMA 2ZQKA 4PRHE 1RPUA 3ARBA 1NDTA 1G7HA 3FZUC 3GI9H 2F74B 2V37A 4KK6D 2GUOA 2APVA 2QGEA 3DJRA 3P2TA 3TZVD 1HSBA 4HFUH 2VZSA 1WG3A 2CBMA 2PTTA 2R4SL 3D3VB 3FU5A 1S3KH 4BJLA 4WAFA 1YEDB 4A04A 3NCYS 4UMGA 1RERA 1LK3L 4KMTL 5HHVH 1DO5A 1FBIL 3CN3A 2YD4A 3WDIA 3RI5F 2DM3A 2ZONA 2HB0A 5CGYC 4X83A 4NSKA 2WLLA 2KKQA 3U0TA 4CN1A 3ATBA 3MJGX 5IB1B 5DQDH 3IMWA 1KT2A 1P0SE 1OP3K 3JTTB 2NY7H 1KWKA 1F4HA 1MVUA 1M42A 3GPSA 5C07D 3UFIA 1PYWB 1MPAL 2BSRA 1QLRB 4HUMB 2BVEA 4PBWD 5CBEA 2CJTA 1N7ML 2YD0A 4FHBD 4MSWB 5I73C 2DWDA 3IWUA 1QW9A 3OX8B 4ES9A 5D72H 3C5SA 3CX2A 3HZKB 2M26A 3PU7A 4NKOA 5EORH 4LU5H 2CO7A 3RB7A 3JUZA 1GS6X 1IQDA 5D4IA 1KN2H 1ID2A 1PY0A 3EZ8A 4Z0XA 1SYSB 5F70A 2R69L 4EPSA 2WBKA 5E8PB 2BS71 3GDCA 4HUVB 1GYUA 2HRHA 4G8GE 4QOKA 5IROA 4YSAA 4N85A 1BBJB 2AVGA 4YS4A 5PAZA 1R46A 5BXFA 1I9RL 1MFAL 5GSVA 3MLYL 4ONGH 5E8OB 1YSOA 2VKXA 4JPIB 2XVBA 4NS0A 2LFGA 3U2SA 3V4UH 1ZVNA 2ORBH 2Y36L 4P49A 5CEXB 3WG7B 4QAWA 1AHWB 3EJQA 3ROLB 2J71A 1NIEA 3SYPA 2X6UA 1ZANL 4NKIL 4XCEB 2AMGA 3RU8L 2VLJD 3NPZB 5IVXA 1R3JA 5FYKH 2CCLA 4WI4A 5KSVB 1ZVHA 1H0DA 2B3IA 2W9LA 2ZUTA 3DUSA 1XF5A 3ISWA 1MLBA 2CUMA 2GTWA 3CK0H 4YDIL 5FKPA 5KUKA 1OO2A 4L0YA 4DCQA 4GUCA 3WGVB 2F68X 3CLEL 3PL6C 4XCFL 3KVPA 4PJXF 2YRLA 1DSFL 3SE8L 5SX4I 2VDMB 3EOBA 2XBZA 1B2WL 1UENA 2EDNA 1RU9H 5DRWB 4FRWA 2A6KB 2QKSA 1N2RA 3QUYA 1JZ3A 1RZKL 5D7JD 2FAUA 5CF3A 3F83A 5DO8A 4A39A 1CFMA 3QS2A 5DWPA 5JIHA 3GJFK 3OV6A 4U31A 1X5JA 1VFUA 4YHIB 4URKA 3LRSB 3H3PH 3VRLE 5SWQA 2ESVD 4MAUH 4TQHA 2ZXCA 4J3OG 2H41A 1A7QH 4YDLB 1RP9A 2W81C 2YMTA 2WUCH 4UT6H 1ZWIA 3QEHB 3VFVB 2XN9D 3V2AR 1THAA 2VM4A 2HYMA 4IIZA 2IFFL 4E41E 2Y5EA 5JW4Q 2OZ4H 4DGIH 3GSUA 4QXWA 3S5YA 4IMKC 4KNSA 3ISRA 4YSSA 5KS9B 1HEZA 5ESAA 4EKJA 3BUPA 4ZDHB 1TZIA 1A0QH 4P4KA 4QHMA 5C0CD 4QWWD 1EGJL 4NZTH 2DEYX 5D1QB 2XRAL 2LOEA 3O2DL 2OLDA 4LRIC 2YJQA 1MY7A 3MODH 2J6EL 2FUTA 1RZJC 2VW4A 2BRRH 4J27A 3REVB 1KCVL 2XOTA 4M6OH 2DIBA 3CTTA 1MCSA 5DMYA 3TN0A 2R2EA 1XBDA 2BDNH 1N6VA 5DD3H 1MCFA 3EGSA 4DFHA 3D07A 4HT1H 3KLAB 1O7DE 5GIRB 3ILDA 3ZKND 3FU9A 3E38A 2GFBB 1OV8A 4MFHA 1Y18B 1V7NL 2NDFA 4QEGA 2H5UA 5DK2A 1FYHB 4Q0XL 2FO1A 1E5CA 1UADC 2I9TB 4XHJC 3BP6B 4NLHA <