5TK2A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
b'KVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome B
molecule tags Oxidoreductase
source organism Bacillus anthracis str. ames
publication title Crystal Structure of Uncharacterized Cupredoxin-like domain protein from Bacillus anthracis
rcsb
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk2A00
1QHQA 1ADWA 2UXVA 1ZIAA 3NSFA 4KO5A 2QDWA 2E86A 2FNWA 2IAAC 3PAZA 3CVDA 3L45A 4HCIA 4UANA 2ZWNA 3QQXA 4YSCA 3H56A 1ET8A 1NIAA 2P80A 1AANA 3WG7B 4RH4A 2DWTA 2UX7A 2VW7A 1ILSA 4WKXA 5I26A 8PAZA 1V54B 2YAQA 4M4RB 3FU9A 4HZ1A 4DPAX 1JZEA 1NICA 2BW5A 4HHWA 1J9TA 2FT7A 2YQBA 3AW5A 1AR1B 2DV6A 4DP6X 1GW0A 4DP5X 3WNJA 1KV7A 3PAUA 2CAKA 2B08A 3NJLA 2WO2B 3NJGA 3NSDA 4E9SA 1ID2A 1PZBA 1SFHA 3NP4A 2AANA 1KCBA 2YAMA 2R7EB 3SBPA 2XYBA 3X1EA 3ZX1A 1PZAA 2PCYA 3CVBA 1DZ0A 4W1TA 1KDJA 4KNSA 3OMIB 1ASQA 6PAZA 1WA1X 2IDQA 1MZZA 1NINA 2BO0A 4A66A 4YVNA 1AG0A 1PZCA 1F56A 3WI9A 4YSEA 2J5WA 4ENZA 5B1JA 1AOZA 1RZPA 1BYPA 3ZIYA 2BP0A 2P80D 2H5UA 3IEAA 3NJKA 3ABMB 4L0PB 3FU7B 2IDSA 3FYIB 1SF5A 2EIKB 2Y69B 3QJQB 2FTAA 2AVFA 1HAWA 1JXGA 5B1BB 1E67A 4A68A 1GR7A 2IDTA 3S3BB 3U25A 3QJTB 2YAEA 2EIJB 4FA7B 2VM4A 4AI7A 2TSAA 3T71A 2R7EA 1A3ZA 1JOIA 4CSZA 4YL4A 1AS7A 2UX6A 1GY2A 3FQ1A 2PPCA 3ERXA 5B1KA 1BEXA 1JXDA 3CG8A 1SJMA 3FSVA 4P5SA 1J9QA 3OMAB 4AKPA 1W8EA 2HXAA 3CDZB 3EH5B 4YVUA 1XB8A 2QPDB 1ETJA 3GDCA 1BAWA 4BWUA 3CZUB 3DTUB 4AKOA 1QNIA 3AZUA 1KCWA 5AKRA 2PPEA 1PLAA 3AG4B 1NZRA 2JKWA 1B3IA 4KO6A 3IN0A 3MX0B 5B1JC 4FAAB 4F2FA 1V55B 1X9RA 1ZIBA 4AKQA 4G71B 1L9PA 2BHFA 1PF3A 2BP0B 4GXFA 1XMEB 2TSBA 2BWIA 5B1AB 1J9RA 1L9RA 4HHGA 3S8GB 3NJHA 1JZJA 3V9CA 2MTAA 2FT8A 4KOCA 4AZUA 2CALA 2MRYA 2ZONA 1JVOA 2XXGA 1E5YA 1NIFA 4PAZA 3CDZA 1NPNA 2XU9A 2BZ7A 1NWPA 3PXLA 3KW7A 4YSDA 3UGEA 1PCSA 2EINB 2CJ3A 2H3XC 3MBWB 4X4KA 3GXUB 4KNUA 4DP1X 3EH3B 3OQRA 4A2FA 1PLCA 2FQDA 4GP4B 1ZDSA 4G72B 5B7MA 1SF3A 4CSPA 3V9EA 5PCYA 1JZFA 7PCYA 1TKWA 2PCFA 3FPXA 2I7OA 2EILB 2QPEB 5B7EA 2EIMB 2YARA 4M3HA 1E30A 3X1NA 1AQ8A 4E9RA 3S3DB 2AFNA 1BYOA 3QJRB 3FSZA 2XXFA 2YAHA 3PCYA 1BQ5A 4GY4A 1BXAA 3QPKA 1KBWA 2J57A 3FU8A 4G7RB 4BDVA 1NTDA 1TU2A 1SDDA 3T6WA 4Q8BA 1E65A 5ANHA 1URIA 1JERA 2DYRB 2WSDA 1GSKA 1BXVA 3FPYA 1ILUA 3AG3B 4YSPA 3HB3B 1W6LA 1ASOA 3OMNB 1RCYA 4BXVA 1XB3A 2PP9A 4GP5B 3ASOB 3SQRA 2PLTA 2HRHA 1HFUA 2BZCA 2IWFA 3X1FA 2GHZA 4UF7C 2FQGA 1SNRA 3TBCA 1OCRB 3TU6A 3OD3A 2HZHA 5AFAA 1BXUA 2DY2A 1OE1A 2BP8A 2J56A 2GIMA 3IBOA 3X2QB 2YXWA 2UXGA 2UXFA 1AZNA 1PMYA 3G5WA 2I7SA 4K9JA 3BVDB 2VN3A 1MDAA 2JXMA 5LDUA 1L9QA 2N0MA 3T6ZA 4EF3A 2VSKB 1L9TA 2XLLA 2Y1AA 2LLNA 3C75A 4DP7X 1AZCA 1J9SA 5F7AA 3CVCA 2YAPA 3JTBA 2QDVA 4HAKA 3TASA 3BQVA 1GS8A 4HCGA 4A67A 2PP7A 3FSAA 4HALA 4DP4X 3KW8A 3WKPA 1HAUA 3H4HA 2IWKA 4DP2X 5I6NA 1GYCA 3FU7A 1RKRA 1BQKA 3TBBA 9PCYA 5EHFA 1GY1A 2GC4C 4DPBX 5I6LA 3QJVB 5TK4A 1KYAA 3UADA 4A2DA 3RYMA 3ASNB 2DWSA 4P5RA 1OE3A 4DP9X 4KO7A 4E9TA 2XV0A 2BW4A 4QLWA 4ZK8A 3WKQA 4JHVA 2WO3B 1OOWA 1GS6X 3NYKA 1ZDQA 2IH9A 2OV0A 1M57B 2X87A 2XUWA 1NIEA 7PAZA 4JKNA 2OCCB 4HCFA 4G70B 1JVLA 1WAEA 4E9WA 4G7SB 4YSRA 3SBRA 3UACA 3NP3A 3WNIA 2GBAA 4YSUA 2AZAA 3NSCA 5B7FA 5I6PA 2GI0A 3GYRA 2H47C 4F7KA 5I5IA 3D12B 1CYXA 1FA4A 1PY0A 2HX7A 1KBVA 1ASPA 3AY2A 2NRDA 1PNCA 3AG2B 3DIVA 4W9ZA 3NSYA 4GYBA 3FQYA 1SFDA 2ZXWB 1EHKB 2HRGA 1EZLA 2QT6A 4QKTA 4YSQA 1KGYE 3PAVA 5I6OA 4YSTA 2BWDA 3N2JA 2W8CA 1GS7A 1AAJA 5TK2A 1A65A 1A4AA 2BP8B 3QJUB 2XX1A 3FYEB 3ABKB 2GSMB 4NB7A 3HEIB 3OM3B 1FFTB 2AZUA 4E9XA 1NDTA 2FQFA 2YAOA 5E9NA 1JZGA 2FQEA 1PNDA 3S3CB 4E9VA 3X1GA 5IY5B 2A3TA 1IKOP 1AACA 1V10A 4A2HA 1CURA 4N4YB 3IN2A 3NJIA 5D4JA 2IDFA 1MZYA 2CUAA 4YSSA 4BWTA 1OF0A 5I5JA 1A4CA 1AZUA 3ABGA 3EH4B 1N70A 1I53A 1OE2A 1T5KA 2VM3A 1AS8A 1OCCB 2YAFA 4DP0X 2W88A 3DKHA 1JZIA 1SHWA 1JXFA 3TA4D 2UXTA 4DP8X 3X1BA 2VW4A 4Q89A 2J55A 2VW6A 5I28A 2XV2A 3JT2A 4WTQA 4G7QB 4JHUA 4A2GA 4GP8B 1TEFA 4AX3A 2RACA 1A8ZA 3NJJA 4KO9A 2IH8A 3IE9A 1FWXA 1TEGA 2VMJA 2XV3A 2IWEA 4YSAA 2HX9A 1SHXA 1BQRA 1R1CA 2FWLB 2DYSB 1XB6A 4NERA 1N68A 2VSMB 1M56B 2GB2A 1CC3A 1PAZA 1NPJA 3AG1B 3NJMA 4DPCX 1CYWA 1AZBA 3T6XA 2PPDA 4BWWA 1L9OA 1NWOA 3FT0A 1OCOB 3EF4A 6PCYA 3SBQA 1UATA 2CCWA 2PPFA 3QJSB 4A2EA 4BXSV 1MG3C 5I5MA 4YSOA 1QLEB 2B3IA 2XX0A 3N55A 5A7EA 2OJ1A 2HX8A 2YXVA 3S8FB 2HLEB 5PAZA 5D4IA 3UAAA 3ZDWA 3T6VA 2X88A 5B3SB 1IBZA 2XVBA 1WA2X 3PLYA 3NT0A 1J5DA 1ET7A 4E9YA 2CBPA 3T9WA 1AZRA 4E9QA 2FJSA 4UAHA 2ZOOA 3PPSA 3UABA 1VLXA 2JFCA 5AZUA 1L9SA 4BDVB 1KDIA 1SDDB 1MG2C 3UAEA 3ZBMA 4BK5C 1IBYA 1OV8A 2PP8A 1E5ZA 3WIAA 4MFHA 1ZV2A 3FQ2A 4KNTA 1AS6A 1AIZA 5I6KA 4HIPA 5FC9A 1ET5A 1X9UA 1PLBA 4TXVB 2I85A 2XWZA 3FSWA 2Q9OA 1DYZA 1J5CA 5F7BA 1NIDA 1YLBB 4PCYA 4NAJA 1IUZA 1WA0X 2Q5BA 5D4HA 3NJNA 2GC7C 1NIBA 1W6WA 2FT6A 1IC0A 1AG6A 1ZPUA 2PPAA 3H4FA 4KOBA 1WS8A 3EHBB 4F2EA 3FS9A 5I6MA 1JZHA 1WS7A 1CUOA 2IDUA 1A4BA 1RZQA 3ABLB 4N8UA 3NJFA 1OCZB 1M9WA
chains in the Genus database with same CATH superfamily
1ADWA 1E2ZA 2JMRA 4KDVA 2GY5A 2R4SH 5HVFB 4JPIA 2X44D 1NLBH 5D93C 3QWNA 3QQXA 4FQ1H 4YHYB 4FTVA 4A37A 4RAUA 3MRLB 3KDMB 4AVIA 3W1ZA 4U49A 2E9JA 1YPZE 3DXAD 5DT1L 1C08B 3PWVA 3QUGA 5DD6A 2KZ1B 5IJKC 1KCUH 5IMKB 1QBMH 3QCTL 3W57A 5CLTA 5F7UA 1D5RA 2N59A 4FL4B 4OZGB 3MR9B 5DDHA 5TH2B 5A2CA 4QRRD 3GTTA 4W9CC 4O2CA 4A7GA 5I1DB 3N91A 1VZIA 3IDXL 3C8KB 3Q6GH 1S9WB 5HHOB 1JYNA 5E6ZA 3QNYB 3IDGB 4ELKA 4MHHG 1XVSA 3IPEA 4Y4KB 2J20A 3LS4H 4JFZH 2AANA 3HN5A 1ORQA 5DCCA 1QFWI 1IGJA 5D7HA 1A9BA 1ZE3H 3V4PA 2B2XL 1YNLL 4OLYL 5ESVB 4WFHD 4CDHA 5IG7B 1XQ4A 4H8QA 1S9VA 1MZZA 3IFOB 4LBEA 1XDTT 4R0LA 2BO0A 3TBYA 3VDAA 3PWPA 5DJCA 4H88H 2RHEA 3FF8A 1EQWA 1EEUA 3MRPB 3D2UD 4KKBC 4ENZA 4JPWH 3AS1A 1AOZA 2BP0A 2YPKB 3UBHA 4PPTA 1CICC 3DXAA 2XWJA 2I60L 3F3HA 5KVGE 1S7SA 1GR7A 3QSKB 4TSCH 1HIML 4NQSA 1DSFL 1BLNB 4X4ZA 4H0GA 4U1GC 2QGBA 1EHXA 3O2DA 3ULVH 1SLUA 1TVDA 2IH1A 2VMDA 5F71A 4QMEA 4YZFF 2YPVL 3HBPA 4ZX4A 4QYAA 4ETYA 4EUPH 2XA3A 3APMA 4GW1B 5GRXG 1MCJA 2YPLE 2QL1A 1Q0YL 2OR9H 5FDWA 2WINA 5EOTA 4L8CB 4YNYB 1F4XH 1GJWA 2XBTA 1G7LA 1F3RB 2CKBA 4S10A 3U7YL 4NO0A 2QPDB 4OCYL 4KMQA 2QSTA 4OR1A 2Y1VA 3WEAA 4PRIB 2BIIA 3K1DA 3I3EA 3SKUD 3SDAD 3TBWA 2MCG1 1NZRA 4JFHE 1KBGL 3C8DA 5K39B 5HGHB 5J8OA 1C8PA 4Z7AA 5AAWC 5I19L 3T4AB 3RDJA 4X7SL 3FCBA 3GGWA 1HXKA 4OZIA 1L7IL 2VJ8A 4HWNA 3LIZH 3VWJB 4XNMA 2V0AA 3SO3B 5D5MB 3G04B 4JL1A 1KIRB 3EJZC 3LQAC 1M6UA 5ICYB 4AMKL 3HE7D 2MRYA 5DZPA 1HTYA 2JTDA 2BCKB 3HKFA 3G5YB 1EAPA 1FVEB 3H42H 1NGQH 4UU9A 3U30C 2V3EA 3CFJB 3QISA 3UOAB 1PAMA 4PB9H 2CPCA 1I8MB 3OHXC 4S1QH 3SDXF 2V5SA 2B5IB 4M1DL 3LKPA 5ID0B 4AWJC 3MRLA 4KAQH 4NT6A 3TBTB 5JPMA 1DQJB 5B7MA 4ZTPH 5E8DL 2OP4L 1KB9K 4ZFGH 4PJBA 4FFYL 4QXTB 3QJHA 1EO8H 3WFCL 2HFGH 1T1YB 2L7QA 4KVCH 3HG2A 1KWKA 1ML0A 3M7OA 3QK0A 5IB4A 4P23C 3WDIA 4LEEA 4JM2C 3ME0B 4PG9A 1A7OH 2Y25A 5ITFB 2XXFA 3UIZA 5F7EL 4PSPA 4BH7B 4V1DD 5FGSA 2KI6A 1YJDL 2GK0A 5DK2B 1LXMA 4PCSA 4Q8BA 4BQ8A 1E65A 1G5AA 1GGUA 2IAMB 3C5JA 3IXTB 4B5EA 3G6JF 4UM8B 4M6NH 5BXFB 2YOCA 3GIVB 3O9WD 1BZ9A 3M7FB 4AEFA 2JJSA 4HJGB 2EDFA 2DJMA 4YFEA 2DKMA 3AS3A 3TIDA 5L2KA 4UILL 5BPPA 1VAHA 2VR6A 1G7IA 1V3LA 4K5OA 1R6VA 3L4XA 2HRHA 3L3JA 1IU1A 4E42A 3DO7A 1WIPA 4CADA 4WWOA 4N0FA 2FQGA 4RMBA 4X9GA 3ALWA 5JHDB 1AMXA 3INOA 1KJ3L 2APBA 5KJ4A 1H3UA 4XNXL 4PP1D 3HHSA 5E8OB 5HDOA 4J1UA 3QUXC 2IGTA 2XVLA 4L3EB 1EDQA 3K2UH 4KZEL 4IRZA 5KSUA 2XWJB 1KGCD 4MJIE 4NPYA 3KEHA 5F70A 1J11A 4P2OC 3QCVH 5AWNL 5JXEC 1P69B 3U7AA 1SUHA 2I7SA 3HG5A 5F89A 4BE6A 3MRDA 2VN3A 1CGXA 4E9LA 3K7UA 4BFKA 1B0IA 2Y7OA 3QEUB 3BH8A 2J71A 2UZIH 4XCYB 4KI5C 3VH8A 5I2IB 2LAAA 4HV8B 4LESA 2DLIA 4EN2A 2D4DA 2H3NA 4K3HA 1ZOXA 4IRSB 1MREL 1ZLSH 3CZNA 1DHKA 3GJEB 3QZOA 4IRZH 4U6YA 3SDCD 2F19H 1RZ8B 5LN8A 3HJEA 4L1DA 3QDGB 4EI6B 3BPNB 1MHHB 4HKJA 3G08A 4HS3B 1GYWA 3ASNB 3NFNB 3BH4A 3QAZC 4P5RA 1OW0C 2ZXEB 3CFDB 5FA3A 4J4PA 1XF2A 1VPOL 4LCYA 4LEBA 4JR9H 1TCMA 3BESR 3MFFA 4BFFA 5MEND 1MFCH 2A6IB 4BH8A 2IH9A 1XGRA 2VC2H 2EDDA 3BD5A 1KCSL 4ZSOE 2EIBA 1TETH 1XGQB 3EOBA 4S1DC 2OCCB 5HJBA 4Z1PA 1UVQA 1MRCH 3D85A 4EBQH 5ICUA 1IRAY 3LNFA 1JUFB 5IB3B 4ZO9A 2A6JA 3ESPA 2ZG2A 3ELQA 4XRCA 2NX5E 4LSRH 3HZMB 2A83B 3PGDB 4NC1C 2P5ED 1DJWA 3UH8A 35C8H 2VR3A 7CGTA 4KVNH 2AJXL 1OAXH 1VEMA 1MCHA 4MNGE 3HAEH 4LP8A 3D3VA 3EGSB 5DLML 1TQCC 3V7AG 1GZPA 4AXWB 1YUKB 5JMRA 1L0PA 5DK0A 3U7WH 2BWDA 2Y36L 4WWKD 1ANUA 1BGXH 3MGAA 1JK8B 2O5XL 2XYCA 3V5KA 4F9PC 1PW3A 1MFMA 4APQA 4BUGA 1RPKA 4PJCA 2YUVA 3FU6A 4YZWA 3BLKA 3WFEH 4X50A 2FZ3B 4WFEE 2BRQA 5ITFA 3IETB 3WIIL 1XF5A 2OLDA 3AB0B 5C0BA 2XN9A 4MJ5B 4P3CH 4RWHA 3ZQ9A 4QRPA 5EORL 4YDVA 2DIAA 3CU1A 1QQDA 2BXZA 2A3TA 2M83A 3LDBB 4JANA 4BD4A 1L0XA 4PHXA 2P8PB 1ZGLM 1CBVL 4M4PA 1XGZA 3AQDA 2P3YA 1FNSL 2R2BB 1OF0A 5DS2A 1OXYA 5HHXL 5HTSA 5IQ9A 3C60A 5JHDD 2WBXA 5CLYA 1SMOA 4O2EB 5J1TC 4WLCA 1RULH 3QNZA 3BWAB 4FDWA 4I77L 4LVOC 5MEPA 1MDTA 2X4NB 3KYOB 2W88A 4OU3A 1IAKA 3NRFA 2UXTA 1YEWA 2W0PA 2CDEA 2R0ZL 1DBAL 4DPRA 1JNNH 1P9MC 1MFNA 4AEHL 5I28A 1U0QA 1UZ6E 5HI5C 3HCVB 1U4FA 1JD7A 2E4FA 4LDOB 3WFHB 1FO0A 2YN5A 3NABL 5KSVB 3VD0A 2DQJL 1HKFA 3TEUA 1QBAA 4N3UA 1FZOB 4L8DA 3I85A 4L5FE 5GSVA 4UQBA 3DV6A 1JCKA 3SJVD 2WCGA 3BPCA 5TE4L 2EDQA 4WFFD 5BVJB 1NJ9B 1NOFA 1ZHLA 4NERA 3Q3GA 4FP8H 1FVCB 1T66C 2VLLB 3NVQA 3SKNA 1G9EA 1MCOL 4KJWD 2H2PC 4ONGL 4W9HC 5IP4A 4KXDA 5FK9B 2C3VB 1H3GA 1J0JA 5CP7A 3U9PH 1LMIA 5EU7E 4FKHA 2HA1A 5DMYA 4GMSL 2PTTB 2GEEA 5JIHA 2AK1H 3LJ3A 2WC7A 1H15A 4AQOA 2CBMA 3U36B 3WJJC 5E1AA 3PE9A 5EEVA 3BSZL 2WAHA 2HT4C 4F57H 1M1XA 2CUMA 3KJ6L 2HTLC 1KB5A 3O3DB 4HMCA 5T5FH 4JJHA 2OFQA 4AYBA 2AQNA 2JI3A 4U6VL 2Z31C 4PJ8B 4HZLB 5IREA 4MX7B 1NANI 3EGDA 1YMHB 1GJUA 4FC3E 3PJSB 4NX0A 4WEBH 5CILH 2MCMA 3O11A 4PBDA 5HYJE 4OJEH 4FQQA 3THMH 3KMDA 3GBMH 4NCDA 4E9YA 5F3BB 2Z1KA 4GAJL 4BKSC 1AZRA 4PRHB 3V4VB 4E9QA 3UABA 2P4AB 1HEHC 4CVUA 4NSKA 2C26A 4G82A 4HK3J 1OV8A 5D8JL 2NZ9D 5E4IA 1RIVL 2BS9A 3QIUA 2WB1A 2P48B 5DZ9A 2G30A 5KJ7E 4OGXH 3V8OA 3HI5L 3U6XS 3EF7A 4ZYKB 5IFHL 3K6FA 2XKNB 1HL8A 3ROLA 2X70B 1JGUL 3ZDYB 2OYLA 1WYJA 4GNKB 4QHKI 4CGTA 1WA0X 1O7SA 2V2XA 3MXWH 3HR5B 5CU9A 1IC0A 5C07D 4WU5A 3EDJA 4K4KA 5E8EB 5I1KL 2ZTBA 2BVUA 4KGJA 5D6DA 3G6DH 4G6KH 4MJID 1CDJA 4HQQH 5IFAH 3QQ4B 3VFGL 4V2BA 2OKMA 4PJ5A 3VVWA 4F3FB 1E6OH 1MFAL 5J5EA 5KBNC 2YQ3A 3JUZA 3KDMA 4JLRB 3GI9L 5IVXB 2LLLA 1HNFA 2EKSB 5T1MB 1WHPA 2Q86B 4G43A 1G87A 1HHKA 1PGRB 1S5HB 1LWHA 5CR8A 4A2MA 3E8UL 5LBVA 1G7HA 3LV3A 4L3AA 3VXNA 1AKPA 1AXIB 4AIZA 1NAKH 1P6FA 5G5DA 3V0GA 2DQTH 2PXYD 1DEEA 4AGLA 3EKCA 2CK2A 4LQ1A 2GVYA 2X2IA 3IPFA 3T0BA 3V6FA 2WO4A 1MCBA 2WNGA 5C0RH 2VLKA 4WK0B 4HJEA 4KJQD 4L5FH 3WUWB 4Z3TA 4YHML 5IWLA 3FFOA 3IF1B 2EYSA 3HHRB 2PCXA 4N6QA 4LSQL 3RGVC 2ZP9A 3LKQA 2EDLA 3WKNA 1T1XB 3NCWA 3IGAA 1YMMD 3PXJA 3TVMB 4WW1B 2ID5A 3SBPA 4F15C 2NW2A 4X9HA 4LBEB 1NUDA 5D1XC 1KDJA 5BRZB 5KSAD 6PAZA 3IAPA 2WGNB 3OLIA 4FLRA 5IMOB 3SE4C 3BRDA 1Y7VA 1NBVH 3O41B 4Y19D 5ISZD 2H0PA 1EJ6A 2WW8A 3SN6N 1RIUH 5C0JB 5J11B 1ZT4A 4A04A 3NCMA 3WGVB 4IBTA 1QYGL 5C0AB 5GRJH 5IJDC 2FX9H 5FUOH 1LMKA 4AYEC 4DK5A 4F7MB 3QYNA 2R2EB 3NJVA 3PABB 3SZ6A 5B39B 3TBVA 5B1BB 1XD0A 2FBJH 5HYEA 4A68A 1HDMA 1I8LA 1RZJH 1ADQL 1IGCL 2Y7MA 4EI5B 3E38A 1KTLA 2P5WB 2PO6B 1FDLH 4ATTA 3VFGH 4N86A 4PW9A 2QKSA 2P46B 5JNYA 4N0YH 3DVIA 2BOCB 4P3DB 1KUMA 3DBSA 2P8MB 4JFHD 4GS7B 4JFEE 4Z5RA 2EVFA 4NQXB 4JRXB 2BJML 5AVRB 4JVUA 2D9QB 3L1GA 4OD2B 3HRPA 4MMYA 5DD1L 4HUVA 2BIHA 3GJFA 1UKTA 5AAPA 4MQXD 4PWGA 5MENA 2B3RA 5EC2A 1OGAE 4ZW7A 3BIAX 4HX1A 1CLOH 4G42A 3GDCA 3T8MA 3RBGA 3UROR 1U4EA 3UIYA 1ZA3B 2BY0A 4KH9A 5AKRA 2M26A 1S7TA 4QOKA 1GYUA 1R34A 5ENWB 4AZ8A 1PLAA 4JHWH 4KKLC 5FYKH 5DD0L 4U3CA 4F2FA 2YBRB 1LDPH 4G43B 2VE6A 1DSYA 1NBZA 5EO1A 4ACPA 4GUOA 1BZQK 3S4SA 2BNQA 1I1RA 4JGMA 3QI9C 1CLCA 4UDTA 4P2OD 4JM0A 3RKPA 2TSBA 5DEFA 1H3TA 1W8OA 3ARRA 3ILEA 5D70L 3O3AA 2CHDA 1IVLA 3ZUNC 3BE1L 4DUWA 5F7NC 1IBBA 3HZKB 2EVJA 3K1KC 1JF6A 5EC1A 3MCYA 2XVKA 3RPKA 4HJUA 3NCCB 5IHZA 1E5YA 2WGXA 2XZCL 4HGWA 4MQ7A 4PAZA 2ZOKA 3CDZA 3IMVA 4U1KB 4XVSH 3V9FA 5CEZD 3VWKD 3MXVL 2WHVA 3M86A 4LOVA 3FB7A 2YUWA 2CJ3A 3SIKA 3UTZA 1KBPA 4LK4A 4HIQA 2QQKL 1WTLA 4X7TB 5JXEA 3RPIA 3GT6A 1KEGL 1ZWIA 3PF2A 4L4VB 3QCUH 1ZDSA 1JYXA 4KKRA 1W72B 2FDBP 3U9PL 3SKOA 2VXUH 1WBYB 1CDGA 1M7IA 1TCRA 3TT3H 1U3NA 3CQFA 2PWEA 4Z7VE 1T21A 3TXAA 4LF3B 2EDEA 3SE9L 2WQ8A 2QHLA 1MSPA 2DJSA 5FAAA 4F7TA 2GJZA 5DU7A 3SJVA 3U4AA 5E2VH 1Z3GH 4RGNE 4PH8A 4ZOCA 1URIA 3ZE2E 5GRVK 2IJ0C 3NABH 4U2YA 1R3KB 1HHGA 1OSYA 3FB5B 2EO9A 2MOGA 1ONQA 3CHRA 3RPBA 43CAB 1KN2L 2ZX6A 3CTTA 3VMNA 1EMTL 4GO9A 4UZGA 1JNNL 1FZKA 4PRHD 3VXUE 4JQIL 1KGWA 5IMMA 1FIEA 1YNKL 3PL6B 4HHAB 2IALB 1A3RL 2Z31A 2VDPH 1G43A 1NGWA 3EHBC 4J3SA 4LSUH 5BZWA 5LCVL 3O4LD 1GA2A 3II3A 4PJAF 5DHVB 5IB5B 2D7OA 4APXB 1U9KA 4OT1L 5F1SA 1RJYB 2WLLB 3BEWA 5HGAB 5ACMA 3UG5A 3X2QB 5AVQB 3MRNA 4KJYB 4F7MA 1RUPH 2H1XA 2Q7NA 3WDHA 4UUJB 1U2YA 4XN2A 2Q6WB 3IMWA 5GGRY 3A6BH 2VSKB 1E4KA 3C12A 3JVGA 1VJSA 1I9IL 4FFWD 1AGFB 3HPLB 4KJQC 4N2IA 3LIZA 1NC2D 3UPAA 1BSIA 3K3QA 1LGVA 4NQCB 1NEZG 1HCVA 1DVTA 5F7WC 3MUJA 4F7CA 1FGVH 2QQNH 3LB6C 2BSDA 3TASA 3WE6B 1QSFB 1U95B 3QUMB 5C08A 1G6RH 2BERA 2O5NA 4HCGA 4OH2A 1EGJA 1HAUA 3CN1A 3ZL4H 5EBGA 3V4PL 2AC0A 1G7QA 5FF6A 3LZOA 3U82B 3RYMA 3VG0H 3ECWA 1Q1JL 1IAIM 4JGNA 3MV9E 1ZHKA 4HKXA 5IOPB 3RZCD 2UZYB 3TN0A 1EHNA 2BW4A 1HU8A 3BP6A 3PPEA 4GQPH 3L4CA 2D0HA 3OLEA 2WO3B 2YZ8A 5ID1A 3NFPA 4IKIA 4RFEB 3VGEA 4G9DB 2YZ1A 2BSRA 3VQ2C 1EAQA 4AK2A 1JZ7A 3QQDA 3VE0A 3EYFA 3RILA 5D9SB 35C8L 4AG4H 1MCWM 1CTMA 4Q6KA 4XP9H 3ARTA 4KROB 1KPRB 3O8XA 4ZUUB 1QUNB 3J8F7 2O6FA 2WXIA 3L7EB 3D12B 4WTWA 1CXHA 3OKDA 5E8NA 3K91A 5GZNA 2CIKB 2EAEA 2QQLL 4KTEH 1TETL 4RGND 1XCQA 2E47A 4WI2A 1HI6A 1SXNA 4NRZB 2PYFB 5DC0A 3QT2A 5DRWB 3VB9A 3PHSA 4H2CA 1KYFA 2CO1A 4UT6H 2Q7YA 5L6YL 4JR9L 4JZJC 1EHKB 1PX3A 1AGEB 3I9IA 4X8JA 1FL3B 3FTSA 4XCFH 1HQ4B 4E0RB 5CZKA 4AH2B 2CBTA 2Y22A 3PGCB 5JPMC 2DW5A 1QEXA 1G7PA 4KI1A 5TK2A 4R7DB 4CC1A 2B9BA 2X4NA 3KYOA 3PL6D 3TZVD 3HG1A 5CEXA 3OB0H 4NAQA 5D2NE 1KV3A 3J2PA 3NZ8A 1XF5B 1N6QH 1CLZH 1HH9B 2ZXAA 1EFQA 3FUDA 4U05A 3A6BL 1RUAH 4ODHL 5J13C 1E9QB 2UY7B 1XGPB 3WJMB 5J4MA 1DO5A 2IFGA 4NDMA 1R0AL 4F92B 1FO0B 4H8HA 5HHVH 1QMUA 4E9VA 2NQCA 4BGDA 3WXWH 5KSVA 1HZLA 4AL8C 1G1YA 1TF4A 5KVFL 4TYUA 1FRGL 4GI9A 2F18A 4KKQA 1NGPH 2LT9A 2C4XA 3B8YA 4N4YB 3QC6X 4HS8H 1MZYA 3QXDB 1DE4A 2WBWB 3CLFL 3B3IA 3LKRA 4IW4C 2XBZA 4KI5F 4XB8A 1XXDC 1JK9B 1G1KA 3FFDB 3WNKA 1QSFD 2O5ZH 3TO2B 3AXHA 4X5XB 5HY9A 3Q7JA 3VRIA 3ZDYF 1A2YA 1FNLA 2EUZA 1SHWA 2VJXA 4OZ4B 3V0IA 1JPSH 4FNLH 3ULUE 3HBQA 4XOBA 1MLBA 3VXTB 4NAMA 1TFHA 1I8IA 2M1KA 4K3DH 4Y1AD 3U36A 5SX5H 4Z3HA 4LDCA 2XV2A 1PJWA 2RAMA 1RHHA 4WW2C 4GP8B 4GOSA 4NI6A 1TYEB 5AAMC 2RACA 5CKGA 2QKIA 5FCUH 4KNQA 1UQSB 3GXFA 3VRJB 1A9EB 3QQ3B 3L2NA 5SX5K 1Z9OA 2XIIA 3TH4T 4JFUA 3LKNB 2WTOA 2W65A 5E00A 4J3OD 4DOHE 4NUPA 2DMGA 4JKWA 4U0RB 2XWTB 1CC3A 1PAZA 1UASA 3TJPA 3RJOA 4XMLH 4EQ3A 1WICA 1E27B 3S4SG 3VW3H 3VRLF 2YQ2A 1SHMA 3DC0A 1FYHB 2EXYD 5A16B 1JWSB 3M8OH 4NO0D 4X6DE 3GSVB 5E2TH 4YSOA 5A2AA 5GIRB 5DVNA 4IBLT 5CFHA 1M7XA 1WC7B 1F6FB 2HX8A 5GGRB 1IC5L 1U92A 1OTTD 2L4OA 3KPNB 5D4IA 3BGMA 4QHNA 5D70H 1JTTA 2ERJC 4HK3N 4LLVB 1USZA 5H2BB 4BFBD 1WF5A 3FOMA 1IC7L 1LEKB 2YPLB 1J5DA 4J12A 4OD1L 4AH2A 1FH2A 1MVFA 3JV4B 3PGCA 2PMZA 3WSQL 5BV7L 2R69L 2R2HA 3FUHA 3CFNA 5ADPH 1T2XA 4QRTA 1IGYB 2DQHL 4QF1A 2BM3A 1V5JA 1E9QA 2PP8A 1E5ZA 1CLOL 1TQBB 4E5XG 2AS5M 1YCSA 3I9GH 4MFHA 1DJXA 5AZ2H 3FQ2A 2V2WA 4MNHB 5IFJA 3I6LE 4ANUA 4Z7WF 1AIZA 3TH2T 3O2DH 4X0KB 1WZ1L 1KTJA 1L5GA 1T1ZB 4PJDB 4F1ZA 5FYJH 1Z5LA 4JG1L 4WV1B 1J0YA 2XJLA 2V2XB 3WTWA 3D2UB 3QXDA 3F64A 3BHBA 1NCIA 3OAZK 1KZQA 4QHLA 5ID0A 3ZE1E 2BJMH 2EEBA 3FN3A 4I2XA 4FA8A 1SDAB 4IRJB 2PPAA 3NEXA 3FUMA 2EDKA 2JKSA 2NQ3A 4HLZH 4XNZB 3SKMA 1ODUA 4LPXA 5KBKA 1S7QB 1JDAA 1JZHA 5KW9L 1QASA 3ARUA 3FH5A 2IDUA 4JZNB 3ULVL 3N06B 3EH1A 2VXSL 3L3IB 1BP3B 1E8WA 4FNPA 5ESAB 2UZXB 4TSCL 3L1OL 3E6FB 4KKPA 1NQBA 4GKNB 1ED3A 2CO7A 4GH7B 4FQ2L 5D55A 3QIBC 4D8PA 1S78D 1I82A 2J1KA 3PHOA 4GEIA 4JRYB 4NPJA 2KERA 5T3ZD 5K1JA 4M4RB 4UWQB 3VSQA 4E2OA 4ABVA 4FZEH 4U6YB 1IGTB 1DQKA 4H88L 3RB5A 1JI1A 2FT7A 1D7DA 1KLUB 4GG6F 4CADB 4PY8J 1UZ8B 2K45A 1KGJA 4WUUA 4WGKA 1JNHA 2WYIA 2ISDA 3L4UA 3DI2B 3FHEA 2FECI 2D7NA 4OGQC 3MV7D 3N44B 3TNNA 4D0BB 4XCNB 4RGNC 3BLBA 1DN0A 2F1AA 2ICWJ 4WUUE 3F2LA 2QPUA 4NPYB 3RURA 3VX0A 1RZIA 4ZRGA 2Y2YA 3LKOA 4HVBA 2G2RA 2HFEB 4PJIF 3U6RB 1JRHL 3CVBA 4LKCA 5CEZH 4JPQA 1HEZB 1DZ0A 3F01A 2J4WL 1S9XB 5HYJA 4P07A 2TAAA 1BDYA 1JGDA 3QEGH 5KYXA 1Y6NR 5C0GA 4S1DD 2P24A 1JIBA 5T8IA 4IU3A 4Q9QL 1OD9A 2DN7A 3JZ7A 4NQEA 5J0BA 5TQ2H 1LO3H 1NC4D 1QLEL 4OF5A 4N1HB 3BI9X 1QEWB 1N3NB 3MUHL 4R3SB 1JGEA 1UT2A 4H8UA 3VXMD 3ARDA 1E67A 4FYTA 2HMID 1S7TB 4QOKB 2CWRA 3HUJA 1AR1D 5LXVA 4HS6B 2AERT 3U1QA 3ES6B 5IESH 5B3JE 3T0EA 2P43B 3BH9B 3WHE1 1A3ZA 5FV2A 1X5IA 4HT1L 3HC4L 4KI5D 1DUYA 4GMTL 1P9MA 2BVPA 3CPLA 2BOBA 4K9EL 5EU3A 4PJGF 2N1TE 4P5SA 4BINA 5ADOH 1JG9A 1MJ8H 5C0BB 1Z3RA 2P47B 3LRLA 4I0PC 3GSUA 4MQ7B 4PJ7E 4Y4KA 3CDZB 1RZKH 4JM2F 4MJ5A 4AVKA 4FQPA 5KVDL 5CJXA 2YMXH 3EO0A 3AB0C 1BAWA 3EYOA 4JM4H 4OKVA 3QDMA 1E8YA 4V1DE 3D34A 5F93C 5IJCC 5I9QB 4RAVB 4LPYA 5A2JH 5C0FA 5E6RB 5E8PA 3AG4B 2JKWA 4K5PA 5B1JC 5CJ8A 4XP4H 5E23A 4YN3A 4ZUSB 4AKQA 3GBML 3AM8A 1GZPB 4PJGE 3PHAA 4YLQT 1IM3B 4BQCA 5AVVB 4Y4HA 3THML 2N7SA 3PV6A 1T6VN 2Y0SA 4F9PA 3NIFE 3S5LB 1UWGH 4YHPB 1CGYA 2K0RA 4F8NA 3DJSA 3D69A 2V9QA 1OPGL 1QA9A 3KXFD 4HGWB 2HJKA 2H9GB 1D5ZA 4W6WB 4OKDA 4YX2H 4TULH 3VFPB 4QOKD 1UJ3B 3MROA 2V33A 1RZ7L 2VN6A 3QUYD 5ALBH 4UQ3B 3NGBB 1XR9A 3UGEA 2A0LC 2NXZC 4P49A 3QQNA 4W6YB 3B56A 4X5WA 4P8QA 4KK8C 4A2FA 5MEOB 2NY4D 1YO4A 3F65A 3RFZC 3DPBA 3QJXA 1IEHA 2FD6H 1IGIH 3RUGE 1WGVA 2QPEB 3AQZA 4TVPH 2YRBA 1DJGA 1RHFA 5T5NF 5EBLA 4JAMA 2VDKL 3POCA 2Z4TA 4OGYH 5IGXL 3CWGA 5LGHH 1K3IA 2FHCA 1P4IL 3E3QE 4R5TA 3MCLH 5D1ZC 3MLTA 4XAWL 1J0IA 1KBWA 4IK6A 2YGOA 1SZNA 5FXCH 3ILDA 3L4VA 1XH0A 3KPSD 1DLFL 2ED9A 3PDOB 3OKLA 3CFEA 4XP1L 1GMIA 4TV3A 1Z9PA 1AYOA 3BPNC 4TOYH 4UOW0 1RCYA 1YMHA 4BXVA 3AROA 2IPKA 5FM5M 5IVOA 2EKJA 2GT9B 3T0EB 4IRJD 3O45B 4I77H 1B2WL 4OZHF 4EOWH 4MS8C 1S78C 1MCQA 5CZXD 4YOKA 1FL5B 2PW2B 3QZWB 1FV1A 3IXAB 4UTBA 2E7MA 4UM9A 2GQHA 3HC3H 3L3DA 4WWKB 3PQYD 2ZXGA 2BP8A 4NNPL 2J56A 1F4WL 3IK2A 1PZSA 5T3XD 1CBVH 1MRDH 5EU3B 2YLHA 4HPOL 4WCYL 3QUZC 2CD0A 4TVSa 4QY8A 2Q2EB 4M7JL 2QR0A 3NIFF 4G7YH 1D6EA 4ZMOA 3O9WA 3PAYA 3ARFD 4PJ9B 1AC0A 5HGHA 5K39A 2N0MA 3WIIH 1N0XH 1RUKH 3DVNB 5D2NA 1LO5B 4F7CB 1RERA 1UWXK 3V0JA 4DP7X 3BAWA 5HHNA 2ODIA 1RUQH 5TPWL 3UTTB 1J9SA 1QKZH 2YAPA 3NG5A 4N2HA 3EBIA 4YK4C 3IAQA 3NCYS 1LK3L 2O5XH 3EOAA 4A67A 3MYJB 3CSBA 4Y4HB 2DQ6A 1BGXL 3KW8A 2X4UB 4J3TA 4Z7VB 1QFOA 4JKPL 3RVWD 1AJ7H 4EN3A 4KRPC 3T3ME 2F15A 1U8IB 3EYSH 2GK0B 5DK2A 3RWFA 5F3BA 3GMNA 2IAMC 3F6IA 1T7WA 1YQVL 4U33A 3K6SB 4KVNL 2AGJL 1CICD 4PLJC 3VFPA 1EX0A 1UJ3A 4A7UA 1QR1B 1GS6X 5C9JA 4XPBL 1BAGA 2GSGB 3BP4B 4Q0XL 3NIGE 7PAZA 2ZCKH 4KTDL 2PNDA 4G8IA 4HGMA 3DETD 1COBA 1UA6H 2OMXB 2AAVA 3IMSA 3HLKA 4J3UA 5HDWA 4JGJA 3TEYA 1B88A 2X70A 1B90A 3GM0A 4XN5A 3X12B 2AZAA 4ETQA 1EXUB 2VLJB 4IMLB 4FJYA 4CMMB 4PJBF 4QGTA 1WAPA 1WD8A 4P2RB 2ZUQB 5AB0A 1DANT 1CIUA 1FG2B 3G6JB 4GW4A 4XWOD 3GMLB 5I1IH 1AXSB 3RTQC 5ABDE 4C58B 3GKWL 4LLMA 3T0DA 5DR5L 3VM5A 3KH3A 2X2UA 3QJFA 4TVUA 1NAMH 1HDMB 1RV6X 1AC6A 5KEZA 4YFLF 1KULA 5EOCJ 2KMWA 4PIBA 5DVMA 3WUWG 4N2EA 1T22B 1VZGA 2BFVL 3BZEA 1ZK5A 3ZTCC 4FG2A 1HKLH 3N04A 4FFVC 5IKCB 3ZYOA 1UXLA 5BMFH 4ALAL 1MFDL 2ZJSL 4Q9BA 5HDLA 1INEL 2HKHL 1O9ZA 2AF2A 4NB7A 2DWDA 2FR4B 3B34A 2IOIA 2XXCB 4L1LA 2Q8AL 5AD0A 1OKEA 4JO2L 1P7QA 3REVA 4C4KT 2E7BA 4PMEA 1UA7A 4Y4FC 1INQB 1MH5A 4AUYA 5E9NA 1SRDA 2JV6A 3UPCA 1JDCA 3TA3C 2NY4C 3D6GA 5JOPD 3IDJA 4IK7A 4KQ3H 5BUGA 2FNBA 4RAUB 5F0LB 1ZA6A 4ZQTA 3QUYC 3QUKA 4KWUA 3TO4C 2FJHB 1NC4A 3CFIC 1KC5H 1CIDA 1WG3A 1WPCA 3KWWA 3EOYG 4BRVA 1IGMH 3DX2A 5C2BH 4LHUG 4MLIA 5HDQL 1OE2A 3OZLA 1U41A 3L3HB 4GKZA 1JYWA 1X9QA 3H8NA 4H5SA 2YK1L 1A6AA 4AIEA 1GCFA 3ZGHA 3TGXA 2J55A 5CGBA 2FGWL 3SJVE 5A3ID 4G7QB 2CLVB 3MV8B 5KN5B 4FQXC 3ARBB 2CU9A 1KPVB 4FEIA 4CC0A 4GKSB 3EOBB 4LSSL 3BP7B 4KO9A 5HSFA 5IUSA 4KKAC 5TE6H 5ITBH 4UBDC 5E2JA 1NCAL 1Y1UA 2X89A 2ATAA 1A7OL 5KUKA 1NCJA 1TZGL 1X4YA 4L48A 2D3VA 5IG7A 2BNQD 1D5MB 2OMWA 4F5CE 2J3SA 2BNUA 2WLNA 2FX8H 4HDIA 5E8DH 3UYPB 3LPWA 2BX5A 2OXHB 3CFBA 1RP9A 3FT4B 2F08A 5EIVA 1HZKA 5LNEA 1OWWA 3WY4A 1CGTA 5FA4A 3IRCA 2A9MH 3GLZA 2CKBH 5I1DA 3N55A 5F7DA 4HWEL 2C4FT 1FL6A 4EKXA 3KPNA 5DJ2B 1MIEH 4AMKH 2YQGA 2H2PD 5KWYC 3L5XL 3V8CA 3IFNH 4HD9A 4OQ1A 2Z4QA 1QW9A 3QBTB 3NT0A 3ARPA 5FUCC 5HHME 1L7IH 2EADA 1U93B 4QXGH 4X7SH 4K07A 4PW4A 5I19H 4M8RA 2N1KA 4O58L 1LO2L 1I7ZA 4IEFA 1UUNA 4H1LA 4XNAA 5INDA 4IM8A 1NC2B 4OCNC 4WWNA 1GYAA 4YDVB 1WFIA 1H6UA 1JYVA 3NBNA 5JDSA 3NCXA 3QIWD 1G0YR 4KY1L 4UCFA 4Y0GA 5CJXC 5GPRA 5MENE 4PRNB 4MNHA 1DQDH 4YXLL 3ARFB 1KGIA 5IFJB 5GGVH 3ZTDC 1WBZB 3FO2B 4WU7A 3UEZA 1DCLA 1YN6B 4XX5A 1X4XA 4I3SL 3ULUH 5IQ9B 4NUJA 4ZS7L 5GGQH 1ETZA 3UJTH 4V1DB 3D87B 3E2HC 1OZUA 4KPHL 5I75B 4K73A 3HE7A 4LLAA 4IU2A 3TZVB 4JFEA 4NAJA 5I1CL 3RGHA 2YPVH 4G9FB 1MXGA 1YPZA 3EO9H 1KCLA 1CTOA 3EADA 3LXAA 4EUPG 2GUOA 3CVHB 3OJ2C 4IBQA 5DRNB 4B9PA 4Y2DA 1K8IA 2BP5M 1DSFH 2GSIB 1PJ9A 4FEMA 2IO5A 1WS7A 2ORBL 3H9YA 4LGPB 4PJHF 3N43B 3ABLB 1A4BA 4M7LH 1NGXA 5BS0A 4UT9H 1T89C 1AD0B 2WP3T 4AOFA 1M05A 2VZ3A 1BVNT 1QFUH 2MQCA 3QORD 5GSVB 3BWSA 3A47A 3DV6B 3V7AE 2I60H 2DQDL 1K2DA 4UMGA 4WVRA 1CICA 1ROWA 1TZHA 4MD0B 4DF9A 2FEDC 3MV9B 4FQXB 4M8QB 4X8GA 4NKDA 4W6XB 2DWTA 1ILSA 2R9HC 1CFMA 3GFUA 4N9GB 4RQQB 3HJ0A 2C3VA 1FFNB 1YYMH 1AHKA 4Z8FL 3P9WB 2COQA 1YNLH 4W4OC 2B2XH 2X6AA 4ISVB 4NC2B 5FHBL 1J8SA 3EOTL 1P5UA 1KXTA 1N3NA 2CAKA 4KK6C 2VSCA 3SB3A 1AHWA 2VLKE 2WO2B 4QRSA 3QUYB 1AI1H 4K71B 2VISB 2H1LM 5DTFB 2X1XR 3U46B 3F7QA 5CP3H 3NN8B 1I1FA 1ZLDA 3QUHA 3L9BA 3R1GH 3F7YB 4PRAB 3N1FC 4ZUWA 3AUVA 3MRKA 5FUZH 1A4JB 2DWEA 4LSDA 4KNSA 4TSAH 4Z7NE 3V4VH 3VQMA 5A40E 1QOKA 2A9CA 2OSXA 4PV8A 2E7HA 4UM9D 4YVNA 4R7DA 2VH5H 1KGUA 3FT9A 2NYYC 2OK0L 5DT1H 3ZIYA 4LRIC 3OBAA 4L4TE 3UX9B 4U1SA 4FQ1L 3SD2A 3UYOD 2NSQA 2X9XA 4YHKH 1GOGA 4NDMB 5TF1H 2EE9A 4PN6A 2FJUB 3PP4L 1FVEA 1A7BA 4DQAA 1G4MA 2E9GA 5H35B 4UIKL 1JPGB 2H1PH 1QUPA 1BM3H 3UP1A 1A02N 5AZEL 5HVHB 5DJ6B 1HC1A 2VZOA 1RPQA 3T2QA 5J06A 5I2IA 5KOMC 4NM8L 4G9DA 2HWZL 3LRSA 4JRFA 3OKMA 5B3NA 3CH1A 1BFTA 2A1WH 4BYHA 1EJ8A 2AMGA 1BVKA 3CU7A 3GMRB 5LHDA 1VERA 2B0SH 1D3CA 3NZHH 1QP1A 3TS8A 4OFPA 2NUPA 3GMPA 4Z7NB 5KYWB 2R8SL 4H7VA 4AKPA 4PSRA 4QT5B 1W8EA 4MA8L 5I0WA 3LHAA 2YKKA 1ND0B 1OLLA 4P5TD 1XB8A 5DLLA 1IGFH 1LQSR 4PREA 4FLOA 2J1XA 5A2LH 1WBZA 3FO2A 4WU7B 3WTSA 2A6IA 3WFBH 4Z0BH 5DRWA 5IBTH 3VYOA 2A9NL 1KCWA 2YFNA 1UQSA 3VRJA 5HHOE 2APFA 3S34H 3ARBC 5E2UH 2GCYA 3T65A 1W80A 5AB2A 2GJ6E 3N0PB 1NBYB 1V3MA 1IAIH 4XPFL 2HFFB 2BHFA 4HUUB 4LGRB 5IIEB 1EBPA 3KM2A 3L4YA 5FOBA 4JY6A 3HVDA 3MLTB 3S8GB 4L4VD 1Q9WB 2YD1A 4F27A 3AQXA 4PM1A 4W4NA 2DJ4A 3KPLA 2JKLA 1DEDA 2EDHA 4JN1H 4X6CE 3BWUF 3ZZLA 3Q8EA 3BEVA 1A7RL 3SDYH 2DTML 1CF8H 4M6MH 4LVNC 3TVMA 4Y1AA 5HD8D 4YSDA 3KNBA 5SWZE 2JQAA 2ZCHH 5F3HA 2HTKD 2IIJA 3HFMH 5CSGA 1N2RB 3UC0L 4NKDB 4G8FB 3PWUA 3A6CH 3EXJA 2GYSA 2IVFC 4ANWA 1M2OA 1KB5H 1QRKA 4GQZA 2LTQC 3DNKA 4UOZA 1MCSA 2R9HD 3JTSA 5DEJA 2YAHA 2J8UE 1C7SA 2JF1A 2MWCA 3GUTA 4L23A 5EC2B 4HF5L 2W81C 4WDIA 3SYOA 5GS0H 5HHQB 4IBZA 2G9HB 3NRPA 4AQAA 5GS0D 2X7LA 1E4XL 4QRQB 5TF1L 3VI3F 5C0EB 4HW6A 3QORB 2P45B 4OLVL 1RZKC 4HC1A 4LL4A 5I8CA 4BSJA 4HF5H 4HSCX 4JDZA 5BW7C 3SQRA 4ERSH 1OGPA 3EGSA 1X5JA 1HFUA 1CS6A 3X1FA 1S7WB 4ZX3A 4ACTA 4UF7C 1HWGB 3KLHD 4W9GC 3N0AA 2VLRA 5I1AB 2EC9U 3Q2LA 4NHCL 5FGBC 4I13B 3TU6A 3UBXG 2XWBB 3WU1A 3HZKA 4RZKA 3RL2B 4OJAA 4OIBA 1OE1A 1MPAL 4NQVB 4R90L 2VIRB 1N8ZB 1JZDC 2DDQH 3HFML 3CZEA 4QRPE 4BZ2A 1KIQB 2K1MA 2UXGA 1U8HA 4XPHH 4M1CC 3DBXB 3FB7B 3UTZB 2ESVA 3W5MA 4G3YL 1WQVT 1MDAA 4B0MB 3ATBA 4TN9A 2XZAL 4BEIA 2D2OA 3ETBJ 5AEAA 3NGBC 3T77A 2P8LB 2A9DA 4PJCE 1J0HA 5BOZG 4R0LB 1O9WA 3TBYB 5G2NA 4ENED 3OAWA 4YGVB 2F8OA 1QWHA 4JFTA 4I18B 3O3AB 3IWUA 3HZVB 2ADJA 3CQQA 1RZGA 3BLPX 4IMLA 5CSZB 2YGVA 4G6FD 4DP4X 1JNJA 1U3HC 5FM5O 1UH4A 1LYQA 4ZW3A 2DRUA 1MY5A 2CHZA 2GC4C 2C3HA 3GBNH 1X4ZA 3B2UC 4QO1B 1RU9L 4U1HA 4FFZL 3C2AH 4YH6A 5T3ZH 4DGIL 3QJFB 4TNFA 3MV11 4OZFB 1BG1A 2ZOUA 2GFBB 4P23B 2FH6A 1HILA 2D7TL 4WHTB 1HHIB 4I48A 3U4EA 3FT1A 3QRBA 4U6HB 2G2RB 5IHBA 2PCPA 5F0MB 2PYEB 4AT6A 4GQ9H 4UTBH 1WAEA 3DIFA 2BSEA 3O8XD 3DGGB 4NZTH 4P04A 3EFFA 2N56A 1QFPA 3NJXA 2VLJA 3NZHL 3SBRA 2NPLX 1B4JL 4CMMA 2GBAA 5FK9A 5I1CH 4RWYL 3ISRA 3TO4A 2DMCA 1ZSDA 3SJVB 4E36A 4KPHH 5BRPA 3GHPA 1FVCA 1OCWH 2VLLA 3SKNB 5CCJA 4YZFE 1ASPA 2OMNA 2EJ1A 2WLHA 4DKFL 4PV1C 4Y16A 5IB2A 3B8SA 1F02I 3DIVA 5AZEH 3IJEA 3AC0A 3ZRFC 2H1PL 1EH9A 2V2TA 1OK0A 1P7KA 4ZODA 1U6AH 4B9KC 4C56A 3BKYH 3BZFB 5E1AB 5KYYA 4X6CF 3ZDZB 3ROLB 3OLGA 4LQFH 2CO7B 4OLWH 1NL0H 4O58H 3Q06A 2L8AA 5E6UB 3E7JA 4KDWA 3VSVA 2WBJD 5K9OA 4XCEA 4MAYA 1QO3A 3WEXA 1JF1A 3FUIA 2NZ9C 4J3BA 3IDIB 3KYMA 4HZAA 4AMWA 1MIEL 4B60A 3VXSD 4OI8A 1BIIB 3L54A 1NDTA 4W9LC 2YD5A 3FCTB 4ELME 4Z3GA 1CXKA 3MRJA 1A1MB 5I1LB 3GSRB 2XWEA 4Z3JA 3RWCB 3RFZB 2HJLA 4PRBA 4XE5B 1NEUA 1AACA 4R7NB 3FUNA 4YDJB 2UWEA 2XKNA 3BD4A 3QZMA 1N4XL 4N0UA 4DAGH 5I0DA 3MLZH 4PMFA 1KXVA 3EGDB 3KLAA 5JUEH 2WZAA 3KGUA 4I18A 1I53A 2ARWA 4I1RA 1CE1H 1HEZA 3KCPA 3PNWA 3SE3C 3L6FA 3DURA 5E5MA 4G80A 4E68A 4FGMA 3HBZA 2ZKMX 3K6DA 4M8UA 3MJ9H 5JW4R 4HIJB 4KZDL 5DFAA 2IPTL 2FSEB 2WCPA 5LBGA 2GBUA 3GSUB 1EO5A 2H7WA 4YR6A 3D9AL 4BKTC 2NY0C 4QO1A 4UNIA 4F37K 3IDYC 2EE3A 1TUPA 3V6BR 3A67H 5FO8B 3FL7A 5FO9B 5HJ3B 1SGKA 4OGAC 1A0QH 3MO1A 3KPRA 1HILB 5IHHA 1HHIA 4I48B 3U4EB 4BSVA 4NZUH 5AOKA 2OMWB 1V27A 4PJBE 4K0OA 1ZCRA 1C9SA 3LV3B 3UO1L 4MCZA 5DO2C 3F83A 1R47A 1E9PB 2YA0A 3EDKA 4JAMB 5E6IC 3ZOAA 4R8WH 1WP6A 4Y5YC 1GGIH 2HVJA 5BJTB 3HAEA 2YD3A 4GSUA 1D5IL 4ZS7H 2ICEB 3DARA 5GGQL 2G0LA 3KLDA 1G7MB 1HSBA 2D7MA 3ULUL 1SY6A 1FLRH 2BWQA 3BPOC 4GRLD 4I0PA 1MG3C 5I5MA 3RQ3A 5MP6L 5J3HD 4PTTB 1QLEB 3MJ6A 4UQ3A 3DUHA 5B8CB 2YD0A 1DQDL 3PJNA 1F5WA 1HOCA 4YXLH 2X4QA 3Q5TA 1JD9A 4KY1H 4NZ8A 2J8OA 1WWCA 1GL4B 3O6LH 4G6AD 1NKOA 2Z8RA 2K6YA 1DLHB 1F11B 2BVTA 4FXKA 4NRXB 2ZJSH 1LO2H 4XX1G 1KBKA 3KWTA 1WFJA 3KWVA 1LEGB 2Z8SA 3WAKA 5EU5A 2R0KL 4MMYB 1ZT4B 3OAZH 3BZDA 5K9JL 3MV9D 4FQXD 1OM3H 1N5YH 2ICCA 2ERJB 2ZUSA 2VO5A 3GSXA 1AKJB 3KAAA 1XGRB 4ZAKA 4HEPA 5C0DA 4OM0L 2R0LL 3BVWA 3RG1C 1YEDA 3ZRSA 1A9EA 4PS4H 1E3ZA 2PO6A 2Y4SA 4N8VG 4WO4A 3DRQA 1NKRA 1AXTL 3DVNA 3WS3A 3TA3D 5EA0H 4IU2B 3PWVB 2H32H 4IS6B 2Y5QA 3JSSA 4IIQA 3ZKXC 2NYZA 4JQIA 1YLBB 4L4TD 5EO1B 3RX8A 2APVA 4CW1A 1IUZA 5TDPA 3NJNA 3SDCB 2OI9C 3Q9QA 5FCSH 5KBMA 1UA6L 3FQUA 1E27A 5C0CB 2AJYH 4OVVA 2DLTA 7FABH 4O2CB 5F96H 3O41A 2CXKA 2RJMA 3WHXB 5J56B 4QRFA 3VXPB 4DVBA 4EPSA 3LQMA 1FCCA 1TMQA 4M5TA 1UFUA 2FWOA 1YEKH 5FGCB 2VISA 1JGVL 3NSFA 1YUHB 3EJZD 3CCHB 1P84J 4ABQA 1G0DA 3BVNA 3ILPA 3D39E 4Z77B 3PU7A 1QHPA 3ZHLA 2WXMA 3VD5A 2XWTA 4MJ6A 2VR4A 2JJTA 3CZKA 1CI5A 5ELIA 4XOEA 4PV8B 3UBXI 3EFOA 3MCKB 4YDMA 2JQMA 3EFDH 4HHWA 3I75A 5EN3A 3RB7A 4AENA 5LG6A 2YQBA 5C2BL 4LEXL 4LU5H 4XPTH 3L5JA 3GSVA 1GW0A 1BIHA 3OX8B 4UT7H 1KBBA 5I15L 1LWJA 1T3FB 3ASWA 2L7UA 1JWUA 2R51A 4YLBA 3ULVE 1GW6A 4FE9A 3UC2A 4DIXA 1YG9A 1P0SE 4ZXBB 1T1ZA 5EOQL 2ED7A 3UBGA 4HLEA 2NCMA 4NQQA 4KK5C 5BCAA 4J6RL 5EZOL 4NNPH 1TO4A 3P40A 4JO2H 2PXYA 4MRCA 3FRPB 1FNAA 3N50A 4M9OA 4OFQA 1ZGLB 3DSFH 4NEHB 4ALAH 2IADA 4M8VA 2LU7A 2XJKA 4JO3L 2BFVH 3D3VD 5HD8C 5IEHB 5GS3A 4N1EA 4OY9A 2EIKB 3V0FA 1JE6A 4HFWB 5HYSB 1OARH 4KKNA 1HAWA 3OSVA 3Q2CA 4PJ5D 3RWGA 5KVEL 5M94B 1E40A 3S3JA 3R19A 4PJDA 5IHZB 4P2CG 2YMTA 5DR5H 3GZPA 1NFDA 1AGBB 3GMQA 1NDMB 1AYRA 4RFNC 1IZJA 3B9KA 1P4IH 4U1NB 2AV7B 1ES0A 5DUMH 3KWWB 4NQDE 5CJOL 2J8UB 3U2SA 4DGUA 1B0RA 5GGTL 2ADGA 1GPOL 3NK3A 4ZW5A 2WXHA 3US0A 4DKTA 4WO0A 1Z6JT 5KYWA 2OTUA 3L5WB 5T1LB 5GS0C 5EU5B 1XF4B 5IB5A 3CG8A 1OQOA 1H3PH 3CXFA 3FQWA 1JMZA 3K74B 4LIQL 3T3PB 3V6ZA 5I23A 5KS9F 5L8JB 5DQDL 5BZWB 1HYSD 4LVNB 4UV4H 1IV8A 2ZWZA 1FGNL 4AYFA 3LRKA 4GRLB 5IM7A 4HISA 3D05A 4I4WB 5BVPL 1AGFA 3HPLA 4UQEA 1CGUA 1YQVH 5F1KC 1ZD6A 3KXFB 4LAJH 4M7KL 1NCWL 1NC4B 2CUIA 2MKWA 3IE4A 3W0WA 4O2FA 4CJ1A 4XOCA 1AO7A 4PGJA 5KS9E 2DWXA 5DVLA 1L9PA 3MU3A 5D1ZD 5CKAA 3S36H 1KN4H 2XFXB 4D0CA 5CZRA 2HRPL 1GAFH 1M53A 4MBRA 4GRWH 2VQTA 2MTAA 2OCFD 4Y16C 4U1LA 5D1ZI 5E4AA 4NHUA 5ICYA 2DWDB 1AR2A 2R29L 4ZAKC 4JM4L 2WQWA 5K5YA 1F1AA 1IM9A 5TQ0L 4X5LA 1IX2A 4G7YL 1RZKL 1ZJBA 4G2AA 2DQMA 1DQJA 1HINL 2D0FA 4DERA 4J8RB 2VSDA 3PWUB 1B0GA 1PG7L 2DWYA 5HDBF 2XN1A 5PCYA 5E4EC 3V0VB 3LAFA 1KEGH 1C1EL 2VDMB 3C60D 2DLEA 3ZDZF 5JHDA 3GINA 1AD9B 1RIHH 5FYKD 3ZIMA 4P5TC 3NPSB 3D52A 4ODVL 1E2WA 3GLEA 4JW3A 1BBDH 3FU8A 5DHXB 1EHAA 1HI6B 4NRZA 2O5YH 4BDVA 1J0ZA 3CPUA 4TOYL 1HXMB 3L9RA 3GIVA 4HG4J 1E6JH 3PWLB 3QG6A 4HFWA 4OLZL 4JFXB 5IHUL 3RWGB 1K72A 3NACL 4UDUB 4UNUA 4Z76B 4OJDH 1KJ2A 5FR3A 5BO1L 5HYSG 1JNLH 3HB3B 3WJLA 2DPKA 1MLCB 4GRMA 2KPNA 2H3NB 4LPTA 3PRZA 3UTTE 5JDJA 5IGXH 2IWFA 3AU1A 4HCRH 4U3SA 1DP0A 2WTRB 1T89A 3LPGA 1TTCA 4HIXL 1NMBH 1NCCH 3QJOA 3FH7A 3LTVA 2ZYHA 1OB0A 6FABL 1MOEA 3P02A 1UGKA 2HH0H 2E7LC 3UEQA 3WLBA 2GIMA 1T7XA 5IEHA 3IBOA 5JW4M 3CFKB 4JPVH 3R7RA 1AZNA 1EZSA 3LZQA 2WPGA 5C0FB 3RRQA 1XIWD 3JUYA 3ZJAA 1UB6A 1OP9A 3WJJA 2WWNA 3N41F 3T6ZA 1Y0LB 2ZIDA 4CDGC 2NX5D 1HJCA 3ZMEA 4YDKL 1QX1A 2VLKD 1FL6B 1XX9C 4XO4A 2WZ0A 5CGYC 4KU1A 3DROA 1EGJH 2RA1A 3QULB 1IC1A 4PJAA 4LLQA 4LNRA 4U0QB 4E42B 3DO7B 4MXVE 1FSKB 5D7EA 4L3CB 2GUOB 3H4HA 1HZHL 4MAYD 3MBEB 4EIZC 4C4UA 4PV9B 3S98A 2EUXA 1WBXA 1NLDL 1RZ8A 3HHSB 4B9GA 4M6OL 2RQEA 1RJZA 4K15A 1AD0A 4OZ4A 4ZSOB 2VDQB 4OV5B 2AEWA 4KMLB 4TNVK 1GZHA 2CLRB 2AQ2A 1HSAB 3WN5B 3NYKA 2QADD 4OB5H 2GBTA 2OM5A 1CZ8H 4XP6H 3D09A 1NIEA 5IW1B 4L2YA 1TYRA 1OTSD 3KLQA 4Q6IC 1B4LA 3IDUA 1GHFL 5F1OB 2NY1C 3NSCA 3BGAA 4IIZA 1F6AA 1KJMB 2ZSVB 3HC4H 4TNVF 4M7ZB 1A22B 1CYXA 2NY4B 3DPDA 3I6GA 1BIIA 4H1LH 1WZ1H 5K1VA 1BFVH 1T5WB 1E4JA 2L7EA 3LEXA 4EDXA 4M48H 4KMTH 4EI0A 3QDGE 3CBRA 3P0YH 2PO6C 2G0KA 4S2SA 2OJEA 1SFDA 4HSAC 3RDTD 1JN6A 1H5BC 1I3RB 3G5VA 1R4XA 4OBRA 1LO3L 1QLEH 5AAWA 2EYTA 5DS1A 1EAJA 6TAAA 3A24A 4FFVD 2W8CA 1GS7A 3KYAA 4FTVB 4JE0A 1LK2A 4TSBL 5ANMA 4YJZL 5ACLA 3ZKMC 1TQSA 5C08D 2NTFA 1T7ZA 3T3PE 2JIXB 5CJQH 3WTXA 1YEJL 3QJUB 4ZO7A 3S36X 4RDBA 4Y8AA 3ET9F 3FAXA 1S7VB 4ONOA 4QCIA 4U1KA 4YE0A 3SDDC 1HE7A 5CEZL 3IMRA 1IT9H 1TDQA 1VENA 3MRMB 4NENA 2V3FA 2YAOA 5D1XB 2Y7SA 1BD2B 3RIKA 3OMZA 4O00A 1MQKL 3MNVB 3RU8H 1HHHA 2PKDA 4XN1A 1UH3A 5IY5B 3RPIB 2BHZA 2NY3D 2PR9A 1MCWW 2PWHA 2VRKA 4A39A 3HS0A 4Q2ZB 1LE9A 3CX5K 1PX4A 3CUPA 4PJFF 4QJ3B 1QSZA 2VN5A 4Z7UA 1NCGA 5MI0C 3TF7C 4PVMA 3K2IA 1N26A 3DURB 3KR3H 5E5MB 2COVD 3QEHA 5A2IH 3C60B 3S37X 1FNGA 4Z76A 4XXCA 1OPOA 5BV7B 4JY6B 4LCWD 4YHOL 1CG9A 1JZIA 4IRJA 2VDOB 3B2VH 3MRIB 4RISL 2VXTL 3AFLA 4AGPA 2YRPA 2VW6A 3BUTA 1RUML 3OKKB 4TTDC 43CAA 4FQ2H 5JIIA 1RZJC 2MPVA 1OVZA 1ED3B 5JO5B 4QRPB 2OR8A 1D6VH 1QAWA 1V7ML 3TLRA 1ACZA 2UZXA 1FWXA 5I16B 3GJFH 3PG2A 2VXSH 1MUJB 4XHJC 2ICWA 5K59F 2GG1A 1E4KC 5C07E 1SM3L 4YSAA 1BJ1H 1SHXA 3C6LA 4WJ5A 1KT2B 2F53B 3C6SB 1D7BA 1DFBH 2DYSB 1AFVL 4FULA 2QQQA 2AXGA 1M56B 1E4XI 2KT6A 2XZQL 5D1XA 3RY6C 1FG2A 2E4TA 3W39B 4K23H 1KXQA 4DPCX 5KANG 5D7JA 3MLWL 1G7MA 1HSBB 3MRNB 3NFSH 4MZIA 3HUJF 4PV9A 3SBQA 2CDFA 4JG1H 3UTOA 7TAAA 3OR7B 4LLYB 4OD3L 2LE9A 5AZ2L 1W9XA 1A3LL 5A7EA 3CLEH 2HLFC 4ZUVA 1WV7T 5CU5A 2VDLL 4LKCB 4L0ZA 1A7QH 3TBSA 3A4EA 2TRYA 1MWAH 1LM8V 4F8TA 4X9YA 1PIFA 1YYLL 1IBZA 3CGTA 4JRYE 4OF0A 5EFIB 1MNNA 25C8L 3Q1SL 3VACA 1AHMA 4Q56A 2K4WA 4F8QA 5DMKB 2ZWKA 4XBGA 3MRGB 1GYVA 2LFGA 2ZSWA 4U1JB 2YPLD 4WWID 2V7HB 3MYZA 5LVEA 3GZOA 2EO7A 5EDSA 1VZHA 2NSXA 4YEEA 2BCMA 5F9OH 1H6EA 4JDEA 3BT2L 1CJYA 1N8ZA 1VGEL 3QWQB 4I3GA 1FSKC 4YBLC 1UZ8A 4ZOBA 2AXJA 5F7HA 2DL9A 5KS9A 1OF2B 3W0WE 4BK5C 1CGVA 2E74C 2WBKA 3EO0B 4ZMAT 5J12B 1E0OB 2B16A 4HMDA 1F45A 2I25N 4R3SA 1MCCA 2UYLB 5EB9A 1X9UA 2WSKA 1HHKB 4JDZB 5KVMC 3WIHH 1BPLB 3SDCA 3ESMA 3V0WL 3BFQG 3CHPA 1IM3A 3AMKA 4XZ4A 2H26B 1YECL 2X9ZA 5D4HA 2ADJB 1CK0L 4ZMNA 4PJHB 4XN9A 4N2MA 3DUSA 3CMOH 3T08A 3VMPA 1EEYB 2NT0A 1HXYB 3J27A 3HZ3A 1CFQA 4HIHB 4QTHA 5I6MA 5C8JA 1CUOA 2ZQKA 4P9MH 4J2QA 1DVYA 1ZGLP 1OT1A 3NJFA 1MFBL 1C7TA 3M46A 4ZXBD 2R23B 1AIFB 3IRZA 4JFWA 4GXVH 5HHPA 4R9HA 3HS0B 2FWSA 3ECQA 3H56A 3VG0L 2IBBA 4IHBA 5C0IB 3O0LA 5E70A 5F6HJ 1MCEA 3VFVA 2J88H 3VJ6B 4YK4B 1JZ4A 3CMGA 4WTZA 2IGFL 4HZ1A 4OCRL 4KKZA 1OHZA 1HH9A 2CGRL 3IS0X 5I9QC 3F58H 1FNGB 3NSJA 2VDRB 4YHLL 3AW5A 1S7WA 4MA1B 3D69B 2FK9A 4Y5XC 5E8EA 3VXNB 1CT8A 2VUKA 4NKQB 4PBWD 4PG2A 4AIZB 2NR6D 4DP6X 4HS8L 3EGXA 3Q0HA 1UACL 4IHOA 2YUZA 2DM4A 2JELH 5T33H 4NZJA 4O51A 5KVFH 3AGWA 4IGBC 4NKIH 1T1XA 1KCRH 4W93A 1MQ8A 1KIQA 1VESA 4LL1A 5HHVL 4EN3C 2EYSB 3O2WL 5JO5A 4WWKC 1R0AH 3PDGA 1LTXA 4F33B 3TF4A 1D5BB 2AV7A 3LRGA 2CJSA 1B9KA 1U8OB 3BW9A 2X4PA 4W1TA 4WUUD 1A7PH 3C6SA 3GZKA 3OMIB 3S0PA 2C7UA 3QVAA 4OCXL 4X2UA 5HYQA 5I66B 2NZIA 4N20A 4HGKC 1N9PA 3WI9A 5DRNA 5I1GL 2AI0L 4OF3A 3GQFA 3VXQB 5EIIG 4B97A 3H3KA 1OO2A 2H5UA 3H9SE 3L2MA 1ECZA 2BSBA 3T0XA 4E41B 3ZKQD 3QZNA 1SF5A 4ZNEE 4P4KA 1FJ1A 3VFUB 4JFOB 3S35H 1PVHA 1RVFL 3D39A 5D1QB 1K4DA 1KXVC 4WKZA 3CXDL 2MCPH 3SY0B 2IDTA 3S3BB 5IB1B 4JRXE 3B9KB 2E46A 4R4ND 1UKQA 3LKNA 4P3DA 3RAJH 5DC4B 3KPSB 1CDCA 2TSAA 4G6MH 4LLDA 4RQQA 2QQLH 1KTLB 4ZNEA 1QSVA 3MOAL 1OGAB 1DQQB 4FXTA 5E9DA 4D0CB 2IPKB 3IRPX 1WISA 1NCDL 4HEMA 5EIIB 1Q72L 1CK0H 3SYAA 4HIEA 1JXDA 1CFBA 1NCHA 4NN6B 3D0LA 4PS7A 4XP9L 2PW1A 1Q9LA 1XF3B 3FK3A 4OFYD 4YXKL 4BKLA 1D7FA 3IJ9A 2QQKH 1WZKA 1LDSA 4A7VA 5C0JA 5IMLB 5L7XH 4MYPA 3F7VB 2ZCZA 4FXLA 1RURH 3RDTB 3PYCA 3OL2A 1MVUB 4XN7A 3L2LA 3RZCB 1M71A 5LLIC 4ODWA 8FABA 4MMXC 2DWEB 2HT2D 5E6IA 4EI5A 1I3UA 2XY2A 1TCRB 1OL0A 4Z7WE 3H53A 5DJDA 5E7BA 3V2AR 1SJEA 4QYOA 3BQUC 3SQBA 5DD0H 1FGVL 2QQNL 3V9CA 4OV6F 1YYLH 5K33A 1R5IB 4ZW6A 1XBRA 2FL5A 4DH2A 5IT2L 1FAIL 1JVOA 4EZMA 2FZ3A 3FT2B 1XT5A 3IETA 5HGBA 1I1FB 1JPGA 1QR1A 3STLB 1CDYA 2I69A 5HJ3A 2HG5A 3A4FA 4M29A 4DKAA 4L1TA 4A7SA 1PDKB 4I3RL 5K1NA 4N2BA 4PLKD 4F33A 4GP4B 1WZLA 2CCLA 2ZOLB 5DD3L 3CXHJ 3MSPA 1RSYA 1ZS8A 2OW7A 4OLUL 3MLSH 2VE6B 5LCVH 2DKUA 3X1NA 4XNYL 5HYJD 1IAMA 4GIOA 1OY3B 2F1EA 3CNKA 1AFVH 2B20A 3N1PC 3BWAA 1ND0A 1TQBC 2YUXA 1UM4H 4Y4FA 1SM3H 5CBAB 1EMTH 2W5PA 2YS4A 4M43L 2BVQA 4JNXA 1JZ8A 5H35A 1KN2H 2HRLA 5EUOE 1C16A 2DYPB 2R29A 4CU7A 3DSNA 1PIGA 3KYKL 4Q14A 3AG3B 4PJXA 1MKFA 4HOMA 1J10A 3KYNA 2GCYB 3T65B 4J3WA 2QPSA 3KH4A 1UWEL 1E28B 3MA9L 4IGBD 3X17A 2B8OT 4R7VA 3DYOA 4MB5A 2DQFA 4XODA 1O7DE 2F54E 5TDNB 3SE9H 2SEBB 3NCBB 1I31A 2Y23A 3D33A 3DOIA 4XGZB 4IBSA 1OP3H 1OSZA 2GJ6D 4XXCC 2ITDA 2OCJA 2IF7A 2XQYK 1F41A 1I9JL 2WINB 3ULUD 4W9JC 4PQXA 3CC5B 3TOPA 2DLFH 2IFFL 3UTTD 3QCUL 2WJ7A 4K7PL 1MJUH 5HI4C 2OS7A 2YXWA 3TCXA 5AG8A 3FZUD 3P4MB 1LP9B 3BVDB 1RFDL 1ZJAA 2XTSA 1KTDA 2B5IC 4Z7UF 3ZKXB 2Q87A 4LSTL 2XN9D 4O02B 5LDUA 4XVSL 5DHYA 5DZNA 2Y1AA 1DVFD 4NQCA 2VWEC 3MKGA 5D9SA 5J12C 1DDHA 3C75A 2J1YA 1BBJB 3SOTA 3MGTB 2YWYA 4LSVH 2PTUA 5ALCL 1QACA 1T1YA 4Q9CA 1CD1B 4HMEA 2N3JA 4HAKA 4BUHA 1BEYH 1ADQA 2FX7L 2LW3A 5E1IA 5T1KB 3KPSE 3SBWC 2F58L 1VADA 3KS0J 3RIAK 3P73B 3O3UN 2XA8L 4B27A 1DVZA 4H8VA 1CDUA 3KVPA 2XXMB 3O0RL 1RJZB 4TSBH 2EEDA 4GAFB 1PYWA 4WW2B 5EHFA 3N1QC 4A2DA 4DK3A 3VGAB 2X7LB 4QRQA 4DP9X 1A6AB 1UXWB 2OJZL 4JO4H 2Q7YB 4BZYA 3FT2A 5T3XH 3COOA 4M61A 3RDTA 1KTKE 2CJUH 4M5YL 1NMCC 3B9VA 3ZTNL 4RBPH 4PRIA 1HJBC 4RIRA 4XNZC 4POZD 1JV5A 4Z3IA 4ZTEA 2FHFA 2XUWA 3LN4A 3L3JB 4NJAL 2AKRA 3P77A 4H13C 4JKNA 4KGLA 5EN2B 1OSEA 2Q7AA 1G7PB 4E9WA 2FJHA 1IARB 1ZKAA 4HUCA 1RL1A 5DJDB 1QTPA 4PJ6A 2ICEC 2NMSA 2OXHA 3ZTJG 4FQIH 4J28A 2CXGA 4PP1C 1CDBA 2ROXA 3FB8A 3CX5J 3MRCB 4MSWA 3TJEL 1S9KC 4MVBC 2BNUB 4HDIB 2HX7A 3ZT5A 4LCIL 2VLJE 4G8GE 2CNYA 1BECA 5DJ8B 1YZZA 2MQ0A 1FDLL 4FNQA 2R1XB 3G5YA 2CJUL 4M5YH 1NUGA 5J13B 2PWFA 5KTEL 1XCQB 3KEDA 3FTUA 1E5UI 1XL4A 4HEPG 1PL3A 2X5PA 1RJLA 1UA3A 1YEFL 3ARBA 1EZLA 2XBDA 3BQUB 4PJXB 4QKTA 3WTVA 2Q3AA 1EFXB 5JPMB 4U3XA 2Z0BA 1U93A 3DX8B 4E0RA 1A65A 1F18A 4J1UB 4RDQG 5DQ9A 3P3UA 2Z4QB 4AVJA 3P30H 4WEBL 5CILL 3ABKB 4LSVL 1XF1A 2QPFA 2IBZX 2AW2A 4E9XA 5DUPH 3IJHA 2JXMB 1F97A 2K8QA 1NC2A 4X6BB 1CU4H 4QRUA 2KPWA 4LSQH 5AW6B 3MRDB 4ZOEA 5JOFB 1DBJL 1DCEA 4KHTH 3V6OC 4URKA 2ZXBA 1UVQB 2DLFL 2EC8A 2ESVE 1XH2A 2FATH 2IFFH 3IN2A 3IM1A 3LH2L 5EG6C 1TJMA 3SQOH 3T8XA 1PKQE 3UDWC 3ZRCC 4BGLA 4YSSA 1B0RB 1OAZL 4J6IA 1I4FB 4ONFL 3EH4B 2X4RB 3ZDXF 4M7LT 3C5SA 1WUNT 4FL4C 3AT9A 1ZGLA 2OW6A 1GOFA 3CSGA 2W9DH 4JFPB 5FA3B 1FLTX 4U1LB 3P69A 4B3VA 1AY1H 2MSPA 2DQJH 5BO1H 1AQMA 3GI9H 1EDYA 3VAEA 2EIEA 3GJFK 3JT2A 2BNRB 4G6AC 2AQ1A 4MS6A 4WGWB 3P4OB 4HPYH 3ZDZE 3NJJA 1DBML 1E6JL 3EJCA 4AYID 1DBAH 1F4HA 1H8SA 3D85B 4JVPA 1YAZA 1ACCA 1UD8A 2O5YL 3WNOA 2X6BA 5E00B 4K9EC 4XX1E 3OGCA 5FFGA 4ODVH 5EZJB 3NTCH 4JO8A 1RP8A 5I1KH 5F1IA 5EO0B 1PSKH 5GS2D 3MXWL 1RIHL 3OJDB 4BWWA 2PPDA 3VGGA 1BQHG 5DD3H 3TA3A 3FQXA 1A6TA 2Y06L 3OR7A 1JGUH 1G4RA 1U8PB 3LMJH 4X4XA 3RVUC 3FQNB 1IBFA 1HT6A 2KQMA 1PG7H 1I1AC 1XF4A 1QQDB 3QUYA 1I8IB 3ZT6A 2NZ1A 4PIRF 2BVOA 1UKSA 1H8LA 5AVSB 1G9NH 1KXTB 3GBLA 3WD5H 1CPUA 4D0DB 4MRBA 3VWKA 3AWGA 1GVIA 1BA9A 2D7PA 2CK0H 3DTXB 5SWSE 1FZJB 4MQTB 1RAMA 3WFEL 2VQ1B 2CRZA 4MAYB 2V9RA 3M17B 1WA2X 3PLYA 4GSQA 4HJ1A 4X6CA 3QDAA 1BQHB 1EBAA 4TQEH 1OTUD 2R4RH 1NBZB 2YR3A 1F3JB 1ZT1B 2FJSA 1BV8A 5ILTH 3LKSA 5AZUA 2DMHA 3MRJB 1NEZA 3IGLA 2P1YA 2Y5EA 3O4OC 5HI5D 3F12B 3PWNA 5KYUA 2XICA 1XAKA 2F5BL 3BN9C 2XN9B 2AEIT 4Y2NA 1N18A 1F4YL 2Y1ZA 4AGMA 5JQ6H 1OANA 4JX0A 2VRQA 4QTIH 5BOJA 2VAAA 4AQ8C 4XN4A 1NBCA 3QXAA 5BO0D 4GMSH 1N6UA 1T0NA 1AP2B 3OF6A 3QO1A 4NKMB 4ZFZB 1GKOA 1CDIA 2P5EB 1Q72H 3T6QC 3G5ZA 2MEJB 4L4VA 3RE0A 1MCOH 1F86A 3EH2A 1JFHA 4U1IB 1U30A 3BO8A 1MRCL 4EBQL 3C6LD 1DQLL 3IAGC 5MEPB 5C8JB 1YEHL 1HL4A 3MRPA 3FS9A 2Y9RT 3WO4B 1KCSH 5I73C 3GWJA 5JHDE 1VHPA 3H85A 3BVUA 2MCPL 2OMZB 4P57B 1OCZB 4JRWA 1VFAB 1Q9KB 3LSOB 1JWMA 4P4KD 1G7LB 3ZSSA 3LKOB 3B1TA 1S7SB 3CVDA 3CQPA 2ZX9A 2A74C 1OARL 4YEFA 4JFXA 3O6KL 2NXYD 2R0ZH 3FTXA 4UDUA 4KFMA 1WITA 1G9MC 4N6RB 5T1LD 4POZC 2YAQA 3MHZA 5EF3A 5EZJA 4H26A 5I24A 1YEIH 1KTBA 1F1GA 3B4NA 1RULL 3BUYB 1P7QB 3REVB 2QLVB 2HVBA 3MBXH 4LHUD 3GIZH 3FT3A 1P1ZB 5HDRA 3PWJB 4TM9A 5IROC 3E8VA 4JE4B 5EZOH 2XWXA 1KIRA 4HBCH 1V3KA 3T04D 4Y9CA 3V95A 1SN2A 3MMEB 3MV7A 1E9OA 2DLGA 2DM3A 3L9EA 3NJGA 4CVXA 4UQCA 3SPVB 3APFA 3NP4A 2CDGA 5EORH 1VSCA 1LILA 5L88H 3G6AA 3HAEG 4PGDA 3UZEA 3K2UL 3UZVB 1KY6A 4PJ8A 2WSPA 1KJ2H 2GIXA 4MX7A 4XNXH 3L95B 4F58L 5E9DB 5FYLL 1J8KA 3ULUC 4LEXH 4LU5L 1ASQA 2IDQA 3MJ8B 2WXQA 2IGFH 2J2ZA 2MQGA 4FI6A 4U6XB 2VABA 4YBQD 1AG0A 2EIZA 3EFDL 4EI5C 5IBUB 1WVZA 1BYPA 3ATDA 3X14B 4AUJA 3F7KA 3NJKA 3HNTH 5IBLD 3CH8A 5AW4B 2RQ8A 5GJSL 1U8HB 4U4BA 2RR3A 5FF6B 4BCZA 1DN2A 2VAJA 5D2LB 5JQHC 1R5WA 4KK9C 3WGUB 4L37A 1GTNA 2OJEB 4LLWA 1PY4A 4RAVA 3MV8D 1OOAA 2NY0D 3D0VA 2J8UF 3JZYA 2CLRA 3BH9A 1EVTC 4AI7A 3WO3B 4I89A 2Z6FA 5DUJA 5F7EH 3EDEA 3GMMA 4P5MA 2Z92B 3T71A 1S46A 3BUQA 2CRYA 3QPQC 7FABL 2ZKXA 4UI2A 3L08A 2NTFB 4G8FA 2QSQA 3IJSA 2HG0A 2JIXA 2FAUA 4QR7A 3SQBB 4ZFGL 4BFJA 3WIHL 4IOSA 4NQVA 1DFXA 3FSVA 4PW3A 2EH7L 3FN0L 1J9QA 4JB9H 1E5CA 3GRWL 1NCOA 3IF1A 4G11A 3H9SD 4D7PA 2VC2L 4YVUA 3T3PF 2ZP0T 2GTWA 1KENL 5CIPB 2GFBA 2R0LH 3QEQE 3W81A 2PR4H 4AKOA 4JQXA 1TMCB 3BT2H 2EDRA 3CZGA 3ZHKA 5F9OL 3AREA 4D9LH 1LE9B 4FI8A 1B3IA 2EZ0C 3Q44A 4MB3A 4PJ7F 5LN4A 3K6IA 3QI9B 2NNAB 3CLWA 4ANVA 4DKDC 3RX7A 4HD5A 1HYSC 3AS2A 5JHLL 2A0LD 2YMOA 2OMYB 2ZYRA 1PF3A 4I85A 1BF8A 4GXFA 4XO8A 4FNTA 2EDNA 2F0CA 3DMMC 3IPBA 1L9RA 4L4TB 5F88A 3HZVA 1DEEB 1RZGB 3SDAB 3NH7L 3CLEL 3QQ4A 3SE3A 4FFYA 3P4NB 1OB1A 4OZFA 3Q05A 1JZ2A 5D71L 2YSTA 4BHUA 3PV7A 3QRGL 5I1JL 3I74A 5I16A 4RMVA 4KNUA 4DP1X 2Z0UA 1EEZB 1Q0YH 2OR9L 4MXWH 1CB4A 1B0WA 1NANH 4F80A 3QH3B 3BIKB 5B7EA 4U3HA 1TOXA 2VO8A 1S5IL 5KSAA 5CM1A 2J2ZB 1DFBL 5JIKA 5K59E 3FSZA 4XNQA 3JYBA 5DJYB 4BHUI 4KKCD 3KYMB 3RKDC 3WN5C 1BXAA 2J57A 3V55A 3TBVB 3B7UX 5I71C 2BY2A 2MNWA 4UILH 2Q10A 3KBFA 1JSYA 1UWXH 3UTQB 2QADC 4K8RC 4TNEA 5DFWH 1OAUH 5KVFE 1MWAB 1E9OB 3D08A 5AW3B 1A8JH 3BAIA 3BMWA 5F7FA 3HPJA 4LASL 4KRNA 1ZE3C 4RISH 5DD5L 3W0WB 3LYRA 5CBEB 4ILDA 3KCWA 3ULVC 5BUAA 3LPPA 3CHOA 3OKEB 2YXFA 3BZFA 4KKAD 5KYYB 1M4KA 2PCPB 3MJ9L 3EJQA 4D9RE 3KR3L 2HAZA 3C6LB 1KT2A 2F53A 2J8HA 3TV3H 5BQ7B 4FQHB 5JW4Q 4PJFE 4OLYH 3WMSA 4NUQA 3ZMRA 3WNNA 3RGVB 1N4XH 5M7QA 2VZ1A 3GJFB 1A1NA 1D6EB 4JFZL 3TVMD 1BREA 3LRMA 3HIZA 1ZTXH 1MQKH 2CDFB 4XB3A 3PDOA 4MXQC 3E2HB 3A0OA 1JV5B 3NA4A 4NJ9H 1IT9L 1HS6A 1L9TA 3H42L 3AWEA 4F2MB 1QLRA 2VKWA 2DEXX 3V4UH 1WAAE 5FW8A 1ETA1 5CF3A 3FTYA 1AZCA 3MDJA 3PWPB