5TK2A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
KVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome B
publication title Crystal Structure of Uncharacterized Cupredoxin-like domain protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. ames
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk2A00
1PF3A 4E9VA 2XYBA 2GC4C 4W9ZA 2YQBA 3X1GA 2PPCA 5LDUA 2FWLB 2XWZA 3HEIB 3CDZA 1TEGA 2IWKA 3EH5B 3S8GB 4YVNA 1JVOA 1T5KA 3FSWA 1J9TA 4GP5B 4E9TA 1PZCA 1PLBA 3TBCA 3TU6A 4MFHA 5B1AB 4DP4X 5A7EA 3EH3B 3QJSB 2BZ7A 4NERA 1HFUA 2FQDA 2QDVA 2YAFA 1SHWA 2HX8A 3FU9A 4A66A 4E9XA 1TU2A 4P5SA 1JZEA 4PCYA 3DTUB 3NJJA 5FC9A 2PP9A 1ZIBA 4YVUA 4BXVA 1W8EA 4BDVA 4G7QB 1JXFA 4E9YA 1AZUA 4DPAX 3JTBA 4ZK8A 2BO0A 2VW7A 1AZRA 2YAEA 2BP0A 2HRHA 2PP8A 4KO9A 1BQRA 3TASA 4E9RA 3ABKB 1L9SA 3QJUB 3T6ZA 2UXFA 3H56A 3TA4D 4A2GA 1BQ5A 1BXUA 1NIBA 2B3IA 2YAQA 2CJ3A 5I6NA 3T9WA 4BWWA 5I6LA 4F2EA 2FNWA 3N2JA 2XU9A 4YSOA 3TBBA 2PPDA 3T6WA 1NZRA 2VM3A 3S8FB 3NJLA 2YARA 3ZBMA 3AG2B 3N55A 5AKRA 1N70A 1GY1A 1M56B 2XUWA 3S3DB 2A3TA 4M4RB 3ZDWA 4E9SA 1PZBA 5TK2A 1CYXA 5PCYA 4WKXA 5I5MA 2XLLA 2VW4A 2OV0A 2EILB 1V55B 4HZ1A 3FSZA 2H3XC 4A2DA 3WG7B 1L9PA 2IDSA 3C75A 5B1BB 5EHFA 1X9RA 2FT7A 1SJMA 2I7SA 2NRDA 1KCWA 1ID2A 1UATA 4A68A 3NSCA 1FFTB 2JKWA 4DP2X 2H47C 4QLWA 1X9UA 5I5IA 1PY0A 2IWEA 3EF4A 1M57B 2TSAA 1ASQA 1SF5A 2W8CA 4JHUA 1E5ZA 4QKTA 2YXWA 4A2FA 1BQKA 4PAZA 2FQGA 1AG6A 1OE2A 1IBZA 1TKWA 4AKQA 1XB6A 3FQ1A 3AZUA 1HAUA 1I53A 1ZV2A 2VM4A 4WTQA 1PLCA 4DP0X 2XX1A 2J55A 5I5JA 4GY4A 1CUOA 1NDTA 3AG1B 1JERA 3IN2A 4EF3A 4HAKA 4W1TA 1OCZB 4HALA 4KNUA 3ASNB 3PCYA 1J9QA 1ET7A 1JXGA 3PLYA 1KBVA 4HHWA 1PLAA 1PZAA 3QPKA 2HXAA 3FT0A 1DZ0A 1A65A 1FA4A 1NICA 1AS7A 1XB8A 1PMYA 3FU7B 1KV7A 1J9SA 1SHXA 1SFDA 1SNRA 3HB3B 4NB7A 1BXAA 3RYMA 1JVLA 2HX7A 4Q8BA 4UANA 4A67A 4N8UA 2ZONA 2OCCB 5I6OA 4GP8B 3OM3B 3EHBB 3QJVB 2IH9A 4GP4B 3X1BA 1CC3A 2CAKA 1GS8A 1MDAA 1NPJA 2EIKB 2YAPA 4AZUA 3NJNA 1OE1A 2Q5BA 2HX9A 2CALA 3D12B 3NP4A 2BW5A 2VSMB 2HRGA 3G5WA 1OV8A 2YAOA 1PCSA 3NJKA 2X87A 4KNSA 2XX0A 3FQ2A 3PAZA 3QJRB 1ASOA 1AS8A 1KGYE 2VMJA 1AQ8A 2BW4A 4JKNA 2H5UA 3NT0A 5AFAA 7PCYA 4HIPA 3SBQA 2QDWA 1E65A 3QJQB 1WAEA 1KYAA 2VW6A 2IH8A 1AZNA 1CURA 1JZHA 2ZOOA 1IC0A 2P80A 1OCOB 2XXGA 1TEFA 2PPEA 2XVBA 3NYKA 3NJIA 1AR1B 3CVDA 1F56A 2W88A 1AS6A 2JXMA 3S3CB 4G72B 2B08A 3DKHA 3IN0A 2BZCA 2GHZA 4TXVB 1KDJA 3NJMA 3SQRA 3CVCA 3PAUA 3WIAA 5I6MA 2I7OA 4M3HA 1L9OA 1OCRB 1XB3A 4G7SB 2P80D 2R7EB 2FT8A 2GI0A 5AZUA 3X1NA 1WA2X 2DWTA 1SDDB 3ABMB 1GYCA 4NAJA 3ERXA 4DP7X 2BP8B 5ANHA 3WKQA 3BVDB 1AG0A 4YSUA 1GY2A 2BWDA 1NINA 5I6PA 4GYBA 3T6XA 3X2QB 3CG8A 1VLXA 2OJ1A 1QLEB 5B1JA 5B3SB 4F2FA 4G71B 4DP8X 1GW0A 3GYRA 2DYRB 3KW7A 2LLNA 1MZZA 1RZPA 4YSAA 1BXVA 3CZUB 4KNTA 3AY2A 2AZAA 5I26A 6PAZA 2PPFA 1ZIAA 4YSPA 1RCYA 1IUZA 1V10A 1YLBB 2UXVA 3OMIB 3X1EA 5TK4A 2IWFA 4A2HA 5B7MA 1GSKA 2PCFA 3X1FA 1BYPA 2ZWNA 2YXVA 5E9NA 1XMEB 3KW8A 4YSSA 3PPSA 3CDZB 2GIMA 1WA1X 2UXTA 4G70B 1WA0X 3OMNB 2N0MA 3SBPA 4BWUA 4UF7C 4YSDA 1V54B 1IBYA 2XV2A 3T6VA 4E9WA 5B7FA 3U25A 4K9JA 2CCWA 2IAAC 3UAEA 3FSAA 1PNCA 3SBRA 2EIJB 3EH4B 3UAAA 2IDFA 2EINB 2GSMB 4KO6A 2FQFA 4P5RA 2E86A 2VN3A 2IDTA 3FPYA 2XXFA 1NTDA 2PP7A 1A3ZA 7PAZA 1N68A 1E5YA 1RKRA 2YAMA 4GXFA 4FAAB 4YSCA 1OOWA 3H4HA 5B1JC 4BDVB 4F7KA 3FYEB 5I28A 1WS8A 3S3BB 1ET8A 4YSRA 8PAZA 4N4YB 2BP0B 1ZDSA 3NJGA 3QJTB 3FQYA 4DP6X 2UX7A 4E9QA 4YSQA 2FT6A 2WO3B 1KCBA 1A8ZA 1HAWA 3L45A 1JXDA 4DP1X 1PAZA 1J5CA 2PCYA 4RH4A 3T71A 3NSYA 2IDQA 3QQXA 1ZDQA 1MG3C 1ILSA 5D4HA 3AG3B 4KO5A 1AAJA 3UGEA 1JZJA 1KDIA 4AX3A 1KBWA 1JZGA 3NJHA 4A2EA 4AKOA 4YSEA 3BQVA 1JZFA 4HCFA 1NIAA 2RACA 2I85A 1JZIA 3MX0B 5PAZA 2XV3A 3GDCA 1AOZA 2QPDB 4DPCX 4BXSV 4HCGA 1E67A 3OMAB 5B1KA 1NPNA 5F7AA 2GBAA 1A4BA 2EIMB 2Y69B 1W6LA 1CYWA 1MG2C 1ASPA 3ABLB 1DYZA 2BWIA 2CBPA 3NSFA 3IEAA 2JFCA 3ASOB 4KOBA 3FU7A 2DY2A 2ZXWB 5B7EA 1QHQA 5IY5B 5D4JA 4KOCA 3WI9A 1ET5A 3FPXA 2IDUA 5D4IA 1SF3A 1GS6X 2FJSA 4ENZA 3AW5A 2FTAA 1AANA 1WS7A 3UABA 3NSDA 4JHVA 4X4KA 1ZPUA 2TSBA 1EZLA 1PNDA 4Q89A 3JT2A 3FS9A 4L0PB 2HZHA 3MBWB 1QNIA 1JOIA 2J56A 3NJFA 1NWPA 3PXLA 4DP5X 1J9RA 1W6WA 3WNJA 1BEXA 1AZBA 1IKOP 1NIDA 5I6KA 4YSTA 4HHGA 3PAVA 1GR7A 1L9TA 1ILUA 9PCYA 2VSKB 1B3IA 1URIA 1J5DA 2BHFA 4YL4A 3WKPA 2DWSA 2WO2B 2UX6A 1BAWA 2J57A 3ZIYA 2DYSB 3AG4B 3NP3A 3ZX1A 4DPBX 1GS7A 2YAHA 4AKPA 1AIZA 1ETJA 2Y1AA 2Q9OA 1L9RA 3IE9A 3UACA 4BK5C 4UAHA 1AACA 2AZUA 2GC7C 4FA7B 1MZYA 1EHKB 3FU8A 4DP9X 1E30A 1NIFA 3GXUB 3V9CA 2GB2A 2AFNA 1OE3A 2AVFA 3DIVA 2FQEA 1NWOA 4CSPA 1OCCB 2R7EA 1RZQA 2AANA 5F7BA 3V9EA 1ADWA 4CSZA 1SDDA 1NIEA 2QPEB 2BP8A 2X88A 3ABGA 3FYIB 3OD3A 2PLTA 1AZCA 2DV6A 1R1CA 3FSVA 2J5WA 4AI7A 2MTAA 1A4CA 2PPAA 2HLEB 2UXGA 3CVBA 1BYOA 2CUAA 6PCYA 3WNIA 2WSDA 3OQRA 2XV0A 1A4AA 1FWXA 4BWTA 1M9WA 4G7RB 2QT6A 3H4FA 1L9QA 1OF0A 3IBOA 3UADA 4KO7A 1SFHA 4HCIA 2MRYA
chains in the Genus database with same CATH superfamily
1A64A 1CF1A 3VG9B 4JFZH 1HEHC 3KMDA 2JXMB 1G6RB 1S7XA 1JPTH 1PDKA 1DJYA 1L7IL 4JFDD 1U2CA 32C2B 3QARA 2C9VA 3EYSL 4OZHF 3GI9L 4FL4B 1CVSC 3RVXD 3WV0A 2AEOA 4BH7B 2NXZB 5C6WH 1JVOA 1T5KA 1EWHA 2XBTA 1PZCA 1KCRL 1ZRUA 5T5FA 3L3KA 2DEXX 4JPKH 5AAMC 4PMEA 5KVFL 2EICA 4HK3J 3LQAH 4U1IB 4X7EC 3V4VH 1E7UA 5MENE 2JB6B 1IGTA 1SXCA 2J2ZA 3BDYL 4M62L 4XB3A 4J39A 3ROLB 3WHXA 5C70A 2CIKB 4GT7A 1C5BL 4P3WA 5K39B 1JZEA 4TSAL 1J0IA 2QVFB 3CZKA 1P53A 4HT1H 4YPGB 5DHVH 1CFVL 3IFLH 4NPJA 2EC9U 3GMLB 4AT6A 5C0CA 3C8DA 4JFHE 1MWOA 4C4KT 4GXUM 1MCBA 1WSST 1JFQL 4PTTB 1UXWA 3H2QA 4NPKA 3QO1A 5J57B 5C97A 5MI0B 5D5MF 4UQ9A 1T7YA 4EI5B 1IGYA 4KK6C 4UM9D 4E9RA 5C0JB 1EERB 1F3DH 3T3PF 3ZKND 4OLXH 2FEDC 1X5AA 2PTTB 4PWIA 3O2DA 1PLGH 5C86A 5JOEA 3TH2T 4NQCE 1EQWA 1MWAB 3QH3A 4TLTA 3A6CH 1WT5C 5E0FA 4UIKL 3DVGA 2PYEB 3L3HB 4XNQB 3WS6C 2G9KA 2HP4A 2B1HH 5E2UH 3KCWA 3T08A 1G5AA 4UWQB 4IGBA 4ZUWB 1CGUA 1FCGA 4PJXB 1O75A 3MOBH 5JNYA 1T04A 1JSYA 5E00B 4NENB 1GIGH 5BRZA 3IKCA 2B14A 4FXGA 2XUWA 4YE4H 5JW4R 1QQDB 2VR9A 5GRXG 1OAXH 2N01B 3MX0A 2KKQA 1FJ1B 2X2UA 1U58B 5TK2A 4KROC 3JWDH 5HGAB 1RZJH 3WCYA 1GH7A 1U95A 3GXFA 4PJGE 4XVOA 1UB6A 3ES6B 4WNSA 1JNLL 4RBPK 5AWNL 3LQZB 2CBQA 1YY9D 5T3XL 4QHMB 1XSOA 2EABA 4HF5L 5H37G 3TT1H 2J72A 1ACCA 3KGRA 5TH2A 4YS4A 4FQLL 1D5BA 3QFDA 2CM6A 3O9WC 4A2MA 1HL9A 1I9IH 1XSJA 2YEQA 3SDAD 1KIPA 5I1DB 2K3HA 3LDBB 5LN4A 3U0WH 5C9JB 4F8QA 2Y06L 3QK0A 1UWEH 2F5AH 3OWRA 2WN3A 3KPLB 1IAIH 2IWEA 3MLTA 1W16A 4KQ4H 5DD3L 3VFRB 2DKUA 2YBRA 3ZE0E 1MCPH 1U8IA 1BMWA 3BW9B 3JV6A 4DGIH 1IZKA 1AG6A 1R6VA 4KTEL 4NIKB 1P9MC 2QSQA 4LLDA 3U1QA 5D7KD 4GQQA 4HK0B 2RGSA 3BLPX 4JHWL 4JFFB 5F3HA 3VG9C 1HTYA 1LWHA 1OM9A 2RCSL 2NUPB 4WTQA 4X8XA 5E1IA 3TIEB 3VXQA 1WF5A 4X7SL 3B2XA 3SQBA 4OT1L 1RULH 3OJDA 5T1KD 4J6RL 4DK5A 5I24A 4EI5C 1AO7D 3EO9H 5CINL 3MA7B 3BISA 2O30A 2XWBA 5GS1B 3ZQ9A 3IBEA 1KTRL 1WQVT 5I18H 1AJ7L 1OSPL 2C1PA 2V5YA 2ZKYA 2J43A 4WI9A 3HBQA 3FB8A 1J9QA 3DGGB 4DAGH 2NW2A 3ZMNA 1AQDB 4N8CH 2EJ1A 2GK2A 1AGBB 1MCOH 5IGXL 2GVYA 2VDMB 4E42A 1ZKAA 2FECI 4N90E 1PY4A 2WAHA 2ENYA 3H9SE 3WS6A 3ORJA 2BS9A 1TETL 2XQBL 1C1EL 3UYPB 4LSRL 2O1AA 3BE1L 4NC1E 1MRCH 5AW6B 1J86A 5KUMA 1JVLA 1M7IB 3V9FA 1JZ3A 4TKWA 5FXCH 4KHXH 3LS4H 3NN8A 1BF8A 1UHVA 4PJIB 1F4XL 2PETA 4HV8A 4JO4H 1G7PB 3KXFA 3VI4F 3ZDZB 4POYA 1D9KC 4NZFA 4TUKH 4YLCA 4GP8B 4U1NB 4YDMA 1A14L 1ZD6A 2D7NA 1HSBB 2AV1A 2Y5QA 1CC3A 5A6IA 3O8XB 1XGPA 2P43B 1MIEH 2K4WA 4TS6A 3LKNB 2CIIB 3GSVB 1Z9LA 1YEKL 2XXCB 3MODH 4LEXH 4KJYB 4HFUL 4FXKB 3T2NH 1Z66A 2DLGA 4DQOL 3VMOA 2Z7WA 4XBGA 1A4JA 1OV8A 3OSVA 3BQUA 3I6SA 3T2QA 3HLKA 2CLVA 3H7BA 4P46D 2Y2TA 4KFMA 4X4ME 2WNKA 5IK3B 3FONA 5CCKH 3G6JA 1ASOA 3QS2A 1KIQA 4NO0D 5H37H 1Q8MA 1YY8B 1BF2A 1D7FA 4OLYH 1U36A 4P3DB 4Y89A 4E5XB 4AJVA 3PHOA 4HOZA 1E6JL 4EZLA 1QI3A 1WCBB 2UV3A 2CRZA 2XXGA 1P6AB 1P9MA 1QRNB 1S78D 2AI0L 4JKMA 3O6LL 4H88H 4N0UE 1E42A 1GGIL 3UJJH 3WD5L 3GPSA 5AYUL 3T8XB 1F56A 3V4VB 3WHE1 5HVGB 3L6FB 2JXMA 1G6RA 4LDCA 5JPNB 5DFAA 5FGSA 3ZYJA 1A7BA 4UT6H 5IFHL 4LZKA 32C2A 2B15A 3IJ7A 4EI5A 4I7ZC 4FCHA 4R2GC 2GPZA 4BH7A 1ZEAL 2AP2A 3RVWD 2YC1B 4DGVH 3SQRA 3LB6D 2RHEA 2APXA 1AHWB 2XPGB 3FB6B 3LDBC 4BUQA 4M3HA 1XB3A 3VD2A 3QPXL 1IC7L 4U1IA 2VDOL 4JG1H 1R46A 3CFNA 2JB6A 5D6DC 4LOEA 1P1ZB 4AYGA 5ANHA 3DURB 1BDYA 1HNYA 4JQVA 3ROLA 2BNQD 2CIKA 5K39A 2A7BA 4HIEB 2QBWA 4MYWB 5TDNB 1BHGA 5FUZL 3EOAB 5B1JA 4GQZA 5B3SB 4YPGA 2ITFA 3GMLA 1HIML 5KYUB 3LPOA 4PTTA 1HWGB 3NA9H 2R0ZH 5GS1C 4F7TB 3INUL 1MCKA 2ERJB 4IBSA 5C0JA 2JH2A 5T1DH 4QNPF 5CJOL 4C54A 2PTTA 1RCYA 3QHFL 2BJMH 3EDKA 1PFOA 4N0YH 4R7XA 1MWAA 1QFWL 2QZQA 3BT2H 2ZG3A 4M8UA 1NEUA 4YDZA 3L3HA 2PYEA 4ALAC 4XNQA 1WWAX 1TTCA 4LBAA 5F9OH 3D7PA 3KW8A 3UGUA 3APCA 1LE9B 2WXOA 1ZLEA 3O2VL 2X28A 4N8VB 4GIOA 4ZUWA 1S7RB 2OMUB 4ONHB 2P48B 3KHQA 3MJ9L 4PJXA 4RZKA 4OIIH 5D7LB 5E00A 4NENA 2QADB 1KB9K 5J11B 3U25A 4XTRD 1CLYL 3ZY7A 1QQDA 5HHXL 3FSAA 3NIGF 1U8PB 1FJ1A 2VZ3A 2KZWA 1U58A 2IDFA 1LQBC 5HGAA 2HKAA 4P5RA 3ES6A 3DUSB 3W57A 1IL1B 1RZKH 2PNDA 3AJ7A 5JW3H 3LQZA 5CEZH 3QR0A 4LGRB 4QHMA 4Z77B 4LHUD 4AMWA 4DETA 1RKRA 2EIZB 4GXFA 1Z5LB 2X6AA 4Z0BH 1F00I 2W65B 2VXQA 3EBAA 2WQRA 3MSPA 5I1DA 4FTVD 2EDEA 5C9JA 3G9AB 5IOKA 1PSKL 5JO5B 3K6NA 3KPLA 3RL2B 3H53A 3VFRA 3UBXG 4U7KA 3KWUA 5D6DA 2MNWA 3BW9A 1X5KA 3QDAA 3A24A 3NSYA 3MLVL 1T21B 2ZKXA 2V7HB 4HK0A 5JUEL 5AW8B 3U1PA 4JFFA 5KSAB 3IJHB 4KO5A 3TIEA 2NUPA 2GAZB 1L5GB 4P2CG 3S5YA 1KBWA 5JPNC 1F3DJ 3R0NA 4QXGH 1LK3H 3QW9A 2W92A 3WNPA 2JF1A 2AJUH 3MA7A 5AZ2H 4N2GA 5GS1A 3JVFC 1UZ6E 3X17A 1JWSB 4U1JB 2CHZA 4PRHB 5SWZE 3DGGA 2F53E 2J6EA 1AQDA 5IBTH 3EXJA 5LO7A 3JUZA 1AGBA 2R0LL 5EG6C 5DWPA 5IJKC 2J4WL 3VGEA 5D1ZC 3UYPA 1U3NA 4PWGA 4O2EB 1G7QB 1M7IA 2YN5A 4LVEA 1UM4L 2KERA 4K2UL 2C7FA 2W9EL 3CZSA 5DI8B 2QGBA 2VDLH 4RRPG 4PJIA 4S1QL 2X89D 5AB2A 1IVLA 1G7PA 1RUPL 4KMQA 3CDFA 4U1NA 5L2KD 1FL5B 4CKQA 1HSBA 1EDHA 3ATEA 4WFHD 1XTLA 1CGTA 3PXLA 3RAJL 3O8XA 5DEZA 4C47A 3BIAX 4M7KL 3LKNA 2CIIA 4TULL 3GSVA 3WNJA 1DL7L 1V7NL 1XXFC 2JELH 4KJYA 5ECGA 3FT4B 4A37A 3IDGB 4FXKA 2GJJA 3NAAL 3FW6A 3L5WB 1MREH 3ET9F 4H13C 2BY3A 2QKIB 5J5EA 3SD2A 1OVZA 3U4BH 3AUVA 5IK3A 3O0RL 1T4WA 2C3XA 2QADC 1TO5A 3OHXB 4M29A 4NFBA 4HDIB 1YY8A 3TONA 3VX1A 3VD4A 5DJ6B 2WXQA 3N1GC 1BFSA 3QXAB 2ZCHH 4P3DA 4E5XA 4MJIB 4O58L 3CJJA 4G5ZL 2ZWLT 1WCBA 4XNBA 1KGCD 1QRNA 4N26A 1GZPB 2F7PA 4JG0H 1KBKA 1LDPH 3T8XA 3V4VA 1RQ5A 3L6FA 4RAUB 1KN4L 5JPNA 3F62A 4JY4B 3B9VA 4U1KB 1OGAD 4NO3B 3G7TA 4KK9D 1J8HE 4NFDA 1BZDA 4WTXA 3QJXA 2YC1A 3AU0A 1AHWA 2XPGA 1NWOA 3FB6A 4XX1E 1MH5B 2CU9A 3GHPA 3E8UL 4D0BB 1HHKB 4R7NB 2ZJSH 2APBA 2ARJQ 2AANA 3WEOA 4P5TC 4NQEE 2P9RA 2NY6B 3FCBA 1P1ZA 5I2IB 2AQRA 3DURA 5DUMH 3WMSA 4QXWA 2VLRD 3VFTB 1A7PH 4DJMA 2W1NA 1ZT4B 3H3BC 1ZE3C 3FSVA 4HIEA 4AI7A 5TDNA 4OFIA 3EOAA 1WGOA 2IFFH 2AJZB 2Y0SA 3BWSA 3VDBA 1R5WB 2UY6B 5KYUA 1IU1A 4KI5C 4ZMAT 2BOLA 1IAIM 4I9WD 4W70A 2I9TB 1YNTB 1JDAA 4B5ZA 4D7PA 3FN9A 2QSTA 5GGRY 1QBML 4BJLA 4F7TA 4XWOD 3MCKB 3OQRA 1UJTA 5IHUL 5DK2B 4NQDE 3EYFB 1SFHA 1NM9A 3WO4B 1KJ2H 3FUFA 5EO0B 4GXVL 1GAFH 3S88H 1XT5A 2FX9L 4S1RL 4DKTA 1JRHH 3AS1A 4FQXC 4M6OH 4NM4H 4QRTB 1LE9A 4N8VA 2VDOB 1S7RA 2OMUA 4ONHA 1MW1A 5D7LA 4AIZB 1YEFH 4KV5E 2F5BL 4XAWL 3P3UA 3S35X 4MFHA 4AUYA 3P54A 1G9HA 1NMCB 1PEZA 1U8PA 3F00A 3ZLQC 2Z3FA 3B9DA 2A9CA 4PJDE 4D3CH 1JWUB 3DSFH 2AXHA 5DT1H 4NHCH 4BM7A 3DUSA 1IL1A 2VLMD 3HN3A 3ZSSA 2D0HA 4XVUC 4G6MH 4PCYA 4X6DE 3T0VA 3VWKB 5FC9A 4Z77A 4I1PA 3BKJL 2EIZA 3WFDH 1Z5LA 3BLBA 4FZEH 3DI2B 3LKOB 2D9QB 4HXAL 2QKIC 2ZSWB 4E9YA 4OIAA 2FJGB 5C2BH 1NBVH 2W65A 2QV2A 1UT2A 2H0EA 4GRWH 4LVOB 3I6LD 4PJ7E 3VD3A 2VERN 2EVHA 3W9DB 5E9DD 1NGZB 5JO5A 2AJVL 3RL2A 1K6QL 4NUJB 3FOMB 1RUAH 2YJQA 1BQ5A 3BESR 3SB3A 5HHQB 3CX5J 3EDFA 2VLLB 2QKSA 1T21A 6CGTA 3SPIA 3KGSA 5L7XH 2V7HA 2VWEC 1U30A 1GC1H 2BINA 5IW3A 3IJHA 4J3XA 4L5FH 5KSAA 4PR5B 3S8FB 4UMGA 2GAZA 4ZOBA 1L5GA 3TJHD 4QYAA 2X4OB 3VI3B 2JI1A 2BVEA 3NGBC 2X2HA 1DJZA 1V7ML 1ZLDA 1NCJA 3PQYB 4KX7A 2F74B 4N2LA 5PCYA 1QFOA 2E3VA 3VYNA 2NX5D 5BUGA 1JWSA 4U1JA 2Y3AA 5I5MA 4PRHA 1QFUL 4MVBD 5D7IB 2DM2A 1YAZA 3FSZA 2FL5B 4ZXBB 3C60D 1IO4C 4U0RB 3VQLA 3UC2A 5I30H 1CE1H 4JFDE 2FX7H 5I8OH 2ESVB 3L5XH 1RH8A 4G8EB 4F8NA 3D2TA 2GYSA 4WW2B 4Y9CA 5B1BB 3CE1A 5IMKB 5FF6B 1A9EB 4OZIB 2JKLA 4UYPA 2CDEB 3UTSD 1LK2B 1MFUA 1FIGL 3KWXA 4HGMA 4O2EA 5JHLL 1KCWA 1G7QA 5DD5L 2NMSA 1SBBA 5F9WB 1PS3A 4ELMF 4PRIE 5DI8A 3P30L 3V55A 1JI2A 4OCRH 2AXJA 4ODVL 5B3JE 1MCNA 1FL5A 4PUBH 4G80B 4PGCB 2CO6B 2VUYA 4JM2F 4KK5D 1IBHA 5H37A 5MERB 1KY6A 1N0XH 4BKTC 3CSPA 4L1DA 3FT4A 5DZLA 1ZANH 3IDGA 3TWCL 2BX5A 4Q0XH 3VRIB 3VXMD 1TQBC 1OAYH 2EH8H 2J55A 1ZV9A 5C8JB 3L5WA 2D0GA 2QKIA 4U6VL 4OF0A 4HMEA 3RB7A 4G6JL 2FIRT 5L2JA 1H3GA 3DRTB 3OHXA 4G8GD 4HDIA 4PY8J 5DJ6A 1BM7A 3O2WL 4N2DA 1NMCC 3QXAA 3CNKA 3E6FB 3WGVB 4MJIA 3E38A 5TE4H 5ID1B 2JJTC 5K9JL 2EH7H 2JKIS 3GBNH 1S9WB 3DUHA 4K7PL 1J18A 4AWJC 5KAQG 3VWKC 3RA7H 1GZPA 1S6NA 1IGFH 2UWEF 4RAUA 5CD3B 4YJZL 4M9OA 4JY4A 1F58L 3O4LD 4NO3A 4U1KA 1EFXD 2OCCB 2X6UA 2WKGA 2VXUL 4LVOC 1SMAA 5I6OA 4LCCB 1PZ5B 1MH5A 3AMLA 4S10A 5FKPB 5DLML 1HHKA 4R7NA 4YFLF 4D0BA 4EOWL 1MCCA 2DQUL 4Y5VB 2P5ED 3L4VA 5FYLH 5F96H 2GTWB 3CFCL 5IG7B 2I25N 3Q7JA 4JRXB 5I2IA 3PDGA 1FFPB 3VFTA 4TQEL 1YNKH 2EUXA 1ZT4A 2YAOA 3T65B 3NJKA 2IGFH 2P24B 1XGQB 2AJZA 3ZMEA 1AS8A 4XNXH 1R5WA 2UY6A 2Y7MA 3MLSH 4ZZKA 2I9TA 1YNTA 4TVPL 4JQIH 4RX4A 1IE4A 3QJQB 4GIAA 3MCKA 4HH8A 4JRYD 4LU5L 1KYAA 3T2OA 2QR0B 4KRLB 4UNUA 5D7KE 1I8IB 5DK2A 3EYFA 4I18B 1AI1H 5IEHB 3HE7D 5FLVA 1XCQB 2HTLC 1ZK9A 1B4JH 2ZX8A 3CLFL 3OF6D 4Y2OB 5EO0A 1K5WA 2EKJA 3MBXL 4KUCF 5F71A 1AO7E 4WW2C 1DQLL 4XPBH 4QRTA 1EXUB 2F2HA 4GKOA 5DJ2B 1QASA 4LIQL 2BVYA 4AIZA 1TQTA 5F9WC 3Q8FA 4GT0A 3QEQB 4LVNB 2O6DA 5CUSL 2E56A 1JNNH 3F6LA 5EBGA 4P48A 2DQTL 1JWUA 3ELAT 1WFNA 4MQ7B 3E3QE 4GRWB 2C4FU 4TLSA 2JB5L 3WKQA 3CZLA 1QSED 1BPVA 1VLXA 3QJOA 3VWKA 4EUPH 4ZTPH 4AYID 1HXMB 4Z0XB 2X1PA 5AW3B 2CMRL 2G2PA 4FADA 1NBCA 2J8OA 2HFGL 3LKOA 4W6WB 2ZSWA 1B6UA 3DDFA 5J8OA 2FJGA 4PJHE 2AZAA 3HG3A 4I0PD 4XVSH 5B38B 6PAZA 3VVWA 1GGTA 1VZHA 3W9DA 4XWGH 2RD0A 1NGZA 2VXVL 2WZPA 4NUJA 3FOMA 3MV9D 3V7MA 4NAQA 1JGLL 5LLIC 3ZQWA 1QYGL 3HUJF 5HHQA 3R8BB 2R0KH 3RQ3A 2VLLA 1PBYA 2WUBL 1JTTA 4HWZB 4XHJC 3P4OB 3CHSA 1CF8L 4PR5A 5DDHB 3DDGA 1D5IH 1V54B 2ID5A 2X4OA 4XBPB 3VI3A 4N1CA 3GI8L 4JG9A 4Q14A 1OK0A 2EDWA 2PWHA 3PQYA 4LCCC 2F74A 5ECJE 3EH4B 3ZTJG 3U6RB 4F1ZA 3H9HB 3LPWA 1MFEL 2VZ1A 2AAVA 4UT9H 4N1EA 5D7IA 1AQHA 1BQLH 4Y5VC 4ZXBA 2FL5A 2XXFA 3EZJB 4K3HA 1A3ZA 3CU7A 4X5LA 1A7QH 4PW9A 2XKUA 1ZLUH 5ADOH 1OAUH 2AHIA 2ESVA 4G8EA 4HYTB 4WW2A 1OL0A 1XCXA 1XAUA 1UM6L 4ZODA 4ZOCA 5IMKA 3BWUC 4MAZA 5FF6A 1A9EA 1HS6A 2K3TA 4W9LC 1HE7A 4IKLA 4TSBL 1J48A 2CDEA 4XOBA 5LKNA 1LK2A 2Y07L 1ET8A 3LCYA 8PAZA 2NY3D 3MV8B 1XH0A 5HDOA 1QLFB 2VDKH 5EF2A 1FORH 4QXUH 3TZVB 4K94C 3K6IA 1IAKB 4JG5A 3FTUA 2B4CH 2BNQE 3VXPB 4PWFA 2YPVL 3L45A 4G80A 4PGCA 2CO6A 3Q6FB 4L9DA 1M2OA 4QTFA 1HINL 1PCXA 2NY0B 5GGQL 2UZIH 5MERA 2HVJB 2BOCB 2R29L 4WCYL 4C4BA 3WDIA 3VRIA 3BUYB 2E8YA 4A2EA 4JCWA 4LK4A 5C8JA 4XP9L 3AWEA 3UG5A 1T0NB 1QWHA 5D7JD 2ZX5A 4XNZB 2F8IA 5JYMA 5C07B 3DRTA 2A0LC 4L4JA 2YEVB 4WI0B 5DMIH 4LVNC 4UQEA 3AM8C 4P5KB 1RPKA 3E6FA 2X4PB 4RRPM 5ID1A 3D30A 1UA6H 5GS0D 2Q10A 3ABLB 2FBJL 4RMWA 4XBEL 2WMPB 1DYZA 1S9WA 5IP4A 1I31A 5D72H 2BHZA 4HZLB 1VFOA 2MOVA 3CDCA 4Z7NB 4F57H 1BEYL 1T83C 5CD3A 1TTBA 4RFOH 4OB5H 1SF3A 1WIPA 2NDGA 3OKDB 4ENZA 3CXDL 3KPOB 4LXFA 3V4PL 3TVMB 1JYXA 1PNDA 4LCCA 2P5WB 5SWSB 1PZ5A 2R69H 3L16A 3ZUCA 3BRDA 2EDQA 4AMXA 4IU3B 5FKPA 4ZNEE 1DQMH 4Y5VA 3PGCB 2P8PB 2ZXEB 2BRQA 4NNYB 2GTWA 5ICXB 5IG7A 1YEIH 1A9VA 4JRXA 3DV6B 4QD2E 1FFPA 3QQNA 3M46A 3ZTJH 3ZUNC 4BV1A 3T65A 3QUMH 4HETA 2LV4A 2GCYB 2I26N 2IC2A 5H4YA 2P24A 1XGQA 2VSKB 5CS7A 1Q0EA 1ACXA 3CVIL 4GI8A 3PJNA 4K7FB 1O7SA 5HI3C 5AOZA 2QR0A 5G2NA 5EULV 1U8JB 3RWEB 4BFRA 4YAQB 1I8IA 3BPOB 3ZKXC 1LO2H 4I18A 5IEHA 3S4SG 3D52A 4RWHA 3WIHH 3FJTA 1XCQA 4H26B 4WIQA 4Y2OA 5C08B 5A6LA 3HI6H 4UV4H 1QSFB 1O5PA 2OMXB 2VB5A 4QEGA 3IM1A 4QJ4B 5J1AB 1ED3B 4DN3L 3NTCH 4JFEB 1CR9L 1HT6A 4LCIL 2AK1L 1EXUA 3RTQB 2BVTA 2QSCL 5DJ2A 1NAML 2AFNA 4J3OD 4EUPB 4H0IA 2BVQB 1OM3L 3TOPA 3QEQA 3AM8A 4OCMC 5E2WL 3VD5A 4TNFA 3MTXA 4U6HB 4RMQA 4MQ7A 3ARFD 2WQXA 2OW6A 5LNEA 3OD3A 4Z7OF 5EEVA 1KB5L 2QQNH 4Y4HC 4PJBB 1M6UA 5GISL 3TN0B 4LT7A 1E3XA 3OLDA 1HXMA 3LYRA 4Z0XA 4POZD 1G7MB 4B97A 2HLEB 5ALBL 3PJLA 4FQCL 1N26A 3A22A 2DKSA 5L2KE 1R5VB 3IMRA 4PPTA 4XNZC 1O7VA 4R0LC 5ELIA 4QJ5B 3ZPDA 1YEHL 5B38A 3E6HB 3OKNB 4AH2B 4BWTA 2F1BA 1X5GA 5FM5O 4KO7A 1P5VB 5AVWB 4FI7A 3D9AL 2NR6D 3HBPA 5JXEC 5E6ZA 4LARH 3T2LA 3C12A 2KQNA 1VGKB 3ALXA 4I85A 4ELKB 4HWZA 5DUPH 1DEEB 3SZKC 5IQOA 4QRUB 4AZ8B 1Q90A 5KEZA 3U7WL 1QFPA 2IWKA 3P4OA 5DDHA 3FSWA 4XB8A 5FGCB 2X3BA 4HUUB 4XBPA 1MCQA 3ZT7A 1XF3B 5A7EA 1LTXA 2DQHL 2W0KA 3S34H 3ZGHA 4MQXC 3U6RA 3RX7A 4G8IB 3B5HA 4ODSL 3H9HA 4TM9A 5F72S 3VXRD 1KGCE 3VA6A 1J1XH 3A4DA 3CFTA 2VDKB 1RFDH 4W9JC 4YC2B 1I1AC 4KKZA 4ZMOA 4HC1L 2HFTA 2OYMA 3NJJA 4MCMA 4PJ5E 4Z7UE 5MENB 3AQXA 2A6DB 4HIXH 3WENA 4Q97A 1BOYA 1OGAE 3GKZA 3NSXA 4ZAKC 4EBQL 1LP9B 4JMXA 2BSDA 1XF1A 3E1ZA 1CIDA 3H55A 5E70A 4HEPA 3MV8A 2HKHL 4ONFL 1QLFA 4YWGH 2R2CA 4CDHA 5JIQA 3DX7B 4YDLC 2AJSL 3Q8CA 2FH6A 3ESOA 2Z1PA 3TZVA 1IAKA 2H32H 2VAAB 3VXPA 5HD8D 2KHAA 3RI5K 1G9NC 3Q6FA 3U7YL 3BPOC 3EO0B 3PYCA 2PCFB 2OL3B 3FTGB 1PG7X 4YXHL 3T6WA 1MCEA 2EO1A 4B27A 4ZT1A 3EKCA 2E9JA 2HVJA 2BOCA 5FYKD 4I9WE 3BUYA 1SOQA 4OGYL 5M95B 5BV7H 3RTQC 4LPUA 1T0NA 4H8WL 4PWEA 3MRGB 5SX5K 3TNMB 1CYXA 1VAHA 5G4OA 4GW4B 5C07A 4WI0A 5C7XL 2NTFB 3HC2A 2DIAA 4A55A 2D4DA 2EQDA 4PJXF 3RVUC 1WJ3A 4P5KA 4FF9A 5JOFB 3ZTCC 1GXEA 2X4PA 4KQ3H 5TDPB 3LTVA 3K1DA 1X6NA 2OTUB 5CR8A 5EFIB 4JO1H 2WMPA 4KRPD 1IE5A 5E1QA 4I3RH 2APSA 1IQDB 1CDCA 8CGTA 1AZVA 4FYSA 5I0XA 2ZT9C 4HZLA 5KYYB 3TN0C 4KZDL 1NH6A 2VH5L 4RLDA 4G6FB 3QIWB 4A68A 1BOGB 2WWMC 4AJYV 5B39B 4NZ8A 3B9AA 4DP2X 1HN1A 3OKDA 1SVCP 3U36B 2FLMA 1FNFA 3KPOA 4LSVL 1BP3B 3SKOB 3TVMA 5I8KH 4HWBL 1IAMA 4MB5A 2P5WA 5SWSA 1KYFA 2VLME 4FLQA 3IYLW 4IU3A 1JTPA 4HKXB 1EJ6A 3PGCA 2P8PA 3AZUA 3QNFA 4NNYA 4Y4KC 1UKQA 5ICXA 5ISZD 1RXLA 3DV6A 1OZUA 2OMWB 5JW5B 1URLA 5I19H 1IFHL 5HYSB 3CC1A 3DMMD 3I6LE 3LEYH 3DIFB 2GCYA 1EMTH 1CMOA 4KZ0A 3VO0A 4CKVX 4GAJL 1YYCA 4BRVA 3U9PL 2Z6FA 2Q8BH 2GT9B 4I77H 2EXWD 4K7FA 1YEEH 3FT0A 3RWEA 1U8JA 5IBLD 4YAQA 1K8IB 1SVZA 5GXBB 5IM7B 3SZ6A 4YC2C 5FV2A 5HHMB 3NFSH 3CLWA 1J87A 4H26A 5C08A 1SNRA 3V4PB 2AKRB 3RZCD 1B2YA 1QSFA 2OMXA 5AW2B 3WDHA 4ADIA 3NVQA 1N6VA 1ED3A 1XH3B 1G1OA 2HLAB 3QIUB 4JFEA 4UQCA 5J1AA 1KTCA 3H9SB 3RY6C 3RTQA 1SRDA 1UURA 1VEPA 1N59B 4EUPA 3QJVB 2BVQA 4PS8A 4IKNA 4A6YL 1XX9C 2YQ2A 5JZ7D 4NM8H 2PXYB 2K45A 3Q2LA 4HD9A 4TTDD 4Z8FL 4U6HA 4PJIF 3HRZB 4QTIH 3UCRA 2FGWL 1MY5A 3VGHA 1U21A 1T7VA 3I9IA 4I3SL 4B53A 4PJBA 1P6WA 1U8MB 4YXLH 4BHUI 2VNCA 3SGKC 3TN0A 4XOCA 1EJ8A 5HP5A 1G7MA 2CJUH 3H9YA 4M1CC 3LH8A 1KGYE 4FLHA 2IXQB 2FLBT 4LSUH 5IBUG 1HWWA 2JKRM 2FX8H 4HKBB 1R5VA 3AUWB 4KJWD 3C2AL 4LPTA 4Y9BA 5JDSB 1JK9B 1GGCH 3BVWA 3NPZB 3E6HA 3OKNA 4AH2A 1ZVYA 1QBLL 2XG4B 4F7CB 1PYWB 1SEQH 2FJFB 1P5VA 4FMKA 4IKJA 4OVVA 2FUQA 3VXME 1TEFA 2H1PL 2DB8A 3GMMB 3PAYA 4MZIA 3OL2A 2EEXA 4I88A 1VGKA 1Z7JA 4CA4A 4ELKA 1DEEA 3V0WH 4QRUA 4AZ8A 5CAYB 5ALCL 1H3XA 2F54D 5L88H 4M6NL 4N0UB 1W72H 2ADFH 4JN1L 3PWVB 1WFUA 5I6MA 4HUUA 4XE5B 1KB5B 3KYKH 1R5IB 1XF3A 1NDGB 5GSVB 5JQ6L 5E8PB 1NFDE 4XVTH 3FCTB 4EKXA 1WTLA 4DP7X 4G8IA 3S4SB 3A4AA 5CJQH 5DRZB 2JLLA 1BLIA 3QCVL 2G0LA 1NCWH 3T6XA 3UTQB 1GVIA 1QO3B 3GEFA 5MENA 2A6DA 3KHOA 3O4LE 3ECBB 2FCBA 3GBML 2FEEI 4PJCE 5C0RH 3LZOA 3VB8A 1LP9A 4LSTL 3GB7B 5LBGA 1JFHA 1ZGLB 1RZPA 4WU7B 3RY6A 1UOLA 5JIIA 3P0YL 1W0WB 4JPKL 3M1CA 5CIPB 5I0WA 3B2VL 4NZTL 5F8QC 2P5EE 1VEMA 3DX7A 3B83A 4FGMA 4XO5A 3VE0B 5BV7B 4GLRH 1V10A 4DEPC 2QLYA 4M1GH 2VAAA 3OMIB 3CVHH 2Q1EA 5TK4A 4KX9A 1IJNA 3EO0A 4KTDH 2PCFA 4TVSa 2OL3A 2OSWA 5FA4B 4P9MH 3FTGA 3DK2A 3RPKA 4GG6E 4J7RA 3CDZB 4JDVB 3QHTC 4IEFB 3SN6N 1UEYA 3SGKA 1JS4A 1TR7A 3FU5A 4JJ5B 2BCKB 3IAGC 1D7CA 4JFPB 1RIVH 2WXNA 4XNDA 2BXYA 3VNZA 1R24B 4FG4A 1KG0B 3GTTA 4JS7A 1XGRB 4JRYE 1W8OA 3U0TB 1TPXB 1WFTA 3MRGA 3D1MC 2QZ5A 3TNMA 1PLGL 4GW4A 4QHKJ 3FAWA 2NTFA 5IR1B 1BFTA 3BKYL 5K9OB 4XXWA 2XVLA 3JWNE 4MS8D 2IDTA 5HI5C 1BAGA 3C09B 4NQVB 5JOFA 2YSTA 2A9BA 1ITBB 5F1KC 5TDPA 3WE1A 2B1HL 2OTUA 1DJHA 1N68A 5EFIA 4W81A 2Q2EB 4JRWA 4FAAB 1IQDA 2R69A 2VL5B 3L4TA 3MOBL 2VCOA 5KYYA 4OZHE 1BBDL 1GIGL 1D5XB 5T1LB 2I69A 1VSCA 3DHJA 2X3CA 2ZUWA 3QIWA 1BOGA 4PY7B 4X42A 1THAA 3QJTB 5B39A 8FABB 3I6KB 3JWDL 4P2QD 2W60B 3U36A 3KBHE 3S36X 4A04A 4X7CC 3V0FA 3SKOA 4OZGF 3LNFA 3K0YA 1F1GA 2XTJC 4C57C 4PS4H 1QSEE 1CGYA 1M2VB 4G3YL 3TT1L 3QZPA 3CPUA 1UC6A 4HKXA 1ZDQA 2CKNA 1KC5H 4IRZA 4JDTH 1RMFH 2VDQB 1VIWA 5EBLB 1IGJB 2XWEA 4EI0A 3QI9D 1AVAA 1I9IL 4WFFD 2OMWA 5JW5A 5E4EB 2ZXCA 4L4TD 1GGBH 3T5WA 5AYTA 3DTDA 5DJXB 4U6XB 5HYSA 4LF3B 3DIFA 5CU5A 3KM1A 3WIHA 2XV3A 2B39A 5ADPL 1UWEL 5IESL 3UMTA 5D5ME 1IAIL 2F9BT 2NY7H 2OXGB 2YQ3A 2ZCKH 5G4NA 1KCSH 5A7BA 3T3PE 3MV9E 2XWCA 1EZVX 4WF7A 3QWRD 1MCPL 2XQYK 4JO2H 2GT9A 4YHIB 3N6YA 1TTRA 1A22B 3ULUC 3SE6A 4KI5F 4GMSL 3MREB 4KXZI 4NKOB 1K8IA 4JHZA 4L18A 2YMXH 5IM7A 2CWRA 3TESA 4H8QA 4AL8H 4Z5RB 2X0WA 2EVFA 1ACYH 3DX8B 3V4PA 2D7OA 2AKRA 2ZXWB 5D4JA 4EAEA 3QYNA 3GIVB 1XH3A 2HLAA 1IC4L 3QIUA 4FULA 2VSCA 3FH5A 3H9SA 3AW5A 7CGTA 1BMZA 2YWYA 4RZCB 1N59A 4DAGL 4HKJB 1F90H 1DQDH 3BPNB 5CLXA 3ME0B 1RZ7H 3PP3H 1TCMA 1MCOL 2PXYA 3AS0A 1JOIA 2P4AB 1MFDH 2OYLA 5K9KB 1YPZF 4JY6B 2QV4A 3ZDXE 4IIQB 2ILLA 1GJWA 3OXRB 3HRZA 1QNZH 5HHVH 2BC4B 2M8XA 2ICCA 4X9BA 2ZUYA 4PB9L 1YYMH 2C3GA 2DLFL 3O3EB 1WITA 1U8MA 4NCDA 3RWJB 3LS4L 3ZZLA 1J1OH 1ZS8B 5D1XE 2O5NA 3ECVA 5ILTL 4TUKL 1KFAH 2IXQA 2CQVA 3AWFA 4Y4FB 3TF4A 2C9XA 3FMGH 4U7MA 3MZTA 2G3XA 4HKBA 4R90H 4YL4A 5EA0H 4BZYA 5BS0B 1UG9A 5JDSA 1JK9A 3Q48A 1GGUA 1W72B 1X4XA 2XG4A 3HMXA 4S0TD 1XIWB 4GQ9L 1PYWA 2FJFA 5ESAB 5DQDL 4F7CA 3C09C 2EDNA 1UGKA 2YAHA 3T2NL 3ZT5A 2FR4B 5J1SC 4AMKL 3D06A 3GMMA 3UACA 5KJRL 3RX5A 3DJSA 3L3JB 1R75A 1MZYA 1EHKB 4I8DA 2OAAA 3OWEA 2B5IB 4KUCD 4PS7A 1IRAY 2ED7A 4N0UA 3D8MA 5GS3A 3FSOA 1XVSA 3PWVA 1YC8A 1EH9A 2AMGA 1A7OH 1KB5A 1R5IA 3ILQD 4LO9A 1NDGA 3EHBC 4OFVA 2VDRH 5GSVA 1IM9D 3V9EA 5E8PA 3FCTA 2NY5H 3S4SA 1AFVH 3UJJL 3BMWA 1NBYB 2DV6A 5DRZA 3TA3D 3WXVH 2VO5A 1J5OL 1KOAA 3VFUB 3UTQA 3Q2NA 3GXPA 1QO3A 3R18A 4H8WC 4UT6L 5ITBH 1U8CB 4MJ6B 3ECBA 3T0ED 4BFGA 1ERNA 3CVHB 3MLUH 5E4EC 4EN3B 1N3NB 3GB7A 1BQHG 4Q6IC 3QXUA 3H3PL 3VI4E 4WU7A 1ZGLA 3WNIA 2X44D 1W0WA 3QZBA 5H94B 4UOQA 5CIPA 5CN1A 3WLWC 2DMBA 3H4FA 4HEME 3OAUL 4KDVA 4N1HB 4NXKA 4O4YL 4YDKL 3VE0A 2HT2C 5JYLA 3IWVA 3DI3B 3FNKA 1CK0L 3D85D 4ZX6A 3RDTD 4YNYB 4PJFF 5FA4A 5JHAA 2V17L 2BSEA 2FWLB 3R1GH 3MKKA 4DOHB 1MOEA 3CDZA 4JDVA 4IEFA 3EH5B 4KVNH 2WO4A 1UWXK 3TEZA 3NK3A 1YMMD 2R0ZL 4JJ5A 2BCKA 4HJ0D 4JFPA 3ZU8A 5JOPD 1JZDC 4Y1AD 1R24A 1KG0A 3WFEL 1XGRA 3B43A 4R7DB 1Q38A 4HC1A 3MJWA 3NCYP 3U0TA 3BPNC 3IJ8A 3O41B 4CVZB 4U1LB 2RH0A 5IR1A 5BO0D 1WZLA 3IF1B 5K9OA 3B3IB 1BFOB 2XNAB 3V52H 2CM5A 4NQVA 2HRLA 5F9OL 3ZE1F 2F0CA 4UDUB 4D8OA 1EAJA 4YHZH 4N87A 1WO2A 4H1LB 3UAFA 4KI1A 2VL5A 1SOKA 2YD3A 4HGWB 5I66B 1W8EA 3GMQB 4K5MA 1SY6H 4WTZG 2VR3A 1D5XA 1MAKA 1QZ1A 1KLFB 4X6DB 1UGNA 5T1LA 4CILA 3TF7C 5E9AA 3MYJB 5FCUH 4PY7A 3UO1L 4I2XE 1J12A 4Y4FC 8FABA 1B88A 3I6KA 4XCEB 4DGYL 2W60A 1L9SA 1OPOA 1NFAA 1W8NA 2WGXA 5AKTA 3TT3L 4I0CC 4Z78B 5KVEE 1TQVA 2DQ6A 5JW3L 5C0CD 2HN7B 3QHZH 5CEZL 4LLAA 1M2VA 1XIWC 3HPLB 3X3GL 4BWWA 1DVUA 2PPDA 4NJ9L 4PP1D 1CICB 4GUCA 3WAKA 5EBLA 1IGJA 3G08B 3N5AA 4JDEB 4GUOA 2KUTA 3WXWL 2B5IC 5DJXA 4U6XA 4LF3A 1RZFH 3GMOB 1PZBA 2OXGA 1C8QA 3PL6B 4QNPE 3CFEB 4FA8A 4OLVH 2NY4D 3S2AA 3LH2L 1V55B 5J7CC 4YHIA 4IDJH 3T0XA 3VD9A 4R96B 2B16A 3VI3F 3F7QA 3MREA 4NKOA 3CGTA 3AXLB 4EE2A 4X7FC 4Z7WF 4YO0B 4Z5RA 4QXGL 1JUFB 5LN8A 3DX8A 4HISA 3TYGH 1G94A 5GRUL 5D7IF 2J71A 1FVCB 1M53A 4JFDB 5AZ2L 3GIVA 2H47C 1DVZA 5TF1H 3NIGE 2CHNA 4RZCA 5B21A 2TSAA 4WW2F 1N8ZB 3VXRE 4HKJA 1BZOA 1S3KH 1I9JL 5IBTL 4OZIF 5AL0A 2KI6A 3ME0A 1NUDA 2FK9A 2E0PA 4PRIB 2GHWB 1SM3H 4WEBH 2NSXA 3A21A 4JY6A 5K9KA 4IIQA 1H9VA 1N64L 1I53A 3OXRA 1UA3A 1UZGA 4OIBA 2BC4A 3L7FB 5F7HA 3UYRH 1QWUA 2Q8AL 3O3EA 3QZOA 1NDTA 3OC8A 5EZIH 3MJGX 3MOAL 3RWJA 2VDLL 5AG9A 3TC9A 1ZS8A 2LAAA 4Y4FA 3BLKA 3C5SB 2R0WL 3UEZA 3N50A 1TVBB 2B3RA 4WI7A 3ETBF 5BS0A 1FFRA 3NIDF 1P84K 3UH8A 2DS4A 1W72A 2OZNA 1EVUA 1XIWA 5ESAA 4QRFA 1YDPB 5FM4A 1XB8A 4JFTA 2FR4A 1KV7A 1SHXA 4JK0D 1Q0YL 4KK6D 1WFOA 2HH0H 4JEGB 3L3JA 3US0A 4JPSA 4IBUA 1MIMH 2EE3A 2FEDD 3D34A 4B5EA 4ES9A 4Z3TA 4JO3H 3R0MA 1R3HB 2ISDA 1NKGA 4F9PC 5EU7E 5B1CA 1JJUA 4D8PB 1LJMA 3SYQA 2DI8A 1GYWA 3SJVD 2CALA 1NBYA 2PTUA 2K4AA 1NOFA 2J21A 3VFUA 2X05A 3KXFD 1CLCA 1CICC 4KROD 4X2UA 2LQRA 1U8CA 3L48A 4MJ6A 4EN3A 3P11H 3CVHA 1N3NA 4DTGH 3SDAB 4HIPA 3SBQA 5H94A 3F7VB 2KQMA 4F5CE 3OPZH 1XD0A 1Q9OB 3BWUF 3PL6C 4IBYA 4J8QA 2FWUA 3POHA 4GINA 5ISZE 5DUML 5DC0A 1IC0A 4B96A 1OCOB 1A7PL 5BW7C 2F08A 4K3EH 5FB8B 2GUOB 3CHRA 4LEBA 5IQ7H 4UI2A 4YNYA 1CZ8H 2IFFL 3LRSB 5LDSA 4PJAE 3C9NB 3MMEB 1O0VA 2QSVA 3NJMA 4NX0A 4X98B 5T1KB 1WRFA 4ONOA 2E9IA 5SV3A 1L9OA 1LNUB 1OCRB 4FFZL 4Q2ZB 2R7EB 3L17A 1PIFA 4YLBA 5DZPA 3SE9H 1HX0A 3VXOB 4R7DA 3UO8B 4DK6A 3FFCB 1H19A 3DOHA 1EVTC 4JFWA 2XZQH 1NSNL 5EEUA 3O41A 4CVZA 1KJ2L 3EJPA 4U1LA 3IF1A 5IIEB 3B3IA 1BFOA 1GAFL 3S88L 4EI5D 2XNAA 2I60L 3N42B 5I6PA 3S96B 5KBKA 2CKBL 1DEDA 4LASH 2BS8A 1JRHL 1JXJA 4UDUA 1RUQL 2J3SA 5ES4B 2ADJB 4H1LA 4HGWA 5I66A 2XKSA 2MOGA 4K73A 2ICEB 3GMQA 1MZZA 2Q76B 4X6DA 1KLFA 2ZOWA 1NGQL 4J2QA 1ZJAA 1U2HA 3MYJA 3GJFK 3NOIA 5LCVL 3BXNB 3NK4A 1OO2A 4XCEA 3DSFL 5ABAA 4Z78A 5DT1L 2P42B 3B7SA 1JPGB 4NHCL 2Y6SC 4PJHB 2HN7A 3RI5F 4J2XA 1AP2B 3V6OE 3DBXB 3HPLA 3OSKA 3CMOL 2N0KA 4RCAA 5HTSA 3N9GL 3F04A 3PP4H 5E9NA 2VIRB 4KRMB 4DNLA 1D9KD 1T2JA 1GOHA 1B9KA 1CICA 1PGRB 2CBTA 2N0MA 3G08A 4WHDA 4GKLA 4JDEA 5E1AB 1ADQH 1NBVL 4RFNC 1SBSH 2G4GA 1MHHB 3S6CA 4FNQA 3FUHA 1S7WB 4P46B 5FK9B 5CZVL 2DI7A 2WV3A 3GMOA 3WEXB 5LGKA 1N0LB 5E08H 1THCA 2PYED 4FLRA 5E94B 1RUAL 3PL6A 5DMJB 3CFEA 3AQZA 2Y23A 1TU2B 4LSPL 1T7WA 2CUIA 4R96A 5BW7A 3HG0A 1IFRA 1DP0A 1XDTT 3Q5OA 3AXLA 4L5FL 2F54E 4YO0A 3EJCA 1JUFA 4HUXB 5I28A 1FVCA 4JFDA 5FHBH 4Q9RH 1NCBL 4ZS7H 4K71B 1HAWA 1N8ZA 5C3TA 4PGEB 4IRJB 5KVGE 4BE6A 3UBHA 1CE1L 5I30L 1ICTA 5I8OL 4PRIA 3V0DA 4AUUA 1G87A 3MRKB 1I1FB 4GSDH 2VDPH 4OGXL 2H7WA 1VPOL 4P3CH 2BNQB 5DR5H 3L7FA 3ISYA 3OHMB 3GSNL 4HBCH 2IGLA 1TZOA 2RACA 4LQ1A 4ZUUA 3LS5H 4G42B 1AOZA 1S46A 4XMPH 1Q0XL 5EDXA 3T0DA 2ALAA 3M07A 1WWBX 3I02B 3LRHA 4APQB 3RVTC 4QOKB 2XCMC 3C5SA 1HL8A 4J4PC 1TVBA 3T0BA 1J10A 2VDNH 1HNGA 3KPRE 1CYWA 3MNWB 2V3FA 3L2LA 2Q7YB 4NCC2 1JZ4A 2XN1A 1YDPA 4P59L 1ZANL 2BDNL 4W9CC 4Q0XL 3EBIA 2K0RA 2DY2A 4Z7IA 2E75C 3HI5H 4N68A 3FN0L 4Y5XC 4FQ1H 4JO8A 1WIUA 4HW6A 4YX2H 1R3HA 2ZQKA 3QXVA 4XCCL 1EZLA 1OKEA 2AXFB 4OLUH 4D8PA 2VMFA 4YEEA 3BKCH 4Z7NF 1F8TH 4L3ED 2AK4B 1CLZH 2Y36H 4LPVA 3GBNL 4OJCA 4X50A 5IHZB 1J9RA 1DLHB 5GGVL 4LSSH 2JNZA 3RA7L 1IKOP 4OVUA 5F9AC 1IGFL 2WCSA 3HBZA 1CLOH 5KWYC 3L5JA 2RMNA 4YLQT 4LHUB 4IRSC 9PCYA 3KR3H 5A6MA 4P2QE 1CXEA 4ELME 3VW3H 4G7VH 5E8DL 3SDAA 4RSYA 4F8TA 3F7VA 2J7LA 2R51A 1Q9OA 4AENB 3WSQH 4A7VA 4IHBA 3NP3A 4ZUSB 2AJ3B 1YQVH 3IFNH 5AUMB 5ANME 1AIZA 1YNKL 4HH9B 5FB8A 1BVNT 4WFFE 2GUOA 4L4TE 3QUZB 1JHLH 2EVGA 3ARTA 3LRMA 3LRSA 4DP9X 3C9NA 2XBZA 4XNXL 3MMEA 3BP7B 2AJYL 4A7QA 1O6VA 3VXTB 4FQHB 4X98A 2BZDA 3MACH 1JGUL 4PRNB 5T1KA 4JQIL 4MXWH 4IMKC 1LNUA 5M7QA 4Q2ZA 2R7EA 1MY7A 3VXOA 1BQUA 1Q9KB 4K71C 1WBZB 1BWWA 3GSRB 4MNHA 3FFCA 3F2LA 2ZWZA 1H8LA 1JL8A 1SY6A 3GHBH 1I8MB 4HOWA 4IRJC 2E4FA 4ABQA 1B4JL 1C5CH 5IIEA 2YUWA 3NCJH 4KX8A 1BVKB 3S96A 5D7SL 4XPBL 4BHUA 5DQJB 5CSGA 4LBEB 5DYOB 2UWEE 2ADJA 1KZYA 3CVBA 4XN4A 2X9XA 2BIQA 2ICEA 4JPQA 2Q76A 2BFGA 4XMZA 3IMVA 4Q9QH 1A6AB 3LVEA 1JNNL 3FT3B 4PJBF 4APQC 3BXNA 1FWXA 5C3IA 4PI0A 4P2RE 1AQKH 5IQ9B 5DJ8B 5L2KB 1JPGA 3VFGH 1YEGH 1QACA 4PJHA 1G7IB 4GBXB 5T1JA 1AP2A 1XEUA 4TVUA 3DBXA 5CGBA 2WYZA 1ZHKB 4ZTPL 4G2AA 3BVNB 4OFYA 3IETB 2VIRA 3VA2C 3C5ZC 1LEKB 4HLZG 4F58H 2PR4L 2OA9A 1I3RB 3JWNG 5J6SA 5E1AA 3RPBA 5I74B 1MHHA 1S7WA 4N2OA 4P46A 1IGML 5FK9A 5TDOB 3GLDA 1F2QA 5ETUB 3WEXA 4XWGL 1N0LA 2BY0A 4FNUA 3DTXB 1VFBB 2NXYB 5E94A 2JKNA 2ZYSA 1TU2A 4KXCA 4NUPA 2R0KL 1ZLVH 3MZGB 3WEAA 2MJWA 1J8SA 1FL3B 5D7LD 1OTUC 4A63A 3UERA 5IZ7A 4UZSA 2QADD 1MRDH 1SUHA 2EDJA 2WYHA 5F7DB 1DTUA 1D5IL 5AALA 3VGAB 4HUXA 3OR7B 4M5ZH 4Z7UB 4PJ5B 2O5XL 2Y25A 4G1MB 1OGAB 5CLYA 3EJZD 4IMKA 3QC6X 3LOWA 4XVJH 2WBWB 3QJUB 2UXFA 3GRBA 4FQPA 3QULB 1LP9F 3TA4D 1UACH 1BQLL 1LWRA 4PGEA 4IRJA 2ZWKA 2QVMA 4KQ0A 3MRKA 1I1FA 3T0EE 3U1SL 1U8OB 1ZXQA 2BNQA 4KK8C 1IC5H 4WTZA 2AAAA 4M6ML 1FBIL 2ZD0A 2VC2H 3MLXH 4P5TD 3DROB 4G42A 3QUGA 1FORL 3MGOB 4RVBA 4QXUL 4K07A 3SGJC 3C8KB 4WEUD 3I02A 4APQA 4ATWA 1ES0B 4M7LT 4QOKA 4NQUA 4LKXB 2JQZA 5LGHL 2MFNA 2UZIL 3MNWA 1LO4H 1SMDA 3HUJE 1KLUB 2Q7YA 4NFCA 5T3ZL 5HVFB 4G9DB 5I8CB 4KI5D 2BXZA 2BRRH 5A3IC 1YMME 2FH8A 4FE9A 3CHQA 4GAAA 5JOPE 4Y1AE 1FLRL 1ID2A 4PRHD 3TTSA 1X9UA 3APDA 3DO3A 1FC1A 4P07A 1WZAA 2COQA 1X5HA 2AXFA 4HLZH 4XPTH 4KVCH 1BZQK 1X5LA 4FQXD 2DZEA 2AK4A 3GSNB 3JWNH 4FFYH 4WUKL 5IHZA 4BFBD 3L9RB 1DLHA 4GAGH 1OPGL 4GBXC 5ICUA 3AU1B 5E6SB 3VNYA 1PLCA 4K9EH 4F57L 3GSOB 5C6PB 1QR1B 4ZNEA 4LHUA 4WO0A 4JM4H 4PBXA 1PY9A 4LDLB 3U48A 43CAB 2IAMC 4BZ2A 3F05A 1KBBA 3AT9A 3MNDA 2FBRA 3RWDB 4JN2B 3P40A 4XVUD 5C0CE 4ZFQA 3K0WA 3HNTH 2WWKO 5IWLC 2NXYC 4AENA 2YLHA 2BP5M 4HBQA 4ZUSA 2AJ3A 5AUMA 1FA4A 2GJPA 1A47A 5IB1B 4HH9A 4L0YA 1JDCA 1KTKE 5FFOA 3QUZA 2HX7A 4UANA 1SLVA 4N8UA 4MJID 2ZONA 5DD0H 3BP7A 2OTPA 3VXTA 4FQHA 4QRPD 3TP4A 3WFHB 1MRFH 4PRNA 2WTPA 3UDWC 5CJ5A 5JHBA 4GP4B 3T0WA 4GAFB 3D4GA 1Q9KA 1EEUA 5F0MB 1NKRA 1P7BA 3RBSA 1GS8A 1WBZA 3GSRA 1N4XL 1I8MA 1LO2L 5LGJB 4NWTL 3HIZA 2Z34A 4RWYH 5IT2L 1MXGA 4WHYG 2VSMB 4UV4L 3C60B 4GSXA 1BVKA 2X1WL 1VA9A 4R26L 4KH9A 4UQIM 4HWEH 5DQJA 2G5UA 3EF7A 4LBEA 5DYOA 2BIMA 3C5XA 1JPEA 3QJRB 4NAMA 1FV1B 1X9QA 3SO3C 4HJJL 1XXDC 5FUOL 1AQ8A 3T04D 3NT0A 3WNNA 7PCYA 2NY6D 2FO4B 3MU3A 4N8PA 2XC8A 3OC5A 3VM5A 5KW9L 1CL7I 1A6AA 5I1KH 4AK2A 3FT3A 4Q4EA 1AZNA 4YPJA 2AQPA 1ADQA 2X89A 3ARGB 3CSFA 2IANB 5IQ9A 3INOA 3GBDA 3LIZH 5DJ8A 5L2KA 2A1WH 1G7IA 3QWQB 4GBXA 3ROOB 1URZA 4G72B 2DTML 1ZHKA 4FFZA 3BVNA 3IETA 3DKHA 5EBMB 3TJEL 3PNRB 1LEKA 4CC1A 5HGHB 4LAQH 1KDJA 4MXQC 1I3RA 3BJ91 3EFFB 2AABL 1HL4A 3JVGC 4K8RC 4M8QB 4DGWC 5J4MA 1OCWH 5EOQL 5TDOA 5TPWH 5ETUA 5AZUA 2LU7A 3Q5TA 4A7TA 5IEKB 3ABMB 1EK3A 1SUJA 3DTXA 4J3OG 1VFBA 4F2ME 3I9GH 1HHGB 1WUNT 5JIPA 1XZWA 2K6WA 2BWDA 3H85A 5I1HH 2L7JA 1FL3A 3PNWB 1NFDB 3LZNA 3ZDYF 4F2FA 1FHGA 3V6FB 3V0IA 5F7DA 5LCVA 3H2WA 4IS6B 3ULUF 2DQGL 1BV8A 3G6DH 4GO8A 4ZW8A 4BGDA 3WTXA 3OR7A 4OF7A 4Z7UA 4PJ5A 5F88B 1AE6H 1M7UA 3EYUL 4G1MA 3S34L 1OGAA 3GSWB 2CPUA 3O4LB 1EFXB 1OEZW 1A7NH 2OR9H 4PJCB 3RX8A 2VISB 5IUSA 4JKWA 5KS9B 4FG6D 4MMXB 2V7NB 3VWKD 3SJVE 1J1XL 5IQMA 3QULA 1NEZB 2VC2B 4I89A 4OV6F 4EJ1C 4Z7OE 1WTGT 3L5HA 3P3YA 1SN2A 4HIXL 4OCYH 1FN4B 1X4ZA 2P5EB 3QRGL 3CK0L 2PN5A 1U8OA 1G9MH 1IGIH 1IIKA 2Y1YA 1T22B 5J9PB 2WZPD 1Q4NX 3HAEG 3UAEA 4WHYH 4GG6B 4PEEA 3DJTA 3DROA 3CXHJ 1I3GH 4PRPB 4WWOA 3SBRA 3BKMH 3MGOA 2MEJB 5A16B 3SYOA 4HP5A 1CXKA 3C8KA 1GOFA 1ES0A 1MN4A 2E86A 2B7DT 2IPUG 4B60A 4LKXA 4JRYB 1NTDA 1OY3B 5GHWH 4F3FB 3D69B 1NBQA 3F64A 1C8PA 1E5YA 1KLUA 1BM3H 1H5BB 2A4ZA 3DIDA 4G9DA 5I8CA 4AXWB 1M1XB 1NGPL 2KBGA 4TMPA 4UTAH 3PQYD 4H2CA 4FG0A 3M7OA 4YE0A 1UYWL 3S5LB 3P2TA 5GGTH 4WWKB 4TNWK 4PLOB 4C4KO 1Z9MA 1DVFB 3GC3A 4FI8A 3VGDA 3FQYA 4NQXB 4GEIA 4OQTL 3BZDA 5EC2B 4E9QA 2HTLD 5LB1A 3HZ3A 3QWNA 4OZHB 2IGTA 4LLQB 4U3HA 3ARGC 3D6GA 2EADA 3GSNA 3BIBX 2PW1B 2GSGB 2WB1A 2MCPL 3L9RA 3HCVB 4R5VA 3DJZA 2JQAA 4Y19B 4F33B 5H35B 3AU1A 3AACA 2KDGA 3H2PA 3NJHA 1QSEB 3GSOA 4N2EA 3PGFH 1QR1A 4KHTH 4QPEA 3OV6A 1PKOA 2ZF9A 2VJ0A 4NP4H 5KSVB 43CAA 1VDGA 2ZX9A 1ULVA 2WIMA 1CFSB 2GBAA 4MNQB 1WD8A 4UDTB 3RWDA 7TAAA 4JN2A 3FQWB 5KVEH 4PWHA 4I0PB 4XB7A 4OCSH 2EKSB 3ZRFC 2QHRH 1JP5A 5D5MB 4AJ0A 4XC1L 4HUMB 3VM7A 1E2VA 4LRNH 3MV9B 3QRFM 2YEZB 4NZJA 5IB1A 5I19L 4JZJB 2OMBA 2NNCA 3B9KB 1PW3A 1ZLWH 1ET5A 1EMTL 1NCTA 4Z1PA 4Z3IA 4X99B 1CDUA 3WUWG 4DKEH 3UABA 4LEEA 5GJSH 2OZ4H 4MB3A 3WFCH 3WFHA 4I77L 2O6EA 1B9ZA 3NACH 2WXJA 4XAKD 2CK0H 4Q89A 3UAJC 2VZVA 4PJXE 4XHJD 3UZVB 1AIFB 3HLAB 4B7IA 3QUYB 1PZSA 5LGJA 3HAEH 2ZOLB 4FNLL 1GTNA 2AERT 3C60A 2F19L 3PAVA 2VERA 4WNQB 3D2UD 3RU8H 1T3FB 5ACMA 3VG0L 3ZDXB 1NUNB 1IT9H 1NCCH 1FV1A 3GZQA 3RUGF 3SE3A 5HVWA 1URIA 2YPLD 1PZDA 2BHFA 2FO4A 5DURD 4CJ1A 4NM8L 2HT3C 4JRXD 5HJDA 1BAWA 4WJ5B 4KMTL 2J57A 3PREA 5D1XB 5F7LB 4DERA 1H3TA 3ARGA 5HYJD 2IANA 2VLKE 5I75B 3VGFA 4XP6H 1YEJH 5AEAA 3AQDA 1UT1A 1KXQE 2VR8A 1H5BC 4MJ5B 3NABL 4BD4A 3ROOA 3A23A 2CHDA 2GC7C 1QP1A 4URTB 2WBJB 3BDXA 3EH1A 1NIFA 4YFLI 5EBMA 3C5JB 2K8MA 2WSPA 4N22A 5HGHA 3B7YA 2D03L 3P2DA 5AZEH 2FX8L 3EFFA 3B2DC 4DESA 1DVFC 1OB1B 1OCCB 4M8QA 1MKFA 1GGCL 5FYKU 5D7JB 5F7BA 3BD3A 2Q86B 1QKZH 1MJ7H 2WIIB 1BVOA 5IEKA 2HSIA 1UJ3B 2B2XH 2VMCA 1HHGA 1AZCA 2ZCLL 5FYKH 1AGDB 4UQ2B 1UZ8B 3WJLC 4UU9B 3K6DA 5IMLB 4ZFFB 2FHBA 4XPHL 3PNWA 1NFDA 2IBGA 3V6FA 2B0SL 3O3BB 5L88L 2UXGA 3QEQD 1CN4A 4IS6A 1YNLL 2JKSA 3BOVA 4PM1A 1WZKA 3UTPD 6PCYA 3KYKL 4P23B 5TD4A 4PB0L 3PHSA 5F88A 4L3EE 3K5RA 3SYCA 2JIXD 4PLKD 3GLAA 3GSWA 3O4LA 1A4AA 4M02A 1EFXA 2ZG1A 5I15H 4PJCA 5KVMC 2VISA 4KZCA 3UAJA 2N1TE 5KS9A 4MMXA 2V7NA 1A3RH 4HCIA 5TFSL 3VI4B 2HRPH 1NEZA 2MRYA 4Y8DC 4JQXA 4HMCA 1TQSA 2GC4C 1GZHC 4W9ZA 4IQHA 1PPIA 2FLRT 4MQTB 1FN4A 2OMYB 2P5EA 1KXVC 5C0RL 3P1VA 3T4AB 4JZJC 1HKLH 4PVMA 4AGPA 3B9KC 4ZMYA 1J9TA 1S7SB 2ICES 1XZ0B 2ZYHA 1T22A 1WDAA 3VMNA 5J9PA 2O5YL 3TXAA 1XV8A 1VRSA 4GG6A 2OXHB 2JKXA 4PRPA 4GKSB 3L3GB 1JPFB 2EP6A 1X7SA 5A16A 4ECNA 4K5LA 3UJTL 5KOMC 3MBEC 1HHHB 2DIBA 2ZYRA 4K7PY 3BAEH 3FU9A 4KXDA 4A66A 4I1NB 4E9XA 4MLSA 1T1XB 4G7YH 1FZOB 3QUYC 4JRYA 4F3FA 4P9ML 3D69A 3SGDH 1H5BA 3RLSA 1MQKH 4AXWA 2QTEA 1M1XA 3OF6A 4FFYA 3AREC 4G7QB 2DQIH 1IEBB 1UM5H 2Z64C 3S5LA 5HI3D 4WWKA 3K71B 4XN2A 2JCWA 4F37K 1DVFA 1QBBA 4NQXA 4GMTH 5EC2A 1G4MA 3N04A 4O2FB 4OZHA 2CCLA 5D1XC 4A2GA 4LLQA 5I6LA 4I2XB 5K59F 4YSOA 4OH2A 2PW1A 2GSGA 4MJJA 1NCNA 1CD1B 1U2YA 1CL7H 2DQDH 2R15A 3HCVA 3M8OH 2WXLA 3QEHB 1LDSA 1WAAF 4Y19A 4F33A 3MV8D 1A6WH 5H35A 2LABA 3EJSA 5HPMB 4HSQA 4YHLH 2F8OA 1QSEA 2WBJC 3RIFF 1GY1A 1OTTC 5KSVA 2L0DA 2EDXA 1I85C 5FO9B 1CBVL 2CH8A 1CFSA 1JZ6A 3BH9B 4MNQA 4UDTA 3Q9QA 3FQWA 4Y4HD 4PS4L 4I0PA 2EKSA 1PX8A 1S4IA 3QUXB 5D5MA 2EEAA 4LPYA 5EEZA 3H6JA 3Q01A 1GZHA 2F8VA 4YN3A 3MV9A 1TZGH 2YEZA 3C75A 4OZFG 1E28B 2ZKHL 4OGAC 3N41F 4B9YA 4JZJA 2LHAA 1GGBL 1E0OB 1AMYA 5JXAH 5KSUB 3B9KA 3HAEB 2DWDB 1NL0L 2NY7L 4F93B 4M7LH 4X99A 1WPCA 1I8UA 1EBAA 1KCSL 3K2UH 1PY0A 4M7ZC 3WHE0 1A8JH 3BZEB 5KVFE 3O4OB 5JXED 5FS5A 3ARVA 3P73B 5BPPA 4HFWB 5AW5B 2BERA 1M42A 1FH2A 3UZVA 1Z3GH 1AIFA 5D71L 3T09A 3NIGB 2MTPA 2CDGB 3HLAA 3QUYA 3VXRB 3FQ1A 1ZLUK 4AL8L 2IMMA 1HAUA 2ZOLA 1ACYL 5L4MA 2Z0BA 1FO0B 4WNQA 3F7YB 4FXLA 2EDHA 3B5GA 1T3FA 3TCTA 5SWSD 4MQXD 2P5WD 3IDYC 2D0FA 1KTBA 2YGVA 3PCYA 1DQDL 1IKFL 3I6GB 4G82A 3HC4H 2FYVA 5L9DL 1RZ7L 4OZGE 3QPKA 2HXAA 4WJ5A 1VFMA 4N3TA 5D1XA 2R4RH 4KXBA 5KVGH 4ZAKD 4MSWB 1DZ0A 1JMXA 5FX3A 3FU7B 2D7QA 1YYML 1P4IL 4B0MB 1E6OL 4MJ5A 1BXAA 4ZFZB 4M48H 5L8LB 1CDGA 3RHWK 2WBJA 4A67A 1J1OL 4YHOH 1ZHLB 3C5JA 4F8LA 5F93C 2B59B 4RGMC 3CBRA 2F8XC 1ITCA 1T5WB 1SZNA 5EA0L 2Q2LA 1OB1A 5GRVL 4KPHH 3KH4A 1HQRB 4KFZC 1RURL 4L29B 5D7JA 3QAZB 4U31A 2MQCA 2Q86A 4MD5B 2WIIA 4BA8A 1H0DB 1QSFD 4KI5E 1UJ3A 2Q5BA 5FWRA 1FE8L 1E8ZA 1AGDA 4UQ2A 1UZ8A 3RTQD 2BH0A 4UU9A 5IMLA 5JLZB 4ZFFA 3BI9X 4PRHE 3KLDA 1KCVH 4RGNC 2FATH 3AT8A 3RWIB 3O3BA 3ML9A 5BQDA 2NQ3A 3RVUD 3CMGA 2WLLB 3HR5B 1B2WH 4P23A 3DK0A 4OZFH 5LAPA 3P9LB 3IXAB 3OJMB 2A74C 1JF1B 1WWWX 5K1NA 1UA7A 1RZIB 2XWJB 1NLBH 4TVPD 3RIAK 1AFVL 1FNLA 3F58H 3TN0D 2P80A 2VLJE 1YPZE 2IBBA 3VI4A 3CIQA 4ZFOL 4YZFF 3ASWA 2WWMD 5ENWB 4K5NA 1DANU 2GIYA 3ATBA 3HW7A 5AB0A 4JUSA 3MNVB 2OMYA 5E1HB 3D5OF 3MLUL 2BZCA 3QUKB 3T4AA 1F13A 2LLGA 1LXMA 2ARWA 3P9MB 3LZPA 1S7SA 4NZUL 4U0QB 1XZ0A 4K5PA 4L1BA 3BZ4B 4DVRH 3II2A 4PJAB 4LE8A 2OXHA 3N40P 4Y4KD 4CUCA 4L8CB 4UTAA 4GKSA 3L3GA 1JPFA 1OAZH 4QHLB 5GGTA 1KSRA 1HHHA 4AQ8C 4D9QD 2DM7A 2G75B 1T1XA 1FZOA 3MI6A 4NC0B 2ATAA 3SKJH 3BP6B 3EADA 4UOZA 4N2AA 4F15B 2NYZA 3KJ4B 4KVNL 4WWNA 4JFUA 4XCFH 4QRPE 1IEBA 1DFBH 4EIUA 4HJUA 5J89A 1WYJA 1JE6A 2Z35B 3CZUB 1K5NB 5LBSH 3K71A 3F7KA 4FZ8H 1T2QH 2FDBP 2VWEE 2ZUQB 3LMJH 3QCTL 1F5WA 1NAKH 1ZIAA 3LKQB 2X70B 1U4FA 4O2FA 4W9HC 5MEND 4PFEA 4XNMB 5F9DC 4EI6B 1HZHL 3UPCA 3QAQA 2IQ9H 4PG2A 4A2HA 4KXAA 1GSKA 4I2XA 5CN2A 4LOFA 3X1FA 2VQ1B 3EO1B 4AYFB 4CVXB 1CD1A 3KDPB 1ANUA 1RJYB 1ZK5A 5HI4C 3QEHA 2X4SB 2E46A 2Z8WC 4OW6A 4XP1L 5KOVC 1NGXB 2BIIA 1I7TB 1HCZA 4K9JA 5FCUL 4AV4A 1EO5A 3CPLB 4BIKA 4CSSA 4WV1C 4HIIB 5FO9A 3QXWA 5DJCB 3BH9A 3HMWL 3QNXB 3QAZC 1QW8A 1S7UB 3FH7A 3CZGA 3W9EB 1HHIB 5C0GB 3QUXA 4U05A 7PAZA 4ZMVA 1CO1A 2V0AA 4M1CD 4EO5A 5CWSB 4JPWH 4PJFE 2PO6C 4FP8H 1ETA1 3IPEA 3VXSB 1E28A 1P2CB 2KMWA 1MHPL 2IJ0C 4JAMB 2JJUA 4L4VB 4MKTA 4OAWB 4KUZL 4OTXH 4X5XB 3WMQA 4IBVA 2KH2B 1E4XL 5KSUA 1RZFL 4UBDC 1J05B 3HAEA 2DWDA 2VZTA 1ZDSA 1KGXA 1RU9H 1EXHA 2Q0ZX 4N3UA 4YSQA 1KGJA 2FT6A 2WO3B 4OLVL 5DHMC 3BZEA 3CSYB 1KJ3H 2RTTA 1WLHA 2I27N 3B2UC 3KCPB 5CJ8A 4XO3A 2O93L 1J5CA 3P73A 2K9FB 4HFWA 2EXTA 1J0HA 5DJZB 2CDGA 2VOTA 3VXRA 3ZE1E 3QIWD 5GS2D 4DFIA 4AX3A 1KDIA 4HIQA 1EO8H 3TYGL 1FO0A 3F7YA 1UADC 1UCTA 5TF1L 4QHUB 2LLLA 3F7PC 4EPSA 1T89C 2EC9T 3CFQA 3I6GA 3LPFA 1TQWA 1LGVA 4BBWA 1OARH 2XHNA 4NEHB 5E95B 2VRQA 3HRPA 4MSWA 2WGNB 2DN7A 4X6FB 5HHPB 3KYAA 3ASOB 3K72B 3UYRL 3FU7A 3KPRB 2A73B 5EOTB 1ZLSH 4D0CB 4ZFZA 2P1YA 3QFJB 3I74A 1ZHLA 2FJSA 3S8WA 1AZZC 4FI6A 2B59A 3DX6B 3NSDA 4XZUB 3DETC 2AQ2A 2APTA 2TSBA 4NN5B 1T5WA 4X5WB 2ZUQC 3Q0HA 4HHAB 5CBAB 1HQRA 4L29A 3PU7A 2H41A 5HHMD 4WO4C 3ZTNH 5I73B 3HZVB 2ADIB 4MD5A 5BQ7B 1E9OB 3VI3E 1H0DA 4KU1A 4GFXA 4M00A 4N90D 1SLXA 4WZ9A 5IF0B 4Z7WE 1JF6A 2R27A 5JLZA 1MIML 1KTLB 4QF1B 1N19A 2ZXAA 5D7IE 3RWIA 3JWOH 3LSOB 5JA9A 3PF2A 4JE4B 4UTBA 2PXYD 1F41A 3DBSA 3WKMH 5HI5D 4NO5B 2WLLA 3HR5A 5IVXB 1A6UL 4MA1B 5I0YA 1LQSR 4XOEA 4AYMC 2DWSA 3P9LA 2DH2A 3IXAA 1JF1A 2D73A 3MRMB 2AQQA 4B95C 1RZIA 2XWJA 4RBPH 2DEWX 3GTNA 1A6VH 3BGFB 5T5FH 2NZ1A 4G6KH 1H3PL 5C9KA 5ENWA 3QJZA 3BFQG 4JM2B 1JMZA 1WEJL 3KVPA 3MNVA 3Q44A 5FO2A 3WOVA 5KZCB 3QUKA 5CSZB 5ANMB 1UT9A 5K5YA 2YFOA 3W37A 3P9MA 2XTJD 2HG5B 3K3QA 1T89A 3OPZL 3L81A 4CGTA 3MXVH 4NNPH 1MCLA 4YFDB 3BZ4A 2QPUA 4PJAA 1FG9C 3LN4B 4L8CA 1T2XA 3K8KA 1NIEA 3NIDE 4NDMB 4QHLA 4K3EL 3UJIH 2G75A 5IQ7L 3L95B 4PCSA 3WTSA 2WN2A 1CZ8L 1DJXA 2GY5A 3BP6A 3O2DH 5F7FA 3THMH 3VQ1C 1KXHA 2CRIA 2YRZA 3VVVA 2H4EA 1UD5A 3VDAA 3ULUD 2Z35A 4XAKE 2ZWYA 4ZFOB 3IRPX 1K5NA 4TQHA 3N1MC 2UWEB 2NTSP 5E6IB 1VGEH 3DOSB 3C6EA 2QT6A 4XC3H 3LKQA 2XT1B 2X70A 3NG5A 4EXPX 4XNMA 2LFGA 4EI6A 4PLJC 1NMBH 4O51B 5HJ3B 5JW4Q 2Y7OA 5KYXB 4U1HB 3SE8H 2VQ1A 3EO1A 4PD4J 4JR9H 4AYFA 4CVXA 4P2RB 1RJYA 4MCZB 1TEGA 2QMJA 2X4SA 1CYGA 1NGXA 2XICA 4YVNA 2YPLE 3V6OA 1I7TA 3ML8A 1IBDA 4TRPL 4UOJA 4HS8L 3CPLA 4NN5C 4RETB 1WV7T 4CVWA 4HIIA 4PYHA 9CGTA 1TVDA 3EBGA 5HYJE 5GZNC 4X83A 3SDDB 1YG9A 5DJCA 2IV9A 4CMHB 2BSED 3BPCB 3QNXA 5I73C 1S7UA 3BJLA 3NEXA 1DBBL 3EJYC 1D6VH 4QHNB 4PCTA 1HHIA 5C0GA 3W9EA 3PP4L 5I1IL 1RP8A 1DCEA 4Z95L 5CWSA 5M94B 2R39A 5D1ZI 4NKMB 3U7AA 1KJMB 1P2CA 1SBSL 4JAMA 4L4VA 4HQQL 4OAWA 3NCFB 4X5XA 4N2CA 1BAFH 4TNWF 4ZBJA 1KEGH 1J05A 4M7JH 5E08L 4HJIA 1IQWH 3RVXC 2MPAH 3CBJB 3ZHKA 3L4XA 3GS7A 4BE5A 3CSYA 1Q72L 3PWJB 3KCPA 4W4OC 4FQIH 4Z7UF 1IGCL 3GIZH 3QQ4B 2XV6B 3BGFC 2XZCL 4MB4A 5DJZA 5AOMA 1J0JA 2UYLB 5T1LD 3ARBB 3QEQE 3TA3B 4KZEH 4RA0C 4WUUD 5DHYB 3MHZA 3UTPE 2C3VB 3H42L 5K9QI 3CIAA 2K7QA 3EHBD 3MFGB 4XNYH 3KPSB 4AQ1B 5FHBL 4Q9RL 4E9SA 4QHUA 4WKXA 2HT4C 3IDNB 3EOYG 4HKZB 3D0AA 2CUMA 4HZ1A 4TPRL 4K23L 5KSBF 2B1OA 3LKRB 4GOSA 2G3MA 4D9RE 1CTNA 2RQ8A 1MCJA 4X6FA 5HHPA 4WSKA 3K72A 2D9CA 2YD0A 1J7VR 3D85B 4HBCL 3KPRA 2YPKB 1J0YA 4Z6AT 2A73A 2I7SA 3GS4A 5EOTA 4D0CA 3LS5L 3US1A 3WLWD 3AT0A 4XMPL 5GSRB 3QFJA 5K33A 5HDWA 1XR9B 3KYNB 1NC4B 3SGEH 1U6AL 2HT2D 3TLRA 4F9LC 3QR2A 1YMMB 3DX6A 4XZUA 4X5WA 5CJBA 5E6IC 2VDNL 5E23A 4HHAA 5CBAA 5GZNA 1ZJBA 2K6ZA 4PAZA 1CXLA 3HZVA 2ADIA 3FF8A 1MEXH 4K4KA 3WNMA 5BQ7A 1E9OA 5DVNA 1DJGA 1ZV2A 4P06A 2VM4A 4N2KA 2DWXA 5IF0A 2R1XB 3P3TA 3HI5L 4N2MA 1MXDA 3AB0B 3WKNA 5D1QC 1KTLA 3ZL4L 4QF1A 3QG6B 2ZWSA 3G6AB 3LSOA 1KTDB 4PREB 1HCVA 1XCWA 4YX2L 4ETQB 3MCLL 1XF2B 1SOSA 1A3LH 3GXTA 3ASNB 2ZYIA 1VF5C 4NO5A 1JXGA 1U3HB 4X8CA 3RVVC 5IVXA 3BKCL 2ORBL 4MAYB 1Y6MR 3PFQA 2G5RA 1TYJA 3MRMA 4CMHC 1XGUB