5TK2A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
KVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized Cupredoxin-like domain protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. ames
molecule tags Oxidoreductase
molecule keywords Cytochrome B
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk2A00
3X1GA 3ASOB 4DP8X 7PAZA 1NDTA 4KO6A 2GHZA 5B7FA 1PLAA 1ET8A 2PP9A 2CCWA 2YARA 3CDZB 1M57B 4A66A 2DWTA 5I6LA 4BWWA 3FT0A 2HRGA 3NSFA 3IEAA 3TASA 1NWOA 3BVDB 1M56B 2QT6A 2FQGA 2IDUA 1KGYE 4AI7A 3OMAB 1AZUA 1IBYA 5D4JA 4AKOA 1KBWA 2DV6A 3AG4B 2H3XC 1JVLA 1URIA 2XXFA 1ZIBA 2HXAA 4CSPA 1B3IA 2CUAA 3UGEA 4P5SA 4G7SB 5B1JC 3PLYA 1A4BA 1V10A 3SQRA 1ID2A 1SHXA 2XXGA 1RKRA 3ABKB 1AR1B 2W88A 2I85A 4RH4A 3NJFA 2X88A 3KW8A 3UADA 1GY1A 1ILUA 2E86A 3FQ2A 3JTBA 3X1NA 3TU6A 1V55B 2PCFA 1ETJA 5I6KA 1SHWA 1J9RA 3EHBB 1ZV2A 4YVUA 2XYBA 4M4RB 5B1BB 3NSDA 4A2HA 1NPJA 4DP2X 2J55A 1TEFA 1XB8A 2IDQA 4GY4A 3S3DB 2AVFA 2FT8A 3OQRA 1PCSA 4BWUA 3CZUB 3DKHA 3QJUB 2H5UA 2BHFA 4W1TA 1GS7A 3FYEB 3ZDWA 3CVBA 3FPXA 1AS6A 2FQFA 1OCRB 2Y1AA 3MBWB 2EINB 1XB3A 4DPAX 2YAMA 2XX1A 1BXVA 2PLTA 4A2DA 3AG2B 2WO2B 2ZONA 1X9UA 1TEGA 2EIJB 3T6XA 4FAAB 3D12B 2X87A 4HZ1A 4F2EA 1WS7A 4DP1X 4L0PB 2XVBA 5I6MA 1IUZA 1J9QA 1NIDA 2IWEA 1NIEA 3X2QB 3WKPA 1IC0A 2XV2A 4E9WA 3T6VA 3IN0A 5I6PA 1E65A 2B08A 2GBAA 4A2FA 4UF7C 2HRHA 1BQRA 3H56A 1L9RA 2AZAA 1BQKA 1ZIAA 3S3BB 1HAWA 1WA1X 2FTAA 4KNUA 5IY5B 2Q9OA 5D4HA 2DYRB 1ZDSA 1BAWA 2TSAA 2YAHA 3NSYA 3HB3B 1J9TA 3WG7B 4DP4X 2XV3A 3NJJA 1GS6X 3FSWA 2B3IA 1NIFA 3IN2A 2XX0A 2VW6A 1ZPUA 3PAZA 1L9OA 3T6ZA 3DIVA 1AOZA 4A2EA 1AANA 1BXUA 3UABA 4GYBA 1WS8A 5PCYA 1E67A 3AG3B 4NERA 1V54B 2QDVA 1XMEB 1BXAA 3NYKA 1JZFA 3EH3B 4HAKA 4KO9A 1PY0A 5A7EA 2UX7A 2GC7C 1MZZA 1PZCA 1FA4A 1NPNA 3IBOA 4YL4A 5I5MA 3SBQA 4YSSA 2OCCB 4YSOA 5I6OA 5I6NA 4CSZA 1ZDQA 1TU2A 1PF3A 1A4CA 1AZBA 1M9WA 3NJIA 1AZNA 3U25A 4DPBX 1JERA 1CYWA 5TK2A 4JKNA 3UAAA 3UAEA 1PNDA 4BDVA 4KOBA 1GW0A 1SF3A 4Q89A 5I5JA 1JZEA 5I28A 4DP6X 1TKWA 1BQ5A 1SF5A 4UAHA 2VM4A 4E9RA 3C75A 1JZIA 3PAUA 1JZJA 4GP5B 1E30A 2BO0A 2BP0A 1L9TA 1BEXA 5F7AA 4EF3A 1AIZA 5B3SB 1KCBA 2NRDA 4KNTA 3X1EA 4JHVA 3NJKA 1IBZA 4BK5C 2UXTA 3AY2A 1PZAA 4YSCA 1KV7A 4A2GA 4GP8B 4JHUA 1PLBA 1J5DA 4DP9X 3PCYA 5B1JA 2LLNA 1ASOA 3H4HA 1EZLA 2MTAA 3OD3A 3CVCA 4E9TA 2BP0B 3G5WA 1JOIA 3PAVA 1W6WA 3S8FB 2W8CA 3RYMA 1HAUA 5I26A 1DZ0A 1E5YA 1JXDA 2IDTA 4PCYA 1NINA 2PPEA 2OV0A 8PAZA 1GY2A 2UXGA 5LDUA 1MG2C 3FQYA 2OJ1A 1ILSA 1RCYA 2IDFA 1OV8A 2JXMA 1MG3C 9PCYA 3GYRA 4BXVA 2FT7A 3BQVA 1KYAA 4G70B 1PAZA 2FQDA 3V9CA 2AZUA 3S3CB 1R1CA 3N2JA 3OMIB 3QJVB 2EIKB 2PP7A 3NJMA 3T6WA 4F7KA 2HZHA 2A3TA 4GP4B 1PNCA 2ZWNA 1PMYA 3WKQA 3CDZA 4AKPA 4F2FA 2VW7A 4YSEA 2I7SA 1RZPA 3NP3A 3NSCA 3PPSA 4HCFA 1CC3A 2IH9A 3V9EA 1WA0X 5B7MA 1KDIA 3OMNB 3QQXA 3ZX1A 2YXWA 2CALA 3X1BA 6PCYA 1JXGA 2I7OA 2EILB 4YSPA 1HFUA 2FWLB 4HHWA 3ABMB 2IAAC 5ANHA 5I5IA 1XB6A 2YQBA 3EH5B 2Y69B 3QJTB 1GYCA 4DP0X 3PXLA 2YAQA 2QDWA 4YSQA 2J5WA 3SBPA 3KW7A 4P5RA 3MX0B 1ADWA 2P80A 4G72B 1SDDB 2PCYA 3H4FA 2HX8A 1ET7A 2GIMA 4GXFA 1L9PA 1BYOA 3WNJA 1GSKA 1UATA 1OE1A 3TBCA 1KBVA 1JZGA 4N4YB 1A3ZA 1AG0A 3QJRB 2DY2A 3NJNA 4KO7A 3ZBMA 4DP5X 5D4IA 2VMJA 3QJSB 4K9JA 1BYPA 1E5ZA 2VN3A 3TA4D 3QJQB 2CBPA 1DYZA 4DPCX 6PAZA 2IH8A 2YAOA 1X9RA 3FS9A 3IE9A 4AZUA 2BWDA 1NTDA 4ZK8A 3WNIA 2BWIA 2YAPA 2PPFA 3FU8A 2VW4A 3FPYA 3WIAA 2HX9A 5AKRA 3NJHA 2JFCA 1AG6A 4W9ZA 4WTQA 1JXFA 2BP8A 1JZHA 2YAEA 2GB2A 1J9SA 2PPDA 4E9QA 2QPEB 4BXSV 1QNIA 1KDJA 2XUWA 5AZUA 4BWTA 1EHKB 2BZCA 2ZOOA 1A65A 3CVDA 4HALA 4E9XA 3WI9A 2N0MA 3GXUB 3UACA 1SFDA 1WAEA 5FC9A 2JKWA 3L45A 5E9NA 2FNWA 3T71A 1RZQA 4QKTA 1OOWA 1NIBA 4A68A 3AG1B 3NJGA 2QPDB 2IWKA 3EH4B 1QLEB 2BW4A 3HEIB 2Q5BA 2WO3B 4NB7A 3FU7A 1NICA 2BZ7A 2XV0A 3NJLA 1FWXA 2ZXWB 3NT0A 4YSUA 4G7QB 1AQ8A 2XLLA 3JT2A 4KO5A 4G71B 3FQ1A 4MFHA 2IDSA 1AS7A 2UXVA 4WKXA 1W8EA 3S8GB 2HLEB 1YLBB 4UANA 4PAZA 3ZIYA 2CJ3A 1NWPA 2UXFA 2XU9A 1N70A 1OE3A 1A8ZA 4E9SA 1AAJA 1ET5A 3EF4A 1OCZB 4YVNA 1ASQA 1GR7A 1PLCA 4HIPA 1IKOP 4HCGA 2HX7A 2WSDA 2TSBA 3T9WA 3ASNB 1FFTB 4ENZA 5B7EA 3QPKA 2GC4C 4QLWA 2VSKB 4FA7B 3SBRA 1JVOA 1SJMA 2PPCA 1OF0A 1OE2A 3FSAA 2P80D 2J57A 5EHFA 3TBBA 4BDVB 2FJSA 4KOCA 1SDDA 3FYIB 2PPAA 3FSVA 5B1AB 2BW5A 3OM3B 3NP4A 2GI0A 1AS8A 1OCCB 5B1KA 1CYXA 2DWSA 4TXVB 1L9SA 1I53A 1L9QA 4G7RB 4YSAA 4A67A 2XWZA 2AFNA 1SFHA 3N55A 1KCWA 1CURA 2IWFA 2BP8B 1SNRA 2MRYA 3AW5A 4DP7X 4AX3A 1GS8A 3ABGA 1OCOB 2GSMB 2H47C 2FT6A 3ERXA 4E9YA 7PCYA 2DYSB 1MZYA 4YSDA 2R7EA 1ASPA 3ABLB 2EIMB 3DTUB 4E9VA 1F56A 4M3HA 1N68A 4YSTA 1J5CA 3CG8A 1MDAA 1PZBA 2VSMB 4AKQA 1QHQA 2YAFA 3FU7B 5TK4A 1T5KA 4HHGA 2RACA 4YSRA 1AZCA 2J56A 4N8UA 1WA2X 1W6LA 1A4AA 2FQEA 2UX6A 3FSZA 5PAZA 5AFAA 4Q8BA 2R7EB 3GDCA 4X4KA 2YXVA 3X1FA 2PP8A 2VM3A 4HCIA 2CAKA 3AZUA 1NZRA 2AANA 4NAJA 4KNSA 1AACA 5F7BA 3FU9A 1AZRA 1CUOA 1VLXA 1NIAA
chains in the Genus database with same CATH superfamily
2BK8A 2OXGA 3OZKA 4WO4D 3ZMRA 3MRQA 2W95A 2ZYIA 4PLJC 5KVEH 1BMGA 5KVDL 1ET8A 4JGNA 2GJJA 1IVLA 1YEJH 1NBQA 2YEVB 3NFSL 4GW5A 2ZJSL 4OF6A 1ZEAH 4EN2A 5K59F 4MD4A 1X5JA 2DWTA 3RFZC 2RH0A 2AJXL 4HBCL 4OBRA 4PBXA 3K6SB 4QRPB 5K59E 1E8XA 1Y07A 3G5XA 1NOAA 3DX8A 5KSAB 4WIQA 3WAKA 4CBPA 2WSPA 4WFEE 2VT0A 3SKMB 4UQEA 4LSTL 3OKKB 3H0TA 2Y2YA 1S3KH 2CO7B 4L1TA 3ZTCC 4PJIA 1J0HA 5B38G 3JTTB 3V4PH 4HW6A 3D85B 5EORH 3VQ2C 1Y6KR 3WLBB 3O45A 2JB6B 3LN4B 3QFDA 5C71A 1XGQA 3CU1A 3DNKA 2RTTA 1TQBB 2KS0A 3EFDL 4QMEA 3KR3L 3SDYL 1T83C 1A4BA 4OJYA 3FB5A 1PG7L 2BCKA 2IH1B 1GZQA 3WUWB 5IQ7L 1AR1B 3HHMA 4L3EA 3F5WB 2D0GA 1GHFL 1CE6A 3T08A 3QPQC 3ZKSD 4JQXA 3ZDYE 1XXFC 2ED8A 3VFTB 4MZ2A 3JTBA 2YMOA 4KZEH 3WBDA 2Q3AA 2GJ6E 5DJZA 3LXCA 1SHWA 4X6CB 1BGXL 1KOAA 4ZDHB 1RP8A 5AVTB 2V2WB 3ZTDC 5B1BB 1QI3A 1EJFA 2XJKA 4YXLH 4FADA 1PJWA 3KGUA 3UTSB 2E46A 1IM9A 3UTPD 3VU1A 4BFEA 2B39A 2MPAH 2ICWB 2QHRL 1CD9B 1TEFA 4LLMB 2DI8A 2E9IA 3TX4A 3MCYA 3BQUD 4BQBA 2YA1A 3HJEA 4UQ3B 4F92B 5J13B 3VD0A 4AYMC 4JO4L 1NSNL 2EDEA 1BX2A 3BWAB 4N0UA 4G3YL 2CLVB 1KEMH 5HDLA 3VGAB 3QXTA 3NJXA 5IB3A 1G1OA 1AKPA 4G2AA 1QR1A 4P2AA 3K6IA 3FHQA 4XNUL 1N8ZB 2V9QA 4KI5E 5D1ZI 3D1MC 4JFQB 1R17A 4NZJA 3RIFK 1DBJH 4OVVA 2E47A 4NUMA 4MMXB 4N1EA 4CN6A 1CO1A 1JNJA 3ECBB 3H9YA 4J7RA 5A6MA 4OQTA 4R7VA 3ZDZE 2X87A 1MREH 3CD4A 1P84K 1PYWA 1XV8A 1TFPA 4RMBA 3MV7D 1KY7A 4FYTA 4DT2A 3BISA 1R3JA 3S2AA 4J3OF 4WGVB 5FHBL 5C0AA 3T6VA 1W0WB 4PJGE 3H3PH 2G9HA 3MRDA 2EXWC 1ZPLA 3O9WA 3CFEB 1L9RA 1P9MA 3I6KB 1QABA 5EZLA 3P4NB 5I1HL 1PKQB 1XX9C 2DYRB 5FF6B 1D5XA 2YAHA 5K1NA 1IGYB 1P1VA 4KTYA 5BZXA 1ITCA 4Z95H 3N0AA 4HGKC 1MWOA 4ZFZB 2GSIA 5EC1B 3H7BB 1P5UC 4A2EA 3KCWA 4GYBA 5I0DA 3EYOA 4MCZA 1D7DA 4U1MB 3LRLA 4UQBA 1CFMA 4IRZH 4YHOL 5AW1B 2WYZA 1T4WA 3GXFA 2MKWA 4MXWL 5SWZA 4H25A 3FF8A 3EYUH 4D9LL 4XNDA 4U1HB 3IJHB 3O8XB 2GC7C 2GQHA 4L9LA 1NPNA 1C5CL 4ZODA 4DVRL 4DUVA 1KTLA 4GQRA 4KRLB 4XP5L 1QUPA 4XNAA 4I18C 5DS2A 2AABL 4IRJA 1ONQA 4GQZA 1DLFL 2V5MA 4F7TB 5I1HH 4ANUA 1AZNA 2Z31B 4DPBX 2B14A 1G6VK 1WP6A 3MAWA 5TK2A 3LSOA 4DK5A 3DUUA 5I8CA 4ZTOH 5D7IB 3APMA 3AUWB 4NN5C 3RZCB 1UTDA 1CD8A 1TKWA 3C8KA 1RZ8A 3IJSA 1BVLB 3JVGC 5DT1L 4BE5A 1K5NB 1BLNA 1C5BL 3OHMB 1UJTA 4JRWA 4A55A 4HSQA 4JCWA 4E9RA 2FNBA 4JFED 4Y1AE 4I48A 1QFWI 1VGKA 2XPYA 1BWWA 3U82B 1L7TL 4KY1L 1BEXA 1AYRA 1SJXA 5I82A 1RK1A 3OKYA 5EUKB 1S7RB 5JZ7C 5C9KA 2AXWA 5KN5B 4MDJA 1PKQE 2MQ3A 1NCBL 2EE2A 2O5XL 4M7LT 4NN7C 5IW1A 2YMTA 5KYXA 2MTAA 2YLKA 1AP2B 3KJ4B 1KTBA 1UH2A 2KZKA 2J6EH 3U9UA 2JK5B 2VLRD 3GRGA 2HVKA 4JG0L 4N2MA 2E75C 2FX9L 3D39B 4Z9KB 5AB0A 5FO8B 4NI3A 4LPUA 2WBWB 3O4LE 4H8VA 1HN1A 3TPUA 2EUWA 1CL7I 1FZJB 5L4IA 2UXGA 1TYRA 1P4IH 3FT3A 2EDXA 2WVSA 1E9PA 2IDFA 4M6MH 1BM7A 2YEZB 3A67H 5DI8A 1XGUA 3MI6A 1MVUA 5C97A 4PGBB 3W56A 3ARGD 1MCBA 1B9ZA 2GIXA 3GSWB 4XBPB 5DU7A 1QZ1A 5ADOL 1A6WL 4XCCL 3HMXA 2NPLX 2CG9X 3CQFA 3IU4L 1EZUA 3BP7B 3MV9E 1QBBA 4H26A 3UG3A 5D7LA 3MGOA 1RQ5A 1OQXA 2DQDH 3PPSA 2AJZB 2Y6TE 4N2GA 3FRPB 3TJEH 4FGMA 3ATAA 4EEEA 1OAUH 4LFHD 5C6TL 3PWNA 4XXWA 5DD3L 4FG0A 4Y1AB 3LRSA 1UEMA 1JXGA 3F12A 4HC1H 4U6VL 4YSPA 2HKHL 3RGBA 2R1XA 4WRLA 3RFZB 4EQ3A 5E4IA 4L18A 2IAAC 3SE3C 1TQVA 4NQDE 1AD9B 1MQKL 3EJCA 1GL4B 5T5FL 4NQCD 5DO2C 3OKNA 5DYOB 2VRQA 3US0A 1A1MA 4DP0X 3V55A 1FI8C 4AGLA 1NGXA 1A6AA 2QDWA 5IEHB 2E4TA 3O4OB 4BHUI 5F1NB 1J0JA 1ACXA 2XQYA 2EDKA 4G8GE 4L3EB 2W92A 4R7LA 2BSSB 2XTLA 3E38A 2BJML 1UWGH 3OJMB 3P9MA 2NSXA 2GIMA 2CDEA 4N0RA 3T2QA 3N3EA 1T2QL 3QO0B 5IHWA 1UACH 4JPKH 1JHKH 1YDPB 3VXUA 1KYFA 2HFEA 2VAAA 3CQQA 1AQKH 3LS4H 3N1FC 1XCTB 1IM3B 5LHDA 5T3XD 4DP5X 1T4KB 1D6VL 1QSED 1BYPA 1MIMH 3WFCL 1B6UA 1CLYH 4RGMC 6PAZA 5K9OB 1SEQH 1Q0XH 5HHOD 3BSZL 4L8BA 3BRGC 5HVGB 4HAGA 3A5VA 2GEEA 3U2JA 5EZJA 2L04A 1Z6JT 4U1NA 5ANMB 4XMZA 3TYGL 3ARYA 5KSBB 2AMUA 4AGNA 3HZMA 2FD6H 4FNTA 5D2LB 1YMMB 4A7SA 4FA6A 1MQKH 1QFUH 4QD2E 3NK3A 4X5XB 5GJSL 2PW2A 5HYFA 4L0ZA 4BWTA 2HG0A 1A65A 3EYFB 4OLUL 4A1RA 4FTVE 4W9GC 4A7VA 4XB3A 5FXCH 4LGPB 2WBJD 1OALA 3ISYA 3I6LD 4K7PY 5D7EA 1S7VB 3WEXB 1LLAA 4GRMB 3MXVH 2G9HB 2J5LB 3MRDB 3BMVA 4OD1H 4TQ8A 4YZFE 4G1EB 4RCAA 4NB7A 4LSVH 5IMOB 4PPTA 4G8GB 2Z4QB 4QTIL 1XGZA 1IJ9A 2DI7A 2F7QA 4G71B 1E0OB 4G9DB 5GGUB 3PGCB 4H2CA 5IMMB 5FHAH 5E08H 1JZ4A 1FG9C 4F3FB 3NAAL 2OZNA 2CLRA 2EDOA 2XU9A 1KUMA 1A8ZA 3RP1A 3QORB 4HJGB 4GW4A 4E41E 1ECYA 4YLCA 2OMVA 3PL6C 3JWOC 1RZ7L 1WAAF 2JI1A 3UDWC 4FMKA 4B27A 1YEEH 1I7RB 2X12A 3KL5A 3V5HB 1MHEA 2OSLA 2EH8L 3SY0A 3NFNA 2WSDA 4WDIB 5FM5M 1JGUL 4A37A 3MRGA 3SODB 3I75B 4OZFH 3RBSA 3H2WA 5LWYL 4Y1AD 1CDIA 4M02A 2UV3A 5CHNA 5ANME 5IB1A 1PAMA 2EH7L 2GK2A 2IADB 3BW9A 2MSPA 2PPCA 3C6LB 1OF0A 3MJGX 2LAAA 4JY4A 3K2MC 3MTXA 4KKLC 1YMME 5DZOA 1GRWA 1SDDA 3IJYB 2WVVA 2GFBA 1YNTB 2WPGA 1EFXB 1M2VA 2WCPA 1RZJC 3BVTA 5AL0A 4TSCL 4IKLA 3NP4A 1MH5A 1WICA 1EWHA 3IVKA 4MNQB 5I8KH 2ATPA 1TZ8A 1HESA 1JHTA 4PJGA 2YGOA 3UGXA 2XN0A 5TTRA 3AW5A 3CU7A 4TRPH 3BZEB 1R0AL 4CKVX 2VZOA 2CWRA 3CQPA 2GUOA 1FGNL 3PQYB 4DO6A 4PJ9B 5IZ7A 3P4OA 3I02B 2Q10A 3KGTA 1AE6H 3UG4A 1SM3L 2ROYA 1G5AA 2VIRB 3DMMD 4JN2A 4Q9BA 2A74A 5IHZB 5CIPA 1EMTH 12E8L 1A1OB 1D3CA 1HS6A 2XPGB 2YAFA 4KHTL 5MEQA 2WSKA 4TVPD 1FE8H 5DUBA 5F0PB 5HYQA 3FF7A 1JGDA 5CN1A 5AOLA 3QIBA 25C8L 3D4CA 4DEWA 2NY0B 4K8RC 4MZIA 4QXTA 1JGLH 3O2DA 5K1VA 1FYTD 4Y16B 4DO5A 3KPNA 3U0WH 3MYZA 2G3ZA 1UD4A 1NZRA 2ZKMX 4HK0B 4JDVB 1Z5LB 4QXWA 4R0LC 4KNSA 3WKYA 3QDMA 2QZQA 4ETYA 4F7KA 3D2UA 4OQTH 4X83A 1BPLB 3F85A 5EZLB 3QQ4A 1F8TH 1HSAA 2W65B 3ASOB 1R75A 5C09D 4C4KT 7PAZA 1NMAL 4HUXA 4LVHB 3WJJA 5GGQH 3G6DH 4UM9D 5J9PA 2PP9A 2QKIA 3JQOB 4AENA 5GZNC 3QUZA 4HKJA 4KY2A 3AREA 1CIDA 4Z3FA 4JM2A 1RV6X 3E9UA 3ML8A 5ETUA 3ZE1B 1EDYA 4X4XB 1YMHB 4BKLB 3IMWA 5JTWA 3K1DA 4PH8A 5ESVB 1M56B 1NC4D 4PMFA 2Y5QA 4NHCH 1RJZB 3CSYA 3RWGA 4NRZA 3QAZC 1F41A 5HHME 3MPCA 5F70A 4O4YH 4JFWA 4R3SB 3BH8A 3FK3A 1EEYA 5D7JA 1N4XH 2B1AL 4P4RA 4GW5B 1KPUB 1DQDH 4OIAA 4HOZA 3G5YA 5DK0B 4GAGL 4GMSL 3PV6B 4UNIA 4XXCC 4Q9QH 5DURD 5EZOH 3ZLQC 3T0AA 3A21A 2E9GA 2X88A 4ODVL 3UADA 4EDXB 1QI4A 4C56E 2ZOTA 1TQCB 5HGAB 1MFBH 5TQ2L 4P5TB 3WFZA 5I6KA 2PYEA 3UTOA 3STBA 4V33A 4YK4C 1MI5D 1OLLA 1RHHA 2JELL 4XNXL 3IKCB 1JNLH 1KYUA 3APFA 4XP9L 4YO0A 4Z3GA 5INDA 3QZWB 5T3XE 4LMQE 2BRRH 4AEHL 5GRYA 3HFMH 3IU3B 4OZFB 4L4VE 4GW1A 3GSVA 4GY4A 1M6OB 3IFOA 5GRVL 4FI6A 3N42B 4I2XA 1U8OA 3CZUB 1K4CA 1FZKA 1CBJA 1A02N 4UM8A 1W0YT 5D2LF 2XTJE 3DHMA 1N64L 1OAKH 5IW1B 3ZDWA 3CVBA 2D7PA 3D2TA 3B9KD 1TETL 4ZFOL 1LK3H 4GRLB 4Q9RL 1NDGB 1BVKB 1X5AA 1H8NA 1IC7H 4ZTPH 1CT8A 2GTWA 4JJ5A 3SJVE 5DJCB 3KPMA 3ZKXC 5IJBC 1CFVL 1IKFL 3SBWA 1SXBA 2UWEF 4I3RH 2VDLL 4KXZI 3MBEB 4HK3N 2ZX7A 5AVWB 5CS7A 4QRPA 3QI9D 3MRFB 4OGYL 1ZHKB 4XMLH 1G7PA 4XPGL 5F1KC 3BKMH 4G8AC 5GPRA 3BKCH 3P4MA 3DBSA 1TETH 1S7VA 3LVEA 1NUNB 2A6KB 5D72L 5B38B 4L9DA 1ZIAA 3MRMA 5JHDB 4KNQA 5L0QB 3D9AL 1JZ7A 2Y6SD 4FDWA 2CCLA 2EYRB 2R83A 4H20H 3QISA 4ANVA 2TSAA 5C08E 4JRXD 4Z5RA 2R29A 3BQUC 4UINH 4AZ8A 4ZOAA 3BUYA 4XPHH 4MXQC 5EOTB 3IN2A 3L8QA 4HT1L 2DWDB 5AOIA 3EGDA 1R4XA 1Q1JH 2CCVA 2Z92A 5TF1L 2IGTA 1WS8A 3QCUH 4FN0A 5FYKE 1E67A 2VLKA 3AG3B 3UJIL 3OKLB 3QUZD 3QH3B 1IKNA 2VLRB 5FLUA 4KDVA 2EC8A 3O11B 4Y5XC 4NUJA 5DK2A 3SE9H 1U3HC 2KUTA 1HHGB 2YGNA 3HAEB 5I0XA 4A38A 1JTPA 3C09B 2VISB 1OZUA 3H9HA 43CAB 5I5MA 1TZHB 4Q9QL 2FWOA 2OCCB 4CSZA 2EKSB 2LU4A 2C4FU 3HPLA 4PJ5E 3F7YB 4Z7UB 5HJ3A 5KWYC 3WIIL 3B7TA 3SQOL 3U25A 1BAFL 4RAUB 4F2MA 5BOJA 4U6TA 1PNDA 3W2DL 4P2OC 3OLDA 1T89A 3BUDA 4E0RB 4LASH 3QHTC 2XWRA 5F9AC 4MASA 3QRBA 3RVVC 1E4HA 1U8HA 5I28A 4DP6X 3VDBA 1A8JH 2MPVA 1RL1A 4G9FE 2AK4D 2QJDA 2ERJC 4W9IC 2EDDA 2ZE0A 1JZIA 3ULVC 1YNTF 4OI8A 4JKLA 1X5IA 4Q6IA 1RULH 1WBZA 3H42L 2GTZB 4K7PH 5B3SB 4FEMA 4GKLA 3A6CL 1RLBA 2X1WL 3HE7A 4RZCA 4KUCF 4LCIH 4CAGA 4YSCA 2AJUH 3B3IB 4I18B 1JMXA 2CO6A 1YZZA 4P2QB 4PJXF 4Z3HA 2X89D 3HC0B 2H1PL 4JLRB 1UGKA 1YY8B 4PRIB 3NZUA 3RUGB 2VJXA 1DN2A 3F05A 2A1WH 4Y4KC 1QPXA 2VLJE 3RDTA 3N6YA 4P05A 5I1GH 4J2XA 3OTTA 2DIBA 3GKZA 4NSKB 4ZMQA 1JOIA 1Q94B 3GJFK 4K8RH 4MLIA 2YJLA 3S8FB 1Z2KA 3OR6B 1E5YA 1OT2A 2D4FA 4P07A 1DBBH 2JJSA 4PCYA 2BOBB 12E8H 3TCLB 3QYNA 2CO3A 4L8SC 4R8WL 2JIXB 1OARL 4I0PB 3QHFL 3MUHL 2HTKD 4TQHA 4UT9L 4AGQA 3T4AA 2PN5A 2YPLD 5AVXB 1NBYB 1G9NH 3GGWA 5F2FA 3UTTA 3R8BB 1HHIA 4LOUD 1NCWL 4LCIL 4P9HL 1F6AA 1IEAA 1OP3K 2FQDA 5CP3H 1R1CA 5MENA 4ZUTB 3QP3A 3S6CA 1E4XI 2OI9B 1UUSA 2UVEA 3EBHA 4QOKA 4BUGA 5HHOB 4HSCX 4JR9H 2GJ6A 3T4AC 2FL5B 3CN3A 4OZHE 4R0LB 3L16A 1FZOB 1BQLL 2WB7A 1CC3A 3QR1A 5C0BB 1QEWB 4Z18A 4JY6A 1C5DB 1RZIA 3OQ3B 1JPSL 1KDIA 3V4VH 1GC1H 4XP4H 2PR9A 2Y36H 5CP7B 1JTOA 4KUZL 4PJ8B 5AALA 2BVOB 4AMWA 3C6SB 2Q20A 1LE5A 3IFLH 5FWRA 3T77B 4NKIL 3QC6X 4A6YH 5I5IA 2Y25A 3GXNA 1F11A 3GJEA 1DBJL 4MSWA 4XVJL 4M7JL 5BUAA 4UYQA 5AENA 1GTNA 2UZYB 4HDIB 2OYLA 1M9SA 4M48H 3TEZA 2YUWA 2HLFC 3D50A 3C6LA 2WQWA 4KJPD 5GS0D 5DGRA 1ZT7A 5DK3A 3SBPA 1XEDA 1KJVA 2VJ0A 2WUBL 2A77L 3LS5L 1SDDB 2ZUQB 3QNZA 4HLJA 5CCGE 2Z31A 2B77A 3KDPB 3WNJA 1KXVC 3UJIH 2AK1L 4Q4IA 3AU1B 5EH1A 1U3HB 3D18A 2IPUG 1R34A 3PREA 1ADQA 1ZT1A 2M83A 3NCCB 3O8XD 1U4FA 1O9WA 2VO5A 3MRIA 1A1MB 5KVMC 3BZ4B 2ZKYA 3LDBC 4NQXA 2VMJA 5GZOA 3BZEA 2O61B 5E1AB 4DAGL 1C16A 3ZZSA 1B9KA 1KGIA 2JELH 4XNXH 3QIWD 1LM8V 3HS0A 4LRNL 4QHUA 4QXGL 1CK0L 1LP9F 2HVJB 1MPAH 1FZMB 3OJVC 1P7KB 2CDEB 1FGNH 2L3BA 1RD6A 4P5TC 2WV3A 5FUOH 3R7RA 2O5ZH 3EDEA 4ZK8A 1FZJA 3L3IA 1TQWA 2XG4B 1F4WH 1PZ5B 1V3JA 4U1IA 5CNHA 4OV5B 4G8FA 2Q1EA 1IT9H 4PJBF 1CFNA 3SKOB 2OI9C 5EUOA 1IO4C 2Z93A 1JXFA 1BVKA 3DX9B 5D1QB 1R3LA 2H26A 1IIIA 1IL1B 3ISWA 2KMWA 4ONOA 4BFNA 4QYAA 1XAKA 2D7TH 2ZOOA 2VMEA 5A6LA 2GCYB 4C4BA 3PXHA 3QUYA 1IC7L 4ZTPL 5AAMA 3UACA 1KLUA 1CIUA 1SFDA 4PJIE 3CDGB 5KSVB 5F96H 4LLQB 4PQXA 3UC0L 4D8OA 5BZZA 5BXFB 3K71B 2FNWA 4XZUA 4GUCA 1RUPL 3ZKXB 1NDMB 1NIBA 5D6DA 5D2LA 2WQUA 4Z0XA 5IJVA 4EIUA 3GI8L 3MLVL 3HBPA 1Q9OB 4PGBA 1OM3H 4G6JL 3P3YA 1C7TA 1FA4A 4YSUA 2PW2B 2ZXWB 2ZG3A 2FIRT 1ITBB 3FCUB 3MA7A 3MACH 2D3VA 4MDIA 4JNXA 4YDJB 3VXQA 2N01B 1M05A 2I9LB 2WZPD 4DGVH 5CZVL 2JSFA 3F84A 4QGYA 4BKLA 2CJ3A 1YC7A 1CFTB 1QRNA 4V2CB 5ESVA 1VERA 4UAOC 2A6JA 2A9BA 5FYKD 4MJ5A 4OM1H 1V5JA 3D3VB 3EF4A 2P3YA 2Q6WA 3EJZC 5BZDA 2VLRA 2OSXA 5ALBL 5IM7B 4E68A 2NDFA 4YC2B 5C0AE 5AAWA 3ZDXE 3TJHC 4YHIA 4HH9A 4G8EB 1QACA 2PO6C 5T1KB 2VSKB 3DK0A 3WUWA 3S34L 4MD0B 1Y0LB 1G9MC 1CDJA 1TZHA 4IDJH 1P4LB 3OPUA 4AQOA 4ZJ9A 3QUMB 4UTBL 4IMLB 4BDVB 4C57C 2FJSA 1ZHLA 3DO4A 3B5GA 3FYIB 4M7LL 3JTTA 4X6CA 5TQ0H 3DROB 4KPHH 2BW5A 2XTJD 3W38A 4NI6A 3P3RA 2C3HA 1RVFH 2J43A 2Y3AA 4G7RB 2AQRA 4QJ5B 5DF0A 4XVTH 3L6FA 2BVPA 4BELD 3ARFC 4G59C 3B9VA 4FQ2H 1XAUA 4OF3A 4WHYG 1DQVA 2B0SL 4WY7H 5G5DB 4N6RB 3E2HB 5A3ID 3DWTA 1MCNA 4QHNB 4YUEH 3V0FA 4OIIH 3FTGB 4U1GB 7PCYA 5JOPD 4FNPA 3F7LA 5E8EB 5LN4A 1EDHA 3U0WL 3PWVB 3FO1B 2Q76A 1U6AL 1NDGA 4E9VA 1FVDA 4R4ND 1S7TB 1YQVH 3K46A 3V0IA 4G6AC 4BM7A 1FORH 3KYNB 3HG5A 4AKQA 2X2HA 4ZFFA 4LEOB 2NX5A 4XP1L 1U3ZA 5IT2L 1G6RH 1G1CA 5A2IH 1E9OA 4TVPL 1F2XK 1R9FA 1P7QB 2UX6A 1WTGT 3GIZL 4O02H 4PCSA 5PAZA 1EEZB 3JYCA 5C0AB 5DJDA 3RWFA 4L3EE 5I1EL 1RUPH 3JV0A 1KT2A 4Z76B 1JD7A 1OGTB 4P06A 3UPCA 5HGHB 4GBXB 3AZUA 5B8CC 4AUYA 2HT4C 4XN5A 2YR3A 1GGBL 1XXDC 5JIPA 1GZPA 5CD5D 1AGFA 2FAUA 2DH3A 4Z7WE 2AQSA 2CO1A 4XWOD 1I7RA 4PFEA 1JNHB 2O5YH 3SY0B 3GO1L 3VXRE 4JDTH 1BIIB 5E6UB 1I3RB 2R0KH 2JWYA 3NZHH 3MGOB 2VNCA 2WQVA 4OLYH 4D9QD 3DC0A 4EE2A 1N10A 1O7SA 3GEWB 1OP5K 2EDFA 3LH2H 1ORQA 4DKTA 3OLIA 4UDUB 5TE7H 2FQGA 2VN7A 1JV2B 4PVLA 3UCRA 4JR9L 4LQFL 2JMRA 1H3UA 5HDBB 4NO5A 2DB8A 1I3GH 3PWUB 4K15A 3RWEB 2AERT 2DV6A 2AKRA 1P4UA 4KH9A 4R7DA 1I1YB 2W59A 5HJDA 4MKTA 4OCSL 3UJJL 2EJ1A 3CFMA 2NY5C 2CUAA 3QXAA 1RERA 5GGRY 4AQEB 2EKSA 2XHNA 3PLYA 2X44D 3SQRA 3HZ3A 1MAJA 3LZFL 2F7OA 1FN4A 1DDHA 3FAWA 3PDOB 3BVNA 4G8GD 4NQEB 3AY4C 4DETA 3QORC 4FTVB 4D3CL 3FQ2A 4Q56A 2VL4A 4AQZA 2FEJA 4N8VB 3ZRSA 1YEKL 2VYRE 1TLKA 3MV7E 1OT1A 4NHUB 1QLEH 1S7SA 1MVFA 4J8RB 3W11C 4CC0A 5ABDE 5D1XB 1K85A 5E2VH 5K9QI 2Y22A 4L9LB 1NPJA 4UIKL 5C92A 4PJ6A 4BA8A 2R8SH 2W9LA 4Y5XA 3LD8C 1KB5B 2W0PA 4QRSB 4WHCA 5IJKA 3RKDD 1UGNA 2DQHH 4C83B 4LK4A 2XDHA 1XO8A 4ZUWA 1BJMA 2FSEA 4KTEL 3LSOB 4JCMA 5HGGS 4ELKA 2FO4B 1FVEB 4Z7WB 3L3KA 5I8CB 5I76B 2HRPH 3BXNB 4FCHA 4HJUA 2XVKA 4RAVB 1PGRB 1QAWA 4WJ5B 3F62A 2PXYD 4OD3L 4QCIA 3BO8B 1RZ8B 3IJSB 3EJRA 3HCVB 4HK0A 1B0IA 2VXQL 1YMMA 1SJEB 3OX8B 1DJYA 4K3DH 5CN2A 3EDDA 2VN5A 3GSVB 2XX1A 3QEHB 4X99A 1BVOA 2R1WA 4CUCA 2XWEA 1CI5A 1CVSC 4X4ME 1FGVH 2C3VA 2F8IA 3POCA 4JHAL 4APXA 5JW3L 2F54A 2FJGB 4FQHA 4DP1X 3CN1A 1LMKA 4P59H 4WSGA 4WUUE 1MCDA 4G82A 1BF8A 3GK8L 2FHFA 3RNKA 2OQJB 3OPZL 3BPNC 4GRLA 2AQ1A 4LCUA 5FYJL 1QW9A 3INUL 4YHPB 1BQKA 5CJ5A 1HAWA 3OJDA 3D2UB 3T0EA 4KKBD 5I8EB 4MS6A 5HYIA 1JV5A 3TCXA 2YN3A 1XVSA 3U46B 4PRDA 4DP4X 4FG4A 4MDIB 4PTTB 4UDTA 4P2QD 3DI3B 4GO6B 5IBLD 1KPVA 1OT4A 1D9KA 4QT5A 2Y7QA 1BXUA 3PFUA 1GPOL 2VC2H 3KWXA 3WL9A 2WVTA 2XWCA 3K72B 4P3CH 4N2AA 5E1QA 1V54B 3X3GL 3DV6B 3IMVA 5KSBF 4L9LC 2VQUA 4PLKD 3V5HA 4B96A 1G5GA 3E6FA 3GHBH 4MVBD 1AIFB 3FOMA 3V0HA 3LRKA 1E3ZA 1OM3L 5E6IC 2Y7NA 2JQMA 4NPYA 4B0MB 5GS0L 4YZWA 2B1OA 3BCFA 3JWNH 1UJ3C 4P3DB 3VGBA 1MZZA 1UVQA 5IJDC 5FHBH 1PG7H 3CN2A 3JV6B 1HHJB 1FV1B 2H32H 3QDGE 4Q9CA 1HK6A 1SDAB 3FOLA 5E6ID 2HTLC 5G55A 1WFJA 3RWCA 3E7JA 2Q86B 1U4EA 1VFBB 4OZIB 4OCYH 2R2EA 3F58L 2LFEA 4NUJB 2NLJB 4TN9A 5DK2B 2ATPB 4AV0A 2H0FA 3WY1A 2WBKA 3QJZA 3FN0L 2O61A 3OXSA 1TO4A 4NDMA 1F4WL 2BO0A 3NFPA 3V6OE 1L3WA 2X4OA 5DRZB 1MCHA 5F7DB 4A6YB 2I60H 1KCBA 1DQJA 3TZVD 1ZLSL 3TVMB 1U3NA 3MLSL 1IBZA 1NC4A 4AYFA 3QDJD 1JPST 4N68A 5DVLA 1TPXB 1JFHA 2Y06L 5FDWB 1KENL 1EFQA 2FDBP 5KANG 2NCMA 4P3CL 3QUZC 1DQQB 3QARA 2WD0A 1Q1JL 3BAXA 1D5ZA 4ZAKD 1WEJL 5CILL 4RZKA 3U4BH 4AIXA 5K69A 2TAAA 3LD8B 4UQ9A 5CMAA 4H8WH 1OY3B 2XIBA 5L88L 4KMTL 3VWKD 3Q1SH 1ZTXL 2FX9H 4PWJA 5HYQB 4YAQB 5LCVL 1BVNT 2FZ3A 1YNLL 4I13B 2PPEA 4M5YL 4ZAKC 3S5ZA 1BYNA 1ZCRA 2WUCL 3VI4A 1GY2A 4HKXB 4FQLH 4XBMA 1SXSA 3Q6FA 1NUGA 3KPNB 5AVQB 3VXUD 3OB8A 3NABH 4XCFL 1E2ZA 4G9FD 1P69B 3KEDA 3BVWA 3KPPA 3GYRA 4Z95L 2FT7A 3W9DB 4JFYA 4GSDH 1JTTA 2Z9TA 4OJAA 1OAJA 2F54D 3T0EC 1V7NL 3NJMA 3PU7A 4WFGD 3TTYA 2ITDA 2OJZL 1X5XA 3KPOB 3NCJL 4UT7L 4W68A 5CXPA 2H8PA 1IAOA 1PMYA 4GRLD 3RZCC 4CBZA 5JW5B 2VW7A 1XGRA 4L4VB 3VUAA 3C5ZB 5TDPB 3VSVA 4YSEA 1AR1C 1LEGB 3LKRB 2A6JB 3T4AB 2DQUL 5K33A 4JB9H 3VQLA 3WNNA 1M1XB 3GGWB 2RJMA 4ONFL 4IM8A 4HUVB 3PIQA 4R84A 2YWYA 2NY4D 3DOSA 3IXTB 2AXFA 2I7OA 5IROD 1W0VA 1DN0A 1UOWA 4PWEA 2LU3A 4S2SA 4XX5A 5EU3A 5KANI 4TVSa 3B34A 1FCCA 1GGIL 1CQKA 3IJ8A 3ZTNH 4L2YA 4U1LB 3TPKA 1ZS2A 3VXSE 3SYPA 4PP2B 5C08D 3QDME 3AS2A 4FZ8H 3C8HA 3PXLA 3V52H 3D25B 2V5SA 4AYBA 2EEAA 2O26U 4PREB 5J6HB 4OUUA 2OL3A 1N6VA 4N8PA 1FVCB 3MYJA 3ZSTA 3FL7A 2P43B 1J0YA 2CJUH 3DJZA 4OR1A 5HDRA 3U0PB 2ZZUT 2GJ6D 2H6UA 2NYYD 4HEMA 4RAUA 4F2MB 5DC0A 5LAXB 1JPGB 2O6CA 2X6BA 1C8PA 2V7HA 1KBVA 5CZXC 4YNYB 2LABA 1HILA 5IFAH 3DMMB 1UD5A 1KF9B 2K8MA 3B9AA 3D8MA 1FQ9C 2X9WA 3OC8A 4LIQH 3VWJC 3ZTEA 3A4DA 4QRPE 1FNFA 4MQ7A 1MI5A 5C0RH 2H1PH 3TA4D 1FAIL 4KXCA 1RUMH 1DYZA 2HPOA 4JFVA 4PJHF 3VRIB 4BZ1A 3UPRB 4HIIB 3P0YH 3IDIA 3WNIA 4NGHH 3RDJA 3VJ6A 3QS2A 4JLRA 3MLYL 1XGPB 3CFBA 3CPLA 4JFPA 2YLHA 1E4KC 5E5UB 3WKNA 5GZOC 3WEXA 3GKWH 3ULVF 3K0YA 4AH2A 2CBTA 4YIQB 5JOFB 1HINH 5D7LD 4E9QA 5D71L 5AB9A 3AS3A 2H6PB 3L4TA 4QEGA 3SB3A 4LESA 3VI3E 3TIEB 1P7QA 2Z8VC 1JUFA 2Y24A 4QRTA 3B2UD 4D7PA 1M7IA 3ARDB 1UZGA 3PGFH 3OKOA 1LTXA 2GY7B 1ACCA 1KT2B 1TO5A 3L45A 4Z76A 5C3IA 5B3JF 2WWKO 3S4SA 4R4FH 4NCDA 2IC2A 1K6QL 5SWQB 1F13A 3UP6A 4JUTA 3UZQB 4E9LA 1USZA 5CR8A 5TJWK 1QLEB 3IDXL 4OV6F 1UXLA 1CXFA 3ILEA 4GO9A 4JO2L 2ZX5A 1UM6L 4MFHA 3MN8A 3RVWD 3PHOA 3KYOB 4Y5YC 4L8CB 2J4WH 5DHXB 2V17L 4P2OA 4B3VA 2J8UB 4XTRD 3KEHA 4Z78A 5L4MA 1KN2H 1ZS8A 1B88A 3PL6B 4FULA 5HJBA 1TT6A 4A7GA 4LDCA 3IDJA 2ZF8A 2R2BA 1DQLL 1L9NA 1RK7A 4Y9FA 4ESKA 1CICA 2IDCA 2WBXA 4FLHA 1TDQA 3HR6A 1LO2H 4PB9H 2YBRB 1MVYA 5L9DH 1FL3A 5FYJE 4PRIE 1S3RA 1IKOP 4HCGA 4YUEL 2E9WA 2W0FA 4YDJA 1TYJA 3ETSA 5JPNA 1BF5A 2MCPL 2BDNL 1H5BC 2NY4B 3GT6A 5DJ0A 4YBQD 3QEQB 1FN4B 2GJRA 1A9VA 3EBAA 1I8KA 5DQJA 5IBUB 5G4NA 3MZTA 3ES6A 3V0VA 3KWWA 4N8VA 5EHFA 4L4TE 1AZVA 1HHHB 3EZ8A 4KOCA 4DN4L 1TCRB 2X3BA 3W3BA 2NTFA 2JKRM 4MTMA 5B1AB 2VR3A 3QS3A 4I77H 4OTXH 4MHHI 2C9RA 5HYJD 5MP6L 3DXAD 4LARL 1MCWM 1I9IH 3OBAA 1JRHI 4PBWD 5LNEA 1OTSD 3IU3A 1SFHA 4V1DB 2XSKA 3DX9A 3GQFA 1CGUA 1U0QA 2QSCH 3S8WA 4O02B 1CVRA 1P1ZB 2DQJH 2PTTB 3V0AC 2X4OB 2J1XA 4G6JH 3LEYH 3I3DA 2LLLA 3TVMA 2KZBA 3CFTA 3IJ9A 4RMRA 2CO6B 5H35A 2D7OA 1JF6A 4HPHA 4MMYB 2CRZA 4F20A 2CJTA 4XP1H 1NC2B 3NTCH 2EYSA 3AM8A 4LSQL 4MJHA 4ODXB 1A7OH 4YSDA 4POYA 5BOPA 2XQBL 1WBXB 4M3KB 4YBLB 1MIML 1R46A 4GT0A 5T1MA 5HP5A 3KBHE 2X0VA 3KWTA 3TBSA 1PZBA 5FKPB 1KULA 3DIFB 4JVUA 1AHWB 5TK4A 3KGSA 4N6QA 1FSKB 3FTWA 4P2RD 4PJ7F 2XKNB 5DC4B 3SO3C 1N0LB 4BFIB 2C3VB 4F9PC 3ULUE 4XXWC 4Z3IA 1DSFH 1P5VA 2IAMB 4JJHA 2UYLB 4HZAA 1K4DB 3PJNA 4BK5A 4TL4A 1Z9NA 2MKLC 4WEBL 1EGJH 5LJYH 2XTJC 1QFHA 3LHAA 4PJBE 3FU9A 3V5KA 1MPAL 3VFGH 5EOQH 4MQXD 5JPNC 3IT8D 2CA3A 2NX5B 4ELMF 4HWBA 1WV7T 3OSVA 1FBIH 3WSQH 5B7FA 4X98B 1VPOL 1WGVA 4G11A 4JANA 2VM9A 4UNUA 5A2AA 2PMZA 3LXBA 2YARA 3ESUF 5DK0A 4LCVA 1F45A 1G7JB 5IQ9A 1TTGA 5ERWA 5CCJA 4H88H 4YS4A 4OZGF 4TUUA 1T5WA 2JJWA 1WZKA 3FUHA 4JG1H 1WZAA 5FCUL 2PNDA 1OGPA 1CD0A 4FABH 3CFQA 2D7MA 3AJ7A 4C4KO 2BVQA 2R0KL 1ZD6A 1AFVL 1E5BA 1YNKL 2CMRH 3FQTA 4MA3A 4PW3A 5ECGA 3WIFB 3LTVA 4DGWC 1TJGH 4G6AD 3FKUS 5TDOB 1I3RA 2A9NH 2UWEE 4OCNC 1PX3A 1C12A 1URZA 2MEJB 3HN3A 2ATAA 2WJ5A 2JKIS 3MO1B 4J3SA 2R51A 1DVSA 3TBYB 3X13B 1ETB1 5KSAA 4HWEH 1KJ2L 1QBLL 4PY7A 1E90A 4HFUH 5C07B 3X11B 1TU2B 1J1XL 3VSQA 3KW8A 3M7FB 2P8PB 3DURA 3VGEA 4HXBH 5G5DA 4UUJA 4JPSA 4WI2A 3MR9A 2ZOWA 1C1EL 3EHBB 3PYCA 4J27A 4BKSC 2QL1A 4ODWB 2EIBA 2FEDC 2JJUA 4H88L 3GI8H 1KCKA 1NGPH 3BHBA 3UO8B 3WO4C 4DP2X 1IIKA 5CEZH 4HIHA 5DJ2A 2WYIA 4NKOA 5DC2A 1XB8A 1IGML 2JCCA 4KK5D 5IOPB 2FT8A 5I19H 3IMUA 5FLVA 1FYTA 2WLIB 1DCEA 2NR6C 4TNVK 4WUKH 1UB6A 5AOZA 5KVGE 2QR0B 2JH2A 2QELA 1TJGL 4WI0B 2OMBA 1RU9H 5FDWA 3SE8L 5K9JL 1UZ8B 4R2GC 1FO0L 1KCVL 1S7XB 4H0HB 1NAKH 2FQFA 4ZUSB 4W9EC 1THAA 3CPLB 2G5RA 1XB3A 3D3VE 5EOCH 3LIZA 5J7CC 4BSVA 3P3TA 1MW3A 5I30H 4Q6YA 3K2KA 3GO1H 4KPHL 4WFFD 3BGAA 4KWUA 4BBWA 3QUYB 5BS0E 4Y8DC 3E2HC 3KCPA 2W9DH 1FC2D 4MBRA 1MKFA 4QRRB 5CGYD 3QT2A 2FLBT 2IMNA 4XAKD 3O3BA 3QULB 1IUZA 2A5UA 4PRHA 4ZMOA 3S97C 5IKCB 3UBXG 1YA5A 2A7BA 1TJHH 4JFQA 3A3YB 2XWTA 3FZUC 5F3HB 4JM4L 3WYRA 2AGJH 2FVNA 2VL5B 3TT1L 1MCIA 3L08A 1UB5A 3BWUF 2NNRA 1Q9WB 5EMYA 4JKMA 4MX7B 4D0BA 2ZCHL 3P0GB 3L3GA 2VXSH 5I2IB 2GPZA 4WWKB 3QUXA 1YQ2A 2MQCA 4L5FE 5AVVB 2X1XR 4HS6A 4YPGB 4KRPD 1HQ4B 4JM2C 2LAGB 1A0QH 1NMBH 2XQ0A 5DUPL 3V5DA 2MWCA 1KLFB 5JDSB 3ARFA 3SPHA 3VNZA 1BXAA 5EU3B 5DVKA 2BWQA 1E9QB 3P2BA 4KUCD 2ZNWA 4ZDHA 4NO3A 4KAQH 1CQYA 4GI8A 4XN8A 3QQNA 3G9AB 4K55A 3WDJA 4UDTB 4PG9B 2WWMD 5JMRA 2FJFB 1ZTXE 2YC1B 4B97A 5T3ZD 3DSFL 5DJ0B 3IF1A 1BZ7A 2DL9A 4ZTEA 3UTSA 4HOWA 5DUML 5I6NA 3D4ZA 2C26A 3L5WB 5SWSD 2R23B 1R6VA 1O7DC 1U2HA 4OFYD 4RMVA 4AIZB 3VFSA 5BVPH 1QW8A 2QKSA 5FDYA 1M9WA 4KMTH 3NJIA 3QG7H 4ZNEE 1ZWIA 2XRAH 5I66B 3UAEA 3E6FB 5GJSH 3HRZB 2WXQA 2YUXA 3SSGA 2VR9A 3BXNA 1S7QB 4I0CC 5C08A 2X05A 4HT1H 2WLYA 4LDEB 3U30B 3GBLA 3MUJA 1L3NA 3N43F 1S7UB 3O3EA 2YD5A 1DVUA 1C5CH 1I9JH 3GSNH 1P4BL 1SXCA 2JJTA 3MXWL 3NMEA 3QEHA 2CR3A 1IV8A 1RMFL 3C60A 4DW2H 5ICZB 2NRDA 4KVPA 3TF7C 3B2MA 5A2BA 1SMAA 1NFDF 1RZGA 2NY3B 4X9YA 4XE0A 4R4FL 3RKPA 3WFBL 5IMLA 2LQRA 4P4KD 4DCQB 5FW6A 2BSCA 1I8LA 4PS4H 2B5IB 1F0LA 1XH0A 1CICD 4ONGL 1AXIB 3VI4F 4WSKA 3CHRA 1TENA 1AQKL 3CVCA 4YJZL 5HGDA 2FBJL 3EYQD 3R06A 1C16B 4KVNL 1DVYA 5BRZB 4C8XA 3EJYC 1K3ZA 3LEVL 5CEYA 1BFTA 4IOFD 2EDWA 2GCYA 1NGWA 2OV0A 3LEYL 5EBLA 1GHFH 4JJOA 1K4DA 4FFZL 3EJYD 3LJ3A 2WWKT 1QMUA 3LH9A 4XRCA 3VGGA 5FOBB 4ONFH 3NCFB 5JNYA 2K4WA 4L37B 1A4KB 3UCQA 2IPTH 4N5ED 5FFOA 3MV7B 4Q2ZB 3ULVL 2H2SC 2R56L 3LKPA 1VFOA 5D1XE 1HJBC 2DQTH 1GPOH 2HZHA 3IMSA 3B2DC 4PBDA 1N2RB 3N04A 2AXHA 1CXLA 1U8QA 3AQZA 3MCKB 1D5MB 3LZQA 3TEYA 4IIQC 2BX5A 2FHBA 2XVGA 1BQLH 2P47B 5JR1L 1MVUB 4Z7IA 3FOLB 2CJUL 3DX0A 1Q9OA 2J6WA 3KYMB 4EZKA 4S10A 4CW1A 2X40A 5FYKU 3AS0A 4RMTA 2WNGA 4I5BB 1SHMA 3HOGA 3X14B 4FG6D 2L7UA 2ITDB 3BIBX 3MRNB 1HCZA 3LEXB 3WMQA 1MNNA 1D2OA 3BP7A 2ZUXA 3VWKC 3CE1A 3AWGA 3ZHLA 1QFPA 1IQDB 1GYCA 2R0ZH 4H40A 4R96B 5C0RL 4L8DA 3U4BL 2PWEA 1R24A 1PG7X 5C09A 1ADWA 2CBMA 3U6RA 3QG7L 3HE7C 4JKWA 5KZCB 3DROA 5D5MF 4BZ2L 3O3UN 1ZV9A 2EXTA 5HHVL 3ET9F 3W0WE 4PMEA 2BIMA 5JDJA 3MODH 2HH0H 1S9VA 4KDTA 4YHKH 5KG9A 4NZ8A 1SXAA 1EHLH 5ISZD 1EH9A 1QHOA 2C9AA 2L7EA 3RZCD 3X17A 3DVGA 5AKSA 4DKAA 3ZHNA 4Y19D 4NKMA 1TVHA 4OQTL 2V5RA 1B3JA 2E5EA 2WINA 2BWDA 1NTDA 1H19A 4ODXA 2BWIA 1JPGA 3J2PA 3DRTB 2EXYC 3EUDA 4H1LH 1OCWH 1XCTA 4JKPL 1SEBA 2AV1B 5EIVA 4TOYL 2NY3D 4LSSL 1U8JB 1JZHA 5KUKA 5GXBB 5J12B 1MAML 2QADD 4LL1A 2XA8L 5JHLH 3TVMD 2DQFB 1TFHA 3PHQB 2KLTA 2PXYA 2WOBA 2OJZH 2BZCA 2XFGB 3MA7B 4XE5B 3S35H 4E9XA 5LGJB 1PX4A 3D48R 1IAOB 3FO9B 4Z7UF 4N1CA 4U1NB 2JKWA 1VSCA 3H9SA 1FO0A 2C1PB 3NDYE 2G4GA 1YEHH 3TVMC 3VXMB 3ZOAA 3Q6FB 1YEDB 4DZBA 1XH1A 2J2ZB 2QPDB 3MLSH 1GYUA 1RURL 1A3QA 2ZOUA 3FN3A 4I0KA 2GBVA 5DDHA 3L9BA 2OKMA 3MUGB 3V10A 1E27B 1WVZA 3ZGIA 4EUPB 2YRZA 5K9QG 3M6DA 2PETA 4MXVE 2FWSA 3LPPA 1FE8L 3WENA 1IGYA 5DD0H 3VNYA 5BV7C 1OL0A 2ZD0A 1LP9A 3L3GB 1R47A 2HLAB 4X5PA 3SO5A 1IEBB 5JIIA 1JGVL 2ZUTA 1YEIH 3LNFA 3TNMA 4IIQA 2VABB 4OIFA 3C09C 3MROA 5SWQA 3RTQD 4YPGA 4D0DA 1C7SA 1T83A 3QDAA 3X3FL 3IKKA 4P2CG 3CH8A 5FYLL 2JLPA 3TURA 1FFOA 1S78D 1ODUA 4KZEL 2I9TB 3GI9L 3VSTA 3T9WA 1D7BA 4J4PA 1HILB 2XA8H 3FO0L 3ZHKA 3DMMA 2R1YB 2ZCKL 2IV8A 4IKJA 1TZIA 4PJ9C 3SDYH 1PY9A 1Y7VA 4U6YA 2ZUSA 5GGSY 1SJMA 2G5BB 3NCWA 5JW4N 3FQRA 1JBJA 2I5YH 2EE3A 2OK0L 1N7ML 2R2EB 3DX4A 5EO0A 3CFDB 4IGBB 4CJ1A 1F4YH 2X4PB 4JFFB 3S5YA 1BIHA 3CFJB 3IE4A 15C8L 3ATFA 3NAAH 3OM3B 2GI0A 5CSZA 4CU6A 1HE8A 1OCCB 2XIDA 3H3KA 3B6SA 3OR7B 5C08B 5T5FA 3S37H 5I1JH 3NIFB 5IESL 1JK8B 4KDTC 3W57A 4AQEA 1IAII 2NY0D 2BXZA 4EZMA 4WEUD 4ZX5A 4N20A 5DLML 1QRNE 1FYTB 2AJXH 3MGTA 5DVNA 3KPSB 4JY4B 2VQTA 3WFDH 5CJXA 3KWWB 5TPWH 5JPMA 1ZGLB 1JGUH 3Q2LA 4B7LA 4O51B 2EH8H 3ZJAA 1MJUH 5GRJH 3VG0L 4ZS7L 1I9JL 1OGAE 4NC2B 4XVTL 4MBOA 1MFCL 3D87B 3H1ZA 5CJQL 3ABLB 2AP2A 1INDH 2OMWA 4V1DA 1E8WA 5CJ8A 1KB5A 3S35X 3WDHA 4MAYA 2Y06H 1USQA 3OF6D 4UQ3A 2HVKB 4BINA 2YPVL 2Z4QA 4YBQC 1KSRA 5E8OB 3KHOA 4LE8A 2MMXA 4APXB 3KLAA 4MMYA 5CIPH 3UTSE 2ZOKA 3GDCA 2OQJA 3G6JE 2HRPL 4N22A 3X1FA 2VM3A 4O2CB 4A7UA 3L1OH 4HCIA 4NNPL 1XZ0A 1ZHBB 2BNRB 2Z1KA 4HCRL 2A74B 4GMSH 2DQCH 1RH8A 2ZIDA 3QFJD 1CGYA 2PCFA 1AZRA 1L9PA 1NKGA 3WE6A 4RISL 4DSYA 3UMNA 3UZQA 4U1SA 3ZRCC 4HXBL 4P46C 4WI4A 5EU4B 4BFBD 4GLRH 5I75C 1FNSH 4NZTH 2WXJA 4OFVA 4AXWB 4BFJA 4PTTA 5HYJE 4GI9A 2J88L 3FC8A 1M57B 5C0GB 2B2XL 4BWWA 5DFTA 2NXZC 1M7XA 1IGJA 5E7FA 1I7UB 4P5MA 4WW2A 2CGRL 3ZKMC 5KSUB 3QEQA 1SY6L 1M1XA 3CPUA 3P9LB 2YD1A 4Z7VF 3FRPA 5DFVD 5KS9A 4JDZA 4PJ8A 2OYPA 3RUGF 4I3SL 1NGQL 3ZIMA 3AXHA 2X2IA 5D4JA 2VDQH 1XBRA 1O6SB 2CHDA 3GTNA 1NMAH 1A6VH 4PVNA 3UYPA 2A74C 3N0PB 4FCAA 4AMXA 3RGVC 4CSPA 5IEKB 1MUJA 1FNGA 1JMZA 1V10A 4Y9BA 2XXGA 1XHHA 3MC0A 1UEYA 5FM8A 5CLXA 5LNDA 3DDGA 3SQBA 4U6HA 5I71B 2IFFH 4PJFF 3ZE0E 3MCLL 5AOJA 2MTPA 1EK3A 4WTWA 5EU7C 5MEOB 4HBQA 1ETJA 5ACZB 3CLFH 2LE9A 3MRPB 5IVZA 3BH8B 5I76A 4YNYA 3A4EA 1QKZL 2VDPL 3I9GH 3QXDB 1YDPA 4HPYL 3QZWG 5DYFA 3IB4A 5KOVC 1HXYA 1UVQB 5H2BA 1IFHH 2CHZA 2AK4E 2AEWA 1JZ5A 1SJVA 4MQTB 3SJVD 5IVXF 1X4YA 2VLME 1PCSA 3D06A 2Q86A 3CVHL 3MNWA 5DS8A 4BWUA 4PV8A 1N0LA 4NQQA 3ESVF 4RSVA 1CTNA 2B7DT 3QQ9D 3WTYA 5J13C 1JZ3A 4KKPA 1KWGA 3A67L 3KJ6L 4NYLB 3EG9A 3RFRA 1L0QA 4FE9A 4TVPH 3HKZA 3NFPB 2YAMA 2CBOA 4FFYL 1IL1A 1UASA 3T0EB 3DIFA 1P0SE 1TEGA 3ZTJG 2ZPKH 4GOSA 1DJHA 2EIJB 3OAYK 1E50A 1TJMA 4JZJB 1K8DB 1G7JA 2YEZA 2BRQA 1MWAL 4JRYA 5JPMC 2OW6A 3GC3A 1WWAX 1ZK9A 1XGYH 2GIYA 4TSAH 5L6YH 4MB1A 3IFNL 1KBKA 3ZDYF 3IMBA 3S3BB 4CA4A 1JN6B 3A47A 2L4OA 1BD2A 3ZE0B 2ICWI 5LGHL 1UFGA 5LVEA 3D85A 2BNUA 3NSYA 1J9TA 1GJUA 4M43H 2XV3A 4YHNB 5J89A 1GS6X 3PUCA 4WV1C 4OF5A 4Z3TA 5E6YA 4NC1E 1EO8H 3SCMB 2KPWA 4I8DA 1LYQA 1IC5L 1AANA 2VXTH 4I4WB 1CICB 1KIUB 4HJGA 1CGSL 4NERA 4F9PA 1AE6L 2XWJA 3CDFA 3M1BB 5FGRA 2KQNA 2QDVA 3PJSB 5ID1A 5INCB 5BRZD 4K2UL 4PJAF 2E7LA 1DO6A 3BEWA 1XSKA 3ZPDA 2Y4SA 3D39D 5HY9B 2NSMA 4WEBH 3O45B 5E00A 2ZCZA 3BUYB 3CLWA 1KC5L 5E56A 4FQ2L 5IR1B 1R3KB 4IU2B 35C8L 1AGBB 4Y88A 2ICCA 4DFIA 3KDMA 4XCEA 5C07A 3X11A 5F7DA 1TU2A 1RK1B 5L4FA 5CBEA 2HRLA 3ESPA 3ARFB 2XZAH 2H9GB 3MV9B 1J1OL 4KOBA 4GQ9L 3H8NA 4M1DL 1ZK5A 1XGYL 3GPEA 3BUBA 4K73A 3FRPG 3NIGB 1NBVH 3BP5B 4HMEA 1KPRA 4Y2OB 4JHWH 1GMEA 3OKNB 3IPEA 5A16B 1S4IA 2BC4A 3DV4B 2OMTA 3C75A 1E30A 4UTBA 4HKBA 2BP3A 4XX1E 3WEOA 4EF3A 3C87A 1HEZA 1TPXC 3FFCD 1T0NA 1UD3A 3VFWB 5IFHH 3NJKA 4NQDB 3LOWA 3G9VA 2Q7YB 3SE4A 1DJZA 5I1KL 5DA0B 2DQGL 2X41A 2OTWB 4O51A 2EYSB 1ZSHA 3K6OA 3ATBA 1YUKB 1KCUH 1HXMB 4LKCA 3BN9C 3O3AA 4LL9A 4LP5A 1XH2A 5ENWA 3BFQG 5DJ8B 1F00I 1MFMA 2C3GA 3M1CA 1MREL 4JO3H 3CFEA 5A1AA 4AT6B 5HVHC 5H94A 2XCMC 4DOHB 3BESR 2ZWSA 1DZ0A 4XI5D 3LIUA 4D0BB 4LHUA 4LSVL 4LPWA 1G7QB 3ZSSA 2V8LA 4D0CA 3HC0A 4XN7A 3WJLA 1EEZA 1PIFA 2IPKB 3P4LA 4EZLA 4PRIA 3T0XA 1MQ8A 1E42A 5EU7E 3O0RH 3GDBA 5KYNA 1KNOA 3OHXA 4NM8L 1PJ9A 5AL8A 4FL4C 2HWZH 4UQ2A 3ZW3A 1PIGA 4BXVA 4HUVA 1OTTC 4WI6A 3I6KA 2XBDA 3K5SA 4XBGA 5FKAB 5F7EH 3N2JA 2A6IB 3QUYD 2QFPA 4GP4B 4ZMZA 1LE9B 2H0PA 5AW2B 3SKNB 3TBWB 3WKQA 4F3FA 4AKPA 2D2OA 1GGTA 3U0TB 5KBPA 4FI8A 3WS3A 4PWIA 4ETQB 2VABA 4L37A 4UT9H 5AW3B 4FQJL 1SYVB 1KYDA 3P9LA 5TFSH 4AUUA 1KMGA 3CZJA 4U3XA 5JDSA 4Z7NB 3FUFA 2P5WD 4AYDC 1Q0XL 1DBBL 3IGLA 3UBXI 1JRHL 5KAQG 1DVZA 1NMCB 1XL4A 3DA0A 3WLWC 1M3IA 3KYOA 3RDTC 3MRLB 1WAPA 3BT2L 3CFCL 4IHOA 4X6BB 4AMKL 4DGYL 1BHGA 2E9BA 4ZQKB 5CWSA 1MRDL 4YL9A 1EV2E 5AQ0A 1RJLA 1SY6A 4ZW7A 1U58A 4X6DB 4RMWA 2GTZA 3ARBD 3SKUD 1JDAA 4LQ1A 1LXMA 1S7RA 2QLVB 4WFED 5EF0A 4GXFA 1OAYH 1SOKA 2SEBB 3MSPA 2FGWH 4ODWA 3L3JA 4KZDL 4W4OC 5D1XA 2VZUA 4E42B 1REIA 2ENQA 3HE6A 3E6HA 4NJ9L 5I16A 2APFA 3RGVB 3ZBMA 1A7BA 4RAHA 5AYUH 4YHKL 4ELMB 4Y9GA 4E41B 2B1HL 5D4IA 4JB9L 3A6OA 4Y2DA 4BQ9A 4Y4HA 4OTXL 3TXAA 4L8SB 5I71C 3GSOB 1FVEA 3CSPA 4A6YL 4F1SA 1JVKA 3HFML 4KVNH 2IAMD 4YGVB 3RILA 1MH5B 2FJHA 3TO4D 2HFEB 4AEIH 1MRDH 2FBOJ 3I9AA 4D8PB 4R5VA 1NCJA 2RQEA 4FNLL 3VWJA 4W9ZA 4IS6B 2V8MA 2YAEA 4U31A 4FHKA 5IUSA 1CT8B 2GTWB 4JJ5B 4WLCA 4EKXA 5CAYB 4M62L 5IG7B 3V2AR 2DWYA 5J06A 1IGCH 4HF5H 1T0OA 4YX2L 3NPSB 1KBPA 3M17B 4FHBD 5EUOF 3INUH 2CH8A 2P42B 1GTFA 2VDKH 3W0WD 2QSQA 5T1MB 2VWEC 2Y3NA 3U2IA 4ONHB 4YDNA 3E3QE 3AREC 3V5KB 2Z7UA 3L3OB 4A68A 4JS7A 2GKIA 2APTA 5EIIA 4L4TA 4U1SB 1GGCH 1PKQA 4X7FC 1TOXA 1NICA 1DEEB 1UKTA 3WDIA 3EYFA 1L0YA 1E28B 1T66C 1P5VB 2YKLH 5E2WL 4MRCA 5IMKA 1H3PH 2OL3H 1QTPA 2CM6A 4NUPA 1Q0YL 4B5ZA 2ZCKH 2PWFA 3KLQA 3SDXA 4NUGH 4JRLA 1MHPH 2WQSA 4XP6H 2ICEA 1S7WB 4QRBA 3K72A 1W8NA 4XHQA 1BDYA 1YUHB 2O6PA 1RZFH 4R3SA 1AIFA 2WANA 1YNTA 4Z77B 4MAUL 4JZOB 1OPGH 1YEIL 4P3DA 2X2JA 3AITA 1ZT1B 5AKTA 3MFGB 1Q8MA 2X42A 1OB0A 3MRIB 3V4VL 1WD8A 1H3XA 4S0HA 3SBRA 1JCVA 3DGCR 1PDKA 2XICA 3UBXB 5L2KB 3KLHC 3ARSA 5EEWA 5FO7A 2IVFC 4RMUA 1TTFA 3ULUD 1TJIH 3CSYB 4YDLC 1YYML 3TBBA 4OJFL 4PRBA 2BIIA 1MFDL 2NUPB 3CH1B 3MREB 4LOVA 3QCUL 4WNQA 3L1FA 3UH8A 1S8DA 1LEIB 1FF5A 1IZJA 2B8OT 1HIML 2CR6A 1BQHG 2YD7A 3C8KB 1UH3A 4GEJA 3K8MA 2ADJB 5AVUB 3FT9A 4KQ3L 3U1SH 5EBWA 4F8PA 3FQWA 1AGDB 3PV6A 5E1IA 3PXJA 4PLJD 4OKVB 3NIDB 4F93B 2JCCB 5IOPA 2IWFA 1U8JA 1KCSL 4LKXA 5HHMB 3ILDA 2GSGB 5F6HI 1X4ZA 5DUBB 4MXVF 4HD5A 1RZGB 3S48A 2OJEA 4KRNA 3BKML 1LK2A 5JR1H 2G75B 5CINH 3FO9A 3UYRH 4J3VA 2R4SH 1E40A 1E6JL 5EN3A 5HGDB 4GS7B 5IVNA 4Y4FD 4AK1A 3BAWA 1RUKL 3GUTB 5BQ7A 3B9EA 3MRBA 1L6ZA 4HLEA 2F18A 5EZIL 1LO0H 3P30H 3UAFA 3MV8B 3L95A 2Z7ZA 1IC4H 1U8NB 1WK0A 4RNRA 2C4XA 3LKNB 1WFUA 2I9LA 3UIYA 4HIEA 5JIKA 4TLUA 2OMUB 4MGXA 5D7KD 1XGUB 3VXMA 1OEZW 1KLGA 2Z8RA 3GS4A 3GHBL 3SD5A 1BVNP 3W0WB 5EPMA 1MHHA 4G80B 2HJKA 4DP8X 1DBAH 3GMPB 4X8JA 3FSOA 1TQSA 4HFWB 4OF7A 5D7SL 4LCWB 2A6IA 4AZ8B 4HLZG 1FH5L 3LZRA 3MRGB 4FXKA 1BLIA 3DDFA 3K91A 4WI5A 1YJDC 4JFSA 2B4CH 2KQMA 4I89A 1BQUA 4JO8A 3TASA 5FEBA 2QADB 1JPTL 3NDZE 1BJ1H 4CRPA 4PWFA 4FXLA 3BVDB 5C0BA 1FIEA 3BVXA 2WXNA 1IGCL 2VOTA 4UUJB 1SBSH 1YNKH 2CMRL 1NBZA 4AKOA 2PO6B 4ZW5A 1G4MA 4RBPK 3OAYH 1JK9A 2D7QA 4ENEC 5JHBA 2FJFA 1GAFH 1TNMA 3ILQD 2DWXA 4FJYA 3VFUB 4IHOB 3QZWA 4MNGE 3QUKB 4G7SB 3GMNA 4B6ZA 3JWOH 3MBXH 1BOGB 4JHBA 3SDCA 5KAQF 4HV8A 2QPUA 1EAQA 2GUOB 2DTSA 3ECQA 3MFFB 3V5DB 2YOCA 1S9YB 2UVFA 4EUPH 5AZEH 3T0DA 5AWNL 5AYQA 3UX9B 4P4RB 1AXSB 1S9VB 3DHJA 5HSFA 1ZLWK 3ULAB 4KXZH 3LQAL 4PJCB 1CL7H 3RTQB 1BPVA 1RLWA 3QIBD 1G7HA 4AL8C 3S37X 4PEEA 3ZE2F 4DESA 5E4EC 4N86A 1OHQA 3PP3K 5KBLA 1KIRA 1SVZA 3KLKA 2YPKB 4AQ8A 4LSRL 5BQDA 5IMLB 2R0WH 3F58H 2NZ9D 1IKFH 1RHHB 2BNQE 1JGLL 2AJYL 2XY1A 3FYEB 3QULA 1GZHA 3L5HA 4YLBA 3HNTL 1OCRB 3TH4T 3UJTH 1EXHA 3I50H 2E3VA 3TBVB 4D8PA 1UACL 3TGXA 5AG8A 1X6LA 3QDMB 3CDCA 3DHPA 4IDLA 4RWYL 3QDGD 3IPFA 1RZJL 3TNNB 2AW2A 4HUXB 1UA6L 4B9YA 4Y2LA 3WJMA 1D5XB 3GXMA 3FB6A 5C0IB 2DQJL 2NYKA 3WXVH 4XOAA 2HUHA 2VAJA 1F8TL 3U6XA 4DCQA 3BDYH 1ED3B 5DD1H 3GLEA 3L7EA 4G42A 4GQPH 2VC2L 5E2TL 5I6PA 3VD9A 1T5XA 1SJEA 3OX8A 4G1EA 4LVNB 1U6AH 3HKFA 5DDHB 4XN1A 3A23A 5DVOA 2MOGA 4KJQD 4LSRH 1FCGA 4J12A 5E6IB 4JN1L 4LHUD 4GSXA 3BC9A 3HAEA 3HBQA 4L3CA 3AT8A 3BKJL 3OZ9L 4R0LA 3UEZA 4U1HA 4XN4A 2D7NA 4WNJA 5C0GA 2B0SH 3LN9A 2H1XA 3PAZA 5DRXB 3FHAA 1U91A 3DIVA 1C5DA 5CU9A 1YEFL 5B38A 3QWNA 4HCRA 2OR8A 1RJYA 1PX8A 4MJ5B 4N2CA 1KELH 4FKHA 5I23A 4GIAA 3NYKA 1BFOA 1IU1A 2RALA 3V4PB 3T4YB 1T6BX 3DUUB 2XBZA 4HAKA 1F11B 1KCRL 2V5YA 4J8RA 4MB3A 2OZ4H 4PB0L 5A7EA 3MZGB 2J7LA 5DMGD 1IC5H 5E94A 5IUCA 2YD9A 4ZS6D 4LNRB 3IBOA 1WPCA 2A0LC 5H4YA 4YSSA 3F7VA 2LTQB 3IWVA 5JZ7D 5C09B 4HP5A 4AQ8C 3PWNB 3C60B 4FQ1L 3M1BA 5F7NC 3U7YH 3V0WL 1A22B 1OP5H 1KJMB 2APWA 4QI3A 3LRHA 5I1AA 1MCWW 1NFAA 3ZGHA 3X14A 3AMKA 3HE6B 1XIWD 2R69L 2WZ6A 4MMZB 4X5LA 4B41A 1SY6H 1JHLL 4FKEA 3V95A 1SF5A 4QWWD 1K8IB 3RHWF 3UTPE 3B7YA 1T1WB 2J8UE 2FIKB 5D2NE 3H9SE 3IMRA 1DJIA 1P6AB 3VTAA 1UD6A 4QO1A 2KC0A 2Q0ZX 4XNMB 3B8SA 3D39A 1ZLWH 3AY2A 2YD3A 5DUJA 2J8HA 2DLTA 2B15A 3C2AL 5TGBB 3WTXA 5CU5A 3PCYA 1KIPA 4D2NA 3W5NA 1SUHA 2GYSA 2Q76B 4QJ3B 5AVRB 2H41A 4XO4A 2ILLA 4GSQA 4HEPG 3BZFA 4P5TD 1T21B 3HE6C 3QUXD 2BVYA 4O58L 3QXUA 5HI5C 4Y4KB 2LLGA 3OKMB 5IROA 1J8HB 5BPPA 4TKWA 2H1LM 4NQDA 1P7KA 1JXKA 5DZJA 5EF3A 1QSFE 3B3IA 4U2ZA 8PAZA 4HJIA 3AUVA 3T0WA 2XG4A 3AQDA 5D9SA 1NEUA 3QUXC 4LVOC 5D5MA 3AGVA 2DW5A 4L3ED 2E76C 3RWFB 1CFNB 3U7WL 4XVUC 2J2ZA 3PJLA 2RCSL 3SBWC 3ZL4H 3KD4A 2R4SL 1FIGL 1MFEH 4BGDA 3NK4A 3H85A 1I3VA 2V2TA 1LWJA 3W0WA 1IGTA 4JN1H 3MDJA 5KUMA 2K6ZA 2NNCA 2HJKB 3S3CB 3UTZA 2GBUA 3GMMA 4KTDH 4NQSA 1DL7L 3QWRA 4HKJB 3T6WA 1GJIA 1AD9A 4HWEL 5SV3A 5F21B 1B2WH 4D0CB 1P6FA 2A1WL 1IEBA 1FFPA 4EJ1C 4JFOB 3HRZC 5I1IL 2EVHA 4XVJH 3FT4A 5DHDA 2DLFH 5D7JD 2DL2A 2NNXA 3LQAC 1HCFX 1WUZA 1W9XA 2DD8H 3MBEC 4UNVA 2CALA 4OCMC 3OKKA 4H8QA 4HXAH 4M1GH 5JHMA 2FWLB 4OZGB 5C3LD 5ID1B 4YHMH 4X4YB 4B60A 3ABMB 1PLGH 1J5HA 1YYMH 3BRFA 1CGVA 3AQXA 3CBRA 1T80A 2YBGA 3R0NA 4QOKB 5D7JC 4NQTA 1XB6A 5HHOA 1FNGB 4L3AA 1IAIM 5EB9A 2HLAA 3OAUL 3EFFA 5HDBF 1PTZA 3B2VH 1ROWA 2HYMA 2ZAGA 4P9ML 5C6PB 1LNUA 2FE0A 3MQIA 5GIRB 3S88L 4PRBB 2JNZA 4AJVA 4GG8A 3CLEH 4EBQH 3TJHD 4Q52A 2X4RA 4OB5L 2X7LB 3AABA 4OM0L 1OAZH 3RWDA 3IJEA 5EZJB 1IT9L 5EBWB 3NJNA 4X6BA 4R8WH 3CZLA 1ZTMA 3IFPB 4ZQKA 1F58H 2Y07L 1TUPA 1GC1L 4P23C 5E4OA 1N5AA 4K9JA 5D1QA 2BVTA 3BGFC 4EIBA 2CBPA 5DRWB 2BY3A 4ZPTB 4HU2A 3US1A 3BPOB 3SZKC 1E6OH 2VXVL 4GXVH 1X9RA 1OSPL 5I1GL 5JW4R 3QZBA 5DR5H 4EPSA 2OTWA 3FU8A 2YS4A 1EAOA 1B0GB 4B7IA 5HPOA 3TZVB 3OKDB 5DEGA 4U0QB 5DJAB 5JA8B 1CDBA 1KN2L 3VFGL 3AAZB 1X6NA 2W80C 3RB7A 2W91A 3IBEA 4NEHB 4NC0B 5FGBA 1GGIH 4QIRA 2GB2A 4G7VL 2SODB 3WNPA 4JG0H 4LVHC 3A22A 1MCRA 3S35L 2HKFL 4JE4B 3ZHFA 2BSTB 3HW7A 4K3GA 1FZMA 3Q1EA 2GY5A 5TPWL 2OR9H 4HIIA 2YOAA 3FFCE 1FRGL 3HZVB 1PZSA 2D3LA 2FL5A 3DVFA 4O5LL 2CHNA 5IBUG 2IPKA 1J8HD 1UOLA 5EO9B 4QKXB 1XGTA 3KLDA 3PHAA 3QGVA 2P5ED 3CNKA 1O6VA 1DLHB 3BGMB 4GW4B 3HLKA 1SYVA 4I3RL 2ZXBA 3NRFA 5LXGL 3E0GA 2GEQA 1A2YB 4HS3A 5FB8A 2BW4A 1HHIB 2WAQA 1SYSB 2BZ7A 2W60B 1Z9OA 1UT9A 1F3DH 3OLEA 3QXVA 4LCWA 1MHCA 5EA0L 1VAHA 3GJFA 3T8XB 3NFNB 4HHAB 4WDIA 2FHCA 3D69A 4HJ1A 1E4XH 4MSWB 5M7QA 3U46A 3LXUX 1YLBB 4TUJB 5ECJE 3P54A 3TM6A 3H54A 3ZIYA 5CD5C 4APQB 4EI5B 5JORA 1IFRA 3WTUA 2C9XA 4L1HA 2JKLA 2VE6A 4LL4A 1BWMA 3LHPL 5AZEL 1G7MB 3EF7A 5GGVH 1F02I 1BM3L 2ED7A 2LFGA 1KGJA 2FGWL 3DMMC 5FYLH 2MNWA 4JQVC 1W72B 3VFNB 4KRMB 1E28A 5TF1H 1ZLVK 1U3HA 3D18B 5HDWA 1MUJB 3QHFH 3T1WA 3UIZA 5HD8C 2IG2H 2ALAA 3PWPE 4KY1H 4FA7B 3IJHA 4YGAB 2Q87A 4L29B 4X4XA 1KJ3H 1SZNA 2D9QB 3LQZB 1S46A 2BVPB 4ZFOB 3Q8AA 4DOHE 1HTYA 5CZRA 3EW3B 2J57A 2O5ZL 3P69A 1AJ7L 5L2JB 5FK9B 4ZO8A 1A5FL 2AJSL 4ZUUA 2JTYA 2WMPB 4L5FL 3AU1A 4U7SA 4JFZL 1J87A 3EFOB 1SN2A 4ELMA 3VW3L 3F3HA 4PJXB 5AW7B 2MRYA 4G6KH 4MRBA 1P4LA 4KKCC 5FO7B 3ES6B 3V8OA 2PTVA 1H6EA 5E8OA 2X6AA 3IRZA 1SJHB 1XR8A 2IV9A 4XPFL 2VR6A 2BSBA 5ES4B 2RB8A 4H20L 5JIQA 1JF1A 3IKCA 5IW3A 4JZNB 1TZGH 2EIMB 1A7NH 1WH0A 1KIPB 3WD5H 3F83A 2AQ2A 2HA1A 3MJWA 4Z7NF 1J5CA 1Z9SA 3M8OL 5DD6A 5F1IB 3F7QA 1M6OA 3PUUA 3ALXA 3FCBA 4I85A 3VD1A 3FU7B 3ULUF 4OGXH 5GZND 5EZIH 3HS8A 4FTVD 1F1GA 2MOVA 3KM2A 3F04A 3Q9QA 2DZEA 3ZDXF 3MRKB 1A4AA 3L9YA 1BW8A 4EN3C 5C1MB 1M42A 4X6DE 1Q9KA 2ZAIA 3ZL2A 1UXWA 4PJ7A 2CAKA 1ORQB 4AY0A 1CS6A 3PWPB 4C56A 4YHLH 2AANA 1N6UA 4Q9RH 3SGEH 3CFUA 1DVFB 1RJZA 5FKPA 4XBGB 4X9FA 1ZLDA 1K9TA 1CLCA 2VLLA 4OF0A 2IXQA 2YXFA 1U93A 1HZHL 2QHRH 2MPAL 4H8WL 1I1YA 5DRNB 2VDRL 3CIAA 1BMWA 1XT5A 4ORGB 1NCWH 4QXUH 3V4UH 4FERA 1RUML 2GAZA 4WO4C 4KKBC 1OD9A 3SGKC 2DYPB 4GBXA 5EU6A 3G5VB 1SQMA 5BZWA 3DTDA 2RFXA 1U8LA 1BZOA 3ATDA 3BKYL 1U92A 1AZUA 4NJAL 4RMSA 3PGDA 1EJ6A 4P9HC 5IBLC 4G3YH 2OMZB 32C2A 4FXKB 2DEXX 2HXAA 2A9CA 3HG1B 1G84A 1NKRA 5D2LE 1AMXA 1A4JA 2P52A 3EGDB 3ROLA 2W88A 2I85A 3BP4A 4KKAD 2MQGA 4GQQA 1CGTA 1QSFA 2F58L 3V7MA 4CU8A 4XNQB 5D1ZD 2E7DA 3FTGA 4I9XA 5TE6L 3E6HB 1HHGA 1ZV2A 2XYBA 1AHWC 1SQ2N 1MCOH 3L4ZA 2Y2TA 2BC4B 2WBJA 5E2VL 3GIVA 2JE8A 1EO7A 43CAA 4OCRL 5CLTA 5KVDH 5D96B 4QNPF 2VDKB 1DDTA 3MRBB 3F5WA 5LCVH 5JW4Q 4LCCA 2WLLA 1G6RL 4MXQD 5CBEB 2GG1A 3VB9A 4AG4L 2CDGB 2ENPA 3UTTE 3UBHA 5EORL 2Y7SA 1SDYA 3G6DL 4WF7A 1YMMD 3AT9A 1TXKA 2X4TB 1TJHL 1W16A 1WYJA 4HFUL 4OLZH 1J05B 2Y1AA 1EEUA 1P84J 2EINB 4JHWL 3EJSA 2A6KA 5A2LH 4S1DD 4DPAX 3VSUA 1MCFA 5JHDA 1A6UH 4DQOH 1G7LB 3AG2B 2KERA 2N7AA 2EEFA 4OSUH 1T7ZA 2QV4A 3MRQB 1UB6B 4GUPB 3RLSA 3V6ZB 3GMLB 1G6RA 2BY2A 4ZUWB 3WGUB 2XBTA 4JQIA 2KT6A 4H4NA 4BD4A 4NNXB 4PJFA 5HYEA 1MXGA 4MD4B 1JZ6A 2O72A 3SCMA 4UIMB 1SGKA 4FXGB 3MRRB 3GWJA 4FFVD 3N1GC 2VUKA 2ZYRA 2XJLA 3EKCA 4PJGF 3F8UB 4XVSH 3UBFA 1CXHA 5KW9L 1T03H 3W82A 3E8UL 2PABA 4R7DB 4F58L 1KB9J 3NIDF 3VXQB 4Z1PA 3FUKA 4M5ZH 3A24A 4O2EB 3NIDE 3NJJA 3PGCA 5DUMH 4AM0B 1TYEB 1SPDA 4HJSA 4CU7A 1T7YA 2EUZA 2M2DA 3O9WB 5PCYA 3LKSB 4ZUVA 4NZUH 3CBKB 2WIIA 1NEZB 5E0FA 2XA3A 4OLVH 5J1AA 3X3GH 1CLYL 1TQUA 3EYSH 5HHNB 3HB3D 1B2YA 4HWBL 3BUIA 3O3DB 4OCXL 2IFFL 4A7QA 2R8SL 3I75A 4TUKL 4ZZFA 1PZCA 3L4XA 1CI3M 1VCBC 4PS3A 4GKSA 1A6ZA 2MH4A 5CZVH 4DGVL 4JFEB 1JHLH 1LMIA 4NN7B 5EO0B 2RGSA 2A6DA 4IGBA 3RVXD 4NZUL 3KZ8A 3VFTA 3GM0A 3N5AA 1ZE3H 4Y2DD 4WI0A 2NY1D 3PE9A 1SF3A 5BUPA 1AXTL 1WCBA 2APXA 4LOUC 2H6OA 3LQMA 5TE4H 4KJQC 4YQXH 1BQ5A 5ENWB 5HDOA 4AVIA 3MBWA 4KHXL 3O2DH 1LWRA 2ZWKA 3UC0H 3P3UA 1I7TB 3MGTB 3TFBA 2NY1C 5A6IA 5DJYB 3VGAC 1YEWA 5CUSH 3O2WL 3MYJB 4R4BA 3TBTA 4OCXH 3W1ZA 4K94L