2JJSC

Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
publication title Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jjsC00
4MXWH 3DRQB 4OM1H 1Q72L 1BBJB 2W0FA 3HC0A 3NAAH 5D96C 3GMNA 5E6IB 1GCFA 4XCFL 3VFNA 3CH8A 3RL2B 2YRZA 2YUXA 4J23A 4ODUB 2EKSA 2WP3T 2FWOA 3PHOA 3RHWK 3C09C 2K3TA 3OAZH 2R0ZL 1GOFA 1AKJA 4NCDA 4OFPA 4E41E 3MXWH 2J2ZA 1IM9A 5E7BA 4HUKB 4Q0XL 1KCSH 3BZFB 3DMMC 2DLFH 2R0LH 4M6NH 1I3RB 1DQJB 3RDTC 3TIDB 4UT7L 1OAQH 5D1ZA 5CIPH 2ZG1A 1DVFB 2H9GB 2JJWA 3SE3A 1A3QA 3J8F7 1YDPA 2P5WE 3D85D 3OHXA 4F3FB 1UA6L 4Y4FC 1YYLH 2ARJB 2ZOLA 3U0TB 1WIUA 5FAAA 3O2WL 4DK3A 5I75C 2X10A 1LE5A 2ZCHL 1RZFH 1C08B 1X4YA 2AEWA 1BJMA 3PL6B 2C4FT 3E6HA 5EZOL 1VGKA 4GKZA 5L88H 1U2CA 4NJ9H 3K4AA 1DDHB 4X6DA 2VOTA 3HG1E 1IC1A 1L0QA 2ILLA 2Z8VC 3VD4A 1U36A 3MOQA 2DLGA 4ZDHB 1E6OL 4CJ0A 2M2DA 3C5ZC 3QDJA 2A83A 4KKAD 3RL1B 4LLQA 3BRGC 3VXRE 1PGRB 3QPXL 3WCYA 4U7SA 1JFQH 1OAXH 2X4TB 3KDMB 3MRPB 4HIXL 4U1IA 1ZS8B 4RMRA 1LEGA 3JZ7A 3BZEB 1QPXA 4Z76A 4P5KA 2M8XA 5IBTL 1AD0B 4PRHB 2P7TB 1NDGA 4G8GE 4B50A 1Q72H 2V2XB 4M7LL 2AJZA 1YEGL 4GG6A 3LKQA 1TITA 3HI6L 2VZUA 4IOFD 3WSQL 4F9LC 4CL7A 5I15L 5KBNC 3BVNA 3KGRA 5GGUB 2KZWA 4E42B 4LCCC 4NT6B 1I85C 3DX7B 3T0EE 2R0ZH 3OKMA 1YMHA 4ZS6C 1FYTA 2CDEB 1YECH 3B3IA 1UEYA 3THMH 4J3UA 3QG6B 4O4YL 5B4MC 4LGPB 4I5BA 4WO4B 2DN7A 1U8MA 2AK1L 2FB4H 1KGCD 4M61B 5CD3B 4XP9L 1L7TH 2H2SC 2GSGB 3AREB 1MVUB 1XMWA 2W65A 5TPWL 3R0MA 3VXUE 1LK2B 3WFEL 3UDWC 4KC3B 1MCOL 5ILTL 4S1RH 3RY4A 4LCUA 4LKXA 3T77B 2BDNL 5CMAB 5I1IH 1UA6H 4Y2DC 3P0VL 1SJEA 3IDJB 4HIEA 4BKLA 1J8HB 2ZCHH 3W82A 5KG9A 3V6OE 1P4BH 3N06B 1MVFA 1LGVA 4NFDA 3QZWG 1ZVHA 5EZOH 3BIAX 5D7IE 1T1XA 1EZVY 5C0BD 3SO5A 1E6OH 3MRFB 2SEBB 3K2UL 4JY5H 1VESA 3LKPB 3MCLH 5FGBA 1BP3B 3IXTB 4EQ2A 3QPXH 3DXAD 1HHHA 3WL9B 5DJ0A 1EVUA 5EO1A 2JB6B 1QFUL 3TEUA 4KK5C 4UU9A 4CUCA 4F7EA 4OF3A 4K3JL 4BZ2H 3AS2A 4MGXA 4FFVD 2VERN 5IBTH 3HMXL 4WFFE 4TSCL 1I3GL 1MELA 3FO1B 4M02A 2VL5B 4XVUC 4AH2A 2R56L 3AM8C 1A6PA 1YEGH 3WNKA 5IBUB 1YEEH 3HI6H 3WSQH 4LGSB 3EDFA 5I15H 2FBJL 4P2RD 2ZUXA 1KB9K 2H2PC 4YK4B 1A6ZB 4PBXA 1Q9OA 1W8OA 1RJLA 4M43L 1L0YA 3WIHL 4YIQA 2EXWD 3S36H 3VJ6B 5HY9B 4NQVB 1AR1C 4OQTL 1WEJL 4U6HB 2X7LA 4ZO7A 1X5HA 5ICXB 1EDQA 4P46D 4C58B 1CFQA 2A38A 5SWSB 1ZLUH 2X4PA 1WFNA 4LNVA 4GG8A 1I1FB 3EYOB 4Z78A 1XAUA 1G84A 3WFEH 4NJAL 4Y8DC 3SDCD 4F7CB 2BDNH 4B41A 4HIHB 3PE9A 5ID0B 3LKOB 1KIQB 3P0VH 5D9SA 4LIQL 4KHTH 5F96L 1R3HA 5MENE 3ESUF 4NRZB 1FPTH 2GJ6E 1LE9B 4YHYC 1EAPA 4MJIE 4IEFB 4ZO9A 3K74B 4S1DD 2UUDH 1Q0XL 4PJBE 1UG9A 2NY4C 5MP6H 2ATKB 5KSAD 1O7SA 2H8PB 3ZYIA 1YEKL 2L0DA 4UDUB 1MCEA 3FO9A 3H3PH 4NUGL 2ADGB 2FLBT 3EO9L 3DTXA 2W91A 3B2UD 3UC0L 1T0NB 3K2UH 3QNZB 3VFOA 4EDWL 5B39B 3P4NA 3SDYL 4Y4KA 3AMKA 5L0QB 3KXFE 4I9WD 1QFUH 4Y89A 5HSFA 1T5XB 4K3JH 1INQA 3GSNL 1JGDA 4WWKA 3W5NA 3K80A 4TSCH 3B9AA 3D3VA 1HCVA 5D96B 3SBWA 2PO6C 5EU6A 4YHIA 5DLML 4EI5A 2ICEB 2AEIT 1RUML 2FBJH 1X5YA 2R8SH 4WDIA 1CIUA 3CFDA 1WZMA 3FQUA 4BFEA 3PDOA 4PP1D 1MIEH 4JANA 4OQTH 1WEJH 4A6YA 5T1KD 2V2TA 2BNRD 1MF2L 1WLHA 1H3PH 2J8OA 5ESAA 5JW4M 4JZNB 4RZCB 2P5EA 1D5ZA 2LU4A 4BFIB 5HYQB 5FB8A 1JZ8A 3RDTB 2Z92B 3FN0H 3VFSB 4UBDC 3SKUD 1S5HA 3VRJB 2JKXA 1O7VA 2QV2A 3D18B 4RQQB 3MCKA 5AUMB 4HWNA 4LIQH 1WBZA 2AV1B 2F15A 4PJHF 5DD6B 1D5XB 3QI9A 5FYKL 1IAOA 5DR5H 4HS6A 4RMWA 3WLBA 1U8OA 3OJMB 1FL5A 3QIUB 3ARBD 4WUUE 1DQLL 4XNXL 1GYAA 4D0BB 1KJMA 3BJLA 3EO9H 4KK8C 3JV5A 3UC0H 1PZ5A 4GW5B 1TVDA 5ID1A 4X6BA 3MRMA 5CCKL 4POZC 2M1KA 1T21B 1IGJA 4Y2OA 4G6FB 2BHZA 3VI3F 5TGBA 1WT5A 2OSLB 5FXCH 3BP7B 1BFOB 1S78D 3G5XB 5MHSE 5TDNB 4Q2ZB 5HGAA 3L5HA 4MAYC 5B22A 1LP9F 3MV7B 4CAGA 4DKAA 1E4KC 1JGEA 5DLMH 3T4AA 1EERB 3MGOB 1S3KL 4YDVB 5KSVB 3MJ9A 1T7VA 2CRMA 3QUKB 4KRNA 1RUMH 2YPLE 5C8JB 5K93A 1J86A 5GGRY 3UTOA 4Q6IA 5E1HB 4AEIH 2DI7A 1MJJB 3LPGA 4L1DA 1JWUB 1QR4A 4UINL 5IEKA 1JPTL 5DVOA 4X8JB 2DQDL 5L2KE 2R2HB 4PGDB 4NQED 1VGEL 1YMMB 2EO9A 4MXQC 3MRQA 1MF2H 1ZANL 4NFCA 2OXGA 5ACZA 5BXFA 4HKBA 4K94C 3E3QE 3WN5A 2VZVA 3V6ZB 3GMQA 3L6FB 3AC0A 3BEVA 3F7RA 4N0FA 4ZS7L 5F88B 4UOJA 3BGFB 4JM4L 4QRPD 5BCAA 3T0VA 2FD6L 1P6AB 1IQDA 2I26N 4PJDE 5F70A 2AEPL 2BCKA 3SGDH 1R3IL 5FYKH 1BVKA 5GRYA 1C5BL 1NANI 3P0YH 1DQDH 1JYXA 3ULUD 3O3DA 3CNKA 4F15C 4W6YB 1C5CL 4JHAL 1CZ8L 2CDGA 2R23B 3HLAA 2WANA 2P43B 2WUBL 3RTQB 4RNRB 3F5WA 1A1NB 3RP1A 1IARB 2EDKA 3FQTB 1XGQA 4Q9CA 3BPOC 4UAOB 4G9FB 3U30B 1HDMB 2XKNA 2Y06H 5H8DA 5A2JH 3ARFD 1DEEA 5KVMC 1MNUL 1QSEE 3IDXL 1II4E 2NY0B 3BMWA 3MROB 1FORL 5CHNB 1EEZB 3L3HB 4NUJA 3Q5TA 1EA9C 5DYOA 2R1YA 1RQ5A 1BMGA 1FZOB 3D2UA 4KY1H 2NXYB 2A6IB 2QQKL 4JY4B 4LLDA 4V1DD 2MSPA 2JF1A 4UINH 1JPTH 2HH0L 2DQDH 4OZIF 3QFJE 5C9JB 1BVLB 5T5FL 3OX8A 3HA0A 4IRZL 5IVXA 1ZANH 4J3TA 4DZ8B 1NC2D 4JZJA 2P8MA 3MMEB 3GIZL 4NC1C 4GKSA 2EYRA 5KSUB 2R2BA 3R06B 4WHTA 4P4RB 4ZS7H 4JM4H 1ZAGA 3U4EA 2ZUQB 2FD6H 2VIRB 1IKNC 3B5HA 1CLZL 3BAEH 2AEPH 3R8BB 5HHOE 3Q0HA 5KAQF 5I2IB 1AQDB 1C5BH 4ZPVB 5TDPA 3OR6A 1PKQE 2GQHA 1T83A 3GMPA 3AY4A 4M4RA 4MNQE 5B38B 1WBYA 2DLIA 4JHAH 2OTUB 3EFDL 3VGFA 4EVNB 3KPPA 4KRPD 3SDAB 1RVFH 5C07B 1U58A 4NPYA 4MQXC 4I4WA 3HC4L 3UTQA 2CIKA 4JQVC 5J12C 1RZKC 5DJAB 2WWKO 2R1XA 1EFQA 1ES0B 5EIIA 3AXLA 5E00A 2AV7A 3IDXH 1T03L 4HEME 4HWBL 3KPQB 1F6LL 4NO2B 3DO3A 3TBSA 5E99H 2BVOA 1FORH 3ETBF 3QWRA 5D7LD 4P2OB 4RFEA 1FLTX 3PHQB 4XCCL 3B9KB 4KK9D 1K8IB 4LVHB 4UDTA 2QQKH 1H3VA 2A6DB 3ZDXF 3NCYP 5HHMD 1TVBA 2XA8L 2A73B 2JTDA 2WWMC 4JREB 3OKEA 4YO0A 2HH0H 3BDYH 4QRQB 5DWUL 3DJ9A 5KJRH 1INDH 1P9MC 4JKWA 4DUXA 4NKOB 4PJ7B 4QOKE 3RPKA 3ZE1E 3QO1A 5KS9E 4IRZH 1ONQA 3EJZD 3QULA 3VFNB 2V5YA 4C57C 3GIZH 2FCBA 4HKZA 2Y4SA 5DMGC 3EHBD 2EKSB 3LKNB 5TE7L 3BSZL 3FB7A 2CLVA 1K4CB 2XTJC 1T4KB 5INCB 2V5SA 1G9MH 4XT1C 1AKJB 1BJ1J 2IAND 4L4TA 3HNSH 3E6FB 1ZXQA 4OLZL 4HGWA 1ITCA 3SCMC 1AXSA 2F8XC 4LIQE 3JTSB 3MRIB 4NOBA 1LDPH 5D1ZB 2XA3A 3EFDH 3FFCB 1AGEA 4IS6B 5DD3L 5C0CD 3OHXB 1QRNE 4N8PA 5IMOB 1A6AA 2QR0A 2OI9B 4OJFH 3REVB 3PQYA 5HPOA 2XWBA 1HHKB 5M95B 4Z7VF 3T2OA 4D3CL 1OD7A 1FCGA 1OLLA 4HWBH 4X6DB 4I8DA 4LCWE 4GRLA 5MEPB 1OD9A 1NDMB 2A83B 3ZYZA 3SKNB 4M6ML 1ED3B 4PRPB 1MWAA 3UTSB 3W0WA 2GAZA 2KZ1B 4Y4HD 1LEGB 3D0LA 5ENWA 2XA8H 2VZ1A 3TESA 5GGVY 4M7LT 4ZQKA 3BGMA 4U1JA 5DWUH 2OTPA 2VITB 3MX0A 4WI9A 3JWDC 4GQPH 3NCYS 3P9LB 2AJZB 4S0SD 3LHPH 4WV1C 3QNXA 1HCFX 4UT6L 2HT3C 3L3KA 1G7PA 5FKAA 5C0DA 2X4OB 1IE5A 3VWJC 1UZ6F 1CDUA 3IDYC 2UVEA 5D2LB 1ZE3C 5TE7H 1T0MB 5D7JD 1PSKL 3RX7A 3RGVC 4C56D 4H5SB 1GRWA 1A7OL 3W9DA 1ZT7A 3TZVA 4PLJC 2YD3A 4GKOA 4I5BB 1LD9B 1EEYA 4H20H 3ILPA 3W39A 1A1MA 2Z8RA 2WW8A 4FZ8L 4J4PA 4C54A 4F15B 3P4MA 2W65B 3PGCB 3L3JA 4PRID 5FYKE 2W9DL 4O58L 3VGEA 4PJ5A 1OAUL 5MI0B 1HHJB 5DD3H 4MXVF 4LKXB 4OLWH 5CZVL 1KJ2H 1LP9A 2G5BB 3QFDB 2YXFA 1A3LL 5CWSB 1MFBL 4R26L 3JXAA 1NPUA 4KMTL 1MH5B 5F7UA 4O51B 4D3CH 1WIPA 4ZODA 1EXUA 3EOBB 5DHVA 1AGFB 3PDGA 3RWFB 2BY2A 3B8YA 5JXEC 4EOWL 1TLKA 1BQHA 2ORBH 5IK3A 1MHCA 5EWIL 3Q5OA 1XIWD 1GZPA 3LV3A 2DB8A 2YXMA 4PJXB 4LSPL 5DK0A 3NFNA 3KPRB 1H15A 3QO0A 2NW2B 4G6KL 1NFDB 3ZKND 5EO1B 1XF5A 5FYJD 4Z7NE 2YSSB 3LB6D 4NM8H 3QXVA 1Y0LB 3RX5A 1MHEB 4XGZA 1C1EL 2NY6D 2MCG1 3V7AG 3K1KC 1CYGA 4NFBA 1KG0A 4O9HH 5C0JB 3ARTA 2DWEA 1WTLA 3OG6B 5FK9B 3DETC 5LWYL 2JIXB 4U6YB 1OCWH 1U0QA 2QSTA 1PSKH 4EN3C 2CUIA 4X5XA 4KAQL 3FO0H 3MRRB 35C8L 4ZFZA 3CX5J 3GJFH 1DP0A 4GMTL 1A7OH 5BV7C 1NUGA 4H26B 5F8RC 2NY5L 1CFQB 2HTKC 4S1SH 2HFFA 2ICWJ 2VQ1A 1KPRA 4LLUB 2JJTC 4H1LA 1A5FL 4HG4K 5SV4A 4FZ8H 5DGQA 1DTUA 1GAFL 1T1WB 3FKUS 1IM3A 1HH6A 4O58H 1CFTB 5FKPA 4FQXA 3TYGL 1N3NB 4OZ4A 3KJ6L 3WFHA 5CZVH 2XNAB 5HHPA 3O3AA 4JZOA 1H8OA 2IAMB 1VADA 1A3LH 4F7TB 2BP3A 1MFBH 4R26H 3O3BB 3CLFL 1YY8A 1IGIH 3NGBB 1S8DB 1AD9A 5ESVB 1WTGT 5DA0B 1Q94A 4EOWH 1KELH 4MB5A 2NNAA 3FO9B 4F8QA 1AP2A 5EWIH 3VFWB 4NC2B 4OZIA 2C4XA 1G6RB 3G6JE 1JHLL 4LSPH 3P4NB 4M5YL 4PJ8B 4Z7UE 3O9WB 4G6KH 3SGKC 4DZBA 5L8LB 6CGTA 3LMJL 4HH9B 1ND0A 1R5IA 1JGDB 2RHEA 5EU3B 1EFXB 2ZP0T 1LO4H 3HHRB 3GMOA 1C1EH 4P49A 5CBAA 4HUVA 2AJYL 3RHWF 2V17L 4J12A 4EI5B 1KXVC 2DBLL 3MLZL 4LOUC 4B5EA 4LLVA 5E6ID 2NPLX 4WI6A 3BIBX 5LWYH 5B3JF 3CFDB 3NACH 1PLGL 3QEQA 1CICA 3PDOB 3QCUL 3BKJL 5F7MC 3DMMA 35C8H 1QLFA 2IMNA 4JANB 4OZFB 4AENA 1CDBA 3CFKB 4A6YB 5E5UB 4OFIA 5F6HI 3FQNB 2D31B 4LPTA 4N9GA 4NQCB 4ZXBA 3ULUL 4HSQA 2NY5H 2VQUA 5C0EA 3LKRA 2UZIL 5J13C 2HTLD 3GSOB 2B1AH 1K3ZA 4JKMA 5A2IH 1A5FH 4JB9L 1QEWB 1GAFH 5IHZA 4YC2B 1PG7X 3RKDD 1CFNA 1S5HB 1UQSB 4IJ3B 4ERSH 4MCYA 3TYGH 1KTRL 5FFLA 2OQJB 1IC7L 1DVFD 1A64A 2A1WH 3GSWA 1RY7B 4LSVL 3UTPD 3C5ZA 1MHPL 4PTTA 3CLFH 1U8OB 2VDRL 1XT5A 3UZEA 3WJJC 4HPOL 4OCWL 1FCCA 4AL8L 3GK8H 4MX7A 8CGTA 1IC5H 3MLXL 3PL6D 4Y88A 3UJIL 4DWHA 5C1MB 3NTCL 3RVUD 3OV6A 5D5MB 3U36B 1L6XA 4M5YH 1A4JA 1O0VA 4G8IA 4CGTA 4LK4A 1OAKH 2A6KB 3DYOA 2NZ9C 4F9LA 4WW2B 4L4VA 2LU7A 2XICA 3VXMA 4KTYA 4MMXC 3QDGA 4NIKB 5HVWA 3OF6A 1I85A 3DYPA 1F2QA 4AIZB 2ZCLL 1JGEB 4PRHD 3MR9A 3WO4C 2DBLH 3MLZH 1EVTC 1ZVYA 4MLSA 1KGCE 3O11B 2YD7A 5ISZE 1DEDA 3BP6B 2HKFH 1PLGH 2IADB 3BKJH 4LLWB 5M94B 1Q9KB 5IEKB 3CVIH 5CINL 2V7NB 2HLFD 3WE6A 3KNBB 1JMZA 3ULUH 4NDMA 1KFAH 4Y2DA 2YMXL 1N6VA 2WBJB 4HKBB 4WO4D 4MA8L 3GMQB 4N0FB 4RAVB 3BEVB 5J3HC 2WIIB 4Z7VA 3ARED 2BNQA 3HPJB 2P8PA 4QHMA 4Z9KB 5C0BE 5IB3A 1IC7H 3KJ4C 1A47A 3HE7B 2FL5A 1A4KB 3S5LA 3PWUA 5ABDE 4K71B 2DYPA 2BCKB 2HT2D 3DXAE 1MHPH 2H32A 5E8EA 1JF1A 5GGSY 1MRCL 1KTLA 1VFAB 5A2FA 5HYSG 4NBZB 4HPOH 4OCWH 1J8HD 4AL8H 5LCVL 3MLXH 4FRWA 5I1KH 5ALBL 3UJIH 1V7ML 1H0DB 1ROWA 3HLAB 4DN3L 3NTCH 3I2CL 2OR9L 5I16A 1CXLA 4TUJA 2X4SA 3EO0B 3GNML 5J9PB 2EE9A 5HVFB 4F7PB 1F4XH 4P2RE 4AMKH 5F89A 3ROOA 3ULVL 1U8PA 3VG9C 5BZDA 3SQOH 1G7HB 2XKNB 1J7VR 1NUFA 5JLZB 3NCJL 5GGTA 3HAEB 3EW3B 4PJCF 3M1BB 3T0EC 4NUJB 2ZCLH 1G7QB 1ERNA 5IOPB 1OTTD 4QCIA 3WJLC 1HSBB 2HG5B 3GEWB 3CDGA 2X09A 2XPGB 5IMLB 4L9LC 2FJHA 1VEPA 1KB9J 4F7MA 4KKBC 4BZ1L 5HYJA 1VENA 1HQRB 5IM7B 1SYSB 5CP3A 5IB2B 2BOBA 5EOTA 5J1AA 3MV8A 1WWAX 1Z3GH 5CP7A 1IC4L 4BSJA 4JZJB 2P8MB 3PGDB 1A1OA 3QPQD 5SWSD 1K4DB 2EYRB 3H9HA 3V6OC 4H25A 3QUXC 3O0RL 3FTGA 2CK2A 1NCAL 3MLTA 1KN4L 4I2XB 1ZGLA 3CFCH 2BNUB 1RUPL 4KJPC 1TTUA 3BWAA 3IDIB 1JTOA 2RJMA 4GKNB 4YNYA 3O2VL 1I9IL 5TDPB 4I9WE 1MCJA 1MRCH 3AS0A 5LCVH 2LTQC 3CFJB 5ESQA 1WBYB 1MUJA 2BSTB 2A74B 4XAWH 1V7MH 3HZVA 4LPCA 1HK6A 3ARQA 4X4XA 2B5IC 4DN3H 3KPPB 5D8JH 2OR9H 3TIEA 1U58B 1LWRA 3GNMH 2AERT 1YNKL 5CD5C 5DJXA 4XNMB 2PO6A 3V5KB 4FQHB 4OCRH 2ITDB 4NNXB 1LMKA 1W2KT 3V9FA 3EFFB 2FECI 4N8VA 2WV3A 4RRPA 3NCJH 2ICWA 5I9QC 2A6JB 2BMKA 2J6EH 5IB1B 2BNRE 3FQWA 1G7JB 5JUEL 1EGJA 3DIFA 2DQCH 1J88A 5EU5B 3TVMD 1NMCB 5I1JL 3IGAA 4XZUB 4EQ3A 4GXUN 4JHWL 4X5LA 4XNYL 4RFEB 5LGHL 2HWZL 5C9KA 3CMGA 1ITBB 1BM3L 3VFVB 2IPUK 2DQIL 3G6AB 1JI2A 4BZ1H 4PD4K 4GBXC 5I8KH 1MAKA 2VAAB 2AP2A 4YO0B 1N6QH 3ISWA 4JPKL 4XCNA 1A7PL 5DF0A 5C0RL 3EKCA 4P48A 3O2DL 1IC4H 4NO3A 3MUY1 5J13B 3CK0L 3WO3B 3BI9X 1DQTA 4R3SB 1KN2L 1SY6A 5D2NE 3CCHA 3GHBL 3O0RH 1NMAL 1NCAH 1YEFL 4MNGB 1KN4H 4HWUA 1E28A 3QUZC 3I75B 1HOCA 3KWWB 5DJDA 2X4NB 3E0GA 4X6EA 5JOFB 3L7EA 1MJ8L 4MDIA 4L4TB 1I9IH 3H2WA 3N85H 1XGRA 2XG5A 4Q9QL 2OL3L 1SJHB 1JF5A 2Q76A 1C5DA 4EIZC 3LZFL 1QNZL 1BAFL 1T6WA 5EIVA 4LBEB 1KNOB 4P5TA 1U8JA 3QIUD 4IRSA 4KI1A 3HPLB 3KG5A 4MAYA 1A6AB 1YNKH 5FYJL 4RAUB 1E4KA 4ZOBA 3BWUC 1MCWW 4XAKD 4J1UB 3ARDC 4FG6C 4NZRL 3PIQA 4O02L 1NGZB 1BQSA 4G6FD 1EEQA 4NNPL 2EE3A 2AXGB 1I3UA 4NQEE 3TC9A 4QXWA 4DCQB 1K5NA 1BWMA 5I1JH 4PY7A 5FCUL 3VXQA 4XNYH 3QCVL 4WNQA 5LGHH 2HWZH 3IS0X 4EDXA 4HDIB 1P7QB 1BM3H 4N5EC 2DQIH 5D1QC 1ZLVH 1NGQL 1FSKB 1FO0L 3JBG7 4JPKH 4HFWB 5EG6C 5JDJA 3EYSH 3O4LA 3KLHC 1M4KA 3OZ9L 3ZLQC 2PTUA 5C0RH 4LLYA 5I73B 2QJDA 3O2DH 4HKJB 1ZVSA 1CT8A 3B9DA 1YMMD 5EO9B 4LHUA 2ZUWA 1TVHB 4UI2A 1KN2H 3L3KB 2F5BL 4PJHB 1A9EA 1G7PB 4YPGB 5B4MD 4X7FC 5C0DB 3GHBH 4ZUUA 3ULUE 5BVJB 5T3XD 1NMAH 5IBUG 1YEFH 2FEEI 2HT4C 5CGYC 1U8IA 4HKXB 4EXKA 1NJ9B 2YN3A 2EKJA 2N7BA 1MJ8H 2VB5A 3SHSA 5TH2B 2VR4A 4D0DB 5C71A 3S37L 2A77L 5FM4A 2IGFH 3HC3L 5JA8B 5J11C 2OL3H 1T6VN 1Y6KR 4LPVA 1YQVL 3LZFH 4JN2B 1QNZH 4YAQA 1BAFH 4HQQL 3LEXA 5J7CC 4E0RB 1DE4A 3L3JB 4NQXB 4ZUVB 4G7VL 4LSQL 1A14L 3RUGA 1EPFA 3QXTA 3UAJC 2ZZUT 1OQXA 3HZYB 5DMJB 5FYJH 1J0YA 4JEGB 3WKNA 3RTQD 1OW0A 3B4NA 5M7QA 4V1DE 1HXMA 4NZRH 4O02H 4JCMA 1B9ZA 4FN0A 4PJEE 4G9FD 4NNPH 3CVHL 4KZDL 1FJ1A 1QD0A 2WLZA 2RR3A 2NY0D 3C5JA 1GZPB 1KEML 3L5JA 3P4OB 4POYA 5JW3H 3QCVH 3NFNB 2B2XL 3R8QA 1PEWA 3W81A 3RNQB 3E3QC 1XF5B 5B39G 1KYOK 2AJ3B 5KVFL 2NXYD 4XTRC 2J7LA 1FO0H 3NFPB 1WISA 3GSXB 1U8HB 4EUPA 4OBRA 4CU8A 1WWWX 3MO1B 4WTZA 1JN6A 1IJ9A 4FQQB 1I1AA 2F5BH 1P7KA 2DWEB 1WJ3A 1OTSD 5IROC 1CR9L 4I3RL 4QWWC 4V2CB 1J11A 1C16A 1JUFA 4YQXH 5HI5D 1MCQA 2D7QA 5DJ8B 4Z6AT 3FT4B 1CD1B 2QLVB 1DN0B 3NZ8A 4MQSB 5E08L 5JOEA 1U8KA 3BOVA 2HJLA 4TUOA 2FGWL 5GHWL 1W72A 4R0LC 1HYRC 3S37H 2A77H 2D7OA 4YEFA 3JWNC 3HC3H 4JQVA 2PF6A 4M9OA 4H1LB 1YQVH 5A2LH 2CUHA 4WHYG 4CVXB 4HHAA 3UJTH 1HH6B 2LU3A 3V7AE 1LHZA 1RZ7H 2VXQL 5F7WC 5JQ6L 4FQXB 4LSQH 1RZ8A 1A14H 5HJ3B 5D7LE 4PJCA 5FGCE 3SDAD 5C07D 3CPLA 2GFBA 4ISVB 4M7KL 3SJVA 2E7LC 5HHME 1R3KA 5B8CB 4JFDB 4YGAB 1AD9B 3B9VA 3CZFA 1CK0H 3VGDA 4NQTA 3VXTA 5GGRB 1QSFA 4ELMF 1UXWA 2DQEL 3V95A 4TNVF 4OZIB 4RBPH 2X44D 4OAWA 2B2XH 2UWEE 5GRJL 4BQ9A 5JPMB 3TP4A 4P2OD 3OKDB 3B9KD 4JFYA 5DFVD 1R5IB 2K7QA 2DQFA 3ZKMD 1MQ8A 4QGTA 1AY1H 3MLPA 2IANE 1WC7B 4J3SA 4NRXB 1CR9H 1GOHA 4N0UA 3AU1B 3FT3A 5DSCB 3OPZL 3JV6A 1JE6A 4PG2C 5FDWA 1S7VA 1CICB 2IPKA 2XZCL 3QUZB 4QRRB 3S35L 3X11A 3GRWL 1QLFB 3L95B 4DKFH 5GGSA 1MHHA 5C0CE 4XMPL 5FV1L 1CE1H 3MA7A 4YZFE 2FGWH 2YD1A 2XFXA 5GHWH 1AKJD 5GIRB 3LKRB 3P40A 5C7XL 1BLNA 3VD3A 2F58L 5BS0A 3DVGB 2VXQH 4MCYB 5JQ6H 4CADB 4Y16A 5EORH 5D1ZD 2FJGA 3DYMA 4G80B 3FFCD 2BVQB 3LD8C 2DKSA 2R39A 3IJSB 5DURB 5CEXA 1WBXB 2EDBA 2X1PA 3BPLC 4XI5C 4PTTB 2XN9B 3AS3A 4C83B 2F8VA 4XNZB 1MFAH 2F53A 4MX7B 4U1MA 5E4EB 3IU3B 2VXVH 2DQEH 5E8DL 4I0KA 1UYWL 3T65B 4M48H 3KPMB 3P4LA 2V7HB 3LVEA 4G8IB 4WV1A 1SHMA 5EFIA 2P45B 4PRPD 3UTSD 3VWJA 4HWZA 3RU8L 1X6NA 3ME0A 3VXMB 1OTUD 4C56E 4MHHG 3TWCL 4DN4L 4KVCL 2E5EA 3DECA 3WBDA 3RGVA 3KR3L 2IQAB 4TVPL 2JK5B 4G3YL 1UXSB 5EC2B 4WFHD 5DZNA 3L5XL 3TN0C 3OPZH 5LG1A 1FC2D 1T5WB 4PRIE 2PNDA 1OF2B 3EDDA 4DW2H 4EBQL 3S35H 5LKNA 4LHJB 3KPSB 4XMPH 5JXAL 2O5ZL 4ELKA 1NCDL 3QQ3A 5DT1L 3HR5A 4AZ8A 1PFCA 3MOAL 3MYJA 2ADJA 4MS8D 1T22A 4S1QL 3JVGC 1HEZB 1PG7W 4OUOA 3T2QA 2OMBA 5C7XH 2Y6SC 2F58H 4B0MM 3G04A 4Z7VB 2CR3A 4GUPA 2VNCA 2UY7A 4LSUH 1RIHL 5LGJA 2W59A 3PXHA 5J1SC 2XQBL 4UIMA 1CS6A 2NY3C 2DYPB 3RPIA 4JQIL 4WFGD 4KMQA 1C7TA 2H32B 4LSSL 5E8EB 2RGSA 1ZT4A 4NO0B 5DQ9A 5FYJE 3PWJA 1KLGB 5F9JA 4Q97A 1HWGB 2ZNWA 3JV4A 5E8DH 3U4AA 3BN9D 4I13B 1V8HA 3OR7B 5E94A 4TUJB 2X4SB 5IVOA 3S3PA 3V5HB 1YEDA 1KCUL 2EDDA 5HPMB 3HNTL 3UYOD 5KSBB 3KPRD 1U8PB 1OGTB 4L5FH 3VU2A 5E8NB 5IESH 3RU8H 3EYUL 1P69B 3TWCH 4EN3A 3C2SA 1BREA 3V52L 4KVCH 5JORB 4GRMA 1GZQB 2EEDA 4FZEL 3DUSB 5JDSA 3SE4C 1MI5A 4ORGB 1OSPL 3HN3A 3DV6A 3L5XH 1JVKA 3O8XA 3CX2A 2O93L 4CN6A 1R3JB 4JRXB 1S9XA 2JJTA 4EBQH 3MA9L 5IW3A 5HYJB 1U8LB 2JIXD 1IGTA 4WEBL 3GUTA 2HMID 4N8VG 1NCWL 1KIUA 4PV9A 2O5ZH 4MHHI 2BOBB 1NCDH 3BW9A 4OCMC 3GI8L 2PW1B 5J1AB 5DT1H 4R9HA 3MOAH 2VDKL 4S1QH 4KXZI 5KANI 1R24A 4WIQA 1UM5L 5I6XB 4Y5YB 2APWA 4C4KO 1A1OB 4JFXB 1TQCC 3H9HB 2WBWB 4WI8A 5I1DA 4I18A 2NY2B 2IPTL 1IRAY 1NAKL 1OAZL 3EYQC 3CZJA 1EHLL 4LQFL 1NCCH 4LSRL 3OKNA 3MNZA 3NZHL 2VLRE 4IDJL 2XQBH 5C0AB 5IV2A 3RJQB 4JQIH 3TM6A 3OSKA 4IMKA 4LSSH 4YNYB 3WIFB 4HS8L 2IAMD 3JUYA 4HIJA 3C2AL 3MRHA 2YWZA 2A9NL 4RX4D 5ANMA 3X12B 2WK2A 4D9RD 4FQLH 4OF0A 1MUJB 4NKDA 2VDMH 4UQ3A 2IEPA 1I4FA 2CIIA 3ARGB 3QUYC 1U8QA 1KCUH 1WUNT 4XPBH 4PJ8D 5EBWA 3SKMA 3O9WD 1TNNA 2CH8A 5IBLC 5IW6A 2E6QA 1LILA 2IBZY 4PRNA 5INDB 3DIFB 1EFXD 1VFMA 2JELL 4S0TD 5T3XL 4CDGC 4YDLB 3VFPB 1FVEB 3OJDA 4YHNA 3V0AC 3DRTB 2E7HA 4ODVL 1BZ9A 4EI5D 5DMGD 3BPCA 4XB8A 2N1KA 3MA9H 3W11C 3P3YA 1D5BB 4WEBH 1NCWH 4D9LH 4XCNB 5EC1A 4YXLL 1U91B 3GI8H 5HDLA 3R1GL 3MRDB 3W9EA 3NA4A 1RFDH 1MRFL 3DVNA 3MZTA 4NO3B 4NQCD 3H0TB 5HHQB 5ITFA 3UBXA 1NL0L 4DVBB 2P5ED 5FV2A 2J4WL 3MXVL 3WJJA 1NAKH 1OAZH 1E28B 2XV6B 1HOCB 4LSRH 1SMAA 3GJEA 3GSVB 2ICWI 3L7EB 3LD8B 4ELMA 3WUWA 5JW5A 4TSAL 1XR8A 1RMFH 4HS8H 1OAYH 3MREB 1ZLWH 2VUOA 3FRUB 3OWEA 1C5DB 2X5PA 4M62H 5SX4I 2VXTL 4UQ2A 1R0AL 3OXRA 1OOAA 3WDJA 4BFGA 4WU5B 3RWCA 1F3DH 4PRHE 4OGXH 2FR4B 1RK0B 4RDQG 4LNRA 1EBPA 3X17A 3V8OA 4E41A 1MJUL 1R6VA 3U2SA 3N1QC 1KB5A 3BPNC 2X9WA 3NN8B 1CDHA 1K9TA 4QRUA 3PGFL 3NCEB 5T3XH 5DJYA 2P5WA 2XQYK 4ODVH 3G5ZA 5EZIL 4GS7C 5JNYA 2F19H 1G9MC 2APBA 2H3NA 4HUMB 3HZMB 1F13A 1X3DA 4LVOC 5HGBB 4YXLH 3STLA 3O4LB 2JB5L 3R1GH 4Y1AB 3U0WL 3ZSSA 1MRFH 3MJ8A 3AB0B 2Z35B 3HG1A 4PJDF 4KKAC 5F71A 4PR5B 3D87B 1A9EB 1J8HE 4P3DA 1E6JH 1UACH 2WBJD 3ZHLA 2FJFB 1FL6A 1BGXH 2J4WH 4AIXA 4OZHE 4ETQB 1XCQB 3GSNB 5DQJB 4TSAH 4M93C 3HE7D 4EUPG 4G8GA 4HV8A 4IOFC 1JGLH 4R97B 4LVEA 3LEXB 5I74C 1V7NL 1R0AH 3IJHB 5TFSH 5F6IC 4NWTL 3CUPB 1S7RB 4D0CB 2VKXA 2FIKA 4HGMA 1JGVL 4OLVH 2Y23A 3UX9B 2J5LB 4CW1A 4BSWB 2GJJA 1F90H 2FIRT 1UENA 5J57B 2V2WA 3PGFH 4OCSL 3VXUA 4Z7OE 2NW3B 5DK3A 2DIAA 1DBKH 3C5JB 3T3MF 3OAUL 4LCYA 4LASL 4LKCB 3LRSB 5EZIH 5SWSE 2C1OA 4KZEL 2GJZA 1U92B 4JO4L 2FRGP 3CDFA 3N50A 3QQ9D 1HNFA 1MOEA 3QUXA 4DK6A 2NTFA 3DROB 2OYPA 2YEZA 3WNMA 2JB5H 2AS5M 2ADFL 1XF3A 1OSZA 4OUUA 4G43A 2DJUA 4IIQA 2FH8A 1ZHLA 2ERJB 1CQYA 1I1AB 4MQ7B 3HS0B 5AYQA 4LGRB 1EHNA 4N9OB 1QFWL 2R29L 4K3DL 3KYOA 4FFVC 3NZ8B 2EDWA 2E8ZA 2HJLB 1D5MA 1Q9LB 1KT2B 2C7UA 1NBZB 1MREL 1J1XL 1SJXA 4HXBH 1QRKA 3GSRA 3TCXA 3FAXA 4BQCA 1V7NH 4JPIA 2EXWC 3LN4A 4OKVB 4ZUWB 3KYMB 5T5NF 3RVVD 1YNLH 4BH7B 1KEGL 3OXSA 4NWTH 3KLSA 1M71A 4P46C 4QNPF 1RJZA 2GFBB 4DKDC 2OK0H 4PV8A 3SJVB 3TO4A 1JGVH 5FO7A 4U0RC 1C8PA 5T1DH 1ZEAH 4P3CH 4PG9A 3TNNB 3UZVB 4H0GA 3SDCC 5AWNL 1B0WA 5IKCA 5I1CL 4OCSH 3W2DL 3ZYOA 1YUHB 1UWXH 1MEXL 1KF9B 1IGYA 3EBAA 4LARL 5FF6B 4LASH 3ZE1F 5DS8A 4B7LA 5FOBB 5KS9F 2Y7QA 4J7RA 2G75A 3GM8A 3QWRD 3RKPA 3OGCA 2QSCL 5D93C 3DGGA 3QHFL 5MENA 5IR1B 2E8YA 4JO4H 4S1DC 4HGKC 1T7WA 4FA8A 2C3HA 2CXKA 4MJIA 3CU7A 5E2TL 1AHWC 5KSAC 5GRVL 4ZFFA 1QYGL 2ADFH 1FNGA 1Q9WA 3VD5A 1N2RB 4K7FA 3B2UC 3RVXD 1IZKA 1Y6NR 5E70A 4HCRA 4WI2A 3T09A 2VTFA 4S11A 3Q1SH 2BFVH 3K7UA 4N0UB 1CE6B 3KXFA 1QFWH 2JLLA 2D9QB 3FMGL 3X11B 4WVRA 4XWOD 3BHBA 4S2SB 3QEUA 1MHHB 5GGSB 3SGJC 1B6UA 4P23B 5F1IA 3DGCR 2BHYA 2GY5A 5DHXB 1MREH 1J1XH 1UM6L 2AJVL 1S7XB 4LLAA 4XAKE 4L4TD 1HKLL 1RI8A 1HKFA 1UJ3B 2DQTH 4LQ1A 1XF2B 1T1YA 4PP1C 4XH2B 4JRYA 3ARDA 5BS0B 3X13B 2UV3A 2W92A 1FBIH 4Y16B 32C2B 1KEGH 2FJGB 2Z4QB 1NGYA 3BXNB 3MV7E 4LLMB 3KLDA 2B0SL 3ZL4L 2BY0A 3IAGC 2HJKA 3WS3B 2AABL 1I1RA 2D9CA 1GPOL 2DOCA 4Y5XC 1NCNA 2EDLA 5D1QA 3H3KA 4HIIB 2DWDA 5AWNH 5I1CH 3OB8A 3ZTNL 2VYRE 4K94H 4LARH 1F11B 1YMME 1ZOXA 1N7ML 1WWCA 4LHQB 1Z0MA 3TYFB 3QHFH 5IHLB 3WV0A 3PWNA 5T3XE 2VLLB 5CIPA 2IALB 2Q3ZA 1I9JL 5D2NC 2P46B 5EFIB 1P7QD 1D7FA 1PY4A 3W0WD 2NY5C 2VABA 4LVOB 3ARBC 3SDXB 3VMOA 5D4QA 1QYGH 4ODWB 4L29A 2WZPD 4PJIB 4BELD 4UNTA 3NCFB 2E7CA 5F3BA 1D3CA 1M7IB 1N5AA 3HAEG 1ORQB 5DI8B 5E5MA 5KN5A 1DBML 3FMGH 3JTTA 3EGSB 5EZLA 1U3HB 1S78C 2I5YH 5J3HD 4AEFA 1TXKA 1KBGL 3H7BB 3BKCL 4Z5RA 1M7XA 5I76A 3QQ3B 3BP5B 3S96B 2QSVA 4GXUM 1JF6A 1UM6H 2PETA 1V3JA 3TZVD 4TUKL 1HKLH 3EO1A 1FNFA 3WS6C 1IBGL 2YPLA 1ADQH 2DJSA 4G9FE 4DUWA 3I02A 5F1NB 4JM2F 5F6IB 4KKNA 5LGJB 5AYUL 5L2KA 1VKXA 1D6EA 3RPIB 5FA4A 3EOTL 1XGTA 3C60A 1JNNL 1CDCA 1VEOA 3TBYA 1XR9B 1ZT4B 1INEH 3OKYA 2OR7A 4Y5VC 2FHFA 5ETUA 5F9JB 4Z7NF 4UNUA 4XPTH 1YNTB 4OLUL 4NGHL 3ZTNH 1ZK9A 3D1MC 2XWJB 2Q6WB 2HP4A 4FQCL 2VQTA 4PJDA 3GGWB 1OVZA 2BY3A 1LO2H 1PX3A 4U7MA 5FECA 5IROA 3ULUC 4A6YL 2W0LA 1EH9A 1KYOJ 3W5MA 3VFTA 2J1KA 2R4SH 4W70A 5DC0A 5TF1L 1OP3H 1DLFL 5ADPH 4OCLC 1ZMYA 4JDVB 1MI5B 3MRBA 3GHEL 4JDZA 2EC8A 5JW4N 1LK3H 4R0LA 3O8XB 5IQ7L 2FBOJ 1W0WB 1S9XB 3ARFC 5TJWK 3GUTB 1CI5A 3BKCH 1LO5B 3ILQD 1QSEA 1WIOA 3IDGB 5JA9A 4XVSH 5LAXA 5C07E 5FHAL 1R24B 4BYHA 2BRRL 1IBGH 3TCLB 2E7LA 1UKTA 4MD0A 3I6GB 1G6RH 1KIPA 2GK0B 1JHKL 3IVKB 4NKIL 1T1ZB 3LKSB 2W07A 3MNZB 5ALCL 4FQXD 4LAQL 2OJEA 3QFJA 5BQ7B 1NH6A 3EOTH 2AQ3A 1JNNH 3M45A 5ICYA 1YPZB 5EB9A 3MRHB 4G8FB 3P30L 4JFDD 4UQ3B 2EIZA 2MPAL 4NGHH 4K9EH 2QEJA 3T04D 5E5RB 3EYFB 3MJ9L 4HJ0D 4PJ7E 3B2VL 3QIBA 5D93B 2CD0A 3WUWG 1RHHA 5HHOA 1PX4A 3DX8A 1G7MB 4OZFH 1LO3L 3SKMB 2X40A 4A6YH 1AHWB 4OFVA 5IW6B 4R8WH 1MLCA 4XXCC 4PG2A 4MNQA 5TF1H 4KRPC 1DLFH 1CGUA 4NZTH 5CAYB 1RZGB 3GHEH 3OJDB 1DQQA 1BZ9B 1FGVL 1I3VA 1DQML 3O4OC 3BPCB 5IQ7H 2VDNL 5GRZA 1QG3A 4YHML 3VXPA 3IS1X 3QUZD 1CICD 4QRRD 5IJVB 1FFNB 3FFCE 4NQUA 4ZFGH 2BOCB 3SEPA 5FHAH 1UCBH 3DX9A 4XHQA 1A6WH 2BRRH 4ZXBD 2ZCKL 4KK9C 4G9DB 2FO4A 3OKLA 4OM0L 2EDXA 4JDTH 3D39A 1DZBA 1BZ7B 2LABA 5HDBE 5SV3A 3OL2A 1JHKH 4HAGA 4NKIH 5DQDL 2IFFL 2KUTA 2JCCB 5T1KB 4P3WA 4X6DE 5ALCH 4LPXA 3GJEB 4ELMB 1WWBX 4LAQH 2RQ8A 1MCWM 3EJZC 4TQEL 1D9KB 1UB6B 2ZSVB 4WHCA 4QOKA 4TYUA 1TTGA 5KS9A 5DURD 3PNWB 1J0KA 4I0PA 5TE6L 3RWDB 3SN6N 1IL1A 1JYNA 3EHBC 4PRPE 3UTSE 5ACMA 4GJTB 3O45B 4I3SL 4L8CA 3P30H 1C12B 2XN9D 4FG6D 1SEBB 4X6CF 1FIGL 2XZAL 5DEFB 5ECJE 3BH8B 1FAKT 1QOKA 2I9LA 1NFKA 2GCYA 3B2VH 1YEHL 3TFKD 2Z93A 1GL4B 3FAWA 2R2EA 3G08A 4KDTC 5C0GB 3BO8B 1LO3H 1ORSA 4QF1B 3TA3A 3TN0A 4N5ED 5D2LE 4UMGA 1QLRA 5TQ0L 4LRIC 5GXBB 4KU1A 3UBXI 4NN7B 2PXYB 1VFBA 3WXWL 4L8SC 1AGCA 3VXMD 2MQCA 5T3ZD 3QDGD 5HYEA 2FECL 3D25B 8FABA 3DBXB 5DJZA 1QRNA 4HS3A 1FGVH 1DQMH 4U6TA 2RFXA 4ONHA 4W68A 4X99B 3U6RA 4YHMH 3WFDL 3SKOA 1PW3A 3MUJA 1N64L 1BFVL 2CJUL 3STLB 1AC0A 1JJUA 3KPSD 4N5UA 2OBGA 3MRGA 1FVDB 2DQHH 2PYEA 4LCWA 2R4RL 5EH1A 5DK2A 3MLYL 2ZCKH 3PV6A 3RIFK 4OM0H 1YA5A 1JWMB 1U95B 4P2QB 4Y4HC 4C55A 3EYVA 4GRWF 1QR1A 5EULV 5AAWA 1W0VA 4G7YL 2BVTA 3VDCA 5DQDH 5C0IB 3TBVA 5CEYA 2EE6A 3KYNB 5D6DC 4TQEH 1B4RA 3K1DA 4PJFF 3WHXA 3BUYA 4PJXE 2VMFA 4HV8B 1UC6A 4O2CB 5JIKA 3KPRE 2DYPD 1AJ7L 3HAEH 4I3SH 5I1LB 1IVLA 3A6BL 5DMYA 1NFDE 4GQ9L 5D7JC 4DOHB 4QRPB 1TJIL 4QLRA 1PEZA 1S9KC 4PY8I 3TNMB 1FIGH 2XZAH 5TE4L 5BO1H 1FZJB 3NIGE 4HJJH 3QJHA 2HVJB 1UH4A 2AXJA 4LEOA 3FFDB 4P59L 2EYSB 1DBBH 1JTPA 2BVPA 3FB6A 5TQ0H 1T7XA 1F6FB 3WXWH 2HVKB 1B4JL 3MGTA 5I1AB 1F8TL 4U49A 5DRXA 2UYLA 3ABZA 4Z7WF 3P77B 4PJAF 1QQDB 4WJ5A 1KLUB 3IFOA 4QHUA 1LEKA 5EUOB 3LEYH 5K59E 1RUAL 5DD1H 5IHUL 1ETZB 1SYVB 3U9PL 3WFDH 4YPJA 2CLZA 1G6VK 3CFEB 4JO3L 5MEOA 4FXKB 1A9BA 1HHIB 1N64H 4JRXD 1BFVH 2CJUH 2NTFB 4JM2A 5HYJD 4DGVL 3HZKA 1ZGLM 2G9HB 3P11L 1XIWC 1OSZB 2GKIA 5GSRB 1NSNH 1UZ8A 1AXTH 2NTSP 2E9WA 3IFPB 1ZHLB 3OB0K 4KI5F 4P2YA 1JPGA 4JQXA 3I85A 4V1DB 3ZKNC 4ONOA 4D9RE 4K2UL 3LB6C 3T0BA 2MFNA 3FB8A 2VO5A 4G7YH 3KYOB 3STZB 5AD0B 3MOBL 2CK0L 2NY2D 1JPSH 3GFUA 2NY6C 3U9UA 1Z9MA 1ZLSH 1CD0A 4CDHA 3QUYA 4Y19A 4DQOL 3G5VA 5EZJB 1B0GA 1S9VB 4NKMA 1AJ7H 4ZAKA 3QZWA 5EUKA 4IOIB 5L6YH 5JPNB 4GQ9H 3VFMA 1FNEB 5CEZD 4JPIB 2Z91B 3GM0A 4QXTA 5TE4H 2BC4B 4KGJA 1UKQA 3UCRA 4HXAL 3ZE2E 3ARGD 4YWGL 2NMSA 2VUYA 3TBWA 1RJZB 1ZWIB 4PFEA 2C1PA 3TO4B 1DSFH 1A6VH 1WZLA 2C3VA 4FQIL 5IB5A 1FLRH 5HTSA 5CJQL 3NH7H 3N9GL 1NGPH 4NQCE 2Y7QB 2EH7L 3QXAB 2JJUA 1MFEL 1RUAH 3O4OB 4AJ0A 4QHNA 5IHUH 3KYKL 3P73A 4HZLB 3IDMB 1HILB 2IH1A 4JO3H 4KRMB 1P2CB 2BSRA 1PYWA 4R96B 2ZUUA 3V8CA 4DGVH 5DRNA 1R5VB 3KPOB 3P11H 2LVCA 2O61A 2NLJA 3D0VB 1AE6L 3D6GA 3DURA 4KWUA 2DQUL 1XGUA 4H0HB 1AR2A 3CFBA 3VI4F 4F57H 1BIIA 4XPHL 4Z7UA 5F7EL 4LL9A 5DUMH 2Y1VA 1CVRA 2X4QA 5DXWA 2JE8A 5EO0A 3MOBH 5E95B 2CK0H 3NPSC 1QACA 3QNYB 4IMLA 4RFNC 1UT9A 2MHAA 3O81A 5D5ME 4DQOH 4ENED 1MCCA 2FO1A 5E6IC 43CAA 1BOGA 3ECBA 1T1YB 3IETA 3QEHA 4FQ1L 1MFCL 4QTHB 5CBEB 4RMQA 3TJEL 4XWGL 5GISL 5A1AA 1NGYB 3D85A 4IRSD 4GG6F 4F33A 5BVPH 4MA3B 4L8BB 1EHAA 1MPAL 2OJZL 5SWZB 4FQIH 9CGTA 5CJQH 4L8SB 2DWDB 3WNOA 3B6SB 4L8DB 4RWYH 4LF3A 1CXFA 3ORJA 1DVFC 3HRPA 3PG2A 4HUUB 2AAVA 3HKFA 1A3RL 2KPNA 4HT1H 2EH7H 1FRGH 1ZHKB 1FE8H 4HPYL 1Z6JT 3PWNB 2EYTB 1BD2B 3KYKH 4WRLA 4CMMB 5AEAA 3BQUB 4JO2L 1RZJH 3PL6C 3U7YL 4CN1A 3Q6GL 2CLRA 5K9KA 1AE6H 3RVUC 3O4LD 4QT5A 4Y1AD 4TTDD 3VD7A 4BZYA 1Z5LA 4LHUD 3I3BA 5F7EH 5C2BL 3MFFA 3QIWA 2F54B 3JTTB 5EZLB 2A0LD 2GITA 2PR4L 4N8CL 1OGAA 3BP4A 3C6SA 4U1GB 4ZUSA 1ACYH 4Z5RB 3CSYB 3VWKB 1YYML 2Y5TA 4M1DH 3MPCA 4AK1A 1J1OH 2AJXH 4R7NB 1RU9H 1DL7L 4M6AA 2HYMA 3WLWD 1NUNB 4AT6B 3OQ3B 4CU6A 3EO1B 2VXUH 3L9RA 4FQ1H 4PJ9A 3JV0A 5ISZA 1DBJL 3ROLB 4PJEF 3KVQA 1I7ZA 3RZCC 3RZWA 3TJEH 2HLFC 1XGPB 3MRKA 1L0XA 4XWGH 5GISH 2ITCA 3FO2A 2AKRB 25C8L 3HI1B 4HX1B 5DA4A 5GSVB 1XGTB 3C60B 1FFOB 3F7VA 1MPAH 3FOLA 4WO4C 5IHBA 2OJZH 2FYYA 2MCPH 5C09B 1BEYL 2MQ3A 1SBBA 2GTWB 3AREC 5EPMA 5I18L 3G6DH 2VKWA 5CSZB 1IGML 3ARWA 3MRNA 5C70A 4OD1L 1T89C 3MNVA 3DXAA 4JO2H 3VH8B 5IFJB 1KJ2A 3VCLA 1Q8MA 4I2XE 2BJML 1U3JA 4MA7L 3X14A 3MRLA 4M1CD 3BIKA 4AM0B 4H1LH 4KK6D 4JDZB 4PJFA 5FIEA 1A7BA 5DO2D 1I1AD 2VZOA 4P2RA 5C2BH 1JZ5A 5E1AA 5AZ2H 1IGFH 4BUGA 4N8CH 2PR4H 3VFRA 3B9EA 4ODXB 3V0WH 4F2MA 5C86A 1YYMH 5DHYA 3SE9L 5LAXB 5JOPD 1JBJA 3O6KL 1OTTC 1MRDL 2EDNA 4P46A 3L7FA 5BRZA 3RWJA 5F6HJ 4F80A 3EZ8A 1FG2A 3NA9H 1G0YR 4KJQD 4YK4C 1NLDL 1WZ1L 3G5YA 1DBJH 2YPKA 2VDOL 1KIPB 5TDOA 4WGWB 4CVZA 4NNYA 1H5BA 3EUUA 2DD8L 2VLJA 2YC1A 2EIEA 25C8H 4GW4B 1DJSA 3MSPA 2Y9RT 3QPQC 2UWEF 1B0RB 5T3ZL 3QXDA 4X98B 5MERB 4Z8FL 2ZJSL 3SJVD 2CO6B 1BEYH 1UB5A 4Z77A 2EO1A 1MQKL 2EIZB 2XXCB 5I18H 1IGMH 5IUSA 4L3EA 4OD1H 2LAAA 3QIBB 3K3QA 1R3LB 1T2QL 4JG0L 3L3DB 5DJ2B 4OGYH 2BSSB 3VGBA 1OARL 3DX8B 3OMZA 4MSWA 5IWLC 1E4WL 5C0FB 4MNGE 4L3CB 4TPRH 1BX2A 2D0HA 2PYFB 4MA7H 5EOQL 4OB5H 4NCC1 3ULSB 4QHKI 4P4KB 3SGJA 1N26A 4QRSA 2ADIB 1CFSB 3IF1A 1X7QB 3GMMA 5HI3D 1OLZA 1E4JA 4L4TE 2X9XA 2IBGA 3SKJL 3ZT6A 5L0QC 1KJVB 1AO7B 3IKCB 1KENL 2NX5A 2Z9TA 3WDIA 4NP4L 4IBLT 4P9ML 3NPSB 3ZSTA 5HXMA 5SX5K 3SO3B 2V9TA 3GIVA 4QY8B 3TVMC 3O6KH 3CVHB 1T3FA 3FT2A 4P23D 2Y25A 4D8PB 2VR5A 4MLIA 2G2RB 1JMXA 2HFEB 5K9QG 3TF7C 2IH3B 5IQ9A 1JPFB 2DDQH 4NQDB 5KVEH 3KS0J 1NLDH 3D39B 4R2GD 3C08L 4KHXL 5BS0D 1OPGH 1TETH 3C9NB 3RWIB 4Y16D 3SDDB 2Q86B 2GSIB 4I0PB 5FUOL 3F7YA 1IL1B 1IILE 3QH3B 4G6JH 2ZJSH 5GGTL 3W0WE 4Z8FH 2X70A 4ZD3L 5JW4Q 4L8CB 5HHVL 1LNUA 5D2NA 4UILH 4OF8A 1MQKH 2V9QA 1QKZL 4EKXA 3ARBA 4JPWL 4X5WB 1S9WA 2D7PA 2W38A 2GCYB 1WCBA 3EDJA 1T2QH 4JG0H 2HN7B 4JY6B 4PP2B 1BZQK 2R2EB 2V5MA 1JV5B 3ZO0A 1QA9A 4PJHE 4K3GA 1E4WH 1IAIM 1WCQA 2DTSA 3TA3B 3QRGH 5D70L 5KTEL 2X4RA 3VXOA 2EC9U 5BJTA 2LVEA 4QRTB 3PWVA 3QIUC 1AGCB 2UY6A 2AEQL 2EDHA 4XRCA 3DNKA 4X4ME 4LVNB 5JTWA 1Q1JL 5IG7A 4V2BA 1KIRA 1KENH 1MCLA 3ES6A 1MCFA 2RFXB 1TENA 2VH5L 4NP4H 3WS6A 4P9MH 3VGGA 4U6XA 3VI3E 1JHTB 3U0PA 1U3HD 1NGXA 1I8MB 1CGTA 5DFWH 1QFPA 2H32H 3VXSB 4NQEA 2PYEB 3RVWD 4FFYL 5CEZL 4XCFH 3PV6B 3O6FB 4JKKA 2Y72A 3FQRB 2WM0A 3EYVB 1B90A 4PYGA 4Y5VA 3RZCB 1I7RB 3C08H 1JYWA 4FQ2L 3T2NL 1NBYA 1U9KA 3VGAB 2FHBA 5GGVL 1TZIB 5CEYB 4JFFA 3L3IA 4KH2A 1EK3A 3EOAA 1IGCL 5J6GA 3RWEB 1QO3B 1M05A 4JJ5B 1FGNL 5D1XA 4Q0XH 2OS7A 2QTEA 4U33A 3VE0B 1H3GA 4OZGB 4UT7H 4X0KB 3BGFC 4JPWH 1RJCA 2X1QA 3QJHB 5IVXF 1YN7A 2DS4A 2YWYA 1LO0L 4WFED 3O2WH 1U8NB 3FB6B 3GBML 1NEZB 5D70H 3S37X 2D2OA 5KTEH 1E27A 2H6PA 1TPXB 3VFUA 3PWLA 1J0IA 4MNHB 5EBLA 2W60B 2HFGL 4OZHB 1J0JA 4M8QB 3MGTB 4HF5L 2AEQH 1IAKA 2ZPKL 1SY6L 2UYLB 2PW2A 3RTQC 1MI5D 4P0DA 1RD6A 3UO1L 2DM3A 4P5MA 3DO7A 3L3GB 1JNHB 4HIXH 4KUZL 2IJ0C 3O8XD 5DUPL 4UAOC 3U30C 1RURL 5JIHA 1QHPA 2IQ9L 1M6OA 4PJEA 4NHUA 1UVQA 2NY0C 4RWHA 4M7LH 43C9B 4FFYH 5CEZH 5CFHA 1NC2A 4GLRI 2ATPB 1S7WB 2GK2A 2NXYC 4JFDE 4U1KB 3HRZB 2OLDA 4FQ2H 3T2NH 5GGVH 2YZ1A 1B6DA 2BVYA 5IW1A 3GSUA 4OZIE 4J8RA 3D48R 1IGCH 4OV5B 3Q6FA 4O4YH 2EDJA 4Y19B 3ZDYE 3MBEA 1FNSL 1OTSC 1FGNH 3J7HA 4NKMB 4ZAKB 2AK1H 5EUKB 1I7TA 4MJ6B 4XP9H 4I1NB 5IVZA 5HI5C 5TPWH 1T04B 2X05A 3SOBL 4OFKA 4W6WB 1MCOH 3EDKA 1TJGL 4XXCA 5ILTH 5SX4H 2ZG3A 3MV11 2ZUQC 3PJSA 3C6LB 3LQZB 4TULL 1F4WL 2QKIB 1TDQA 5T1MB 3QHZL 4XNQB 1S7QA 1S7SA 4HUXB 2PTTA 4QRRE 2HFGH 2R1WA 4HF5H 1ZHBB 5JHDB 5IJKC 5GS0D 1SY6H 3SDAC 4FFWD 5D7LA 2D4FA 2X4UA 1X5XA 1IFHL 1XF4A 3CLEL 1P4IL 4KUZH 4C4KT 4R6UA 4U1HA 2P24A 5DUPH 1I8IA 1FVCA 1PYWB 1RURH 2PN5A 4X4YA 2IQ9H 4M1GL 4J3WA 2YBRB 3HMXH 3HCVA 1P1ZB 1I3GH 1RSFA 3TVMB 3CAFA 4H8WL 5GS1B 2R56H 2Q8BL 3PP4L 4F58L 3HUJB 1TQBB 3SPVB 4PBVC 3OKOB 1A6TB 4N90D 3RFZC 4P2OC 5A3ID 1X44A 1BIIB 2J6EA 2UWEA 3B9KC 5DVLA 2XN9E 1VPOL 4LVHC 5DFVC 4XCEA 2APTA 4BH8A 4DVRL 4FQJL 1TIUA 4I48B 4M43H 4WTWA 3TBTB 3ZDXE 3WIHH 4P99A 5EO0B 4HW6A 2OR8A 4RIRA 4JREC 3S97C 4GAJL 3ZKMC 1TCRA 1DANU 1CIDA 4RGNB 4QGYA 1OB1A 5EN2B 3RWGB 4DKEL 4FQPA 4ZOEA 1D9KD 1JNJA 4KDTA 1ODAA 2FEDD 3VRLF 4IHOA 3IETB 4X6FA 2VDLL 1T0PB 1F3JB 4QXGL 3SOBH 1ZSDA 3VXME 4NJAH 3UPRA 3QDGE 4OD2A 2YUWA 4LDLB 3CIQA 5BMFL 3S35X 5F96H 4U4BA 4XCYA 3PUCA 1F4WH 4M3KB 4APQA 4YUEL 1ZT1A 5CILL 3S8WA 4E41D 1Q0XH 1V3KA 1AIFA 4ZTPL 4X7EC 2DL2A 2J8HA 3LAFA 3KPSE 1YEKH 4LF3B 1OP5K 3V2AR 2PXYD 5D1ZC 4NUGH 1GGIL 4HK0A 4WWID 4JFPA 3I6KB 4EDWH 3SDYH 2OI9C 3OJVC 1IFHH 4FXGB 2W9EL 3X3FL 3MLSL 2QQQA 3RIFF 5E9DB 3GSNH 3S3SA 4Z7VE 4PLKD 2C5DC 4MDJA 1W72L 4TVSa 4H8WH 4YHPB 4NRYA 4YGVA 2Q8BH 5CKAA 3M17B 1A7NL 1RZKL 4WU7B 4Q9RL 4R7DA 1A6UL 3MACL 1G7LA 1RZIB 4MCZA 4F37K 4ZSOB 3R4DA 4DVRH 4FQJH 3LIZL 4XBPA 1IEBB 4P2QD 4Y8AA 1OTUC 2GITB 1OGAB 5D7JA 3C6SB 1VA9A 1FV1A 2LAGB 2GT9B 5FM5O 4X6CB 3S4SB 2Y5TB 3CH1B 3WEXB 5K9JL 3L1OL 5DJCA 4I3GA 1KPUB 2CSPA 2EIDA 5F9AC 5H2BA 5KSBE 5F93C 4PJ9B 5F97E 2FGZA 1FL3A 1NAMA 4QXGH 1UZ6E 3UTTB 3VA6A 4PRIA 4BA8A 3FQXA 2BZDA 3NPZB 3TV3L 2F5AL 4YBHA 3V5DA 3IRZA 5BMFH 4MS8C 4XBGA 1HI6A 1KXQE 5CILH 3LSOA 3U48A 2X2YA 4OT1L 4O2FA 4JRXE 3TPUA 5HYJE 1DQLH 1JL8A 1FFPB 4XNXH 4XXDB 5FYLD 5MI0C 2F9BT 1EMTL 2OL3A 2MKLC 1XIWA 5CUSL 3DV4B 5C08B 3AAZB 5CCKH 3FCTB 2W9EH 3X3FH 3DUUB 4JLRA 1TJHL 3CC5A 3DX6B 4GRWB 1S5IL 4BSVB 1HXYB 2FATL 3BN9C 4OTXL 3X14B 1A7NH 5C0AE 3OBAA 1J12A 2X9YA 1S3KH 3QWOB 4MJ5B 2J8UF 4PJFB 5HGDA 3MACH 5FA3B 1YN6B 2YA1A 3P9MA 4Y7MA 4CRPA 1XZ0A 5CEZE 3LIZH 1Z0NA 4XX1E 1FZKB 1P4LB 1VGEH 2AXFB 1U3ZA 1S7UA 1IKFL 2BX5A 4PB0L 3S88L 5BRZB 3RWJB 5HYSA 2ED9A 5GQBA 3DVFA 1I9RL 2HMIC 2ZOKA 1A0QL 3JWDL 2F5AH 4OF7A 1H5BB 2VLJB 4PRDA 5I17B 1GXEA 1H3XA 5H35A 1JRHI 5E2WL 5DRWB 4Z7WB 5IMMB 4PJAB 1R3IH 3V0VA 4PRBB 4PLNC 1PQZB 4LRNL 3TO4D 4PS4L 3MFGB 5AZEL 4JFEB 4XHJD 2VAJA 3KHOA 1C5CH 2XWTB 1CZ8H 5EU4A 4L3EB 3WFZA 2WUBH 3QQ4A 5CUSH 4K3EL 2VLRA 2VC2L 2IAMC 5FCSH 5F7FA 4MJ4A 3MRCB 3LH2L 5I8CB 5T33L 5FO8A 3NGBC 3PP3K 1K2DA 1RK1A 1MNUH 1NFIB 4FXLA 1CXHA 5DDHA 4PGCB 4OTXH 5FGSA 3E8UL 1H8NA 1ZHNB 4QRSB 1UEMA 1HH9B 2WIMA 3DRQA 1BBJA 4P57A 4PJ8C 4ZG1A 1FN4A 3O9WC 1UM4L 3TO2A 2NX5B 3RL2A 2B7DT 1J87A 4ODUA 4TNVK 4RMVA 2MTPA 1MLBB 3IFNL 3MUGB 2Z31B 2ZKHL 3DHMA 3ULVD 2EDRA 4EIGB 5T5FH 4MD5A 1IKFH 1T20A 4M8VA 2W0FB 3HC0B 3SBWC 3GMNB 4PB0H 3S88H 4K9EC 4EI5C 2CRYA 3BUTA 2DTML 2MNUA 3OAYK 4BQ8A 1J0ZA 3WDHA 2FWOB 1A0QH 3PHOB 4JRYD 1I3RA 4OF6A 1DQJA 1CLZH 3TIDA 1DVFA 2H9GA 4MB3A 5CJ8A 3AMLA 2ESVA 5HHXL 5F8QC 1YEIL 2R69L 1IM9B 4LCIL 4NWUL 3HE6A 2ARJA 3U0TA 1LNUB 2B1HL 5SWZD 1BQLL 3RA7L 4YC2C 1C08A 3PL6A 4IJ3C 5TQ2L 3O4LE 1YDPB 4Y1AE 4XP6L 1GJIA 3HC4H 2X6MA 2VC2H 1F4AA 4U0QB 2ZOLB 4ZDHA 3UTZA 1UKSA 1WAAF 3LH2H 1LE5B 3RL1A 1BD2D 5L7XL 4J6RL 2YRPA 1WICA 1VGKB 3E6HB 4GKZB 2X4TA 3TT1L 3PWVB 1T03H 4ZNEA 3BQUD 1ZS8A 3BZEA 3E8UH 3QG7L 1VFOA 4EEEA 2QADB 1AD0A 3QDJB 4PRHA 2P7TA 4LLQB 4XCCH 2V2XA 5KVDL 1KIRB 2RB8A 1HE7A 4U1IB 1JZ7A 4JR9L 4YDJA 1IQWL 3IFNH 4WW2C 1WT5C 4KDVA 2F54D 3U0PB 3LS5L 2ZKHH 1WGOA 4Z76B 4P5KB 2A2QT 1NDGB 4NT6A 3L5IA 3DX7A 3VWKD 4GG6B 2CDEA 3LKQB 1AGBA 2DTMH 4WGVB 3QG6A 3BVNB 1J5OL 4WO4A 4Q6IC 4YE4L 3BSZH 5CD3A 5IMKA 2GSGA 1MVUA 2VJXA 1FNAA 3OKMB 2DQJL 1YMHB 1LK2A 1FYTB 2XYCA 4JFFB 4OF5A 3L3IB 3B3IB 2VN4A 4MQTB 2HFTA 2NQCA 4NQSA 5HHXH 2ED8A 5J6GB 3T77A 1YEIH 3LS4L 5CMAA 2R69H 3VFGL 1ZA6A 4E9LA 4OLZH 1U8MB 1JCKA 4NWUH 3IDJA 2WBJC 3C60D 5D1XB 5GS0L 4RSVA 5AG9A 2B1HH 4ONFL 1J8HA 3RA7H 5C09D 4S10A 2V6HA 2VLMD 4LCUB 4GAGL 3HMWL 4ODSL 1KCLA 4DFIA 3HI5L 4XP6H 5HDOA 3HE7C 4HIEB 1SJEB 4K71C 4BKLB 3VGHA 3MRFA 2SEBA 4UV4L 5KG9B 4JRWA 3LKPA 3IXTA 1E27B 4R4FL 1CLOL 3WL9A 4DAGL 1KC5L 1T1XB 4XP5L 5JOPE 4XPFL 2PW2B 2E27L 2D3VA 3SGEI 3FO1A 5IGXL 2VL5A 1KACB 4M6MH 1RV6X 4P5MB 5KVDH 1HHHB 5DJ0B 4WI3A 4UU9B 1IQWH 3STBA 4TSBL 4F7EB 3FB5A 1A6ZA 2UZYB 4AH2B 3VJ6A 5HY9A 4KROB 4U6HA 4U3CA 5ERWA 4UT6H 3UYRL 3T8XA 3SJVE 5DZLA 1J5OH 5SWSA 4NN6B 3QQ9C 4YE4H 4CN4A 3S9DB 1Q9OB 2D4DA 3QYCA 1RJLB 1I1FA 3EYOA 4YIQB 1OT2A 4NCC2 1BECA 5FEBA 2DQJH 2X7LB 5E6YA 1IT9L 5IW1B 3RRQA 1P5VA 4F7CA 4J8RB 3VW3L 5C0ND 1GOGA 1KB5L 1AH1A 3ZDZE 4HIHA 5ID0A 3LKOA 4JZJC 1KIQA 2X4PB 3QP3A 4IRJA 4GG8B 4NRZA 3N1MC 4Z78B 3L5WA 5IVZB 1LE9A 2W9DH 4I0CC 4OGZA 1OAUH 4GAGH 3HMWH 4ODSH 2OXHA 4PGBA 1FC1A 1N4XL 3HI5H 2H8PA 4UDUA 5D9SB 5FO9A 1R3HB 4R4BA 3QIBD 5EBMA 3GBNL 1IEHA 1T0NA 1BFTA 3QNZA 4UV4H 2J8UA 1EAPB 4KMTH 5B39A 4OGAD 4N0UE 4NHCL 1CLOH 1P53A 3AY4C 4K8RD 1CG9A 4DAGH 3RVVC 3TJHD 4XP5H 4XPFH 3TH4T 2X1WL 3DTXB 2E27H 3VFOB 4P4KD 4P9HL 1NGWA 4Y4KB 5C6PB 4M7JL 1XF4B 2ICEA 1XFPA 4UIKL 1AO7D 4TSBH 5ADOL 1INQB 5HDBF 1BFSA 1OM3L 5BS0E 1K3IA 4WWKB 3PHSA 5JW4R 4ZOAA 2HAZA 3ZHDA 2Y36L 3D3VB 2MJWA 2EC9T 1J05A 5EU6B 4YHIB 3RVTD 1NMCC 3UYRH 3VMPA 2I27N 2VZSA 1MFNA 3GO1L 4WDIB 4JZNA 2VR9A 4BFIA 3FQUB 1KCVL 5JZ7D 4KAQH 4NQDD 3D39D 3QUMA 5FHBL 1U6AL 3RDTA 3VFSA 3RVXC 4GMTH 3CSGA 1IT9H 1BVZA 2WLYA 2V2TB 3VRJA 3OAZK 2YUVA 4RQQA 5AUMA 3SDDD 5ESAB 2N7AA 4KDWA 2APFA 2P5EB 4Y4FA 1F58L 4YHZL 1D5ZB 5FYLL 5DD6A 1D5XA 4IHOB 4I0PD 3H9SA 5FB8B 5D2LF 4XWOC 5E7FA 3SDXE 3UPRB 4UNVA 2I07A 1VFUA 2QBWA 2YUZA 5D7SL 5A2KH 4PJIE 1Z9SA 1N4XH 3KJ6H 3MCKB 3UPAA 4D0BA 1WBZB 1YJDL 3GBNH 4APQB 3QI9B 1IAOB 4GW5A 4M7ZC 4HS6B 3WLBB 1AIFB 1EEUA 1T21A 1FL5B 3TA3D 4MVBC 3MNWA 4N0RA 2OSLA 4RMSA 4UTAL 1KJMB 4RDQF 3I3DA 3K8LA 1BFOA 1EX0A 1PZ5B 2CO7B 5D6CA 1JHLH 5TDNA 3DI3B 4Q2ZA 4P9HH 3JSSA 5ID1B 4M7JH 4X6BB 3MV7A 3MRMB 4XP4L 1IGJB 3MGOA 4YDVA 4UIKH 3QUKA 5C8JA 4Q74A 5TGBB 3LMJH 5ADOH 1XEDA 2JJSC 5K9OA 4YJZL 3RUGF 4LCCA 5HGAB 1JWUA 5FOJA 4K7PL 2AJYH 4X8JA 4R7DB 2V17H 2F74A 3VXSD 3T4AB 3IAQA 2R2HA 3MJ7A 4PGDA 4PJXF 2PYED 1YMMA 2D7NA 1Q0YL 1T7ZA 3O6FD 4Q6IB 4HLZH 1NFDF 3UEZA 1KCVH 3QCUH 2AJUL 4U1SA 5FHBH 1FSKC 1U6AH 1FV1B 3RZCD 3V6ZA 5ICZA 3L6FA 5F88A 3UDWA 3NIGF 1HIML 1FFQA 1X4XA 3MRQB 5I73C 4WFEE 5ACZB 2UZIH 3MV01 2UZXB 1F58H 5BXFB 2O26U 4PBWD 5FYLH 4JB9H 3WN5B 2L7UA 1HYSD 1WAAA 2OZ4L 2V5TA 1NAMB 1T80A 3UXFA 3NIDE 4FNLL 3MLWL 4X9BA 1IQDB 1RZJC 1MI5E 1YJDH 2R23A 4LSVH 3TZVC 3U1SL 3RTQA 1BVKB 1UWEL 5ELIA 2LQRA 4OCYL 1DUYA 1A1NA 2VDRH 3LSOB 7FABL 2IG2L 3O3DB 3FQTA 5KW9L 3U46A 1UFUA 3U4BL 1FDLL 3LEVL 4G9FA 4UTAH 1HDMA 2CDGB 3T2PA 4WEUD 2I25N 4GW1A 3MROA 3F5WB 3AM8A 5CHNA 1EEZA 1UWGL 3L3HA 4XP4H 1XGQB 4ZPTA 3WFCL 1CXEA 1DEEB 2A6IA 4DTGL 4HLJA 2P44B 1RJYA 5DYOB 2R1YB 3QISA 5J89A 3D2UB 1BVLA 1CDIA 4OM1L 2J3SA 1YPZE 3P9MB 3BD5A 3MMEA 4LLDB 5DMKA 3DHJA 5KSUA 3R06A 5CINH 3ZTJG 4P4RA 3HTLX 2K1MA 3ZE2F 3LQAL 3OX8B 3ESVF 4HH8A 5IVXB 1VB9A 2YMXH 4W4OC 4X7TA 4Y19D 1ZLUK 4GKSB 4ZAKD 2OZ4H 4MA8H 3TLRA 5I2IA 2R2BB 4TVPD 4ZPVA 4WHTB 2AK4A 4EJ1C 2ZOKB 3ILQC 4FNLH 3U4EB 2P8LA 4RAHA 5B38A 2R0LL 3EJJX 3I50L 4CU7A 1OAQL 3FHQA 4EVNA 3C6LD 3SDAA 3U1SH 5BW7C 4N0CD 1UWEH 2IPUG 3OR6B 1YYLL 2YD5A 3CFIC 3GMPB 2IG2H 5DJAA 5KW9H 2UUDK 2ICCA 5ALBH 1ES0A 3LEVH 4FP8L 1JTTA 2FH6A 3BD3A 3NIFF 4FQXC 4YBLB 3I2CH 4NO2A 4N90E 4NPYB 5JHDD 4I4WB 3C5SA 1DR9A 3UTQB 2CIKB 1UWGH 1BHGA 3IRPX 3ULVH 4U31A 3WFCH 1ZGLP 2R1XB 3PHQA 5B8CC 3B9KA 5EIIB 3AXLB 5E00B 2AV7B 5DTFA 1K8IA 5FO8B 4R90L 2A6DA 1JFQL 1OAXL 4DTGH 1XH3A 1GH7A 3TBSB 2JCCE 2A73A 2BVOB 4HJ0C 3DARA 4ELME 1A7QL 5H94A 4QRQA 4RGMB 5D5MF 2DI9A 4NKOA 4PJ7A 3H8NA 4Y0GA 4P57B 4UDTB 1FN4B 1WFOA 3TO2B 3UZQA 5GZND 1TVBB 3CSPA 4WW2F 3OKEB 3LKNA 1SBSL 1K4CA 3M07A 4MD5B 3LQAH 1T20B 1T4KA 3QO1B 5INCA 1ONQB 3QULB 5KOVC 4RGND 3NFSL 1YECL 4HKZB 3THML 3RJDA 3E6FA 3K0WA 2FB4L 3FB7B 2CLVB 1QP1A 1L7TL 1CICC 4Q9BA 3JTSA 1RUPH 3BISA 3MRIA 3QXWA 3I50H 3FFCA 4S1RL 2ESVB 4FHBD 4GXVL 4IS6A 4ZXBC 5I1IL 4W6XB 4M7ZB 3O2VH 5IMOA 2D7TL 4LFHD 4HGWB 2Q87A 3HE6B 1KLFA 1X6LA 1AXSB 3REVA 1P4BL 5BZWA 1HHKA 2F8OA 4FP8H 1AGEB 3QA3A 2VLKA 2GY7B 1VHPA 1OP9A 2QR0B 5MEPA 3RI5K 1NDMA 3UTZB 3PQYB 3QDHA 2EDTA 1MSPA 2XWBB 4JY5L 4P2QE 3SKNA 3MCLL 4PGEA 1ED3A 4PRPA 4XC3L 3UTSA 4R90H 4XPAL 3BDBA 4XNZC 4F37F 5E9DD 1X4ZA 5E4EC 4GRLB 1NEZG 4BZ2L 5JUEH 3TFKC 3T4YA 1A7QH 2VITA 4JHWH 3GI9L 4X83A 1B3JA 3QDMA 3P9LA 1MWAB 1S9YA 3W0WB 1YEEL 2GAZB 3QR2A 3D0LB 4YBQD 5ENWB 4DOHE 2X4OA 4YDJB 4Z0XA 2DM4A 4QRPE 3QIWD 4ZQKB 5FYKU 5D2LA 1A7PH 1JPST 1OGAD 1T0MA 3BGMB 3QBTB 1SBSH 4U1JB 1EBAA 1J0HA 3S36L 1G7IA 2DI8A 5ITBL 3CK0H 3NFSH 4H5SA 3QNXB 1F4HA 1AGBB 5FKAB 3ALXA 3VRIA 1LD9A 1BF8A 5A43C 5IMKB 4PJ9D 5FYLE 1DBAL 5ISZD 1GSMA 2CDFA 3UTTD 3PGCA 2DLTA 4QHLA 3DLQR 2D03L 3B5GA 3W9DB 1HHJA 1ZT7B 4GXVH 4NQSB 3TZVB 1F97A 4K8RL 4RISL 5EUOE 1ZA6B 2D7TH 4Q9QH 1EEYB 3T3PF 3ILPB 3PWPA 4KHTL 2G5BA 3QFDA 2B8OT 3W39B 1A1MB 1FPTL 5CWSA 3C87A 3P4MB 1MH5A 4O51A 4PJ5B 4YHOL 4IM8A 2VL4A 3EOBA 3ZE0F 1AGFA 3RWFA 5MP6L 2XKSA 1ADQA 3RBSA 2NXZB 1VDGA 1LP9B 3H3PL 4LMQI 2BRQA 3HFML 4PJXA 5C08D 4PJGF 3KPRA 4XC3H 2NW2A 4KJWD 4XPAH 1EXUB 5EOCJ 5DHVB 1NFDA 2O5XL 2YSSA 1BQHB 2XXMB 1EJ6A 5IK3B 1MHCB 4RMTA 1Y0LA 5FCUH 3LV3B 1CWVA 1MHEA 3GI9H 4MJ2A 5DK0B 3TH3T 1H15B 3QO0B 5IB4A 3C8KA 5C0JA 3IYLW 5FK9A 1NGQH 3FB5B 2CGRL 1XGYL 4XNUL 2JIXA 4U6YA 5H37H 2R8SL 3RY6C 3OZ9H 3I84A 4XGZB 1MIEL 1HWHB 3MRRA 4Z18A 1IKNA 4KUCF 5ITBH 1KG0B 5DRZA 5ERWB 3T8XB 3T08A 4ZFOA 4H26A 1WK0A 5BRZD 1H3PL 2DRUA 4YXKL 4LLUA 4X5XB 3T1WA 1DBAH 4ZFZB 1T1WA 3FN0L 1QBML 4DFHA 2D03H 4OI7A 1CFTA 2QL1A 3IJYA 1N3NA 2VLJD 4K8RH 4RISH 1CLYL 3VDAA 2XNAA 1EZVX 5I6XC 2HFFB 4Y5YC 2VQ1B 2HA1A 4IRJB 1KPRB 4PLOB 2IAMA 3HB3D 4F7TA 3L5WB 2YR3A 4HQQH 4RX4A 4WCYL 5DR5L 3O3BA 1IM3B 1H3TA 4YHOH 2NY2C 4JFED 4A2MA 1S8DA 5ESVA 5FKPB 4G7VH 1NC4A 2NY1B 4OZ4B 4PGBB 4GO6B 3WFHB 5HHPB 3ZTJH 3O3AB 4JZOB 4L3ED 3IT8D 5FO9B 4R4BB 3VFWA 1VADB 5EBMB 1WFTA 3HFMH 1G6RA 2BVEA 2J8UB 1YY8B 4PJ8A 4KI5D 1QFOA 4LFHG 2QHRL 3O9WA 2ARWA 1HINL 4KZDH 3CVHH 1CG9B 1Q94B 3ULVE 2YZ8A 2O5XH 4HH9A 2NNAB 3NOIA 2EIBA 1JGUL 2RAMA 1AP2B 3D9AL 3ARGC 1KEMH 5EU3A 1EFXA 1P9MA 3WIIL 1NGWB 4YX2L 2OCFD 4DZBB 2OM5A 5KVFH 2X41A 2CGRH 1XGYH 4U3XA 1ND0B 2NX5D 4JRYE 4XNUH 1U3YA 1R5WA 4AEIL 3GZKA 2RIKA 1SJVA 3C09B 3GMOB 5F9OL 2Z31D 4OZFA 5CBAB 4NO5A 4HUVB 3CFKA 1SM3L 2QSQA 1J05B 1MAJA 4YDLC 4BUHA 3FQNA 1FYHB 2D31A 4NQCA 4LLVB 4I3RH 5DMIL 1JWSA 3FN3A 4JFOA 3QRFM 2EDOA 3L3OA 5SWZE 4YXKH 3GSOA 3SCMA 3QEQB 5B21A 3DMMB 4AENB 1QEWA 2GYSA 3QUMB 5E08H 4W4NA 4B53A 1QBMH 1UQSA 2IMMA 4KQ3L 4N9GB 4ZXBB 4U3HA 2OQJA 1CLYH 5C0EB 1CXKA 4Y4FB 3S4SG 1BD2E 4HZAA 1IM9D 5I75B 3H9SB 4WCYH 2YN5A 3WXVL 5IHZB 4H0IA 3P0YL 1CFNB 1DQDL 1Q38A 2VN7A 2I07B 1K8DA 4Q58C 1ZTXL 1TZGL 2ZUYA 3GMLA 2DMKA 4NYLA 4PY8J 1QUNA 4ENEC 3GSWB 4O2EA 1HZHL 4M7KH 1YQ2A 2UVFA 3C5ZB 5D5MA 3U36A 4HK3N 5DC4B 3DWTA 4J2XA 2QHRH 2F54E 1HINH 2A6KA 5HYFA 2VWEC 3MNWB 4WW2A 5I71C 2C3XA 2Y06L 1JGUH 4P5TC 3D9AH 4K7PY 4HUWA 4IRSC 5D6CB 3WIIH 2YOCA 1Y18A 2VZ3A 1J9CT 3QB7C 1A4JB 1F4YL 2QADD 5GRJH 4AIZA 4YX2H 3QDJD 4JJHA 4CNIA 3EAKA 1CD9B 4KY1L 4L4VB 3O11A 4U1LA 1I1YA 3B43A 2FLRT 4JPVL 3BP6A 3QDGB 5K9OB 2Q8AL 2IADA 2DL9A 4LCCB 4LLWA 5F9OH 4X4ZA 3BDXA 1Q9KA 1Z9OA 1SM3H 2V7NA 2F74B 3MR9B 4HBQA 1WQVT 3KNBA 3MJ7B 1KV3A 5DMIH 3MRJA 5D7KD 2WBJA 5C09E 2XZCH 4U1SB 2VLME 3GRWH 4GLRH 2GIYA 3F6IA 4RAVA 5ICZB 3WE6B 2WIIA 3EDEA 3HPJA 4KQ3H 4J3VA 1YY9D 4NDMB 1FYTD 4TTDC 4JFFD 4GSDL 3AB0C 2N56A 4Y2DB 3K8MA 3HE7A 1A4KA 5GPRA 3BAEL 3AVEA 2X89A 3WXVH 2A0LC 5D1XD 3WFBL 4OCNC 4M4PA 1VFAA 2BNQB 2LV4A 2P8PB 4G8EA 4QHMB 5D7IF 2DF3A 1ZTXH 2NYYD 2CKBA 5JXEA 1TZGH 5IB3B 1GGUA 2FL5B 4XB7A 1H0DA 3S5LB 3PWUB 1SVCP 1HZHH 3WLWC 1RVFL 1JF1B 3EO0A 4H8WC 2COQA 4J3XA 1DUYB 5J9PA 1KTLB 4F7PA 1MCSA 4R97C 3U46B 5C3TA 1MCBA 1G7HA 5CSBA 5JLZA 4GW1B 3HAEA 5B38G 1UYWH 5I16B 5L9DL 1GGBL 3M1BA 3B83A 1P5UA 5E99L 3RAJL 1F4YH 1G7QA 5IOPA 3RBGA 1OW0C 4ZPTB 5F89B 3ROOB 4OFDA 5MEQA 3WNPA 1HSBA 5BZDB 2HG5A 4WENB 2J5LC 4JPVH 3A0OA 4FMFA 2XPGA 5IMLA 4M6OL 4XVJL 2Q8AH 1CDJA 4DN4H 4ESKA 2ZUVA 3KR3H 1HQRA 5IM7A 1RJYB 1SYSA 4G3YH 4JGUA 4TVPH 3BDYL 5IB2A 4QCIB 5KJRL 1INDL 2WAHA 4FTVA 3T3ME 3ZDYF 3ZYJA 4KROD 3Q3GA 3CDGB 3O41A 2FJHB 3PGDA 4F7MB 1TFHA 5DMKB 3N1GC 1K4DA 1JIBA 5F7YC 5JXAH 5EOTB 4M1CC 3MV8B 4I2XA 1CQKA 3GJFK 5KOMC 1H3UA 2EZ0D 2BNUA 3GMRA 4KK6C 1CGXA 4GSDH 5CP7B 2VSCA 2E9JA 3IDIA 1J8KA 1G9ML 5DO2C 2ERJC 4X7TB 1I1AC 3MBED 5DVKA 4YHYB 3KPNA 4H25B 4KRLB 3HNSL 4GKNA 4PJGA 2R9HD