5GXBB

Crystal structure of a lacy/nanobody complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
MQVQLVESGGRLVQAGDSLRLSCAASGRTFTTYLMGWFRQAPGKEREFVAAIRWSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKLEDTAVYYCAAAARPSYSGDYGYTEALRYDYWGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactose permease
publication title Crystal structure of a LacY-nanobody complex in a periplasmic-open conformation.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 22
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gxbB00
1FBIL 1EO7A 1KTLB 2AEPL 2XRAL 4KRPD 3O2WH 2F53B 3TV3H 3LDBC 3TYGH 4U6VH 2HT3D 1NBZB 5CUSH 3RVWD 4AJ0A 4WNQB 3SO3C 1QYGH 1FG2B 3BKCH 3BZEA 3U4BL 1NC4A 3NCCB 2O61B 2FH8A 2H3NA 5M95B 3BUYA 1I7ZA 3MMEB 2AXFA 1W0YT 2A6JA 2BOCB 2VABB 2R4RL 1Y6MR 2V5RA 1T03H 3GDBA 3WFBH 5ADPH 3GHBH 3RWGB 1FN4A 4UUJA 3H9SD 3HG1D 5IT2L 3IDNA 1AD0B 3EJZC 1GC1C 1FORH 2J8HA 3GMMA 5IB1B 4PJ5D 2ZUTA 4JGUA 4PP1C 4AG4H 2R9HC 4BFEA 1MF2H 2LAGB 5DUBB 5E99H 5KTEH 2Q86B 2DM4A 3MFFB 2Q20A 2VAJA 3FFCB 4LSTL 2VITA 5DK0A 1BWWA 1VESA 3OGCA 3C87A 2J88H 4G42B 1BOYA 4KMLB 1QSEB 3S98A 1BVKB 1WAAF 2ZCLL 1KPVA 4KU1A 5K9OB 4LPCA 4JO3H 3Q5YA 1P69B 1TVHB 3MLRL 3GMOA 1C5DA 2X4TB 2XWTA 3FQWB 1YN6B 3VMNA 4KRPB 4CGTA 4RA3A 1MJJA 1AGFA 1RMFL 1T22B 4DKEH 3ARQA 4XCNA 2Y7QA 3O11B 1NLDL 1YNLH 2B4CC 3K8LA 3LKOB 5E56A 3V6FA 3M17B 4P2OD 3KS0J 3LQMA 2FWOB 2Z4QA 4NO3B 1KJ3L 2XPGA 4PLJD 2XY2A 5ACZB 5DMKA 3QPXL 3EO1A 4U1GC 3PNWB 2EICA 2R0KL 1BEYL 2QR0B 4D9LL 1FRGH 1WWBX 1C5BH 3O0RH 1E28A 4TULL 3GJFB 3MA9H 2YPLD 2EH8H 4MCYB 3DPBA 3H9SB 5I9QB 4GG8B 1PDKA 1LP9B 1MVUA 5K9KB 4FFVC 4YHOL 1FJ1B 4IRSA 2PXYC 5JHLH 4U1HB 4OF8A 4YC2B 3QIBA 1C5CL 5KVEL 5MI0C 4Y4KD 1QD0A 2KPNA 3QDJB 4PV9A 3BHBB 1U2CA 3L3DB 3SKNA 3ZYZA 4QRPD 3MV8E 3EYUL 3LKRA 4YIQA 5EUKB 4RZCA 4Y19B 4Z95H 3CFJA 3AU1A 3UMTA 1I7RA 3D9AL 1MELA 1DR9A 4JPWL 5J13C 3F12B 4G6KL 5JPNB 3QFJA 3VD9A 5IM7A 2VDQH 4ODXA 3DX7A 5E1AB 4O2CB 1MH5A 2CDFB 1X7QA 3P4OA 4OUUB 3JVGA 2F5BL 2ZOLA 2WQRA 5B39G 3MRGA 5C6PB 4QTIL 1CVSC 4LQ1A 5J11B 1CD0A 2VZVA 5IK3B 3D85D 2EYTB 2VDKL 3O45A 4RIRA 4DW2L 3PQYE 1NGZA 2D2OA 5DJDA 5ID1B 2VTFA 2Y5TB 4MXQC 1E4KA 3L3JB 2UWEA 3MJ9H 1C7TA 5FECB 1YA5A 4UIMA 1WIOA 4FABH 3FT2B 4PJCE 2NY6B 1M6OB 3FQNA 4DTGL 3QP3A 3FOMA 1XIWD 2K3TA 4QRSB 3RWDA 5EC1A 4U1SA 1PG7W 1D6EA 2ZSVA 4I1NB 3CFBA 4Z18A 5T1LD 1QBBA 2PW2A 1YEFH 5E70A 2H26A 4IS6B 1C12A 5FYJH 3FFDA 3HNTL 4XTRC 4Z7NF 4PS4L 5LJYH 4MQTB 5EULV 3UC0L 4TOYL 4YHYB 4QRPB 5EBMB 2HT4C 1VFAB 3OAUH 3MLUH 1GL4B 3O3BA 4KZDH 2J2ZA 3ZTJG 5ICZA 2GK2A 1I3RB 5DMGC 3EHBC 3BN9C 4KKLC 3HAEH 5EOTA 1UC6A 3WFCH 4LOUD 4XX1G 2FGZA 5DJCA 4LHUD 3VI4E 5DJAB 1DN2A 1Q0XL 3ZL4L 3OF6D 5TQ0L 2BJMH 1OAXL 3HRZA 2RCSH 4L4TD 3HN3A 1PY4A 3DURA 4QCIB 1LE9B 5IMOA 4PLKD 3HI6L 1A6WL 3AXLB 4MCZB 3SDAD 1MFCL 3D85B 3HFMH 4ZOAA 5K59E 3PGDB 1TZGH 5GHWL 4PRIA 5L88H 4XC1H 1PYWA 1DBJH 2I9LB 2C1PB 2ADIA 5INDB 5JQ6H 5LGJA 5DHVA 4JY5L 1LK3H 4LK4A 4GRWF 5LQBL 3PGCB 4GAGL 4K3EL 3C09C 3VRJA 5I15H 2W9DL 1H3PH 4Q6IC 1ZSDA 1XIWB 4OLWL 5TFSH 1NCAH 1P7QB 1B2WH 4G9DA 3ZDZF 2X1WL 4XBEH 3HZVA 2R2HB 4JO1L 2VQTA 3T0ED 1NAMB 1MCCA 4XCEB 5TDOB 1FSKB 4JRXE 2G75A 4ISVA 1SY6A 1ZMYA 2P7TB 2DQIH 2EZ0D 1F3JB 1XF5B 5JXEA 4MA8L 5EH1A 5HVFB 3TNNB 5DURB 4XMPH 4JDTH 2A9MH 4X5WB 5DI8B 1RIUH 1FPTH 2AQ3A 2YC1A 1A7NL 1AD9A 2JK5B 5E4EB 1SHMA 5CSBA 2BSSA 3W39B 3S36H 4LRNH 2OR9L 2FJGB 3RL2A 4HIEA 2O5ZH 4XAWH 3RIAF 4TTDD 5LGHL 3OJDB 3HB3C 2XOTA 1Z3GL 4NC1C 2GITB 1YECL 2FIKB 2Q1EA 3NAAH 3T4AA 1RZKC 1JGEB 4K3DL 1IAKA 3ZKSD 4YHNB 2HJLB 1TTUA 3SDAB 1QBAA 3OXRA 2M1KA 3U4AA 1L6XA 1J9CT 1XGTA 1FO0A 1U9KA 4YPGB 4UINL 2F19H 2PXYA 5KVDL 5INCB 1FNEA 1A14H 1KJ2B 4Z9KB 1S7RB 5BV7B 3WJLC 5C0ND 2C3XA 1FBIH 2XRAH 3DO7B 1AY1L 2G2RA 4P9HC 3QEUB 5D2NA 2DBLL 4N1EA 3RGVD 4HH8A 2R2BB 1OF2B 4RFOH 43C9A 3OKEA 2DLFH 2YKLL 4HS8L 4HMEA 3U4BH 3QA3A 1ES0B 3D69B 3T0EB 4OGZA 1UM5L 3GIVB 5SWSA 2R4RH 1VFUA 1HKLH 4KK6C 2K7QA 4LHQB 4QRUB 5DJ2A 1KIRB 4AEIL 1EDQA 3I3EA 4J3XA 1QOKA 4WIQA 1JRHI 2D0GA 1BLNA 3UYOD 1YEDB 5D7LE 3NA9H 4HKZB 1CD9B 5FYKD 2AERT 4N90D 4G8EB 5E5MA 4LLQB 2GYSA 3BISA 4NP4L 4OFKA 3O3EB 3U79A 3BO8B 1ETZA 1T1WB 1GGIL 2IPUG 4U1JB 5IESH 5DRZB 1TPXB 4PUBL 2IPTL 3NOIA 4WI7A 3WLBB 4WJ5B 1S9WB 3CXHJ 4NQXB 2UV3A 1DFBL 4PJAE 3B2VL 3KYOA 5EOQL 2I9TA 4LSTH 1T7XA 5IHBA 2HRLA 2NW2A 2ZCLH 4LHUG 2W0PA 3ARRA 5C08D 5EZJA 1KB5A 3MLRH 5IW1A 4BFIB 2DJ4A 1F11A 2C3VB 2D4FA 4GG6B 2NLJB 5HDQH 1HEZA 3D3VE 3RDTC 1RMFH 1TETH 4YFDB 4HH9A 3RGVB 4YHIA 8CGTA 5E6ZA 4RNRB 4L9DA 2QQKH 4XPTL 4POYA 1FZJA 2G5RA 2V5SA 2GJJA 4OFPA 3VRIB 4P4RA 1VFBB 1GCFA 4JAMB 1KJ3H 5KS9B 5D9SA 1U36A 1U8QB 4F57H 3EYVA 3QPXH 4NQSB 3HPLA 4PRDB 3SE4C 1AJ7H 4GLRI 4TULH 4Y1AA 1FE8L 2IH1A 4OCSL 4NJ9H 1NGXB 2R29H 3P4MA 3QCVH 3O8XD 3QULB 1CF8L 4YHOH 3T77A 4YO0B 5E1HB 1IQDB 3SDXE 2EIZA 3S97C 1EZVY 2AKRB 2VB5A 1C5CH 3ZHLA 5KVEH 1IGCL 3V4VL 3WS3A 5CMAA 2FX8L 1X5LA 3EYUH 2APTA 4BK4A 3ESVF 4C59B 1FFPB 1FL3B 1NGWB 1HXMA 4Q6IA 3D9AH 5EUOF 2V2WB 1K8DA 3HI5L 4G6KH 3MCLH 1ZGLM 3EDDA 1UXWB 4ZG1A 3HI1B 1U8KB 1JNHB 1DL7L 5C08B 4OZGB 3MNWA 1WBZA 2F5BH 2CIKA 5C92A 1IGTA 1AXTL 3OSKA 1GZQB 4NQTA 4XWGL 5DD3L 4K9EC 4M5ZL 5KSBE 4QTIH 1DEDA 3FRPA 2W60B 3I6GA 4IMLA 1S9KC 4HW6A 2VDKH 3L7FB 2QQLH 3WD5L 3QI9C 3W0WE 3KPOA 4KHXH 5IB4B 2CLRA 4JFXA 3RVUD 5HJ3A 5AG9A 5JPMB 5C0IA 1BBDL 4P23C 1GC1L 3L95B 1Q9KA 5C0EA 3CFEA 4L8DB 3C5ZB 1J5OL 4QRRD 4WV1B 2NX5A 1RUAH 3WXVL 3O9WD 4DTGH 1TVBA 3LKPA 5IGXL 3MYJB 5AAMA 2VMFA 1K6QL 4UV4L 3OTTA 5ILTH 1EAPB 2K1MA 3M8OL 6FABH 1UQSB 2YD7A 3HNTH 4LDEB 4PS4H 5ESVA 4MJ6B 3UC0H 5CKAA 3WJLA 4TOYH 4MGXA 2GFBB 2XG4A 3F5WA 3R1GH 4CUCA 4OZIB 1T04A 4K8RD 2AJ3B 2UVEA 1CGWA 3QEHA 5JZ7C 2BSTB 2IH3A 2R23B 4TUJA 3W9DB 2J8UE 3IETA 5FOBA 4YHML 3OMZA 1G7PB 3ARFC 1TQBB 3TF7C 5GGRY 4OIIL 4NQCD 3FHAA 1HHKA 2R1XA 3EOBA 1D7FA 3ZTNL 1YMHB 1RSFA 5EZLA 1Q0XH 4RAVB 3DXAA 3ZL4H 5TQ0H 4OTXH 4WI2A 3RTQC 3RWHA 4M3JA 1MRDL 3LEXB 3U0PA 1N64L 3DUUA 1BD2B 3GBNL 2EXWD 5EU6A 4GRMB 5TDNA 4YHKL 1A6WH 3CFDB 1CR9L 1LD9B 1IEAB 1XR8A 5E9DB 2DM2A 1RJZA 5GHWH 3V6OE 2GT9B 4L4VE 3LN4B 4M4RA 3ALWA 4KTDL 1I9JL 5SX5K 1PW3A 3FN0L 4HEME 2QKIB 1FO0L 5T3XE 2AW2A 4O2FB 5HI5C 1S9YA 2ATPA 4HK0B 3MV7B 4GAGH 4L8BB 4E41D 4K3EH 5IMLB 2ZUQB 3BSZL 1BFVH 4TRPL 4IOFC 1TCRA 3MRIB 2W9DH 1U8JA 2RB8A 3QAZC 3TN0C 5GSRA 4OLWH 4BFGA 2EKSB 2ZUVA 4U6YB 4HS6B 2DN7A 3P0YL 4M93B 5I16A 1OGAD 3QHZL 5C09A 2QSVA 2Q8BH 2NY4C 2NY2B 4HX1A 2EECA 4F33A 4WFFD 3BEVA 3ZKXB 8FABA 5F88B 1J1XL 5DD0H 4ZSOB 5DD5L 3WIHA 3RDTA 4MA8H 3E3QC 3HC0A 4DZBB 1J88A 1H3XA 4BQ8A 5A1AA 3G5ZB 4NZDA 2QJDA 3WHE1 1JGLL 1Q1JH 1EEZA 1JYWA 1KJVB 5F1IA 1MHHB 1Q8MA 2Q3ZA 1XF4B 4M8QA 4OT1L 4UDUA 5ITBH 5DFVD 4ELMA 3KPSE 3IU3B 5C07A 3SE4A 5LGHH 1Z3GH 1YECH 2X4OA 2WLYA 3DGCR 1IL1A 5GGTA 3DV4B 4K3DH 1I1AC 2HFGH 5JO5B 5MENA 5DRXA 1F4AA 5CZVH 1ZAGA 1Y18A 3S3SA 4XBGA 3F58L 2OZ4A 2V2TA 1X5JA 2VDPH 4UINH 4P5MA 4KKBC 5C9KA 5ABDE 3ECBA 3D39D 3GJFK 3QXWA 1PKOA 4AEEA 4YAQB 3ES6A 5DZNA 1EX0A 2DBLH 4XMKL 3VFSB 2W0KA 5B21A 1MLBA 1G7IA 3GZKA 1HH6A 2DJSA 3DYPA 2O26U 2YKLH 4HS8H 4Y7MA 5CWSA 3PABB 5DJ8B 1QSFD 1R3HA 2A9NH 2VLKD 2R2CA 1HIML 3HE7A 4KQ4L 3DECA 2OMNA 1UM5H 3OXSB 5D2LF 1PAMA 5DHYA 4E9LA 5ISZE 3V52L 2W9EL 4BKLB 3M07A 3CXDL 4ZUVB 4AEIH 4HIHB 3I02A 3QQ9D 4N0UB 4LVNB 2BVQA 2ZZUT 1DE4B 2X4RA 1CFSB 3RPIA 3RKPA 2JIXA 3VFTB 4OGAC 3SDCD 3X12B 1CCZA 3QI9A 5I71C 1E27B 5CAYB 2MJWA 3QUYD 4NP4H 5LWYL 5E8PB 5HGBA 1V3LA 4P23A 1GGIH 3BDYL 4PUBH 4OZHE 1YDPB 3FONB 2EYSA 2IPTH 5FHBL 3UPCA 2G9HA 4NN5B 3QHTC 3QZWA 5C0FA 4LEXL 4ZOBA 1CICC 1DFBH 3MBEB 4LPWA 3QIUB 4KROB 2OQJA 5EOQH 4AENA 3BXNB 3CPLA 1RZ8B 4J4PD 4JRYD 4RMUA 1T1XA 3U36A 3VI3E 4NKOA 3WNMA 3GSOA 1ZA6A 4NO5A 4PJIF 5J12B 4WHDA 3UTSE 3DVFA 1M05B 5FA3A 5BS0D 2PTTB 5D4QA 3D39B 5MEQA 3H6JA 1G7LB 3BYTA 5GGRB 5FXCH 2YUXA 4XPTH 1MCIA 3ARFA 4UMGA 4GSDL 3ARBC 4YBQC 1QSFB 1QO3A 1EAJA 4Q2ZB 2VH5L 3RJDA 3WO4B 3WXWH 4JEGB 5F1NB 2Z92A 3IAPA 3O2DL 3BWAB 4DEPB 1RK0B 4P5KA 5ICXB 1XZ0A 2VXUL 5CSZB 3RTQA 2HWZL 1FE8H 4OCSH 2FATL 4GW1B 1A1MB 5ETUB 5C1MB 5T5NF 1ONQA 1CF8H 5I75B 3SDCB 4PY8J 3LRSA 1ZT1B 2XKNB 1I4FB 2I07B 1JGDA 4UNTA 4ENED 3DBXB 1B4JL 1IGCH 2YRLA 4ORGA 4X80L 4Y4HD 2ZUWA 5CP7A 4KVNL 4N8CL 3V4VH 3GSQB 3MCG1 4LF3B 1QFHA 4Y4FD 4W4OC 5KS9F 4Z76A 5H37G 1ZLWH 1W0WA 3GHEL 2Y07L 4M9PA 1HH9A 3TN0A 3D0VA 5E8OA 3BH9A 2XG5A 3VFNA 1U3YA 3HI5H 1H3UA 4OIAA 2DQCL 2I60L 2PO6D 2G5BB 3ARPA 2CRZA 4WU5A 1DL7H 4DWHA 5BS0B 3C6LC 4M7ZC 1CTOA 2K9UA 1HXYB 1N2RB 2HFEA 1AXTH 4QXUL 1AQKL 4FA8A 5DD3H 2V9QA 2WV3A 4M5ZH 4BYHA 4ZUUA 5IVNA 4JHBA 1HNFA 2N7BA 1Z9LA 1T5WB 5HVGB 4UU9A 3WD5H 4ZO8A 5DRNA 1FFOB 5B3NA 2AJVL 2VLRB 1OTSD 5BRZE 1KIPA 2PYEA 1GC1H 1Q9LA 2IALB 5F8QC 3V4PH 1J5OH 2IPUK 3L5XL 4EBQL 5FYJD 4MNQA 2BP3A 2QSCL 4MJIB 1DVFC 1PVHA 2JJUA 5DHVH 1I1AA 1RK1B 3MRNA 5IGXH 1BM3L 3MRMB 1K6QH 4X9IA 4JZNB 1INDL 3LPGA 1JBJA 1RY7B 1U2HA 4CJ1A 3M8OH 4PJ7B 3FO0L 5EC2A 2DQGL 5DK2A 1A7RL 2NW3A 2C9AA 3P77A 1KCVL 2ITCB 3PWLA 5DVOA 1VFOA 3BZ4A 4Y4FB 1BF8A 5HYQA 2DYPA 2X9WA 4YHMH 1J87A 1CXKA 5EZIL 1SY6H 4OIIH 1AKJD 5I8CB 2MHAB 1WIUA 3BVNB 5T3XL 5C0AA 2G60L 2ZOKB 4M03A 3SDDD 5C0JB 3LIZL 1IILE 2PW1A 1OTTD 3ZTNH 5GRWA 1QP1A 4HS3B 3I6KA 1HHHB 2VR5A 2I27N 4RAUB 4CN6A 4EI5B 1MRDH 1QRND 3ZE2E 5L2JA 1N64H 1N3NA 1MHEB 3G5XB 1B0RA 3GBNH 2EDFA 1AP2B 4PJ8D 4YHKH 5LBSL 2CRMA 1NKOA 3V4UL 4W81A 2GJ6A 2VISA 3N1QC 1ZT7A 4OLZL 2X7LA 4HDIB 1T6WA 1F8TH 4GS7C 4KTDH 1MFDL 2JCCF 3REWA 1I9JH 5C0BB 4PTTB 3SOBH 1NAKL 1FO0H 1GZPB 4LIQH 4X8XA 5EU5B 2VLLB 2BNQD 1DQTA 3UP1A 3KVQA 5KVFL 4NHCL 4MJ4A 2NYYD 1CICA 4UOJA 4RDQG 1X5IA 4HULB 2PR4L 4LKCB 4ONFL 2OJZL 3L7EB 3P0YH 2P5WB 3QHZH 3IDXL 3F7VA 3QQ3A 3CVHL 4Z78A 1FNLA 4JLRB 3TNMA 4Z7UB 3CX2A 5C2UB 4PJDA 4UTBL 4OZ4A 4H0IA 2Q7NA 2VR4A 1J1XH 4OF5A 5I1IL 1HDMA 3IDUA 2FJHB 5DD5H 3HAEB 2CUIA 5ANME 1EHAA 1MCQA 3PWPE 1LEIB 4OCYL 4YHPA 1L9MA 5CBEB 2VIRB 3GSRB 4FG6D 1JGLH 3O4OB 2XN9D 1A7PL 1SJHA 4G8FB 1AKJB 2NXYB 3LAFA 3ARBA 4IRJB 1WFTA 3ME0A 4OT1H 2B8OT 3BKJL 2PYFA 4OLEA 1JNJA 3WKMH 5AWNL 4LVEA 1RZJC 4HK3J 4K55A 1ZK9A 2CRIA 3FOLA 1GVIA 3VFWB 4NNXB 3C8KB 1FZOB 1VA9A 2OS7A 4W6YB 1U91A 25C8L 2GCYA 1T0PB 4U49A 3F58H 1HILB 5J3HC 4P46D 3VE0B 1CXIA 1MREL 1K8IA 2Q7YA 2X70B 4G3YH 4CNIB 2R8SH 1WBXA 3ULUE 3MZTA 2X4PA 4DK3A 3CFKA 4XMKH 5DJ6B 4W4OA 1Z0MA 1KB5H 2RJMA 1QEWA 4JPIA 3TIEA 1TENA 5I2IB 1FFNA 3WO3B 1BIHA 2B5IB 3GMPB 4NDMB 5GJSL 1XCTA 3ABZA 1G9NC 2GSGB 2ILLA 2J4WL 4KQ4H 5IW6B 1MCHA 4J3SA 4ZTPL 5CIPA 5FM5M 3T2QA 3V52H 3GSXA 3C6LA 3O41A 3BQUC 3L3IA 3CXDH 1EJOL 4M5YH 4FQXD 3DI2B 2MCPH 4HIIB 3TJHD 5I1AB 3BIKB 4Z7WB 3SCMB 4HUUB 3MRRA 4KV5E 4WUUD 4U7MA 2XN9B 5GIRA 2B39A 3ZKNC 1T4KA 5IFHL 3RI5K 4EOWL 3GB7A 3WFHA 5J1SC 1KCKA 5T1KA 5LWYH 3HMXA 3SY0A 4C83A 3HAEG 3EFFB 3OAYH 4ERSL 3PWJA 3MRLA 1S7UB 5FHBH 2I25N 5IG7B 3BRGC 4LEXH 5HGAA 2HVKB 1FAIL 4KMTL 2CLZB 3VFVA 3DRTB 2CO6B 4L4JA 2OMBA 4NQVB 4V1DE 1N6VA 2CIIA 1ZHNB 5F3BA 3O6KH 3H0TA 3FB5B 3HUJA 2F54E 2NY5L 5EBLB 2X41A 3PHOB 1N7ML 1I8LC 4XP9L 5HVWA 1U58B 2DWEA 1WWWX 43CAB 1RZIB 3NZ8B 3HC3H 3MOAL 1TJHL 4AH2A 4ZAKC 2Z31D 1MY5A 2HN7A 4PJXA 4GSDH 1KFAL 3V0VA 4QXWA 3FT4B 2ESVE 5IR1A 1HHJA 4Y16D 2APBA 1AQDA 4QO1A 1M7DB 1OWRM 1JZ7A 2BC4B 4BSVB 4X6CB 4PREA 5I0DA 3O2DH 3SPVA 1I3VA 3VFUA 5EOCL 1DQLH 4JKLA 1EFXD 2VXUH 2UZXB 3HR5A 3OAZH 2HWZH 1AGCA 5CCKL 1C7SA 3DO3A 4C55A 2IBBA 4QHNA 5FO8A 1DLHB 2FATH 2WBJD 4MZ3A 3VU2A 2YD9A 2QSQA 2H6PB 3S35X 4WUUB 5KVGL 2BFVL 2NTFA 3PJSA 1DQDL 2IC2A 1B4JH 5M94B 3NIFE 5E03A 4KVNH 2V9TA 3DVGA 3AUVA 1YN7A 4L8CA 4D9QE 1O5DT 3GHEH 2DQUL 2Y07H 3QNXA 2VL5A 4Y8DC 3TBVA 4JVWA 1UH4A 3MJ7A 4P9HH 5L2KE 2DQCH 2I60H 1GOFA 1Q0YL 1ZEAH 3IS1X 3CXHK 4CVWA 5JW4M 4U1KB 3O3DB 2N7AA 2W0LA 4WTZG 4OAWB 2WWKO 3MUY1 4KHTL 4URTB 1B3JA 1PKQB 4EUPA 2BY1A 4L9LC 3QFJE 4QXUH 5GRYA 1F4HA 1AQKH 4G5ZL 1S7WB 4EVNB 1K4DA 1MCFA 3PHQB 1MQKL 4U2YA 3A0OA 3DMMB 2Z31B 1WEJL 4KJWC 1TJGL 3OB0K 4XNYL 4DN4L 4PRPA 2LU4A 1A5FL 4MSWB 5F6IB 3OKNB 4G8GE 5ITFB 5JHDA 5ID0A 2P5ED 3L5XH 1FH5H 1EFXB 1L4IA 1UWXK 5EO9B 1J8HA 1ZS8B 2QSCH 2DL9A 3KJ4B 5BZWB 3WHXA 5F7DB 4Y5YB 1INDH 4KRPC 3UJIL 3W9EA 1GH7A 4QF1A 4L3CB 2HT3C 1FZMA 3VXMA 1Q9WB 4LLDB 4PJBF 3VFRA 5C9JA 2DQGH 1NFIA 1XGPA 1A7RH 4G9FD 3G6JB 1KCVH 4R0LC 5GRVK 4BH7B 1SMAA 1QLEL 4GKZB 4NM4L 2BHUA 1A1NA 4Y2DD 4JQIL 4WO4B 5FF6B 4WHCA 3VJ6A 5EZIH 1BQHA 3CMOL 4OD3H 1MIEL 3WIHH 5T3XH 2X4SB 4MA3B 2E9IA 5HGGS 4LVHC 1R24A 1EHLL 3LIZH 1FGNL 2VSDA 1NBYB 5CGMA 1U8IB 5BVJA 3LKNA 2X4QB 3BQUA 1OSPL 3QUKB 4OF0A 4YC2C 1BQUA 3QNYB 1ND0A 5LBSH 5C0RL 1JYXA 2X1XR 5D7KD 3V4UH 3O6FB 4LMQE 3T0BA 4OLZH 3Q48A 4N1HB 4OCXL 5IV2A 2EEBA 1MFDH 1ZT4B 4YDJB 3U0WL 2AJUL 1NAKH 4PRHB 1VGKB 3QUMA 1VKXA 1E4XL 5HYSB 4PRIE 2JJWA 2OZ4H 1PG7X 4PGDA 3ZSTA 1F13A 5KVFH 4NHCH 1MUJA 1RJLA 3F8UB 4Z0XB 3CAFA 1OAZL 1A7QH 1RVFL 1SJVA 3BH8A 3RY4A 1F2XK 1TTFA 4ONFH 2OJZH 3QWRA 4HKJA 5SX4I 1KPUB 4X7EC 4KI5E 3THML 3EYFA 4JY6B 1S5HA 1S7TA 3TO2A 2ZUSA 5D7IF 5LAXB 2W38A 4K3GA 2FIRT 1YNKL 1T7WA 4P2OC 4G9FB 1I8LA 5I1IH 5HYJB 1B90A 2HJFB 1G1YA 4PLJC 4Y2DB 4WVRA 3QEQA 4XVJL 4OCYH 3V2AR 4ZAKA 5KN5B 2CXGA 1A7PH 1FVDA 3MLWL 3IKCA 1U93A 2VZOA 5T3ZE 3WNNA 3BKJH 3BMWA 3IJSA 1NEZA 4XP5L 1VGEL 5ENWA 3VXNB 4NKMB 1K5NA 1UZ6E 2DIJA 2EXYD 4M00A 3WIFA 1A6ZB 3RX5A 4D0CB 1T0MA 5D1XD 5IF0B 3QG6A 3FO2B 2YD1A 4L29A 4Y4KC 3KXFB 1HQRB 3D0LA 5E6ID 2V17L 25C8H 1RD6A 5ERWB 5IKCB 4QTHB 4YX2H 2E7HA 1MREH 4JKPL 1UFUA 4LPXA 1YEIL 3EO9L 3PP4L 1A9BA 1OPGL 5I1DB 4H8WL 1VB9A 3MMEA 1NUDA 1QFWL 3B9DA 4OCWL 1IC1A 3BZEB 2BOCA 1NC4B 4RGOH 3S37L 3IDYB 1U3ZA 4FZEL 1MJUL 2H3NB 1KTKE 3UPAA 1I7ZB 1H5BC 1U42A 4Y5XB 2AXFB 4PY7B 2A6JB 5D2NE 3RWGA 5F3HB 3B83A 2X44D 4NO0A 4PJFB 4HWBL 4ZD3L 1MWAA 1FN4B 4JGJA 4OV5A 2D31A 5CLWA 2ADFH 3GMMB 5B22A 4LRIC 5FDYA 1PEZA 5KG9A 4LKXB 2DIAA 1KCLA 2ICEB 3MFFA 1JV5B 3M45A 1XIWC 5B39A 4I48A 3VXQA 3FFCA 5D7SH 1N5YL 1IFHL 4ERSH 2P45B 4G42A 4UV7L 1QSEA 4QNPE 1BVKA 3VMOA 3OHXB 2PCPB 2WINB 2QL1A 4KMTH 1FAIH 5EWIH 1FSKC 3RY5A 3RZCC 4OJFH 5TF1H 2CLVA 5E6IB 2F8OA 1YN6A 2XXCB 3ROLA 3AS1A 4ZFOL 3NVQA 3GMOB 3LHPL 5K33A 1C5DB 2FO1A 2XWTB 4GW4A 2DKMA 2A0LD 3T3MF 1MJJB 1AGFB 2AXHA 5E4EC 1N7MH 2P48B 5EPMA 2QEJA 4XP9H 3MV8D 4NO3A 4XCNB 2Y7QB 3DUHA 5I73C 3V6FB 4AK1A 4LOUC 2B2XL 3MOAH 5EUOA 1TJHH 3PNWA 1HSBA 3GJFA 5DMKB 3EO1B 3VXRD 2MOVA 3H9SA 3HG1A 4EKXA 4Q6YA 3G9AB 3SDAC 1E28B 4GG8A 5K9KA 1FJ1A 4OCNC 5E2WL 1PY9A 4PJ5A 4I3SL 1GHFL 3EW3B 5CCKH 4HIXL 2VKXA 5F71A 2CQVA 1MVUB 5BV7C 4LAJH 5KVGH 2YXMA 3H3KA 5KANG 4MNGE 3CVIL 1Q9OA 4CVZA 4W68A 3B5GA 3PDGA 2BFVH 2FEEI 3QIBB 3PQYD 3LEYH 1DQDH 3GJEB 2DRUA 5FM5O 3SKNB 3NH7L 1K3ZA 1QKZL 3LKRB 4X9FA 4YIQB 4W6WB 3U9PL 1JPTL 3CFJB 3W5NA 1VHPA 2KZWA 3T0EC 1BAFL 2B7DT 5JDJA 1PX3A 2JJVA 4OUUA 4M6ML 5IM7B 4PFEA 4ODXB 2EZ0C 3DX7B 1CFBA 2IMNA 2R0WH 1MH5B 1X7QB 3STBA 4P4KD 3T09A 5DMIL 4XVTH 5IK3A 2P49B 2EYTA 4P2OA 4R4FL 4G5ZH 4XP4L 1AI1L 3MJ8A 1QBLL 2D7QA 1QPXA 4GKSA 3O45B 5ID1A 4QRTA 4RIRB 4TTDC 1YY9D 3HS0A 1QHPA 1NGZB 5DWUH 4GMTL 4KK9D 4LLMA 1TJGH 3FT2A 3SGEH 1KJMA 4LNRA 3PF2A 5DJDB 2YPLA 4ZDHB 3VXRB 4DN4H 1A5FH 1M6OA 2H32H 5IQ7H 1NANH 2UWEB 4QRSA 2V7NB 4XB8A 4B53A 3FQNB 1NBQA 4I5BB 1DBML 5EC1B 4U1SB 3TBWA 4JY4A 1QFOA 1VACB 2VZTA 2ZSVB 2ZWLT 1OY3B 4Y4KA 2PW2B 5C0NC 1L0YA 2H26B 1C12B 2AXGA 3UJIH 5KZCB 4QRPA 4DGVL 1VFAA 4WEUD 1KULA 3PXHA 5LVEA 1JGUL 1OM3L 3LDBB 3O3BB 3QG7L 1MJ8L 4POUB 5ICZB 1WF5A 4JQIH 2D3VA 3SO3B 4RCAA 2NTSP 5DJAA 1H5BA 3CMOH 2P4AB 1MIEH 2XQYG 4HWZB 1AXSA 3BPCB 4QCIA 5DJCB 1EHLH 1FGNH 4M7KH 4MCZA 3HRZB 1CGSL 3D85A 4JRXD 4DGIL 3IDGA 5EFIA 2KL6A 3DURB 1OSPH 5IMOB 2I9LA 2Y36L 4FFVD 2HH0L 4QGTA 1PYWB 5HY9A 3DXAE 4BSJA 2E9WA 2CKBL 5FYKU 2ADIB 3G6JF 3PGCA 4LRIA 1LHZA 5LGJB 3CLFH 4OCXH 2JB5H 1XGRB 3NCMA 5DHVB 4CDHA 4DKFL 4HBCH 5EU6E 3U0WH 1UENA 1XIWA 4HUXB 2D7PA 3OR6B 1E4XH 3LQZB 5HYFA 1HKFA 5T1LA 2VL4A 1ZSDB 1A6PA 1EO5A 3BJ91 1CGUA 2ADJA 1OAZH 3MOBL 4G9DB 5T3ZL 3T1FB 3TT3L 1WK0A 2P8LB 3JWOL 2DJUA 1RQ5A 5B8CC 5FYLH 3THMH 1F3JA 3E6FA 1XF5A 2WBKA 3RUGE 1ZLUH 4M6AA 1KIUA 3K46A 3TNNA 4WI9A 4ZFGL 2G75B 4ISVB 2DLTA 5DI8A 1YNKH 5HHOE 1XH3B 4UIKL 5C71A 4X9BA 3EUUA 4O58L 1H3VA 2FJGA 4NRZA 5CIPH 1AD9B 4G7YH 1MWAL 4LHUA 2BSSB 3I3DA 3OF6A 3U1SL 4BSWA 4BUHA 4WV1C 1FV1A 3RL2B 5TQ2L 2FLRT 3UTZA 4L4TA 1KT2A 5D2LA 4JDZA 4U1GB 4P5TD 1VGEH 3O8XC 5IROC 2HJLA 5F96L 3UX9B 3MLPA 2CGRL 1Q72L 2AGJL 3SDAA 4F7CA 3VD7A 3T4AB 3F7QA 4X6DE 4OCRH 3WDJA 2WANA 4YPGA 5DRWB 3HMXH 4YHLH 5INCA 1P2CA 1S7RA 1KGCE 5D7LD 1FO0B 4TNVK 1WTGT 1YNTA 2V17H 4PJ9C 3DO7A 2PXYB 1FNEB 1BGXL 1MEXL 3QEUA 1HN1A 5D1QD 4HQQL 2XXMB 1OF2A 4JKPH 4KRLB 1KLGA 1INEL 4PY8I 1U8OA 1YEIH 3EO9H 3PP4H 1ES0A 3AS2A 4H8WH 3TWCL 43C9B 3KPRD 3T0EA 1QFWH 4OCWH 3S37H 1D5MB 1X6NA 5J13B 3QA3B 1MJUH 1WIPA 1UG9A 1KIRA 5IB5B 4PJIA 1YEGL 5SWSB 1C1EL 3ZKQD 3X3FL 3ZE0F 4HWBH 3J7HA 5DJ2B 2UYLA 3QSKB 4JFHD 5CP3A 5TE7H 4XHQA 4GMSL 5CEZL 2L0DA 1BLNB 3D3VD 1LDPL 3RVUC 4FQJL 3V7AE 1ZA3A 1T1WA 5DRZA 2WQ8A 1UACL 3WLBA 4WJ5A 4Z7OF 3O9WC 1XGQA 4NQXA 2YMXL 4YQXH 5AEAA 4WI4A 5J4MA 1LK2A 2YD3A 3AFLA 1X5FA 2JTDA 4AMKH 4UQ3A 3CNKA 2VXTL 5B3JF 3KYOB 1V05A 4ZXBD 3IRPX 3SO5A 4PJFF 2ENSA 1UCBL 5D7LB 2C3VA 5E5RB 2NW2B 1NFDB 4BQ9A 3ILQD 2WBWB 4K8RC 5E95B 4IJ3C 2CR3A 5EZJB 1KB5B 3LHPH 5CLTA 3RGVA 1F11B 4R26H 3C6SB 1WQVT 1EGJA 1TMCB 1HEZB 4HH9B 2YPVL 3GK8L 1DBBL 4WTWA 5HHMD 5KS9A 4UDTB 3KHQA 3KPRB 4LCWE 2B2XH 1W72L 4P4RB 2DKUA 5FHAL 3VD3A 1DEEB 5TPWH 4PR5A 5GS0L 5D9SB 5FDWA 3EYVB 4UBDC 4QOKD 2R0ZL 2EXWC 5DS8A 3MRHB 3SHSA 4Y1AB 1HHIA 3QULA 4YO0A 2IH1B 4QWWC 5E2WH 1GHFH 4ODVH 3ZHDA 2AKRA 4GXUN 1U6AH 4HIXH 4LU5L 3CVIH 4I2XA 1RZJH 2V7HA 5HHQB 3W0WD 2C26A 3D2UD 4CU7A 4LNVA 4GOSA 2L7JA 2EE6A 1FFPA 4D8PA 5CMAB 4YFLI 1QTYT 2XZQL 1QKZH 1CBVH 1NL0L 2EE3A 4F37F 3VD5A 5E2JA 1JPTH 3C09B 2N1KA 3H9YA 5A2FA 1F00I 1UXWA 1ZHLB 2AK4D 1BAFH 1HXMB 2APFA 1JNHA 1K8DB 5C08A 4OZGA 4X6FA 4CADA 2HJKA 3O4LD 5B8CA 5K93A 3VGAB 5TGBB 1IKFH 1PZ5A 1HE7A 3MNWB 1WBZB 3I75B 5DMIH 2CIKB 3OQ3B 3GGWA 3M1BB 3P9LA 4R4FH 1E4WL 4HJGA 1CFQA 1G9NH 5HHMB 4U0RC 5IB4A 3I6GB 4IMLB 1VENA 4XP4H 5GQBA 1AI1H 5BQ7B 1A02N 1QBLH 5DFVC 4R8WL 3L95A 1BOGA 2X05A 3N1GC 1FNFA 3IU4L 4NSKB 5GGVY 4GMTH 4WV1A 5C0IB 1ROWA 3QB7C 1EUTA 4QOKB 1L9NA 1Q9KB 5C0EB 3CFEB 3O8XA 5IROA 2NX5B 2NY0D 1XGYL 5DFWH 4RGNE 1HWHB 2BNUB 1TVBB 3LKPB 1EIBA 1DBMH 2W65A 5I8KL 4HUVA 2H1PL 1A6TB 1R5VA 2OCFD 4DGVH 1H3WM 4L4VD 2AJ3A 1SYSA 3D2UB 3CDCA 2DL2A 2JCCA 2R23A 3W9DA 5ESVB 2R56L 3F5WB 4XCCL 1T04B 1JGUH 4Q9BA 3QEHB 5T3XD 3QG7H 4TUJB 3IETB 2AK4B 5FOBB 3ARED 1CL7L 4ZUTA 1IQWL 1HHKB 1U8HB 4NZUL 3W5MA 1JN6A 3O4LB 3QQ9C 1QSZA 2GQHA 2R1XB 5E6YA 3CX5J 3QCUL 5EZLB 2OYPA 2WM0A 3RNKB 1CGSH 4DGIH 3RWHB 1IEAA 1JIBA 3RHWF 3U0PB 1OD9A 3DUUB 4LLYB 2Y36H 4MAYD 3QUYC 5TDNB 3RA7L 3CDGA 1XR8B 1YJDL 4PD4K 3A6CL 2HH0H 4Z77A 2CKBH 4HK0A 4QRRA 5IMLA 4JO4H 3LZFL 4OD2B 3VDAA 3SGDH 3Q5TA 3O9WA 4DKFH 2W07A 3BPLB 4P99A 4TUOB 1MFAL 4PJCF 3NIDE 1S9YB 2ATPB 4PJEE 2DLHA 3KPSD 4X4ZA 1KYOJ 4NWUL 5HYEA 1NMBL 3EAKA 2GY7B 3N0PB 5EA0L 5GSRB 3SN6N 2HKHL 5I8OL 3C8DA 5T1MA 5T3ZH 3TT3H 4YGAB 3JWOH 1RAMA 3OV6A 2WSKA 1JWUB 5C09B 4ODWA 2L4OA 4HX1B 4I4WA 3BEVB 5DJXA 5CS7A 1WZ1L 5HD8D 4MLSA 3MLVH 4HHAB 4NQCA 4X7SL 3RDTB 3HC0B 3ZYJA 4EDWL 3FQUB 4F9PC 5J0BA 5M7QA 2JJTC 4O58H 3AREB 3INUL 3QXDA 1R0AL 1MWAH 4NIKB 5LCVL 4AIZA 3Q6GL 3U1SH 3VI4F 4YHZL 4UDUB 3U2SA 4K7FA 4ELMB 1QVOA 5EOCJ 2WIIB 2RFXB 5C07B 4D2NA 5JO5A 5CZXD 5ISZD 5F96H 2CGRH 4PIRF 1Q72H 5B38B 1ORQB 3B3IB 2X4OB 1IL1B 3V0AC 5K59F 5J6HB 4I9WD 5MENB 1YPZE 4ENEC 2OTWA 4JFZH 3IFLL 4ZFFA 4HGWA 2H41A 4JHWL 2IQ9H 4Y4HC 3R06A 4CW1A 4DQOH 1Y18B 4XBGB 3W2DH 2V2TB 2R1YA 4JFFE 4YAQA 4P5MB 4O51A 3H8NA 4Y4FC 4E41A 1BGXH 1MEXH 1RU9H 3B9KD 4P3CL 4G43A 5IJKC 4HQQH 4K3HA 4OKVB 2VLJE 4LGPB 3ES6B 3VDCA 1WTLA 1EPFA 3PABA 5DJ8A 2ADGB 1MLBB 1OGAA 1G7IB 2PO6C 3TWCH 1HH6B 1U95B 4B41A 4M6OH 4OI8A 3OXSA 5CWSB 1R3HB 2VN7A 1CIDA 3HZMA 1N8ZA 4EXPX 4N0UA 1YEGH 2PNDA 1C1EH 3FQRA 2J1KA 1DE4A 4OB5L 1I1CA 3UTSD 1RFDL 5JQHC 4QHUB 3OKMA 5E8EA 3RTQD 2BVQB 3DSFL 2YXFA 3X12A 4GMSH 5CEZH 2X4RB 1YMME 1LDPH 1NMAL 3RPIB 1OTSC 3DYMA 3MXVL 1DJSA 4FQJH 1WFUA 2JIXB 3GI9L 5KANI 3VH8B 5FYKL 3QI9B 5J56B 1UACH 3BGMB 5CJOL 4P23B 1FL5B 3TJEL 1CU4L 3JV4B 3BXNA 5C6WH 1S8DA 3QZWB 2J5LB 2EO1A 5FYJU 2OQJB 4AENB 5SWZE 1ERNA 3JWDL 4XB7A 1EXUA 1U8LA 1MCNA 1T1XB 1MOEA 4HC1L 1CYGA 5DUPL 4NKOB 3GSOB 1ZA6B 4JZJC 4NO5B 2QTEA 3TFKD 1TFHA 4G6MH 5FA3B 3B9KB 3U7YL 5B38G 3UJTH 5MEQB 2NY1D 3P30L 3O4OC 1GIGL 1MCPH 1OB1A 4XP1H 4XPGH 1RUPL 4AEFA 5ALBL 1QSFA 3GK8H 2VLKA 2YPVH 1O7SA 3SDDC 3QT2A 3HUJE 1W72H 1V7MH 1OTTC 5JOPD 5FHAH 3KGRA 3N1PC 3QWQB 4L5FL 4YDIL 1QO3B 5F1NA 1SJEB 3AY4C 3AMKA 3ZSSA 5CSZA 4JFEE 3SEPA 3MV11 4MDJB 3RY6A 2Z92B 1YEEL 4PJ8C 1A1MA 4HT1L 5EIVA 3RTQB 4PJXE 1VEOA 3SDCA 2WWMD 5KSAD 3OJVC 3VGGA 1NFDF 1LO0L 3FJTA 4RX4D 4BZ1L 4NQDD 3QUYA 3DBXA 1ONQB 1IKNC 3ULVE 1J12A 3LRSB 4LU5H 3JTTB 4LF3A 4PJGB 3HNSL 3UTTE 3SKMB 3S3JA 4ORGB 2NYYC 5DD6A 5ADOL 5BRZD 4F7PB 2EEDA 2OK0L 5CGYD 2EDXA 4PJAF 4W70A 1NL0H 1JI2A 3UTPE 4J4PA 4JRYA 1KXTB 3P73A 4Z76B 2VLMD 2YBRA 2VYRE 2G5BA 4FQ2L 4K2UL 3VH8G 3HHRB 3MGTB 3QAZB 3TN0B 3D0VB 4NPYA 3QDMD 3VFNB 5BS0A 4MHHG 5CEXA 4OF6A 4ZO6A 1RIVL 2NY4B 4WU5B 2ICCA 4OM0H 3EOTL 1U41A 1VADB 2FD6L 2OI9C 3QZWG 3VWKD 5DR5L 2NY1B 4KI1A 4FG6C 4DCQA 1FLTX 2YA0A 3QR2A 4V2CB 1E4WH 2XIDA 3F62A 4ZUUB 4F9PA 4Z7QE 2JJTA 1RJYB 4LPTA 3MODL 5DRNB 1E4JA 3QUZD 3IU4H 2AVGA 1KIPB 2PYEB 1F02I 4EZMA 3WS6C 5CILL 1XGYH 1T6VN 4GXVL 4PLOB 1KXVC 3C60D 3LH2H 2C5DC 4PTUA 2QHRL 4P46C 4PRPE 1N5AA 3G08A 3MRNB 4NQDB 3VCLA 3SDXF 1IE5A 2PKDA 2FJFB 3WUZA 3F65A 3SE3C 4Y4HA 3JWNC 3D1MC 2ITCA 1E6OH 3LS4H 4MLIA 1OVZA 4Y4FA 5EC2B 3VGEA 1U3HD 5IJKA 5DK2B 2NW3B 3P77B 4BELD 4WDIA 1HOCA 2R56H 2A6DB 4XCCH 4G6AD 2DQHL 5C7XL 3BZ4B 5LKNA 1NCTA 5HYQB 3BVNA 3KYNB 2JF1A 1DZBA 2PO6A 5DK3A 4AQOA 1ZVHA 4GW5A 3VXME 4ZOEA 4LSUL 1CL7H 2GAZB 3QDMB 1I9RL 1IQWH 3ARBD 4K23H 3AROA 2V5MA 4NZUH 3LRHA 4XMLL 5C0AB 1CDJA 5DEGA 4FQXC 4RAUA 2DAVA 3MRQB 3TJHC 3V5DA 1G6VK 5D7IA 4KMQA 1MHEA 3I6LE 1SQ2N 1RPQA 3QCUH 5KSBF 3I6KB 3TA3D 1AP2A 1OT1A 4M4PA 3STZA 3MJ9A 5L2JB 2ZJSL 1N3NB 5F7YC 4PJHE 1B0RB 4J3VA 2H32B 3RA7H 2LQRA 2GJ6B 1YJDH 2VISB 3A6CH 1ZT7B 3QUZB 2X7LB 5I71B 1JMZA 2VLLA 3B2UD 1MCKA 1CK0L 1WUNT 1WITA 1A3LL 1IEBA 5GGQL 15C8L 4KJQD 1AO7E 3B9VA 2JJSC 2JKXA 4LKCA 1G0XA 4NWUH 1NMBH 3C60B 4M7LL 1Z9OA 4DVRH 2HKHH 3BPNC 5IEKA 5I8OH 4JLRA 4XNZC 4J3TA 3TBYA 2W59A 5F9WC 4OM1L 4LCCC 4MDIB 3F7VB 3QQ3B 4Z78B 4MVBD 1JHLH 2IJ0C 4JZJA 1XMWA 3TIDA 3TNMB 5IBTL 1U3HB 4PJDB 1MCDA 4QLRA 5MP6H 4GBXD 1WZ1H 5CJQH 2VIRA 3GSRA 2J8UF 2Z31C 4YWGH 4G8FA 5I18H 1T1ZA 1EHNA 3QXVA 4X7SH 3E8UL 4HUWA 4EDWH 5F72S 5DMYA 3T0VA 5IVXE 4HLZH 3SDDA 4Y16C 3INUH 1SJHB 3D25B 4RAHA 1JTOA 5CP3H 1EK3A 3ARBB 1EJ6A 5LCVH 5AUMB 3Q6GH 5DUML 3AY4A 1KG0B 1KCUL 2PYFB 4S1RH 1QRNA 2DB8A 5ALCL 4PRAB 4S0TD 5BXFA 2OL3A 5FA4A 3QEQE 4NN6C 4NNXA 2WAHA 2WBJC 1JZ3A 4Y5YC 4PJ8A 4ONOA 1CFNA 3UPRA 3FOLB 3T04D 2WP3T 1DVFD 1HILA 1F6AA 3VE0A 4YR6B 3IFLH 3BE1H 5FKPB 1EVTC 1S5IL 4Q9CA 1U91B 4JHWH 5DGRA 1IKNA 2GCYB 4CNIA 1DUYA 3RVTC 2BNQA 5JOEA 2FSEA 1K8IB 4P3CH 1WBXB 3NCBB 1L0XA 3C2AL 4H88L 2DWDA 3RAJH 3WNKA 2X4PB 5I2IA 1UH2A 4NDMA 3GMPA 4L3ED 2F53E 2GSGA 1N6QH 4JPIB 4WI5A 2R0LL 5IWLC 3CCHB 1FFNB 2XFXA 1XCTB 3AVEA 5IB2A 3LOWA 3EYSL 1OW0C 1RV6X 3C08L 4HJJL 4V1DD 1J0IA 5CIPB 1I1RA 4HIIA 5I1AA 3GSXB 3O41B 4OB5H 1RFDH 4NFDA 3L3IB 2F54D 2XN9A 1YEKL 3MV9D 2E7CA 1JPGB 4P2RA 4U6XA 1NMAH 3MXVH 1MFEL 1S7QB 3GI9H 4YK4C 5GIRB 1I1FB 3ZKMC 4M1GL 5FYKH 4IRZL 2F58L 3LPWA 3GSNL 4WTZA 5HHPA 1S7UA 5T1KB 2CUHA 3SY0B 5IG7A 2ESVD 4C83B 1F58L 4KKAD 3TJEH 1CU4H 3WS6A 4NQVA 1ZLVH 2VNCA 1Z6JT 1ZHNA 3OPZL 4K7PL 5HGAB 1MPAL 1DVFB 3RPKA 4HG4J 4P46A 5D70L 4R6UA 3FB5A 1NGPL 2HKFL 3FFCE 3GMNA 4Z6AT 5DUPH 3PHOA 3SE3A 5F3BB 1GJIA 2LVEA 3BZFB 1QSEE 2VDNL 3VFOA 5F9OL 4Y2DC 1RZIA 2VJXA 1P4IL 5DF0A 3QUXD 4AIXA 1CS6A 4LSQL 3EOAA 1RUPH 3L5WB 3ULVL 4DN3L 5E7FA 4L3EB 3SBWC 4NKDB 5K9QG 3HZKA 3K4AA 4LEOB 4D9QD 3DX8B 2HN7B 3ZDYE 4L5FH 4X6CA 1P4BH 2FH6A 5CKGA 3V0VB 2Y1VA 2GSIA 4V1DB 5IR1B 1HHJB 1WVZA 4FQXA 3LQAL 1AQDB 4C57C 2NMSA 2YPKB 1YEEH 3U0TA 5E2TL 4PREB 2WK2A 5F70A 1CD8A 1DLHA 3B43A 3CC5B 3OWEA 3SPVB 1I9IH 2F54B 4HT1H 3VFUB 5J1TC 3HR5B 4WUUA 3OJ2C 3A6BL 1AGCB 3MV9B 3GI8L 5FO8B 1LO0H 4XWOC 4WW2F 4N8VA 3P2TA 4MD4A 1D9KD 4AL8L 3H9SE 1LO2L 1LP9E 2NTFB 1OAKH 3PJSB 2F9BT 2ZNXA 3HNSH 4GS7B 4OZHF 4WFEE 1S78D 2OK0H 3IDYC 3VXPA 3DVGB 2JJSA 4G8GD 3QDJE 4Y5XC 3S3PA 1XF3A 4ZFOB 4FQ2H 4U1NA 4Y19E 4K2UH 4F7TA 2K7PA 3QNXB 2VL5B 5SWQA 3VI3F 2DI7A 3O3DA 3BX7C 4OAWA 3TBVB 3MJ7B 4TN9A 4LCCA 1RIVH 1PKQA 3BPOC 1OARL 1N0LA 4O2EA 4EVNA 3ULSB 4N5EC 2FD6H 35C8L 5E2VH 2BOBA 5DR5H 3IS0X 4F8QA 2Z31A 4X7FC 2GTZA 4HJ0D 1K4DB 4U6HA 3DI3B 3BAEL 4FQPA 1RHHB 3GRWA 4PJGF 5AZEL 3UO1H 3UDWC 4H20L 4MSWA 3GSUA 2FBJL 4Y16A 3K8MA 1MSPA 3MODH 1T83C 4CBPA 2CPCA 1DTUA 2EXYC 4QKXB 1EFXA 3OR7A 5D1XC 1CE6A 4XXDA 3P4NA 2Y9RT 5IBLD 5JHDB 4GQ9L 2WBJA 4Y5YA 5E6IC 5CILH 3CK0L 1Z2KA 1J8HB 4ETYA 1BVLB 1ZHBB 1J1OL 3WHXB 4I3RL 4LLDA 2X9XA 1CXHA 4QF1B 5DTFB 3G6JA 3WDHA 1F6LL 1FZMB 3GIZL 3SKJL 4GKZA 3VFRB 5C9JB 4XCFL 4Z0BL 1NFIB 1XGPB 1AGDA 3CH1B 3QNZB 4GRWB 4XPHH 1RULL 1EFQA 1MCRA 1IZJA 2DQHH 3MFGB 2CUMA 4QRPE 1G84A 4K8RH 3LPFA 2NZ9D 5CBAA 2OM5A 1NDMA 3VJ6B 4LSUH 5IWLA 4KDTC 1BQHB 1I9RH 2ZG3A 3TZVC 4NM8L 5IHZB 2BDNL 3LY6A 4BFBD 2DLIA 1QPPA 4XMLH 2X4QA 1X4YA 5L8JB 2BVUA 1OW0A 1R24B 3WFEL 3IVKA 2DQDL 3N1FC 5F7MC 3PIQB 5DQ9B 3QNYA 1AC6A 5BVJB 3LKNB 4R7DA 4KGLA 3BQUB 3EBAA 3HRPA 4EI6A 2IGFL 4XPBL 2ZJSH 4ZODA 4AZ8A 5HGDA 1ND0B 1CIUA 3D6GA 1PD6A 4YDJA 3V9FA 2P5EA 4PGEA 4S1SH 1M7XA 5GGQH 1AE6L 5T3ZD 2COQA 4G6FB 2MCG1 3QUMB 1VKXB 2W92A 1XF1A 5EORL 3HLAA 3OKOB 4ZQKB 1R3IL 1RJLB 4JY6A 4M7LH 3BH8B 4HFWA 5D96B 3RWIA 5E2UL 5LAXA 4HKJB 2EIEA 2A0LC 4OM1H 3GBML 4S2SA 5IOPA 3EYFB 4G9FA 4NZTH 1S5HB 1S7TB 2OJEA 3L5HA 5KSVB 2HJFA 3P9WB 3QCTL 5IBTH 3WV0A 4M62H 5DA4A 2WLZA 4Y2DA 1FVEA 4JM2D 5KN5A 3WLWD 4K94C 5GPRA 1U8PB 4YLQT 3SBWA 4G80A 4R90L 2KQNA 4MJ5A 3VD4A 1EERB 2KKQA 4ZAKB 1FVDB 1MCBA 2IBZX 3IF1B 1EUUA 3D18B 3VXNA 4H1LA 4LPUA 4NKMA 2EDNA 3BT2L 1U93B 3IKCB 2CKNA 3IJSB 1GPOH 1A6ZA 1KCUH 1NEZB 2D9CA 1HZHH 2Q6WA 4O9HL 5ALCH 3R0MA 5ENWB 3ZE2F 5HBBA 1CLCA 3WIFB 4OI7A 2CKBB 1ZWIB 1NC2D 5IKCA 1T0NB 4QTHA 3QG6B 4L29B 3VXSD 5EBWA 3NCYS 2NZIA 2J6EA 1Z9MA 3DGGB 1M1SA 3VWJC 3MYZA 3QH3A 5EU7E 3DV6B 3RX8A 5I1DA 1HINL 4JN2A 3IYLW 3KAAA 4IEFB 1JNNL 5LGKA 1ZVSB 3QDHA 1A9BB 4H88H 3P11L 3VGFA 4Y5XA 3GBLA 2XNAB 4PY7A 5BO1L 5IB3A 4XVSL 2DI8A 5F3HA 3S96A 4LCIL 4P4KC 4X8JB 4PJFA 5ESQA 1MCWM 1CTNA 4R9HA 1MI5E 2VERN 1AC0A 3EYSH 4R2GD 4YDVA 5D71L 5CEZD 3C08H 4B7IA 4NO0B 4FMFA 3T0EE 4DVBA 4XC3L 2ORBL 4EIGB 1MWAB 4L9LB 1YY9C 5CJ5A 3GO1H 2X4NA 4OV5B 4KK9C 3BRDA 2D31B 4MA1C 4KQ3L 4LKXA 4Q7DA 2ICEA 1JV5A 1MFEH 3UDWA 3FHQA 5KVMC 1YEJL 4NGHL 4M1GH 2HAZA 5KG9B 1T83A 2F58H 4OFDA 3ESUF 3OHXA 3O3AA 4FQLL 1SM3L 2PCPA 4I48B 4NRXA 5D1XA 3VXQB 5B39B 5HPMA 1F58H 2WINA 1EBAA 1E0OB 4P2CG 4GUPB 5E6IA 2V9RA 3PWUB 1MFBL 4K7PH 4CU6A 1Z0NA 3KLSA 4X5XA 4MHHI 1YEHL 3VXSB 3KR3L 1NGPH 2F8VA 2CLVB 2HKFH 1NEZG 3ROLB 3RNQA 4X0KA 2UUDH 1DLFH 2VDNH 4MNHA 4ALAL 1OGTA 4X4YB 3ULUF 3DVIA 4GW4B 3SQOL 2AV7B 5F9OH 2PF6A 4UT6L 1NQBA 4MA7L 5EPMB 5GS0D 1CLYL 4R0LB 5GXBB 5I30H 4LSQH 4WFHE 4GG6E 2Y23A 4DN3H 1OT2A 1F97A 3HR6A 5EUOB 4OGYH 3UXFA 4HUNB 32C2A 3AS0A 4KDTA 1HSBB 1RUKH 1QR1A 5J6GB 3TZVA 1BX2B 4R2GB 4WCYL 4OLYL 2FL5A 3GRWL 4LVHB 5KS9E 3HG1B 3LQAH 2EO9A 2C3GA 3ROOB 4WEBL 5JIHA 2ENYA 2YZ1A 3A6BH 4PJ5B 4KV5F 3DJ9A 3GI8H 3WJJC 3GJEA 1J1PH 4AL8H 1LO2H 1Q9OB 4CVZB 3U30B 4PG2C 4I0PD 2P47B 2KBGA 2IEPA 4JCMA 2X4UA 2FLBT 3SGJC 1K2DA 2VQ1A 2NY7L 4P59L 2BNRD 4WWKD 1C08B 12E8L 2XZAL 4JJ5A 4KUZL 4WY7L 1F4WL 5GS1C 2DLEA 1CGXA 1OARH 4UNVA 3MV8A 5KAQF 4RMTA 3BKYH 1W72B 4OLXL 1V3JA 3MUHL 2WNGA 5C08E 4P2OB 4OZGE 4F3FB 1DDHB 2BRRL 4U7SA 1S7SA 3MJ8B 1BZ7A 1TTGA 2IFFH 3BAEH 4TNWK 4GKSB 1RZGA 5AZEH 4ZDHA 4QRTB 3HNVH 3VXRA 4H20H 4P5TC 1BMGA 3HS0B 3V8CA 1F3DH 3C8HA 4JVUA 3V5HB 2V7NA 4QXGL 4LLMB 1KJMB 3OZ9L 4LNRB 2YPLB 4ZO9A 1IT9L 4MD5B 4I5BA 5A3ID 1VACA 3N50A 4LSRH 2AJXL 3CK0H 3TBWB 5B4MD 4JY4B 3UCRA 3PQYA 3RZCD 1PQZB 5D1QC 1J1OH 1T66D 4I3RH 4Y4KB 2MMXA 4OGXL 1K9TA 2AXGB 1JZ5A 4CKVX 3VWJA 3ZHKA 4I0PB 3NIFF 2P24A 1JZ2A 3BKML 3SKJH 2E7LC 4XCFH 4Z0BH 4PJCA 4NCC2 4OQTL 1UEYA 4LGSB 3X11A 1TCMA 1RULH 1ZOXA 2NXZD 2FX7H 3KLAB 5EDXA 5L9DL 3O81A 3TCXA 3VG0L 4OZIE 3RBGA 2BNRB 4WWKB 4HWZA 2AEIT 3BPCA 1OP5K 3MUZ1 4P4KA 1X44A 1H5BB 4JO2L 2BHZA 5IHLB 5CJXC 4NM8H 2BDNH 1IC7L 2H9GA 2IADA 1QG3A 3MXWL 1AXSB 3BP5A 4NT6A 5I8EA 1UA6L 2AV1A 3LV3B 4QRQB 4LAQL 3S5LB 3IDGB 1AIFA 4MS8D 5EFIB 4YEFA 4UILH 3FO9A 2IGFH 1ZLUK 5HHOD 1I75A 1KPRA 1KBGL 5F1SA 2HTLD 1NCUA 2OL3H 4M48L 1XGRA 1BD2E 3UZVB 4X6EA 5HY9B 1NAML 5FCUL 4MQ7A 2BY0A 4HUXA 1NCBL 1QLRA 3OR6A 5E9DE 2BVTA 4PBXA 3LQZA 5JORA 1GGUA 1AE6H 5AYUH 1P9MC 4ZXBC 3SGEI 2J6EL 5HDOA 3ETBF 3T1FA 2P8LA 1NANI 1NBVL 4LPVA 5EORH 1T2QH 5T1LB 3UROR 1GYAA 3GM8A 4C4KT 2DIBA 3ILQC 1R3IH 5EO0A 3NFPA 3VGAC 3MV7E 3GSVA 4ETQB 5D72L 2ADJB 2AQ1A 4UB0H 3GFUA 3RZCB 1KCSH 2R69L 4OIBA 2EDRA 5E2UH 1QFWM 4DKDC 4ESKA 1QRKA 4B50A 1KGCD 3S35L 3CDYA 5CEYA 3VRLE 3E6FB 5BZDA 2QHLA 1XH3A 1LO5B 1YC8A 2C4FT 4C56D 4XHJD 3VXUD 2H2PD 4O02L 1PX4A 2YR3A 4KZEL 1UM4H 1K85A 2VOTA 4PB9L 3JV0A 5I73B 1QFUL 4ZSOE 4NRZB 4R90H 1YY8A 4LHUB 3MJ6A 4F58H 3N85L 1BJ8A 4BSWB 1KJ2L 1FV1B 4JRXA 3UTZB 3BT2H 4L4TB 1KT2B 1CQKA 5D2LB 4JDZB 3KLDA 5DRWA 2P8PA 4F7CB 5JOFA 5DVKA 1P5UA 4QHMB 4WI3A 5MEOB 5E00B 1P2CB 1YNTB 1ED3B 5CJ8A 2AEPH 4OLUL 4ODTL 5JW5A 4PG2A 3S5LG 4L8SC 1A1OB 2RQ8A 1HINH 1KLGB 3DETC 2LTQB 5DDHA 2YUVA 1U8OB 3BP4A 4Z7VE 1D5MA 3P11H 3FAWA 3UTQB 1R3KA 3SGJA 2E9BA 3NN8B 5K9QI 1TIUA 5IB5A 2BSRB 4XVSH 1E4XI 2DDQL 3MLTA 4KI5F 4LCIH 4KUCF 5GS1A 1CXFA 2QQQA 2YK1L 4PJIB 5D71H 3PL6D 2OBGA 3QO0A 4NQED 4ZS6D 4R4ND 4C56B 5IT2H 3VA6A 4XC3H 3VXUB 2BSED 4DOHB 2ORBH 2UYLB 1FZKB 4MXVE 1UT9A 5E94A 4ODSL 1BBJB 4RMRA 1ORSA 4KQ3H 4N0UE 1ZA3B 2ATKB 3BPLC 4LCWD 4Y5VC 4P5TA 3G04A 2EYRA 3TPUA 4NGHH 2NY0C 1XGQB 4U2ZA 4U3CA 1UZ6F 1LK2B 3CFCL 2E7BA 5D7LA 1V7NL 4UQ3B 3GNML 3GKWL 3V6OC 1NFDA 1G7MB 2HLFD 1NDGB 1MFBH 4UQ2A 1FP5A 5D1QA 2Y6SC 4EIZC 1YEHH 3KR3H 3KPNA 3C6SA 4GKNB 3BRFA 4JM2F 4KH2A 7FABL 2QLVB 4D94A 4JFDD 4UDTA 1NLDH 3SQOH 3KPRA 4POZD 5FEBA 3AREC 4UT6H 2IAND 2XT1B 4PJAA 2IPKA 3NCEB 3D39E 1DEEA 1NCCL 2ZCHL 1PG7L 4G8IB 5F8RC 2R0KH 1QFWI 1BEYH 2RGSA 4PR5B 4D9LH 2OTUB 3MRHA 4HMCA 5CJXA 1GSMA 2EDDA 4K94L 5FDWB 4X99A 4WCYH 2ED7A 4OLYH 3GRWH 1PGRB 4NQEB 1ZANL 4MAYC 5DS8B 2ZUYA 4IM8A 3D3VA 3OGOE 4J1UA 3VMPA 4WEBH 1HHIB 5FK9B 4WGVB 3D5OF 4FN0A 1MQ8A 1JNLL 2MKLC 5HI3D 1N26A 5HHQA 1PBYA 4YEEA 4LCWB 4I2XB 2V7HB 3PE9A 4HLZG 4PJ9D 4ODHL 3G6DL 4LLUB 1ZHLA 1EHXA 3ARDC 4D8PB 4QNPF 1P9MA 1ZE3C 4ZXBA 4JPWH 4F80A 2E5EA 4YH6A 1A4KA 3WNOA 1JPSL 3P4LA 1PZUB 2NY7H 4RGND 4RMWA 1BZ9A 12E8H 5TGBA 4X6FB 4CADB 4KUZH 2HJKB 5HD8C 1BZQK 3I75A 1F4WH 4WY7H 3RIFF 5B8CB 3M1BA 1MCEA 3RIAK 3ZZ1A 3V0WL 3RQ3A 1PZ5B 3RWJA 1M7IB 4JFDB 1XGUA 1ZTXL 5BQ7A 2A77L 3GGWB 5TDPA 3VXOA 2IANB 3MNVB 3P9LB 5BS0E 3K80A 3O2DA 4HJGB 3ARGD 3H7LA 4DW2H 1CFQB 2BRRH 1EMTL 5DYOA 5T5NG 4GAJL 4NSKA 3V7AG 4BQBA 1DQML 1FNGA 4QOKA 5D1ZD 1BOGB 5CZXC 1FDLL 3WHE0 1L7TL 4QXGH 1DCLA 3OZ9H 2J5LC 2BNUA 1F6FB 2VLRE 4EEEA 3O8XB 3EOYG 3IAGC 4G7VL 2XY1A 1JPFB 1A6TA 4NUGL 4WW2C 2W65B 4EXKA 3B9KC 3W0WA 4MAUL 3D2UA 4F9LC 5JMRA 4MJIE 4HUVB 1OLLA 4PRNB 3B8YA 1R5VB 3QQ4A 4OGXH 1SMOA 4X4ME 2GJZA 1H8NA 4PJ9B 5J06A 1H0DA 1SYSB 1ZVYA 5EIQA 4L8SA 2JCCB 2AK4A 3BKMH 3BD4A 4OQTH 4PJ7E 1IGML 5F9DC 1X5YA 1MCJA 1U8HA 3DROA 4X6BA 2AEQL 4LASL 3O4LA 5L9DH 4OF3A 1UKTA 3K0WA 3VG0H 4S0SD 4Q9QL 1QHOA 1BF2A 2UZIL 4ZUTB 3PGFL 2E8ZA 5ICYA 4JO2H 2IAMD 1JN6B 1OAXH 3RNKA 4Q97A 1IC7H 4HSQA 3S37X 1F90L 4TPRL 4UBDD 1OSZA 4LLYA 4N0RA 1UA6H 5E24E 2D7OA 3HMWL 3HI6H 3FT3A 4FQHA 4LAQH 1MFCH 2J8UA 4CAGA 3QHFL 4H1LH 3HZYA 3ARGB 3ARWA 4QWWD 5DC4B 3CDGB 1KBGH 4OD2A 4M48H 5AAWA 1X5HA 2LU3A 1NAMH 4JY5H 4TUOA 1CFVL 3C5JA 5FCUH 4Z77B 2X09A 3TVMD 4Y5VA 5LQBH 4QRRB 3NACL 4Y88A 2CRYA 1N59B 3FZUD 3MC0A 3O9WB 4X9GA 3F7PC 2P1YA 1ZKAA 4PGBB 3T65B 4HCRL 2J6EH 2NY5C 5A2JH 5C0BE 4K71C 4H26B 2VE6A 3GUTA 1NBVH 2YHGA 5HHNA 2ZP0T 3T2NL 1KNOB 4JO1H 2UY6A 1IC4L 1JWUA 3H3PL 3TFKC 1DQJB 3V6OA 5D72H 4HMDA 1QLFB 4L4VA 3S6CA 3BI9X 5IMKA 5T1MB 2R69H 4PGJA 4S1QL 5DJZA 2NY1C 3BDBA 1IM9D 4ODWB 3S35H 3FO1B 4I4WB 4N0FA 4HHAA 5DJXB 4IJ3B 2YRZA 3HKFA 2FGWL 4HXAL 3FQUA 1WCBA 2P5WE 4FFWC 2QQNL 1J0YA 4O02H 4IMKC 5E8NA 4CRPA 3AREA 1A7NH 1U0QA 4KK5D 4Z7UE 2IBGA 5GRVL 3PDOB 4NQCB 4XBPA 4KZEH 4PB9H 5DJYB 3DHJA 5KJRL 2OR9H 4N9OB 2AI0L 5AG8A 3QXDB 3NTCL 2EIBA 3L9RB 5DO2D 3BJLA 2ZKHL 2WIIA 3ZT5A 2RFXA 2IAMB 4AIZB 5BJTA 2FR4B 1GGBL 1SJXA 5B38A 1ORQA 3B3IA 3U2SB 2WWMC 1GAFL 4K7FB 5KSAC 4NNPL 1QVOB 2Z93A 5J6HA 3FAXA 1FIEA 4MAYA 4OBRA 1ZGLP 5EN2B 1TZIB 4XPFL 1I1YA 3R8BB 2MPAL 2LABA 5A2IH 5KOVC 3IB4A 5KVDH 2OTWB 1T5XB 1YMMD 3P0GB 4ZFFB 4HGWB 3R06B 3QJFA 4P2QD 4CW1B 3KWWB 4NO2A 3UAJD 5CGYC 4OKVA 2R1YB 3TVMB 1AY1H 4OLUH 1KXQE 4O51B 2QADD 5CSGA 4ODTH 4E41B 1J0ZA 4DUXA 3KPSA 4G43B 1DSFL 2ADGA 3CVHA 1U95A 3SGDI 3IJHA 1U8MA 4MJ2A 1OGAB 2E27L 1WLHA 3LB6D 5F7LB 3G5VA 5EZOL 4ZFZB 2A74B 1GGCL 1KB9K 2FRGP 2R4SL 3RUGF 5SWZD 2KUTA 3CMGA 2FX9L 1BIIB 3VWKC 1RUQL 5EU3A 3HZMB 1IM9B 4LSPL 1N8ZB 4QHUA 4YUEL 4F15B 4A6YL 2YK1H 5DVLA 3FQRB 1TZHA 4LLAA 2HYMA 4TVPE 3CZFA 5GRXG 2W91A 4FP8L 3OKMB 2WUCL 5E8EB 4EJ1C 4IIQC 2D7MA 5IVZA 3VH8A 3QUZC 5D5MB 4WRLA 4ODSH 4TUKL 4U0RB 5JW4N 1EEYB 4Z8FL 1F3DJ 2RBLA 5J1AB 3BGMA 1F45A 2AJSL 3TYGL 1JF1A 1FL5A 3T3ME 4Z7WE 1ACYL 3JV4A 5ISZA 4FQCL 1QYGL 2XN9E 3BKCL 4HZLA 4ODBD 4YGVA 5D8JL 3C60C 4ZO7A 3B2VH 4JFED 4X6DF 1EV2E 4M9OA 5BOPA 1GXEA 3CFCH 1S8DB 4HUKB 4P3WA 4WW2A 3QFDB 1UJ3C 1YMMB 1EXUB 3B9KA 1JGVL 1U3HC 1U8LB 4KJPD 4F9LA 2ICWJ 4JREB 1Y6NR 4P2QB 1UVQB 2XWBA 3QISA 1CGVA 3ULVD 4G6AC 7FABH 1J05A 3BIBX 2A6IA 3PHSA 4OZHA 1FLRL 3GMQB 3P9MA 3UTTD 1X4ZA 1OB1B 4AG4L 3L3HB 1NMCC 4HAFA 5HXMA 4LP5A 1MF2L 2VLKB 1SJEA 2ZCHH 2UY7A 5CD3B 1A6AB 5I6XC 4ELKB 4MDJA 2HG5A 2YD4A 3TA3C 3UTSA 4YE4L 3TC9A 1IBGL 3MQIA 4K94H 4XI5D 3WFZA 4I0KA 3FB6A 1ZLSL 1ZANH 1SYVA 3VG9C 2XI9A 4JO3L 3RWCA 4M61A 4EN3C 3FKUS 4X6CE 1IARB 1B0WA 1NUNB 1JNLH 3HCVB 3JTTA 5H94A 3Q2CA 3SDYL 3B2UC 3QUYB 4PJGA 3WMSA 3SKMA 2PUQT 3KG5A 4KJQC 3O6ML 3TH4T 4F7PA 2FX8H 1UXSA 1UWEL 4UTAL 4ODHH 4ZUWA 3G6DH 5DD6B 4OI9A 1PEWA 3MGTA 4LGRB 2OR8A 2WMPA 1NCDL 4JRYB 3P73B 2YBRB 3GSWB 1RUML 5F6HJ 1HQ4A 1JPSH 4MVBC 2CK0L 3QRGL 4NPYB 3WN5B 4P57A 4FOMA 1F42A 5CEXB 2EH8L 1VADA 5J9PA 4GBXC 3U4EA 4YBLB 3OKYA 1GGYA 3QDGD 5AZ2L 4XWGH 3ULUC 4HD9A 3V0WH 3MRCA 4XNMA 1VEPA 3C5SB 4PJBB 4B7LA 1ZTXH 1HHGB 4DCQB 4IMKA 1RJYA 1EMTH 5H35A 1AGEA 2P8MA 4CDGC 1PKQE 2A2QT 4GAJH 3MZGB 2ARJQ 2DLGA 1JZ8A 4Z95L 5DC0A 1BBDH 3TCLB 1FDLH 1SEQL 3UBXA 1L7TH 3WXVH 2XWJA 5KSAA 4HGKC 1SEBA 4RX4A 4JHAL 4NQDA 3VGHA 2E9JA 2FJFA 3I6LD 4UV4H 4G7VH 2CJUL 4PTUB 4H8WC 4RRPA 2X1QA 1N5AB 3G08B 4IHOA 3VCLB 2BX5A 4F7MA 2R2EA 2HMID 1WC7B 4MAUH 4GAFB 3FQXB 4Y4HB 1WCQA 1WJ3A 5BRZA 3PUCA 2A6KB 2NR6C 3CU1A 2A6DA 3IDIB 3H3BC 4OD1L 2X89D 1NSNL 2MWCA 3KNBB 2A73A 3KYNA 4WDIB 1IGJA 1HOCB 1ITBB 1IGMH 4UAOC 1AO7D 2GAZA 3QDMA 5I1LB 1S9VA 4LASH 2PO6B 4V2BA 4GW5B 4Q9QH 1A2YA 3MRQA 4NN7B 4PV8B 4FABL 5MERA 3PGFH 5C0CE 5A16A 2M2DA 5I76A 4XH2A 3VWKA 5DEGB 3AAZB 3QDGB 4N5UA 5TF0A 2D03L 1F90H 3V5DB 5D7IB 4U3HA 2E8YA 1YEFL 2H32A 4HGMA 2O5YL 1AR2A 1CR9H 3STZB 3T3PE 3L6FB 3QHFH 3BEWA 4IIQA 1CT8B 1D5ZA 3QUZA 4JR9L 5F9AC 1VSCA 1B9ZA 3FN0H 4KKAC 4MMXC 5IP4A 1CDHA 1JWSB 4KK8D 1OAUL 2CDGB 1P6AB 3BSZH 3NACH 1X5KA 4TRPH 1IEBB 1VPOL 3C60A 3L3KA 4I8DA 5JNYA 1SVZA 4HCRH 5F9JB 2EKJA 9CGTA 1P4LA 5HHXL 1JUFA 3T2NH 4PRHE 1IC4H 4MDIA 3H3PH 4OFYD 3IJYB 5IEKB 3MRKB 5ELIA 3TBYB 1UJ3A 1U3HA 3SE8L 4S1QH 3QUXC 3O6LL 5GSVA 3TIDB 4JZJB 5IQ9B 1M71B 2FGWH 1OTUD 4Y0GA 5L88L 3BFOA 3FB7A 1I8MB 2QQNH 1EO8L 4J3UA 4EQ2A 2GKIA 1T1ZB 2JELL 3D25A 4HUWB 2XZCL 4LDLB 4P2RD 5AUMA 1LK3L 1V3MA 4M7JL 4MZ2A 3SDDB 1KG0A 5HYJE 5E0QA 2F53D 3NTCH 3X14A 4OBSA 5FUZL 4PRAA 3UZEA 3MGOA 3TA3A 1CL7I 1GGBH 1AH1A 5TFSL 1NCAL 2GEEA 1B2WL 1GAFH 1QRNB 3TEUA 1G6RL 2OL3B 5FA4B 5BXFB 1D9KC 4PJ8B 5ANMA 5HPOA 4YR6A 4J2XA 5FKPA 1CFNB 3UPRB 1R5WA 4EN3A 1MLCA 4XAKE 4FQIL 1F6AB 1C16A 1S78C 4LCUB 4LBEA 4TVPL 1DUYB 5F7FA 3KXFE 4JDTL 2BNQB 3EDFA 1KN2L 2FSEB 3NIDF 4WW1A 4PJEF 1QA9A 4ORZC 1DSFH 3CSYA 5DD1L 3AB0B 3E0GA 2DWDB 1XEDA 4JZOA 3CCHA 3T8XA 2I5YL 5IMMB 1F4XL 2O5ZL 2VQUA 1WAAA 2HT2D 3PP3K 1HIMH 1DP0A 2E27H 3MRJA 4NFCA 2R4SH 2SEBA 2XFXB 3VFGL 4AEHL 2W9EH 5IB2B 1LNUA 1ZLVK 2FX9H 2FECI 4GBXA 1RUQH 2Z35A 1RZ7L 4LSPH 3DX9A 4JQVC 4A6YH 4HJ0C 2DQTL 3T2OA 4XVUD 1JPGA 1QBML 2GK0A 4JKKA 4DFIA 3WEXA 2OI9B 2I26N 2X10A 2WUCH 1S7QA 3E1F1 4TVSa 1WISA 1I1FA 4YZFE 3LSOB 4RFNC 3MLZL 4P2RB 4TUKH 4U6XB 1A3QA 1FVCA 3V7MA 4Z8FH 3KLHD 5GRJL 3IDMA 2AJSH 5IBLC 4JM4L 3BDYH 4RFOL 1X5GA 1ACYH 1S7XB 5JTWA 4FQCH 2DLFL 5HHPB 3D87B 3U7WL 3WFDL 5D8JH 2PTUA 3VW3L 3IXTA 5D96C 1DVFA 4HKXA 2XTJD 4XCYA 2FHCA 1X9QA 1YPZF 1HKLL 3BZFA 4P46B 1LEGB 1JGVH 2HRPL 4LSSL 3GMNB 4X7TA 5C0GA 3NA9L 3VFOB 1H9VA 3L5WA 5D5MF 4L3EA 1FLRH 4NKDA 2NZ9C 3ALPA 2GI7A 2P46B 4LEOA 3PWNB 2MKWA 4WFED 3DX8A 4HWBA 3EOAB 1ZXQA 3V6BR 1ZV5A 2Z91A 3HZKB 3QDJD 1T21B 4APQD 5IESL 2XA8L 5IJVA 4V1DA 4KI5C 2VH5H 5GZNC 5ACLA 4Y19D 3DLQR 2YPKA 4TQEL 4PRBB 3CC5A 4JDVA 4YE4H 2F54A 1IBGH 2GSIB 4FQXB 1JE6A 1K3IA 1ZLSH 5MEPA 3MV9A 1FYTD 3U0TB 2EC9U 2LVCA 1KCRL 3BGAA 1CWVA 5IIEB 3SDYH 1JZ4A 3HE6D 4N8VB 4MD4B 4FZ8L 5HDQL 5JXEC 4YDLC 1AGBA 1TETL 3O6MH 4X80H 2ESVA 3JWOC 4N8CH 2AP2A 2QQKL 1KTDA 3PG2A 1UWEH 4UTAH 3RVTD 3CJJA 2YD5A 4ZFOA 2VXVL 3S4SB 4MWFA 1MIML 3VXPB 2XTJB 5FM8A 1UWGL 5D6CB 4F57L 1NCDH 2VSCA 2WW8A 1XF3B 1RUMH 4U1NB 4F7TB 2CK0H 2RR3A 1AJ7L 4KTEL 5SWQB 3QRGH 3BPNB 4XNZB 2NY6D 3ULSA 5F9WB 2IQAA 4LCCB 2H45A 4DZ8B 4JM2C 4NJ9L 2BVOB 3QCVL 2R29L 3QUXA 5HVHC 2KDGA 5AZ2H 4O2EB 3WLWC 5GS2H 3H7BB 1P7HL 3TBSB 4D3CL 1RHHA 2BOBB 2OP4L 1G7HA 2GTZB 3MTRA 1CQYA 3HUJF 4U6HB 1BFOB 4APQB 3RWEB 2AJVH 2CH8A 2R1WA 1WWCA 5L2KA 1MVFA 4IOIB 3GSUB 4Y16B 5D2NC 4FTVD 3SJVD 1O0VA 4ZNEA 3ZKMD 5DQJA 4GAYB 1D3CA 1SEQH 2XTLA 4YNYA 2BVYA 4YPJA 3ZO0A 4EBQH 3OR7B 3EDKA 1RIHL 1CE6B 1DN0A 1BVLA 1FYTB 2W1NA 3PWVA 3MCLL 3P4NB 4PJXF 4XXDB 5FB8A 1QFPA 4NN6B 1ZHBA 2WBJB 3VXRE 4JHAH 1BM3H 1D9KA 5TE6L 2UWEE 4FXLA 2CJUH 4U4BA 3I3BA 5DTFA 3G6AA 3ULVF 1NPUA 2VUOA 3PV7A 3HE6B 4BZYA 2VKWA 3FO0H 4P48A 3EGSB 3QPQC 4JHZA 1ADQL 3CH1A 3QNZA 1KC5L 1LILA 4G8GA 4XRCB 4OD1H 2X5PA 2QQLL 1NSNH 4QHKJ 5GZOD 1AGDB 3RKDC 4R7NA 4KHXL 1BFTA 3I9GL 3MGAA 4N8VG 5IHZA 2AAVA 1OP9A 4R2GC 2G60H 5CBAB 1KSRA 1OOAA 3S9DB 1NDMB 4O5LL 5HI4C 1RUAL 3NFNA 5DEZA 3PIQA 5DQ9A 5DVMA 3H2WA 3S4SG 4FFZL 4JFYA 4JQVA 1P7QD 2D03H 4NWTL 3IVKB 2BCKA 5ILTL 4R7DB 4EI6B 2O5YH 4R3SA 6FABL 3U30C 4Z7QF 4X98A 1REIA 1EA9C 4XWOD 5HGDB 2BMKA 2V2XA 4OSUL 5FIEA 4JR9H 3R1GL 1VDGA 4FTVB 3SJVB 3GKZA 4YK4B 1Y6KR 5DURD 5A2LH 3X17A 4KC3B 1OAUH 2P5EB 3K1DA 4PGEB 5F7EL 1HYSC 1UH3A 4J12A 3OKOA 4GRLD 4ZQKA 1XF2A 5GGUB 1VPOH 2B20A 4HV8A 1UB5A 4HK3N 2PR4H 3HLAB 5ACMA 5F7KC 5HHXH 3UJJL 3DUSA 3QBTB 1U3JA 4C58B 3IDXH 4HFWB 3CVHH 4OTXL 3RWIB 5KSVA 5FGCB 2LFGA 4UTBH 4S2SB 3JUYA 3MRBB 3PV6B 4J6RL 3SE8H 5IOPB 5GS0C 2Z0BA 2OJEB 3O6LH 3UZQA 1J86A 1U8PA 1WFNA 5CHNB 5HDLA 4N5ED 1FVEB 1EO8H 3JV6A 3S88L 2JELH 3IF1A 2GHWB 4NUJA 5JIPA 3D18A 2XZCH 4G80B 3ULUL 1JF5A 4MJ5B 4M7JH 5DT1L 4CN4A 1A4JB 1BFVL 5FUZH 5D93C 4H1LB 5AWNH 4NCDA 2APXA 2CKBA 1MI5D 1ZWIA 2Q6WB 3IFNL 1G6RH 1T0NA 2FZ3B 4TTGA 1A7BA 2PTVA 4PJHF 6CGTA 2Q8BL 4ONHB 5HDBE 3DGGA 4I0PC 3H9HA 4FQIH 3DV6A 4KXZH 1I8IB 1R3JB 2FCBA 5DD0L 5EBWB 4JG0L 4TVPH 1W0VA 2KH2B 3QH3B 4RGMB 1ZVSA 4LIQE 1NGYA 4JN2B 1KN2H 1T7VA 1Q1JL 1JF6A 4GRLB 2XNAA 2CDEB 4WWKC 5DD1H 1EEQA 1IGIL 1T3FA 4X8JA 2I5YH 5ITBL 4DFHA 1F4XH 5GJSH 2GTWB 5IB3B 2ED8A 1QR4A 1II4E 2J4WH 3S96B 1TQCB 4ZTPH 5ESQB 4Q58C 3VFGH 4AEHH 3TZVD 4YDVB 2HFGL 4JM2A 1RZ7H 1EJOH 4L9LA 3BPOB 1Z5LA 5CZVL 4IBLT 2DQTH 4DVBB 1BVZA 1QBMH 1UADC 5SWSE 3REVA 2VDPL 2UUDK 3V79C 2X4NB 1I8KB 3FQTA 5IVXF 2MTPA 5E5UB 1OP3H 4WFHD 3MLZH 2VRAA 1OAQL 5IFHH 1G0DA 3TH2T 2VAAB 4EOWH 3HA0A 5GRJH 1R3LA 4CVUA 1P5VA 5A3IC 4JM4H 4RFEA 2BY3A 4GUPA 3U9UB 1U92B 3U7WH 1MI5B 3WFDH 4CU8A 1V8HA 3O3AB 4NRXB 3PWUA 5D1XB 1NC2A 5B4MC 5HPMB 2A9NL 4ZPVA 1JTTA 3VW3H 2D0FA 4E42B 1T66C 1CDGA 3VFPB 5DQDL 3VXSA 1DANU 1Q38A 3DOSA 4H1LG 2FHFA 4WHTA 3MRFA 4X5XB 3F7YA 2YA1A 4X4YA 1DBAL 3FTGA 2AV7A 3WBDA 3E2HC 2AJYL 2HRPH 4LSSH 4P2YA 1NH6A 1YQVL 2C4XA 2EDQA 2NY5H 4RA0C 4X0KB 2NXZC 3RNQB 4M1CD 1F4YL 4R0LA 2MNUA 4MNHB 4U33A 1OGTB 2BVPA 1UCTA 3K2MC 1NFDE 4LP4A 2CSPA 2QSTA 2GUOA 2W0FA 4HLJA 5J6GA 1KFAH 1BX2A 5F93C 2FB4L 3WSQL 2XA8H 2ZPKL 3QIWD 3K8KA 2AJZB 32C2B 3KPRE 1YJDC 3H42L 1P1ZB 1QR1B 3ROOA 4MS8C 1D6VL 4TQEH 3TZVB 5IBUB 2FL5B 3NCJL 4WTXA 5EOCH 3OX8B 4E5XA 3OBAA 3VXTA 2HTLC 3BZDA 1R5IA 3A6OA 3TH3T 5E7BA 1NFKA 4CVXA 1KCRH 4JFHE 4Y1AE 1T89C 3LCYA 4FZ8H 4UZGA 1G9EA 2LTQC 4ACPA 1OHQA 3VWJD 4N0YL 5CJBA 1H3GA 3X13A 4PGZA 4X4XB 5BMFL 2VXVH 1C08A 4ZYKB