5GXBB

Crystal structure of a lacy/nanobody complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
MQVQLVESGGRLVQAGDSLRLSCAASGRTFTTYLMGWFRQAPGKEREFVAAIRWSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKLEDTAVYYCAAAARPSYSGDYGYTEALRYDYWGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Lactose permease
publication title Crystal structure of a LacY-nanobody complex in a periplasmic-open conformation.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 22
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gxbB00
4LASL 4K71C 4G8IA 1AGDB 4JRXD 5EIQA 4O58H 3LS4H 4NHUA 2F53E 3HNSL 5I8CA 5JQ6L 4MA7L 2R8SL 3WNNA 1KPRB 1K4CB 1F6FB 3NIDE 5BJTA 1IL1B 1ZHBA 2XG5A 2CMRH 3FT3B 2FECL 3N85L 5EOCJ 2XTJE 3OTTA 1ZOXA 3QH3A 2WLZA 3KPNB 5KVGH 4ELMB 1K8IA 1U91A 4L3EB 2BVQB 3O45A 3H3KA 1U93A 3U0TB 3QJFA 1R24B 4IMKA 4F7EB 2YBRA 3TYFA 1I8LC 4OT1H 3T2NL 4F57H 3FFCA 1KCLA 5SWZA 3TNMA 5JOEA 5FXCH 5LGJB 2IPUG 2ATKB 3INUL 4ZDHB 4JM2D 4X4ME 3KR3L 4HIEB 4U1JB 3EZ8A 3WUWA 4JG1H 4LCCC 2NY7H 1A6AA 1HQ4B 4PJEE 4RGMB 3UPRB 1MJ8L 1N3NA 2A83A 2IH1A 3F7YB 4PJDF 3PWPD 3GMRA 1KJMA 1EEYA 1GGIL 5GRZA 2MCPH 4HIJA 2X42A 1YPZE 4HIXH 5E4IA 3ARVA 1ACYH 2CIKA 4QHMA 5E00A 5DJYA 3ARED 1WC7B 2D03L 5IK3A 1A7RH 1YEEL 2C3HA 4CU8A 2Q8BH 1SBSH 5E99L 4K3EL 3GMNA 2DAVA 4NN7C 5ICYB 4K94L 1DQML 1QHPA 1JGUH 1IM3A 1FZJA 4KI5D 4ZQKB 1A14L 3EO9H 2YPLB 3CLFH 4PJFE 4WNQA 3QHZH 3OWEA 5IWLC 1C1EH 2J6EA 1HXMA 1JGLL 4IOIB 1X5IA 3OKMA 2FYYA 3I3EA 2VQUA 1UEMA 4LLVA 4OV5A 3O3DB 4HXAL 4NDMB 1Q9OB 2APFA 2L4OA 4UB0L 1NGQL 2W38A 1UB6B 4MJ4A 1GAFL 5D2NE 3MRMB 3FONA 5C0CB 3OHXB 4M7LT 1QSFE 2B5IB 2VE6B 4J7RA 2X1PA 4BSWB 3QHFH 2VSCA 5EO9B 4M6NL 3VXUE 1YEJL 3QIWD 2CKBA 3H8NA 4LQ1A 1I9IL 4TSCL 1Z3GH 5AEAA 5F93C 1JWUA 2JIXB 5D8JL 4HLZG 4ORGA 2DQUL 1TVHA 4LVNC 4PB0L 1NDMA 4PJGF 3P73B 4EI6B 1MPAL 5D1XC 1G9NH 2F58L 4JFEB 1X5HA 1Q9WB 4ALAH 1X5XA 3VH8B 1EV2E 4GAYA 2DMBA 4Y2DC 2BZDA 2IQ9L 4PJBE 4TUOA 1T1WA 1A9BB 1FVEB 1CVRA 1FNEA 3IDGA 3MJ7A 5HGHB 4FXKA 1JHTA 4CVWA 5L7XL 2WWMC 1KGCE 5MEPB 5CGMA 3G6JF 2VXUL 1LE5A 1I9RL 2JJVA 5ADOH 1EEUA 1ZLSH 4HF5H 5T33L 4NUGH 4MHHG 5L88H 1MEXL 5D93C 2X40A 5GRUH 3WMSA 3MA7A 1P6AB 3FHQA 1YYLH 1NFIA 2Q86B 3EZJB 2BHZA 3SE3C 4DN4L 2CO6B 5MHSD 3SKJH 1NUNB 3TO4C 5GGUA 3OXSB 1FVCA 5DRNB 2VTFA 4L8CB 2AJUH 5D7IB 2AXFA 4MVBC 3OKLA 5JHDB 2YC1A 1GGBL 2H8PA 2QSVA 4LSSH 4OBRA 1PY9A 1MQ8A 4EXKA 1EHLL 2YD9A 4P2OA 2J1KA 3I3BA 5HYJB 4KTYA 4WUUD 1JPFB 1FGVH 1Q0XH 4X99B 4ONOA 3HUJB 3C6LC 4XCEA 3OKKA 4F2MB 4NRZA 3R06B 4HEME 2BRRL 3FQUA 1J0ZA 1XGYH 1U8OA 4PP2A 4NFDA 3TT1H 3K8LA 1BGXL 3GFUA 4ETQB 3MPCA 1S7QB 3EYQC 1B4JH 5EUOB 2B1AL 4R26L 3VI4F 1UGNA 2ORBL 2OZ4A 1U8LA 2CUIA 4O2FB 4XPTH 3MREB 4NKMB 5DJCB 4FFWC 5HBBA 3BAEL 4NQCE 4Q9RL 4RRPA 4X6CE 5DS8A 3ARBD 4YXKL 1C12A 5D70L 2F15A 1CDIA 1Q94A 4Y1AE 2A73A 3T77B 1TZGH 3QDGE 4J8RA 1OGAA 5JOFA 2C1PB 4HJGB 4JRXA 5B8CA 2H1PH 4DKDC 4Z7UB 2ICWA 4JJ5A 4ZTOL 5CHNB 4ZOBA 2AABL 5MEOA 1UB5A 1QR1B 2ITDA 4GRMB 1FCGA 4Y5VA 5EOTB 3QDAA 2F54A 1BD2D 3MNZB 1TJGL 3D69A 4NN5B 2YKLL 1PKQB 2E9IA 4MX7B 4X5WB 4EDWL 1CT8A 1Y6KR 5DT1L 4ZNEA 1QA9A 5ID1B 4BFEA 1BQUA 1TTFA 5F9WB 3EFDH 2ZCKL 1QYGL 5JW5A 1PQZB 1IFHH 3GSRA 5IP4A 2D0FA 5J89A 2ADGB 1MFBL 2IPKA 1VA9A 2VLRE 4F7CA 4X9FA 1NCAL 2W9EH 2EH7L 1JHLL 3P4OB 1ZLVK 3NZ8B 3KLHC 4LEXH 2IAMD 3LEXA 5KSBA 4MD0B 5EC2A 5IHUH 3RWFB 4Z7WF 1QTYT 2NZ9C 5I66B 3D3VE 3BKCH 5AUMA 4Z8FL 1UCBL 1G9MC 1XIWD 3OKEB 1JWSB 3RVWD 3ARZA 1UJTA 4GBXC 3H3PL 4NFCA 5IBUB 3UJIL 1DL7L 1WFOA 2I60L 1GRWA 2RQ8A 4POYA 4V1DD 4Y5YB 4UTAH 1A4JA 1FFQA 3BH9A 5CZXD 3WD5L 1JE6A 1GOGA 1F4WH 2BOCB 2PUQT 1MREH 1HHIB 3B3IA 4XP5H 4LLYB 4ZS7L 4GW5A 3WFBL 1U8HA 5JNYB 5HHPB 4ZXBD 5H35B 3AY4C 2VAJA 4P3CH 1ZHLA 3PV6A 1HN1A 3V6ZA 4KTEH 1KYOJ 1OPGH 3DMMB 1WITA 4PTUB 4PLJD 4N0FA 3ZYJA 4XMLL 1GSMA 4UAOC 1AGBA 1AHWC 2F5BL 5D1ZC 4ZD3H 2QBWA 5EC1A 3B8YA 4HZLA 3QNXB 2HTLC 4DN3H 3ZDXF 5IT2H 2H6PA 2R69L 3L95B 1RVFH 4GQ9H 4KV5F 1CFNB 3TC9A 1LO2L 3M17B 3KYOA 3QIWA 5EUKA 5L0QC 4ODUB 2EDTA 3RVTD 3O3AB 1HZHL 3QCTL 3KLAB 2FO1A 1NBYB 3EGSA 2A6IA 3ILQD 4QOKD 4QYOB 5I9QC 4ELKB 3RNQA 1MCHA 1D5BA 1IGIL 4ZUWB 1CLCA 4U7KA 1DDHA 1KXVC 4FZEL 2W0KA 3ARGC 1ZLWK 4U2YA 4AEIL 4JZNA 1YMMB 5DMYA 1IAIL 2IH3B 5J12C 1AJ7L 3RL2B 4MJIA 1BZ9B 1KFAL 2VXVH 4GKSB 1SQ2N 1SEQH 5I18L 3DLQR 5IB5A 3AAZA 2XZZA 5ETUB 3BUYA 1E4WH 4MCZA 4Z78B 5IV2B 4IJ3C 5HD8D 4F3FA 5C0NC 3MQIA 1MUJB 2DF3A 3BDYL 3BGMA 5F1IA 1XF5B 5I75C 1KJ3L 4XNQB 5DD3L 1YN7A 5C2BL 4IRJB 2RAMA 2BNQB 3TIDA 1S9YA 4OTXL 4RFOH 4KXZI 5JZ7D 3ZTNL 1CE1H 5EIIA 4I1NB 2AI0L 2YPKB 5ELIA 4PTTA 3RL1A 4LPVA 4MB4A 1CTOA 1MWAH 1CF8L 1AXSB 1W0VB 2HRLA 2PO6C 3O0RL 4FN0A 1RFDH 4YDIH 4DUWA 4FFZL 1H3TA 4NJ9H 4QKXB 2QSCL 4R2GB 4R6UA 4NZUH 3L1OL 1ZA3B 3W11C 5F6IB 3PDOA 3JTTB 3AXLA 4JR9L 5CINL 1WISA 3QUMH 4YEFA 4DZBB 3OAUH 3O11A 4GKOA 3IDJA 3QI9C 4JKPL 5CZVH 4KJPD 1LNUA 3I50H 2VZ1A 1GCFA 3BKJH 1NC2D 1BBJA 2E7MA 4U0RB 2VLKE 3ULSB 5HJ3A 2F74A 3VWJD 4QXTA 1NAMA 1HEZB 4OZ4B 1G7HA 2IQAA 1LK2A 4NC1E 2EDWA 2N7AA 4OLVL 5HYEA 4MWFB 3MXWH 5F1SA 2XKNA 3BZDA 1GHFL 3RPIA 1E27B 3FAWA 3UYRH 1AD9B 3BE1H 3QFJA 4CVXA 4NKQB 4RQQA 3BGFC 5FECA 3UTZA 3SGJC 5KSVA 1GC1H 1TQBC 4HV8A 2ESVB 1WBZA 4D9RE 5C07B 3TF7C 2QADC 2R39A 2XPGA 4XXCC 2L7UA 5DHVA 5FM8A 3IETB 4QRPA 4DK3A 3BQUC 2HRPL 3E6HB 4WW2C 1EO7A 2DTMH 5DD5L 2BSRA 4EI5C 2A38A 1ZGLB 2J88L 4NRYB 4OD3H 3LKOB 2H2SC 3IGAB 5C0BE 3GSQB 4OLXH 4TQEL 4HIHB 3QFDA 1EHXA 1BHGA 4OIIH 3LQAC 3JWOH 5KS9B 4OF3A 5B39A 3O8XB 4M5YL 4M8QA 4GW4B 1XR8B 4GMTL 2OJEB 4JREC 1RUPL 5I6XB 4FMKA 5HHMB 4PB9L 4PG9A 2WSKA 3QA3A 5E94B 4O02L 3FQTB 5HYSG 3OR6B 2HVJB 4FQQA 4J3UA 4G6JL 5BV7H 3QUYD 3RTQA 3QG7H 1YC7A 3M07A 3BWUC 4JHBA 2Y9RT 3QNYB 2VRAA 4UU9B 5KZCB 4M62H 4M93C 4PUBH 5L2KA 1AKJB 5I16B 3QNZA 5CBAB 4DW2H 4LNVA 3DRTB 5D5MF 4YHKH 5IBTH 4GG6F 3F62A 2XZAH 1YNTB 1QRND 5FHAH 3ZMRA 3ROOB 4KJWD 4UI2A 1VFUA 3H6JA 4OB5H 5F9JB 1CFBA 4G5ZL 1WFTA 2GUOB 4PRBA 2XKUA 2JCCA 2VLLA 5EOCH 1B3JA 1SYVA 3F6IA 3HE6D 1U8QA 1A3LL 2VDML 4E5XB 2I9LA 5FB8A 5IROA 2R0ZH 4YXHH 5HVGB 4U1IB 4XB8A 4KRMB 1MRFH 1IGYA 3FMGH 3L6FB 2G5RA 5D2LA 2D3VA 2XA3A 2UZIL 1K85A 4YHNA 4C58B 2CRIA 1EXUA 1ZT1B 3O2WH 1TZIB 4D8PA 1FG2B 3DURA 3LN9A 2Q6WB 5E24E 3H0TA 4QOKA 3PIQB 4KMLB 1QO3B 3IF1B 3UAJC 5DUPL 3VD7A 1RUML 4LKXA 3P0VL 2XACC 4L8SB 2YMXL 2P8MB 2NY0C 3S37X 4NNPH 1V7NL 4GKNA 3HKFA 1U58B 4LLDA 3SGEH 4Y16D 1L9MA 1F90H 5I8OL 1I1YB 1P1ZA 4WI4A 1CE6B 3TEUA 4WV1B 1VFAB 2F8XC 5F7EL 1CI5A 1FNSH 1UKSA 1GGYA 1R5VA 5DJZB 1RUAH 2XFXA 2XWBB 3EOAA 5T3ZH 2EXWC 3VFWB 2DQFA 3LDBC 3D0VA 4HW6A 3SPVA 3IDXL 1ULVA 4K3HA 1MCCA 2OXGA 3VU2A 1KNOB 4JPIA 3TIEA 4O2EA 3NGBB 1G9ML 3GMOA 1MJUH 5T1KA 3EFFB 4H88L 3F7VB 2HFFB 3U83A 3D39E 2PTVA 4PR5B 3EIFA 3SO3B 1QFHA 4HPYL 4R4BB 5TF0A 5I1JH 4YZFE 2V2WA 1S9XA 1I9JH 3VDBA 3LMJH 5F3HA 5GIRB 1RZFH 4D0BA 4F7MA 3Q5TA 4ZAKB 1D5XB 1GZQB 1WZ1H 3FOMA 4U1KB 2O5XL 3VFOA 5IVZB 1YNKL 3SDXA 4PP1D 2EE6A 2EDEA 4YDLB 1WQVT 4ZYKA 1A6PA 4M00A 4Z7VA 2R15A 1S9WB 5FIEA 2CD0A 3W0WA 3NFSL 5GGRA 2Q76B 1FAKT 4PJDA 3DVFA 3SKUD 3GKWH 2AJVL 1HH9B 3PHOA 2VISA 2WV3A 4NZTL 3B9KA 4L5FH 3LS5H 2HTKD 5I17A 1N5AA 2CXKA 3DPBA 3L5XH 4KFZC 1U36A 3V0WL 4ERSL 4YDKH 4HSQA 4LLQB 6FABH 4M61B 1EMTL 3QCVL 3DXAB 3L3DA 1DANT 1T2JA 1F8TL 1FPTH 4Z0XB 5DQ9A 2MQ3A 1UVQB 2HN7B 3BN9D 1WEJL 3STZB 3DGCR 4QCIB 4XB7A 1QPPA 5HVWA 4XP6H 5DK0A 1QFOA 3O6MH 2HT2D 2X4TB 5EORL 4XNXL 2ZUXA 5T3XE 1L7TH 2XNAB 2VDLH 3BIBX 1OLLA 5F9AC 5CD3A 3U2SB 1VKXA 4HUKB 2OTWB 3O6LH 5F44A 3CK0L 3QEQE 3S3JA 4NZRL 1GXEA 2VABB 1DBAH 2HT3D 4YO0A 4JM4H 5FYJH 4WWKC 4CU6A 4Z76B 1A3QA 1HK6A 5FDWB 4MXWH 5J1AB 4JM2F 2B4CH 3VFUB 1AFVL 4DFIA 2F19L 1ZLUK 3WDJA 4NBYB 3HHRB 1DUZB 3T65B 1EPFA 1INEH 1ACZA 3P40A 1OCWH 5CGYC 1KG0A 1NPUA 4AEHH 1CFTA 3FQRB 4ZTPH 1D9KC 5DFTA 3HG1A 1DSFL 2CUMA 2OX5A 2AQ3A 3WDIA 4PGCB 4ODXB 1MIEH 3P11L 5I15H 2EH8L 3KDMB 2FB4L 1IMHC 4M7ZC 1HSAB 5T3XL 4M43L 1ES0A 5DQJA 2YD4A 4LL9A 2DQTL 3ARFB 4GRLB 3UYOD 4XXDA 3VXSB 1FGNL 3MFGB 3BOVA 3I6KA 4LNRA 4OZFA 5JW3H 1IC7H 5E8OA 5IB4B 4LP4A 3G08B 4X83A 2R4RL 2EO9A 4XVSL 2HG5A 3CU1A 3GSWB 5IHBA 1NAKH 3RWHA 1JV5B 1HHGB 5AD0B 1C5BH 3HPJA 4LEOA 1NFKA 4G9FA 1WAAF 4LCWA 4L29B 5DEZA 5H94A 5IVXA 3VGEA 3RWJA 2PKDA 1YN6A 4HFWA 3IFNH 1JNLH 2FX8H 5T1LD 4YPJA 3NZHH 4QXUL 1FL5A 4E42B 3RY6A 3TN0C 5HPOA 3WE6A 4I0KA 1MHEB 2IG2H 3EYVA 4OCRL 2FECI 1T1ZB 2DDQH 1TJHL 4M4PA 3RWCB 2DIJA 4G6FB 3L7FA 4XZUA 3BD4A 1O5DT 3QDMD 3FB6B 3S8WA 2VLJD 3PXJA 4PJHE 2W0LA 4ODVL 5I1DA 1ZWIB 1BFOA 3EYUL 4L4VA 4B53A 5LAXA 2J5LC 3AC0A 4Y16A 1OARH 5FCUL 2VIRA 3LQAL 3VI3E 2HLFC 2E7LA 1C5DA 4HUWA 4MJ5A 5E5RB 1CDGA 4LARH 3MV7D 1PLGL 3WNPA 4PJXA 1UFUA 2J8UF 1UXSA 5HHQA 5LGKA 4MNGB 4F8TA 1R3LB 1KLFA 2XT1B 1J9CT 12E8H 3M1BA 3RWDB 5JQHC 5BS0E 1G84A 4NKOB 2A6JA 4QXWA 1B0GB 1HHKA 2IEPA 1K4DA 1M6OB 3B83A 3WFCH 2BC4A 3UTTA 5J3HD 4RAVB 5M95B 5JA9A 2XZQH 1CYGA 2GW5A 5HDLA 5IJVA 2CUHA 4J4PA 4Q0XH 2XQBL 5ISZB 2IFFL 3FO9A 3X3FL 5DDHA 2ZZUT 35C8H 3Q48A 1S9VB 4L8BB 4WO4D 8CGTA 3R0NA 4K7PX 3VXTB 4YE4H 4WHTB 1MCRA 1UWEH 1J8HD 4U6XB 4GXUN 2JJWA 3JUYA 5C0DB 1ZGLP 1BQHB 4Z7WA 4XVTH 2JTDA 4GG8B 3MJ8B 5JLZB 3OZ9L 4OCYL 3FB7B 5I0ZA 1NGZA 4GXVL 2X4NB 1G7QB 1F6AA 4ELMF 2Q20A 3IDIB 4ONGH 4WVRA 4NM4L 4NQVB 4YIQA 3MBEB 5T3ZD 2ZUVA 4GAGH 1REIA 1CQYA 4NQEE 3CDYA 2O5YH 2DYPD 3DGGA 5C1MB 3VE0A 3U6RA 2NY2D 1ITCA 4G9DB 1M05B 5LXGH 4P5MA 4S1QL 4LPYA 3JTSA 4PD4K 5D6DC 4Z7NE 4JKLA 2GSGA 3BO8A 4XHJC 4ONFL 2OLDA 4AMKH 4EUPB 4KDWA 2KZ1B 2W60A 1BLNA 4AM0B 3OJ2C 2XG4A 4L3CA 4NWUH 1C5CH 1Z5LA 2BNUB 4L9LB 4JFHE 4UT6L 3L3HB 3UTSD 3OXRB 4X6DE 3VXRD 4FTVD 1QQDB 1U3HB 1MRCH 2YPVH 1FDLL 3LHPH 5MI0B 1X5LA 1YEIH 1U8IA 3TJHD 4RAUA 2D7MA 4XBGA 4JPWL 2SEBA 3ZKXC 1KELL 5JOPD 3MGTB 5JQ6H 3HNSH 2R8SH 4MSWB 4N8PA 2PNDA 4IMKC 5GGVY 3CCHB 3AM8A 4JFXA 1IARB 4O2CB 3VXQA 5E6IB 3S6CA 3N85H 1YEKL 5SWSA 3GSOA 3OAZH 4N8VG 4NYLA 4HAGA 2R4SH 4NT6A 1CICA 1J88A 1YEFL 2G60L 1EBAA 2B2XL 3HAEG 3O9WB 1ORSB 3GK8L 3UMTA 3T2NH 3T04D 1NCNA 4KJYB 4MNQB 4O4YH 2BVPB 1MHCA 5DLML 3INUH 4FFVC 3HE7A 3KR3H 5EU6D 1W8OA 1TCRB 4PRPE 3TVMD 4APQB 4PRIE 1KTKE 3O3BA 3W2DL 1QKZL 5BRZA 4UOW1 5GXBB 1S7VA 1MJ8H 4JO3L 1RSFA 3L9RB 5E08L 3S7GA 3PWLA 4UINL 1W72H 5EN2B 2D03H 1RU9L 4EXPX 4RFNC 2YSSA 4XPAL 4C83B 1YEEH 5B38B 1ZA6A 2H3NA 2AERT 5E99H 4K3EH 3D2UD 3WFHA 3CSYA 2ADIB 3H42L 3QDJE 2NY1B 4R96A 4AIOA 3QXVA 3V8CA 1A14H 2FJGB 5F3BA 1OAKL 2OP4L 2QR0A 3WL9B 2R9HC 4IIQA 3DHJA 5IOPB 2GJ6D 1JGLH 2ITCA 3I2CL 2YEZB 1NGXA 3EOBA 1AIFA 1U95B 4A6YB 5IGXL 1AO7B 3IJHB 3MV9D 5I19L 1UH3A 4PV9B 4LHUD 1OW0A 4UB0H 1FAIL 3BKYH 2LE9A 4ZO8A 1GAFH 1KSRA 3MLSL 5JXED 2BOBB 3RNKA 4XBPB 5D7IF 3BRGC 3HPLB 4QRUB 4BH7A 3UPCA 4P2RA 2D7QA 4M6NH 1YEJH 4NUJA 1QSEE 5FOBA 3ZDYF 4LLWB 1WICA 1I9IH 4LKCA 3PWUB 4YQXL 1X7QA 3LD8B 4OCNC 4S0SD 4YR6B 1PG7X 4KROD 3SE4A 4UDTA 2BVYA 4MLIA 2FH6A 1JGVH 3I9GL 5FEBA 4LVHC 1PG7H 3TBYA 3HUJF 4P5TA 4TTDC 4XX1G 4PB0H 5B22A 2Y5EA 4HK0A 1MPAH 1JPGB 4OI8A 3U1SH 3BZ4A 4FQHB 4PJ7A 5C08A 4RA0C 3SJVD 4GSDL 5E2VL 5B39G 2IGFH 4G8GE 3BP7B 2IQ9H 5IVNA 5EUOF 1T2XA 4CVZA 5E6YA 1SEBB 1E28B 4CMHB 1I7TB 3VWKD 1S3KH 3L5WA 3MV8B 2EIEA 2VXUH 4JFFE 4AK1A 3Q6GL 4HIIB 1B9ZA 1BMGA 5T33H 4BM7A 4XAKE 2PXYA 1OTUC 1AP2B 4P2OC 2PR4L 4M1GL 2HVKA 1M4KA 2ARJQ 3FFDA 1T5XB 3GSXA 4JY4A 1CXKA 4Z7UF 1OP3H 5IMLB 3RX8A 1CD8A 3FB8A 4L1DA 4GS7C 1GGBH 4K23L 4KKNA 2HJKB 3CPLB 1VERA 1LEIB 9CGTA 1IAKB 3S4SB 4D0CB 1EHLH 5CLTA 3ZDZE 2BMKB 5IHLB 2DKMA 3MLRL 2N7BA 4ZOCA 5F1NB 1X6NA 2Y25A 1NC4D 5DMGD 4V2CB 5JO5A 4JN2B 2NY5L 3BT2L 3PNWA 4LSVH 3ZE0E 2H32B 1BECA 4LAJH 5D5MA 1U8MB 3VXMD 3C60A 4M9OA 1P7KA 5C09E 2MFNA 3DX7B 4PJEB 3P9LB 1JBJA 3FKUS 3Q3GA 4UV7L 4WUKL 1JJUA 1BGXH 1RK1A 4X5XA 2B1AH 1IAII 2ORBH 3VD9A 4ZO7A 5B8CC 5HHOE 1V3MA 3BAEH 4Q9RH 5JHLL 1OTSD 4JB9H 5DHYA 1CBVH 4S1DC 4FQPA 5KW9L 2P7TB 4JO2L 5F71A 3DX8A 2VXQL 4Y5VC 1WLHA 4HQQH 1JMXA 2OM5A 4JQVA 3EO0A 2FR4A 2QL1A 2AK1L 1CDUA 1G7LB 2IANE 5L8LB 3GSNA 4BJLA 1BZ7B 4ZTOH 1EEQA 5JPNB 2H2PD 1TJGH 2AQ1A 4NO2A 2YKLH 5TDNB 1A02N 5I1KH 4EDWH 3QJHA 1LP9E 2AJXL 5DT1H 1NLBH 5E2TL 1EERB 5HGAA 2EZ0C 3NVQA 3U30C 1EO8L 5I1AA 1Q38A 2ZCKH 2ZSWA 2J12B 1ZAGA 1KCSL 1B90A 1G7JB 3F7PC 2FJFA 2K3TA 1QBAA 4HCRA 1MFBH 1FL6A 1HCFX 3QAZC 1NCAH 5JMRA 2EH7H 3TPUA 1JHLH 4WTZG 2JJSA 5IM7B 1IZKA 1LO0L 4XT1C 3MV11 4R7DA 1H3PH 3T3MF 1HDMB 3FFCE 4U1GB 5SWZE 3MLXL 3UJIH 3IJSB 1DL7H 2I60H 5DD6A 3IDMA 3RUGB 1H0DA 3PL6B 1JRHL 1A1NB 4Z7QF 1DR9A 3TNNA 3WD5H 1Q9KB 2BNRD 2ATPA 5GRYA 3IKCB 4N90D 1NFDF 4Y5XB 5DC4B 4ZS7H 2WBJB 3WFBH 1YY8B 4R0LA 5A16A 4U6HB 3MV9A 2AV1A 4G8FA 4PBWD 1XAUA 1I7UB 1NKOA 1KTRL 3ZE1E 3FTGB 5HSFA 5LQBL 3QULB 4LHUA 4PJ8B 2CIIB 2LVCA 3P77A 3QIBD 3RZCD 3QIWC 3KXFA 2FCBA 3IB4A 4XMLH 3MNWA 4JDTL 1A21A 2F5BH 5BZDA 5IG7A 2MWCA 5JXEA 3QUXD 1HNGA 2R1WA 3ZKMD 1YY9C 2HH0L 1LO2H 2P5ED 3E0GA 2NNAA 3BUTA 4MA1C 3K4ZA 3MFFA 3LB6D 2Z92A 4WU7A 3SDDA 4I2XB 1HZHH 3QCTH 4YNYA 3BZEB 3K8KA 1NBVH 1RQ5A 3NCYP 1PX4A 2W0FB 2Y36H 3VRIA 4DEPC 4ZO6A 3N9GL 2GK0A 1IGIH 1CFSA 2EYRA 4HBCL 4MQTB 5CUSL 1F5WA 4UIMA 1HHJB 1XGUB 4AEIH 1MF2L 2VR4A 1IAIH 3GM0A 1KJ2L 1AJ7H 1J0YA 1JWMB 4M3KB 3EJJX 4JFQA 4YJZL 5I18H 3QT2A 4FQXA 4X6CB 2VOTA 4Q97A 3TCLA 3TBTA 4IEFB 4Y4HA 1OAYL 4Z77B 3MRKA 3B5GA 4H25B 3QDGB 3K46A 4BFIA 5DD3H 4CU7A 4PRDB 5I74B 5C2BH 4M7JL 4YC2B 2HT4D 1LQSR 3PF2A 4OTXH 3WHE0 3LKPA 2J6EL 4OCSL 2AI0H 1W0WB 2LU7A 4TRPL 4K3DL 1KC5L 1CDCA 4EIGB 1WSST 3FN0L 1CF8H 3O0RH 2WINA 2EC9T 3WUZA 4Y7MA 1HXYB 4FFZH 5KJRL 1MCWW 3DETC 4YBLC 5EULV 1IGJA 2QSCH 4UZGA 3UBXB 4OZFG 3VFGL 2YXMA 3L1OH 4ODWB 4E41B 4H1LH 3AMKA 2DBLL 2ZOLA 3T2OA 3H7LA 1JPSL 1JNNL 5CINH 5I73C 1ND0A 1HWGB 3I02A 2HMIC 3S3PA 3NIGF 4YGVB 1K2DB 4BELD 3C2SA 4LCYA 3VXMA 4JKPH 1KIQB 2CKBL 1HYSC 4JG0L 4Q6YA 1LEGB 4QRSA 2OL3H 4I5BA 4KWUA 5SX5K 1R3JB 4F7TB 1KPVA 5D7KE 3HZKA 1HH6A 3H9YA 1Q9LA 4OLVH 5E0QA 5J6HA 1NEZB 2JK5B 1WAAA 1GHFH 1MNUL 1QSFD 4HC1A 4O51A 4J12A 3ZE2F 2WIIB 3TZVA 4JFED 3SE8L 1R5IA 2NY4D 3VFMA 4ZUSB 1A47A 2BX5A 4NQXA 2VDKL 4U1MB 1SJHA 3QO0A 1NMAL 2CRMA 4AIZA 2OQJB 4OKVB 5J6GB 1NMBL 1A8JH 1BBDL 1BF2A 2XXCB 2HRPH 3REVA 1IGFL 1CK0L 4K9EH 2EYTB 4KMQA 1DQQA 3ZSSA 2YD2A 2APVA 1OTTD 5IQ7L 2CK0L 2J88H 4X6EA 3RIFK 1A1MA 3OV6A 3T4AA 3ULVC 1GGTA 3O2VH 4DVBB 4I48A 4TQEH 5DMKA 4JRXE 4KK8C 1FO0A 1L7IL 1V3KA 3I6LE 1T3FA 4P3DA 3EBAA 1IEAB 4Y4KD 3VXOA 5E6ZA 3CVHA 4OUUA 1ZS8B 3T1WA 3WBDA 2AEPH 5DTFB 4M5YH 3DV4A 5IW6A 1V5JA 3RTQC 2J8UA 2NYYC 2UY6A 1RUPH 1V7ML 4PB9H 3DROB 3MRNB 5CZXC 3VMOA 4LSRL 4PJ9D 4HD9A 4O02H 3ULUL 4P9HC 4ZNEE 4GFTB 4ZXBC 1EGJA 4G6JH 2DJUA 3PDGA 1KN4L 5MERA 2OZ4L 1TFHA 3LRHA 3EO1B 2OBGA 5CJ8A 2X5PA 1AQDB 2APXA 5T1MA 5TF1L 3PJSB 3HCVA 3HRZB 5KSBE 4P4KB 1IC5H 5IROC 1Z9OA 4IRSB 5BO1L 3GMQB 4ESKA 4AG4L 4G5ZH 4RBPK 4OI7A 5E8PB 3IRPX 1AGDA 3EDDA 4TUKL 5TQ2L 3MMEB 1U92B 1KPRA 1K4CA 4XPHL 1A3LH 3P2TA 1IL1A 2VDMH 3LEYH 3T2QA 4OZIF 3T0AA 1P5UA 3FT3A 4KTDL 4OGXL 3KPNA 4NQCD 1R5WB 3C5JB 4ELMA 4L3EA 4PV8B 2BVQA 1JYVA 3WFDL 2NXYD 3U0TA 3E1F1 1R24A 4F7EA 4Y1AD 4KJQD 2I24N 4Y2DB 4R7NB 5D7JD 4FOMA 5D7LB 1EFXB 1F42A 2KQMA 4JE4B 3RQ3A 5LGJA 2HJFB 2FO4B 2ATKA 4ZDHA 5J57B 3NN8B 5DUPH 4HIEA 4U1JA 4KK6D 4YEEA 3P0VH 3CZFB 1HQ4A 3UPRA 5HD8C 1UYWH 3F7YA 3L3JB 3RVVC 3RP1A 4HWBA 5FKAB 1NLDH 1OAUL 5I8OH 1WC7A 3V5HB 1FSKB 4G6KL 5F7EH 3P0GB 2E7CA 3F58L 1LWRA 3OQ3B 5ICYA 2EE9A 2EEDA 2YD8A 2D2OA 2VLRD 4ZQKA 4X6BB 2GT9B 2YPLA 3C5ZD 1G9MH 5CIPB 4MJ6B 4P9ML 4W6YB 4H88H 4IOIA 2ZPKH 4MJIE 3D3VD 3FO2B 4MXVE 2ZUQB 1FRGH 4HPYH 1G6VK 3L3KB 2VZTA 3QXDB 3O3DA 4NDMA 5KANI 1Q9OA 3VFSB 1CL7L 3DMMD 4YHYC 2K9UA 4X9GA 1UB6A 5KSAB 5HHVL 1H5BB 3MRMA 1Q0YL 3P30H 3NA9L 2O5XH 5C0CA 3OHXA 1X5AA 3B9KC 1TETL 1YNKH 3PGFL 2VE6A 1RJYB 4BSWA 2OYPA 5MHSE 5EO9A 2VUYA 3NFSH 3SO5A 3NCFB 4RFEB 2IADB 4S1SL 2AJVH 4P49A 4QRRB 4MA8H 1G0YR 4NZTH 1QLFB 5C70A 1FNFA 4G7YL 1RK0B 2JIXA 1LMKA 5LG1A 2VXTL 3GNML 4ERSH 1ZK9A 4NQDB 1FYTD 1TLKA 3KPLB 3P73A 4EI6A 3QCVH 4WTXA 5K9OB 4JFEA 1Q9WA 4U2ZA 3VH8A 1F8TH 1ZLVH 1SM3L 3VFTB 1AD0B 1WEJH 5DUML 1A9BA 1FVEA 1EDQA 1ZXQA 4JDZB 5HGHA 1XF4B 4OM0L 1LVEA 2AAVA 4LQFL 4LGSB 5EORH 3MYZA 4XNXH 5IHZB 5F7NC 3KS0H 2BSSB 2AXHA 3O2DA 2IC2A 5CSGA 2Q86A 3CK0H 1A6ZB 1RZKC 25C8H 4NZRH 3ARTA 5I1CL 3QFJE 1JK8B 3OXSA 3MJ9H 3CFJB 5DRNA 4JFZH 4L8CA 5D7IA 4RAHA 5JHDA 1ZSDB 3STLB 4M03A 5C0RL 2WQRA 1QVOB 1H8SA 5DMIH 5HYJA 1JPFA 2F19H 4QRPE 3U7WL 5J0BA 1I1RA 4X99A 4LOUC 4NGHL 2AK4D 3HUJA 4M3JA 4F2MA 5LWYL 3R06A 4XP9L 3B2UC 4NQTA 1DSFH 3AROA 3OL2A 3V9FA 1NAML 3GRWA 3OGCB 3P11H 2CDGB 4P0DA 4ETQA 4CN6A 2OI9C 2FB4H 1OM3L 1M7IB 5EUOA 3GKZA 5GJTL 4S1RL 5T3XH 1X44A 4O2FA 2BVTA 1WFNA 3MREA 4NKMA 5DJCA 1OAXL 1UZ6F 2DQTH 3BGAA 3MJGX 1EZVY 3ULVE 1FGNH 4KUCD 5ACMA 2JKXA 3MACL 3RA7L 1FQ9C 2CLVB 3T77A 2R4RH 2WWMD 4XVSH 1ZLWH 5EH1A 2C1PA 3K2UL 4HJGA 4KRPB 2VLKD 1MCNA 4Z7UA 1I1FB 2UVEA 5CHNA 3RY6C 3MC0A 5CEXB 1QR1A 3D39B 5L2KE 2Q3AA 5I1LB 4GRMA 4XVUC 5EOTA 3STBA 3N1QC 3MNZA 4LCUB 4U1NB 3TO4D 2UV3A 2ENYA 4PLKD 1PKQA 4MX7A 4MVBD 4X5WA 1BEYL 1RZ7L 5ID1A 3PE9A 3D85B 3ARPA 2E9WA 2CDFB 4LPUA 4OCRH 3AGVA 1WTGT 4Y16C 2JCCE 1PQZA 4LLUB 4P2QB 4D9RD 2I26N 2E7LC 3FN3A 2ADGA 3IXAB 4IDLA 2VLMD 3G5XA 4ODVH 2VZSA 1ED3B 3ULVL 4TTGA 3P4OA 3C6LD 3EYUH 3NZ8A 4U49A 4N5UA 5EU5B 4U4BA 4MD0A 1FZOB 5HHMD 5I30L 1R3IL 3RWFA 5JW4N 2XZCL 4X9HA 4AQOA 1AI1H 5I66A 5FCUH 3LQAH 2ZCLL 1VDGA 3VGDA 5GSVB 5C0BD 5D2LE 3EYQD 4G6AC 1DQLL 2IBZX 3OKEA 2PO6B 1PLGH 1CGYA 1JWSA 3LS4L 4F33B 4WI5A 4FFWD 5E9DB 4F9PA 4QOKE 5CAYB 2LTQC 3OG4B 4Y5YA 4NHCL 4LVOC 4R3SB 2WWKT 4P9HL 1DZBA 4LBEB 2BOCA 4JFDB 1RIVL 2W59A 1HHIA 4J4PC 4M02A 4LLYA 5DA0B 3NMEA 5JNYA 5GS3A 5HHPA 4CVUA 5H35A 1V3LA 1IILE 3QI9B 2ZUWA 2X89A 4NJAL 3OF6D 5C8JB 2VYRE 2EDXA 3DI2B 2M1KA 3DMMA 1KUMA 4RCAA 4PTUA 2Z8SA 4PGBB 1JZ5A 1FBIL 3FJTA 5A40E 1P7QD 3X3FH 3QNXA 4JG1L 2NY7L 3L95A 4OZHF 1LD9B 1CFNA 3MCKB 3VW3L 3QISA 4GRWE 5CSZB 3ZT5A 2MCPL 1JN6B 2AS5M 3M17A 1NKRA 4HUUB 5HDOA 4ODUA 1QFWI 1T7ZA 2YRLA 3KLAA 3VDAA 5DEFB 1NBYA 3PWJB 3BN9C 3KPSB 3OZ9H 4OCYH 4GXVH 4QYOA 4ELKA 4ZUWA 1G6RB 4NM4H 4BH8B 4KKAD 1QG3A 1NUFA 3SDXE 2HT2C 3UO1L 3EO9L 4LHUG 1CXEA 1JZ8A 5BMFH 4Z7VE 2IH3A 2EDNA 5K93A 4K07A 3RL2A 3W0WE 1BZ9A 3GDBA 4GKSA 4GBXD 1QBLH 2HT3C 5ETUA 5CWSB 4Z78A 4UUJB 5IV2A 1T21B 1MUJA 4UT6H 1T6VN 3S96B 1XF5A 4XNQA 3VRJB 4OCMC 2X1XR 1JYWA 1X9QA 4ISVB 4IRJA 3WN5B 2BNQA 1S78C 1VFBB 3K3QA 1FDLH 3QHFL 2YPKA 3AM8C 4FZ8L 3O41B 2Z35B 1F58L 1W0VA 1AXSA 3UXFA 2NY6C 4JPWH 4KQ3L 4P2CG 1OD7A 2VXSL 1KELH 1NBQA 1AR1C 5D1ZD 1CICC 1AQKL 1XGRB 5KAQF 2B0SL 5DGRA 3FO0L 4JAMB 3O3UN 5I1EH 3NCEB 1ZA3A 4ZAKD 3CIQA 3JTTA 5FUOH 3HNTL 1PSKL 4DZBA 3HE7C 4MNHB 2FGWL 5T1DL 2ADJB 5K33A 4YGAB 1MCBA 2B2XH 2FLRT 3CFCL 3GK8H 3GSUA 3ULSA 1MCJA 1HEZA 2P46B 4OZ4A 5IEHB 4RDQF 3WNLA 5IQ9B 5DC0A 4W81A 4NO0D 3ARGD 5JXAL 1ZLSL 3RAJH 4MWFA 3W2DH 1QKZH 5L88L 3H3BC 4QTIL 5GRUL 4OF6A 1IE5A 1E27A 1AD9A 2F8VA 4BK4A 3DO7B 2AJUL 4UINH 1RU9H 5C0ND 2ESVA 4XPAH 4HMCA 2FSEB 4IIQC 4AEFA 3P3YA 5C07A 3FQXB 3ECBB 3U82B 1M71A 3H42H 1A64A 3IETA 5DI8B 3UX9B 4LIQE 5K9QI 1OW0C 3E6HA 1D6EB 1PAMA 1Q0XL 4LDLB 1OAKH 1EFQA 2OP4H 3ARDB 1ZGLA 2XWTB 4NRYA 3I2CH 3ETBF 3LKOA 4PJGB 3IGAA 3CU7A 3GSQA 5I19H 4HIHA 2E8ZA 8FABB 1D3CA 3TT1L 2JB6B 3SE9L 1FAIH 3W11D 5KS9A 1ZGLM 4G9FE 4DKEH 1RZKL 3O8XA 4LCWE 4PY8J 4GW4A 1XR8A 5I71C 1YEDB 5IVXE 2OJEA 3F7QA 3NIDF 5DJ8B 4OAWB 4JPKL 5T3XD 4J3WA 4OUOA 3SE4C 3SDYL 3CC5B 2H9GB 3G6JB 5FDYA 3T0VA 3QEQD 4P5TC 1MH5B 5E94A 3KPRD 2XN9B 1BOGB 3FQTA 4FXGB 4G43B 1TZGL 3OR6A 2HVJA 4YQXH 2H1PL 2A1WH 3TWCH 3QNYA 2BHYA 4UU9A 1FV1B 4LVEA 3WO4C 4LIQL 3V8OA 1AKJA 2EDLA 5I16A 3I9GH 4KPHL 5CBAA 3DRTA 4L4VE 4AYFA 3WIHH 5TDPB 1T04B 1YNTA 4PJEF 4YFLF 1J1PL 5D9SB 3ROOA 4Y19B 4GSDH 4F15B 1YPZF 3BPCB 5F9JA 1DEDA 5SX4I 2PXYC 2Y5TB 2QADD 1U8KB 3EFDL 3D25B 2M2DA 3BQUD 4PJXE 4IOFC 4E5XA 3AS1A 2XQYK 1M7DB 4WU5A 5E4EB 1A22B 3DOSA 3DYPA 1D6VH 3QXAB 5FM4A 4U1IA 3HN3A 2DLTA 2AW2A 4PJFF 5FGRA 5IHUL 4M1GH 5TGBB 4JEGB 3L6FA 3BKCL 1LE9B 2V2TB 5KOVC 2NY2C 4GAJL 3WJLA 3UTTE 4ETYA 1KCKA 1EVUA 1ZT1A 3LKRB 3T8XB 1C08B 1TZIA 1FG2A 2Q6WA 2LVEA 4G6FD 3PIQA 1QO3A 3C60C 3IF1A 2I25N 2ZUUA 4FS0A 1UM4L 3ZYZA 5DK2B 4UTAL 4TVPE 5HYQB 3NTCL 4L8SA 4YFDB 3MLRH 1F4WL 5ALBL 2P8MA 1IT9L 1ZLUH 3PP4L 2D7TH 1U58A 3BT2H 4PRPB 5ECJE 3MRHB 1I1YA 4XP1L 2R29L 1CE6A 3G6AB 4WV1A 1VFAA 4X7DC 4KTEL 4Z7WE 4JO4L 4P4RB 1OPGL 4UV7H 4DKAA 4HX1B 4WUKH 3B8SA 1JNHB 5DJZA 2XWBA 3PHQB 3BFOA 3QWOB 4JQVC 4NO3B 3VFWA 4G6ML 4OJFH 2APBA 1JVKA 4U1LB 1KNOA 2O26U 2AEIT 4NSKB 4XMKH 4DN3L 1U8PB 3MZGB 5IT2L 3LN5B 5JHLH 4XCCL 5KW9H 3SY0B 4JO2H 3EFFA 2NPLX 3U79A 4HK3J 3F7VA 2HFFA 2VXQH 3QDJB 3BP6B 4PR5A 3V4UL 3RUGF 4R4BA 2AK1H 2OJZL 4ZODA 4PJBF 3MRLB 3HB3D 3KYKL 5FO7B 5GIRA 4JVPA 4HBQA 3BH8B 2YA1A 4ZAKA 1D5XA 1GZQA 4TVPL 5ISZD 1R0AL 4U1KA 5IVZA 4TULL 3EAKA 3SQOH 5CMAB 1XFPA 2LAAA 3AB0B 4EN3B 3OGOE 43CAB 5BS0D 1S9WA 4BQBA 4XNMB 5MENB 1UH4A 2NX5D 2Q76A 1II4E 4KQ4L 2JJSC 1HH9A 1NMCC 2VXVL 3UAJD 3Q5OA 1EO8H 2W91A 5C3LD 4S10A 1U8JB 2NY0D 3MRPB 4LLQA 3GI8L 4M61A 5SWSE 1BWMA 3CFBB 3UBXI 3DXAA 1UXWB 4QWWC 3DYOA 1OAZL 1DVFB 1LO0H 1MOEA 4Z0XA 3VD3A 1UVQA 2HN7A 1S9KC 1HSBB 5KVEH 1RJZB 5CILH 3STZA 4QO1A 2EXWD 5FGSA 3MJ6A 4QCIA 4R0LC 1KIPB 2NQCA 3MLXH 3LKSB 2X4TA 4P2YA 1SY6H 4XWOC 1GZPB 3WS6A 5SX4H 2UY7A 1XH3B 4LPXA 2XNAA 1OY3B 5BRZE 3U2SA 3X3GL 4NOFA 4NQED 4ONHB 2OTWA 3QUML 1U3HD 1A5FL 3IFOB 2J3SA 5IFAH 5BVPL 1RUQL 2VABA 5JXEC 4X6CF 2MQ0A 5FKPB 3VGAB 2BXZA 3I50L 3RZWA 3BKJL 5LQBH 4Z76A 2CPCA 1BFTA 2FD6H 5FDWA 1JTTA 5J1AA 5T5NF 3VFUA 4JFHD 1P4BL 3SDDC 4HJ0C 2XA8L 1HWHB 3JWNC 4KROC 1DUZA 1KYOK 4P48A 3T65A 4KC3B 3RGVB 5IBLC 3BYYA 3KYMB 1B6DA 1MY5A 4XTRD 3KPRA 1S5IL 2HH0H 5HYSB 4HDIB 3FQRA 4LRNH 4PGCA 4ODXA 5F9OH 4J2XA 5F7UA 4OIAA 5DA4A 3KDMA 1HSAA 3N9GH 4APQD 3ARFA 2ZUSA 4FQXC 4GRLA 1EUTA 5CUSH 3VXSA 4Y4HC 3CSBA 2QHRL 4RWHA 1MF2H 4P2RE 5IB4A 3QIUB 3G08A 1A7BA 2Z4QB 5EA0H 1T20B 3SDAB 2QQLL 3N1GC 2VR9A 3T3PE 5FO9B 3HC3H 3GSWA 4OQTA 4V2BA 1JV5A 1A7QL 1HHGA 1OWRM 5AD0A 4FQCH 1BJ1J 4YFEA 5J56B 1UJ3B 1OAYH 3TBVB 2BP3A 2GTWB 4L29A 4N68A 5GHWL 4L9DA 1YEHL 4I13B 3LSOB 1I1AB 4M7JH 2RGSA 2J6EH 4PJ7E 5C08E 5KVFL 4KZEL 4WWKD 4E42A 3CZJA 4TRPH 4K3DH 1KC5H 5DMGC 3FN0H 5D1QB 1MHEA 2DQEL 1T1ZA 3RWCA 4HKZB 4I0PB 5AG9A 5KJRH 2PYEB 3FB6A 1RJLB 2WBKA 4X7FC 4WFGD 1ZWIA 2DBLH 1JPSH 5CGYD 3VCLB 4X6FB 5SWQB 1BPVA 4ZFGH 1D9KD 2CSPA 1LDSA 3BPNC 1MI5B 2CKBH 1OTSC 1NGYB 4JG0H 3KJ6L 4EJ1C 1ZVYA 3TZVC 1U0QA 4UILL 5EOCL 3L3IB 1CDBA 1TTUA 4MNGA 4WI6A 1R3LA 3C08H 3O4LB 4P46B 4DOHE 3RWDA 2VWEC 3TNMB 4KVCL 1MNUH 4NKOA 2P24B 1B0GA 2H2PC 1M6OA 1EJOL 1RV6X 3SE8H 3VDCA 1L0YA 3ROLB 3TCXA 3FMGL 3W9EB 2DTSA 3NABH 2BFVL 1QSED 2BJML 4RAVA 1KACB 2VDKH 3O2WL 1NMAH 3TT3L 3HS0B 5ISZA 3IAPA 1MAML 1KJ2B 1NMBH 1BBDH 3JVGA 1S9VA 4PY8I 5AYUH 1WWBX 4L8BA 3KG5A 1IGFH 1CK0H 5TDOB 3VXTA 3TN0D 3GSVB 1KCRL 4WHTA 5KG9B 4GMSH 1JF5A 1NCTA 3HNVL 3DTXB 5IQ7H 1LDPL 4U6XA 3ARRA 4CKVX 3C09C 3S37L 5C0DA 3TV3H 1OLZA 2BCKB 2CQVA 3BWAB 4GG6B 1BQHA 3RDTB 1RULL 2VL5B 4GG8A 3MJ8A 1FNSL 1L7IH 5JLZA 3FB7A 2X4NA 1RIUH 3LZFL 2M26A 1G7QA 4RISL 1WIOA 3IDIA 4ZOAA 4NQVA 3MBEA 4JFFD 4EDXB 4NZDA 3WXVH 3V79C 4HGWB 4RWYH 2FBJL 4CW1A 1V7MH 2HLFD 2NXZC 4G9DA 1M05A 4LSRH 4DUVA 1IZJA 4F37K 1JZ4A 4RGNB 4TNVK 1P4LB 4PJ5D 4OCXL 1T80A 3HI6H 3BP4B 4J3XA 5DVMA 5DF0A 3SKMB 4EUPA 2JELL 3IYLW 5C0AB 5I0DA 4YHPB 4AM0A 5I1JL 5IIEB 1I9JL 2BNUA 4L9LA 4Q9CA 2HKFL 2OZ4H 2UZYB 2Y06H 2ZJSL 3L3HA 3QUKB 3LH2H 2YUWA 3OXRA 1WZ1L 4HJJH 3X11B 2P5WB 3K81A 3VJ6B 1QQDA 4YDVB 1U3HA 3S36X 3DHMA 5TF1H 2V5TA 2YUVA 5A2KH 3TBWB 2QSQA 4NM8L 1BIIB 3S34L 1CS6A 4RSVA 4AENB 3JZ7A 4AG4H 4JZOB 1CXFA 3GSNL 3MGTA 3UCRA 4POZD 5E56A 4L5FL 5DR5L 5TQ2H 1KJVB 4MSWA 3GIZL 1Z2KA 3ARUA 4XPHH 3CCHA 4O2CA 1T1WB 2E27L 2GITB 5E6IA 3OPZL 1IBGL 3WFDH 1JMZA 2ZNWA 4RGMC 3O9WA 1RZJC 3MV9E 4WFFE 1ORSA 4TOYH 3QQ4B 4M7LH 4KJYA 4MNQA 5E8NB 1FVDB 2BVPA 3QEUB 3V7MA 4H1LG 3U4BH 5BVJB 3HZVB 4IRZL 1PDKA 2AKRB 3UTPD 5ITFB 4NOBA 1U2CA 3KXFE 4DGIL 4HCRL 1TCRA 4KRLB 4APQA 3EDJA 4N0RA 4P99A 4QHUB 1L7TL 3QRFM 4UBDC 3LPFA 1BVKB 3L9RA 4XHJD 5C0GB 4ZSOB 1G7MB 1OAUH 5DSCB 2X70B 5EN2A 1KF9B 4HGKC 2QQNL 4EKXA 1IQDB 5B38A 4C83A 3OJMB 3JV5A 4XPFH 2DQCL 1X5FA 1ZVSB 3F58H 4PBXA 2NY3B 4MXWL 4K8RH 2ADIA 1IKFL 1JTPA 2B4CL 2FEDC 3TJEL 4HT1L 2GTZB 2FJGA 4X4ZA 3CUPB 3DX9B 1INEL 4P9MH 5FCSH 3WL9A 5IFHL 1T5WB 5IOPA 4PIRF 2YEZA 4A6YA 1U95A 2B5IC 4AEHL 1CFVH 3WXWL 1AO7A 3IJHA 4PJCE 2AV7B 4PV9A 4ZUVB 1CL7H 3FFCD 2X05A 5SWZD 4HS3B 4C56B 2CGRL 3SDCB 2CRYA 5HHVH 2VDQL 1O7VA 1Q0YH 2YD1A 2X41A 5IB2B 3MNVB 4JRXB 3LRGA 2BOBA 4GO6B 3PGFH 1J86A 2D0GA 4NNXB 4XBPA 3U46B 4AEEA 3HPLA 4QRUA 2C3XA 4AIXA 4FQ1L 5IF0B 3EUUA 1AY1H 5JW3L 2ZSVB 4HS8H 2CKNA 3FB5B 3CDGB 4S1SH 3E3QC 1XGPB 2HFGH 3HRPA 4FFVD 4LLWA 1NAKL 4HS6B 3PWUA 4YR6A 5FYKE 4U31A 3MO1B 5E2WH 4G7YH 4P3WA 2VXTH 5JPMB 3GNMH 3BDXA 2PYFB 5KN5B 5LBSH 2E7HA 4LMQI 4UTBL 3RVXC 1CLZH 3SOBL 5MEQB 1JPGA 4FQHA 1JNLL 4JM2B 1JYXA 5D4QA 5KSUB 1BF8A 3WIFB 4NZJA 3VXME 1SM3H 3BP7A 4OF7A 1TIUA 5DUMH 5EOQH 3PWPB 1SEBA 1E28A 3FCTB 1I7TA 3LEXB 1ITBB 5DJ6B 4Z7OE 4OM0H 4QGYA 3MV8A 3WCYA 3SKOB 4LQFH 3AREB 4QHKJ 4U6VH 4HIIA 3S35X 1IJ9A 2R9HD 4MS8D 2CJUH 1WAAE 3CSGA 1AP2A 1HILB 5C7XL 4KY1L 4OF8A 5I2IB 1XF2B 1OARL 1T5XA 5IMLA 1OQXA 2DQHL 1AC0A 4N0CC 1XGTB 3BP5B 5FYKL 2YR3A 3FT2B 3V2AR 2HJKA 3CPLA 1LEIA 4GW5B 5C0RH 4RMSA 1IAKA 3S4SA 2VWEE 2A0LC 4D0CA 2BMKA 3DNKA 2DOCA 1PD6A 5F1NA 2HA1A 3U7WH 1PFCA 4NGHH 4JN2A 4X4MA 4PRAB 2H32A 3E2HB 3WNMA 1U8MA 5LWYH 4HWEH 4XP9H 3DX7A 1Y18B 1KB5B 4PJEA 4TVSa 3P9LA 1NAMH 1TDQA 1RURL 4TTDD 1D5MB 4S1RH 1S7WB 1UWGL 1F3DH 3L5JA 3H2WA 1OAXH 4WJ5B 1PYWB 2J8UE 4HC1L 4LRIA 1TVDA 3RA7H 2P7TA 4J3VA 2DICA 4WDIB 5C0JB 4K7PL 1VCAA 4Z6AT 3MROB 3FOLB 1G7LA 4FQ2L 2IMNA 4WI7A 2DWDB 3IFLL 1BZ7A 1WZMA 4KJQC 4NN6B 5FO8B 4I18B 3S5LG 5JPNA 1H15B 3ZL4L 1FE8L 5DHVH 1OTUD 4ONGL 5F9WC 4P2OD 3MUZ1 4GAGL 4N8VB 4N90E 5TDNA 2O5YL 2X1WL 4KK6C 3HA0A 1BEYH 1KN2L 3HAEB 1P7HL 1WGOA 2C3GA 4JANB 3SCMB 4HHAB 2P48B 5KVDL 2C26A 3K80A 1GOHA 4S2SB 3SQBA 3CVHL 4X8XA 2OK0H 4M48H 1G7JA 2DRUA 1N4XL 1F02I 1EEZB 3ULVH 4OBSA 2G9HB 4F9PC 5IM7A 1MRCL 4L3EE 3RWIB 5A43C 2YPVL 3QEHB 4Y5YC 4KUZL 3DV6B 5I30H 1R3IH 2Y1VA 2XZCH 1P4IL 4WUUB 4XRCB 2ZCLH 3GJEB 3MRBB 1MAKA 5EZLB 4WHYG 1DQLH 1HDMA 1OGAD 4OV6F 4D0DB 1RJCA 3IJSA 3P9MB 3I6LD 3RUGA 1T89A 3A67L 3PL6A 4WW2F 1A1NA 4S1DD 4NHCH 5EDXA 3LAFA 1E6OL 3DMMC 1Q9KA 4P9HH 5SX5H 2XY1A 1BJ8A 3Q6FB 3IKCA 1RIVH 5D71H 3T1FB 4Y5XA 4BFGA 2F54D 2WBJA 4UT7L 1YY8A 4JDVB 6CGTA 5IMMB 5I73B 2X9XA 1RZGB 4XH2B 2R4SL 1LO3L 4HH8A 5DFVD 4HKBB 4U6HA 1RY7B 1NH6A 3FTGA 4NJAH 3QULA 1QOKA 4PJ8A 2CIIA 4O4YL 3ARBB 4WI2A 4NIKB 2CO7B 5C0IB 1FBIH 2CLRB 1CLOL 1NCCH 3J7HA 4Y2OA 1TPXB 5FM5O 2YPLE 5IR1B 1CGUA 2EZ0D 4NKIL 3VW3H 3GJFB 2D9CA 2IWGA 5CEYB 1BD2B 1W72L 4I2XA 2CR3A 1G0XA 3PWNB 3BZEA 4ZFOL 4PS4L 4B7LA 1TVBB 2W0FA 5ESAB 1N8ZB 2E5EA 3V0VB 2NTSP 3NFNB 4K8RD 5C0CE 1RZJL 2WZPD 4PJHF 5E8DL 1RHHB 1JL8A 3IRZA 3UO1H 4MGXA 1HHJA 1QLEL 1XGUA 5ESQB 2EDKA 4IRJC 3VFRB 1JWMA 2VITB 4B41A 4DZ8B 2IAMB 3VI3F 1WZLA 4X6CA 5T5FH 1LK3L 4PJIB 4Z77A 2HLAB 5IB3B 3BKYL 5HDQL 4H25A 3DSNA 3QDGA 1LGVA 4WCYL 1XIWB 4PRDA 4R2GC 1U3YA 4GRWH 3WKML 4JFEE 5ITBL 4V1DB 1W0WA 4FZ8H 5F6IC 5LKNA 1F58H 1IAOB 4KQ3H 2VXSH 1G0DA 1HXYA 2VR5A 4E0RB 1KENH 3GMPB 1AQKH 1KB9J 4ZXBB 2B0SH 3CXDL 3UBXA 5LJYH 5KANG 4NPYB 3FO0H 4RBPH 4ODWA 5EIVA 5DURD 2EXYC 4U0RC 1JGVL 4E41A 5DD0L 1PG7L 2HYMA 3LPGA 4TSBL 1YY9D 3HNTH 2X4QB 1PSKH 2MJWA 5GRWA 4N0YH 1VGKB 3U1SL 2FGWH 4YGVA 1K2DA 5T1DH 4W6XB 1KIQA 1FZMB 1MHPH 2IGFL 1K8DB 5D7IE 3HMXA 4MJID 3CFCH 4C4KT 5JHDE 4K9EC 1LEGA 5EBMB 1R3JA 4F7TA 5HHXL 2NLJB 1S3KL 3ZDYE 4MDIB 5GPRA 2VNCA 5HYJE 1T22B 5JXAH 3ARYA 4NQDD 4QTIH 1NEZA 2JK5A 4RMUA 4OCWL 5JDJA 4YK4B 2V5MA 2WIIA 4JFYB 3B9VA 4XNYH 4DGYH 1DBML 4PLKC 2RB8A 4Z7NF 4M9PA 4ZUSA 4U1MA 1MJ7L 5HYIA 3G5VB 2OQJA 2WQ8A 5LCVL 5EUOE 3ELAT 4OKVA 5J6GA 5DEGB 4D9QD 3OB8A 3O2DL 2EYTA 2NR6C 3FAXA 3O8XC 3WLWC 3RVUC 5ICZB 4LSVL 2X2YA 3U36B 1M1SA 3DETD 5I6XC 4DVBA 3CH1B 4M6OL 4JZJB 1EZVX 4Z7UE 1IEAA 3SE9H 1ZS8A 1CGSL 1RZKH 5DTFA 2P8PB 4OLZL 2HMID 1MAJA 5JW4Q 4JPKH 3SDYH 4JB9L 1CBVL 1PKQE 3DROA 3MRNA 4NCC1 1DBKL 1HYSD 4EBQL 1T7VA 1DE4B 4BZYA 1KOAA 3QFJD 4HQQL 5IESH 4CBPA 2VKWA 1KTLB 3BISA 3GRWL 4KZDL 1YMHB 3QWRA 1MFCL 1KIRB 3DVIA 3W5NA 3V7AG 1W2KT 2KDGA 3EO1A 4LIQH 1JF1B 1NC2B 4KPHH 3TESA 1AQDA 4QHKI 4QRPD 3VWJB 1H3UA 4MMZC 4N1HB 4OZFH 3PJSA 1OP5K 3HRZA 3N1PC 4P4KA 5I1KL 1J1PH 4IRSA 4K7FB 2AGJL 4UDUB 3GMQA 1NLBL 5E8PA 1PG7W 3MMEA 1U92A 2DWEB 1N0XL 3WJLC 2H41A 5GRJH 2OTUB 1R5WA 3C5JA 2DQGH 4PV8A 3ULVD 5H2BB 3RWEB 5ENWB 4KKAC 4KK8D 4L8SC 5BZWB 1SJEB 2VO5A 5EZJB 5I8EB 2EIZB 4MQ7B 4GAJH 4R7NA 1H3PL 5D7LA 1EFXA 2HJFA 2FO4A 1Q72L 2ZP0T 1I9EA 3RTQD 3NN8A 2NYYD 1UM4H 4WV1C 2X9WA 2O93L 5GS0C 3L7EB 5E03A 5L2KD 1J0HA 3CZFA 3NTCH 2CLZB 3MRDB 5ALBH 3L3JA 1IT9H 3PP4H 2X7LB 1F2QA 3JWDC 5FKAA 2R2HB 1AC6A 5J13B 1UT9A 3C6SA 4XP1H 2R29H 3NGBC 3V5HA 1FC1A 1FG9C 4JHAL 4JO4H 3LRSB 2PF6A 1RIHL 1LEKA 3SO3C 4G6MH 1A2YB 2I5YL 3T0ED 4X6BA 1FYTE 4N0UB 2GT9A 3QUYB 1CD1B 5CIPA 4MJ6A 4ZAKC 1WTLA 4XCCH 4ENEC 4ODBD 1MFNA 4FABL 5HVFB 4R97B 3FO2A 4YDLC 3V4UH 2ICES 5F6HI 3L3KA 3I75B 3U48A 2OJZH 3N1MC 3QXDA 1NCBH 1S7TB 4LSPL 1QRNB 3VFSA 1VADB 1NBVL 3KYKH 4WWID 5IJKA 5KSAA 1YDPB 2Y36L 1H5BA 3K4DA 5CSBA 4TVPH 3RWGB 3U7YL 1R0AH 1RZ8B 4MAYB 4TULH 4JJHA 1RJYA 2BNQE 3HE6B 5C9KA 1IGTB 2OSLB 1QUNA 4QRQB 4RFEA 2IADA 4KQ4H 3MTRA 1HYRC 3GBLA 4QRRA 1NFDB 5CKAA 3UROR 1QLFA 2PW2B 1OSPH 1RK0A 3QQNA 4NQDA 1T2QH 1X5ZA 3RVVD 3GI8H 3KPLA 3O4OB 3FZUD 2AK4E 4QY8B 5K9OA 3WS6C 4LGPB 1F13A 1OAZH 5T1KD 4HWZB 3VFTA 1AD0A 3ZE0F 4IBLT 2V17L 1KEGH 5IVOA 1WF5A 4JDZA 1XF4A 4XNZB 1INQB 3BW9B 3IDYB 4RX4A 3PQYB 3I6GB 3SKNB 4LF3B 2B1HL 3L3OB 5IHZA 2BSSA 1DQJB 3X3GH 1Y0LB 1FFOB 1A9EB 4Q9QL 1A5FH 1A6ZA 5BVPH 1RUQH 1ZT7B 3HTLX 4YDJB 4DQOL 1JK8A 3MRCB 3HLAB 3CFJA 3W0WD 1UZ8B 1ZSDA 3STLA 3JUZA 1IC4H 3BPLB 4LLMB 2GAZB 4QEGA 2OL3L 3B9KD 5C07E 3LOWA 1QVOA 5EB9A 3PXHA 2R2CA 4RNRB 4IMLB 1P4BH 2XA8H 3CX5J 2HFTA 3EDEA 3ZO0A 1NL0L 5F88B 1S5IH 3ARFC 5F8RC 5IEKB 4GRLC 2ICEB 1LP9F 2UWEB 1BZQK 1F4YL 3MRRB 3QRGL 3NIGE 3OGCA 2CDGA 4Z95H 3KPTA 1M7IA 5KS9E 2D31B 2DJSA 2VLME 3AFLA 1WFUA 4CJ0A 2IMMA 4U05A 3BIKB 4K9EL 3LKQB 5HHME 2QHRH 2CLVA 3PDDA 3S4SG 4G3YL 1O7SA 5GISL 5L8KB 2QQLH 4MAUL 1I3UA 4DCQB 1A0QL 3O2VL 1DN0B 4JCLA 1A7QH 3GBNL 1I1FA 1KEML 4HUXB 5CEXA 3D39A 3FT4B 5GHWH 2FRGP 2AEPL 5I1LA 1YEHH 4HLJA 1MWAB 1I7ZB 4LCUA 4U1NA 1FNHA 2JJUA 5K9QG 2VAAB 1SHMA 4QHNB 5KVFH 4KZEH 2AXJA 1H8OA 2ADFH 1XZ0B 3D85A 4NBXB 3AU1B 1QNZH 4GW1B 2CDFA 3IAQA 3MLUH 2RIKA 2DQEH 5GZOD 3HG1D 3AS2A 4ODTH 3ZE1F 4LLUA 4P2QA 4PGEB 3QUMB 1GH7A 1A7OH 1J18A 3IXAA 2R23B 4LOUD 4OZGB 1ED3A 1I8KB 4LP5A 3EJYC 3GHEL 3V5DB 1EUUA 5EU5A 3B2UD 1FZOA 4A2MA 2WP3T 4MQXC 1IC5L 5CCKL 1Y6MR 4EIZC 2XN9D 2GJZB 5GSVA 5HI4C 1J12A 4M1CC 3EYFB 3ZKNC 1DLHB 1RAMA 3KJ6H 1TNMA 4KXZH 4F33A 2MPAL 4UILH 5E9DA 4JFPB 3CDCA 3NACH 3LEYL 4G9FD 3K0WA 4LCWD 3T0EA 4R3SA 3HB3C 1N59B 4LBEA 4JFDA 5DFWH 3MRFB 5DZLA 1UEYA 4KVCH 1Z9MA 1L6ZA 3R0MA 3RU8H 3JVGC 1OQOA 5ERWB 1EJOH 3OJVC 2GSIB 4M7KH 4X5LA 4BKLB 4JCMA 5C8JA 4GKZB 2ZUYA 2BFVH 3ISWA 3JV0A 2BJMH 4PGBA 4MDJB 4XVUD 3TT3H 2VH5L 2RR3A 1MAMH 2C4FU 1UQSB 3BD5A 1UYWL 1LD9A 4L4VD 3MCKA 1KCRH 5CSZA 4LDOB 3MBEC 1JN6A 5JA8B 3HNVH 2IFGA 3T0DA 1LDPH 1Z0MA 4HUUA 1HIMH 3S37H 1NLDL 1XR9B 2ZOKB 4TUJB 3DJ9A 1RULH 1FNAA 1Q1JL 5T1LB 5DEFA 3PWJA 1F2XK 3KPSA 1QPXA 4DGVH 3LZFH 4RISH 1K5NB 1A7PH 1G6RA 2XRAL 1YNLL 4Y88A 4BH8A 4G8EB 2YN5A 5ESVB 2FBJH 4CDHA 4L9LC 5BV7B 3QDMB 3BZFB 4TYUA 4OZIB 2VLJB 4G6AD 4OQ1A 3SN6N 2AEWA 2ZPKL 1U3HC 3WUWG 4OCXH 1FRGL 3H9HB 4W4OC 1J1OL 5GS0L 4P57B 5MI0C 3UTTD 2JELH 3RFZC 4YX2L 5CWSA 4UUJA 5L8JB 1T21A 2FHBA 2HKFH 3S96A 2ZJSH 3DYMA 3DRQB 1D5ZB 3DVNB 4J4PD 3VRJA 3P30L 1E4KA 4L1HA 3MV7B 4ISVA 2D7OA 4TVPD 3RY5A 3WN5A 3CFKB 2EIDA 4MZ2A 4EEEA 1VFBA 3OR7B 3S88L 1FJ1B 3DXAE 3KHQA 2YZ1A 4NM8H 3O41A 1L6XA 3Q5YA 2Z35A 5E6IC 3S34H 2ERJB 4WEUD 5DRZB 2I07B 3CFEB 4XTRC 4I9WE 4MA8L 2PTUA 3GSNH 5ANMB 3ULUF 1XGRA 5DR5H 1FLTX 3GIZH 4JAMA 3G6DL 3O9WC 5F9DC 1PEWA 5GGTA 4Q74A 3ZT7A 2YRPA 2JJTA 5GS1B 5CGTA 2E27H 3CJJA 3OPZH 4XP4H 5JUEL 1IBGH 4APQC 2ADJA 1K3IA 2R56L 3MUJA 4FQIL 2XIDA 1URLA 4WO4B 1OB1B 1MELA 4I3GA 4C54A 1NCWL 4X98B 2VZVA 2Z31D 3TA3B 2X09A 4IRZH 5IEHA 4LHQB 2VL4A 1J8HB 5IQ9A 2FWOB 1XCTB 3RKDC 2BVOB 4HCRH 4DGIH 5JDSB 3ARSA 3MBXL 5FYJU 5IFJB 1MCPL 1A6TB 1CIUA 3MUY1 2NY1C 25C8L 1ZTXL 3KPRE 3UBXG 3VGFA 4OSUH 5AWNL 4Z9KB 3MJ9L 1EA9C 4JFZL 2UVFA 3DO7A 4IHOB 2QQNH 3V6OA 1EAPB 2DYPB 4BA8A 4JKWA 2KH2B 5INCB 2FSEA 2DQCH 2VDRH 3FQXA 1T1XB 3ECBA 1GYAA 3MCLL 1S78D 5DMIL 1IKFH 3KJ4B 4ZPVB 2JB5L 5DI8A 4N8CL 2FJHB 3FN9A 3TJEH 4X7EC 4HT1H 2A9NL 1NCDL 1D6EA 3VXSE 5SWSD 2NY6D 4XC1H 5IFHH 3UTSB 3ARDA 4OIBA 2XWTA 3PGCB 1AR1D 4TSAL 2DI9A 5KSBF 4PJGA 1CICD 5EBGA 3WXWH 3VXRB 4FTVB 4UOJA 8FABA 2JB6A 4I0CC 2CGRH 3DBXB 2P47B 4CMMB 2VDQH 3O6FB 1YEDA 3HE7D 5DJ8A 1MCFA 4OAWA 3LD8C 4UT9L 4OLUL 2D9QB 3J8F7 3CC5A 2H9GA 3G6JA 4KI5F 2BY3A 5BRZD 3X13B 4FQ1H 4YUEH 5JIPA 5FF6B 1MH5A 3PV7A 2XN9A 1BOGA 3T4YB 4FXGA 3H7BB 3MLYL 4G43A 5E1AB 2IF7A 5I1GH 5FV1L 3QO1B 3NCYS 3GMMB 2EDFA 3MR9B 2GI7A 2EKSB 1FV1A 2PETA 2BSTB 1FLRH 3GB7B 5HYFA 4CMHC 4UTBH 2DM4A 3SOBH 5CLWA 1QLRB 5TDPA 1T04A 5D9SA 5EU6B 3LIZH 1K6QL 1UZ6E 3TVMB 1VEPA 4Y19A 2PTTB 4OQTL 3BPCA 3VG0H 2QQQA 1GL4B 2DLFH 2Y5TA 1KT2B 3EKCA 5HTSA 1U8KA 3D25A 5B3JE 2LU3A 3QCUL 3MCG1 3G04B 4K94C 4RRPG 1INDL 3H9SB 4I4WB 1M7DA 4BK5A 2FX7L 2K7QA 4MNGE 3QPQC 3QXAA 1ORQB 2NMSA 4PYHA 2VN7A 4GLRI 5CJBA 4YWGH 3NOIA 1NGWB 3D2UB 3D18B 4X9BA 4KY1H 5C7XH 1QFUL 5TGBA 1AI1L 4P2RD 1LE9A 2DQHH 2V2TA 1A4KB 3VXNB 4IS6B 4AY0A 5FYKH 4RGOL 3LKRA 3T8XA 1C08A 5DJXB 4JGMA 5BOPA 1I8MB 5KTEH 1CZ8L 2GJ6B 4NCC2 4OFKA 5ISZE 2D0HA 5A3ID 1FL3B 5DK2A 3X14B 1N6UA 5HYQA 4YAQB 5FYLE 4P5TD 5CEZE 3M45A 3V7AE 1IQWL 4PRPA 5C08D 2NX5E 3MRHA 4U33A 1MCQA 2R0WL 1IM9D 4MYWB 3G6AA 5DQDH 4P4RA 3VRLE 4YHML 4HX1A 1RURH 1JNHA 3PHQA 5DVNA 3QWOA 2VUOA 4NO3A 3BIAX 1KPUB 5DUBB 5FFLA 2OR9L 4ZFFB 1IRAY 4U1LA 1UWGH 4POZC 3EYOB 4NSKA 1NSNL 1U8PA 1WVZA 4DKFL 3LN5A 4HC1H 3AS3A 2PXYD 3SY0A 3QDJA 2YUXA 3BP6A 4CGTA 1YEGH 4K7PH 2MHAB 3BHBB 4IOFD 4FQ2H 4GUPB 3EJZC 3S9DB 2D7PA 5DRWB 3MRLA 3IFLH 5FO7A 3MV01 3SJVB 3RIAK 2HKHL 3BH8A 3DARA 3ZL4H 1FE8H 3C8DA 5F7DB 4PJCB 3LCYA 5CEZL 1CTNA 3V5KB 2ZKHL 1MLBB 2HJLB 5CMAA 1IVLA 3VWKB 3MRQB 4EN3A 1QACA 5DVKA 43CAA 4KDVA 5BMFL 4XNMA 5FGCB 5MENA 1KN2H 3C60D 5KVDH 4NRXB 1QBLL 4AL8L 1FO0H 2Z31A 4L4TB 5CS7A 4WI3A 1BWWA 1WCBB 4B7IA 3CVHH 2YS4A 4JRYD 1U8JA 5DJDB 1N4XH 2XICA 5AZEL 3MRPA 3DX6B 3IT8D 4U1GC 2DI8A 3CFBA 5HHNB 1UXWA 1T89C 3PL6C 1DVFA 4KUZH 5D6CB 4Z18A 2AP2A 1P4IH 4PGZA 3MLTB 1A6VL 1HSBA 5F89B 1RJZA 1JHKH 4OZHB 4Y5XC 1EGJH 2WBJC 1NC4B 4MNQE 1CGXA 1KIPA 3LKSA 3CNKA 1WZKA 4HWUA 3A67H 1GZPA 1T7YA 2GYSA 5I1EL 4PJ8C 3HC0B 1XH3A 3U9UB 1E6OH 1XCQB 5FUOL 4ONHA 1KCVL 5BCAA 3IFOA 2EDDA 4K3JL 4UT7H 4XBEH 2DQJL 1R3HB 5JIKA 3ULVF 2DBJA 1LO3H 5FKPA 4YHLL 4PJIF 5D72L 2XWJB 2QQKH 1IEBB 3GO1L 4GLRH 4Q6IB 4RMRA 3AS0A 3WLBB 4MLSA 1F11B 1T4KB 4Y89A 1CLOH 5L6YL 5J11B 2N1KA 2DQIL 1YUHB 3RAJL 1SBBA 4PRHB 3RGVA 3I84A 3RI5F 5K9JL 4X80L 5MP6L 3KYMA 1BQLL 4NKIH 4R4NC 3KWWB 5DGQA 5HYSA 3VD4A 4HDIA 3F12B 4OLWL 1AO7E 1FP5A 1NANI 1NJ9B 2LFGA 4PS4H 4JKMA 4NC2B 2JCCF 5EO0B 3LQMA 4WFGE 5GSRB 4EVNB 4QWWD 5CJQL 1RZJH 2F5AH 5E8DH 5ID0B 1QLEH 4HWBH 4QTHB 5DJ2B 3QIUA 4MS8C 1TTGA 2Z4QA 3G9VA 4QT5B 1T20A 3SDAA 4YC2C 5FO9A 4OD1L 3WYRA 1H8NA 4CRPA 1A1OB 2AVGA 4WFFD 3MRGB 4NC0B 4XWOD 3WV0A 2FX9L 5D2LF 1LK3H 1UJ3A 4LSTL 2GTWA 5HDQH 1VSCA 3RIFF 4DKEL 3KXFD 4UNVA 1DJSA 1FIGH 4WCYH 2R0LL 3EDFA 3LSOA 1MCWM 1I1AA 1QFWL 3C2AL 2EE3A 1G7IB 3WKMH 3Q1SL 2DLGA 4HUMB 3R8BB 2MMXA 4LGRB 4A6YL 5ITBH 2LU4A 5D1QA 2MCG1 2BNRB 3KVQA 3HI1B 3HZMB 4BFBD 5T1MB 1P5VA 5E2JA 4HKZA 4I0PA 3SDDD 2A1WL 3TWCL 2W07A 4HJ0D 1GGCL 3CXDH 4AT6B 1BFVH 2PYEA 4X8JB 3R4DA 1T7WA 1BVZA 1U3JA 2DIBA 5IBLD 1RJLA 4PJAE 3F65A 5DD0H 3CMOL 4TSBH 3VCLA 1WV7T 4UNUA 4X6FA 5SWQA 5GJSL 3QIBB 3RZCB 1AE6L 5J9PB 3WIHL 1MRDH 4K2UL 1IM9A 1MI5A 4GRWF 4P23B 1NGYA 5FUZH 3Q2CA 1HQRB 3QUXB 4J6RH 1O0VA 5HI3C 5BQ7B 5HHXH 2P5EB 3L3IA 4FQXD 1TQCB 5DYOB 2ZG3A 4Y4HD 3NIFF 2A2QT 2Z8WC 4Y4FB 4BUGA 1D6VL 1GPOL 3O4LA 4P46A 1W72B 4N1CA 4OCWH 2P24A 2F53B 4ZFOB 3SDXF 2QKIB 5L9DL 5JR1L 5AZ2H 3ROLA 4PJ5E 1DBMH 1KXQE 4Z7VF 3W9EA 4F7PB 2EEBA 5EO1B 2XTJB 5HDBF 3MLVL 1FFNB 1T03L 1MJ7H 2R0KL 5FYKD 3HS0A 2COQA 3OX8B 3RRQA 1Z0NA 1N0LA 5LCVH 2DLEA 1KJ2A 2B39A 5D96B 1MCIA 1VPOH 2EEAA 3O2DH 5TDOA 3GSVA 3NPSB 4U7SA 3O6KL 5KG9A 1AGEB 2D7TL 3DTXA 1J11A 5ILTL 1WCQA 4P5KB 4JO1L 2C9AA 2BCKA 1WBXB 3BWAA 4GG6A 4I8DA 4HH9B 1FFPB 3RDTA 2VL5A 4M6OH 2W9DL 1JFQL 5CP3A 1D7FA 4JRYA 4YBQC 1YPZB 1I8IB 1CGSH 4OJFL 4OLZH 2DM2A 4EDXA 3QSKB 2HFEB 1NANH 4HGWA 3VGHA 1T1YB 4D9LL 4XMKL 5M94B 3ZKSD 3GI9H 2RJMA 4XCYB 5DVLA 3MLWL 1DBKH 1NQBA 4OGAC 4EBQH 1HI6B 1P4LA 3TZVD 1B2WL 4G42B 3BPOB 1EJ6A 4G7VH 3BP4A 3SKMA 3GRWH 4KZDH 4UQ3B 4P4KC 4PJFB 1MFCH 3DO3A 5DFVC 5C0AA 4IRSC 4LCIL 4FFYH 4YHPA 4YHIB 1CVSC 3UTPE 1DBBL 3MSPA 2JLLA 3NCJL 5IIEA 3K1DA 3QUKA 3KLSA 3UTQB 3FQNB 1F3JB 3UC0H 3V6FB 4I77L 3X11A 2P5WA 3VJ6A 4YDVA 5GGSY 3SQOL 4XGZB 1VACB 1DQDL 2R2EB 3WDHA 3VGGA 1I7RB 2GEEA 3TBWA 3D0LB 3VG9B 4U3XA 1BIIA 3ZHKA 3OG6B 2AGJH 1F45A 2IPTH 2YUZA 5D2NB 4AENA 3IS1X 1MVUB 2R1YB 4JZOA 1LO4H 1QSFB 2WK2A 1KJVA 3MRJB 4HK3N 2OMNA 3PABB 4GXUM 1N0XH 3RUGE 1XMWA 2NY4B 4JPVL 4KVNL 3VXUB 5FM5M 2GITA 3MLZH 1S7SB 2XXMB 4TPRL 4FNLL 4F80A 3T0XA 2R2BB 4YXLL 1W8NA 4K8RC 1S7XB 4U1HB 1OGTB 5KVEL 3KPQB 5CILL 3QQ4A 2FNBA 1SVCP 5E8NA 3SCMD 3DUHA 1FVDA 3QEUA 5GGVL 4NC1C 5BVJA 3HZVA 2DB8A 1Q72H 2AKRA 1P2CB 3HMWH 5ITFA 4NKDB 4X9IA 1FSKC 1SY6L 4OFPA 4PJBB 2NXZD 4QHUA 3PGDB 1UWXK 5IVXF 3BI9X 4Y4KB 1J0JA 1DCLA 4OFYA 3TO2B 1BVKA 5IFAL 5C0GA 1CCZA 4ZSOA 1G7MA 4X4YB 5DSCA 2X70A 2OXHA 4GJTB 3BRFA 1IQDA 1X4ZA 1FORL 4I2XE 1UCTA 4JHAH 2KZWA 4PJ9B 1CU4H 2FD6L 1ZVSA 3IJYB 2B8OT 1RIHH 1U9KA 2ZUQC 4R90L 5EU4B 5JW4R 5LGHL 2I5YH 1ADQA 5E5UB 2GTZA 4NNYB 3CUPA 5IJKC 3DX9A 5KSAC 1CN4A 1H5BC 1T5WA 4L3ED 4FABH 3C9NB 2X6MA 4HKJB 4NQSB 1RUKL 5E7FA 4LRNL 2AV7A 5CZKA 3A6CH 1XF3B 4CADB 1CQKA 1SMAA 4ZUVA 1A7NL 5F9OL 2Q8AL 4LSPH 3OKDB 1YYML 4NP4L 4ZFZB 4HS3A 4XI5D 4C56A 1ERNA 1MSPA 3SDCA 2AEQH 3U7YH 4PJXF 2H45A 1IGML 4FQLH 5IB2A 3MNVA 4WEMB 4NNXA 3U46A 1OT2A 2NW3B 2P44B 5IF0A 2GFBB 1AXTL 5TE7L 2VDOL 2ZSVA 5JTWA 2W0PA 2DLHA 3FB5A 3CDGA 4JHZA 5EA0L 4PGDB 4AH2B 1XGPA 3HC3L 2P43B 4KRNA 1CG9B 4NQCB 4HS6A 2O61B 4ZUUB 2DL2A 4FQCL 5K59E 5DD1L 4M4RA 3MO1A 2NXYB 4HULB 3WSQL 1JGDB 5CBEB 1QBBA 3ESUF 1CDHA 4Y1AB 5JPMA 4UBDD 4CNIB 4LFHD 2PYFA 5KN5A 1EBPA 4E41E 5D7JB 2ILLA 5MEQA 1WBYB 2YA2A 2YPLD 4JM2A 2UWEF 1PZ5B 5KSUA 1S8DB 4BQ6A 1N6QL 2GCYB 3WIFA 3G5XB 1GIGL 4POUB 3C8KB 5TH2B 3PWPA 2V17H 1J1XL 1WWCA 3IFPB 4WGVB 3FCTA 3S98A 2FEDD 5DJ6A 2CDEB 3SKOA 4R4FH 3AREA 1XF1A 3CAFA 1ZEAL 2B7DT 2B1HH 1IGCL 5C0CD 1FHGA 2DS4A 3ARXA 5AAMA 2QEJA 1HILA 4ZFGL 4Q9QH 2J8HA 1K3ZA 5I2IA 2IPUK 4DQOH 1XF2A 2VLRB 1FN4B 1JIBA 1XGTA 3BP5A 3C5ZB 3FT2A 4LSQL 1WT5A 3QUZB 2A6DB 4OF5A 5TE4H 4K71B 4ODSL 4U6TA 3D3VB 2E9BA 2JIXD 3WO3B 1AGFB 3C08L 2NTFB 3GIVB 3OB0K 1OSZB 5TPWH 3F5WB 5C6TL 1NL0H 4PRAA 1I4FB 1FH5L 1DBJL 3D9AL 3C8HA 3MLPA 3HMXL 4CN1A 4UOW0 1Y18A 1KB5A 4NWTL 4QXGL 2QHLA 1QR4A 1F4YH 3NABL 3QRGH 1CR9L 2NCMA 4O5LL 3V4VL 2R1XB 3U0WL 2V6HA 4OZGF 2H26B 3RVXD 3C5SB 1D5MA 5KBNC 1S7WA 4KRPC 3VMNA 4WJ5A 3QZWB 5AYUL 3ZZ1A 1PYWA 2J4WL 1DLFH 5I1IL 4LCCB 4Q7DA 1MFAL 3BJ91 2Y7QB 4GMSL 2E3VA 2YD7A 4M6ML 4B5EA 1GJIA 4G3YH 4WDIA 1L9NA 5C0JA 5GISH 3TV3L 1FYTB 2V5SA 3MROA 4MAUH 3FOLA 2QSTA 1A0QH 1OGAE 1XGQB 5JHDD 3O3EB 2DWDA 3DUSB 3GBNH 4TNWK 5E2UL 5FO8A 1ONQB 2AJYL 1KEMH 1DP0A 4I18A 1H15A 1RIUL 1ZT4B 2AJZB 4FA8A 3ME0A 1CDYA 2BK8A 4NN7B 2VZUA 5GGSB 5HYJD 3WXVL 4N8VA 4X7SH 4ZS6D 4RWYL 2F54E 4N0CD 3IKKA 3E6FB 3ZYIA 1QEWB 3IVKB 3HAEA 1N5YL 3N06B 1QP1A 4JANA 2HWZH 3LPWA 4HHAA 3SCMA 4H1LB 3HI6L 2A0LD 3B2VH 5C9JB 3CLEL 4S2SA 2X4SB 3TYGH 2FIKB 1E6JL 4JY5H 3RBGA 2Y06L 3LH2L 1EEZA 4HJJL 1UC6A 3GHEH 1S7RB 2G9HA 1NBZB 3NAAL 4IM8A 3RWIA 1YJDC 3QEHA 5DJAB 2OL3B 2FBOJ 3DV6A 3T0EC 2V9QA 3BD3A 4WUUA 4XRCA 3MRBA 3GJEA 3S36L 5CCKH 5EZLA 2ICCA 1GOFA 2AJSL 4QRTB 1TZHB 5BW7A 1F4XL 2ARJB 2AK4B 5D7LE 3BMWA 3SGKA 4D0DA 5CP7B 4NQUA 3P9MA 43C9B 2MPAH 1PGRB 5ACZB 3OKNB 4HG4J 3IAGC 3BEWB 4L8DB 3MUGB 5BXFB 1ZHNB 4DAGL 3BMVA 3GSUB 4LVNB 5FGBA 3NH7L 3Q6FA 3UZEA 3T1FA 5JIIA 3U0PB 4JDVA 5IMMA 1RZGA 5D1XB 4XH2A 3SGEI 1JZ2A 4HKBA 3P0YL 5J06A 3CVIL 2QLVB 3E8UH 3CMGA 1UACH 4TOYL 1BX2B 4M7LL 1S7UB 3T3PF 5C6WH 3OBAA 5J1TC 3ARBA 3M8OH 3U4BL 3RHWF 5C0IA 2CLRA 3BEVB 3ZLQC 1KTDB 4HUNB 1FZKB 3K2MC 3EHBC 2VH5H 4I3SH 3WHXB 4Q58C 2VLKB 4HKXB 5IR1A 4BQCA 3NCCB 3HFML 4QF1B 5D93B 3QYCA 5DMJB 3GJFA 3L5IA 3Q0HA 1M71B 5CEYA 4PJ7F 3FZUC 1BD2A 2C3WA 1FYHB 1MVFA 3TO4B 1I3VA 3PWNA 1Q1JH 1CGWA 4XPFL 4JY6B 3CFIC 1TVBA 5ESAA 1N8ZA 3TLRA 4K8RL 1OWWA 3V0VA 3VXPB 3NFNA 2XRAH 1B0RB 1YNLH 1FC2D 1RHHA 1PKOA 1F6LL 4BZ1H 4BYHA 2AXGB 5EG6C 4P59L 1T6WA 5EU3B 1JI2A 2DN7A 1E4KC 2V7NB 5ESQA 3JSSA <