2QVKA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
189
structure length
121
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEGRPILGEHTKLEVIIEESYEFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 26
structure length 121
sequence length 189
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvkA00
2KLSA 3RB7A 3EADA 2QVMA 2FWSA 3H6AA 3E9TA 3FQ4A 2DPKA 2QVKA 2FWUA 3US9A 3RB5A 3FSOA 2KLTA 3GINA 2LT9A 3E9UA
chains in the Genus database with same CATH superfamily
2DLIA 2DH2A 4G83A 1JHKH 2YWZA 1HN1A 3VVVA 1WITA 1FGVH 2XVGA 4ZUVA 2MQGA 1EXHA 3N6YA 2HWZL 2JV6A 1AC6A 1KGCD 1NKOA 1ODAA 4XOBA 5EOTB 3SB3A 4XMPH 3C9NB 3B7UX 3RIAF 3GSOA 4G3YH 4YXLH 4X5XB 4O2FA 3MODL 1PLGH 2ZE0A 4DCQA 3CHRA 2ARWA 3GI9L 4NCC1 2V8MA 4R7LA 2YXMA 3H9SE 2VZVA 4AYMC 5DK0B 4PJHF 5CEZD 3EBGA 1QI4A 4OQTH 3D3VD 1YMME 4PB9H 4NQVA 3QUXC 1DQQB 3HG3A 5EU6D 3QCVL 3LH9A 1N7MH 4RGNE 1QUNA 43C9B 1JL8A 1SDYA 1VACA 4CSSA 4L3FA 4RAVB 1KJ3H 5EU6E 3JVGC 1U8MA 2O6CA 3JUZA 3FONA 3NZHL 3RJOA 4XO8A 4WIQA 4XT1C 2A74A 1R24B 4CSTA 2NY3C 1F4XL 2WYZA 3DV6B 4QEGA 2JB5L 5E1HB 1F90L 1E50A 5B21A 4BRVA 2UYLA 3W57A 4CMMA 3AC0A 5PAZA 1G6RA 3LRMA 4LLWA 4ZMLA 1TSHA 1XD0A 4F8NA 2C3VB 4P5RA 2VW7A 3HUJB 4CVXB 1OD9A 4R7DB 1DUYA 4LHJB 1M7IB 5EWIH 1D7FA 1KGIA 4G9FE 3EGXA 3RBGA 2N59A 4FNPA 4R97C 2JKNA 4TNVK 2LTQB 2WHVA 4XHJD 3ZHKA 4AIEA 1ORSB 4YLQT 5AW0B 4FMKA 5I66A 3TESA 3INOA 5ABAA 3SEPA 4XMUA 3PV6A 3V0DA 3MGOB 1VGEL 4ZD3H 4AT6A 1AZCA 2H5UA 4B5ZA 4MAUL 3ES6B 5T1LD 4APQD 4NO5A 3T4AC 3WS3A 5F7EH 1MY7A 5AKTA 4JVPA 5FKAB 1EJ8A 2VGLM 5K9JH 2H6PB 1RUKH 3E8VA 4I2XA 4U33A 5EOCL 1YRKA 3N06B 4XX1G 1WS8A 3ZXAC 3M88A 3TYFB 3IFLL 5DQDL 1J48A 2A9NH 3NMEA 3RNKA 4IS6A 3GSNB 1CE1H 3QZOA 4CGUB 3ATEA 1KJ2B 2PW1A 4RRPG 3SDAC 2OZ4H 1BXXA 2BOBA 2CGRL 2NYKA 5D93B 4NC2B 1CQKA 3RZCB 3GI8L 1YEDB 5SWZB 5FB8A 4D2NA 3WUWB 2IAMD 1HS6A 4LKXB 4JGNA 1PMYA 4UAHA 4BCYA 2GBUA 4FD0A 1QYGL 5T3XH 4P46D 1JF5A 3HS0B 2HT3D 5D7SH 2R4RL 2LAGB 3QXDA 1KOAA 1FP5A 5HYJB 1HE8A 2NY1C 5DVMA 3EBIA 4KV5E 5DGQA 1L0QA 1AJ7H 1MI5A 2YA1A 4IK6A 3ULAB 1IGCH 4J2QA 4FX5A 2BSRA 4EZJA 4GIAA 3CXHK 5JQ6L 1FDLH 3BEWB 4JZNA 1CK0H 2EE0A 2QPFA 4GP5B 1M56B 3FTSA 3N40F 8CGTA 2GABA 3L1OH 1EEZA 5E6IC 1COBA 1KBPA 3RY6C 3KL5A 4FL4C 1EEQA 3KPRA 4JR9H 3HLAB 3UX9B 1MHPH 1UZ8A 1B9KA 2ADJB 1QLRB 2OMTA 2P47B 4U1MB 1M71B 4FZEH 1IM3A 1FZJA 1JXJA 3LKSA 1MWAB 1XWVA 4S1RL 4DVBB 1RJYB 4X99B 1ZTXH 2BS71 4XC1H 1OB0A 5D9SA 4CADB 4UQ2B 5LG1A 3BIKA 3D4YA 3ARQA 1KB9K 3EYVA 3OHMB 3KR3L 2NNRA 2P5WD 1HEHC 3N1PC 3HC0B 3MLTA 4OGZA 4MJJA 4LHUA 4IBUA 4ZOCA 1WPCA 3BH8B 4AYSA 1M7XA 4OD3H 1LE9A 3KWWB 2WQAA 5F7DA 4GAJH 1WCQA 5ILTL 5KVEH 1AIFA 1XMEB 5LGJB 2FJFB 2DJUA 4OZGB 4TVPE 2XG4B 5HDOA 4AH2A 2Y1YA 5JPNA 3OKKA 3GBNH 3L5XL 5E8NB 1I1FB 3UBXI 1PTZA 1GA2A 4UAOC 2IANE 2AVGA 1EHAA 4K3HA 1PDKB 3UTQB 4BFNA 3VH8B 3OHXA 4OQTA 3IN0A 4CC4C 2DICA 3ML8A 4TKWA 5ACLA 5JNYB 3PP3H 3L9RA 1A6WH 1A4KA 1DVFB 1KZQA 3IU4L 5F7AA 5A1AA 4XVJH 4POUB 3NEXA 2KDYA 3LD8B 1BG1A 4BWUA 4PV1C 3O9WC 2X4NB 5F1IB 2ISDA 1K8DB 5D2NE 3VJ6B 5KVDE 4X8CA 1NFIA 2J1YA 1RK1B 3KLAA 4IOIB 1MCSA 4JY5H 1XAKA 1R0AL 4JG1L 1BEYL 1LM8V 1D5IH 1JF1A 1VADA 3CBKB 3L9EA 1NMAL 4MHHG 4MZIA 1ZLWH 5AVVB 5FOBA 3NSXA 1LO5B 3G5XA 5E8PB 1M53A 2J8UB 4A38A 3D25A 4QJ5B 3D07A 4EUPB 5IQLA 1MWAH 3UBXB 2WBKA 3FU9A 2BWIA 2GHZA 5T5FL 1MHHB 4ZMZA 1E0OB 3DARA 3QFDB 2WGXA 5D1QC 5I19H 1HJBC 5AZEH 3MACH 5MERB 1L0PA 4XNUL 3RVVD 3MBXH 5SX4H 3MRJB 3BUPA 3RGHA 3W11D 3EYQC 4JY4B 4MQXD 2CJ3A 2C34A 3C9NA 4MQ7B 1G1KA 3KPSD 3AZUA 4X5XA 2PMZA 1G0DA 1G87A 5I30H 1ADQL 1BVKB 4AMXA 5ICXB 1C5BH 3S2CA 2QPSA 4KHTH 1AZNA 5D5MB 5DK0A 2IPTH 1QHPA 1U8HB 5I8KH 2OZ4A 4M1CC 3V5KA 2Y7QB 4JVUA 2B5IC 3MXVH 4M62L 2ZOKB 3W0WE 1OOWA 1Z9LA 5F93C 4M00A 1FGNL 1RVFH 1DQQA 5HI3C 3NK4A 1W0VB 1E6JL 5E1QA 4OI8A 4RAVA 4AYBA 3P9MB 2BZ7A 2QFPA 5F9WC 5SX5H 3MV7E 3CJJA 1FORL 2FWUA 3B7RL 3NJMA 1R24A 3QDAA 5CZVL 3WAKA 3UC0L 2WLLB 3VI4B 2VC2B 2HX7A 3JWDL 1KLGB 5F70A 3RWIB 3DETC 4YDJA 3ZO9A 2O61B 1OCCB 3ZGHA 3BKJH 1L9PA 3DC0A 3IDYB 3L4UA 4KZEH 3EXLA 3C87A 5A2FA 4CVXA 3P0VH 1RURL 2Z34A 4R7DA 1UKSA 3HE6C 5H4ZA 3BRFA 1M7IA 3U30C 1MJJB 4ZW7A 3V0HA 5KVMC 3OAWA 5I1EL 4JO5A 4Q0XH 1ORSA 2EABA 2AABH 1IGIH 4IM8A 1AO7B 4U1NB 3WHE0 3X1EA 1PU0A 3LXCA 2GEEA 3DX7B 3MGOA 3S4SB 3BJ91 5KANI 1LL1A 1XF2B 5I1HH 4JPSA 4HFUL 1UCBL 2PETA 3ES6A 1BQ5A 4K3DL 4PJAB 5CJBA 2G0KA 4TL4A 4QRPE 1UEMA 3RWGB 5D1ZA 1SHMA 3W2DL 4XTRC 3X12B 1TNNA 4BQ8A 5FKAA 1G7PA 2H6PA 2XZQL 3NA9L 3O3EB 3KPPB 4ZQTA 1UH4A 1VA9A 3P40A 3QR1A 2Q1EA 2R8SL 5AL0A 3TYFA 4DGWC 3DO7A 3L4WA 4NKIH 1HHHB 4JPKH 5DT1H 3QPXH 1C8PA 3Q06A 5D2LB 1KJ2A 2Q5BA 2GBTA 1P4BH 3FFCE 1UENA 1ZWIB 3OAZH 4LHUG 4L0YA 1LP9E 4OUOA 3APCA 3JV6B 4HH9B 4DTGH 5SWZA 3TU6A 4FXGC 3WUWA 4RMQA 4LKXA 3MRPB 2EAEA 5C9KA 3BGMA 2P9RA 4WO4B 2XA8L 3HZYB 5M95B 5D1XB 2GKIA 3HS0A 4YGVB 3TA3D 5F6HJ 5BOPA 1X4XA 5HYJA 4XMZA 4KX8A 1IM9B 3MOAL 3IMSA 5JW5A 4KZDL 1JGIA 2Q10A 2WWKO 2ALAA 1SXZA 1U2CA 4UB0H 3ZDYB 1NMCB 3TFKD 3N9GH 4QAMB 3QP3A 1JCVA 1CDHA 4GOSA 3BEWA 3HHMA 3QCUH 2HG0A 1BM3L 2HLEB 4PRPD 5ISZB 5DD0H 4XCCL 4WU7B 4JGMA 4PWGA 3S97C 2FSEB 4N85A 5EDSA 2E46A 2EIZB 4YE4L 1VLXA 1Q9WA 1A22B 4NJ9L 5GGRY 2GTWB 3HLAA 2OSXA 3MJ8B 1UD2A 1WGVA 3MV9D 2DLEA 2ADJA 1QLRA 5AWNH 5LNGA 3CMOH 1M71A 4QTIH 4U1MA 5B3NA 3TO4C 2D7QA 3PGCB 3OLDA 4FABH 1MWAA 2R56H 4P4KB 1N8ZB 1RJYA 2DQTH 3BLKA 4O5LL 1TETH 1LK3H 1OAZH 4X99A 1XB3A 4RH4A 4UQ2A 2HXAA 4FLSA 5DZ9A 4CADA 5D72L 2FATH 4FMVA 4I3SH 4M6NH 3HC0A 5HJ3B 1I9IL 1DJXA 3BH8A 1ZEAL 5C0CB 4BUHA 2CCWA 3KWWA 3TL5A 4B7LA 4BRJA 5IHLB 1ZGLM 3V5DB 2EC9U 5LGJA 2F1AA 1TO5A 2FJFA 3L2NA 4GQQA 2XG4A 2YJLA 4OZGA 5HHPB 4A55A 2PYEB 3QQDA 3MODH 3OKEB 2VXVL 5E8NA 3GI9H 1GC1C 4ZBJA 1CG9A 3Q0HA 4RMVA 5LXGL 2NNCA 2YA0A 2ZOWA 3UTQA 5FKPB 4HJSA 2YGQA 3VH8A 1DCEA 4FEMA 2GTQA 4JFEB 1SY6L 4J8QA 3B2VL 4AWJC 1TEYA 3HZKB 1PQZB 1Z3RA 4JN2B 4GBXB 1F13A 2HT2C 2P44B 1G0XA 2SEBB 5JW4N 1DVFA 7FABL 1UA3A 2ODHA 3QBTB 5F2FA 3HE7B 4E36A 3NZHH 2X4NA 2Z31C 5CN1A 2AZAA 5F1IA 4B0MM 4Z7WB 1F4XH 2KH2B 3VJ6A 4LFHD 2JB5H 2AEOA 3FUEA 2VR5A 1MDAA 2DQMA 4IOIA 3U6XS 3FU0A 5BCAA 5KOVC 5E2WH 1FYTE 3V4UL 1DANU 2KQMA 4FG2A 1UOLA 1MOEA 3OAYK 3ZKMD 1LO5A 4ZUSB 4BD4A 4QRBA 1HCVA 4RFNC 5E8PA 1SDDB 2J8UA 4WZ9A 5AB2A 4NUPA 1J05B 5ESVB 2Z7ZA 3UBXA 3M7FB 5A2LH 1I1YB 1P9MC 1MHHA 5J7CC 1HL4A 3QFDA 4QRRD 4PJ8B 1LWJA 1TZ8A 1D3CA 3V9EA 4AZ8B 5MERA 5CD5C 1HYSD 2PP8A 4QKXB 1U93B 2ITEA 5KVGH 3MRJA 2VLJB 3NRQA 4M5TA 2Z6FA 2XKNB 4JY4A 5EOCH 3I6LD 5GRUL 4DKAA 3W38A 3I50H 1E5YA 5HPOA 4MQ7A 4G72B 3IFLH 5CKGA 1KBBA 5DQDH 2OYLA 3V6ZA 2EINB 5GIRB 1NOFA 2V2TB 1BVKA 5HDQL 1ZS8B 4K9EC 4B96A 5ICXA 5E2TL 5D5MA 1BYOA 2CGRH 3ILDA 3FSOA 1VRSA 1U8HA 4F7EB 5JHDB 3GI8H 2Y7QA 3V52L 3RPIB 3E7JA 5C09B 3N85H 1TYEB 5JIDA 1ZY9A 5DZVA 1GSKA 3RTQB 5HPMB 1DTUA 1HQRB 5IMLB 1W0VA 4HXAH 3UG3A 2HJLB 3I3EA 3GTNA 1MFDL 3MCLH 5SWQB 3P9MA 4P2OC 4UT6L 5I24A 1IJ9A 2R4RH 3HBQA 1J86A 2IADA 4ZUUB 4LVHB 4LLQB 4GO6B 4MJ4A 3IKCB 2Q76B 3WUWG 4PPTA 2VXUH 2VMDA 3VI4A 3V4VL 4LCCC 2BIOA 1KLGA 1QSFD 4U05A 5IB5B 5DMGC 5JQ6H 4NHCL 3MRQB 5JW4Q 1DVQA 1QSFE 4YSAA 4WSGA 3MV8B 4Q9BA 1CF8H 1MCWM 3QIUD 1MJJA 1OTUD 1TSRA 1ZLSH 3SCMD 1X5AA 2DQEH 4KKNA 4ATWA 3CPUA 1AO7A 1H5BC 4U1NA 1O75A 1I8AA 3MLSL 5D6CA 4Y16C 4YDLC 3DX7A 1XF2A 2FBOJ 2JLPA 1CFTB 2XXCB 4PJAA 1BBJB 2LLGA 5DVOA 3RWGA 1KDJA 1JNNL 4A2GA 3GIVB 3LH2L 3KR3H 5INCB 3X12A 4MXWL 4G8IB 4BE6A 2ZQKA 3O3EA 3KPPA 1RSFA 5K1VA 1PZ5B 2KZBA 2UY7B 2WANA 5ILTH 2B4CL 4WV1B 4X2UA 1FFRA 5HD8C 4HJEA 1NA8A 4XMWA 3L5XH 5D2LA 4GLRI 1GCYA 4LOVA 3B1TA 3L16A 3ZL4L 4IBTA 2BP0B 4IU2A 4NBZB 3C8DA 3JV6A 4HH9A 4KV5F 3IXTB 2D7OA 3WY1A 1SMOA 3MRPA 1T7WA 3LEYL 1HDMA 4WO4A 3HZYA 2K6YA 1X9LA 4YGVA 2YRPA 2YGPA 2F8IA 3FUHA 3IU4H 3FRUB 4GJTB 2QL1A 1IM9A 1XGUA 3QXAB 4XVUD 1HHKB 4NBYB 5F7BA 5BOJA 4YWGH 1ET5A 2HN7B 4HGMA 3OPZH 4MB1A 2XVKA 5DMKA 2HVBA 3OJMB 3U46A 4OIIL 4HSCX 4O58L 4ZSOE 5B1BB 3WOVA 3QXVA 1R0AH 2X6AA 3NJXA 1IO4C 2G2RB 4X6DE 2APFA 1S7UB 1BEYH 1QHQA 1H9DA 2PPFA 5ISZA 3Q5YA 5HGDB 4WU7A 3VTTA 2FSEA 1NMAH 1UWGL 1ZPUA 2EIZA 3RB5A 4OJAA 3GXMA 4XNMB 1GKOA 2FQFA 4QRQB 4RDQG 1NBVL 2IH8A 3KW7A 3MJ8A 5E6RB 2ZTBA 3SE4A 5T5FH 3V7MA 2QGDA 4AV0A 4P4KA 1N8ZA 4M43L 2GJ6D 1ULVA 4H8UA 4G8GA 5ERWB 5KBKA 1KV3A 1OAXL 3AY4C 5HJ3A 2NY6C 2GJ6E 2OQJB 1CR9L 4J4PA 8FABA 5C0CA 2IDTA 3OSKA 3BQUB 4J3TA 3V5DA 1BLNA 3MXWL 3ZKND 5HHPA 3NIFE 4IRJD 2PYEA 2DKUA 4K94C 4H8PA 5M94B 1OSZB 3UL4A 1JK8B 2VAAB 4OR1A 3FQXB 3BAWA 4YDZA 1QFUH 5DUPL 1ZK9A 3KS0J 1UM5L 1TCMA 1D5ZB 5FKPA 1S9KC 4M62H 4JFEA 3ZTNH 3D2UB 2AMUA 4ZOAA 5BO1L 3U4BL 3HZKA 1DJSA 1PQZA 2JKRM 4JN2A 1E6JH 5BZWB 3MLZH 1XGZA 4GBXA 2MCMA 1QG3A 3EG9B 2GITB 2SEBA 4NM4H 3MX0B 3SBRA 3HVDA 3D39E 3D52A 4N87A 2WBJD 2ZX9A 4FG4A 3QZNA 2YPLD 3HE7A 2COVD 5B3SB 1FORH 1NUGA 2NCMA 2YD9A 3HG2A 5DO2D 5A2IH 4Y2DB 4Z7WA 4GKOA 3VM5A 5CZVH 3WV0A 4B50A 1T83C 3JWDH 2B9AA 2DTML 2IV9A 1EBPA 2X4PB 1YECL 2HKFL 2B0SH 1OARH 3MYJB 4HOMA 2L7UA 1GRWA 5GJTL 1KENL 4WTWA 1YEHL 1AGFA 3HNVL 1RURH 2FLMA 2XG5B 3S37H 3LZPA 1R33A 2AHIA 3MN8A 3EJYD 3KVPA 4H0IA 5CGTA 3NBNA 2X88A 1J05A 5ESVA 3MLYL 4EXPX 5I1EH 1J1XH 3G6DH 4G7YH 5GS0C 1I8IB 1KN2L 2MNWA 3E38A 2VSCA 3HMXL 1I1YA 5CCHE 4QJ4B 1TOXA 3KGRA 4JE4B 4U4BA 3PWPE 3P3YA 4EVNB 4PJ8A 4HFUH 1UCBH 4GEJA 2OKMA 2XTJE 3GIZL 3QW9A 3U7AA 1G9ML 1QPKA 3W2DH 3WU1A 1U93A 3LPWA 1E9OB 2FAUA 4PJ7E 4Q6KA 4PJDE 2G30A 2VLJA 3NA9H 2YN5A 2RTTA 2XKNA 4NQTA 2CRYA 1FNAA 2WUBL 2R8SH 3NCEB 1NC2D 5DCCA 3RDTC 5AVUB 5GIRA 3AS2A 5I1IL 3UG5A 1ZJBA 1UOVA 2V2TA 3V9CA 1ZS8A 3ESNA 3LQAL 1LD9B 4ZW3A 3RPIA 5C09A 1QPXA 2ZWNA 3R19A 5I8OH 3RTQA 1JERA 5HPMA 3BZFB 1P1VA 1HQRA 3MRIB 5IMLA 1MCWW 4EZLA 1AHMA 2VLKD 3TBSB 2HJLA 2XA8H 3II1A 2BSED 5SWQA 2RMNA 4Z7QF 2BNQD 4HUCA 1UOKA 1YQVL 3GS4A 3LMJL 4ZUUA 4LLQA 3HRZB 3MOAH 4N5UA 4KZDH 4R2GB 1J5CA 3IKCA 2Q76A 3HFML 5E1IA 3BZ5A 4WW2C 2Y06H 3HKZA 4E9SA 2X1QA 3LCYA 3BEVB 1E8WA 1WS7A 5IB5A 4JFUA 2DQJH 1MG2C 1BM3H 3Q1SL 3K81A 2VDNL 4KK8C 1BJ1H 2BHYA 2HTKD 1I31A 2A1WH 5GGUB 2D4FA 4J6RH 5DC0A 3IMVA 5KANG 4P5MA 5GRVL 1A14L 5DJXB 4NJ9H 3D85B 3AADB 5ANHA 4MKMA 4V11A 1FC1A 2NR6A 4YC2B 1DQML 1GZQB 3BN9C 4O5LH 1XTLA 1I1AC 4ZXBC 5T5FA 2VN3A 1CFTA 2YD6A 3HVNA 2UY6A 1BBJA 1IBYA 3LRHA 3K3QA 3C75A 5D72H 2AEQH 3ARXA 1PX3A 4DOHB 3GIVA 5INCA 1OTSD 1ERNA 1S6NA 1RQ5A 3U0TB 4W9EC 1OOAA 1S7RB 1Q94A 4PS3A 1PZ5A 3G7TA 4GPVA 1PX4A 2PR4L 2UY7A 3TBBA 4WV1A 3S0PA 1AR1B 5B38B 1R3JB 2F58L 1UFGA 4MMZC 2OI9B 1OE3A 3VG0H 2VXVH 5DJ6B 3R0NA 1EUUA 3LVTA 3RVWD 2FEJA 5LXGH 1EV2E 1X5GA 3EHBD 2BP0A 4NIKB 4AUUA 3PAVA 1CN4A 3BAYA 2PXYD 3ELQA 3S48A 2MIZA 3IXTA 4XNZB 4NZDA 1JPGB 2ZWYA 1SY6H 3REWB 4KRPC 4Z7NE 2WBXA 2JCCF 4NI3A 2A4EA 1IVLA 5H37A 2CGZA 3OZKA 2WXOA 5MEND 2Y4SA 7FABH 4X8JA 1LEKB 3FRUA 5AW5B 3UROR 3ZYIA 3QXAA 3AT8A 2ZUXA 2W94A 3J8F7 4AIZB 3VD2A 1HHKA 5LHDA 1CU4L 5HGBB 2HN7A 3CSFA 1S46A 4ZT1A 5F0LB 1IC7L 1U8PB 4HUKB 3VSQA 3FAWA 2QKIB 2YD5A 3VWKB 2G2RA 5LAPA 2Y3AA 4ICWA 1S7UA 3FOLB 3RPKA 3V4UH 4N2IA 3U2SA 3LEXB 5HGDA 2AJ3B 2XZZA 3DPBB 1U58B 2R15A 5TPWL 9CGTA 1PBYA 4YHNA 2LR4A 5DXWA 5MEPB 1EAPA 5AW6B 4Z7OB 4P05A 4QRQA 3ALPA 4DNLA 1J1OL 3TBYB 2FX9L 1JGVL 2VZ1A 4TPRH 4LOUD 4Q2ZA 1QQDB 2PTTB 5KW9L 3CD4A 4ORZC 3CZEA 4NN6C 2E86A 3FO0L 4DGUA 5ERWA 1XL6A 2B1HH 3S88H 3LHPH 3VVWA 4ABUA 5E5UB 1GGBL 2OQJA 2EDQA 4DO6A 4LAQL 5E2VL 4BV1A 3S8FB 3CWGA 3AFLA 4PVMA 1MRDH 5J3HD 3BQUA 2EDDA 3PGDB 3HKFA 4KMTL 1OSZA 4JRXB 4IBWA 4S1QH 5HDQH 2VAAA 1B2YA 1JK8A 1F4HA 3JTTB 3FQXA 3CXFA 4X0KA 5E2TH 1JN6B 1DBJL 4ZNEE 1BREA 3S5LB 1J11A 2RR3A 2FJHB 1D5ZA 2BOCB 3O4OC 5IMMA 3V52H 1KB5B 1OHQA 2FO8A 3DIFA 3NQKA 2D0GA 1ZGLB 3F7YB 4P5TA 1D2OA 2W9DH 3D2UA 4OVUA 4W9JC 4YBQD 3X11B 5IJCC 2JKWA 5E8EB 2DLGA 3ATFA 3ARFD 2XQBH 5F9OL 3EG9A 1MFDH 2GITA 3UMNA 3MX0A 3N42F 2F7OA 4UT6H 3ZK0A 3MMEB 1THCA 2O72A 4YVNA 3QDMB 3STLB 1S8DB 1K6QL 1ZHNB 2CM5A 4WHYH 5ITBH 2IDUA 2ZXGA 3Q05A 5F21B 3UAJD 1JS4A 3V4VH 2VR9A 3UXFA 3ZU8A 1MCDA 1TJGH 2X4PA 2ADYA 4MZ3A 2ZOTA 5C0GA 4BQ6A 2AGJL 4NHCH 1DE4B 2E7LC 5E5MB 4IOFD 4B0MB 1T1YB 2XG5A 4PJCE 1AAJA 2Q86A 4FQ2L 5A2AA 2AK4E 4UOW1 4OKVB 1OP3H 1I1CA 4PJ5D 3ISRA 4YFLI 5DJCB 4M5ZH 4UIKH 5I5MA 4RLDA 1A3QA 2PCXA 3PRZA 4ODUB 1I8IA 4C47A 1FAKT 3MLSH 2JTDA 2DIAA 2FH6A 3A6BL 1A4BA 4IOSA 1Y1DA 2K4AA 4XBPB 3VNZA 3LRGA 4ACPA 4L4TE 4EVNA 3I9GL 5DVKA 3VI3F 1BVZA 2WLYA 5I0DA 4XH2B 2Y7LA 5D1QE 4XMLH 1NEPA 2IF7A 2FYYB 1ZANH 1E9OA 1JVKA 2O6DA 1F4YL 2BVEA 2FWLB 1PG7X 2J8OA 1MWOA 1NOLA 2F7RA 2XU9A 2B4CH 2DQ6A 3Q2CA 4BZ1L 1I3GL 1IGFH 1V27A 4LL1A 4XVSH 1LD9A 3ZL4H 4HJ1A 3NFSL 4L1HA 4KI5C 2WWOA 4WW1B 3S5ZA 3DOHA 3IF1B 3V55A 2CO6B 1U21A 2KMWA 3AU1B 3BZFA 3MRIA 5K9OB 4G8EB 5BV7L 1SY6A 4W9DC 4FQXB 3LEYH 3TBSA 4DZBB 5M7QA 3QUZC 4AKPA 4JFFA 4J3BA 3DO4A 4ONHB 4MX7B 5K59E 4HALA 3ULVD 3EJUA 1D7DA 5IB4A 5JZ7D 3UTTE 4ETQB 2AJSH 3HRZA 4EDXB 1JYVA 1JZ5A 5IT2L 1QX1A 1WCBB 4F91B 3GHPA 3ULVE 3LX9A 4JDEB 5F71A 2JTYA 3BEVA 4OIIH 4O58H 5A43C 1DN2A 4QRTB 4HIQA 1JTPA 1WP6A 3OXRB 3ZTEA 5E08L 1IJNA 4RMBA 2KL6A 2F8XC 2D0FA 2NY2D 4G6AC 4DO5A 7CGTA 5DFVD 4LMQE 1UWGH 3CFJA 5IBUG 4Q89A 5GGUA 1R3KB 1UG9A 3SQRA 4IKIA 4QD2E 5DJXA 1JUFB 3ZUCA 1VEOA 3ECUA 2G75B 3D85A 4YHPA 1VIWA 1NBVH 1BMGA 4FF9A 4HCRL 3ZLQC 5BRZB 4A67A 5CWSA 1B6UA 4K5NA 1GZQA 3CAFA 3L8QA 3U48A 1N64L 3PNWA 5FA4B 1YO4A 4YL4A 2Y1ZA 1OAXH 2ZOLB 3U0TA 1CR9H 4OFYA 4DW2L 5L4JA 2DIEA 1OP5K 2R2CA 3KLSA 3O2WH 1NDGB 5FA3B 4MASA 3D48R 3OHXC 1KLFB 4NWUH 3EYUH 1R3JA 4R83A 4WUUB 2DIJA 2QDVA 3KLQA 5DJ6A 1RZJL 2F7PA 4QXGL 4R5TA 4FYRA 2EH8L 3UAFA 4G70B 5CF3A 2PABA 3FOMB 3QZWA 1UM5H 2CDFB 4X7TB 3HMWH 1FFQA 4BM7A 3S36X 1JPGA 4J6IA 4MQSB 1FNGB 2BDNL 4K5LA 4UINH 2JXMA 1L9MA 4FFVC 3U4BH 1AOZA 1A3RH 3ZO0A 5E5LA 1QTPA 1UA6H 5E23A 4X80L 2FLRT 5IF0B 2BO0A 2F8VA 1LEKA 4YHZL 1LDPL 2IALB 4UT6A 2VSMB 4AIZA 4JO1L 5HGBA 2FD6L 3NAAH 1KNOB 4G6MH 4GO9A 5MI0C 1SOKA 1CFVH 1L0XA 1U8PA 2DTMH 5C0IB 2QKIA 3KEDA 4R5VA 2HKFH 1H8SA 3VWJB 4FC3E 5AALA 4OT1L 5GJTH 5HBBA 1NBYB 1L9RA 3NZ8B 1KENH 2ZKMX 2WXJA 3L7FA 3LEXA 3Q6GH 1YEHH 3DVIA 4U7SA 3DPBA 3HNVH 1S5IL 2JNZA 5LWYH 3UFIA 5MEPA 2OL3L 4TVUA 3MLYH 4GXFA 5KJ4A 5CJ8A 2CHNA 5DQJB 3TBYA 4PY8J 1KN2H 3SJVD 1QQDA 2PTTA 1KZYA 1M42A 2D2CC 1SEBB 3GIZH 3VXPB 1G9MH 1NEUA 4IBYA 1AKJA 1T21B 2P80A 1VAHA 2UWEE 2B1OA 1NAMB 4KVCL 4NNPL 5GSVA 4Y4KD 4F93B 2ZSVB 3PGDA 3WKPA 4HCFA 1YNKL 1KTLB 2Y5TB 4L3AA 4NRXB 3V0VB 1ZV2A 4JRXA 3NPSB 4HKZB 1OCOB 4Z18A 4Z78B 1AZVA 3K6NA 1JN6A 1QSEE 3LZRA 1PZCA 4NNXB 3S5LA 2FJHA 2BOCA 1ZGLA 1L4IA 1MF2H 3B4NA 4YSCA 3ALWA 4HUNB 3F7YA 3GXFA 4MD5B 3X11A 4JKMA 1AS8A 1XSKA 4WWID 1ZV9A 4NBXB 5E8EA 5D8JH 4A7UA 3S8WA 3CFDB 5SV3A 2F5AH 4AJVA 2A0LC 2HFGL 3ARSA 1CFNB 3LMJH 1IAIM 1H3PH 4DGIL 4U3XA 2XJKA 3QDMA 4NT6B 3STLA 1S8DA 1ZHNA 2ZXBA 3HFMH 4U0QB 2FJGB 3N1GC 4BGDA 1BQLL 4XVTL 4J3OF 2LTQC 2R2BB 1BFVH 3U4AA 4X4XB 3FFDB 1HH9B 2DLFL 2VL5B 4JRYD 3Q1SH 5E5MA 3WMSA 1YJDC 2ED8A 1T1YA 2ALWA 5F96L 5LKNA 3DUHA 4KK6D 4X50A 2DI7A 1NPNA 4OKVA 2E74C 4JRYE 1A14H 1FCGA 1IIIA 1M3JA 3PQYB 4KRMB 4PJDF 4PJ7F 1FNEB 4R7NB 4HZLB 5DD3H 5DJCA 5IHZB 2FUQA 3QNZA 2C4FT 4ODUA 3PWUB 2Y3NA 3S3SA 3VACA 3V7AG 1DQMH 4KKBC 3C5XA 3R1GL 1MW1A 4XH2A 4DPBX 5KG9A 4OY9A 1NEZB 2IWGA 2FYYA 4K23L 4OAWB 5AG8A 1FZKB 4GAFB 5D70H 4EBQH 1OF0A 5D93C 2OMNA 3G5WA 1NAMH 1CGSH 3RZCC 3SDDD 3R0MA 5CFAA 4L5FE 2AJUL 2X2JA 2Q8AL 1YZZA 4P07A 5D96B 3TA4D 3SGKA 5E2JA 3W37A 1ZV5A 1T3FB 2F58H 1BVNT 1OEZW 3E8UH 3T2QA 4EPSA 1S2EA 2ICWI 4WO0A 4GEIA 2MTPA 3HS0C 4N28A 3NUKA 4HEME 4WW1A 4ATTA 3I85A 3IF1A 4LIQE 3H56A 1F4WL 2CO6A 5DLLA 3FCUB 4YXHL 1DJGA 1SJMA 3AU1A 4LCUB 1VB9A 5K9OA 3H9SB 4G8EA 2F6AA 4FQXA 4DZBA 2XI9A 1A6ZB 3DX2A 4AXWA 1EVUA 1YMMB 3SODB 3TTSA 4ONHA 4MX7A 3AM8A 1CIDA 5EZIL 5TK2A 2BNRE 3ZJAA 3IGKA 3TBWB 4ETQA 3QZWG 4RGNB 4EDXA 3TT1L 4ANWA 1WCBA 4OJYA 2A77L 2JKIS 3VFWB 4JDEA 5EU6B 5C08D 1CXIA 5HDRA 4EKXA 4L8SB 4X6CE 3I9IA 4XCFL 2Y7SA 2MHAB 2J4WL 4QRTA 1R46A 3OXRA 3N0PB 4TUUA 4NXSA 5C08E 4BCZA 2F1EA 4J8RB 2CIKB 3UCRA 1MFAL 5AOMA 2EXYC 4GXVL 1X5HA 3ARVA 5TPWH 2BH0A 1PW3A 2J6EL 1R3KA 4MCZB 2QQNH 1BAFL 1JUFA 4ZPTB 3VGAB 2G75A 1TLKA 3KPLB 3QNYB 3O6FD 2J5LB 3LKOB 2JQMA 4ZI8A 5A6MA 5BRZA 3CFBB 2FX9H 1JGVH 4G9FB 2HUEA 5JW4R 2QDWA 4QRSB 3QA3B 3DTXB 5KW9H 3T3PE 2DQFB 4RMUA 3FHQA 1KF9B 3FO0H 1U91B 4KH2A 2FCBA 5FA4A 3OQRA 3TH2T 5HP5A 3NJNA 5AYUL 1N4XH 2EKJA 1YEKL 2E4TA 2HFEB 2Q3XA 2ZOLA 3EAKA 3TVMC 1GGBH 3AGWA 5D7KD 3CFTA 4LAQH 3Q01A 1UFUA 4MA3B 4KAQH 1NDGA 5FA3A 1BF8A 3T6WA 5D7KE 2CPUA 1KLFA 2EIEA 5DFTA 4JKPL 3KNBB 3B2MA 3A21A 2EDTA 3REVB 4ZO7A 1R19A 3BVWA 3OGOE 4GMTL 4RX4A 2FEDD 5E6UB 4DP8X 1DVFC 3ECBB 4LB8A 3FOMA 5GS3A 4X7TA 2CDFA 4KKPA 2WP3T 4DKEL 3Q8AA 2WXQA 1FNGA 2WXNA 3UCQA 3VI4F 4YBLB 1U8CA 3N1MC 5KN5A 3QORD 4ALAC 2GG1A 2A6DB 4UQBA 4JKLA 5IF0A 2H1PL 4UDUB 3GZKA 1HKLL 2IALA 2W8CA 4KJPD 3S5LG 4PCKA 2YUZA 4XNXH 2R0ZH 3BPNB 3SD2A 3DVGB 1WBZB 3K2KA 4O02L 3WD5L 1IAIL 3N3EA 3C6LD 3TX4A 3OXSB 4EZMA 3VWJA 2AGJH 1NBYA 3ZQWA 3NZ8A 2C9PA 1A4CA 2BMKB 2VXSH 2PWGA 4WNQB 1E7VA 1WAAE 3ASWA 3FUNA 5EN2A 2NZIA 3AG4B 1F3RB 1INQB 1LO2H 5GGVL 2W07B 4QTFA 1LK2B 3O3UN 1RP8A 1DJWA 2QQQA 4NZUL 1VESA 2CUAA 5DQJA 3SPIA 3VFPB 3H6AA 3U82B 1D5XB 4RIRB 1DVSA 1SN0A 4EIGB 3A6BH 4WJG3 5I18H 4PLNC 4FFWC 3I9GH 3S7GA 1SEBA 2W0LA 1NICA 1I4FB 2CHXA 3MRNB 3F12B 3VXPA 4AEIL 3ZBMA 1F4YH 4PLKD 3VW3L 3Q44A 1T21A 2DWEB 4KROC 5AW9B 2Y07H 2LE9A 1NAMA 5HHVL 3U2IA 2ZSVA 4N86A 4M61B 2Y5TA 1KTLA 2WVTA 1NM4A 4YSUA 4NRXA 3V0VA 4WI8A 4ANUA 1OD7A 1WSST 4HKZA 1P5UC 1V10A 2P5WB 4RGOL 1DSYA 4GINA 2IMMA 5EV7A 1EDYA 4Z78A 3NFSH 1LO0L 4NNXA 3NSFA 1QWHA 3D7PA 4NO0B 1JZDC 4B27A 2A5UA 4MD5A 2PTVA 4XN7A 3V8CA 2ROYA 2V6HA 2ZP0T 4N8PA 2GC4C 2IANB 3CFDA 4MJIA 5BV7H 1IBBA 4UT7L 2YS4A 5GGQL 1X7SA 5EG6C 4MZRA 5C0JB 1ZLVH 5E24E 4HFWB 2WYIA 1RUQL 3CK0L 4PJCF 4NC1C 3AWGA 3TJHC 2EEAA 3BP5B 5E8OB 2FJGA 4AVKA 2AJXL 1I9RH 3ZR6A 3NCMA 2XPYA 3OMIB 3R8QA 2R2BA 1ZDQA 4LBEB 2VABB 2FQGA 4X4XA 5GRXG 1ZT4B 3LIZL 3FFDA 4ORGB 4XWOD 5D2NB 4HPHA 2VL5A 1MCEA 3MV11 1SVBA 3GKWL 4LBAA 4L1DA 3U6RB 2CIIB 4CKQA 1AGEB 2R29L 5CEXB 4JDVB 1NWOA 2PN5A 2QSQA 2OCFD 3PQYA 4R7NA 4FYTA 1XH0A 4HZLA 5IHZA 3VA6A 4NN7B 1T0NB 4HCRH 3PWUA 1T5KA 5FAAA 3RL1B 3SE3A 4K9JA 4LLAA 4EKJA 1VHPA 2ZUUA 3G08B 3KLHD 2AEPL 1N64H 1JZ4A 4JHAL 1NEZA 1BW8A 5KVFL 1ZE3C 4NQDD 4OAWA 5AOJA 1FZKA 3T1FB 5IIEB 4DW2H 3ALXA 4IGBC 4KX7A 4JO3H 5GSRB 1J12A 3HS9A 3QJRB 5DVNA 1T3FA 2IDSA 4EIBA 1Q1JL 1MSPA 3MV01 3QIBB 5K59F 1RZJH 4Z23A 4PMFA 4TVPH 2EH8H 5D1XC 1TPXB 3B8SA 2CA3A 2B9BA 3TJPA 4OGYL 1HEZB 1FAIL 5E6SB 1OGPA 3BH9B 3BVNB 5DJ0B 4AEEA 3BKYL 3BWZA 2FJUB 4H0GA 4LCUA 1WO2A 4YK4B 2WZAA 1IAMA 3H9SA 3ORJA 5DRWB 5B4MC 4URKA 2AC0A 4XBEH 3WKQA 1A6ZA 1WBXB 4HBCL 1YMMA 1G1CA 3W0WB 5AVRB 5TE6L 1PL3A 4P2QE 3LY6A 1BQUA 4DH2A 2K45A 5CLZA 3TBWA 1LDPH 2VSDA 1IFGA 3A5VA 2PWFA 4JO1H 4ODSH 3VFWA 2FD6H 2J55A 3MRCB 2WTRB 5EU6A 3BPCB 1UOWA 4XOEA 4W6WB 5DU7A 1Q90A 4L8SA 2CJUH 2MHAA 4ZMYA 1E4JA 4HU2A 5KVDH 4OT1H 2V3FA 3SE4C 5KEZA 4MJHA 4J8RA 5CZXC 2CIKA 1B9ZA 2XYBA 2WOYA 5I2IB 4G80B 3MROB 2P52A 5AD0B 5KSAD 3TZVD 4MCZA 3M8OL 1NGPH 2ATAA 3OPUA 1T4WA 4R0LA 3SDCD 2OL3H 4JG5A 2FBRA 5GRZA 3KPLA 4E9YA 1WV7T 2XY1A 3LKOA 2FIKB 1ZHBB 2ZICA 1QSVA 3UBFA 4IHBA 3I6SA 2ZUVA 2F7IA 3CFBA 1R3IL 1HI6B 4PRBB 1TEFA 1K8IA 4G9FA 1RI8A 4QRSA 3QA3A 2N7SA 3DTXA 4O9HH 4JREB 1J18A 2DQFA 1TZGL 5F9DC 4JM2D 2GB2A 1U91A 5DRZB 2WYHA 4FJ6A 4JQVC 5E7BA 2HFEA 5F9JB 3RNQB 3ILPB 3MRGB 2UX6A 2E3VA 4WI7A 5D7JC 3M17B 4MA3A 2FSDA 4QRPB 2C4XA 5E51A 1WEJH 1IKFL 1A0QL 1Z1WA 1E8XA 2Y6SD 4I3RL 2OJEB 4Z0XB 5IFJB 2P42B 1I53A 1NPUA 1KT2A 3KNBA 4G5ZL 4GBXC 5IEKB 3REVA 1OLLA 4LCWE 3ECBA 1GOGA 4YHOH 4HS3A 3HE7C 3MNZB 2LABA 2C3HA 3BRDA 1X9QA 2P8PB 1F4AA 3FFCB 1F18A 1HL8A 3IFOB 3I9PA 2I85A 1IGML 2A9ML 1LP9B 5FCUH 2GTZB 1CURA 2YFOA 3VD4A 5A16B 1X5XA 1AZUA 4IRZL 1F8TL 4UDUA 2GIXA 1CDGA 4DGIH 3K4AA 2X1OA 2B3RA 4HJ0D 3WXVH 3B3IA 1F5WA 3DVGA 1WBZA 3IRCA 4WNJA 3VQ1C 1UH2A 4AL8C 5FPIA 4XVTH 2VAJA 3OXSA 4PW4A 3P54A 3ARGD 3WTWA 3WHE1 4YMPA 3K2UL 3N41F 2WWMC 5BS0D 3TA3B 2J5WA 5IVZB 3LJ3A 2BMKA 4TLUA 4WNQA 3L9BA 3DWTA 4DGYL 4PJ8C 4B9JA 1INQA 1O9VA 3ESPA 1RK7A 2NQ3A 2W07A 5FO7B 4AYID 4XO3A 4PWKA 4P2RE 2BVOA 2A38A 3HZVB 4JZJC 2X1PA 1M1XB 4FQLL 4OCXL 3VFPA 1D5BB 1D5XA 4OZFB 4RIRA 5K33A 1T89C 4GIPD 2HT4C 4IRSC 1R3HB 1XF1A 4JVWA 4LPXA 2XRAL 4UZSA 3SKNB 2VDKL 4NDMB 3MRNA 1KTJA 3F12A 1U8KB 1TVHB 3K80A 2X44D 4K23H 1E4KC 2DQUL 3DXAD 5FYKE 4WTZA 2DWEA 1U36A 3U36B 5J56B 5A2JH 3H4HA 4F7TA 2B20A 3JVFC 3AUVA 3MUGA 3CH1B 4KK9C 4LSVH 4PRAB 4GG8B 2BCMA 4M61A 3RTQC 1DVYA 3AB0B 1YEJL 4Y4HD 3EDDA 1MN4A 1NEZG 4QUOA 3QZLA 1J1PL 4J23A 3BWAB 1E7UA 3CDFA 3A23A 5F1OB 3VDCA 1EHNA 3MLWL 5FK9B 1T6BX 4LVHC 4OF5A 3S35X 1E2ZA 1F4WH 4NO0A 3ZDXF 4YXHH 1NSNL 3FMGL 2H9GB 4WKXA 4PJIE 4XPBL 1V7NL 3VFOB 4KGLA 5EBWB 1FQ9C 2IANA 4I13B 5IJDC 4YX2L 1M4KA 2N1KA 4TNWF 5C0JA 4TUOB 5FGRA 2ZAGA 5BVJB 1BAWA 1MIEL 3QAZC 4PRDA 3EW3B 1PY4A 1X9UA 3D0LB 5EZIH 5D7HA 2MPVA 3BP5A 4BSJA 3HG0A 5E8OA 2A77H 2EIJB 5J13B 2VMFA 2Y1AA 5GHWH 5L88L 4JANB 1OQOA 2YD7A 5DZPA 1JPST 2J20A 2J4WH 4LBEA 2VABA 4PV8B 3QQ9C 5D2NA 4Y5VC 3SYOA 3IB4A 3AG2B 1MFAH 3IJ8A 1NCGA 5HHOD 3U6RA 1EFXD 2CIIA 4L1BA 4N5ED 5CN2A 1AGEA 1HH6B 2J6EH 5CEXA 3DECA 3K46A 4JDVA 3FQ1A 1PX8A 4PGDB 5HYQB 2GYSA 3N42B 3F83A 4HKBB 4X98A 3DPDA 1KGUA 3HB3D 4UTBA 4OZFH 5JIKA 1G7LB 3RL1A 2AJYL 4ZW8A 3B5HA 3DVNA 4WV1C 4L3CB 2B8OT 2K78A 2IOMA 3WEAA 1EAJA 2G4EA 5AYUH 2WZ6A 3T1FA 4KC3B 5IIEA 5E0QA 2AZUA 1B4LA 4MXQC 1EJFA 1QBBA 5GSRA 3U9UB 1UB5B 1YN6B 3IKKA 3CPLB 5EZOL 2KERA 3VNYA 4QHKI 3QIBA 3T08A 2CO7B 1KG0B 1W72L 5CR8A 4GMTH 3KJ4B 1GGYA 1QAWA 5L8KB 4OCLC 5CSZB 5FM5M 4KU1A 4KI5E 3BH9A 5DJ0A 5I0VA 1M7DB 4X6CF 5DRWA 2B2XL 3UTZB 3WDIA 2PWDA 4QHUA 3SYAA 1JGEB 1X5FA 1ZIBA 1KEGL 2HVJB 15C8H 2OW7A 1XGYL 3W0WA 1YMHB 4W6YB 3ZMEA 2RH0A 1JGDB 2GJZA 2FVNA 5EFIB 3LN4A 4NUJA 1D9KD 3C2AL 5I28A 2VDMB 4DP9X 3MRCA 1SLVA 2WTRA 4WWKC 1CL7I 3BPCA 1PGRB 4K71B 4J39A 3MV7A 3U25A 3WJLA 3S9DB 1XH3B 4RWYH 3ARTA 4HGKC 3EOYG 3WTVA 5DO8A 2BIPA 3RX7A 1BSIA 3ETBF 6CGTA 2APVA 5SWSD 1MLCA 2XIIA 3C08L 4KKLD 5JIIA 4PJBE 4DKFH 5L0QB 4G80A 3MROA 4JN1L 3DMMD 5AD0A 5ICUA 3WDJA 4YFDB 2G5UA 5EF1A 3IBOA 1QSFB 4Y2LA 1ZHBA 3LZQA 4IJ3B 1PG7W 3UBGA 4NP4H 1HI6A 4PRBA 1QPPA 1WGOA 3KG5A 3VXNB 3L1GA 1E8ZA 1IBGL 3BQUC 3ZE0E 3UYRH 3QIUB 4AGNA 3D34A 5TQ2L 5DRZA 4F7MA 3KYAA 3NH7L 4DVRH 3I6GA 1U95A 5F9JA 3RNQA 4B9IA 4E41E 3ILPA 1FVCB 3OZLA 3MRGA 3FPYA 2HLAB 4AJWA 2V5SA 4WI4A 4LASH 3M17A 4QRPA 6FABL 2FGWL 3EADA 4PRNB 2QR0A 3DJZA 5HHVH 5C6TL 2DAVA 2X4UB 4WEBH 3QRBA 2FX7L 4NYLB 3RKDC 5IFJA 2OJEA 4Z0XA 1OP9A 1C5DB 4PG2A 1IE4A 5IEKA 1CFQB 1XT5A 3K8LA 4MNGE 2JJTA 1XCQB 1UHVA 1LO0H 1TENA 1X5MA 3GTVA 4WTZG 2E9WA 4Y88A 5TDNB 1FSKB 1NIAA 5AAWA 3HRPA 3MNZA 3VXUE 4LLMB 4N0UE 2P8PA 3FFCA 4Y2DC 4UU9B 3IFOA 1OCWH 1UCTA 2ZOOA 5DUBB 5GS1C 1LP9A 2ZJSL 4UT7H 2GTZA 5GGQH 4AJYV 2VT0A 1UKQA 3RE0A 5F0MB 4AEHL 1BPLB 3AS3A 3T8MA 3CK0H 3GKZA 4P2YA 2VDMH 3EOAA 4ZTOH 5ID1B 4UI2A 3GXDA 3GRGA 4QRAA 2AJXH 2BOLA 4DFHA 1LMIA 1WBYB 1S9XB 4N9OB 2JJSC 2G9HB 5DUML 4KK5C 5FXCH 3MCG1 1BMWA 4YDMA 3P30L 3ZDZB 4KJQC 3GKWH 2YUWA 4ZSOB 4GRLB 2UUDH 2R29H 2IBBA 3QEQE 1WWBX 2CCVA 1KGXA 4X6DB 3GJFH 5FO7A 3SDYH 4WGWB 2J6EA 4PN6A 3HZVA 3AG1B 3T3MF 1WFJA 1M1XA 5FYLD 1IIKA 1NCOA 2CRIA 4HS8L 4JFOB 4O2CB 2VN5A 3SGEI 1D5BA 2OMVB 1OF2B 3FT0A 4OZFA 1QNIA 2QGBA 4F37F 5I0XA 3OM3B 1Y0LA 1FC2D 1RFDL 2NNAA 5AL8A 1R3HA 2AEPH 4I0PB 3SKNA 1M05B 4NDMA 1GJWA 3FHAA 1Q4NX 5C0NC 1U8KA 1TVHA 4URTB 3MLVH 4POZD 4AQEA 4BA0A 4HWBH 3T0VA 5CIPB 4LU5H 3PF2A 4YSPA 3WNIA 4XC3L 5EULV 3KYNB 2XYCA 3U36A 1IMHC 4PUBL 3CH1A 4PRAA 4XR8C 4GG8A 1U8QB 1KGJA 1RH8A 2GJ6B 5AVWB 1UYWL 1X7TA 3GHBH 4YQXH 1CL7H 2YWYA 2XWRA 3LSOB 4LPVA 1L7TH 1W16A 4MMXB 3DJ9A 3BWAA 3JWOC 3MJWA 3VB8A 1QTSA 1YLBB 3F05A 2EEXA 3NIFB 1OW0A 1FZOB 1UURA 3MJGX 2XQYA 4FCHA 4JAMB 3L95B 1L9QA 1LEGB 2OCJA 4PJGE 3O0LA 2H9GA 3BKYH 3TWYA 2O5ZL 3VFOA 1Z5LB 4MQTB 1TG8A 4IRJB 5EBWA 2JELH 2YKKA 2W5PA 1BHGA 4TUOA 4JHWL 5BVJA 5C07D 5TE6H 1TQTA 4N2BA 3D0LA 3F58L 4OGXH 1X5KA 3ZL2A 3DIDA 5C2UB 3CLWA 1F0LA 5C07E 3ZE2F 5E9NA 1QRND 4JRFA 4LPUA 3FQRB 3GZQA 1W8EA 3D39B 3HUJE 4XNYL 3UTPD 3IMTA 3HHRB 3FQTB 4JANA 4JCLA 2G3NA 2FT7A 4K2UL 3N50A 1QRNE 1AR2A 3RAJL 4OCWL 2K7QA 4YC2C 4FULA 3FTYA 1XIWB 5ESAB 4HHAB 1AFVL 3MFFB 3S34L 1XCTB 1T7ZA 1FYTA 4PGDA 1QR4A 4GRMB 4XI5D 5EBLA 4HKBA 1TTBA 5CJOL 4G8AC 4KKQA 4Q8BA 3GD1C 1G7LA 3RVTD 2ZPKL 2ZKHL 1OPOA 4KDVA 3FS9A 1A6PA 2X4OB 3G5YB 5CIPH 1CICD 1RIUL 3TM6A 3HA0A 3PWPB 3NP4A 1GGCL 2CUHA 4I18B 3IJ7A 3O8XC 1MCQA 3ZY7A 4XNZC 5DS2A 3U9UA 1UB5A 3CPLA 3RA7H 5ES4B 1GIGL 1IKFH 1A0QH 4OLUL 4PJ7B 4PWHA 4ZW5A 4G5ZH 1SFDA 1DFXA 2CO7A 1KG0A 3QQ3B 4I9XA 5I6PA 3WFZA 3D9AH 4O00A 1FL6B 2YC1B 1OAKL 2UXVA 3GPEA 4AGPA 2OR9H 3EOTL 5CSZA 1MPAL 3B2XA 3JXAA 4N8VB 3K6SB 4GY4A 1NC2B 1M7DA 3UTZA 4JB9H 2H2PD 1R17A 1JGEA 1SEQL 2NZ9D 2A9MH 1G5AA 3E0GA 3QNFA 4YHKH 2NLJA 2HVJA 1SUHA 4RBPH 3CLEL 1YMHA 3VWKC 4GXUM 3FN0L 4FFYH 2J7LA 5I6XB 1KB3A 2H32B 5EFIA 3WO3B 3SGEH 2ZF8A 3PXHA 4A2LA 4LRNL 1I1RA 3QUXB 2MSPA 1A4JB 2UUDK 3V0WL 3HZ3A 2FBJL 3QCTH 5FM8A 4FA8A 4H8VA 2CUMA 5LJYH 3LZFL 3WJJA 1QNZL 3RRQA 4HSQA 3F3HA 3QJHB 5I6KA 1RZ8B 1XVSA 2R51A 2R23B 4W6XB 2XPGB 5AUMB 2NY3B 3D69B 2OPCA 2FEEL 3AS1A 5KS9B 4DGYH 3AUWB 1XB8A 3IAPA 4XN2A 5CSBA 3MLRL 1QSFA 4O4YH 5HI4D 3GJFA 3B2UC 1A6AB 4OZHB 2XFGB 4OCXH 4PTUA 5HDWA 1TKWB 4LHQB 3VXNA 5KSUB 2EVJA 4HWZB 3JQOB 4K3JL 3QIWD 4J3OH 4XZ4A 4G5AA 3QIUA 4N2AA 4K7PY 4TNFA 3IGAB 4R97B 3A67L 3GINA 3ETSA 5INDB 5D7LE 2DQUH 1FVCA 2HLAA 4HWBA 3T0DA 3FKUS 5I1CH 2ENQA 4PRNA 3RIFF 3CFIC 2GUOB 3FB8B 4OZFG 2P5EE 2X4UA 3FYIB 3T4AB 1KCSL 4NYLA 1UACL 2ZUTA 3H85A 3IDXL 4ODTL 1C5DA 1YEJH 2BC4B 1CFQA 3OLIA 1AGBA 1FVEB 1J1PH 5KBDA 5CLTA 1MCKA 1XCQA 4J2XA 1P69B 4V1DD 5TDNA 1VPOL 1F2XK 5EORL 2DRUA 1NSNH 1KIQB 4LLMA 1GC1L 1GY1A 3L5WB 2LU4A 4UU9A 1H0DB 1V7NH 3QEUB 1MW2A 3NABL 1JTTA 2YRZA 3FN3A 4LSUH 4V1DE 2X7LA 3C5SB 2DM4A 5DUBA 3SDAB 2DW5A 2ZXAA 1N6QL 3QS2A 3B9KC 2W92A 4NOFA 1B4RA 4YNYB 1MIEH 2CLRB 1IVTA 1TQBC 3EHBB 2J1KA 2H6OA 1A47A 5LDSA 5GISH 4Z7NB 3WHXB 2MOVA 5FECB 2XQYG 4A2MA 5ID1A 2P7TB 5DUJA 3TGXA 2YD2A 8PAZA 1WT5A 5E9AA 5D71H 1WBYA 1S9XA 3EYSL 2G9HA 5IW6B 3MFGB 5IB3B 4ODWB 4ONGH 3PJSA 2CRZA 2G2NA 1IEHA 3GTTA 1RZKC 2BSBA 2NY1B 1EZLA 1L6ZA 2L8AA 4TTDD 2M1KA 4QRFA 2VM4A 4OCNC 4ZSOA 3CLFH 4GRLA 1ZLDA 2HLFD 4X6DA 4K3EH 2HVKB 1RZIB 1LTXA 3FO9B 3L7EB 2L0DA 4XHQA 4K8RD 1E9QB 4NC0B 4JFOA 4O2CA 3F8UB 5IHBA 2OMVA 1OF2A 3P69A 4OFDA 3O3AB 3P3TA 2GSIB 1DN0B 4PFEA 4WHTB 4Y2NA 1KXHA 4NQEE 4PREB 4FL4B 4I0PA 2A9BA 4MA8L 3LRKA 1OM3L 3SO5A 5DHMC 5FYJE 3QJXA 1X44A 5CIPA 1MCFA 4NJAL 1JI2A 3KYNA 4PJIF 4WNSA 5HVHB 1BLIA 5EZOH 1E65A 5IHHA 1G4MA 2GJ6A 4OTXH 3WNMA 1YEIL 4L5FL 2DN7A 5ECGA 3LSOA 4WI2A 1Z7JA 4MMXA 3ZYZA 2ID5A 4HV8A 4X8GA 4D94A 1FCCA 1FZMB 1OAYL 1ZKAA 1WYJA 2HH0H 3HN5A 1FZOA 4JAMA 5ETUA 3L95A 1LEGA 3G9VA 2IAAC 4CBZA 3SY6A 3R18A 4FZ8H 4K9EL 1Z5LA 1PG7H 1VCAA 3P0YL 4JFXB 2GUYA 4ILDA 4UAOB 4EE2A 1KTDB 5CU5A 3TCXA 5ACMA 3D4GA 2AQNA 1JZ3A 3A24A 5T5NF 4FFYA 5BQDA 4QCIB 1E30A 3LPPA 4CVZB 2ZNWA 4BSVB 1O7DC 4NC1E 3FQRA 4JY6B 4BH7B 3ULUC 3F2LA 3D39A 3ARFB 3ARZA 2V0AA 2CD0A 4ZAKD 5HTSA 2FR4B 5JPMA 4UM9D 1S9WA 5K1JA 3CN0A 1CDBA 4C57C 1JWUB 4OJCA 3FK3A 1XIWA 5ESAA 4XB8A 3QI9C 1MVYA 4HHAA 1B2WL 1XCTA 1SHXA 3BN3B 4FFTA 1R5IB 4I0KA 4PRHD 5K9QG 3LKQB 5JUEL 4LEXH 1HCFX 4D9LL 1KXQE 1E5CA 3LZNA 2VR8A 3F5WB 3MO1B 2YJQA 3NRPA 2IDQA 4QRUB 3GXIA 3ZRCC 2W91A 3DX3A 2D3LA 2X4OA 5DHYB 2K1MA 3G5YA 3NH7H 2N3JA 4Z7IA 5B7MA 3GLEA 3QUKB 1F1AA 3PWPA 2V7NB 4I18A 4MB4A 4KI5F 4L4TB 4GMSL 1FF5A 1AD9B 1UD4A 1UVQB 3KWXA 5I0WA 4LLYB 3VB9A 2FGWH 2NPLX 4PJ7A 5TF0A 4L18A 4PJDA 3GSWB 1V7MH 1OGAD 4LSPL 5FGBC 3RVUD 1NGYB 3KPOA 2FWOB 4LMQI 5ECJE 3QQ3A 4IDJL 4TRPL 3BP4B 5L4FA 2IJ0C 1KPVB 1FL6A 2YC1A 1KCWA 5D1XE 2P8MB 4N8VA 3K6SA 2WAHA 1NC2A 3DVFA 3TBVB 4N0FA 2QBWA 3GBLA 4N0CC 4C4UA 3SO3B 2ZJSH 4KITB 2X6VA 3QS3A 2FB4L 3RWFB 3A4FA 3QYCA 3VWJC 4Z76B 3MOBH 3CIAA 4PJBF 2H32A 2MWCA 3DTDA 4WTXA 5GGRB 4DPAX 1JHTB 5C0BD 1G7QB 4JGJA 1XCXA 3QUXA 4CMHC 1A4JA 3DHUA 3I9AA 5I6LA 3US0A 4B9KC 1HZLA 4JO4H 4X6FB 1JXDA 2A73A 4JO8A 2J3SA 5EEWA 4EO5A 2BSEA 3S36H 1GAFH 3JVGA 3QJHA 3SE9H 1EZVY 2P45B 3P30H 3ZE0F 1RZ8A 1CE6B 4X9FA 1VJSA 2R23A 4OD1L 5AUMA 3D69A 1QI3A 2BP5M 5DMIL 2MOGA 5HYEA 3T8VA 2VDLL 1IGTB 4ZMWA 1A6AA 5IFHL 2ZOUA 1H6TA 2BY3A 1TKWA 3ECVA 1OT1A 4HS8H 5KSUA 3VMOA 3E2HC 4LLDB 2QADD 3HE6B 4HWZA 5HDBE 1G43A 3IU3B 4A7TA 4CUCA 1OGTB 2MPAL 3C60C 1PZUB 1RFDH 2YAEA 4YN3A 3IGAA 1FG9C 4HK0B 1RZGB 1F42A 1OGSA 4OIAA 5INDA 3NPSC 4ZX5A 1SBBA 4FG6D 1JPSL 4NEHB 3WFDL 3K71A 4C56D 2EE2A 4XC3H 4HIPA 2Z65C 1KY7A 5CJQL 4W9IC 4U7MA 1C9SA 3FB8A 2GUOA 3VD1A 1Y7VA 2IG2H 3DX4A 3QFJD 3T4AA 1MRFH 2DQGH 2IPUK 2LW3A 2BC4A 3QXUA 5TE4L 1YEWA 1J0YA 1FVEA 1VGKB 3VO0A 5ELIA 4FQHB 2B16A 4K94L 5IMKA 3ZDWA 5I1GL 1KIQA 1RP9A 3QXTA 3L5WA 4N6RA 4KGJA 4AX3A 2O5ZH 1H0DA 2PO6D 2ZCHL 1A2YA 1A3LL 3QULB 4HJTA 4N8UA 5DK2B 1MY5A 3C5SA 3IJYB 4PVLA 4TLKA 1KYUA 3SDAA 1KTKE 3MLUL 4JHWH 4OLYL 4YNYA 2CLRA 3GFUA 3K6FA 5CO1A 4R26H 2WWKT 3F58H 1RV6X 3WHXA 4FXGB 5FECA 2P7TA 4DP2X 1TZOA 1GPOH 5HI5D 1NIDA 3G6JE 4GQZA 2VDQL 4X9GA 4XNYH 4EI6B 1EMTL 1U3HD 3HI1B 5IW6A 4NXKA 5B1JA 5IB3A 1IFHH 4ODWA 3ULVH 3EJZD 3SYQA 2PCPA 3FUKA 3PAYA 4MA1B 2XTLA 1D2PA 3GHEL 5FX3A 1NGQL 3WBDA 4JK0D 4PBVC 5IOKA 1AFVH 3RI5F 5CINL 3S34H 1FPTL 2HVKA 2VRQA 1RZIA 3FO9A 3L7EA 2XT1B 4Y19E 2DYPB 5LB1A 2VR3A 1BCIA 4JMNA 4XCEB 5JXED 3A4AA 1E9QA 3KGSA 3EYFB 4W4NA 2EDMA 2WOBA 3NIDE 1F1GA 2Y24A 3O3AA 3OMNB 2GSIA 2E56A 4WHTA 2VLJE 5JW3L 2ZKHH 3BAXA 3RY6A 1ZDSA 5IFAL 3H9HB 2TRYA 5DS1A 4YSRA 4ADIA 1MCPL 2MH4A 5GS0L 5EOCJ 4EIUA 3PHQB 3QJUB 3TPUB 1RIUH 3ZW3A 2GHWB 1S9VB 2BFVH 1QW9A 2FT6A 4XCNB 1UM4L 3QDGE 3QHFH 4ELME 1GGCH 4X6EB 2DTSA 5DEGB 5JHMA 2ZXWB 3CDCA 2I7OA 2O4EA 4L29B 1CVSC 5JHDE 3WTYA 1BD2D 3MRHB 4OLUH 3I02B 2VUOA 2V33A 4NGHL 4Z0BL 3TH3T 4JFHE 2VM9A 2UWEB 1K3IA 2XIBA 3RDJA 2CKBB 5L4IA 1E3ZA 2BVPB 1BD2E 1FZMA 2V7HB 1E9PB 5FFLA 4WI6A 2C9QA 3EOTH 3HUJF 2HT2D 4JPQA 3T04D 1NL0L 2VM3A 3KW8A 3L4TA 4Y4KB 4H8WL 1RD6A 4ZNEA 3UPRB 1QSEB 3IXAB 3OF6D 3RWDB 5IB2A 4EAEA 4YSDA 4L8SC 1KTDA 1ONQB 1I9EA 3DUUA 4LAJH 4Z3IA 3T77B 2BY2A 3JYBA 3GRBA 2JF1A 3Q9PA 3FN0H 5GZND 1Q0XH 4UQEA 4X0NA 4NNYA 4ZOEA 3F01A 3WKYA 2GAZA 4YGAB 1K5WA 3VXMD 4QCIA 4H26B 4N8VG 5F0PB 4CVZA 4CC4A 4BSVA 3QDJD 3V0WH 4JY6A 4BH7A 1H19A 4HC1A 3OB0H 3MV8E 3S35L 2AQ1A 3ARFA 4HF5L 5AVYB 2FR4A 2J5LC 2X1WL 1LXMA 4DP4X 2NX5E 3SBPA 1NANH 1G4RA 3BHBA 4YPGB 2VERN 1KCRL 4B3VA 2C3WA 2ICCA 1JWUA 2BERA 4JFWA 3OGCB 4YSTA 5IQMA 3WSQH 1R5IA 3FW6A 5FO8B 3MLRH 1AACA 4PJ9D 1QI5A 4S11A 3LKQA 4OCMC 4XHJC 5EHFA 4WEUD 1PZ3A 4PJCA 4F15B 2AK4A 2P3YA 5CUSL 5E56A 3TN0D 5DFWH 2XJLA 4UNTA 4JRYB 3F5WA 4HWNA 1OPGL 3MO1A 2HFFB 5IJKC 5JOPD 1WWWX 4OJEH 5DHYA 4APQC 3ABKB 4WK0B 3D50A 5C8JB 3KYMB 1J0KA 3A67H 3LYRA 3QUYB 4OFKA 5IMOB 2V7NA 4ZFGL 2ZYHA 4L4TA 4UDTB 4F57L 4F7PB 4JFQB 1UVQA 3WIIH 3GDBA 3T4YB 3GSVB 5D1QA 2DEXX 2DMGA 1KCSH 1KCUL 1UACH 5C3IA 3QYNA 4OV5A 4ODTH 3GSWA 2OK0L 3U1SL 4HCGA 2CKBH 4YBLC 3NSJA 5H2BB 1JDCA 2FWOA 3FU7B 2J1XA 2XWDA 3BP4A 5DEFB 1NCIA 3BSZA 3KJ6L 1ZLUH 1U8JB 4PR5B 3RFRA 2ZAHA 3SDDB 4F5CE 4Z8FH 2P8MA 2YD3A 5EORH 3L3JB 1GC1H 4FCAA 4GH7B 2IAMC 4PBXA 2E5EA 1S9YB 2W0FB 1N6QH 3RWFA 1WICA 4NSKB 4P46C 3WY4A 5KSVB 4XMVA 4Z76A 2HT3C 5J4MA 1SQ2N 2IH9A 3VGHA 3ZR5A 1PKOA 4ZFOB 1G7QA 5B1CA 1BJMA 1I8MB 1YYML 4FNLL 4HJIA 3MYZA 2CNYA 4X6FA 2F2HA 3VFMB 2E7CA 2BNRB 3UTTA 1QA9B 3EYSH 3PWVB 4P2OB 5I1JL 4WJ5B 4QMEA 3F7PC 4Z7VB 3FUIA 3IFPB 1CPUA 3KAAA 2DQDH 3OSVA 4X6CB 4AVJA 1NBZA 4JGUA 5C6PB 1UZ6E 5BUPA 2PKDA 2CBMA 4LCCB 4S1SL 5C08B 2WPGA 1P1ZB 3RHWK 1SBSL 4NWTL 3P2BA 4UM8B 1IGTA 1TJIL 2I5YH 5B8CC 5T3ZE 5I1KH 2ZNXA 4KDWA 3CV5A 4E9QA 3DA0A 2WIMA 1KUMA 2QHRL 4LLDA 3HE6A 4Q6IB 1OGTA 6TAAA 5EEZA 2QLVB 4NQXB 4UILH 1DVZA 4AV4A 4HX1B 1C7SA 4HK0A 4MA8H 1RZGA 1OM3H 1SF5A 3FU6A 1A7PH 1H5BB 2WNWA 2CHZA 3UZEC 4BZ2H 3T3PB 4Y16B 2VDRL 4DAGH 4OCYL 4G6KL 5FYKL 1Z9MA 4PLJD 1BZQK 1RU9L 3WKNA 2H3KA 4ZZFA 4L5FH 1S78D 4RDQF 2R2EB 5TK4A 1VGKA 2ZX8A 4RFOL 2RQ8A 5DZNA 1OAYH 4R7VA 1FA4A 1JZGA 1CFMA 1U3NA 4KMLB 1JIBA 3CSYB 3B2PA 3GYRA 3EJPA 3NDYE 3RGVD 2DEWX 4K9EH 2B15A 5DK2A 3QULA 2JIXD 1NAKL 3CFEB 3P0YH 1JSYA 2YOAA 3IJYA 1R75A 3PJLA 3AJ7A 2ICEC 1RMFH 5KSBE 1NLDL 4P2CG 3KM2A 4P59L 4FXGA 2DH3A 1AXSB 4GQPH 4H25B 3EFOB 3GDCA 5C1MB 4EI0A 4EI6A 1G6RL 3HI1A 1TTCA 2X42A 1QP1A 1M6UA 3AXHA 4PI0A 4WKZB 3CHQA 3QORB 4NN7C 3MTRA 3FO1B 3TS8A 1RJLA 3T0EE 5IJBC 1AQDA 5DEJA 2QSTA 1D6VL 1WWAX 3FT3B 3C5JB 4JPWH 2ZX5A 5DLMH 1TJHH 1WC7B 2DYPA 1BM7A 3C6LB 1XGQB 4XCEA 1KFGA 5JUEH 3EYFA 3NJLA 5T1DL 4D9LH 4Y4FD 3WFHB 3KGUA 5A2KH 3H2QA 3V0EA 3H9HA 5EPMB 5CBEA 4WFGE 1VFBB 4EOWH 4LOFA 3RZWA 3WG7B 3PHQA 4Y9EA 1S9VA 3RVVC 3TO4A 1IGYB 1QW8A 3QHTC 3A22A 3W11C 4X6EA 4DIXA 4MQXC 4MYWB 3FBKA 1I85C 5MEOB 4L29A 3E6HB 2GQHA 4H2CA 2DV6A 2WINB 4YK4C 5AOIA 1L0YA 3MRHA 3I02A 2H0FA 1Q72H 2K3HA 4S1DD 4LSPH 5J06A 5IW1B 1UXSB 2UWEA 4F58L 2X12A 3W9DB 4IDJH 2CKBA 4TRPH 1CO1A 4ONOA 2BVPA 5FUOL 2V7HA 1E9PA 3F00A 2Y7MA 2XA3A 2GEQA 5TFSL 4ODVL 4Y4KA 4KKCD 5CGMA 5HYIA 1MHCB 2WWNA 4BSWB 3UPRA 1IZKA 1QSEA 3IXAA 4GNKB 4KQ4L 3RWDA 3QGVA 1E67A 4FYSA 3T77A 3WKML 1T1ZA 3X13B 3CZUB 4H26A 2O6FA 4H4NA 3VFSB 4B9PA 5F72S 3MOQA 1XFPA 4M4PA 2V17L 4N2EA 3VXRD 3HNTH 3H7BB 5CZKA 1BJ1J 4ACTA 4FQJL 3V0FA 4YPGA 2NY0D 4KXAA 4WHCA 3TO2B 1H8NA 3TOPA 2Q0ZX 3VXRE 4OD1H 32C2B 3OGCA 5JDSB 4Y1AD 4H1LH 3N91A 4XMKH 2ZT9C 5EU5B 5FO8A 5I8CA 1O6SB 4UZUA 1IT9L 2V5MA 3KPNB 4DOHE 2EE3A 4Q9RL 4XWGL 5ADOL 4TTGA 1G7IB 4G43B 4JRYA 2MNJB 4AE1A 2EILB 2HFFA 1KCLA 2MPAH 5J12B 2OMYB 5C8JA 3KYMA 4PG2C 1V3LA 5KSAC 3HG1E 3QUYA 3GNML 2W95A 4M6MH 3MA7B 5IMOA 3WFDH 4UDTA 4F7PA 1L6XA 1P9MA 4JFQA 2PP9A 4ETYA 4XMPL 3T4YA 4BZ2A 3GSVA 2QPUA 2YEZB 3DO3A 4M4RA 2NY5C 4FI7A 2ITFA 2H3NB 1NM9A 5H2BA 2WJ7A 4KO5A 2DQIL 5TE4H 4KPHH 4P23D 2N4IA 1U2YA 3OL2A 1XR8B 5DHDA 1U8JA 4OQTL 1XGPB 4LO9A 2CBTA 1OAUH 2YSTA 3SDDA 5B1AB 4CW1B 1RULL 4LP8A 3L3JA 1RZFL 4MS8D 4NM8L 4WENB 3S3BB 5I1GH 4UNIA 3KXFE 1N7ML 3DOSB 3GUTA 1A3LH 4HEMA 1JG9A 1S9YA 2W0FA 3OZ9H 4KJYB 1KJ3L 4HCIA 1Q9KB 4NSKA 3D4CA 4W1TA 5KSVA 1INEH 3VFVA 3AVEA 3TA3C 1HK6A 1NFDE 4AI7A 4ZFOA 4L0ZA 1I8MA 3O81A 1DLHB 2YXWA 1AY1H 1DQKA 2AJZB 5HHMD 2VDQH 4P2QB 3ZHFA 3TFKC 2BNRA 2F19L 5E03A 1QA9A 3PWVA 4P2OA 3UTSD 4ZX6A 4WJ5A 1FLRH 2UXTA 4ISVB 3CDGB 3IFPA 2Q7YB 4W9CC 5HDBF 3MRDB 1XL4A 2D73A 3WY2A 3F64A 4IIQC 4OZIE 1NGQH 4X6CA 2X2YA 5MP6L 4YPJA 2ZUYA 3ZTCC 4H13C 1CYWA 5CINH 5GRJL 3ET9F 4LCCA 1FPTH 3OVUB 1P1ZA 5C08A 4A2DA 4F7CB 1QABA 5FLUA 1S3RA 1N18A 4UM8A 5LAXB 5AB0A 2EVFA 5BMFL 2HYMA 1EGJH 4UBDD 1G7HA 4DP0X 1NCCL 5CJXC 1TTFA 4Q6IA 4JKNA 1OAQL 2BXYA 4MWFB 4XP4H 2XBDA 3T2PA 4DHLA 2JH2A 4NQXA 3GSXA 1WJ3A 2QGEA 1DDHB 4A7GF 1CVRA 4HX1A 5KSAB 3TZVB 3AB0C 1E4XL 5GS0H 4U6XB 5K9JL 2WQVA 1U8OB 5A6LA 2P43B 1H5BA 3AABA 4KVPA 4AEFA 1J9TA 1UM4H 5EEYA 5A2BA 4Y16A 1DL7L 4G6JL 4ZPVB 5KZCD 4EF3A 4ZXBB 1G7MB 3FU5A 4P04A 1U3YA 1MFEL 3ZVVA 2OMZB 2EP6A 4JM2B 2VJ0A 5FHAL 2R2EA 2OZ4L 1U3JA 4PGZA 5LLIC 1UWXK 3FDWA 4LEBA 3O11B 5I1LB 3R06A 5C0AD 3CSYA 2X3CA 1NL0H 1YY9D 4LCWB 5J13C 4X5WB 5T3XL 2H26B 4MCNA 3AS0A 2F54E 4UYPA 4MDRA 3VU2A 4MAYD 4DETA 2Z4TA 3F6LA 3ZZ1A 1AXSA 4PV9B 4H25A 3EFOA 4I1NB 4W9KC 4KRPB 2AXJA 3VTMA 1Z0NA 1IGCL 2OX5B 3S35H 5E6ZA 4HF5H 1KDIA 4ES9A 1F6AB 4WKZA 5EUOE 3EBHA 3NIDF 3QORA 5EF0A 1CK0L 1OALA 3FO1A 4L3ED 1KCRH 4PH8A 3EUDA 5DWUL 2XN9E 2E27L 3MI6A 3QO0A 3R7QA 1RK0B 3ZKMC 1IEAB 5FWQA 4ELMF 1F11B 1IGJB 4ENED 4H1LA 2B77A 4FXKB 1CFSB 2BHFA 1WC7A 3C6LA 3QWRA 1XGQA 1YJDL 2XICA 1WAAA 2P46B 3Q5OA 1IQDA 2X05A 1ZTXL 1V3MA 2J72A 1JHLL 1OPGH 4KKAD 4RMRA 5D4IA 5EPMA 4YUEH 3O41A 3P4MB 5DC2A 3BUIA 5JDJA 3KJ4C 4F57H 4F1SA 4GAJL 5L9DL 3QHZL 3PWJA 3GSNL 3Q5TA 5MEOA 1WRFA 3E6HA 1KJ2L 2WINA 1KCUH 2OK0H 3U1SH 5IW1A 1UXSA 4LZKA 4NAMA 3WEBA 2FECI 3W9DA 1JE6A 4JG0L 3KJ6H 4BXSV 1UZGA 4N9GB 1AC0A 1H6EA 3FFOA 5DD6A 5E9DE 1BVLB 1WHPA 3D08A 3WELA 4AQAB 4K71C 4FNSA 3WJJC 2OYPA 2N7BA 5HHXL 1DBBH 1EAOA 5I73B 4KTDL 1A6WL 1QO3B 2GPZA 4XVJL 4PJIB 3X13A 1AZZC 1REIA 4F8LA 3BAEL 4YAQB 4HT1H 5L0QC 1PZ2A 1S7QB 4FNLH 3VFSA 2W60B 3EF7A 3LN5B 5DC9B 3BJLA 3L17A 4JY5L 4X9HA 2EKSB 5FYKU 4BXVA 5I1JH 3QC5X 3ULUE 4N2KA 4IJ3C 3D09A 4I48B 3TO2A 5LO7A 32C2A 5JDSA 4ZX3A 3QIUC 1T83A 2CDGA 1OTUC 1QZNA 4U1LA 5EU5A 2YAFA 1SBSH 2QZ5A 3SCMC 3F65A 4XO4A 1MWAL 3GS7A 1TJIH 3KHQA 3KPNA 1JMXA 4PGBB 2AXGB 3F7KA 3M86A 1EGJA 1OANA 4GSDH 4PGEB 4G43A 3KDMB 1KPUB 3EZJB 3KCPA 3QZMA 2X70B 3NSDA 2PR9A 1GHFH 2OMYA 5AZEL 3MACL 2HG5B 3EH1A 3EO0A 2VMEA 3MBXL 4FRWA 4KJWC 4OI7A 2K7PA 1QTYT 4WUUE 3MA7A 4IKJA 2FX8L 3DRQB 3MDJA 1TIUA 4XO5A 4OCYH 2YEZA 4G6KH 3FH5A 5FYKH 3GBML 3U2JA 3KLDA 4RA0C 5I30L 2ZAIA 2NT0A 1BOYA 2H3NA 3L5HA 5DRXB 4XVOA 4HMDA 1SVCP 1C5BL 1DVTA 3LKPB 4PRIE 4KHTL 2E9JA 4RFOH 5I8KL 1YYCA 4QNPE 3FCGA 1XR8A 2K70A 3BUDA 2EDXA 1XGPA 1MI5D 1N3NB 4CW1A 4I7ZC 1MQ8A 4N4YB 3Q1EA 2BP8A 3UYPB 3IE9A 1H3UA 1CXLA 1WT5C 1UXMA 1RIHH 1IC4L 2ESVE 1TCRB 3DOSA 2CWRA 2CCLA 3NZUA 4KJYA 1SLWA 1Q9KA 4ODXB 3LKNB 3CSTA 4L9LC 4BK5C 3PGFH 4QI3A 1YC8A 2JK5B 4EXKA 5CU9A 4P59H 1UZ6F 4DUXA 2J56A 4XVUC 1WIPA 3KPRD 1PSKH 4DT2A 2AJZA 3F6IA 2YRLA 4M5SA 4ALAL 4P3WA 1AI1H 4P2QA 1G9NC 3QUZB 1S7WB 3LQZA 2OBGA 4L37B 2D9QB 2I9LB 1MW3A 3CDGA 4ISVA 3L1FA 3MRDA 3DK2A 1EZSA 4UZGA 3AT9A 3RVXD 4XCYB 3NEOA 1D9KB 1YEGH 4NQCD 2K4WA 3ASOB 4Y8DC 2Y0SA 3CVIL 2H4EA 3DJRA 4WGVB 4F7CA 3FU3A 2JKTM 3MA9L 4OLWH 2ENJA 5LAXA 3VFNB 1P2CA 1IGIL 2AABL 1NUFA 4NQCE 5D6DA 2J2ZB 1A1OA 2WLKA 1M9WA 4JMXA 5T1DH 5SWSB 3HBZA 4ZO9A 3UJTL 4ZO6A 1FLTX 4DWHA 4YS4A 4G8FA 4G7VL 3DMMB 1DDHA 4KUCD 4XAWH 5FHBL 3TZVA 5KSAA 1EZVX 4PWIA 1OZTG 5CAYB 4U6XA 4H1LG 1U8OA 4L4VE 4MMXC 1BV8A 5DJZB 4ZPVA 1FFNB 2NDGA 3NCJH 5FYJL 5PCYA 3BCFA 5DD5H 2EDRA 1N10A 4ZXBA 1G7MA 1ZTMA 2YA2A 4NKIL 4I5BB 4HBQA 4HA1A 5DT1L 2OMZA 3QPXL 4JM2A 3ZKNC 3Q2NA 4IRJC 3DX6B 2L04A 1P4BL 5KSBF 2RD0A 3MKKA 1W8OA 2G4GA 3FSWA 4ZMQA 3O11A 4FFVD 4DTGL 5I1LA 3H3PL 1P7HL 1A6UH 2X9YA 5TFSH 2EDFA 1L3NA 2FK9A 4ODVH 1CDJA 5IV2B 3L1EA 2QTVA 2XWBB 3D33A 4MMZA 2D7MA 1O7SA 4X9IA 4LCWA 4PJXB 4KQ4H 3WE1A 3ZMNA 4XN4A 3GB7B 2H26A 2NQDA 3FT1A 4N0UB 2UVEA 1D5MB 1V54B 3WKMH 2XLLA 2VZ3A 2WBJC 3WDHA 2Z92B 2ZYIA 4OF6A 2DJMA 1ITBB 5E5RB 2VC2L 4PV9A 4Z7UE 4UB0L 5DO2C 2C9VA 2AANA 3NK3A 2J21A 4NKDB 2OX5A 2QZQA 2V17H 4XPTH 4HQQL 3BKCL 3IPFA 1F6AA 4YHLH 1UJ3B 3VFRB 1OWRM 3HTLX 4N0RA 3FQ4A 3D18A 3EO9L 5ACZB 1AQKL 2A6JB 5LGYA 4J27A 3C8KA 4HXBH 4U1KA 1IEAA 1WZ1H 1L9OA 3EJYC 1L9SA 4Z3GA 1F11A 1IGJA 4FXKA 1CFSA 2ZX7A 4G11A 5D4QA 1IC1A 4N2NA 1IT9H 4B60A 5J9PB 2M83A 2XOTA 4FABL 2RCSL 5F97E 4D9QD 4XWGH 5ADOH 4Q9RH 2Z91B 3PAZA 2DQTL 3QEQB 5DHVB 1TETL 4XN8A 1OAZL 4A6YL 1EJ6A 1LNUB 4P2RA 2AV1B 2X2UA 4D9QE 3CSGA 4I3SL 4M6NL 1X4YA 3GMRB 3GXTA 1JYWA 4Y9BA 4TSAL 3WGUB 4F2MB 5IQ7H 3GNMH 3GS0A 3ZMRA 2WZ5A 5FWRA 3DSNB 1M7UA 3F04A 1BZ9B 3BKML 2CK0H 2ENSA 5GGSY 2G3MA 3BT2L 4R5XA 3I75A 1E4WL 1KGCE 5T3XD 3TF4A 4KTGA 3VGBA 1PLCA 4RISH 2DQIH 1AXIB 2YSSB 4KZ0A 5JW4M 1JXGA 4FXTA 5KYYB 4N9GA 1F3JB 2BIIA 4G7QB 4PJFE 2XKUA 5I6XC 5CMAB 4DERA 3I6KB 1T5WB 4X9BA 1BVLA 1E5AA 1RULH 1RZFH 3EYOB 4NM8H 3N1FC 3T0BA 5CCJA 5CEZE 2MEJB 4AQAA 3D3VE 1OO2A 1SNRA 3LPFA 3R4DA 4ZUWB 5KYXB 1Q1PA 4PJGB 1QO3A 4BFGA 3OC5A 2WQRA 3BYYA 4PJIA 2BVQB 1P6WA 2Z1PA 3BO8A 3T6ZA 4GP8B 5FW8A 1BQHB 4L4JA 1UGKA 4IJTA 3JV4B 2XZAH 3OKYA 1NBCA 4YAQA 2YBRB 1S7QA 2WAQA 4QF1B 3LN5A 3OMAB 1JDAA 4YHIB 1HILB 3R8BB 2EKSA 2F19H 1MAML 3DROB 2LOEA 5E2WL 3VUAA 3IJSB 5C07B 2V5RA 2WB1A 3CZGA 1TJMA 2CNZA 2OULB 5D1ZD 1NCBH 1I9JH 4Y7MA 3SGDI 3PUUA 5AB9A 5MP6H 1DFBH 2HTKC 4W4OA 1QRNB 5GRJH 2F18A 3IM1A 3KVQA 2EDNA 3X1NA 1KEMH 2DLHA 5GJSH 1A64A 3LIUA 5BMFH 2XN1A 2NUTA 2O93L 4PGBA 1FIGL 2V2XB 2E7LA 2AXGA 1NCCH 4OGAD 4PGEA 2P8LB 3KDMA 1KPUA 1KCKA 1OAQH 3HG5A 4LSRL 1JYXA 2XWCA 4QDGA 1A65A 4B6ZA 2DI9A 2YAOA 3BH4A 2HG5A 1E4XH 4AG4H 2DBJA 2FQEA 2DMBA 5KBLA 5KVGL 1TQWA 1OTSC 5T1MB 5SWZD 2QQKL 2IEPA 1DL7H 3DRQA 3A47A 4G6JH 5DD1H 3I50L 1TMCB 4I3GA 3CDYA 1BZOA 1MFEH 2CRMA 4CSZA 1MJ8H 2H0EA 4LCIL 1CICB 3LKPA 5FHAH 5HYJD 2WCPA 4LSTH 3HC3H 4ZS7H 3RVWC 1NFDF 3EH3B 2DI8A 3EGSB 3EHBC 1LHZA 3N85L 5F7WC 1N3NA 2PXYC 1IBDA 4UOZA 1FRGL 1ZCRA 3UYPA 4HXAL 2XX0A 3BX7C 2DB8A 4MVBD 5AZ2L 4PYGA 2GBAA 1TCRA 3L3KB 2UX7A 3MCLL 5G4OA 4Z7OF 2A6KB 5B1JC 2Y23A 4ODXA 2W0PA 3LKNA 4OZIF 2A6IB 4MLIA 5C3TA 1FH5L 2JK5A 2IIJA 1XSIA 4U1GB 1ROWA 4L8DA 3BCDA 2AP2A 3CZJA 4Q74A 4A04A 2VXUL 4U31A 5DJYB 5J1TC 3GM0A 4PYHA 1AKPA 3FZUD 5BPPA 3QUZA 1S7WA 4L37A 2XV2A 3W56A 2I9LA 3PG2A 1R1CA 2DF3A 1A1NB 4X83A 3UZVB 1H15B 5I6MA 4L8CB 1CF8L 1D9KA 5KOMC 5DWUH 1WE5A 2OS7A 3TXAA 2XFXA 2E27H 1ZLSL 2ZUQB 2GBVA 4F80A 1B4TA 2AXHA 2DQEL 4I9WD 3VFNA 4PJBA 1YJDH 2J2ZA 3RUGE 5ICZB 4NFDA 1XX9C 2CLZB 1BIIB 3BGAA 4QOKD 2AXWA 5CNHA 4LOUC 3T2NH 1JHLH 1TU2B 3JT2A 3TCTA 5HVHC 4H8HA 3DMMA 5IHUL 2CO1A 3IAGC 2F08A 4QOKE 4PVBA 3MRBB 5I17A 1FFNA 2KUTA 3EH4B 4JDZB 2P5WE 5IQNA 5L9DH