2QVKA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
189
structure length
121
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEGRPILGEHTKLEVIIEESYEFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal binding protein
total genus 26
structure length 121
sequence length 189
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvkA00
3RB7A 3RB5A 2KLTA 2LT9A 3FQ4A 2FWSA 2KLSA 2FWUA 2DPKA 2QVMA 3EADA 3FSOA 3GINA 3E9UA 3US9A 2QVKA 3H6AA 3E9TA
chains in the Genus database with same CATH superfamily
4M61B 4E41A 4JPWL 1U9KA 5DHYA 1MY7A 4L4VD 1YEHH 3WE1A 4JFUA 2PP7A 4E9LA 3AY4A 2GC4C 3I75B 2YIHA 4GMTH 1SDYA 3ZUCA 4P4KA 3QUKA 1TZIB 4XP9L 2EO7A 1L5GB 2Y0SA 1UM6L 1FZMA 4NOFA 3TCXA 5HHQB 3R0MA 4RAHA 1AS7A 3RWDA 4JPWH 3WS3B 3TEWA 4BE6A 3GFUA 4GBXC 5FLVA 3VH8B 3KYNA 1P6AB 3ZTEA 4UZUA 4YFLF 1J5IA 1URZA 1A4KB 3EHBB 2X38A 4OJDH 4C59B 1DANT 5I1EL 1EUUA 1Q94A 3UTPD 1GYAA 2KYIA 1DQQB 2GABA 4XP9H 1UM6H 3GMMA 5KUKA 3GK8L 1C08A 1WAAE 4N0FA 4W93A 4H8QA 4AL8L 2R2EB 3ARUA 4YEFA 1XF5B 1DHKA 2NXYC 3O2DH 1JZ5A 4Q4IA 5I1KL 2OTUA 3BP5B 1TJXA 3KPQA 2GEEA 4N20A 2R0WL 3F7VB 1KNOB 5I1EH 2A6KA 3GZOA 4KK5D 3EDFA 3EJRA 4A2MA 4PY7A 5F6IB 5BZXA 5D7IA 1ANUA 3DJZA 1JAEA 3GK8H 3GLZA 5C8JB 2X4NA 3QJZA 1SLVA 3FT3A 3VQMA 4AL8H 2X1XR 1O7SA 4OZFB 3U9UB 1UD8A 1UM4L 3IAQA 5KANG 3CC1A 1CT8B 1RHFA 5I1KH 4OBRA 4J3UA 3FU8A 4X4ZA 2R0WH 1J48A 2WANA 3T0ED 1KTLB 4BHUI 2ADIB 2ITCA 1IGCL 4NRXB 5DHMC 2R27A 1PG7W 2IPKB 1BAFL 4A7GF 4K5PA 3U36A 3HCVA 4R90L 4IIQB 1A5FL 2OMUA 3CDGA 1VPOL 1EEYA 3UMTA 4N2MA 1CD1A 1ZLDA 2NLJA 1UM4H 3KS0J 3V0AC 3A3YB 3NCYS 3APDA 3WELA 4KRLB 3BDXA 5F72S 4LLQB 1Z6JT 4HPHA 5D7JC 4HJEA 5IVXF 4X0NA 5IREA 1DJWA 2TSBA 1IGCH 4UOQA 4YSAA 3AACA 3OAZH 3P4NB 4WWKC 1IGFL 4JFED 1PKQB 1IGYA 3MRRA 1RU9L 2WNGA 1PDKA 3L1OH 4R90H 4URTB 4XNBA 1VPOH 4MNHA 4LSUL 2CDEB 1U2YA 3BH4A 4F7EA 1P7QD 5JIKA 2QVMA 1NEZG 2AQQA 2OCFD 5SWZE 3BJ91 3BX7C 3QXAA 5DVLA 2HXAA 3R18A 3GGWB 4ONOA 1IGFH 4FMKA 1TQTA 3KGSA 1AXSA 1RU9H 3BZ4B 1HZKA 3F05A 5B7EA 2L04A 1WS7A 5FWQA 3P73A 4KU1A 4LSUH 3C12A 3CFIC 3UAEA 3LSOA 3KWTA 2JCCE 1JYVA 2VKWA 3L5JA 3UO1L 5LLIC 4P5MA 2VXQL 1I8UA 1FFNA 5AZ2L 1HHJB 3CC5A 2K7PA 4JZJA 5AAPA 3WAJA 4QGTA 4DP2X 3OKNB 4GAFB 1XIWB 4YL9A 3ECWA 3RPBA 1H5BC 3QC5X 5AVZB 3OX8A 3VFUA 5CLWA 4N0UA 4HQQL 3NP4A 3UO1H 1EANA 5IVNA 1VIWA 1RUAL 3FB6A 3LKNB 5AZ2H 2CHZA 3NCWA 2Q8BL 3U1SL 3ZTJG 5H37G 2W38A 3FH8A 4KI1A 3T1WA 2ZWSA 3QVAA 5GRXG 2QADD 3TEUA 3SE3A 4LE8A 3FCTA 1QWNA 4Z7VB 5T5NF 4HQQH 5E23A 3E6HB 4UIMB 2DF3A 1BDYA 3FZUC 3O6LL 3ZDXF 1P84J 1AC6A 2EIJB 1L6ZA 3C6SA 1I9IL 4N0YL 1RUAH 3DI2B 3HUJB 2NY2B 1M6OB 4Z9KB 5TDOA 4QRFA 3FB5B 1C5BL 2Q8BH 3U1SH 1MWAL 5D93C 3SJVD 4D0BB 2BDNL 5DFTA 1O5DT 3L7FA 4PJXB 3C8DA 3DJRA 3ROOA 3AB0C 2VUOA 3O6LH 1QW8A 3MUGB 1RZFL 4UDUA 3QDGA 4XN8A 4N0YH 3T3PE 2QFPA 2OMTA 1P7KA 3KLHC 5SWQA 1C5BH 4KNSA 4TUKL 1MWAH 3VX1A 3MUZ1 1BM7A 2A6JB 2JK5B 5CILL 2BDNH 3BKJL 3S3JA 5I16A 5DRNB 4P23C 3X1GA 1KJVB 1KCSL 3B2PA 2GJ6B 3MU3A 1HHGB 4OZGE 1NBYB 3HFFA 1FNGA 4OGXL 5CD5D 2DWEB 1NCWL 2H0FA 2WAHA 1RZFH 2DEYX 4Z3TA 5FXCH 4FG6D 3AT8A 3FDWA 5FDYA 1LWRA 5C0DA 3FUHA 4WO4B 1NC4A 2DKMA 4TUKH 1JDAA 4PTUB 5KYUA 5CILH 1CF8L 3BKJH 3DMMD 2CK0L 1KCSH 3AREB 3GMLB 4D8OA 2AZUA 1CDBA 1JZJA 3WLBB 2A74C 1BVKA 1LDPL 4OGXH 4QHUA 1NCWH 5B7FA 1RPKA 4IKKA 3NIFF 3WLWC 3TP4A 4AK2A 2JVUA 1KBBA 2WKOA 4V2BA 3VD4A 5FO9A 4OCXL 5IV2B 1A6ZB 4DO6A 4Z3GA 2Q7NA 1CF8H 4PJCA 3FRPA 2CK0H 4TRPL 1YLBB 2Y2YA 2KQMA 3Q6GL 4EI6B 1DVFD 1KJ2A 4O58L 1LDPH 2VISA 5CHNB 1W72B 3RL1A 1BQRA 2OMZA 1RULL 4XPAL 5HYEA 4XZUA 2QHLA 3EW3B 5D2LF 3ARVA 3MRLA 5DJ8B 2ZX7A 2BOBA 3P9LA 3ZT6A 2ITEA 4MHHI 4OCXH 3CZFA 2FHFA 4D9LH 4E5XA 5D1ZA 1XGUA 5DJ2B 4H8VA 4TRPH 4MQTB 3Q6GH 2Q3XA 3UABA 4O58H 2ZNXA 4GLRH 3V10A 5FB8A 1NCAL 3MBEB 3WEMA 1RULH 4XPAH 1YA5A 3ZN6A 3GIZL 3HVNA 1KGWA 1BV8A 2Y5TB 4QTIL 5E9DE 4NKIH 2AFNA 4RAVA 5INDA 2HRGA 3MRBB 4XHJC 4WU7A 2HVJA 4J4PA 5GZND 4ZAKD 1H19A 5CP3H 3QQ3B 3AS3A 3LN4B 4ELMA 4KXZH 4Y1AA 3ZK0A 5AALA 2WQAA 3CUPB 3DETC 1WJ3A 1NCAH 4M7LT 4KITB 4LCYA 4AM0Q 4RWYL 3D3VE 3GIZH 2YA1A 3NDZE 1QTYT 4YK4C 4M62L 3EYSL 5D9SB 1JFQL 2DEWX 4OR1A 5HD8D 3QBTB 4FP8L 4NQCD 3S5LG 2H3KA 5HI4D 3CLFL 2DLTA 1NGZA 3ILQC 3BIKA 3LKPA 1YYCA 2NY4D 3MLYL 3RVVC 2R0ZL 4JEGB 4PV8A 3C6LD 3SCMB 1G1KA 4N2HA 4RWYH 1RIVH 4FQXB 3M46A 3K1KC 4FCHA 3EYSH 1RLBA 3EJYD 4Y88A 4B7LA 4ZXBA 1JFQH 2VKXA 2BNQB 4LPCA 5I6KA 1KYFA 2HT2D 4FP8H 2VIRB 4KKAD 3V0IA 1AG6A 2EINB 1MHHA 3CLFH 1CXFA 1UURA 1UEMA 2EXSA 4GP5B 4KZ0A 4UM8B 3DX8A 3MLYH 9PCYA 1AGBB 1QFWL 2R0ZH 4LCUA 2CQVA 2ARWA 4U1LA 3L4VA 5B3NA 4Y16D 3N3EA 3VYNA 1DSWA 2GPZA 4BSWA 2R56L 2HUHA 3GJEB 4H8HA 3BDBA 1JXKA 1YUHA 3CX5K 1EDYA 4JHWL 2HTLC 1WT5A 3VYPA 3V4PA 2D7PA 5AKRA 2B14A 4NCC1 3PPSA 5T1KA 4Y2DC 1QFWH 4DN4H 2EVFA 4HKZA 1PGRB 3S7GA 5F9OH 1QP1A 3RDJA 5H4ZA 2BZ7A 3FH5A 4AW4A 3GUTB 4XNQB 1L9TA 1NEZB 5FWRA 2JJSC 2R56H 1RJZA 4OZ4B 2Z0UA 3MNVB 4CU6A 2A3TA 5TDNB 3KL3A 3GXUB 3SDCD 1NCDL 2DQUL 2NUPB 4JHWH 1QRND 2GI0A 3KH4A 2XUWA 4NHUA 3BGFC 5DMKA 1EO8L 2IANB 5SX4I 1BZDA 1N3NA 1ZLVH 1IE4A 4LPYA 2HB0A 3M88A 3GMOA 3CFDA 4TV3A 4MDJB 1YC8A 2YZ1A 1E42A 3R8QA 2WWKT 1SYSB 2VLRE 1Q90A 4LLMB 2FIKA 2OW7A 4K2UL 2Q2EB 2DQUH 2VLJE 4OVUA 4KK6C 2YBGA 2VDNL 1OCOB 3FU3A 1EO8H 3LNGA 2AQPA 3ZYJA 2XHNA 3VNZA 3LXCA 4Z7QF 1TCMA 4K9JA 4TTDC 1CE6B 3OKOB 3DO7B 3Q2CA 5JNYA 4F2MA 1MFBL 3EO1B 3HBPA 4N2CA 4K2UH 3O6FA 1GZHA 1L9MA 5T1MA 1YEGL 3N43F 1DZBA 5J06A 5TJWK 2VDNH 3K5SA 3LZNA 4YHLL 4WGVB 3AU1A 4KMLB 3VFRB 4KKCD 2Q8AL 4D8PA 5IF0B 5TPWL 4OFVA 1C12A 2NY5L 1ZY9A 1MFBH 1OF2A 1RPQA 5ISZB 1NFDF 3UZQB 3MV7A 3OAZK 2WQSA 1S7WB 3IVKA 1YEGH 1ORQB 1ZMYA 2BXYA 2OQJA 4NO2B 4NQEA 5CIPB 3ZT7A 5AVTB 4UT6A 3VXOA 4PRHA 2Q8AH 1NC2D 5TPWH 1MLCA 5E70A 2CRYA 1UH4A 2OXHA 2NY5H 2VN5A 2DQGL 1F45A 2CDGA 3GSNL 5FA4A 3CSYB 2XQYG 3KDPB 3NJNA 4OZHA 2VZ1A 3SKMA 1RZIB 3HAEA 2LLNA 2EIZA 4LNRA 5EH1A 3HPLA 4Y4KB 3B9KB 2BY2A 2B77A 1WIPA 4WQOA 1BYPA 1NM9A 2AAVA 2XXFA 3MCLL 4P2QD 1IEBB 3X14B 1MW3A 1R75A 3BWAA 1GH7A 4CNIB 4CU8A 2WXFA 1TZ8A 5PCYA 2ADJA 1JNLL 1KB9K 1H8OA 3DC0A 5HHMD 1YNTF 5I1IL 2W9LA 2BERA 4KJYA 3V6OE 4GB9A 2IAMB 4OF7A 5KJRL 2Z65C 2ZXCA 3MCLH 1JWMB 1LEIA 3CBRA 2A9CA 1RAMA 4PJEB 1AP2B 4OD3L 1GKEA 2ZAHA 3PV6A 1JNLH 5DJYA 5EO9B 2JKRM 3O3UN 4JFDE 2VDKB 1HCZA 4KI5E 5I1IH 4XP1L 4JDTL 2YS4A 5KJRH 5AVQB 4BSJA 5FUCE 5TH2B 5F9JA 2Q7YA 2JKIS 4JFYB 1NLBL 4V11A 3SQBB 2GBUA 4GSRA 1IC4L 2NY3C 4GLRI 3K6NA 1WEJL 3NT0A 1PX8A 2B5IC 4GKZB 1JNHB 5HDQL 4OD3H 1DJIA 5LBGA 3QXWA 4C54A 5E6IC 3V6OC 3CE1A 1YY8A 1QPXA 1OGAA 2OMWA 2FNBA 4IJTA 5DEFA 5E8EA 4JDTH 2L8AA 3RG1C 4L37B 3W0WB 3FRUA 2NY6B 1NLBH 2DLFL 1KENL 4KXZI 4PGZA 4QXWA 1JPFB 5JW4N 1CXKA 1IC4H 3D0VA 1WEJH 2MMXA 5HDQH 4EZLA 4KI5C 4JKNA 2N0KA 1ORSA 5C0BA 3F85A 3N42B 4A68A 4C4UA 3MRCB 1CVRA 3ZX1A 2FDBP 4HK3J 2W81C 5FUCC 2WC7A 5I1DA 4DK6A 3BAWA 3MRHB 5I0ZA 4GUOA 1B0IA 4AYBA 2DLFH 3E2HB 1KENH 2AGJL 4XVUD 1WBXA 1GOHA 4WRLA 4M5SA 1QOKA 5IEHB 5DJDB 1WWCA 3KXFD 3BVWA 1AKJD 3CVHA 2LGNA 3VCLB 4Y9CA 2ALAA 2I07A 3DURB 5C08B 4IRZH 1WBYB 5MHSE 2KI6A 4PVLA 4CN6A 4XPFL 3RWEA 3S5LB 3Q8CA 3L4CA 3L3GB 3O3EA 3KPOB 1G9NL 3EHBC 5CBAB 1E8WA 5C07B 4X6DF 3RPKA 1X7TA 1TR7A 3JYCA 4Z7UB 1NIBA 4PWIA 5T1LB 1CDUA 1XXDC 4CC4C 2Y06L 1LQSR 4JG5A 4JFSA 4UT7L 4XPFH 1BHGA 1W2KT 5CZXC 3WXVL 1MHCB 4ONFL 1BVZA 2Z91B 3L5WA 4PJGF 5FF6B 1JMZA 4E9VA 4YO0A 5F0PB 1G9NH 2MQ0A 4DUWA 1ONQA 4QY8B 2BSBA 3ESNA 2NR6A 5AOKA 5F6IC 1F3DJ 1NICA 2GY5A 3HS0A 3M45A 4ALAC 3U6RA 4E42A 3PWNB 4HBCL 1JK9A 4KKLC 1F56A 2Y06H 1BJ1H 3NJLA 1PKQE 1KV3A 4UT7H 2P80A 3P4OB 3WXVH 4B0MM 4ONFH 2GSGB 2NXYD 3MJ8A 7PAZA 1TDQA 3IKCB 1BD2E 4DPAX 3MUJA 4H1LH 4A6YB 5DQJB 1LGVA 4XCCL 3VXNB 1AD9B 3QULB 3Q2WA 4Z7NF 1AFVL 4LDLB 1E30A 3QI9C 2RFXA 2WGNB 3ASNB 1BQHA 1T1WB 1ZD6A 4HHAB 3H9YA 4XNUL 1HI6B 4QHLB 4GG6A 1VFBA 2C4XA 2YUXA 4HBCH 4PGCB 4HG4K 1FL5B 4ZOCA 4IIQC 3EGDA 3V2AR 3FO1A 5BS0A 3VGBA 5I15H 1T89A 1FNAA 4G59C 5IB1A 1PX4A 5D7HA 3SGDI 3DLQR 4MNGE 1EXHA 1K2DA 5DYOA 5IFAL 4AM0A 3WS6A 4XCCH 2M26A 1OSEA 3WFBL 4FXGB 4F9PA 1AFVH 1EA9C 5IW6A 4U1NA 4I77L 5HVWA 4XNUH 3TCLA 1S7RA 1A1OB 3UBXG 3PDOA 1MQ8A 2WLNA 1H3XA 3CSGA 2IOOA 4KVPA 4ZS6C 2CBMA 3WD5L 4I1PA 4AWJC 1ADQL 1KT2B 5F88B 3FTGA 4NRYA 4O51A 1D2PA 3UJJL 1DJHA 1FL6A 4PIRF 4HDIA 4IKIA 4DGVL 3IJ7A 4OM1L 4OD1L 2Z4QB 4QRPB 3ARFB 5F0LB 1DDHA 3WFBH 2ICES 3Q3GA 2OXGA 1WAPA 4M6NL 4I77H 5HGAA 1WCBB 1GTNA 2X6BA 1SJHB 1BMZA 4X6CF 4F9LC 4H8PA 4WWKD 1TT6A 3RWJB 1I7TA 2YEZA 4MA3B 3B5GA 2R2BB 3I9AA 4F2FA 4ZFFA 3RVTD 1X5HA 1I3RA 4OD2A 1PCXA 5IROA 3NCJL 1ADQH 2IOIA 3MRDB 1FF5A 4ZMNA 3UJJH 1XTLA 3MRQB 5I30H 4DGVH 4OM1H 2BNRD 4OD1H 4J2XA 1GGBH 2EYRA 1Z5YD 2Q86A 4Z7VE 2X2IA 4JHBA 4ETQB 5SV3A 4QHNA 4M6NH 5DGRA 4UUJA 4BK5C 1T4KA 2V3FA 1T6BX 2AHIA 1YMMA 3HUJE 2YGOA 3WKML 2BCKB 5D55A 5DJCA 4GAJL 3NCJH 1UYWL 3OD3A 4FF9A 4RMTA 1LP9B 1QACA 4NBZB 1VGEH 4LLYB 4IU2B 4PJXE 3I85A 3L3KA 3B2XA 2R51A 3Q6FB 5GGUA 2HLEB 5LCVL 1KIRB 4WSGA 4CSPA 1JZ6A 4XBMA 3QG7L 4CUCA 3PFUA 5HPMA 4OV5B 2BNUB 4MA8H 1RZQA 3DECA 3OR6A 1A3QA 3WKMH 4FZEL 4GAJH 1ZGLM 1UYWH 2VM9A 1DSYA 1XR8A 1NMBL 4G72B 1ZLVK 4HYTB 3DV4B 3LIZA 3DSFH 4OZIE 1V10A 3OKKB 1I8IA 2NY2C 5LCVH 2ZIDA 3QG7H 2DQMA 4F3FA 5BW7C 1NIFA 2F54E 1R6VA 5C1MB 4FZEH 25C8L 3EOTL 1F2XK 3RZCB 1NMBH 4LPTA 3I3EA 2PCPA 2R1YA 1U33A 5L8LB 1XH0A 1U36A 3FZUD 3I2CL 4KO7A 1I1AB 4NYLA 2WJ5A 2E7LC 4GKNA 1K3IA 3FU0A 1GVIA 3KLAB 5AW9B 1RI8A 4G71B 3D0LA 1ZVYA 4XT1C 3L3IA 4O02B 5BRZA 25C8H 3EOTH 3FTXA 4Q6IC 4XZ4A 4MB3A 1SHXA 4LVEA 5CCHE 1KPRA 4JS7A 4LSTL 3G6JA 1GZPB 5B39A 3I2CH 3LHAA 3VXSA 1EZVX 5KBPA 1WAAF 2CM5A 3NEXA 4AYMC 3B6SA 3ECQA 3R4RA 1BYOA 2HJFA 1EEZA 3K0WA 2XY1A 4ZRGA 4WUUE 3SODB 1Z5LA 3X2QB 1HIML 3KLHD 3SKJL 1JFHA 1X5GA 4S1QL 4A39A 5GIRA 1RSFA 3TBSA 2Q6WA 3CK0L 5BVJB 1TJIL 4G42B 1JZGA 4LSTH 1UKTA 3ALPA 4R4FL 4YOKA 4YJZL 4GUCA 4JJ5A 2A73B 3CN3A 5FUZL 4GW1A 5FECB 1QTPA 4Z7WB 4AZUA 1HIMH 4NNXA 4BFRA 3SKJH 3ESOA 5HYQB 4RFEB 4L8DB 4S1QH 4N9OB 2ADYA 1JI2A 2EDDA 2BY1A 4U1HB 3CK0H 1QSED 1S9YB 1TJIH 2IBGA 4I18B 5KSBB 2VW6A 5FPIA 5EU3A 2R7EA 4M1CC 4WF7A 2O4EA 4R4FH 5I6LA 3QWOB 5FUZH 2FVNA 5LKNA 1CFMA 3WJLC 2DQIL 3GJFB 3WLWD 4XO9A 3IEAA 2TRYA 4R83A 5KVFL 4PJIE 2FQDA 3PP4L 2ZONA 4N2EA 4XNXL 4YE0A 3UYPA 4G6FB 4NBYB 5ERWA 2KPNA 1XGYL 3FMGL 4PJ9B 2YEQA 3CVCA 4ZI8A 5KZCB 5AKTA 4N9GA 4UQAA 1UQSB 2DQIH 1BZ8A 2YMXL 5KVFH 4G8IB 2IBBA 4B27A 4EQ2A 2ESVB 1J88A 2YK1L 3PP4H 4A37A 4XNXH 4G8GA 2I60L 3V4LA 2OMVA 5TFSL 4PG2A 3FFDA 1XGYH 1TJMA 3NRQA 3FMGH 1E9PA 5FYJL 1U8QA 2VQ1A 3EG9B 2A7BA 3Q5YA 1LMKA 4GIOA 2YMXH 5IB3B 5L2KE 5HJ3B 5HI3C 4DKDC 1DSFL 1U3ZA 1IM9D 2E4FA 2YK1H 5FCSH 3AQZA 3FQTA 4DQAA 2I60H 4XHJD 4PJHE 4V1DE 5E6RB 5TFSH 2JCCF 2CXGA 4X9BA 1F58L 3QA3A 3B9AA 5F7DB 3RDTB 4APQB 2QZQA 1E67A 1BBJB 2D2OA 4HWNA 1KXVA 3SCMC 5FYJH 2WY3B 2YXVA 4FQXC 5HHNB 5ESVB 1LO5B 1J8RA 4XWOC 1YAIA 3CZGA 3BAJA 3BPCB 5DUPL 1AZVA 3CPLA 1DSFH 2GYSA 2J12B 2VXTL 4U6YB 4AEFA 4NLHA 2DTSA 2ED8A 4IBSA 1S7SB 1F58H 3ILQD 1UASA 3BC9A 3DYOA 2MNUA 4LCWE 3RVVD 2YKLL 1FVEA 1TTUA 4M7JL 1UENA 3DWTA 2RALA 3C5SB 2I85A 2XIDA 3LHPH 4PJ8A 1FCGA 2NDFA 5F71A 1EGJL 5IKCA 5AAWA 1D9KD 1GIGL 2RTTA 4GSDL 5DUPH 1OD7A 2F18A 2JNZA 3SE6A 2ZXQA 5DDHB 1G7LA 3OZKA 4K94C 3T0DA 2VXTH 1QSFB 2AJSL 4L8BB 3P9MA 3WNLA 3UAJC 3GXMA 4GRLD 2MRYA 3UBXB 4UWQB 2LVCA 3UZEA 2YKLH 4I3GA 3D3VD 3VMNA 1WAEA 2C1OB 2GK0B 2W0PA 4M7JH 3O6KL 4HLEA 1MFDL 1YN7B 2MNJB 2VR9A 4J3OG 4TQIA 2MOGA 4DKEL 1VFAB 1EGJH 4GSDH 1GIGH 5GRYA 2NW2B 3SPCA 3T1FB 3VWKB 5HI5C 5AKVA 3QIBD 1KCVL 2E7MA 2SEBA 2AJSH 1DUYA 1B2WL 2ZUUA 5HPOA 7PCYA 5FYJD 4BUHA 4HS3A 4LLWB 3ZU8A 2A9NL 2ZOTA 4Y2DD 2ZXEB 3AQYA 1HILA 2BOCA 3L3JA 2DLIA 3O6KH 1MFDH 1I1RA 4FD0A 4X9FA 3T3PF 3VWJA 4DKEH 1QO3A 3Q9PA 3VFTA 3ARSA 3TESA 2IWGA 3BUYA 2FYYA 4EZJA 3TVMB 1KCVH 4XOEA 2V33A 4UQDA 2FLBT 1MPAL 5ISZE 1B2WH 4OZGF 5JO5B 5HHOD 3LRSA 1SGKA 1EDHA 1JOIA 4GW4A 2A9NH 5EO0A 1GGCL 2P5PA 3INOA 1JZ7A 4HC1L 3SDXB 1N2RB 4EI5D 4HIHB 3JTSB 4TN9A 2MQCA 1ZPLA 4HUXA 3RWFA 1DQLL 3V79C 1S9VB 2FWOB 1PVHA 1MPAH 1RUKL 5JHDD 3TBWA 5D8JL 4JFFE 2ATPB 4XAKE 1Q9OB 3H53A 3MCKA 1GGCH 3TZVD 4HC1H 3ZHDA 4TTDD 4FXLA 1YMHB 2AITA 3L3OB 3MLUH 3BPOB 1W6LA 4X99B 3DUSA 3WNJA 5M94B 3AXIA 2FX7L 3CNKA 3DX2A 1RUKH 5CINL 5D8JH 1IC0A 4C56D 1X7SA 2K3HA 4XX5A 3OKEB 4JO2L 3F6IA 3HG1E 1VKXA 5EU4B 3V95A 5A7EA 5KN5B 3HZKB 3PWLA 2FH8A 3VM7A 3ARPA 2XVGA 1WHOA 5LBSA 2BVOA 1QI3A 4ODSL 3PREA 2K70A 1OWWA 2FX7H 3AM8A 5IGXL 3HS8A 5CINH 2KH2B 4Y4KC 1KTJA 3X1FA 1QBML 2YQ3A 3OGOE 5HBBA 4OJCA 2CD0A 4L4TD 4JO2H 4TLSA 3V9EA 5CN2A 4K5NA 4FX5A 4LKXB 4YXHL 2B16A 2JB6B 3LS4L 2ZUXA 3WTVA 4N26A 3MLSL 1OB0A 4ODSH 3Q44A 2FSEA 4JQVC 4X5XB 5IGXH 1JBJA 1WIUA 5TDPA 2J56A 1MUJB 2E8YA 1QBMH 4M3JA 3MGTA 4QCIB 1YC7A 2IAMC 1DCEA 1XGQA 2J7LA 1I3GL 3FQ2A 4P2OA 3S4SA 1PZSA 2YQ2A 3IMWA 4X4XA 4YXHH 3CN1A 2X3CA 3LS4H 4PB0L 2HLAA 3MLSH 4FYSA 8PAZA 1Q9WA 4Y7MA 4N2BA 5DZNA 2JTYA 3QYNA 3MRPB 4IEFB 3O0RL 3UTSE 1GS8A 1QZNA 3HG2A 3W82A 3W9EA 2VSKB 2ICWI 5CMAB 1NANH 2MKLC 2V4LA 5AW8B 5EZLB 4DZ8A 2RJMA 3FTZA 5HYFA 1WS8A 1I3GH 4TSBH 1N6UA 3FTYA 5I0WA 1XT5A 2HP4A 4M4RB 5E8OB 4N6QA 4PB0H 5E8NB 3TT3L 4PRBB 1TZHA 1BIIB 2HT4D 3O0RH 4MQXD 4YSUA 1F18A 5ICXB 3KLSA 3RIAF 3IT8D 4GO8A 3LQZB 1UFGA 2XCMC 2NY6C 1ZDSA 2OS7A 3BEWA 2ZSVA 1TCRB 2WLKA 4GG8B 2FJFB 1ZE3C 2NY3D 4P06A 4X42A 4RFOL 5DRWB 4ZJ9A 5HHVH 2WYTA 5JHAA 5IB2B 1XCQB 2VE6B 3QG6B 3TT3H 5C07E 4DQOL 5A16A 4HF5L 2XN9A 4Z7UE 3VSUA 4L8CA 4JPIA 2C7FA 1J87A 5EBGA 3QORD 3JZ7A 1V3JA 3MUHL 4ALAL 3E2HC 4Q8BA 5GGRB 3ECBB 1O75A 1F11A 4OLVL 5GSVA 4HS6A 1INDL 1SN2A 4RFOH 3TTYA 2DWYA 1JGVL 3P77A 4OJYA 3S6CA 4LOUC 4DQOH 3ARYA 4HF5H 2ZXGA 3DJTA 2G5BB 4CDGC 4FQCL 2GJZA 1J86A 2X6AA 4GO9A 1CYGA 1UD5A 5GGTA 4XH2A 3I6LD 3RE0A 4ALAH 4R96B 4WHDA 4XB8A 2BP8B 4OLVH 3BH8A 4MVBC 5TD4A 1WCQA 1INDH 2DLHA 1T0NA 1IL1B 4OZFH 3TNMB 1JGVH 3FHEA 4FHKA 2X10A 4ODUA 4KK8D 4GAYB 1B3JA 5IG7A 3ZZLA 3ROLA 1JPTL 3OZ9L 5IHZB 3HLAA 2Z35B 1ZLEA 4FQCH 4KNTA 4WNQB 2VSCA 2ZXDA 3LH9A 1QA9A 3UTZA 2Z7ZA 3L1GA 4BXSV 5ID1A 1NMCB 2ZWYA 2DQ6A 3DOHA 4JAMB 4ZYKA 4Z78A 1AHWB 1B9ZA 3VTAA 3EHBD 3FJTA 1LWHA 4BFKA 1YPZE 1U3YA 1JPTH 3OZ9H 4FTDA 5FR3A 2DYPB 2XOTA 5CZXD 3BQUA 4Y8AA 5I76B 3R4DA 4TNFA 3CZUB 4HU8A 3MNWA 2FO4A 3EFFA 4LAQL 4QAMB 3LY6A 5FCUL 4QRPE 3ULVE 3FCBA 2YWZA 2BX5A 1Y7VA 5MHSD 4UU9B 4NQSA 5IB4A 4KKLD 1NBQA 1ZA6B 4OFYA 3MQIA 3OG4B 4UTBA 2O61B 2QGEA 2AJZA 4DP6X 3D5OF 2W07A 5D1XB 5ICYA 4N1EA 2FCBA 2Y69B 4YC2B 1UGNA 4LAQH 2D9QB 5E1HB 4FXGC 5F7LB 3VFPA 1P1ZA 4MGXA 4MYPA 3H9SA 3OLIA 5FCUH 5GXBB 1GW6A 4BGDA 43CAA 1U8CB 4DGYL 5ADOL 1H8LA 5AYQA 1B4RA 4M6OL 5EFIB 5D72H 4XPHL 1M2OA 2H26A 4MJIB 2YD3A 3FNKA 4JR9L 1ZIBA 3X11B 5C0JB 1HSBA 2W91A 2EIKB 5IMKA 3ULVC 3ARFC 4K7PL 1OANA 1QFPA 3QO1B 3F6LA 1YCSA 3TM6A 1WLHA 3SPGA 5CBEA 4DGYH 5ADOH 5EZIL 5C0IA 2E9GA 5F89B 1NKOA 1XHHA 2WWOA 1HL9A 4XPHH 1QKZL 4JR9H 4ZS6D 1HHHB 1X4ZA 4KAQL 3GPSA 1SLXA 2EEFA 3QUMA 1NCGA 3FF7A 1T5XA 4K7PH 4NO0B 1TZGL 1YDPB 4IMKC 4KI5F 2XFXB 1Z1WA 1QZ1A 1VSCA 2K7QA 3MBWA 3PF2A 5EZIH 5D2NB 2LOEA 3E1F1 3SSGA 2E7CA 1INEH 3A5VA 2AEIT 4JO4L 5TGBA 1QKZH 3COOA 1JZ3A 3QO0B 1JHLL 4KAQH 3O41B 4WFHE 5EN2A 1TZGH 1BLNA 1GY1A 4EN3A 1OW0C 3D12B 3AG1B 1O7DC 3WFHA 2RAMA 4N28A 4P57B 3V0GA 2VLME 4JO4H 3V5KB 4QRUA 1J5CA 1XH3A 4CSTA 1JHLH 1XIWD 3VJ6A 2VN7A 4IDLA 4CVWA 4W9IC 4X7FC 1N8OE 3GSXA 1NWPA 3FN3A 3FPXA 5J6HB 4J5VA 3IMTA 2J6WA 1T5WA 4XVOA 3WG7B 4QT5A 4F8OA 5H35B 1NCBL 3RIFF 1ZOXA 4GQRA 1JXGA 4GMSH 3CD4A 1U8OB 4WI8A 2CIKA 1H8NA 4G6ML 1TENA 3E6FA 5KYYB 3L3DA 3BPNB 3P9WB 4QHPA 5C09A 3RWCB 3RZCC 1FV1B 5DC9B 1NGYA 3BH9B 1BFOA 2WVTA 1FZJB 3ZL4L 5IM7B 1NCBH 4DP0X 1I1AC 5K39B 4EZMA 2NY2D 2OI9B 3KPRB 3FTWA 5J6GB 1ACZA 3V0WL 2BC4B 1FJ1A 1W72L 1IBFA 4G6MH 2F5AL 1YEJL 3A23A 3V0EA 2VLKA 4DEPC 4YNYA 3OBAA 3O4LA 2UZXB 2WBKA 2OZ4A 2XG5A 5CR8A 4JRXB 3NBNA 3RY6A 3DX7A 4HJUA 2EE0A 3ZL4H 2XPYA 5E2TH 1C16A 4S2SA 3OF6D 1M2VB 2MH4A 3D39B 1CG9B 1GGYA 3V0WH 1W72H 3PJSA 2F5AH 1J9SA 1YEJH 2HX9A 4M1DL 3U1QA 2QMJA 5FO8A 1KBWA 1G9EA 3GB7A 2GJ6D 4JKPL 4PJFA 4MA7L 1F8TL 5EU6E 4NJ9L 2DI7A 3B5HA 3CAFA 4N2LA 5FO7B 1W0VB 5E5MB 1JHTB 4F7MA 2XWEA 2UY7A 1KULA 3CN0A 3MREB 3P4MA 3ZSSA 4WO4D 1M7XA 1OPOA 4BH8A 4M1DH 4GSXA 2Y7LA 3ARED 3VFOB 5LWYL 3N41F 4JKPH 5JHLL 3VGDA 4MA7H 1F8TH 3QFDB 4NJ9H 1CYWA 4K71B 1EAQA 2F53A 4LEBA 1CO1A 2IF7A 4FGMA 3F58L 4G9FA 1FGVH 2A38A 1AS6A 2AXWA 2HN7B 5B1JC 3ZE1B 1IAOB 5DQ9B 5LWYH 5I75B 2YPVL 4PJ9C 2A77L 4IBVA 2VDOB 2FGWL 3BRFA 5CD3A 2HKAA 3LKOB 5EOTB 4PJAE 1J8HA 3F58H 4UTCA 3DVGA 1R3JA 2UVEA 4N5EC 4NUJB 2Y7QB 4X5RA 3NIDE 1DBKL 3QDJB 4KKNA 5SWSA 1NDMB 4K94L 1XMEB 2A77H 1OAKL 2FHCA 3VI4B 4BFEA 4BKTC 3QPQD 1THAA 2FGWH 3MBED 5DD6A 3TBYA 2JCWA 2WXNA 3EUDA 5I0DA 4MNQB 3WNNA 2IH3B 1K8IA 3NA9L 3EYOA 4NNYB 3IFLL 3Q0HA 4M9PA 2ZYIA 2ICEB 3UPAA 2Y6TE 1JNNL 1QBBA 5E1QA 1DBKH 4EO5A 2KZBA 3RDTC 4UDTA 1VFOA 2QTVA 2DLEA 3D8MA 1BAWA 1JCVA 4G7YL 5DI8B 4K94H 5EDSA 1OAKH 2R4SL 4AQ1A 5DRXA 1Y6NR 2J8UF 1CD0A 2WTRA 5JHBA 4M8RA 4L1BA 4YS4A 2CO4A 3NA9H 1KXTB 2FWSA 3IFLH 1OCRB 4U1JA 1A6AA 4FHBD 5HI3D 3BEVA 1F4XL 4U6XA 1OT1A 1JNNH 2CBQA 4UQCA 3RNQA 2EVHA 4PJXF 1AZZC 4G7YH 5DVKA 3WMQA 4UOW1 2PYEE 1KTCA 2BINA 2R4SH 4C4KT 5CJXA 2HG5A 2R9HD 2EYSB 4Q56A 3C09C 4LCVA 3SCMD 4QRRA 4FQXD 5D70L 3QJFA 1BOGB 2CIIA 2FB4L 2HWZL 3QEUA 4XWOD 2BNQD 3N40P 1P53A 4L4VA 3CX5J 3LPOA 3VM5A 4J6RL 2X41A 2Q5BA 1M1XA 2J1YA 4FNTA 3EGXA 4N2KA 4ZTPL 3SDYL 3L08A 1P6FA 4OZIF 1ZGLA 3IJYB 3I3BA 5T3ZE 4PRNA 3TPKA 5G55A 1E6OL 5D70H 4DGWC 4A55A 2FB4H 2FJGA 2HWZH 3VWKC 3LNDA 4FOMA 2NNFA 4JVPA 5F7KC 1WO2A 3FSZA 2UYLB 4A2EA 4J6RH 3HG5A 2G2RA 4R7XA 2AXHA 1I1YA 5DJAA 3SDYH 3HJEA 2Z8RA 5DTFB 4ZTPH 3DBXB 4WW2A 3KWWA 4IOSA 5CFAA 5I19L 3HNTL 1GGUA 3M7OA 2F7IA 2P24B 4A2LA 2AVFA 3TURA 3CQQA 1R5WA 3MMEB 4CBPA 2DV6A 3OXRA 2CU9A 3F7YA 1E6OH 4ZNEE 1I7UA 4JKKA 4ZUSA 1UD6A 5H37H 4KKZA 2HTKC 4QJ3B 3TVMC 1BZEA 5HI5D 3TA3C 2RQ8A 3MA7A 3UTOA 1WFTA 3ETTA 3QJHA 3VGAB 2ZF8A 2Z7WA 1CC3A 5I19H 2JXMA 3HNTH 2IAND 3KPSD 5LHDA 2D4FA 4F7TB 1VLXA 3HFML 3FQXB 1OCCB 4B5EA 4LASL 3F7QA 5CIPH 3MGOB 3S3SA 2C9UA 2JWYA 1AYRA 4HOMA 3T4YA 1BZ7A 1BVOA 3EJPA 1VERA 5KTEL 4CVXB 2CA3A 4LLDA 2NZIA 4LVHB 5J1TC 1I7ZA 4U1IB 3I6KA 1MW1A 5EOQL 3T0EA 2YA2A 3BVTA 3QH3A 1S7UA 5D7KE 3HFMH 1AGFB 4BFIA 4LASH 2B4CC 3Q1EA 1BCIA 1TQSA 3BPOC 3OC5A 4CU7A 3WJJC 2IH9A 1OSPL 1HWGB 5F7MC 4ZSOB 5KTEH 3I74A 4HEPA 4ZTOL 4KUCF 5EOQH 1NMAL 2YAPA 1HQRB 1K9TA 2G0KA 2VDKL 1DN2A 2UZYB 1G7IB 5HXMA 3RUGA 2R23B 1DQML 4WFFE 1TITA 5DK2B 3JZYA 1S7QB 3O2DA 4JFEA 1F3RB 3CV5A 4WHYG 4PJIF 2IMMA 2J44A 5K93A 5ISZD 3QJRB 3B7UX 2O6EA 1OSPH 3ZHFA 1AQMA 4AEHL 3RGBA 3BN3B 3EH3B 2DTML 4RIRB 4MA1B 4ZTOH 3UCRA 1NMAH 1G0YR 3FOMA 4UOJA 3K6SA 3B9VA 1NOLA 2VDKH 3EZ8A 1U8HA 5IMLB 4M5ZL 1DQMH 4KDTC 3JWOC 3AG3B 1F41A 4JGUA 2WINB 1KB9J 2ZSWA 2XX0A 1TTFA 3DO4A 1T1XB 3MRGA 2NUTB 4M9OA 4AEHH 3BWZA 3HZYA 2PWGA 3OR7A 3B9KD 2DTMH 3DSNB 4Y4KD 1LILA 4Z77B 2VDRL 4ZODA 1Z9SB 2VITB 4IM8A 2V8LA 3K8LA 4Q52A 2XV2A 2VYRE 3PNWA 4IK7A 4UQEA 4ZOBA 3ZMNA 3HZVB 4IMLB 3VD3A 4M5ZH 5IUSA 3GMQB 1KJ3L 3EH4B 2KQNA 2ZCKL 3HC4L 4HUWB 4PJHF 2YD9A 3RGHA 4D9QD 2X0UA 1MI5E 4NAQA 1ZE3H 3VFVB 5A2CA 3CU7A 1JCKA 5IVZB 3LH2L 2VDRH 2IAMD 1G84A 1S5HB 1VACA 4F8TA 4XP6L 3IE4A 1KJ3H 4C55A 2DYSB 1KXQA 2YZ8A 1M56B 3MR9B 1TVHB 2ZCKH 1GR7A 3HC4H 4XCYB 3FT2B 5GS0D 1JRHL 1D7DA 5F1NB 1VGKB 1VCBC 3LH2H 4LMQE 2CDFA 4P0DA 3WCYA 1ICTA 2AK1L 3FHAA 4HJSA 5L4MA 3IRCA 2ROYA 4XP6H 1HEZA 3IFNL 1TYRA 5KYWB 1SVCP 1PS3A 3VA2C 4I0KA 4HD9A 1TFPA 2DL9A 1FSKC 4WIQA 1DBAL 3SJVA 4X9GA 3LPFA 5HGHA 1KDIA 1AG0A 1JRHH 2F6AA 1KGCD 1RZKC 1CK0L 2P8MA 3VRLE 3C9NA 3F84A 4LGRB 2AK1H 3W0WD 4BCYA 3QRLA 2NY6D 3WKNA 1MCHA 2MTAA 5I28A 3V4VB 3IFNH 2O5ZL 1YSOA 3VD1A 4BA8A 3GSQA 1VZGA 3UTTB 2X4TB 2YAOA 4AG4L 1DBAH 5K9OB 2NYKA 1KBPA 4F1ZA 1UUSA 4AGMA 2NTFB 4J3SA 3VQ2C 1CK0H 3Q05A 4JM4L 4WSJA 5DZLA 1U8NB 3TYFB 4L23A 2QR0A 1FNLA 4PREB 1AOHA 2X4UB 2O5ZH 3IFPA 1F42A 4PM1A 4N2OA 3PDDA 3KYOB 5C0CE 5EIIG 2BVQA 4AG4H 4R0LA 3LKSB 4LOUD 4NQXB 1FZOB 4JPKL 4B97A 1CWVA 3DMMA 3SD5A 1C7SA 3NIGE 5C08D 1H0DA 5E8PB 2V7HA 2XV6B 4JM4H 4Y19E 2VC2B 4HKXB 1PZAA 3O45A 5CU9A 4Y5YA 2X0WA 3QZWG 1KZQA 4AYSA 3CHOA 4WHTA 5IBLC 4MVBD 5HGDB 3QK0A 5EZJB 5I17B 3BVNA 5KVGL 2AXJA 6PCYA 1OQXA 2W9DL 2VZUA 4JPKH 5AFAA 2BWDA 4G1EB 3VMPA 2FWLB 3GSWA 1OP4A 1DVFA 3SEPA 1HH9B 3BO8B 3DHMA 2W95A 3W56A 3VU1A 4TNWF 4W9KC 3IJSB 1QHPA 3K6IA 1MWAA 5JIQA 3GS0A 1WZMA 4HFUH 3RVUC 1R3LA 3TIEA 4KFZC 5KVGH 1ES0A 1WISA 4Y5XA 4J3OC 2AC0A 3TJEL 3UAFA 2W9DH 4HG4J 2YEVB 3WE6B 4MXWL 1JTOA 4PJDE 4QXUL 1P4LA 1EQWA 3KM2A 4HCGA 5E4EB 4HJ0C 1GA2A 5D1XC 4WJ5B 3RI5K 1U41A 2N4IA 1BG1A 1BW8A 4QTFA 4U6VL 5IJKA 5C0AE 4Y4FB 2J4WL 3N9GL 2P42B 1EO7A 3HR5A 3TJEH 4ZAKA 2BWQA 3AAZB 4MXWH 2O1AA 3TV8A 3IETA 2FWUA 4QXUH 4AKOA 4JGJA 1G7JB 3QCVL 5DSCA 1U8IA 4XMVA 1MLBA 1O9ZA 4U1SA 2YJLA 3HZMA 4XBPB 1XGZA 3UZVA 2V2TA 4RA3A 4AJ0A 2LV4A 1BXUA 4U6VH 4NQCA 4R5TA 4HZ1A 5HYSA 2J4WH 1YJDC 3N9GH 4M7KL 1HZHL 3MLTA 4OSUL 2Q76B 3SBPA 4NZTL 3STBA 2A0LC 4RAUB 2J20A 1ZT4A 2D7NA 3QCVH 5LXGL 2E59A 4LGPB 3JTTA 1WFNA 3C6LA 1OB1B 5EBLA 4MJ4A 4D9RE 2YMTA 4OGYL 2CLVB 4ODTL 4QRPD 4CILA 4AUYA 3ARFD 4G7QB 3FTSA 2HUEA 4J1UA 5DVNA 1E90A 2CO7A 1XR9A 3GSVA 2W1NA 5FYKL 4YBQC 1B6DA 1XCTB 2PCFB 4M7KH 1HZHH 2ENYA 4RH4A 4OSUH 1J9RA 1HINL 1SEBA 2BFVL 4NZTH 5D2NC 3WL9B 1LK2A 3FU9A 1PJ9A 1QNZL 3HJ0A 5LXGH 1XXFC 3QPKA 4Y16A 4IKNA 4IS6B 5DZAA 1EFXB 4NENA 3WY2A 1PY4A 2YBRB 3RFZA 4WWNA 4NT6B 4O02L 2ZNWA 5CP7A 5FYKH 3LPGA 4HSAC 2P47B 4QKXB 1RHHA 2BFVH 1HINH 2C7UB 3S36L 3QNZB 1QLFB 1QNZH 4QRQA 2Z31C 2PW1A 1URIA 2CO6A 1JPGA 1A1NB 2XNAA 3ZR5A 1J0YA 3EGSA 3APNA 5HHPA 1IQDB 3PDGA 5I0YA 4O02H 4AYFB 3AXLA 4JRXE 4Z7UF 3SDCA 4JMNA 5D1QB 1XEDA 3NACL 3ZDYB 1WHPA 3VFGL 2NY1B 5ECJE 1C1EL 2G9HA 3HEIB 4GXVL 2E86A 5GRVL 3S36H 2XG4B 2IDTA 4CGTA 2CLZA 2EYTA 2GUOA 3ZJAA 4XHQA 3MDJA 4AH2B 5GGSB 5B38G 3B8SA 2EUWA 3PV7A 1PG7X 4AQ8C 5GZOD 5D6DA 4XNMA 1K8DA 2ADGB 4JL2A 5I5MA 3NACH 3V5DA 2FRGP 1XSJA 3VFGH 2VNCA 4AVJA 3G5WA 1C1EH 4GXVH 4YDKL 2ZKXA 2IC2A 4AQEA 3A6CL 3L2MA 4PJBB 2X4QA 3DX9A 4WFHD 5FYKD 1LE5B 4JY6B 4A38A 3RZCD 4UV4L 4R8WL 5F6HJ 4HUVA 4YZFE 2WWMC 4HAKA 4WNSA 3VRJA 4OGQC 1I1AD 1UZ8B 4M1GH 4PRIE 4YDKH 1JRHI 1W91A 1EWHA 4QAWA 5DRZB 3A6CH 3U7YL 2CM6A 4R3SA 4HUUB 5I24A 4PRPE 4ODWB 4ZFZB 3GJFH 3Q2VA 1D3CA 4X5QA 1P7HL 3ZXAC 5GS1A 4UV4H 5L4IA 4NO3A 3OJMB 1E4JA 1YPZF 4R8WH 2WVVA 3ZW3A 1A1MA 2X9ZA 3IWVA 1AR1B 4CVUA 4KXDA 4R97B 4DVRH 1F3JA 5DYFA 3U7YH 2XWJB 1N6VA 1DQIA 1NC2A 1ND0A 1XB3A 3U30C 3WV0A 2HSIA 2RGSA 5FFGA 5IQNA 3ULVF 1AO7B 2R2HA 1OO2A 5EIQA 4P5TB 5A2JH 2CH8A 4MKTA 3FT4B 4JREB 3VI4E 4K71C 2O6CA 1RJLA 4NQDD 4TLTA 3RWGB 4MNQE 3TJHD 5F7BA 4P2QA 4DKTA 3O9WB 1HDMA 1FFQA 5EIVA 3L4WA 3HN5A 2XTJB 4RZCA 4C83A 5I75C 1HHKB 3MRIB 4L3EB 5T5NG 1OZTG 3BZFA 5EBMA 2DM2A 3W9DB 4WI2A 3C8KA 3HRZB 1KTDA 1L9SA 4MQ7B 4D3CL 3U4KA 5K9KA 1XAKA 4RMUA 2XC8A 2IPTL 5EIIB 4JQXC 5EO1A 5GS3A 1KTBA 3ESPA 1IFGA 4YHNB 4B7IA 1PD0A 4G6FD 1RJYA 1UVQA 2OTWA 2ED7A 2QZ5A 2YR3A 2WKLA 4NKDA 4PJ9D 4PJ7E 5K9JL 3VGGA 5KZCD 3QZWB 1KTRL 1QBAA 1NFIB 3HC0B 4D3CH 2WN3A 3E9TA 43C9B 2IPTH 1WBZB 2ESVD 4N5ED 4FXKA 2V6HA 5CSZA 5T1JA 4XXCA 4LGSB 5AW1B 5TF0A 1JWUA 2A83A 2IH8A 1A25A 4YBHA 3CBKB 1MVUA 9CGTA 4HUNB 4KZEL 5K9JH 3L95B 4FA6A 3FHQA 5CBEB 2VGLM 1BQLL 3X3FL 3B83A 4GXUM 1E50A 1HH6A 3MLVL 1G7MB 1R4XA 4P4KB 2WUCL 2W8CA 3QUKB 3ZZ1A 3STZA 1FFOB 3DPDA 3OM3B 3B37A 2ZUTA 4POYA 3GI9L 5I82A 2EIMB 3QHZL 1PFCA 2J2ZA 1E8ZA 4GW5A 3GLAA 1LE9A 4APQD 3TNNA 1OALA 4KZEH 3KNBB 1PPIA 2BVEA 3X17A 1BQLH 3F5WA 3X3FH 5AG8A 3MLVH 1Y6KR 2WUCH 3VFSA 4LSDA 3EYFB 3QAZB 2GTWA 5C9JA 3BFQG 3GMMB 3GI9H 3TLRA 3BP7A 3QHZH 5E9NA 1OT4A 1DE4A 4H44C 4XN5A 3KXFA 2WXLA 2VQ4A 1AKJA 3MRNA 2VLLB 3L6FA 3PGCA 3K2UL 2Y6SD 4PG9B 2OTUB 1ITBB 2A6KB 3IM1A 1D5BA 1XF3A 3WOVA 2WZPD 1ZDQA 4B41A 4UQ3A 1UM5L 2YMOA 5AW4B 4PY7B 3VI3A 2V3DA 1QSFD 2B4CL 4N0CC 2M8XA 4ZFOB 1PLCA 2X4NB 3NCEB 5HVFB 4MXVE 1D2OA 3FT3B 3WHXB 5ESQA 5DK3A 4M29A 2AJVL 3K2UH 3FQWA 1AGDB 3MPCA 2BPBA 2E8ZA 3RURA 1EVTC 3VWKD 3GXFA 5F3HA 3BLPX 4NSKB 5KJ7E 2ZD0A 4W9LC 1HXYA 2B4CH 3VGAC 2F2HA 3HG3A 2AQ2A 1BJ1J 2EECA 3U36B 5I6OA 4Q14A 2XPZA 4KTEL 2YARA 1CD1B 2C3WA 3QDHA 2F19L 1MJJB 2AJVH 3MV9B 4ONHB 1CF1A 1E8YA 4KJPC 2AEQL 4D9LL 1CFSA 1A9EA 2HTKD 3GI8L 4HIJA 1AZBA 1S7TA 4R26L 3FONA 4LVHC 2COVD 3JWOL 1YRKA 3V7AG 1E5UI 4UQIM 4A7UA 3RGVB 5IFJA 3H7BA 3H3KA 4IRZA 1G0DA 4KTEH 3F7PC 4JKLA 3B1TA 1MZZA 1JUFA 4JPVL 2F19H 2JSFA 4MNHB 3ZIMA 3E3QE 4YFDB 4WY7L 4LFHG 4F7EB 2CGZA 2BHUA 2DYRB 3D52A 4FTVB 4J3VA 1G4MA 4CKQA 2AEQH 2YA0A 3FQUA 1S78D 3PQYE 4HV8A 2YD1A 3RWHA 3UGXA 3ZVVA 3GI8H 2NTSP 1SDDA 1PYWA 4R26H 3II3A 4EKXA 2BVPA 3JWOH 4FJYA 4WNJA 1II4E 1JN6A 1G9HA 4N8PA 2I9TA 1Q0XH 2ZOKA 4HULB 4JPVH 2WXMA 3DTXA 3O8XB 3I02A 1LD9B 5F8RC 3S3DB 3BZDA 4WY7H 5B38B 4LEXL 1UJ3B 4Q6KA 3PG2A 2YO3A 1JF5A 5IVXB 4ELKA 4JLRA 1RMFL 4JZJB 1JXFA 4MA1C 3WU1A 3E3QC 3HI1B 4PJAF 4DUXA 3W39A 1SMOA 4BQCA 1I31A 3OX8B 4FKEA 4OT1L 4RGMB 4WWKA 3H56A 2XQYK 5AAMC 1N59B 1EAJA 1WQVT 4H1LA 4J27A 1X5JA 3NIDF 3THML 3SKOA 1GPOL 3FB6B 1RMFH 4H2CA 4YDVB 4Y1SA 2ALWA 1F00I 2N01B 2BNRA 3OZLA 3IDXL 1NL0L 2C5DC 5DGQA 3CN4A 5D7KD 5AD0A 5ANMA 4GT7A 2AV7B 3ORJA 4R4NC 2FBOJ 1JJUA 4NN6B 1RZKL 1ZHNA 2DBLL 3EKCA 1DVSA 4OT1H 4JRWA 5DS2A 1UACL 2A6DB 2AQ3A 4Y2NA 3DX6A 2GFBB 2R2CA 3KVQA 3C87A 3OPUA 2IG2L 4FMVA 4MJ5A 3UAAA 1HE7A 3THMH 3UIZA 1GPOH 1CGXA 5M7QA 4OF6A 2G3NA 1DTUA 1F6AB 5TDOB 1ILUA 3IN0A 3IDXH 4MD5B 1NL0H 3PWVA 2O6PA 3SYCA 4PWHA 1U3HC 4I9XA 4F20A 1SMAA 3M17A 1DQJB 1RZKH 5E24E 2DBLH 3FO9B 4PBWD 2H4EA 1UACH 2EKSA 1H9VA 2DJ4A 4FLSA 2IG2H 1LWJA 1CQKA 3UTTE 3QDGB 5DJZB 5DUBA 4TUOB 5ITBL 5MEQA 2OMTB 1P7KB 4HW6A 5DJ6B 5ESAB 1N12A 1KIQA 5FK9B 3VXRE 4Z3JA 4ZQTA 2WK2A 4U6HA 2HG0A 3QZMA 1JHKL 5F0JB 3MVSA 2A9DA 5E08L 1ADQA 1QX1A 3GTNA 4TPRL 2DMHA 2APFA 4ABQA 4WSKA 2C1PA 4XRCA 3ZDXB 1Y07A 5ITBH 3TFBA 5LAXA 4P9ML 5EC2B 3S0PA 1NC4B 1PQZA 3ATDA 5KYUB 3U48A 2R59A 1MZYA 1XF4A 5AB2A 3PAYA 5E08H 5IQ9A 3UBXI 4O00A 1Z3RA 4GEJA 4TPRH 1U95A 3KD4A 1BGXH 4PP1C 5FM8A 1PZ2A 2VWEE 4HETA 3BHBB 4FS0A 4GI6A 4XN1A 4FHJA 4X5LA 4P9MH 3D50A 1XO8A 1SOKA 2KC0A 2CUIA 3GJFK 1EO5A 3O3BB 2XBDA 3OKDB 4RNRA 2A9ML 2VISB 2WXIA 4XZUB 1XGPA 2AMGA 3D69A 1I8LC 2MCAA 4DHLA 1HJCA 3IJEA 5CU5A 4I48A 1ROCA 3P9LB 5LCVA 3KE0A 3NJMA 4OKVB 3G08B 4J3OH 2ZOOA 3F83A 1CLOL 5CR1A 5FGCB 3H6JA 1TZAA 5JIIA 2VWEC 5FB8B 3CFJB 4PWEA 1RK7A 1N0LB 5DQDL 2HRHA 3NP3A 3O0LA 4G6KL 4BKLA 1AGEA 1GAFL 4PH8A 5H94A 1D5RA 5CLXA 1QSEA 2EDLA 4CJ1A 4JDEB 2Q10A 1TLMA 5INDB 2VO8A 2ICWJ 1IGML 1OAZL 3OKMB 3EYUL 5F7HA 3EOAB 2F5BL 2VDLB 3QUZD 2DWXA 4BSVB 1D6EA 2NDGA 4OCMC 5DQDH 1U8KA 4JN2A 4G6KH 4ADGA 1GAFH 3F6JA 1RJCA 3JV4A 4NC1E 2DYPD 5E4EC 4JHAL 1IGMH 1OAZH 4PBVC 4JZNB 4X7TA 4EDWL 1NGZB 3EYUH 1JVKA 3LKPB 2XX1A 1NEUA 1G0XA 2F5BH 4M4PA 4E0RB 3QEGL 3D85B 3EADA 4NFCA 5DD0L 5FW6A 3U2SA 5BVPL 4PTTA 1UXSA 3BCFA 5LNGA 5IQLA 4AW7A 4J3OD 1IEAB 1BM3L 3D18A 4XVJL 1AC0A 2ZT9C 4JHAH 4IK6A 1UOWA 3T6ZA 4EDWH 4K4KA 1H15A 2PWFA 5DR5L 2E5EA 4HJ0D 5D1XD 3TO2B 4X7EC 2DQHL 3N40F 4U1LB 3QEGH 2FJHA 3L5XL 5DD0H 1YEEL 4MJ2A 5BVPH 1IM9A 1O6VA 4HAGA 3O3DA 2WP3T 3B7YA 1B3IA 5DUMH 5IMMB 1E7UA 1BM3H 4RESB 2CKBB 3QNXA 4YGAB 3S98A 4L1TA 1CGTA 4XVJH 4F15C 3POHA 3QXVA 5DEGB 4ZD3L 4JVUA 4MJID 1T1ZA 3B43A 1T2QL 4AMWA 3ERXA 5DR5H 5EF3A 4O2FB 2LU3A 1NGPL 2Y22A 2ICWA 3D4GA 4HJTA 3DYPA 5T1KB 2DQHH 3BW9A 4HKZB 4N2DA 3L5XH 1YEEH 5MERB 2GITA 1Z9LA 4TKWA 5D1QE 2W0KA 2A0LD 3ZDYE 4PQXA 3TS8A 1TPXB 5DK0A 4ZD3H 3I84A 3S97C 1XBRA 1T2QH 3LEYL 5CJ8A 1BECA 3H0TA 2VMDA 4MB5A 4GPVA 3G5XA 1NGPH 32C2A 1U4FA 5DO8A 1WFMA 4ZK8A 1D9KA 2C8NA 5D5MA 4MD0A 4AIEA 4EIZC 1VRSA 2Y1ZA 3AGVA 2DH2A 3CFDB 4MMZA 1SUJA 4GRLA 4PCKA 4BQ9A 1E27B 2R1XA 4HJGA 5BZDB 3RJDA 4HIXH 1MDAA 2CLRB 2DM7A 1D5ZB 2QSQA 4HEME 3LEYH 3WFEL 1IMHC 2G9KA 5G4OA 2X2YA 4YLCA 1LYQA 1FZKB 3VFNA 1SJEA 1BZ9A 4U2ZA 3QIBA 3T77A 5D7SL 4YHPB 1NUFA 3LQMA 5D1QC 5FIEA 1WD8A 4FI6A 3TF4A 2M1KA 4NDMA 4XO5A 3VRLF 5BRPA 2JLPA 3LTVA 4Y2DA 5CKAA 3WFEH 2YPLB 3KBPA 2IWFA 5T1MB 2IXQB 3JUZA 4ICWA 5CEZE 4LVOB 1MRFL 3RILA 1NJ9B 4XP5L 2XKUA 5D7SH 4KQ3L 3AU1B 5FO2A 1MRDH 3II1A 4KZCA 5HHOA 2J72A 4RMBA 2Z3FA 4JQIA 1YNKL 3KEDA 5H2BA 5ICZA 5HYJE 5AVRB 5C7XL 3IVKB 3SGKC 4EI5A 4LZKA 3S8FB 1C5DA 1M7DA 1MRFH 3T65A 1SDAB 4XP5H 5CO1A 1AO7E 2OL3B 2WQVA 1JGLL 4KQ3H 4PRHB 4Z7QB 5KS9A 5JHDA 1PD1A 3O4OB 1MJUL 3NIGF 1CVSC 4XCEB 5BOZG 1TKWA 2OXHB 3DOSA 3KPRD 5TQ0L 1KEGL 2V17L 2VDOL 4CMHC 4EDXA 1YNKH 3TZVA 3PHOA 1CL7H 1U92A 3HPLB 5C7XH 4IGBB 4XXDB 2X12A 3ARBB 1CDHA 1KWKA 1UH3A 4JRXD 1HEJC 3QQ4A 1I7RA 2AP2A 5C0EA 1JGLH 1SEQH 4JFWA 1G7QA 2X1OA 3I9GL 3FBKA 4C56A 1MJUH 2XTSA 4P2RE 5TQ0H 1KEGH 3D39D 1DP0A 2V17H 2VDOH 2X4RA 2Y3NA 4OI7A 4PEEA 1NFDB 3EDJA 4ZMYA 3P0GB 1IAIL 4PGBA 4L9LA 3VXUA 5GQBA 1ETZA 1Z66A 2X6CA 1KYAA 3FFCA 3BMVA 3QUYB 2XKNA 4JREC 3I9GH 4PJDF 4GFXA 1G1YA 3QUGA 2ENSA 2P5EE 4L4TA 5DJYB 4AJVA 3O9WC 1XZWA 4Y2OA 4FFYA 7TAAA 3EO0B 2IDSA 2JE8A 4KX7A 4MSWB 4U7MA 1JWSA 2PWEA 1JGIA 2XTJC 4P3DA 4WTZG 1J9TA 5D7LD 4JFVA 3BSZL 1QAWA 2IV9A 2APSA 1RZGA 3CFCH 2Q7YB 5EZPA 2ZTBA 4HIQA 4E41E 3GF8A 4BFOA 3ET9F 1WC7B 2D4DA 4FQIL 4G8FA 2OYKA 3HRZC 3K6OA 4UANA 4HC1A 4TLKA 5JIPA 3PAUA 2VB5A 3BUIA 3BKML 4F7PA 3V8OA 3L4YA 3OVUB 5I8CB 4YHML 1E6JL 1YNTB 1QLRA 1OGAB 2OMWB 4JZOB 1CDGA 4HGKC 5K1JA 1Z9MA 1KLGB 2QQLL 2FEEL 2VDPB 5DMYA 1A2YA 1X6NA 3MO1A 3FCSA 1L6XA 4FQIH 2YGQA 4N68A 5JORB 4DT2A 4WI4A 5GJTL 1ZCRA 1U93A 2IH1A 3KBFA 3ZE0E 2J8OA 3BKMH 2UV3A 2Q0ZX 2Q87A 1BFTA 5C0BB 2HYMA 4YHMH 1E6JH 2NPLX 4RMWA 2YGVA 4U05A 3QDJD 3J27A 4KV5E 3CN2A 2QQLH 1Q72L 4KRNA 4POZD 2BIQA 3HB3C 1IGJA 3AY4C 5GJTH 4C4BA 4J3BA 4P4KC 1Q4NX 3HKFA 3VXPB 4FYRA 2EEAA 4HIEA 1AIZA 4I4WA 3WNKA 2C9AA 4WU5B 4P5KB 3DVNA 5D7IE 1Q72H 2ZPKL 2AF2A 4NP4H 4CKVX 2OW6A 2FT8A 5AZUA 1S7XB 3ATFA 3PGDA 4I0PD 4B9IA 3MROB 5E00B 4NUPA 4G80B 5DEJA 2H32B 3QORA 3K6FA 3QAZC 4WFEE 1HAUA 3F12B 1Q38A 3Q8FA 2XPGB 4A2FA 1BXAA 2EEXA 1E9QB 2IDCA 4H5SB 4PIBA 2ZPKH 2P46B 1CZ8L 1CPUA 3VFWA 5KBDA 4MJJA 3SGJA 2GEQA 3QXDB 4M61A 1LTXA 1TETL 3BWUF 3QRGL 2NXZB 4J3WA 5HGBA 2VSMB 2HRPL 1EJOL 2MPVA 3MRFB 3N50A 5CJQL 4DAGH 3GXDA 4QOKB 5BQ7B 3SYAA 2H1PL 2B1HL 1I9JL 1S9WA 3I75A 1CD8A 3OKLA 1TZIA 2VABA 4YXLL 1CZ8H 1QABA 3ZO9A 4O4YL 5HHQA 1JZEA 1TETH 2KZ1B 3QE5A 3RIKA 4F7CB 4DW2L 3WS3A 2DL2A 3QRGH 4UF7C 3VH8A 1BQHB 2AK4A 3WIHH 2HRPH 1EJOH 5CJQH 5LXVA 4N5UA 5FGBA 1J10A 2LW3A 3S37L 2H1PH 3EGDB 2ZX5A 2B1HH 1I9JH 3P11L 3PUCA 4YZFF 2IFFL 1DN0A 3D51A 1DQQA 1PLGL 5E6ZA 2FBRA 5BS0B 4YXLH 1IUZA 1RZ8A 2CHWA 5IB1B 3SPIA 1KPUA 2QMKA 4LHJB 4Y1TA 5DYOB 4AM0B 4BA0A 2WYIA 2ODIA 4CC4A 3ILPB 4DW2H 1HHIB 1ZS8B 1KIUB 2R2EA 4NM4L 4U1NB 5B3SB 1XF5A 4DP1X 2WQRA 3TXAA 4NKMB 5G2NA 4I9WE 4QWWC 3BP5A 5DMGC 4RGNE 5GGQL 4WI0A 3S37H 3F7VA 2OV0A 1KNOA 3EJZC 3P11H 3NZ8B 1X5KA 1PLGH 4IBYA 2PWDA 4LP5A 4KO9A 5C8JA 4KJPD 5I8EB 4N0UE 4NM4H 3LAFA 4OFIA 1KYDA 3QIWD 3U9UA 2ATKA 4H0LC 4MCNA 2P3YA 1CT8A 5GGQH 3EBHA 1I7TB 2FHBA 2YEZB 3K2KA 4YEEA 2ZG1A 1R9FA 3VI4F 1L3WA 4OD2B 5AOLA 2ADIA 3QEQB 3LPPA 1EZUA 2K0RA 2A4CA 3LRLA 1CBVL 2IPKA 4XOCA 2B0SL 1UJ3C 2W0FB 3T4AB 5DA4A 3ESVF 4N22A 3KGTA 1CI3M 2PN5A 4I3SL 2P5WB 1N7ML 1O0VA 1SXAA 1T04A 4UUJB 2J55A 4JZJC 3Q5OA 1YMMB 4YIQB 4XN4A 1CL7I 4YLQT 3V4UL 5EMYA 3VXQB 3MV8A 2AJXH 3IDJB 2GCYB 3P4NA 1CBVH 4XCNB 3GSNB 4AUJA 2B0SH 1CTOA 3B2MA 1FG2A 1OAYL 2FJSA 4U0RB 4YSDA 1CFTA 1MELA 1KCLA 4I3SH 1N7MH 4F57L 4HH8A 2WBJB 2CDEA 3HLKA 3QDGE 4A7SA 1FYTB 3S35L 1QD0A 3V4UH 4PJ7F 2WB7A 4NN6C 5J12B 1Y1DA 3FUMA 3GGWA 5D4JA 5D6CB 1JGDA 3K1DA 4S0TD 1OAYH 1Y0LB 2G3MA 2YLHA 1NCNA 3BZ4A 3V4VL 3WN5B 4F57H 3JWNE 1KB5B 1KCBA 1JZ2A 3ZDXE 5EDXA 3S35H 1L9PA 1RZ7L 4I89A 1X5XA 1MCRA 3WTSA 1GSKA 2WLHA 4N24A 2OSXA 4DESA 1TNMA 4BK5A 2VR8A 2B1AL 5HJBA 2WXOA 1JYWA 3UDWA 3OKNA 1WG3A 3V4VH 1XIWA 2P9RA 4LEOB 4NYLB 3NFNB 2HH0L 4R2GB 3WMPA 1RZ7H 4JFPB 1K4CB 5IOPB 2L7UA 1HK6A 3UL4A 4GBXB 2GK2A 1SXZA 3LKNA 1JIBA 1PJWA 4PJCE 2VC2L 3JWNC 5KJ4A 2EE9A 5AZEL 5B39B 3UYOD 2FT6A 5AVSB 1MXDA 3VXMD 2HJFB 4PV9B 2HH0H 4Z7VA 4DZBB 1ZANL 3IPFA 2YKKA 3CSBA 4Q97A 3LZLA 4AZ8A 4F27A 4AT6A 2J1XA 3HUJA 3OHXA 5CSGA 5I0VA 5CJBA 1M6OA 2VC2H 3FB5A 3TH2T 5AZEH 2QDWA 3IB4A 4MASA 4N4YB 2MCG1 1E5BA 1Z0MA 4P59L 2O26U 3KAAA 1DVUA 5IEKB 1FFRA 3HPJB 4H26B 4MXVF 4X9HA 5CSBA 1ZANH 4RLDA 3QZNA 3MUGA 1WICA 5C0RL 1EHLL 1IZJA 1ODAA 1F1GA 3OF6A 4JCLA 3FB8B 4E68A 2VN3A 1MY5A 4Y1AE 4PP1D 2A6JA 2JK5A 4P59H 3GSUB 4OQTL 5DRNA 1KJVA 4NZRL 2GJ6A 3Q01A 1HHGA 2BM3A 1NBYA 1SBBA 1MJ8L 4OF0A 4PBXA 3CFBA 4NIYE 3UYPB 1EHLH 4AKQA 5C0RH 3EJTA 1DLHB 4L1SA 5BV7C 5F7FA 2V5SA 4N90E 2JMRA 4WO4A 4NN5B 2ENPA 3VTMA 4LDCA 4LPWA 4OQTH 3LJ3A 5E56A 5F1IA 3AREA 3GMLA 4NZRH 1SBSL 1HE8A 2F8VA 1S2EA 4XX1E 3WLBA 1MJ8H 4WKXA 3SIKA 2V2XB 5D4HA 1E3FA 4J4PC 2OMVB 1IC1A 3UC0H 4QRTB 1E9PB 4P8QA 2C4FU 1NUNB 1H3VA 1BMGA 4L29A 1MDTA 3R8BB 4UYQA 1A3RL 4FA8A 5IV2A 1A6ZA 4ODXB 4AV4A 3GLEA 2XJLA 1SBSH 3WGVB 4EI6A 2FNWA 3RX9A 2XTLA 3PYCA 3HI6L 4G70B 3UFIA 1W72A 1WZAA 3OHMB 3IRPX 2ED9A 3F7KA 4ICXA 1IKNA 1DQDL 1ZTMA 2Q1EA 5DJ8A 2I9LB 1AD0B 1A3RH 5DJ2A 2EXWC 3M1BB 5JPMC 4WFGE 3M1OA 1FLTX 3CPLB 4G6AC 3BD4A 4IRJB 3HI6H 2X05A 4NERA 4XB7A 3MBEA 3TN0B 3U25A 4NHCL 1DQDH 1GJIA 2Y5TA 4RQQB 1H5BB 1FVEB 5SWZB 2BVTA 4Y4FD 3HBGA 4FLQA 4GRMB 1G6RA 3BLKA 1DCLA 3CDYA 1E2VA 1F6LL 3QQ3A 4ANVA 5TK2A 3LN4A 1PF3A 2BW5A 3CUPA 3LNEA 4YDIL 4X8GA 2Z8WC 4WHYH 4UOZA 4YDJB 2KZWA 1RD6A 2K6YA 4MFHA 4B9GA 4ANWA 1F2QA 1T4WA 1DBBL 1EPFA 3BIBX 2AVGA 5BO1L 4Z3FA 1PX3A 1U8PB 4IDJL 5GGVY 1TPXC 2SEBB 1TU2B 4F2ME 4YDIH 3SBWC 2WO4A 5BMFL 1D7BA 4DEWA 1TSHA 5D93B 3SCMA 3ZKMC 4FQXA 5JYMA 2EDNA 2YPLE 1T03L 2BNQA 3FW6A 2MOVA 5B8CB 1HILB 2BOCB 3NFPA 1DBBH 4AYEC 1ZHKB 1HNGA 3PJNA 4IDJH 1NKGA 1AGBA 2FYYB 2WIIB 5DUJA 4U7SA 5BMFH 1EHAA 3MV7E 1CLYL 1EFXD 4AK1A 1T03H 2P26A 4X2UA 1FRGL 2N1KA 4NQEE 1W16A 5CEZL 3HOGA 1MREL 3BN9C 4PRHE 4APXA 1XGTB 1IBHA 4HGWA 3PUUA 1X5FA 3O6FC 2NX5D 1GZHC 3VW3L 4U3XA 1CLYH 4XNQA 5EBWB 4HH9B 4JHUA 4LVOC 1FRGH 3CHRA 1NEZA 3D06A 2H45A 1ACCA 4JFOB 4MMXA 2XV3A 3MNVA 3MLZL 4R5XA 5CEZH 5D1QD 4KZDL 3T3PB 2NUPA 3HN3A 1MREH 3LXAA 3CDCA 4W9JC 2NY1D 3DUSB 3KPSA 4LP8A 2IANA 1M6UA 3OWRA 3MJGX 4ZQKB 5B1AB 3RB5A 1JE6A 5AOZA 3KH3A 3VW3H 2NW3A 1NFDE 4F33B 4HWUA 4OZGB 1ZHBA 5MI0B 5FKAB 1CDJA 1SYSA 4LLMA 1JF1A 4TOYL 4GYBA 3MLZH 3ULSB 4E9WA 3PWLB 2WBXA 3HNVL 3O4OC 4KZDH 4OVVA 3ALXA 3EAKA 4NGHL 2WBWB 4U31A 2BVOB 5I6MA 3BAIA 3WGUB 4ZZFA 4AVKA 4ABVA 4ODVH 4RGOL 4YXKL 1CE6A 4BXVA 3OKOA 3DO7A 3ARBC 1AGCB 1TG8A 4XTRC 4LU5L 4YDLC 2JI1A 3W81A 4TOYH 5JOPD 5CUSL 3D08A 1XGRB 3HNVH 1S5IL 2WOYA 4NGHH 2VERA 1DO5A 1BVLA 4EAEA 2V3EA 4G11A 2FSEB 3ARXA 3TA4D 3RAJL 3PAVA 5C3TA 3DIFB 2MPAL 4Y9BA 4YXKH 4RGOH 3LS5L 3V55A 5IF0A 4LB8A 5FFOA 4YSCA 4XO4A 4CC1A 1OGAE 1UOKA 4LU5H 2C3VB 3UZQA 1R3HB 4P2OB 5IZ7A 1DVZA 2CG9X 5CUSH 1PSKL 4YUEL 2QPSA 1S5IH 4PWGA 1S7WA 2PCXA 4WK2B 3QISA 1AR1D 4YK4B 2HLAB 1ORQA 1YY9C 4KRPB 4NO2A 3U9PL 4PCYA 3HBZA 5CIPA 4LBEB 4RMSA 3RAJH 4FJ6A 5J3HC 2MPAH 3OMZA 4K55A 5C0BE 3DVFA 3LS5H 3CFEB 4H0HB 1S9KC 2YD2A 1JP5A 4TF4A 4P5TD 3CSYA 2LLGA 1PSKH 4YUEH 1EHXA 3JXAA 3O6ML 3OJDB 3DUHA 1I85C 3B9KA 4Y4KA 2DS4A 5C0FB 5DXWA 1U58B 1PEZA 3QCTL 1XBDA 3X14A 4KVNL 3O9WD 1GYVA 4CNIA 1TZHB 2BK8A 4N1CA 2WLIA 2XTJD 2PABA 2V5MA 3AZUA 3NEOA 4OGZA 4L3ED 3RX7A 4KDVA 2R29L 2J57A 1VEOA 3C8HA 4JQVA 1TQBB 2ZSVB 3OGCB 4KROC 3O6MH 2E3VA 1WP6A 2GAZB 2IAMA 4MJ6B 4LCCB 4HFWA 4YBLB 5KYXB 3QCTH 3WO3B 2Q20A 4OZFG 4BK8A 1J5OL 1ERNA 3LH8A 1ECYA 1T7YA 1TJGL 5KOVC 2AV1B 2G0LA 4PJEA 1AP2A 1IX2A 2BSDA 2R29H 3FN9A 1FO0A 2EDRA 4TNVF 4LHQB 4CGUB 5L2KA 2CBPA 3L17A 3WY1A 4QLRA 2NT1A 2HMIC 3BUQA 4X8XA 4DOHB 2J43A 1HKFA 5TH2A 1SNRA 4JFYA 1W6WA 3SQBA 1P2CB 1J5OH 4AQZA 3BRGC 2GJZB 1TJGH 4GKZA 3LDBB 1BQSA 4QOKE 3SPHA 3A4EA 4QHKJ 3FSWA 5BJTB 3IBOA 3O3AB 4LLAA 4ODUB 4L37A 3W0WA 2A6IB 1MCLA 2Y5QA 1JPFA 4E9YA 4IBQA 4GG6E 4XE0A 3KVPA 3QZOA 1NAMA 2W65B 3CVIL 3ECVA 1B9KA 5BS0E 1TJHL 3OL2A 3MRCA 5ALCL 2NR6C 2NXZC 4N3TA 3HS0C 1EK3A 2DQTH 1UEYA 4I2XB 3ZRFC 3EBIA 4ZW5A 4TVSa 2QDVA 4HMDA 5IEHA 1MCEA 5DJDA 2OPCA 4NKQB 3CVIH 1U8LB 4AVHA 3BQUB 2FLMA 3G9AB 1OCZB 3OG6B 3VCLA 3LOWA 1TJHH 3MNWB 5K33A 2D7OA 3DURA 4JHVA 2PR4L 4KK9C 5C08A 1WBYA 1HZLA 5ALCH 4JCMA 3O2WL 3CMGA 3GSRB 3ZBMA 4GI9A 2VLJB 4LNVA 3S5LA 3QR2A 5DHVB 5EEZA 1D7FA 3L3GA 3FOLB 5HDWA 5CBAA 1NCCL 4ZOEA 4DKAA 3LX9A 2ZWKA 1T89C 2AJZB 2E6JA 3L45A 1B4TA 1KCWA 3HE6B 3QEQE 4LO9A 4X7SL 3ARGB 1T21B 2PR4H 3VFPB 4IOIB 4WFED 3O2WH 4ONGL 4X4YA 2BVUA 2UWEA 1MHCA 4BEIA 5FF6A 2XN0A 1NCCH 2X2UA 5E5LA 1YMME 4JY4B 4ORGB 2VQTA 5I5IA 2YOCA 2MQGA 2ZOWA 2ADFH 3QIUD 3MV9D 3PWNA 3GS4A 4NJAL 4X7SH 2EXTA 1C7TA 2X3BA 1OTTC 3CHSA 2E75C 3CCHB 2UZIL 4ONGH 3MYZA 3P4OA 4QJ5B 2X4OB 3G5VB 2GSGA 3L9EA 4NCDA 4NKOB 3IXAA 2CO1A 3CZEA 2YUVA 4QWWD 5DMGD 4A6YA 5F0MB 5DQJA 3VXNA 1MEXL 3RGVD 2MTPA 4UZSA 5IROC 4XNDA 1HQ4A 3OLEA 4JJOA 1T1WA 3FT1A 4HHAA 4OUUB 1HI6A 4QHLA 3V6FB 4PGCA 1WE5A 3ATEA 2WYHA 4NJAH 4OJEH 3T4AC 1FL5A 5GRWA 3UBFA 4FTVD 4ABUA 3QJVB 2UZIH 4PJ5B 3RVXD 1XMWA 1OE3A 1UHVA 4TUUA 5A3IC 3CZSA 1QQDB 5I8OL 2FE0A 3HE7A 3D7PA 1R5VB 4IRSB 1SJMA 3NFSL 4XBEL 3U4AA 1MEXH 4MLIA 3KWXA 3UG3A 1BX2B 2HKFL 3AWGA 4S1DC 1JGUL 1KFGA 4ZMAT 3O8XD 1ZS2A 4NAJA 4Z95L 1UCBL 1A1OA 4H13C 4EN3B 1BLNB 1MG2C 3FUKA 2EH8L 1R34A 4LLUB 4U0RC 5F7WC 2B5IB 5IHLB 3MNZA 5JQIB 4I9WD 5I8OH 1KT2A 4GXUN 4W9ZA 2EXYC 2HPOA 5E6IB 1XZ0B 5F88A 1OHQA 2XWTA 3NFSH 2B08A 4LK4A 2ZE0A 4HD5A 1JXJA 1MQKL 4QRPA 2Z4QA 5TE4L 3ARFA 3NSYA 4XBEH 5INCB 3PWUB 2HKFH 4HHGA 4K0OA 1JGUH 2Q3AA 5J12C 1WCBA 3ZE0F 1SJHA 1UKSA 4Z95H 5BRZE 1UCBH 3RWJA 3T71A 3VGFA 5C0GB 3T0VA 4MA3A 2EH8H 4YAQA 2OULB 4QRSA 4JFDB 3G6JE 5LO7A 4KV5F 2NCEA 1Z7JA 2YGNA 3FQNB 3MRQA 5AVXB 3VXSE 1CUOA 5TE4H 1MQKH 2G4EA 3IMRA 4EPSA 3L4XA 4OFDA 2RACA 4ETQA 3QEHA 3L3DB 1U42A 3KCWA 2EC9T 1OHZA 5KSAD 1BFOB 1HL8A 3GMPB 2OMYA 5J8OA 3BDYL 3MRKB 2BCKA 5LGKA 4DCQA 4XN7A 1MH5A 3ML9A 5D7IF 3D6GA 5EU5A 3GINA 4R2GC 1LP9A 4XODA 4UZGA 4LLYA 4IU2A 3WBDA 3QCUL 4OH2A 3Q6FA 3GKZA 4YNYB 1P1VA 5I2IB 3MUY1 1A6TB 1KIRA 4LPUA 2EC9U 2DQDL 4OI8A 5DA0B 4UB0L 2R69L 2WOBA 3C60B 1FAKT 1VENA 4OV5A 1Z9NA 2BNUA 4JGNA 2VXUL 3BDYH 2XQYA 4XBGB 1A9VA 3QDGD 2MQ3A 1EBAA 1KN2L 1HT6A 5CAYB 3N6YA 3VSQA 3DV4A 3P2BA 2WLLB 1R46A 2NQCA 5GZOA 1TMCB 2OM5A 3QCUH 3RQ3A 3ETBJ 2ZYRA 3OKKA 1ZAGA 2FQGA 2XIBA 3KYMB 4K9EC 4LKCA 5AW5B 4CA4A 2DQDH 1ZPUA 4UB0H 2R69H 3BD3A 4ZS7L 2HJKB 4LARL 3SE4A 2VXUH 3RLSA 1QR4A 4AGLA 2AXFB 3A67L 2VDLL 1KN2H 4HUMB 3RZCA 3T6QC 2I25N 2YFNA 2DZEA 2CO3A 3ZTCC 5HDBB 4BH8B 2AKRB 3V9CA 3WHE1 1E65A 1M9SA 1FH2A 1BZQK 1V5JA 2V5TA 1I1AA 2UY6B 3C6EA 4G8GE 2H9GB 3U46B 3Q8BA 1JZHA 3L9YA 1NCHA 4ZS7H 2H1LM 4B0MB 2X6MA 4W9EC 4LARH 3KLAA 3A67H 1DJXA 5E6YA 2F53B 2VDLH 3QI9B 4O02A 4C58B 3UROR 3VE0A 4YFLI 1UD2A 3L5IA 1IV8A 3U6XS 5F3FA 1KACB 5CM1A 1H8SA 4LVNB 3FUDA 1GZPA 4YPGB 3JBG7 3BZEB 1XB6A 4M93B 1N19A 4NN5C 2EDOA 5CD3B 2UVFA 1RXLA 3ZUNC 3VX0A 2F7RA 2C9QA 2G75B 1QEXA 3DRTB 5C86A 1BAFH 4TQPA 5BVJA 2K3TA 4G82A 1GZQB 1YUKB 4YHOL 1A5FH 4XPBL 5L2JB 2NNRA 4X50A 2CKBL 1BD2B 3NCFB 4NQDA 3N41B 2EABA 5FECA 4Z7WA 5AUMA 4K7PX 3EZJB 4AKPA 3TBYB 5HYQA 2D31A 4L8DA 4JM2A 4RFEA 3LN9A 1E8XA 2DWDB 3EYOB 2X70A 4U1HA 2EE2A 3AG4B 1XF2A 1S9YA 2HT3D 4GUPB 4I18A 5KSBA 3ISWA 4YHOH 4XPBH 2YHGA 2PPEA 1PCSA 1VADB 2CKBH 4MNGB 2CA4A 3UJIL 3IU3A 3GJFA 3SZKC 4PLJD 3LNHA 4ORZC 2P44B 5LNEA 3SE8L 3AWEA 5JZ7D 2WHVA 4ANKA 1Q1JL 3U6XA 2GT9B 1M71B 1A6AB 3DGCR 4IRJC 3VRIB 4PJ9A 3MACL 1O6TA 1QR1B 3TN0C 3P0VL 1AIFB 4X5PA 1T7ZA 3UJIH 2H41A 5IESL 4U1MB 3D85D 2HG5B 3O2VL 2ESVA 4OF5A 3CFQA 3SE8H 2BS71 1X44A 4PJ8C 1E4XI 3QJFB 2VXQH 2EXWD 1Q1JH 1UWFA 3RX5A 4Y2LA 2FUQA 4G6AD 5HTSA 3DA0A 3MACH 4PY8J 5HJGA 1X9LA 5G5DA 3P0VH 2X87A 2SODB 4PWFA 3L16A 4MRCA 3TYGL 3BZ5A 3EG9A 3UZEC 1HWHB 5IB3A 5IESH 1CXIA 5HJ3A 3NSJA 3O2VH 5ITFA 4F2EA 4PRNB 5E4IA 2J8UB 4FN0A 3JV6B 4LL4A 2FJGB 2YRPA 5DO2C 4APQA 1FAIL 5LNDA 2OSLA 2BS8A 1BBJA 1D5XB 3WIIL 4JGMA 5HHNA 3TYGH 2V37A 4U1GB 4U7KA 1Q8MA 1LO5A 3S3PA 4Z6AT 3JWDC 2BSSA 3BPCA 3IPBA 3CHQA 3MA9L 5B8CC 2WCPA 4Q89A 3FB7B 2EILB 4KOCA 4WFGD 4LFHD 4ZUSB 1I9IH 4FEIA 1IAMA 2D0FA 2WKOF 4NIKB 2OL3L 4UT6L 1FAIH 4DPCX 1NGXB 3I6GB 2ZF9A 3WIIH 3QJHB 2B3IA 2QQQA 3C5SA 4PJCF 3ZKMD 4HOZA 2R15A 3GHEL 4LSSL 2D7QA 2JXMB 4Q6IB 4FQLL 4TTGA 2WZPA 3MA9H 5DHDA 3A4AA 4AQOA 1GOGA 1QSFA 3LEXA 1MIML 4L8BA 4OZIB 3QQNA 5JW3L 1S46A 3FXIC 3UBXA 5A2LH 4UT6H 2OL3H 1E5YA 1BZ7B 3PHAA 3L8QA 2F54B 2C1OA 2GK0A 4Q9QL 4HWEL 1AZUA 3I6KB 4S10A 3WTXA 4LSSH 5JHMA 3T1FA 2NW2A 3FUJA 4FQLH 4HOWA 2BH0A 1MIMH 4G9DB 3VFMA 4BFIB 2LABA 5JW3H 1OLLA 3QQ9C 4LLWA 4OU3A 1T80A 3SKNB 4W4OC 5IR1B 3U7WL 4R7NB 4Q9QH 2YPLD 1SUHA 4ZUVB 4HWEH 4ENEC 2JI3A 5MI0C 5ENWB 2NQ3A 2HFEB 4ELMF 3INUL 5FGRA 3CVBA 1GKOA 4NO5A 3RUGB 2VM3A 5JO5A 4B9JA 1JVOA 2IIJA 4U4IA 1FI8C 4WUUB 3AM8C 3ARWA 1G7PB 2FECL 2E56A 1UFUA 3SDXA 5I0XA 1N2RA 4Z18A 1E4HA 4HIHA 3JTSA 3FOMB 1T22B 4Z3HA 4FA7B 3INUH 3L9BA 4AXWA 1S9VA 2FO8A 4JDVB 5EPMB 3QQDB 1RK0B 2XWBA 2ATPA 2VDPL 3BSGA 1GXEA 3RBGA 2VCOA 1Q9OA 2D8KA