2QVKA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
189
structure length
121
Chain Sequence
b'HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEGRPILGEHTKLEVIIEESYEFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal binding protein
total genus 26
structure length 121
sequence length 189
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvkA00
2LT9A 3FQ4A 3US9A 2DPKA 3E9UA 3RB7A 2QVKA 3GINA 3E9TA 3FSOA 2KLTA 3H6AA 2QVMA 3RB5A 2KLSA 2FWSA 3EADA 2FWUA
chains in the Genus database with same CATH superfamily
3MROA 1KCVH 2A99A 2QADD 2Y6SD 2AEOA 4G80A 4GRLB 4H8WL 4ZXBA 4N1CA 3QC5X 3VJ6B 2JQAA 2R23B 3H3PL 4FNQA 2AVFA 1OLZA 3BIBX 4RLDA 4PY8J 4U1NA 2XBTA 3UP1A 1BBDH 3AQYA 3GLEA 3V7AE 1BVOA 4XNYH 4ZJ9A 4LASL 1JZ5A 2DQFB 2J2ZB 2ZPKL 1IM9B 1NKOA 5I82A 3F65A 1S9VB 1AMXA 1E4XH 3B5GA 2Z35B 3QNZB 3QULB 4X80H 1DANT 1XD1A 1N3NB 3T0VA 4BCYA 3QWRD 3NJMA 3VG0H 4EDXA 3TA3A 2MPVA 3I50L 4ZD3L 3ZDXF 2Y3NA 5DD6B 3VNYA 1WD8A 4W9EC 4Q7DA 4BA8A 4YQXL 5I26A 5EF1A 3MX0A 3RQ3A 1NGZA 3GLDA 3CFCH 4HOZA 4ONGL 1FQ9C 4GG6F 1MHPL 3UTZB 5BS0B 1OAQH 5FEBA 3KYMB 4TSAH 1U8KB 2KZBA 3QUHA 1OP5H 3KBHE 5EU7E 5JQ6L 4LOVA 2XZCH 3S3JA 3ALWA 2F2HA 3R1GH 2BW5A 3VNZA 5BRPA 4UI2A 3EGSA 2NR6D 5B39G 4QOKA 1W16A 2OXHA 2Z31A 1XH3A 1BFOA 1XWVA 1XSJA 5J5EA 3VI3A 2KC0A 4KUCD 1CBJA 4J6RL 4MFHA 3QZWG 1CICC 2OMXA 2IDUA 3WL9B 1DQIA 1P4UA 3C8DA 1S7RA 3N41F 5GRWA 1QPKA 5TJWK 3WDIA 1MHEB 1JZ8A 1KDIA 3QZNA 1CLVA 1EO5A 1W0WB 3SE3C 2HVKA 1D7FA 3QHZL 4FHJA 4H4NA 4J8RB 5JZ7D 3ZT7A 4F15B 4CSZA 2J5WA 3LRSA 3SGDH 4YFLI 2EDYA 2I26N 4X5QA 3OWRA 4BUQA 4ZMQA 2PYFB 4BKLB 3RY5A 4Y2OB 1CLCA 3HS0C 4QNPF 3IJYB 5BV7B 4O2EB 3GRWH 5DRWA 3EFFA 3NA9H 3WEOA 3BGMB 3ZO0A 4HXBH 4MAYA 1LILA 3KPMA 4MNGE 2Q6WB 4W4NA 4YZFE 5C7ZA 1RZJL 3PNRB 4X4ZA 4F7TA 2Y5TB 2XACC 4Y16A 2XTLA 3MLSL 3MV9E 4K8RL 2A38A 4DNLA 5CEYA 3D39A 3L7FB 3S88L 1OTSD 3E8UL 4CC4C 1MRCH 5FR3A 2PW2A 4P5TA 3BH8A 3WBDA 4AJVA 3ZL4L 1CGUA 1A5FH 4X6EB 5D7HA 5FX3A 4DFHA 3WE6A 3HS9A 4WV1C 2YD7A 4Y2DD 2UZIH 3RGVC 1OGAB 4ZMAT 5GSRA 5F89B 4M7LH 4ODUA 4F15C 1M2OA 1LEKA 3HAEB 5CEZL 1ZE3C 5LG1A 4CGUB 3LB6C 1JZDC 2NYYC 5HHPB 3U48A 5IFAL 4Z7WF 1IBGL 2CM5A 4Z3EA 4B9YA 5K93A 1GGIL 5ES4B 3MV8B 4MB4A 4HULB 2YD1A 4TNWK 4I7ZC 4HT1H 1XX9C 3BAXA 4KGLA 1XGYL 3VWKB 4DP1X 3AT9A 5GRJL 2X2JA 2QMKA 3BDXA 5B4MC 4JKKA 3V0GA 1Y7VA 3AUWB 1XFPA 1GZQB 4I2XB 5D7IB 1IC4H 1JWMB 4AL8L 4Q9RH 5MEPA 3O4LA 3MMEB 3DUUA 2WXRA 4UZGA 5TE4H 3T04D 5DZJA 2YXVA 4UUJB 3GKWH 4JPVH 4NZ8A 1OANA 4M3HA 4OLZH 3AGVA 1KTDB 3MOBH 5T1LD 1MHCA 2E5EA 2X4PB 2OR9L 3LN5A 4JHWH 2OMWB 2Y9RT 2XN1A 2VJXA 2BNQA 2WVSA 4DEUA 1F4AA 4KJPD 1EWHA 1E8ZA 3JV4A 4NAMA 2GQHA 1LK2B 2EDFA 4KXZH 2FJGA 4X4YA 1WIOA 5I23A 1NGWB 4OZFG 1CPUA 2VLJB 1FJ1A 3PUCA 2OYLA 6FABH 5L6YH 1W8OA 4DZBB 3EYOB 3FC8A 2X4RB 4JDEA 1YC7A 5DMGC 3L6FB 3IMUA 4DCQA 3MRHB 4GKOA 3SDXB 2Y6TE 3TCXA 1KCKA 4PJ9C 3UPRB 1LE9A 2J4WL 2FR4B 5TQ0H 1TU2B 5I19L 4KO7A 1BZDA 2A9MH 5GIRB 4HEMA 2DZEA 2HRPH 2AGJH 4I88A 4NO0D 4RMSA 1ACCA 2HT4C 1SJXA 1T66D 4CVXB 2WLZA 3V5DB 1TSRA 3IU3B 4NJAH 3LJ3A 4FHBD 2CO2A 4GMTL 1MLBB 3OB0H 1PY9A 1JHLH 3EO0B 3L45A 3MRBA 2X70A 3JZYA 4YHMH 3AB0B 3DIFB 4HD9A 1F1DA 3UBHA 4UU9A 4XP9H 5EEXA 1HX0A 1PJ9A 3F6IA 1QRNE 5IP4A 5C0ND 4QHKJ 1P84K 5HYQB 4DHLA 1ACYH 1VFBA 2GJZB 4I48B 2VQTA 4AYFB 3MRMB 1HFUA 5FCSH 1PG7X 1WFIA 1JZ6A 4OF8A 4PJFB 3LRGA 4X2UA 4KX8A 2KLRA 3HOGA 2G0LA 1JVLA 2KH2B 2W1NA 1V7MH 2P5WD 3WXWL 5J13B 5GHWL 1OPGL 2X4NA 2VC2B 2V9UA 3PL6B 1TFPA 3I6LD 3WYRA 4M5SA 2ZXQA 5C9KA 2JLLA 4NRYA 4J3OC 3QI9D 3EADA 4OZ4B 2NY1B 5E6UB 3MOAH 3ZN6A 2PPCA 1JGVH 2V3EA 2VQ4A 3KPSE 1N4XH 4LHUG 2EDLA 4NN5B 1OALA 1RLWA 1JI2A 2F7PA 4G8GA 4UB0H 5LJYH 2H47C 3ARED 4HIXL 2MNUA 2N56A 4FADA 5E9DA 2ZAHA 2CKBB 1ZTXH 9CGTA 5KG9B 2OQJB 2EUZA 4BKTC 1DQKA 4K3DH 3V7AG 3PXJA 4C83A 3DK0A 3ETBJ 4OUUB 3HHSB 4PUBL 3OTTA 2B0SH 5IGXL 1BF8A 5EOQL 3MXVH 5I30L 4IOIB 1OARL 2CO3A 3EOYG 4OD3H 2NY2C 2QKSA 2OMVA 3ECQA 3CFKA 5E5MA 3KXFB 3QORC 1D2PA 4HALA 5D2NA 1YJDH 4WW1A 3MLRH 2Y06H 3H7BA 1ACXA 2EEAA 2PTUA 3O2WL 1QR4A 1YEKH 1ZXKA 5SWZB 2QPEB 3OSVA 2EC9T 2CA3A 4M93B 1VGEL 2PO6A 3KLQA 3WFDH 3RUGE 2YZ1A 2ZICA 1HINL 5IT2H 4KK5D 4FQJL 3LQZB 4NN5C 1PD1A 2AK1H 3WEXA 4WKXA 4ZUVA 4FX5A 4XPTL 1BIIA 4PJDE 3MV11 4YK4B 4GMSL 4NT6B 2A83B 3EYUH 1VIWA 5C0AD 5B38B 1H3PH 2YBRB 4Q56A 1LEGA 3F8UB 4K9JA 2APBA 1HHHB 3MA9H 2J43A 4NKIL 1A1NA 3W0WA 5KVDL 1YMMA 2IAND 3OR6B 3QFJB 1B6UA 3SJVA 3SDDD 4B95C 3L54A 4ZMXA 4H5SA 2F58L 1XGZA 2NNXA 2QADB 1KBVA 4G6JL 3AS3A 4PGZA 4PP1C 5D71L 1YNKH 2VDQH 3GM0A 4FXKB 1SOXA 1KCUH 2OJEA 3LRLA 4DQAA 2QVTA 4GW4A 3LKNA 2X7LA 1FN4B 5ICZA 3K91A 4YVNA 5CMAB 3P3TA 1FO0H 1UJ3A 3K2MC 1JTTA 5DFVC 1RK0B 3BMVA 2B15A 1FI8C 1EUTA 2XWRA 4YK4C 3S35L 1XGRB 3RRQA 4R97B 3UO1H 4UT9L 1R0AH 1Q1JH 3GSNL 4QCIA 1I7ZA 4HU2A 4TUOB 1QKZL 2QBWA 2ZG1A 1KGYE 2QLVB 5BVJA 5IF0B 1DSFL 3CPUA 5FDWA 3CXDL 2EINB 4G5ZL 1KIQA 3VFVB 3QRFM 4TVPL 2Z65C 1ORSA 2NY0C 4GRWH 3CFTA 4E5XA 3U7YH 2NSMA 4I5BB 1H0DB 2Y6SC 5DI8B 2ADGA 2A4CA 5T1DH 2QQQA 3M88A 2Y22A 1CLOL 4PJEF 1DN0B 3LS4L 3QDGE 2MQCA 1EHKB 1S7WA 2VISB 3QIUA 4FC3E 1MEXH 1FGVL 5ID0A 2BVQA 3BCFA 2YWZA 3GSWB 1MZZA 2EIMB 3JWDC 3L5WB 1WAPA 3LKPA 4FFYH 4QRRD 5DUMH 4QLWA 4L1HA 4OZHE 1A7PL 1DBKH 1CS6A 1G9NL 5JHBA 5L2KA 4XVSH 3N1PC 4PIRF 4DIXA 4LAQH 4HW6A 5ID1B 4R97C 5LGYA 1GYAA 4R90H 2EICA 5C2UB 4W93A 2OX5B 5CSBA 4APXB 5JA9A 3GDCA 4P3DA 3EDKA 4KRPD 1KCWA 4X5LA 2R1WA 1QO3A 1I3GL 3GUFA 4KROD 2GI0A 5GSVA 4KKPA 3RWHB 3RWJA 3SYQA 4FZEH 1IAIL 4M1CC 4U7SA 2NQCA 4GSDH 4XP5L 1TZGH 1SJMA 5IQOA 5CR8A 1GSMA 5C0FB 5DJ6A 1B9ZA 1NPUA 1T2XA 3EO1B 3EJYC 1FL3A 2SODB 3RB7A 4B9GA 3B1UA 4PJ5D 4M6OH 5BZXA 4J7RA 1FPTL 1HNGA 5EU3B 4F5CA 4K15A 4WI3A 3RIAF 3OXSB 3HZMB 3ARBA 4ELMB 4MXQC 1JYWA 4JFQA 2ATKA 1IVTA 5D7LD 4Y2DB 4LEOA 1MW3A 3L5XH 3MVSA 4N5ED 1BZ9A 3Q1SH 5JZ7C 3IKCA 1U8LB 2CRIA 4KV5E 3WN6A 4WUKL 1A6TB 2ZWLT 2A77H 2VERN 1OT1A 2BIHA 2PWHA 3EDFA 5GGSB 4C8XA 3GC3A 4Z78A 1IBZA 2BWQA 2F53E 4UQBA 1MG3C 1X5GA 1OGTB 4Z5RA 3TEZA 5AKRA 1Y1UA 2W80C 4KKQA 4WRLA 2ZWSA 5GS1A 1WCBA 3CMOH 3IRZA 1OAUH 1P84J 4BFRA 5J0BA 3BGFC 4JLRB 1DQTA 1T3FB 1E27A 1UXSB 2APXA 4ZX4A 1OTSC 3VSUA 3ZBMA 5I5MA 1WZMA 3X3GL 3KPRE 1PZ3A 1M1XB 3LEYH 2N01B 1HOCB 5DD3L 1E9OB 4AK2A 3ARDA 4ZMWA 5A43C 3B83A 4CADA 4Y2DC 5T1LB 1MY5A 1HH9B 2DQHL 3QUYA 3C6LA 3TH3T 4UTAH 4XMKH 1AKJD 1BDYA 2DYPD 5DHMC 2DIJA 2XWCA 3ULUD 1RIVH 1VGKB 2FEEL 1FBIH 2Q7AA 3L3GB 3W11C 4LSSH 1NCWH 5D55A 1QSFA 1NBVH 2QHLA 1UB6B 3WTWA 1Y07A 5T3XL 2WD0A 2XN0A 3ZL1A 1N6VA 3GHEH 4JQIL 4AWJC 1SXBA 4HOMA 5IMKA 4LMQI 3VAEA 5LVEA 2F6AA 2OL3B 1N5AA 5EZLA 5I0DA 2NOYA 4GS7C 1BREA 4NENB 4JS7A 4ODWB 2CMRH 5DD5L 3HI6H 3S5ZA 1K9TA 2J8UA 4N8UA 1VPOH 5MHSE 1G6VK 4R5VA 3MBXH 4OFPA 4F24A 3P30H 7FABL 3D8MA 3U6RA 3QWOB 2C9AA 5T8IA 4Q8BA 4AIZB 1EZVY 1E8WA 1ODAA 4NO0B 5KVDE 1F42A 4JHAH 4LPVA 1YQ2A 3EDEA 1IFGA 4S1RH 2XTJD 3WKQA 3V6FB 3DXAD 3H9SA 1NJ9A 5ISZA 5BVPH 1S7TB 4JO3H 2W07B 3VD3A 1A47A 4U1IB 4BK5A 2GK2A 3ES6A 3K8KA 2KBGA 2DAVA 4XO3A 1DN2A 3L3IA 4R4BB 4WCYH 2YGOA 5FCUH 1HN1A 1P7KA 3O6MH 4W4OA 3GMLB 2XG5B 1Z32X 5T1MA 5JW5A 4TQIA 2HX7A 4Q0XL 3EJRA 4M5YH 3BW9B 3P3SA 3P4MA 3ARUA 5DC0A 4ZO7A 5TDNB 4YAQB 1MQKH 2AHIA 4XWOD 3M17B 4A38A 1SF5A 5H8DA 4JY4B 1PKQB 2P5WB 4PY7B 5CHNA 4XXDB 5BW7C 4GRWF 4UANA 4F80A 4OZGA 3IXAA 2XVLA 2HG5B 1ZHKB 4PCYA 4G9DB 3CDGB 5EIIG 4XMUA 3QI9B 4J3VA 5ICXA 1F45A 2DPKA 5GS3A 1SF3A 1PZ2A 2DN7A 2GJ6D 2DM4A 2H8PA 2WKGA 3ASNB 2XVBA 1T6VN 2XVGA 5FYLD 3VXRA 1PPIA 3G5ZB 3FOLB 4EOWL 4Y4KD 9PCYA 4L8SC 3O45A 1ZWIB 1Z5HA 4K55A 3E0GA 3AREB 3CAFA 4XCEB 5C0IB 1EZUA 2H3KA 3I3BA 1W8NA 3WFEH 4U6YB 5EN2A 4KQ4L 3BO8B 4A6YL 1TXKA 4PJ8A 1J5IA 3QXAA 4NUGL 3KLSA 3APMA 2BSRA 1MFBH 5LN4A 3X17A 2E7LC 3K72A 3NIFE 3NZSA 3WJMB 1FV1A 1KT2B 1SZNA 3L9EA 5IVXE 1EEYB 3SQBA 2P8MB 4BH7A 4UV7H 2P4AB 2YA2A 4EKXA 3RWFA 3QR2A 3LRMA 5L8KB 3ZZ1A 4GKZB 4BSVB 1F97A 4YIQB 2LU5A 1UQSA 4U31A 3V4PB 4NRXA 5K59F 1Z9MA 4HISA 4XAKD 3ENEA 4GQZA 3CPLA 3CFIC 1BQHG 2XNAA 3JWDH 4MQ7A 1WD9A 4PJAA 2AI0H 2AQQA 4ZTOH 1WO2A 5I1IH 1A0QH 3DOSB 2EADA 5A2KH 1DVZA 2H3NB 3W81A 2E27L 3CCHA 3FONB 1PCSA 1FF5A 4EN2A 2P1YA 5C0AB 4P2RA 4YHNA 2M83A 5AKSA 3KEHA 4EVNA 4UQIM 2IJ0C 4XT1C 3T3MB 3NT0A 1BMWA 5EPMB 2WCPA 4U4IA 2FIKB 4OKDA 5FGSA 2WWMC 3JT0A 4KZEL 2IANB 1MREL 4ZTPH 2GBAA 1FFQA 3PWVA 2OMZB 4XBGB 3SDDB 1CE1H 3AG3B 4TUJB 1OOAA 3ZX1A 1YNTF 5HJ3B 4BINA 3LNHA 4JANB 3VH8B 2BIOA 3GD1C 4CJ1A 1MI5A 4RMQA 3JSSA 3S3BB 4IMKA 4PJIA 3V5HB 4RZCA 4GXUM 2XSKA 3KWTA 1YYLL 4Q9BA 1CI3M 3QHFH 4G6ML 4PRHD 1EERB 1SBBA 5CIPH 1T22B 4J3OF 3FH7A 4EJ1C 1QFWH 1TVBA 2IV8A 1CD1B 3BRDA 1HYSC 1OZUA 4AV5A 5INCA 4MWFB 3MDJA 3DX6A 4M3JA 3D85D 1CF8L 3G7TA 3LH2L 4ZI8A 1SOKA 1DCLA 3F5WB 1UZ6E 3MNMA 3BZ4B 4LASH 1BZ7A 3HCVA 1V27A 1AP2A 4CVZB 1MCPH 2YPLA 3FSZA 5KBLA 5DJXB 5D5MB 3BD3A 2ADJA 4Q4IA 2F1BA 3OBAA 5KVFL 2GTWB 3T08A 5DVKA 1EO8H 4B3VA 3RNQB 2C4FT 3LZPA 4RAVB 4XRCA 4YC2C 3WELA 4AE0A 5T3XE 4HUCA 5J6GB 2X6BA 4ENZA 4ZD3H 2JNZA 5HGDA 2L04A 4A63A 4E9VA 3BP5A 4PGEB 5FFOA 1MJ8L 3VCLA 1RY7B 2LHAA 4PRDB 5JIMA 5TF0A 4QRRB 2CRMA 4Y2NA 3NFPA 4PCKA 2R29A 4IRSD 1MHPH 5DZOA 2UWEE 5E2UH 2R0ZL 4L1LA 5DZLA 5AZ2L 2EYTA 2O5ZL 4AYSA 2HA1A 4EN3D 4IIQC 3GINA 2N1KA 4TSCL 4Z7UB 5MI0C 4KRPB 1NSNH 4U3SA 5KZCD 1G7IB 3V0WL 4KROB 1FG9C 2UYLA 3PWPE 3D4GA 1MLCA 5JO5A 3QFGA 1X6LA 1KCLA 4IHOA 3BISA 3VUAA 4NQCA 4TUKH 1RH8A 1OAXL 1X5FA 3HNVH 3QUXD 4UILH 5EU4A 5JMOC 4N86A 5KSBA 2CIIA 3MSPA 5D7JD 4PJ5B 2ICEA 3SGDI 3WNIA 2O5YL 3VFUA 1JYNA 1ZXQA 5GISL 3VFNB 3GBDA 6PCYA 5JXED 3EOTL 4RGOH 2N0KA 3FUMA 3QCTL 4YZFF 5IUCA 4B9PA 3FUEA 2ZKYA 3NAAL 1YYMH 4Z3IA 1LO2L 5FM5O 3OKMB 5G4MA 5FB8B 2V17H 4LVHC 4PU2A 5D7LB 3X1FA 4ANKA 5KYYA 2AEQL 3U2SB 3CLFH 4R2GD 1A14H 4XHJD 3VTMA 1GOFA 4YDIL 3KPQA 3L4TA 1CFNB 1XTLA 1RZJH 1ZVSA 3DX1A 4FZ8H 4LEBA 4OJYA 4XO4A 1T5XA 5DJYA 4HUMB 1MPAH 4AKPA 5AVYB 3MLSH 5I0WA 2H2SD 4KRPC 1FZJA 3SBWA 4QOKE 3S88H 2VL5B 1QFHA 1RULL 1MUJB 3VI3E 3ZL4H 4HUXB 3SDCC 3QFDA 4R7NB 1NOFA 1DBMH 4URTB 2XN9A 5IY5B 1KUMA 1F18A 1L7TL 1D5IL 2G4EA 3SPCA 3QYNA 4H1LB 3FTSA 2VWEC 3AVEA 3DECA 3EJZD 5CCJA 1GTNA 4KKNA 4HJJH 5I1LB 4OCSL 3IAPA 3U0WH 2R0WH 2I7OA 2H0EA 2IOIA 3FAXA 3U0TB 3PQYA 1IBGH 4P46D 2E7HA 3T1WA 2ID5A 1AZZC 5FXCH 1CFVL 1CUOA 3OD3A 3A3YB 3KJ6L 4IBTA 2MCPL 3OQRA 3KZ8A 15C8L 3D87B 2I07B 2O30A 2Z92B 4N5EC 1WEJH 3QB7C 4JY6B 1CYXA 1QUPA 1AKJB 3RBGA 5F3BA 2DYPB 4L23A 2R69H 4PB9L 1Q9WB 5ESQB 3LZOA 4AT6B 4NS0A 4X6CB 4EI5A 2OMNA 4GO8A 4HCRH 3GJFH 1R3IL 1S9YA 2JCCA 3MRKA 2IADA 1KGXA 1ZMYA 3D39E 5E2JA 2MOGA 5T33H 4YDJA 1BMGA 4ZO8A 5G5DA 5D6CB 5C08A 2JI3A 3QNFA 4JPWL 1URLA 2Y36L 2ZCHL 3GUTA 4WW2C 5TPWH 2IGLA 4AJWA 3O6KL 4GXFA 4ZZKA 5CKAA 4EUPA 2W38A 3STBA 4YNYB 3MRDA 2XETA 3UTQB 4N6RA 2OMUA 4KC3B 3DX8A 1LD9A 2Y5EA 4KXZI 3MRGA 5EUKB 4AUJA 5D8JH 4KZCA 2XY1A 4NUQA 2E9JA 2RB8A 3S5LG 1ZHBA 3ULVE 3SKOA 1OP5K 4DK6A 2Z91B 3MKGA 1T80A 2ZE0A 1VADA 3UYPA 3CXFA 1RJYB 1JK9B 1GC1C 1QBAA 3BLPX 4I18C 5ESAB 3CFBA 3GF8A 1U3HA 2ZCLL 3GBEA 2JKSA 4X8XA 4YHKL 1AO7D 2GPZA 2XTJB 4Q89A 1NGYA 3DXAB 1ACZA 3IN2A 4TOYH 4OQTA 1EFXD 1UCBH 1MVUA 3HHMA 1T89C 3TEUA 3ULUC 3B2XA 1R34A 3L81A 2ICWA 4DGVH 3QQDB 2GABA 4N22A 2J4WH 4AC2A 2G2RA 2D7NA 3O4LE 3HI5L 3C9NB 4Y2LA 3P9MA 1AC0A 2QHRL 4J23A 1C9SA 4AIEA 3QH3B 4L1DA 4QRSA 3LTVA 1CU4L 4LCUA 2MQ0A 2VKXA 3CUPB 2HPTA 5HGBA 1ZHNB 2ENYA 1JPTH 1UZ8A 1BG9A 2WP3T 4Z0XB 1OB1A 1YMHA 4JG1L 2BNQE 1KTJA 2NNAB 4PTUB 1ES0B 3ROLA 4PBDA 4AGNA 2YXWA 4AQ1B 1JZHA 4IKNA 4YGAB 3RVXC 3X2QB 3ZYIA 4IYKA 5T3ZE 5I2IA 2GJ6B 3MNZB 5JMRA 3QG6A 3II1A 2OYPA 4R8WH 4ES8A 3D4CA 5KVFE 4XPBL 4ZFOL 1KN2L 4Y4KB 5HJBA 1OAJA 2EP6A 2AZAA 1JVKA 4I4WA 1GGCH 4OAWB 3I9IA 4N68A 5L0QB 1KV7A 4QXWA 1AIZA 3L3HB 3N0AA 2XYCA 4F2ME 1UM4L 3R0MA 4X8JA 3W5MA 1F4HA 3WJLC 2UY7B 4ONFL 3VGAB 4F33B 4HEME 3SPVA 4HKBB 2WNWA 3CQPA 1ASOA 4XP4H 4FCAA 1COBA 1KB5H 4XWOC 3FUIA 3WKMH 2B39A 2G5BA 1TJGL 3G08B 4MAUL 5JOPE 5F1IA 3ABGA 4PR5B 5FKPA 4KI1A 3ZR6A 1TFHA 1IGFH 1E5AA 1DJIA 4LFHG 1MCQA 4YSRA 2APTA 1WS8A 1MNNA 1ZIBA 1O6SB 4Q6IC 2VLRA 3KBEA 1WITA 1T5WA 3MUGB 3OPUA 4RMRA 2VDLB 4Y9FA 2WAHA 3BKJL 2XBZA 4P3CL 3FTXA 4GIPD 5I30H 3PABB 1WUZA 3KWWA 1OARH 1NWPA 1RZGB 2BS71 3MGTA 4NYLB 4AYEC 2P8LB 2GCYB 1QUNA 3KH3A 1D5MB 4JGUA 3RUGF 1QFOA 5L0QC 1K8DB 1QPXA 2QKIA 4XNXL 4EI6A 4B9CA 5E8NA 3EW3B 3LZNA 4DZ8A 5CGMA 1NCNA 1K3IA 4FG6D 4NZTL 4OFQA 4ZXBC 5C0BD 5C3IA 1BQLH 3VGAC 1TTCA 3FO0H 1VGEH 4AIXA 5JNYB 3SKJH 1LLAA 4PJDF 3KNBB 1MVYA 2R39A 2VNCA 4WI2A 1QMUA 1HINH 1N70A 2PMZA 2D7QA 1WSST 2E4FA 4YJZL 5BMFL 2EJ1A 1AH1A 4G8GE 1DVUA 1N2RB 3G5XA 4NLAA 4WDIB 4XPTH 3IDIB 1S7VA 5IQ9B 1BG1A 4KU1A 5E9DE 5I28A 5J56B 3N43B 2B2XL 2H1PH 2XTSA 3N50A 4B41A 1DO5A 1KPVA 1UFUA 4YE4L 4PRHB 32C2A 5EUOF 2YPKA 1SHXA 1MAKA 1Q0YH 2DQUL 4HS3B 1AXIB 5KVDH 1YY8B 1CFSB 4OLYH 3FRUA 4PRNA 4XP1H 4F7CA 1MFCH 4HSAC 4WSKA 3W3BA 3QEUA 5D2NE 1DBAH 3BVNB 1U8IB 1OTUD 4PS4L 5D71H 3D85B 1IEBA 3NJLA 3OB0K 1ET5A 3PCYA 2QVKA 2VDNB 1L6ZA 2Z31C 1MCOL 2VH5L 2COQA 3NJXA 1F5WA 4QEGA 5F1NA 1ZS8B 2CPUA 4KK9D 4N0CC 3MN8A 1HHJB 1ZAGA 3JWOL 3BEVB 4YXKH 5F7UA 3S35H 5CWSA 5D70H 1CD0A 4UT9H 3IDNB 1EZSA 3P4NA 3FT4B 1Y0LA 3NZHH 5D1QA 3GMMA 4YDKH 5FYKE 3RIAK 1S7QB 1A6PA 4KQ3L 4ZFFA 2AMGA 4X6FA 3NP3A 3G9VA 4JHVA 4LQFL 1N8ZA 4IOFD 4IRSB 5FUCE 1GHFL 2FATL 5TGBB 3TPKA 1G7LA 2MIZA 3FQUA 5DYOB 2OJZL 4LVOB 1G1YA 5EF2A 4MAYC 3QQ4B 3SJVE 4EN3B 1LK3H 4GQRA 5FGRA 5FOJA 3F12A 2X40A 2CGRL 1SN5A 3QT2A 2P47B 3C8KB 5CP7B 2HFTA 5JPNB 4OZHF 4Y16C 5KZCB 1NDGA 5CILL 3LS4H 4PTTB 2BOBB 2CXGA 1F11A 5K1VA 3QIWD 1M53A 3MLXL 2UZXB 5D7SH 3DPBB 4HF5L 4RFNC 2BFVL 3QUXB 4WFED 3BDYH 2VDPL 5D7JB 2C1PA 3AU1B 3OXRA 2HT2D 3UTPD 4XCYB 3RA7H 3VGEA 5F7EH 3CMGA 4ISVB 2ADYA 4KMTL 4MB1A 3PV6B 3TF4A 2V8MA 4F9LC 2JKXA 2Y23A 3SY6A 1GC1H 2BY0A 1FFTB 4F8LA 4IRSC 4JPIA 5DC9B 4R2GB 2C3VB 5TF1H 1FAIH 3HG3A 1WE5A 1EEZB 5E5LA 1KGCE 3QJFA 3VD2A 1HCVA 5E6IC 5JOFB 4QRUA 4DPAX 5JPNC 2Q8BL 4JB9L 2GUOA 1NA8A 3H9YA 5FECB 3FDWA 2FYVA 1JSYA 2CCWA 2XPGA 3SHSA 2IC2A 4KKCD 1FYHB 1KBGH 4MKMA 4UYQA 4ZOCA 3BSZA 1B6DA 2CJTA 2I5YH 4H26A 1JHKL 2RQ8A 5EU5B 5FPIA 3D0VB 3R8QA 5K9OA 4IRZH 1I8LC 4NQXA 3RWEA 3HRZA 5L2KE 5D7JC 2CZNA 2WK2A 1RIHL 2FWLB 3TA4D 3KDPB 5EBWA 1EHXA 1F1AA 2CDGB 2PXYD 1J1OH 1DLFL 3HPLA 1UURA 5JXEC 4U1JB 1U3NA 4P46B 1GGUA 4H0LC 1G1KA 5JIKA 3VXQA 4DPBX 3WTTA 5CCHE 4NQEA 3QEQA 3O3AA 5CZRA 5DC2A 1QATA 4XHJC 2PLTA 3UPCA 3WIIL 2XA8L 5F7MC 3OR7A 1IFHH 4GP8B 3CJJA 2DLGA 1FIGH 3MODH 5EU6A 1KOAA 1HKLH 2FSDA 2H2SC 4OJDH 2A74B 3WEAA 1CE6A 5CD3B 5JHMA 1WWAX 4B0MB 3HFFA 1ZD6A 4O51A 4F5CE 3BUPA 4E36A 1I1YA 3OKDA 1VF5C 4U6VL 4KZDH 4HWBA 1AS6A 2DLFL 4M8VA 4UQ3A 3D05A 1HEZB 4HHWA 5CCGE 2DQHH 4GQPH 3EJZC 3CVHB 3S34H 1QSVA 3VFMB 4WTZA 1C7TA 4FA8A 2HCZX 3FRPA 2NNFA 1QRKA 1HS6A 1WBYA 5T3XH 4ERSL 3E3QC 4GFXA 4NRZA 43CAB 3PXHA 4RISL 1NBZA 3TBSA 4LARL 3QISA 4XCCH 3L1EA 1S7SA 3GZOA 4QYOB 2H32H 2NY3C 1AO7B 1YG9A 1TCRB 1OT4A 1EFXB 2WXMA 2EH7H 3ROOA 4ZUWA 1VERA 3D3VA 4UDUB 5AVVB 2A74C 4KTYA 2J88L 4NM8H 4P2OD 1DBBH 1WZLA 1MJJB 5MEOB 3SO3B 2V7HB 4G71B 1D7BA 3A24A 1NC2A 3HZYB 4H0GA 2MTPA 3FCSB 4RQQB 2M8XA 4K5NA 1G6RA 5HI5D 1AD0A 2VR8A 4ZMVA 2NT0A 3OKNA 2DIBA 2PYEA 3FN9A 1XH2A 3X13B 5HYSA 4LSUL 5BZWB 5AYUH 5B39B 1D6VL 3KM1A 4LEXH 3TBTB 1MFDH 3D09A 4JN2A 2OTWB 3FZUD 3GNML 4OLVL 3M6DA 3QJSB 4AW4A 5HVHB 3PAVA 4D7PA 1QSFE 2F18A 3EOAA 1U8CA 2EAEA 3MRPA 4JKWA 5ECGA 2EIEA 5MEND 4N90E 1IEHA 1D7CA 1XL4A 3QS2A 3F6JA 2WMPB 4NBZB 4E9WA 4XXWC 3RX7A 3NCMA 2X0WA 2V2XA 5DZVA 3V8OA 3P9WB 4LPWA 2JWYA 3CLEH 4PJBF 1CO1A 3DOHA 1CIDA 3MLYL 2J8UE 4WU7B 3VFOB 1F02I 4L9LB 4UV4L 4YDLB 3I6KB 2FE0A 1ZSDA 3NRFA 3T4AA 5F3HB 3VXOB 4N0YL 3AZUA 4QPEA 4CW1B 4XPFL 1SRDA 2FEDD 3IXTA 5B1BB 2F74A 2ZTBA 4V1DD 3HC2A 1G9MC 5LWYL 1I7UB 4AENB 1DE4B 1JV5B 4JM0A 3JWNE 3PNWB 2NDFA 4F37F 1L9OA 3NIFF 3H9SE 4F7PB 4NNXB 2VXTL 3HJ0A 3MXWH 2JF1A 1KWKA 2ZJSL 5FFGA 4WW2F 2AV1B 4N20A 5IVXF 5HVHC 2JK5A 4MMYA 4U0RC 4KUZH 1B2WH 4W9JC 3VDCA 3LVTA 1S78C 3PGFL 3M8OH 3WLBA 4Z9KB 3QDJA 4A7SA 4P9HL 1X9RA 3FF7A 1M6OB 1KIUA 1XGPB 4LSVH 4Z7OE 3GS0A 5MP6L 2QSVA 4M03A 1YO4A 2FHFA 2YJLA 3MRIB 4KX7A 1RK1A 2HG0A 3RVTD 4E0RA 3IDJA 3I3EA 2XOTA 2OZ4L 5C0BB 2D4DA 1ZLDA 2Z7ZA 2GJRA 3QK0A 2O5XH 3U30B 2BNUA 2C9UA 1FNSL 2J6WA 3LY6A 1QRND 3OC5A 2DS4A 4UTBA 1OAKL 3ECBB 4MHHG 4Q2ZA 4XODA 3SPIA 3UMNA 3VXRE 2VDKB 1NFIB 3GHBH 4LDLB 5ETUB 3EKCA 4F9PA 2L7JA 1E9PA 1JK8B 2A6IA 1EAPB 1RU9L 3E80A 1UJ3C 4L48A 5CUSL 5DHXB 3VFPB 5IWLA 5JPMB 3H85A 2EIZB 1OCOB 4JFYA 4K23L 2Q0ZX 4HIPA 4ENED 2WIMA 2ALAA 2NTFB 1XR8B 1I1AD 3QIBA 5DJ8A 5DRNA 3ULVH 2YKLL 2NY5C 2ICES 2ZUWA 2Q76B 4Z7IA 2Y24A 4MD0A 2JKIS 3U36B 1QR1B 1LO0H 3S4SA 5LCVA 2OMTA 2WZ5A 1ZGLA 3V4VB 1ECYA 4N4YB 4OZFB 5HYEA 3OMZA 4WFFE 1X7TA 1JGDA 1T1XA 3GFUA 1T1ZA 2ZSWA 5FHBH 4HJEA 5I16A 3Q5YA 2QR0A 4U7MA 4FA6A 1BOGA 3U30C 2QQLH 3TJHD 1MW1A 5FWQA 2LLLA 1Q1PA 5F88A 4G6MH 5DVOA 4E5XG 3QIUC 3KHQA 4ACPA 1QFWI 4F2FA 4PJAE 4HWNA 3K4AA 3NCFB 3GZQA 4ODXB 2L4OA 4YPGA 5I76B 1UZ6F 4PJ7B 5HI3D 5JPMC 2E9GA 1FE8L 2RA1A 3WSQL 3TESA 3ZO9A 1L4IA 1TPXC 3D34A 4E2OA 3MZTA 2JB6A 1XB3A 1CF8H 3LH2H 4OB5H 4XE0A 2HLAB 5DVLA 4P2RE 1BPVA 1JD9A 4Z7QB 3JTSB 4XH2B 2FHCA 2IQAA 3NGBC 1IGML 1A4JA 1FNLA 3H42H 3GI8H 5T1KA 3OJDA 5T3ZH 2HB0A 1KJVA 2Q3ZA 2K7PA 3T3PF 3N2JA 1CXLA 2AXGA 1V10A 2Z1PA 1KC5H 3MYJB 5KVFH 2CUHA 2LTQC 2YKKA 1N6UA 5IB5B 3TPUA 1WC7B 1G0XA 5E5RB 3Q3GA 4QY8B 1PZSA 4K8RD 4QHMA 3CVIL 1MI5E 3AG1B 2IDTA 2UWEF 4R4ND 1TTRA 3CZLA 4H25A 3WD5L 1U95B 3QIWB 4UIKL 1HXYB 4MMZB 2VXVL 2WY3B 4A37A 4MNQD 2A6DB 2F19L 3SZKC 4OV6F 5AAWC 4ZZFA 4WHDA 2VMDA 1SXCA 1CN4A 2O5ZH 3SDAD 3FQ1A 3MLZL 4KHTL 1S2EA 1G7PB 4PRBA 4OSUL 4OI7A 3ZHNA 4L29B 2FLMA 5CEZD 4LHUB 4A04A 3W56A 4PV9A 4OU3A 3B3BA 2VR5A 3DTUB 4FFVD 1R9FA 4A7TA 2YZ8A 5EWIL 1P4IL 2ADIB 3BGAA 5ABDE 4HOXA 3FO2A 2X4QB 2YPLE 2QGBA 3EUDA 3Q6GH 2VAAB 1GYVA 2ARJQ 5DHYA 2BFGA 2I9LA 4OBRA 3U82B 1OAXH 4E41A 5D9SA 2AJZA 1NINA 1NCAL 1TMCB 5JIDA 3BAKA 3N1QC 1B3JA 4DN4L 5GS1C 1FGNL 2XWTA 1ZEAH 2YD0A 3WO4B 3VDBA 5K9QG 1JMZA 5E4EB 1MAMH 2QPSA 2DI8A 3QRBA 2JJTA 4OFKA 2OCFD 2KPWA 2E6PA 35C8L 4V2BA 1PZ5A 4KNSA 4A39A 1DJGA 1WAAA 5JW4N 5CBEB 4POYA 3ARDC 1GA2A 3QNYB 2B4CC 3VI3F 4K7FA 2H2PD 3QUYC 3C6LC 5FA4B 4KJWD 2PXYB 1DFBH 4ALAC 1D6EB 2APWA 4PREB 1PNCA 5CBAB 4CBPA 5AOJA 1J0ZA 2WIIB 4P23A 4I1RA 4Y89A 2V0AA 2GTZB 4LBEB 5DD1L 3BH9A 5CJBA 5CGYD 3BAJA 4PIBA 1IILE 5F8QC 5C0DA 2A4EA 3CDZB 1MCKA 1CF1A 3O9WD 1RVFL 3RPIA 3STLB 4FAAB 4NQCE 3IDGA 5HPMA 1RZ7L 2YA0A 5KSBE 1EHLL 1X7SA 1OO2A 1QLRB 5FKAB 3I6GA 1MW0A 4ODHH 1KTKE 2ZXCA 3UTOA 2X2HA 2ADFH 1ASPA 1IAKA 4KKCC 1GTFA 3RGBA 3V9FA 3WN5B 5IB2B 4NCDA 1SLXA 3UCRA 4R3SA 4KKLD 1NDMA 4W68A 3EXLA 4PG9B 1QBMH 2F8IA 3MQIA 1RLBA 1G9MH 3KJ6H 3TBWA 4PI0A 5JQHC 3H55A 2WBJD 1HSBA 3I74A 3MI6A 1KXVA 5L7XH 1NM9A 2DI7A 4DH2A 4YHOH 2OSXA 5I0XA 3CHQA 4HUKB 1TOXA 2PXYC 4MNGB 1ZOXA 2YD8A 4Y1AD 2DD8H 2ODIA 4FTVD 4RESB 5HHOD 3FBQA 4N8VB 1G7HA 5CFAA 3T1FB 4MJ5A 4L2LA 2RFXB 2R0LL 1CG9A 2M2DA 3F84A 3JWNG 4W4OC 5FYKH 1VFAB 1NH6A 5JDSA 5BNXD 1SXAA 4KH2A 3ULVF 3EHBD 4RGMC 3RIKA 4B5EA 3CH1A 4I1NB 1GJUA 1P2CB 1Z0NA 1N7MH 5C2BH 3CXHK 2EE6A 4GH7B 2ESVA 4P2OB 2H6UA 1URZA 1I8KA 2JJUA 5C9JA 4MSWA 3WN5C 1DJWA 1W6WA 2EYRB 3PQYE 4WFGD 4YSAA 5DK0A 3RE0A 3SOBL 3NCYS 4HMCA 4H8VA 4QO1B 1KLUB 4HJSA 2DRUA 4PWKA 2EVIA 2NZ1A 1WZ1L 4G7VH 1BJ8A 2F53D 3JXAA 1KSRA 1SMDA 4IRJD 3INOA 3CFMA 4GW5B 1FNEB 2DM3A 2XXFA 5DCCA 5DLLA 5AYQA 2NUPA 3IJHA 1AQMA 5ICYB 1KXQA 1IGTB 2JCCE 4OT1H 3G5WA 4PJ8C 5MENB 3FXIC 3UPAA 1UYWL 3CZFA 1JGEA 1IAOA 2JSFA 2AJVH 1IQWL 2QHRH 3D4ZA 3V5KA 1J5CA 3DKHA 3FFCA 3GXTA 4H8HA 2QPFA 1TDQA 4F57H 1S3RA 4G9FA 4M62L 2V37A 3EXJA 4JG1H 4P2OC 3WY2A 3BP6B 1CXIA 2CLZA 2XXCB 3WFHB 5BCAA 2G3MA 2DH3A 4X9FA 5DYFA 5HVFB 1LGVA 1ZLEA 2NXZD 3WHXA 4F3FA 3EJPA 1HHGB 4X0KA 1TJXA 4V1DB 4MJ2A 2FQGA 4JO8A 4S2SB 3J27A 5E4AA 5CF3A 4OVVA 4X6BB 2XYBA 1N5YH 4JCWA 4XVJL 3FZUC 2HWZL 1AGCA 4YHZH 5GS0C 1HOEA 2HJKA 1FC1A 1IQDA 1MF2H 5D96B 3B9KA 3MRRA 3Q2LA 3KLKA 2XV6B 1UM4H 3BPOC 4PJ6A 3C09C 2AAAA 2PPFA 4NDMB 1J12A 3L9RA 4B50A 3FTUA 4LLMB 1GYCA 4XMPH 1FG2A 1WS7A 4YWGL 4P4KD 3CH8A 3OVUB 2I27N 4HVBA 3KVPA 1KNOA 1L5GA 2HZHA 5ESVA 1DLHA 2CJ3A 2EXTA 4P2CG 3NFSH 1H5BA 3CFQA 3UBGA 3IKKA 3NSDA 1LMKA 4FNLL 3MRNB 4I3SL 1QRNB 1HL4A 4JKNA 1RURL 5F97E 5LNEA 3GJFK 4O2CA 3SCMD 4JFVA 4EDWH 1P4BL 2F8VA 5AVZB 3K6SA 4FRWA 2KS0A 3MRCA 3QDMD 4FNUA 1SBSH 4NFDA 4WIQA 3TT1L 4N0RA 1W80A 2EEFA 1NAML 4HIJA 4G1MB 2IAMD 3FQ2A 4X5PA 3SN6N 4JE0A 1I1AB 4A2HA 3W2DL 2YGQA 3UEZA 3W1ZA 1U4EA 4MXWH 1UH4A 3BI9X 3IAQA 5DJCA 3BQUD 3L5HA 3VGBA 4ABQA 4YHLH 1MELA 2JELH 2R2EA 5DRZA 1AZRA 1N0XH 5C3TA 3VI4B 2V5SA 3D50A 4TVPD 3E6FA 5I73C 3V79C 2YUVA 3PDOA 3Q8CA 3UTSD 4NQDA 3P54A 3A67L 1NUNB 3RVTC 1F56A 3RZWA 1QHOA 1OE1A 4DGIL 4H8WC 1SDYA 2Z0UA 1ILUA 4NNYB 1IEAA 5HYJD 4IU2B 2VLRE 3BFWA 4WVRA 4TULL 1WJ3A 4LCYB 3G6DL 4JVUA 4JM2A 2A0LC 2DQUH 5DQDL 5I1HH 4EMZA 3OX8B 4DKFL 1QASA 4GBXA 2WSKA 2WYZA 1VENA 5KVGE 2B4CH 1RZFL 4YHIB 4PYGA 1E28B 3V6ZA 3UC0H 5KBPA 5H94A 4ENEC 4FQXA 2YAQA 1KZYA 1FC2D 5D7EA 4IEFB 1E4KA 2NXYD 3G5YB 2X4TB 1PLGH 1MAJA 5EO9B 3JV0A 5BXFB 4MYPA 3BWAB 3UAAA 3UTTA 3KYNA 4KY1H 1TNMA 1XR9B 4K9EH 5ALCL 2X87A 2YBGA 3FUKA 3MLTA 4HUWA 4L8BB 3MA7B 5D4JA 5EA0L 3E9TA 2WO4A 1FLRL 1NFDF 3B6SB 3B7UX 1AQ8A 2XY2A 5E70A 4N5UA 4JFDA 1KXHA 2C7UA 4YHPB 1YEWA 1UD4A 2AEPL 1XF5B 4N1HB 4OIAA 1KJ2L 4HFWB 5F70A 3BWUC 2ICEC 4I0PC 3T0XA 2R9HC 3QO1B 2YO3A 4IBYA 4YO0A 5EORL 3TJHC 4HUVB 2PN5A 3WGUB 4KQ3H 4YHYB 2R2HA 5D1ZA 1G6RL 1J18A 2WNXA 4JPQA 1BM3L 4LQFH 4MNQB 5I6OA 1S7UB 5EIIB 5HI3C 1PIGA 3JWNH 3SDAB 3BE1H 1MRFL 4HX1B 3WNKA 4TPRL 3TZVD 4RIRA 5AVSB 1A7OL 4JZOA 2DQTL 4D2NA 4FQ2H 4ELKB 1FLTX 4NGHH 1KFAL 1Z3GL 5LDUA 3ILPA 3SBWC 4TLKA 3VRIB 1SGKA 3BKML 5TK4A 5IB3A 4HF5H 1WLHA 2WVTA 3KPOB 5IBUG 4BDVB 4Q6YA 4JNXA 2HFEB 3BUIA 2Q9OA 5IOPA 1UXMA 2VYRE 1EJOL 2J5LB 3FB7B 3OGOE 4ODVH 4GSQA 4K8RC 4E9RA 1HKFA 1OF0A 4WHTB 1UWXH 4TQ8A 5D1QE 1DUYA 3BAYA 4H20L 1UXLA 1RD6A 4XMTA 5IHUH 4QRAA 1KIPB 5C71A 1JUFB 3GPEA 5KJ7E 5E8DH 1MIEL 4LFHD 3H2PA 3SPHA 3FN0L 3TBCA 3UYOD 2EDNA 4X5XB 4LLDA 2ZIDA 3SDAC 1MWAL 4TRPL 5D4HA 2R2CA 5F0PB 2Z0BA 3LH8A 5A2CA 3WTYA 1BAFL 3MJ9A 2CDEB 1BQHB 1AGEA 2Q8BH 3G5VA 1H3VA 1N10A 1FH5H 2ENQA 5TE6L 4EI5C 4B9FA 3CBJB 3L3JB 1ADQA 1B90A 5ITFB 4RAUB 2YA1A 5T3XD 1XH1A 2AQNA 3KGRA 1KLGB 4FLRA 5DEFB 3S35X 2G3XA 1FNGB 1I9IL 2QSQA 3O8XC 5IM7B 4ZPVA 2I32A 2YR3A 2CH8A 3O9WB 2VDOH 2AK4A 3AS1A 3NSYA 3K2UL 1IL1B 1NIBA 3BAEH 4LSRL 3CIQA 2XPYA 1SJHB 2NTSP 5E08L 1I7TA 4J3SA 2ZWZA 3W9EA 3FS9A 4NKQB 2AQ2A 4L8DA 5CJOH 3TO4A 2W0FB 4CMMB 1CTNA 3BN9C 2O61B 1F90H 2GK0A 1C5CL 2FO1A 1NCOA 2WBJB 4EUPG 2DKMA 1DL7L 2VSMB 4IJ3C 2EE9A 3PWPD 4W6YB 2C34A 2GSGB 2H2PC 2XZAH 5EZJA 5C0RH 1JPFB 3K5RA 4KJWC 5GS0H 5DUBA 1JNNH 4Y4HA 4Y4FD 4JDTH 3MRJB 4MZRA 4Y1AB 2FBJL 4FTVB 5HHOB 1G5GA 1ETZB 3KYKH 1H15A 5K39A 2P44B 4U6VH 3NSFA 2H9GB 2H0PA 3UAEA 4D8PA 2Q10A 3SE4A 3O9WC 4QRQB 2JVUA 4JHUA 1E9QB 3L17A 1AXTL 3OHXB 3QEHA 1YSOA 1GZPA 3EHBB 5LUMA 4NFCA 3WFBH 2MKWA 4IGBA 1V3JA 3NVQA 4G6KL 5JXAL 1R5WB 1P0SE 2GKIA 4POZD 4QXGH 2PTTA 1QFWM 5JIPA 3S8WA 5FO7B 1CK0L 2DQCH 1E6OL 3UBXG 2AANA 2V2TA 1EQWA 4MJID 5TFSL 1MVFA 4KKLC 5DK2B 5D2LA 4JFZL 3WNJA 4P4RB 2BOLA 5CN1A 1WWCA 2BNRD 2O6FA 4UCFA 5DEJA 3CSYA 3BUYA 4HC1L 3PPEA 2BRRH 2F53B 2N3JA 2NMSA 4NSKA 1MKFA 2QVMA 4L1SA 1U8HB 1ZHLA 3GTTA 3OHMB 4IRJB 4RMUA 3ZE2B 2V6HA 5EU6E 3MFFB 5DQ9A 4KO9A 1R3KA 4PLKC 4UAOB 2EEDA 3IMTA 3DGGA 4AQEA 1FVDB 5F9OL 5GGVH 3DHUA 1XF4B 1DQQB 1EBPA 3GO1H 5E1GA 4P8QA 5FO8A 4G6AC 2BHYA 5K9KB 4OJFH 2H0JA 3EHBC 1D6VH 4FLSA 4LHQB 4ZDHA 3IETA 3MRQA 2DQDL 1HH6B 4G1EB 2EE2A 4LOUD 1U8QB 3Q8FA 4P3WA 4ABUA 3DVGA 1BWWA 3GYRA 5I5JA 3VGDA 2KZKA 3BPNC 2V2WA 4QYAA 2NXZB 3CZJA 1GVIA 2CIKB 3T0EA 3ZRFC 3A0OA 4WQOA 2J8UF 4LGSB 5G4NA 5ECJE 2AV7B 4JFFE 2R29H 25C8L 3AM8C 1U2HA 4HSCX 4NCC1 2OTUB 3D3VE 4LVNC 2P24B 4MS8C 2R7EA 3SODB 4UAOC 1CDBA 2BCMA 1JPGB 2XBDA 1JDCA 4UV4H 2EIBA 4UT6L 1GAFH 1OL0A 1NC4D 2DMBA 2GITA 3FT2B 4N0YH 4RMTA 2QKIC 1YEHL 4L8CA 3THML 4HV8A 4BH8A 3FQXB 2CLVA 1KXTA 4HLZG 3BP4B 1XF2B 3LXCA 4QRPD 5DDHA 4JFUA 5J1AA 2PYEE 1MH5B 2X4OA 4MQXD 4RWYH 2RD0A 2ZX5A 3KS0H 4GXVL 2K0RA 4P4KB 3BKCH 3DV4B 3C87A 3V0AC 1JWUA 2R51A 1PGRB 2X6VA 2P28B 2ZXEB 3AQZA 3DBXB 3LKRB 4JRLA 4GW1B 2C7FA 2DYSB 3AADB 3DRQB 3QG7H 5IW1B 2FL5A 3QVAA 2NXZC 2OFQA 3IU4H 2C1OA 3CWGA 1W8EA 4WI4A 1AOZA 3U4BL 2KI6A 3NIDB 3MLPA 3KLHD 3FT0A 1TJHH 4P9HH 2IQ9H 3TYFB 4OZGF 3TH2T 3SCMB 1FVCA 2EXSA 2D7TH 3ZDYB 4M61B 4Z0BH 3QDMB 3ISYA 5I15L 1B2YA 4PG2A 1BYPA 5E00A 4WKZA 5IQLA 1BBJA 4MAZA 4B3EA 2IAMB 1A3LH 3RB5A 3GSNB 2CLRB 4BK8A 2F9BT 5AQ0A 5E99L 1ZVYA 3UZQA 4Z95L 1IC1A 2DWYA 4X9IA 2DQGL 2X4SA 2Z8SA 5EOTA 3BQUB 2XZQL 3MGOA 4OCWL 4BFOA 4DN3H 4H0HB 4X5WB 1A6UL 3TVMD 4CUCA 7CGTA 3UTSB 2ZOLB 4FI8A 5HSFA 4BWUA 5KAQG 4BBWA 4PSPA 3RWDA 5L4JA 5I5IA 4J5VA 3MJ7A 3WG7B 2NSXA 4K3EL 4HP5A 1KV3A 5IV2A 4P07A 5HYJB 1CGSL 1MFAH 2J8OA 43C9B 4W9HC 4CN6A 5I1AB 5D1QC 4TTDD 1I75A 4N2MA 3P77A 1UJTA 1XGUA 1GOHA 3QDJE 1KLFB 1UB5B 4G8FB 4YDVA 4YL9A 4Z3HA 5KS9B 3OC8A 2VSDA 2BIQA 1UCTA 3JT2A 3DC0A 3SPJA 2E4TA 5K1JA 1YLBB 4FULA 4C59B 1R24B 3GSVB 2ZSVA 2NXYB 1RUMH 1O0VA 3QUMA 4PJAF 3TS8A 1U30A 4TVSa 5MERA 2IPKB 1AFVH 3FCBA 3I75B 1DSYA 1OAZL 2QZQA 3WIHA 3DURA 1WFNA 5GRUH 4PW4A 4AEHL 1R3HB 1EGJA 4I3RL 5IBTL 3HR5B 1KGUA 4KKAC 1O5DT 5IR1A 4NPJA 3FHAA 3ZDZE 4U1SA 2DWTA 1FE8H 2EZ0D 3N44B 4EUPH 3K4ZA 1EXUA 3H54A 4FQQB 3RDTA 1EXHA 4BQ9A 1NBYB 2OS7A 4DF9A 1ROCA 3MCLL 2BRQA 2VLMD 3D25A 3LD8C 1YEGL 2BP5M 4WO0A 1BQKA 4RNRA 4V2CB 3C8HA 4NO3A 4WGKA 3S48A 2A9NH 5FGCB 5JR1L 5AD0B 1JHTB 2X3BA 3B2DC 3ML8A 4P5KA 1G9NC 1VZGA 4LCCB 3RVUC 1ZANL 5DMIL 2EDMA 2FIRT 5CSZA 1UWGH 4PJIF 1GY2A 3IJ9A 3CC5B 2P5EA 3TZVB 5DVMA 2MHAA 4OQTH 2O5NA 1OW0A 5KWYC 3LN4A 2WTRB 4G8GD 4EI0A 2NXYC 1XGTB 3HI1A 5JW4Q 1BAWA 1DBJL 2G5RA 3AT8A 3IFLH 4HDIA 3F2LA 5DJ2B 3T5WA 4PH8A 3UXFA 1N67A 3HPJB 1IZKA 2MQ3A 3VYPA 1U8OA 2HX9A 4KVCL 1INEH 1OWWA 2VDMH 4KRMB 4XI5C 4Y19A 2NW3A 5B3SB 3K74B 4OF0A 3T2OA 2YEVB 3C5ZD 3WNNA 4FN0A 3TX4A 1HDMA 1PZBA 1UWEL 3EH5B 3GRBA 2WLNA 2E47A 4L3ED 2PPDA 4N8CL 3HRZC 3DYMA 2VXQL 2HTLC 4G3YL 1BZOA 3N04A 1CQKA 5CN3A 2I85A 3N5AA 4KHXH 4ONHB 1TZIA 3MBWA 4XVUC 2JH2A 3CSGA 3LEVH 3NZ8B 8PAZA 4XTRD 2WLIB 3RTQA 5JQIB 3QQ9C 5DSCA 3TASA 5I9QC 3UJTL 5ACZA 1EEUA 2NY4D 4GFTB 3S36H 3VXUA 1FYTA 5IJVB 2VDRH 4R84A 1PSKL 2QFPA 4ANVA 3TZVC 1YPZE 3X11B 2AJ3A 2DQJH 2F7QA 2YGNA 4R26H 4DN4H 1MRDL 4DP9X 3HE7A 5D7KD 5B3NA 2WKLA 2HYMA 1A4KB 4N2CA 3HUJB 3VXSD 3CDYA 1AGDA 3KYOB 3EH2A 2ITCA 2DMKA 4KK6C 2MPAH 4B60A 3LS5H 2VN3A 4JL2A 1AXSA 1H3UA 5K9JH 2H32B 3RZCA 2ZOWA 2XC8A 3KW7A 3RBSA 2K6YA 2F68X 3AUVA 4BSWA 1PLBA 3MV7A 3EOBA 2R15A 3K0WA 3T09A 4Y5XB 1NCBH 3OAUH 4XMLH 3P40A 3H6AA 3I84A 1UKTA 4G80B 5KSBF 2LU3A 1RZKL 1OSPL 5HDQH 4DUVA 1EMTH 1TTBA 3BWUF 4G8EB 4ZS7L 3CSFA 3ZQXA 3PWPB 3Q43A 3HMXL 4WTZG 1B0GB 1H6EA 3FRPG 1OB0A 1A8ZA 5F7YC 3B2VL 4HLZH 1K8IA 4QIRA 5JHLA 3KPNB 4KOCA 5KVGH 1BZQK 4Y4FB 5AVUB 3VFGH 4JDZB 1JGUL 3HE6A 2R1YB 4LKXB 4P59L 4PAZA 2R1XA 3NCJH 3WTSA 1HJCA 4HKJA 3N42F 3Q2CA 1L7IL 4HUUB 2IDSA 2E59A 2UY6A 3KLAB 4O02A 3ZKXB 8FABA 1WAAE 3I6SA 1RSYA 2F08A 1WFMA 3BUTA 3LHPL 4GRLA 4K4KA 3IGUA 1WK0A 2BSSB 2RGSA 2B77A 4H40A 3VJ6A 2R23A 4Y5XC 4I1PA 3BXNB 1ZLSH 1EVUA 4MJIB 4B9IA 4K94L 2DLEA 4IKIA 3ZE0E 5HYSG 2R0LH 2DQFA 2J2ZA 1IM9A 2IFFH 1QYGH 1S9VA 2BNRB 3D2TA 2Z35A 3QNXB 3QNZA 3QULA 4LPCA 3QWQB 4KMQA 4YOKA 2F7RA 1N3NA 3FT3B 1AZCA 4OQ1A 4XCNB 1DQVA 4UQDA 5FW8A 4J8QA 4MHHI 4ABWA 4Y4FC 4JM4H 3LQAL 1TLMA 4BFFA 2E75C 4HAGA 4A6YB 5DD6A 1SXNA 1G9HA 4ZO6A 1BOYA 4O5LL 1HWHB 3NESA 5DZNA 1JRHH 5M94B 4WO4D 2H26B 3SOBH 3KR3H 5B1KA 4GEJA 2R27A 3PHAA 5F8RC 2YK1H 3ZKXC 1DZBA 1Z3RA 3UTZA 5BS0A 1QI5A 2WXLA 4I8DA 4X7EC 4KBPA 2GFBB 1UASA 3M07A 2XV3A 1U8KA 2JCCF 5DRWB 2JV6A 4POZC 3RL1B 4P57B 5C8JB 3KPMB 2Z7UA 4YDMA 3TC9A 1BYOA 4L4JA 1CL7H 2RIKA 3MLWL 4WJ5B 1Q72L 3Q13A 4LO9A 1QLEH 1CFBA 4JG0L 4M7JL 3QPQD 4XCFH 3BUBA 3WL9A 4AYDC 5DHVB 4UQ2B 2H6PB 1MHEA 2FT8A 3QQXA 3MRFB 4I89A 1OQXA 1W0WA 1YY9C 3W37A 1ZTMA 3CVBA 5IVNA 1M56B 2EEXA 5C09D 3WE6B 3P02A 1CTOA 4ZSOB 4NKOB 1WZAA 2ESVE 2GHWB 2VXUL 4YH6A 4BKLA 1NC4B 2XJKA 4OF3A 4Y2OA 1I3RA 4M8RA 2OPCA 4JMNA 3F85A 3V10A 2XA3A 3IJYA 1L9NA 4O2EA 3EYQD 1GCFA 3BGMA 4A2MA 2A9DA 5T5FA 4QRPB 5I71B 2F8XC 3TF7C 1FVEB 3HG4A 1B0RB 2Q6WA 1IAIM 1QNZH 2EH8L 2Y5TA 1JGLL 4NX0A 4DGYL 4DP8X 1E50A 2QSTA 3GSRB 2W65B 4LCVA 4F9PC 3AFLA 5IFHH 3EJTA 3L7FA 1J9SA 3BVWA 2W0LA 1KXQE 5DJDB 5DC4B 4XN8A 1NPNA 3DYOA 4X6EA 2JCWA 3PHOB 2WSPA 4FQHB 5JW3L 5CZXD 3X3FH 3ULAB 1OTTD 4QF1B 4LLUB 4E9YA 1OGAA 4OCNC 3TNMB 2Z1KA 5CZVH 5AFAA 4W6XB 4XBPB 5F89A 1A6VL 3PV7A 4G9FE 3REWB 3HAEA 1TCMA 3VRJB 3MNVB 3BSGA 5HHPA 5E1HB 4X42A 3WY1A 4PLNC 2XJLA 1LEIB 1TVDA 2GSIB 4WI0B 3Q2NA 1DUZB 1R46A 3JV4B 3MV8A 1QI4A 1KB3A 1RURH 3VWKA 5E8OB 1CLZL 4HGKC 3TBVB 4MQXC 4AGQA 3BSZH 4N90D 2G9KA 3S4SG 3I02B 5E6YA 3O4OC 5EBLB 2JI1A 3TVMB 1BQSA 2NY7L 3GBNL 2BVPB 3D08A 4I2XA 5D7IA 3GBML 5I1DB 1D5RA 1UOVA 1JWMA 4KOBA 2YXFA 3GTNA 3MMEA 3EBHA 1U8NB 3II2A 3MUHL 5KSUB 4I87A 3W2DH 3FN3A 4UUJA 4P99A 3DO4A 3PJSB 1ETA1 3KLHC 1KTDA 1J1XL 4FNSA 4F2MB 2ZCZA 4PB0H 2X4PA 1TQTA 5EBMB 1UOWA 1EHNA 1NIFA 5J11C 4PJCF 3WXVH 2VTFA 1G7MB 1IZJA 1LK2A 1NEZG 5HDBF 1T20B 2X0VA 4OCYL 2C5DC 4YLBA 1NGWA 2RBLA 4NM4L 4BRVA 1F58L 2YQGA 4GJTB 2VLJA 5DQJB 2ZKXA 4PBXA 4KRLB 1I7RB 5FLUA 2FO8A 3E1ZA 2N7BA 2Y1VA 4DZBA 4Z76B 3H53A 2DWDB 3EYOA 3IMWA 2X4RA 3TVMC 4DKFH 3L6FA 4AZ8B 3MRHA 3ISRA 3S37L 3SDXA 4F58H 2ZUQB 3W38A 4XPGH 4WF7A 3UPRA 4PS3A 3BJ91 1Z5YD 2FR4A 1IB5A 4OCXL 1TU2A 1X44A 2BP3A 2FVNA 3HVNA 1EUUA 3DSFL 5GIRA 2WO2B 4CAGA 4F8OA 2WXGA 1OCWL 1IKFL 4H2CA 2XFGB 2ZWYA 4JRXD 4CVXA 4RRPA 2MNJB 1MNUL 1I8IB 3V5DA 3UJIL 1IGCL 4IBWA 1NCUA 3IU3A 1MLBA 2ZOKB 3SY0B 1FLRH 3EO0A 3SZ6A 4W9CC 3ABLB 3ZE1F 2OMBA 5TE7H 4NQDE 4OGYH 3O0RL 4G8GB 2HH0L 5CZKA 5IQ7H 2XWDA 4QAWA 2YSSB 5HYQA 2GJZA 4I48A 3CX5K 4AYFA 3MRMA 4W81A 4PJFA 4WWKD 1G6RH 2RH0A 4AX3A 3L16A 3C5ZB 2XKNB 5GRZA 1KCBA 5KAQF 1AGFB 2ZUQC 4X7TB 5F7DB 4EXKA 4L3EB 1WVZA 3Q5OA 2DKSA 2B1AL 2WHVA 2PCFB 1Z2KA 2VR6A 4X4XB 1V7NH 5GGTL 5D2NB 1Z3GH 2D73A 3CN1A 5DU7A 3UTTE 1O75A 2DEYX 1OXYA 2W9LA 1XTMA 5AEAA 5DWPA 3VX1A 4B9ZA 2NY4B 5KBDA 2K8QA 5DHEA 1KCSL 1R5VB 3DDGA 3UAJA 4FFWD 4JFDE 1NFKA 4JZJB 5E8PB 2CKBA 4IMLB 5LG6A 3ILQD 2AEWA 3ZTEA 4U1GB 4CRPA 4OUUA 2WXIA 1TG8A 2NNRA 1YEJH 3HHSA 3PGDB 3VXSB 4CVWA 4H20H 4IOIA 4XNUH 8CGTA 5KYXB 3CZGA 4UMGA 1R5IB 1MIEH 3CFCL 4CSPA 3FN0H 3H4HA 3TWCL 3KXFA 4ZUTB 2GUYA 1OAQL 4RCAA 5GRYA 4TSAL 1KXVC 3BLKA 5H4YA 4XO9A 4TF4A 2ITDB 4NZFA 2XZCL 5KW9H 1W72L 3R1GL 5SWZA 5DFTA 5T1MB 5HHXL 4CU7A 3WO3B 2CUMA 1WIUA 1RP8A 1TQVA 3LSOB 3LQZA 3V55A 1NEUA 2WXJA 1OIOA 4ADGA 1NGXB 2OJEB 4BV1A 3SE8L 4YDNA 4KFMA 3DVFA 3LKNB 4JZJC 4UQEA 3ZRCC 5E08H 4NT6A 1ZS2A 2BSBA 1BCIA 3U6XA 4KXDA 5B38A 1AHWB 2YBRA 4J3TA 2XHNA 1FCCA 1HHHA 2N7AA 1MCWM 3UG5A 2FDBP 5EC1B 1DEEB 4ATTA 3OR6A 5EHFA 5BUPA 1J05B 4CKVX 1U41A 1OP4A 1OOWA 1VFOA 5KUKA 4UTBH 3IDYC 1L0XA 5GS2D 3BESR 3L4CA 4FFZA 2YPLD 4O9HH 3AGWA 1R75A 3ZU8A 3LIZA 2B59B 4E5XB 4FXKA 3X1NA 4HETA 4NC1C 4BM7A 4Z6AT 3KL5A 2ED8A 2QDWA 3C5JB 1FN4A 2XCMC 4ZQKB 5CMAA 1A5FL 2D31A 1RK0A 4MB3A 3DO7B 2A2QT 4ZFOB 2AK4E 1ETJA 3QWRA 2UZIL 1XGRA 3JTBA 1ID5I 4G59C 3UG4A 3QJZA 1SPDA 5LCVH 5DTFB 4TUOA 3IMVA 1AHWC 4GY4A 1E6OH 4JHZA 4M7LL 5E94B 4PMFA 2B3IA 5IF0A 2Q2LA 4WO4B 5ABZA 4JFZH 2YD5A 1X6NA 3VFVA 1ZPLA 1G0YR 3AU0A 3D69B 5GSVB 2EDEA 2XWJB 3GMPB 3IJSA 3OKKB 1JZ3A 4HT1L 4I5BA 4PM1A 1H0DA 5DI8A 3U1PA 1A6ZB 3GIZH 5D4IA 2QMJA 5J4MA 5I8EB 2NR6A 1R3LB 4LP4A 4I0KA 2VRQA 4GO9A 1DN0A 4YEFA 3VVVA 3PP4H 2VISA 3DIDA 2L7QA 1BFTA 5LQBH 4Q9RL 3B9KC 3L5WA 3GSWA 5A2BA 4NOBA 1ILSA 2F5AH 1UWXK 2FJHB 5TE4L 1M71B 2YAPA 3GKWL 2ZCKH 1A8JH 4OLZL 3F58H 4C4UA 4O58H 3O41B 4U6HB 5C09B 5ID1A 1GMEA 4JHWL 1RZIB 3DGDA 2Y0SA 3MFGB 1RAMA 1MW2A 5C6TH 3D48R 4NC2B 4WO4C 1OE3A 4HSQA 3RWHA 1GKEA 5D2LE 4AVKA 5FYJH 1U93B 2PW1B 1H19A 2I60H 2AJXH 4JRFA 2ED7A 3OZLA 5C0FA 3ELAT 1E5UI 5C7XH 3EO1A 3HZKB 6FABL 1XO8A 2XICA 3F7RA 4DO6A 3ABKB 2RCSH 25C8H 1XD0A 5AOIA 3WS6A 5EU3A 1TMQA 3IPEA 2JQZA 2O93L 4FG4A 3OXSA 3HZMA 3QSKB 3EFDH 4JO2H 4KI5C 4W9IC 2NLJB 5DA4A 5TQ0L 5AZEH 1DVYA 3RWGA 4K5OA 1J8RA 2A9ML 4Y2DA 2ZOUA 1CT8B 1FL5B 2HRPL 3JQOB 5CNHA 4N2DA 2BH0A 3K5SA 1U8LA 1QPPA 1L6XA 4NJAL 1JHLL 1A6TA 4IU3B 4JO4L 1DO6A 1A66A 2IXQB 4YHML 4PQXA 4WTQA 1K4DB 5GGSA 4PI2A 4NN7B 3T0EE 3AMLA 1OGTA 5J3HD 1ACYL 4ZFGH 1QHQA 3EF7A 1GW0A 3G6JB 1CXFA 1IAMA 4JLRA 2IGTA 1WFUA 5I15H 1AZUA 1T3FA 3CX5J 4QMEA 1UXSA 3LXUX 4Z7AA 2VE6B 1JXFA 1AJ7L 3P3YA 3FQRB 1M1XA 1HOCA 2BERA 3T8MA 2G4GA 5CZXC 2XZQH 3DX2A 5T1LA 4P06A 3LQMA 1HH9A 1YEDA 3MOAL 1JGVL 3VACA 2P42B 2X09A 4A7QA 4XNAA 3FH8A 2DDQH 3IT8D 3JBG7 3O6FD 1VGKA 2Z4QB 3FNKA 3L3GA 5A2LH 3SYAA 4UB0L 3B7YA 3CIAA 3FUNA 5EO1A 1G7QB 1UB6A 2CUIA 3P4LA 4ZAKD 5EB9A 2HJFB 3IFPB 4AH2B 4K3JH 2FWSA 2LAGB 2W59A 1KYUA 1YHPA 4NENA 5JW5B 5D1ZC 5J1TC 1AGBB 3JWOC 2WOBA 4NZRH 1AQKL 4OD3L 5DFAA 5BW7A 4LCIL 2E9WA 2VDPB 1ZKAA 4RSYA 4Z7OB 4D3CH 4Z3FA 4C56D 4BFNA 1F6AB 2B1HH 2FYYB 2WTPA 3QWOA 5CHNB 3MLRL 4AIZA 2Y06L 1QQDB 4NO0A 1F3JB 1P7QD 1YEKL 4JPKH 4MJ6B 4H8PA 4JRXB 4LRNH 5SWSE 4B27A 5DMKB 1DVSA 1E4HA 2AJUH 3FCGA 1SEQH 3V6FA 3T9WA 4B7IA 2JLPA 5J12C 1S7TA 2NNCA 5FV1L 5IT2L 2W07A 4U1IA 2AK1L 4LU5H 2X1OA 1EAQA 2AMUA 1CB4A 2H4EA 3PAYA 4R4BA 2E7LA 1RZPA 3APFA 3MCLH 2XG5A 1NANH 2O6CA 4FTDA 3EYUL 2WQ8A 2DJMA 2FCBA 4GB9A 3BW9A 5FYJU 1H3PL 5TDNA 3TCLB 4YAQA 1USZA 4WWKB 5JR1H 2VZTA 4KPHH 1FFNB 3M17A 3AXLB 3DSNA 3MA9L 5AKTA 2VLKD 5GZND 4JY4A 1PKQA 2P5WA 4PY7A 3GHPA 4XXDA 2IALB 4A2GA 3HLKA 1JP5A 3BD5A 2ICWI 1YYCA 3BIKA 2HG5A 2W0PA 1ZHKA 3QXUA 4BXSV 2WB7A 6CGTA 3CDGA 1IT9H 2YD2A 3QI9A 4NPYB 4UQAA 4L0ZA 5J9PB 2VDQL 4NRXB 2LW3A 2BM3A 1KCUL 3BKYH 1UTDA 3G5ZA 3FOLA 3ESUF 1QWHA 3CHSA 1ZWIA 2ZXAA 4PGBB 4F20A 3WMPA 1QOKA 5C0IA 3AREA 1AG0A 4XCEA 4M1GL 4XP6H 3RIFK 1FO0L 3LXAA 1T0MB 1WA0X 4M02A 1UWEH 4U6YA 3BO8A 4LPYA 4B6ZA 5E9NA 1XCTB 1HSAB 1SUJA 3UO1L 1R0AL 4X83A 3WJMA 3FOMA 2PR4H 1KT2A 3KD4A 3CCHB 5LXGH 5EG6C 4AGLA 1EEYA 1GJWA 2P8MA 4FKHA 1UWYA 4WWKC 3TO4C 4HWEH 2XVKA 5KYWB 1LQSR 4GKZA 3S98A 3W9DB 4OCRL 4OIIH 4BSVA 1CURA 1SHMA 3GWJA 5HJGA 4Q9CA 4YIQA 4OH2A 1D5ZB 5J7CC 2P5EE 4P48A 4RFEB 5DURD 3U7YL 4OF5A 3V4PA 3EFOB 2YQ2A 5T1DL 1XHHA 1RHFA 3QJHB 4Y4HC 3RKDC 2J73A 1X3DA 5IMMB 4LKCA 3LDBC 4HLJA 1GKOA 4Y19E 1KN4H 3MKKA 3WGVB 1MEXL 4JFED 4G43B 4NHCH 4AY0A 2WN2A 5DUML 2CBOA 1DBKL 3B2MA 3DOSA 2MH4A 2H3NA 1HE7A 2WXNA 3FONA 3ILQC 2IIJA 2DB8A 4IGBC 4XVSL 4BELD 4PCTA 4N2FA 2FH8A 2FEJA 4R90L 5C0AA 5I17B 5ICZB 4Y7OC 1M2VB 2YQ3A 1REIA 1CCZA 1FL6B 4D9QE 1RZKH 5EPMA 1OSPH 5HJDA 2FIKA 1WP6A 2YUXA 2IANA 2ZYSA 4ZS7H 3WIFB 1TZGL 1X7QB 2OMZA 4XBGA 1BP3B 3U7WH 3S3PA 2ZP9A 3NSCA 4TUJA 3K46A 1EV2E 3VXUE 5HJ3A 2P3YA 1FYTE 3P69A 2YPLB 3F7PC 4LNRA 3VH8A 4L1BA 4NERA 4ZT1A 2VIRB 3IJEB 3OJMB 4M6OL 1WAAF 4N9GA 2NZ9D 4J4PD 5IHHA 1FUNA 3N85L 4GI8A 1T22A 2V9QA 1Z9LA 4DKTA 1SM3L 4RBPH 2D0FA 3ZKMD 5IHLB 3VCLB 3ILEA 1CD1A 2Z93B 2Z4TA 3ZE0F 3LHPH 4JAMB 2FQDA 5I1JH 3QAZB 3MV7E 4GAGL 4MWFA 3Q1SL 4CC0A 4TM9A 4Q9QH 4QHNB 2GI7A 3DDFA 4FXGB 4ODTL 3CHXA 1Q0XH 4K94H 3F5WA 1LP9B 4DSYA 3BZ4A 2UUDH 4CVZA 1F1GA 1Q9KA 2A77L 2Y1YA 3E7JA 1HZHH 4M5TA 4YXHL 4P04A 5ERWA 3V0FA 5DJXA 4XN2A 5B21A 4JFOB 2GTWA 3PWUB 1CVSC 3RNQA 2IG2H 4RAVA 3CMOL 2YD4A 3UOAB 1OAUL 4WJG3 4L4TE 5F6HJ 2E7CA 3US9A 2IBZX 1JRHI 2WXKA 4O5LH 4PGEA 3CFNA 3Q06A 2FECI 4PRDA 1HIMH 2BSED 2C4XA 1LL1A 2C8NA 4QRRA 3F01A 5FUOL 4UBDD 5DK3A 3LEYL 2ZONA 1KGIA 3P4OB 3U9WA 4RGNC 1JDDA 1YVLA 3RTLA 2YWYA 1Q9OB 4UTAL 4XMKL 4Z7UA 5IG7A 5FWRA 3ZZLA 4GSUA 2FHBA 1CL7I 4FXGC 4M00A 2I9TB 1G7IA 1RIVL 5CJQH 1FBIL 1T5XB 1BFSA 4NI6A 1NCWL 5HD8D 5IJCC 4PCSA 1EJ8A 1E67A 1XH0A 5JW4M 3VFSB 4YSOA 3GIVB 1PYWB 1OY3B 5I74B 1A02N 1AAJA 3GHEL 4M7KH 4LSQH 2IGFH 4I9XA 4R0LB 5FGBC 4BFKA 2J3SA 3HMWH 3KPLB 2WXHA 4PJ5A 1EAJA 1LQBC 2CMRL 1F4YL 4GKNB 5F71A 2NCEA 1PDKB 3HI6L 3VFNA 2HXAA 2GJJA 1VKXB 4YX2H 4FS0A 3MBXL 2KLTA 4AC4A 5IHZB 1K72A 3OKMA 4PLJD 3KG5A 2W9DH 5D7LA 4XHQA 3TP4A 5FB8A 3U2SA 3O2DA 1NMCC 3CZKA 5BS0E 5ICUA 4JHAL 2UX6A 1CFNA 4XXCA 3HN3A 1JGLH 4S1RL 5LN8A 2X1XR 2JJSC 5BVPL 1FSKB 3IFOB 4JO3L 1LO3H 2EO7A 4PRPD 2VL5A 2OM5A 1MUJA 2ZT9C 5DA0B 1X5JA 4HUXA 1VACA 1WUNT 3H2WA 4R7NA 4WCYL 2HFFB 5FCUL 3O6ML 5L2JB 1WT5A 3O3BB 2IADB 4ZUUB 4M5YL 5FAAA 1EIBA 2Y4SA 1N59B 4H1LA 2YLKA 1XCQB 1YN6B 3K4DA 1MQKL 3T2NL 1HL5A 5I1LA 3LPOA 1IV8A 3GUTB 1DQJB 3A4DA 3P2DA 3TCTA 1INQB 1SQMA 2VR4A 2B9BA 4JY5H 3U0TA 1CI5A 2CDFB 3HNSH 3O2VH 5GGUB 2ODHA 3MJ9H 3HC0B 4JBSA 1AQDB 3HZVB 3RHWK 1E7VA 5HGAB 1Q90A 2DWEB 4LZKA 1ADQH 2I07A 1N9PA 2Z92A 4J28A 4JY6A 2PWDA 1VADB 1AKJA 3N40P 5SWQA 2DYPA 5ESQA 5FOBA 1Q9WA 1T89A 4AT6A 3CFBB 3CU7A 3C2AH 3O6FB 4MXVE 4OR1A 1FSKC 4X6CA 1JNJA 3GBMH 1AD9B 4FJYA 4GIAA 4JFFD 1MJUH 1CWVA 2IMMA 4ZAKB 2Y7NA 5D6CA 3VMPA 1E30A 3TFKD 1MFBL 1PQZB 1TLKA 4U2YA 5J3HC 5I1GH 2J72A 4PVNA 3UBXB 1S46A 1OGAE 1XSOA 4JFWA 4YNYA 5J06A 3UTQA 1Z9SB 2JJVA 2HUEA 3PWNB 3H56A 5A7BA 2PYED 2F1AA 4PWGA 5EUKA 3QJUB 5C0GA 5HGBB 4HIIB 4K7PH 1I9RH 4C56B 3F64A 2ATPB 1BYNA 2C9PA 2Z91A 2CHWA 1P7QB 4KMLB 3ECVA 1RJYA 1JK9A 5ESAA 3D7PA 5IB4B 3GXFA 2FNWA 3P0YH 3DXAA 4KI5F 5B1CA 3L95B 3JWDL 4IBUA 4NNPH 4XOAA 4BWWA 4TQEH 3FUHA 3QQDA 4I2XE 1HNYA 1T6BX 1C08B 4NQSB 4ZTOL 2BSTB 3II3A 5I1IL 4OCXH 2D2CC 3HFMH 4ZAKC 1A0QL 3RURA 1E4WL 1H6UA 3C9NA 3WJLA 1G9EA 1P5UB 1A3ZA 2Z8VC 4XPHL 3QH3A 2YAFA 1N18A 3HEIB 4R4FH 1IGCH 3CUPA 4PRIE 3U6XS 1P4LB 1ZHNA 4RDBA 2VLKB 4S1SL 4Z0XA 3ABZA 4ZTPL 3IMRA 4U7KA 4HGWB 2WZ6A 2NNAA 4PTUA 2VM9A 1CE1L 4MS6A 5KSAD 2Y7OA 4XX5A 4EQ3A 4JM2F 1Y18B 4AQ1A 2M1KA 3UYRH 2GJ6A 3MNZA 1BVNT 2NY6D 1LXMA 5AW8B 2JKJA 3PFUA 4HKXB 5AKVA 4R7XA 2WGXA 4HPOL 4MBOA 5HY9B 4NUJB 4Y4KA 4LPTA 3QHFL 3VG9C 4AM0Q 2EVFA 2HLFD 2IOMA 1T83C 5FLVA 4OAWA 3SDXE 1QFWL 3LKQB 3RZCC 3O6LH 5H37A 4TSBH 1SY6A 4D0CB 3TJEH 2B1AH 3L3HA 3PDDA 2K7QA 3FU0A 3ZYOA 1IC5L 3L1OL 4YSSA 1P5UC 1AR1D 2UY7A 3CFUA 4R5XA 1KG0B 1E5ZA 5GGTH 2L8AA 1ZJAA 4HKBA 2X3AA 4F33A 3T0WA 1GIGH 1NICA 5B1AB 2DQ6A 4EQ2A 5D6DA 3G08A 5LAXB 2YQBA 1MCPL 3FU8A 3LX9A 4PR5A 1KCSH 2FZ3B 4OLUH 5GZOD 4LOFA 2F15A 4YL4A 2WVUA 5DURB 4JFHE 4BIKA 1EO8L 1GY1A 1O6SA 1O9WA 2YPVA 3IFNL 3MUGA 5TDOB 4N0UB 5F93C 3V4UH 5CU9A 1HQ4B 3HE6C 4NBYB 1RUQH 4NI3A 3RWIB 3Q05A 4J39A 3VXTB 3KPPB 4JFEB 2EDKA 1RZGA 4KVPA 3TYGH 4CL7A 4QXVA 4NYLA 2NX5D 2P8LA 2D9CA 2GCYA 2BY1A 3TWCH 3D06A 4LF3B 3QUZD 5E2UL 3RY4A 1D5MA 3V8CA 3DX0A 1PY4A 1K8DA 2WWKT 3LNDA 2C9XA 1IE5A 4XVTH 4GRLC 5FK9B 4FQCL 3FF8A 3FAWA 5KSVB 1W72H 2MTAA 3NIGB 3P9LB 5HHXH 4MVBD 1NSNL 5JNYA 3KNBA 3VQ1C 4B5ZA 5GGQH 2EE0A 4ONOA 2EIKB 2QLYA 3BMWA 2QJDA 1KENH 4BZ2L 4F8NA 3JUZA 3SE8H 4WDIA 3IDIA 2K6WA 3D1MC 4TUKL 5IQ9A 4EF3A 4AYMC 3RWCA 1OVZA 3HNVL 4UILL 4CKQA 4OI9A 3R06B 3RL2B 3TEWA 4OW6A 3T2QA 2EEBA 4GOSA 4S0HA 1VZHA 4PRHA 3GZKA 4AEEA 1AY1H 2HUHA 3AACA 3SE9H 3WS3B 4RGOL 2XWZA 2O1AA 2TSBA 4HS3A 3GMMB 4MA8L 1YY8A 1YYML 1CFSA 3O81A 5IEHB 2FNBA 4RX4D 2B08A 2V17L 4P9ML 4TQHA 4J12A 5AVRB 5CJXC 3FT9A 4A2FA 3DHJA 3KXFE 3CLFL 3CX2A 5AVQB 1A14L 1IMHC 3QPKA 3RPBA 3BVNA 3VFTB 1U8IA 1UHVA 3FQUB 4FZ8L 3CSBA 4AGMA 3D85A 4PW3A 2UX7A 1J9RA 1MPAL 2DJSA 2OYMA 1XSIA 3VQMA 4OI8A 1UA6H 5AAMC 2M26A 5SWZE 3EBIA 1BF2A 2HN7B 3QCVH 3GRWA 1PZUB 2OYKA 3EJUA 3DHMA 1WWBX 1HHJA 1QACA 1DBML 1YEFH 2VLLB 1GH7A 3BEVA 4QHUB 2AABH 3IGAB 4GG8B 3NRPA 2AQSA 1ZV5A 5CJ5A 2JB5H 2HMIC 3IDNA 4L3FA 1T2QH 3B8YA 3FT4A 3VW3L 4PWJA 1TQCB 2H7WA 4HJJL 2JKTM 4L18A 2NZ9C 3NDZE 5F9JB 2GIYA 1N6QH 1V3MA 2R0WL 3BYTA 5HHNB 3U0WL 4APQD 1V54B 4F9LA 3STZB 4GSRA 3FUJA 2W8CA 1DYZA 1NMBH 4IRSA 1AG6A 3BP7B 5BV7C 5TGBA 1F4WH 5DYOA 3WIHH 3TL5A 3DK2A 3QQ4A 3AITA 4EN3A 4YSDA 3P73B 4OV5A 3ETTA 2Z3FA 1EGJH 1K5NB 1WEJL 1Y6MR 3C8KA 5E6IA 2HTKD 3F7QA 4O4YH 4XNBA 5CP7A 5JPNA 2R69L 4DEPB 1A7NH 5HGHA 1X5IA 4F8TA 3ZUNC 3VFRB 4HCRL 4PTTA 3EG9B 3NJGA 4P5SA 4QRUB 1U8PB 3X12B 5T33L 2UZXA 4XE5B 3DPBA 4HJ0D 2SEBB 2R83A 1OGSA 4BFJA 4HZAA 1I8LA 3QUXA 5L9DH 4HMDA 4FLQA 3H7LA 5D7JA 1W91A 5TPWL 3AU1A 4QTIH 2FLBT 4XCYA 5D2LF 4XB7A 1LWRA 1XMWA 1TZHB 1TQCC 2CO6B 4WI6A 2ITFA 4ISVA 4PJGB 1HK6A 5JXEA 1NAMB 4NKMA 3PV6A 5D8JL 3MO1B 5AW1B 4BUGA 2V4LA 4OFIA 3T6XA 3FU7B 3GSQB 1C5BH 1MCBA 2OZNA 4HIEB 4JN1H 3VO0A 3GSOB 4NPKA 2C3VA 4PLOB 3HAEG 3VWKC 2WZPA 5IFJA 3TN0D 5EEYA 1EEZA 2JQMA 1E3XA 3OAYH 5JOFA 5IK3B 4MA3B 5F7HA 4TOYL 4X7FC 1UCBL 5JUEH 3BRFA 4AYGA 2ARWA 4PRPB 4DEPC 5FECA 4DGVL 3C2SA 4KJQD 5A2FA 2C3WA 2XWBB 3FU9A 3D0VA 1THCA 1Y6KR 3PIQB 1A7BA 4DETA 2XFXB 2DLIA 3J7HA 3VFWB 4PJXB 1J0IA 1KYAA 2VJ8A 2PCYA 4Z7VB 4FYTA 4IS6A 2YAHA 2CDGA 5GJTH 1AQHA 3C75A 3FTZA 1JPTL 2PNDA 4JO4H 4R96B 1FZKB 4S11A 4U1JA 4S1QH 4P46A 1SJEB 5B8CB 2X41A 3SBPA 4LLVB 5AW7B 4PLJC 4FL4B 4N1EA 2ZYHA 3MJGX 1MCHA 4NRZB 3MCKB 5KTEH 4R8WL 3OKOB 3WUWG 1ZT4B 4GQ9H 3TIDB 4J3WA 1JERA 2A74A 1S5IH 3C08H 4M5ZH 5CD3A 1KYFA 1YDPB 1GGCL 2KT6A 4JFFB 4TXVB 1AJ7H 1KJ2B 3SE6A 3FB6B 5DT1H 4OGAD 4PJHB 4YBQD 3NN8B 2IBGA 5LAPA 1HEZA 4BE5A 1G6RB 5EC2B 1AD0B 5BRZD