2QVKA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
189
structure length
121
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEGRPILGEHTKLEVIIEESYEFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
total genus 26
structure length 121
sequence length 189
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvkA00
2QVMA 2FWSA 2QVKA 3E9UA 3H6AA 2KLTA 3E9TA 2KLSA 3RB5A 2FWUA 3FSOA 3RB7A 3US9A 2DPKA 2LT9A 3FQ4A 3GINA 3EADA
chains in the Genus database with same CATH superfamily
2AXWA 2CJUL 1NCGA 3VGAC 2NY2C 3IKKA 1PCXA 2RD0A 3WNJA 5HYQA 1MFDL 3QT2A 1BXVA 1MCOL 2CNZA 3T3PE 2EUZA 2PYEB 1XHHA 3IBOA 5HHOB 3QIBB 1UB5B 1HXMB 4R7DA 3MBXH 1KBGL 2E5EA 1W16A 4DTGL 4K55A 4WJG3 5IGXH 1IAOA 2Q6WA 4ENED 3OGCB 1A66A 4I3RH 2R4SL 2IPKA 1VENA 1FQ9C 3PNWA 3VI4B 4RGMC 2E0PA 5I1LB 4FQXC 4RIRB 2E27L 5BJTA 1Q0XH 1OW0C 1RZGA 1UWYA 5BQDA 1GZQB 5DHDA 1A9EA 1BIHA 3TVMD 4FNTA 5CLZA 4JR9L 3ZZSA 2CLVA 1XL6A 3EF4A 4JHWL 1E0OB 3BGFC 1QEXA 3C6SB 5D96C 5HVHC 4DIXA 4BUHA 1IGMH 2C4XA 1FGNL 3M7FB 4U1GC 1N0LB 5D1ZC 2NQDA 1H3XA 2CHXA 2J3SA 4KJYB 3RDTC 5DJ2A 5DRWB 1PY9A 2YWZA 1L3NA 2E3VA 1DR9A 5LUMA 1NDMA 4TVPE 1K8IB 4FLSA 5ISZB 4Y4HD 1XGQA 4N2GA 4WI9A 4L3ED 5KBDA 1A1MA 2HG5B 3GMNA 2HKFL 2VM3A 3OAZK 4XOEA 5JA8B 2Y7NA 4L8SC 5DD5H 5E9DD 2PR4L 4HBCH 1EGJH 1JPFB 3EH2A 4NIKB 5DUML 4PYHA 4NPYA 3CZFA 3FQTB 1PZAA 1W15A 1QSEE 3SJVD 4L29B 3TH3T 2JTYA 5M94B 2HRLA 2HWZH 1FP5A 1JBJA 2J21A 3HNVL 3EZ8A 4P5MB 4FQQB 4F9LC 2GY5A 3TN0A 2JJWA 1ZLUH 4IIQC 3RI5F 1JZ7A 1KIPA 4G8IB 3GLAA 2DLHA 1VRSA 4DZBB 3HBZA 2B2XH 1FE8L 3W11C 1CXLA 3KWVA 2I7SA 1G1CA 4CMHB 3FOMB 4GS7B 5CP3H 5I9QC 5AB0A 1B2WL 1Z6JT 4IKJA 3L3OB 2AV7A 4YDMA 3D4CA 4OFVA 4TVPL 4H25B 4BK5A 3RG1C 4C83A 2ZPKH 4PY8J 3AU1B 4ZBJA 1B4TA 3B2UD 2AZAA 4WSGA 5ICUA 4N86A 2YMXL 1AP2A 2ZG1A 4E9WA 2CO7B 1NL0H 1HXYA 3FCUB 4UOW1 4AE1A 4XNBA 1CU4H 3SBRA 4NNPH 1BA9A 3KPRD 1GH7A 3CVIL 3MGTA 1RIUH 3BVTA 1GY1A 3BQUD 3H56A 4X5LA 3U9PH 1IEHA 1SY6H 2GI7A 3LPWA 3LNFA 4NWUH 1FHGA 3C60C 4M8VA 3VD1A 4JCMA 1LD9A 1YEFL 2D0FA 4HAKA 5DVMA 2GSMB 4ONFH 3SKOA 4CADA 3L3OC 3P3UA 4PV9B 5AUMA 4ZUUA 4IJ3B 3KPRB 3SDXA 3L95B 1VEPA 5A16A 4U1NA 2OFQA 4M3HA 3IWVA 1ZT7B 4PLKD 1X4YA 3MOBL 1G7JB 1XD1A 2DWEA 2IPUG 3T0DA 1R9FA 4NM8L 5HPOA 4XAKD 1OAQL 1RUAL 3CE1A 5K9OB 1KNOA 3W5NA 3RWIA 1A9VA 4EN3C 3OV6A 1TVHB 4RFOH 3GSWB 2FGWH 2P5WA 4CRPA 2HN7A 1MCNA 3P0YH 3PJLA 1OK8A 2VC2H 5AVZB 3RX9A 5A2JH 1OO2A 2JKTM 5KN5A 2X4SB 3GGWB 4OGYH 3B43A 1E3ZA 5BS0E 5FCSH 3QHFH 2PETA 3MREB 2OX5A 5D1ZD 2X10A 3V6OA 1LQBC 4U33A 3L3IB 5GRWA 3VXUA 4Z7UF 4FQ1H 4LGRB 1QABA 3M8OL 4Y4FC 1JZEA 2XZCH 3EXLA 2Z31A 5J1AA 2C5DC 2WCGA 4ZAKC 1YEJL 4X7SL 4OJFL 4G3YH 4WW2C 4PGDA 2BSTA 1DVFB 3NCJH 1T89A 2CAKA 4KXZI 4Z7QF 1WIOA 2V0AA 4YZFF 3LDBB 1AO7B 1YMHA 3JZ7A 1JGUH 3S5YA 1G7QA 1MFDH 1OP5H 3FRPB 3PU7A 4J2XA 3SGKA 3FOLB 5CN3A 3ZE2B 2LU5A 5IHWA 3A6BH 1H6TA 3LKSA 4N8UA 4YSRA 4FQXB 5GGTA 2F5AL 2FEEI 4K73A 2ED8A 3D2UB 4A7VA 3VD3A 2DIJA 5D7LA 3VXSD 5L7XH 4BFGA 5E08L 2WOYA 4PBXA 3ZTCC 4F7PA 4AJWA 1TTUA 4TVPH 1RD6A 4KO6A 2BVTA 5DRZA 3TA3A 3TCLB 2Z3FA 1RXLA 2OTWA 5KBLA 1XF5A 2LLGA 2PO6A 3S2CA 2GK2A 3FBKA 3S8GB 5J11B 2MPAL 1WFJA 5FGRA 3MJ8A 4JHWH 4BQCA 1AKPA 1JPTH 2UZIH 3L5XL 4AW4A 3HI5H 5ENWB 3K8LA 2ARJA 5I1EH 1NPNA 1JV5A 3BISA 2PTVA 1KGYE 3BVDB 4JFFE 1F56A 4Z7NF 2N7BA 1M7DB 2OMVB 3V0VB 5F1IB 2VABA 1KB3A 2BFGA 3C5SB 4PJDE 4I2XB 3D25A 5D4JA 4NKMA 2MCAA 3UBXG 1XH0A 2ZOWA 4FG6C 1GGBH 3Q7JA 4M6OH 3ZBMA 4WHDA 5GZNC 3CSTA 3AXLA 1AANA 3U2SA 2JELL 4Y16A 4HQQL 5GSRB 1NEZG 1RVFH 2Y72A 3W3BA 4AC4A 1RZJH 1MZZA 4YDNA 4JLRA 3NMEA 4J3BA 5IJDC 2KLTA 3RUGE 2F5BL 3VH8A 2G9HA 4U7MA 4R5TA 3WGUB 4AGQA 4H0HB 2VLJA 4ILDA 4YHPB 4WW2F 4HC1L 3CDZA 4P04A 1Q8MA 4MAUL 2FIKA 1XCTB 3ARSA 4FJZA 5CP7A 1C5BL 3KE0A 1I1CA 3BWUC 5A40E 2BNRD 3GXUB 1GS7A 3MBED 2VC2L 1A6VH 2GCYB 4U2ZA 5CJQH 4W1TA 5DJ0B 2AJSL 3IF1A 4OVUA 3E38A 2PPFA 4OZFB 4PBVC 1OT2A 4YXHH 1OM9A 3L4WA 2W80C 4OAWA 4C47A 4YR6A 1ZLVH 5DJ8A 1ZHLA 1GC1L 2V17H 3QR2A 1JZ4A 2B15A 3OMIB 2DPKA 4F2MA 3O8XB 2ZT9C 3QEQE 2WWKO 4HIXL 4MX7A 2XTSA 5CN2A 2X42A 5HHVH 1J1OL 1J9RA 2QADB 1Z5LB 3ASNB 2NYZA 5T5NG 4IDJL 4XMPH 1A47A 4JFPA 4IM8A 3OJDB 1MVFA 2DYPD 3Q44A 2BSSB 2JB5L 1U95A 3BWAB 3Q3GB 3INOA 5C9KA 1M2VA 3FRUA 1UD3A 1PQZB 1PLBA 2DYSB 2I07B 1BVZA 4MQSB 6CGTA 3D3VE 3EHBC 4DH2A 2QZQA 5AW7B 5D6CB 4OUUB 2XA8L 4WCYH 1IQDB 3O2VH 3NJMA 5C0DA 1CFSA 1JTTA 2X2UA 3BO8B 2CDFA 2QVIA 1VFUA 4DP1X 2HRGA 3F85A 3RHWK 1YEWA 4MYPA 4IGBD 3A6OA 2D31A 1JXFA 5L7XL 1ZA6B 3G5YB 2VB5A 4P2YA 1PCSA 1TVBA 4TNVF 5GGVH 1WTGT 5D93C 1OAQH 1RZIB 1TG8A 3FUNA 5FO7B 5I8OL 1CBVH 5LNDA 1I8MB 1AGFA 1MCRA 4G8AC 2PYED 4OLWH 3L5WB 4H0IA 5EO1B 1KTJA 5CIPA 3G7TA 1UH3A 5FO2A 4LEEA 3IJ7A 3BVWA 4M4RB 4N25A 3BMVA 3H9SB 5DK2A 5G5DB 4JRXD 5E00B 3QJSB 5GGQH 2CR0A 4RA3A 4PRHD 5GRXG 4HIEA 3CFDA 1GGCL 3WLBB 4LSTH 3WS3A 3WTVA 4LCYA 4JRWA 1QPKA 4P3CH 3G6AB 2IGLA 1OEZW 2HVKA 5CAYB 5FCUL 4ADJA 5I1CL 5IEHA 3QXDA 4OLXH 5SWQB 3RPIB 1D7DA 1QKZL 2EDQA 2F74A 4PJFB 4BRVA 2P5WB 1MHEB 5KW9H 1DQQB 3UJIL 1UWXH 4F9LA 1FFPB 2X1PA 5KTEL 3CDCA 4ENZA 4CW1A 1U8QB 4J6RH 5GGSA 1FBIH 2BY1A 4AYDC 2Q86B 3W1ZA 1AC6A 1JGUL 1ZKAA 3HNTH 4GBXB 1ZPLA 2EEDA 1S3KH 3AWEA 4JM2B 4N3UA 5KVDH 4NPJA 1DVZA 4NAQA 1MCPH 2E7LA 3F8UB 5LGJB 1MWAB 1IEAA 2X3AA 5DURB 1BXAA 1I1FA 1IGCH 5J56B 1KPUA 1LD9B 4LCCB 3BP7A 4QY8A 3SBWA 2XN9B 2NY0C 1VFAA 2Z8SA 5TK2A 1ETB1 2Y7MA 4AEIH 2OPCA 4N0UB 1YQ2A 4KXDA 3WNIA 1TJGH 2MH4A 4NXSA 2X2IA 1GMEA 5LQBL 1QRNB 5HBBA 4JFEA 2GIYA 5ACMA 1P4BH 4LLYB 3IDGA 3ZDXB 2QQKL 4PWGA 4KKLD 4LRIA 3NCMA 2R8SH 1ZA3B 3MI6A 5LBSL 2IH3A 1UKTA 3KEHA 1OANA 4YZFE 3SKJH 5C09A 5EZIL 5FOBB 5C7XL 1NBVH 5GGUB 2WBJC 4ZSOA 1FL5B 3PQYA 4UT9L 4BH7A 5TPWL 4HKBA 4JFDD 3FTWA 4Q9RL 3RY5A 1WSST 1HU8A 5EULV 4K4KA 2Y2WA 4ZW7A 3EJTA 3VM7A 1NAML 4Q14A 1U8MB 1T21B 3HC0A 2WLZA 5A7EA 5MENA 3S35X 4KKCD 1T22A 2ZSWA 4WK2B 4Y1SA 4Q97A 3ZTNL 2VDOB 2ZUSA 3OJMB 1GTFA 2ZUQC 1CL7H 1CDJA 2JI2A 2HLFC 2R29A 2XKNB 3D05A 2Q86A 5DHMC 4AVJA 1V3MA 3L3GB 2X4TB 3PABB 5KANI 4OVVA 2ETWA 1P84K 3ZRFC 2E76C 1FFPA 3MROA 4DEPC 2X12A 1PG7X 2ROXA 4MKMA 4OGZA 2AJXH 3VU1A 1JGDB 3CZNA 5EWIH 3SKUD 3BEVB 3C09B 5I6XB 2QPEB 1W72A 2AKRA 1D5IH 2HG5A 3ULVE 3HZMB 1N67A 4XNUL 4A2HA 5HJ3A 4GMTH 3BN9D 4IRSB 3CX2A 3KVQA 1S9WB 4BWUA 4ZT1A 1X7QA 3QIWD 2YAHA 4PSPA 2FWOB 2GBTA 2YUVA 2FAUA 3EH3B 1LP9E 4U0RC 3AABA 2AAAA 4W9EC 2X4NA 3OAYK 1ZRUA 4JKKA 4DQOL 4KK8D 8FABB 1J88A 3BD4A 4NNXA 3EFOB 3QJRB 2DL2A 2X4OB 1OXYA 3UTSD 3LXUX 1PZUB 1A4CA 1E8ZA 5C3TA 1DSFH 1S9YA 1QTYT 4PWIA 1BJ8A 2NPLX 3RZWA 4BA8A 5E2TH 3D30A 1FYHB 1F4WH 5TE4H 1SZNA 4XPBL 4AYFB 2A38A 2WBWB 1U4FA 3EH1A 4DGUA 1GYUA 5TGBB 2Z9TA 4UB0H 5EF0A 2IAAC 4H8QA 3BKCH 1RIHL 5AZUA 2FB4L 4PJAA 4JK0D 4QRRE 2DICA 5C08D 1KEGH 3NRPA 3R4RA 2KQNA 2WCSA 3MNVA 3K2UH 3MRGB 4QXUL 2HVJB 3JV6B 3KZ8A 3L4YA 4K3DL 4NERA 1D6EA 2VABB 1DLFL 3EO9H 3QNZB 4M7LT 3RWHB 3VXME 3X13A 2Y6TE 5JNYA 1U8JA 4P23A 2WBJB 3H3KA 1MCSA 2M1KA 3DIFA 2XPYA 4JPWH 1EJOL 4AQAB 3QXVA 2H4EA 4YPGB 4F58H 1IFRA 1L6PA 2C3WA 3TA3D 1S7SB 2QEJA 4AL8C 1PNDA 3IAPA 4LP4A 3LCYA 1HHHA 5JZ7C 3T2PA 1AGCA 3GLDA 3SKMA 3ARZA 3TWCH 5C08A 1MLCA 3S3CB 2AEPL 1FAIH 4OCXH 4I1NB 4LKCA 4GKNB 4N3TA 4ZS7H 4F8NA 1QLFB 3MA9L 2YZ8A 1OSZA 2B7DT 3O6ML 5GRYA 1MI5D 2XPGB 3UGXA 1J5IA 4EDWH 4LEOB 3GZOA 1ASPA 4NNXB 3GIVB 4LSVH 3IM1A 2FUTA 2OMTB 3VG9B 3B7TA 3ZGHA 3WY3A 5C9JA 1NAMH 2QMKA 4X4ZA 3VWKC 5KTEH 3INUH 1EAPA 4D9QE 5HPMA 4MJ6B 4Y4FD 4V2CB 1MVUA 3EF7A 3IFOA 3TBVA 1HHIA 3S3JA 3KCPA 2CBMA 2HJLA 3UZQA 1M42A 4HEPA 2EVHA 2DBLL 4HIIA 1HSAA 5ABAA 1GW0A 2BSCA 4PV1C 4F33B 2FBOJ 4N2IA 1L5GB 4DTGH 5IGXL 5FW8A 1SNRA 3E8UL 1KTDA 2DQJL 4M43H 3TS8A 4LHUA 2R4SH 2R1XA 5B3SB 2GC7C 4TULH 3RFRA 3L9RA 3LIUA 3TPUA 5ERWA 2NMSA 2PXYC 4FG2A 2VAAB 1USZA 2NXYD 5JHDB 3RVXC 3MNVB 3BVXA 2F8XC 4P2CG 1X5IA 4OZIE 4DP5X 2A5UA 4Y4KD 1QFWM 4IKNA 2OL3A 5IVXF 1IX2A 1WPCA 4X7CC 2VN4A 4TNWF 1P53A 1F90L 3CJJA 3FCGA 4ZPTB 5C7XH 1CFQA 3AREA 1SBSH 5JMRA 1KLUB 2AQNA 2B77A 2MTPA 4OM0L 2R9HD 2NY3D 5CO1A 3ULUD 1CF8H 3CC5B 3HC4L 1QRNA 4K71C 3UTTE 3FO2A 4NQXA 4KNTA 4OZGB 3ZDZF 4DP0X 3NESA 4JZNB 3LHPH 1V7NH 4ZOCA 5ESVB 5BRQA 2B59B 2DQFB 2JWYA 1WISA 2GTZB 4W9JC 4P2RD 2NZIA 2ICCA 4Q0XH 3HE6D 4I1PA 5DUBB 5I18L 1I8KA 1IEBB 1YEEH 3FU6A 4OTXH 1A7PL 2W59A 1XIWA 4O02A 4CMHC 5JHDD 2NXYB 3LMJL 5DJDB 2Z31B 1JK8B 4WZ9A 3GSVB 5D2LE 1P7QB 3AU0A 2IWEA 1KFAH 5GJTH 4PJEE 2AXJA 2B2XL 3LV3A 1Z66A 4YLBA 3OC8A 5FX3A 3TWCL 2YD7A 2X6AA 1OHZA 3QJFB 3FQNA 4JGJA 2OLDA 4MXWL 2IADA 4OU3A 4XMTA 1IGTA 3KPTA 2CGRL 4W9DC 2XRAL 1NC4B 3KWWA 4APXB 4Y2DD 3RTQC 3MV9E 2O4EA 3GQFA 3O6MH 1NMAH 1LWHA 3F7VA 5DC4B 3RWFA 1JWSB 4KKZA 5INDA 3RILA 3QPXH 4GEJA 2YD2A 1OAZL 4DGYL 1BAFL 2E59A 2JQZA 4WU5B 3INUL 2AGJL 3THML 3LKOA 3GSQB 4QRSB 4BIKA 1KPRA 4YE4H 5L6YH 3FCTB 2H6OA 2YQGA 4NX0A 4TSCL 3BKCL 1ZPUA 3HLKA 4F2ME 4UM9B 4JFXB 3FFDB 1ZE3C 1VDGA 4JFVA 3GMNB 3PGDB 4QHPA 5I1AA 4HCIA 4HIIB 2F7PA 2ADIB 3T71A 3DKHA 1HAWA 4KZEL 3SN6N 4JFTA 4MJIB 2E6QA 5HVHB 3BGFB 2QMJA 5EDXA 4Z3IA 3UTPE 3WBDA 3KDPB 4NOBA 4LASL 5I8KL 4LMQE 4FKEA 5C0DB 4RFEA 3PDOB 5DJXA 3TNMB 4YDIH 5INCA 5T3ZD 1LQSR 4N2OA 4Y9BA 3QDMB 3ETBJ 4DO5A 4UMGA 1RL1A 1BFSA 1C8QA 3X2QB 5KSAB 3WTWA 3CUPB 3DX1A 2R2HB 1NM4A 1CDYA 4NJ9H 3RNQA 4DN3H 2Z91A 1MW2A 4N0YH 4N8CL 4MHHG 1ZLVK 2WLIA 1YN7B 3BAKA 3CFCL 3CG8A 4FXKB 5T3XH 3DJZA 3QHFL 1Z9PA 4PGZA 4JDVB 3ZR6A 3ZZLA 3ARQA 3GF8A 3WE6A 1QWUA 4Z23A 5AG8A 2Y06H 2BVEA 4H26B 4GXVH 1Z9SA 2VQTA 3JTTA 1KGJA 1SPDA 4X6CE 1DUYB 5TFSL 3RB5A 1D3CA 5F8RC 1URLA 3ILEA 3MV7E 1S7QB 5CSGA 4Z0BH 4EN2A 2JK5A 1D5RA 4JDTL 4NPYB 1V10A 3O6FA 4ZFOB 1M7IA 3G04A 4KDWA 2J1XA 4GMSL 4I88A 5M7QA 5D9SB 1N2RA 2FATH 2KKQA 2YPVA 4HWZA 2L04A 3NTCH 5CMAA 5ALBH 4OGXH 4OZHA 2W91A 3H3PH 4WTZG 2CK0H 3PGCB 4MJ6A 4NRXB 2ZZUT 3EH5B 3U2SB 4U6VH 3HE6A 1DCLA 4MMZB 1MFMA 1NM9A 3WKML 1QVOA 1X5XA 1EZVX 2AK4D 5C0BD 2ZOOA 2DMCA 4NQCD 5FUOL 4PEEA 2R2BB 5I26A 1IQDA 5JPMA 2J5WA 1DE4A 4QKXB 5KVEE 2DI8A 4Y8DC 1UXSA 4BUQA 2Q1EA 2XDHA 4NM4L 1KG0A 5FDWB 3UTZA 4ELMF 1EXUA 2H8PA 3FH5A 1T4KA 1CR9L 3UZVA 2ZYRA 1TMCB 1H3GA 3L2MA 4AKPA 3G5XB 1B0GA 1GPOL 1I8IB 5HVFB 1GJUA 4FEMA 3MV7D 2I60H 3NFPA 3OKKA 4NN6C 3W82A 4AM0B 1HNFA 4D9RD 2VUKA 3F58L 5HHNA 2V3FA 3TO4A 5FUCC 3E6FA 3DX9A 5DQJA 3NZ8A 5HYSA 1ZVNA 3T4YB 3QIWA 1CI3M 5E6IC 4IIZA 3ARFA 4I4WA 4LQFH 3OXRB 4IU3B 3E0GA 1XGUB 35C8L 1TU2B 4YO0A 2Q8AL 1YY9D 3GXIA 1KIQB 2NUTB 1CK0H 2FLMA 3CVHA 3D0LB 1E9OB 4G70B 5DO2D 5ID1A 1F97A 4LSSH 5ALCH 4DFHA 4JKWA 1AZBA 4OD3H 1HH9B 3LRKA 4NQEA 5B1JA 4QXTA 1ZIBA 1KELL 2EIZA 3L8QA 4F7EB 4OQTL 5IQLA 4WUUB 3NIFE 2D2OA 1KT2B 2J72A 1KFAL 5GS2D 3HB3D 2J8UF 2AJYH 1E8XA 4BZ2A 2NY1D 2VDQH 2E6JA 4XI5C 4PRPB 1MXDA 1YYMH 2CGRH 2C3VA 2X40A 3SO3C 1NAKH 4N85A 5HHVL 1NMAL 1R5VA 4MZRA 4I3SH 2Y06L 3QBTB 1TQBB 3VH8G 4J7RA 4EZMA 2IBBA 3AQYA 4M7ZC 1KPRB 3AS2A 1INQB 3L3IA 4D9RE 3OKLA 4RAHA 3SDXF 1AS8A 3BUPA 3G08A 4ODSH 4WU7B 1JGVH 5KSUA 3BGMB 1Q0EA 4CMMA 1BQHA 1CWVA 5CEYA 4DVBA 4GLRI 2GUOB 2PXYA 3OMZA 2HT4D 2VN5A 5K69A 5T33H 3FF8A 4ALAL 5K9OA 4LVEA 4DP2X 1ZY9A 4DGWC 3GXFA 4NEHB 3MO1A 1TVHA 4Y9FA 2HJFA 5A6MA 3DBXB 1JZDC 5B3JF 1OB1A 1JPST 4PM1A 1CIUA 1LGVA 5F7WC 1UKQA 3WJMA 3MLWL 3SPCA 5A6LA 2LFGA 3B3BA 4QYOA 4ODHL 4PJHE 3HG1A 4FADA 1WA2X 3TO2B 3IE9A 1L0PA 4B41A 4Y88A 5GRUH 2VZVA 2J1WA 5LCVH 1TO5A 3JSSA 4PP1C 2EZ0D 2PTTA 2WNWA 4OV6F 1M71A 3U4BH 1H0DB 1YAIA 4BZ1L 3FB5B 3VFOB 1RLBA 3FT0A 4WEEA 3O11B 4ZSOB 3S35L 1DN0A 1XAKA 1G4RA 2KC0A 2DQDL 2DZEA 4XZ4A 1OHQA 3BAXA 4WY7H 3C2AL 5E7BA 4HKBB 1PIFA 3P40A 2BCKB 3G6JF 3GIZL 2NUPB 3KPMB 4PCYA 5JUEH 3MRJB 1E7VA 4PWFA 4N2CA 4KK9D 3WD5H 4PLJC 5PAZA 3ZHFA 3VNZA 2BZDA 4F1ZA 4JDEB 4AYBA 3TT1L 3FB6B 1KCSL 4C83B 1MY7A 4OSUH 3S7GA 2QKIA 4HK0A 4I77H 2ZSVB 4F5CE 2JE8A 2Q5BA 3AU1A 4ZSOE 2B8OT 1NGYA 3HC2A 1DBAH 3IDXH 3QCTL 5IHUH 5LB1A 4JCLA 4ZDHA 1Q94B 3EDDA 1A7NH 4P2RB 5C0CD 4JZJA 5D1XB 3I9GL 2WZPA 1X5HA 3RWFB 2N3JA 1AI1L 4F5CA 3BP6B 1MWAA 3GZKA 5JHDE 4ANXA 1AHWB 2GJPA 4G5ZH 4YSEA 4FFYL 2Y6SD 3K74B 4XHQA 3UEQA 1TTGA 4PGBA 3UYOD 3LXBA 1KELH 2FNWA 4GUOA 4M48H 3TA3C 2X89A 4ZMLA 1EQWA 2HFGH 3BSZH 3ETBF 5J9PB 1J7VR 4GRMB 3U9WA 3MBEB 3CMOL 1CD9B 3QO0A 2MJWA 4X7TB 5E8PB 1U92A 2XZZA 3HLAB 5EORL 2DM2A 5SWZD 4GI6A 2YSSB 4KV5F 4PJBB 1HWHB 2GG1A 2ATPB 2HKAA 3FB7B 4N2FA 1THAA 5AD0A 4HUWB 5LQBH 4NUGL 1MCOH 3NJNA 4PJFF 3SDAA 3V6BR 2APFA 4NYLB 5KVFL 1XDTT 4P9HL 4NYLA 3EHBD 4UM8B 4FTVD 2ZF8A 3QXDB 4KMQA 4QRRB 4JO4H 4Y4KB 2BLFA 2Y24A 1OARH 3P02A 5DJYB 5E8EA 3VSVA 1CR9H 4JGNA 1CFTA 1KZQA 2VR9A 1E6OL 1IIIA 3G6JA 1HK6A 2ADYA 3GC3A 3Q1SH 5D8JH 4HYTB 3BJ91 1GYAA 2I60L 2J8UB 3TF7C 3U6XA 1VEMA 3GXTA 2G2RB 3KGTA 3ECUA 1R5VB 5EEXA 1RZIA 5C3IA 1MI5E 3MUZ1 3OG4B 4LBEA 4XP5L 4U0QB 1NCAL 4LDLB 1O6SA 3QW9A 4YBQD 1WA1X 1MLCB 2NY2D 1T6BX 3GB7A 3ELAT 3H55A 4ONGH 1TVDA 1DQDH 1IFHL 1QAWA 2XX1A 1FIGL 5K9QI 4K9EL 3ZK0A 2IMNA 3B37A 1NGXA 1DYZA 2EUWA 2CO4A 3OB0H 4G8GD 3U2IA 4Y2OA 2Q6WB 1KJMB 3R8BB 2FEDD 5FKPA 2A74B 1K3ZA 4L8BA 4PJGA 3H2PA 3NH7L 4LLMB 2XTLA 3OSVA 1W80A 4PTTB 4N0RA 1AZCA 3BCDA 3OF6D 2WQSA 4X6EA 5E6ZA 3VXRB 2FWSA 1OZTG 2OXHB 1AKJB 1OP3H 2A4EA 2C9AA 4NLHA 3ULVD 4FLQA 2EH8L 3KPNB 3K6SB 3HG4A 2X2YA 5MEPA 4GPVA 3DMMB 3DJ9A 2C1OA 1OTUD 4N2DA 2WWMC 3TNNA 5IG7A 2EXYD 1IC5H 2DQTL 4AEHH 3CNKA 2P44B 1I1AD 3EBIA 2WP3O 4FKKA 4WFHD 4DHLA 3L3DB 1RJLB 3PJSB 3CX5K 2N56A 1ZGLB 2HSIA 1T4KB 2CHDA 4XOBA 1GMIA 1NWPA 1QBBA 3JT0A 5DRNB 1JERA 5J3HC 4FDWA 1L4IA 2I27N 1WUZA 4I18C 1IB5A 1XSKA 2ZCZA 4OF8A 1UXSB 4Z7AA 5IQ9B 1OW0A 4MRBA 4QXVA 5F7DA 5LWYL 1WHOA 4GUPA 3UEZA 5D1ZB 2JI1A 1KENH 3DHMA 1GZQA 4FABL 2VLKB 4ZFGH 4OD1H 1SFHA 4PD4K 3MODL 5ICYB 1HWGB 4RAUB 4FZEH 1DLFH 2AK4E 1MN4A 2WKOA 4Y16B 5EORH 1J0HA 3G08B 4NQCE 5CBAA 1FYTA 4OLUH 4JRYA 3LKQA 3OLDA 5GRUL 1CDHA 1WAAE 3WEXB 4AT6A 2WXMA 5HYJE 5IOKA 4V11A 3VA2C 1YNLH 5T1KB 3QCUH 3FFCE 3JV4A 3KPLB 5C6TL 1MCFA 1MFEL 2IPUK 4HOZA 5MERA 4ZFOA 1ODUA 4CVZA 5DHYB 1IAIM 2MHAB 1X5AA 5KSVB 3D39A 4R2GC 2CGYA 3C2AH 3NSYA 4X8GA 4E9XA 1T20B 1TZHB 4ZK8A 4YMPA 1KIUB 4NO2B 3WAJA 4NN7C 4X9YA 2E4TA 4PS4L 2XWCA 1WZAA 4NZTL 3MN8A 4PB0H 1UWGL 3S36L 3MV9D 4M03A 1D5ZB 2PO6B 2A74C 1BZ8A 1XB6A 3OHXB 2FT7A 1A65A 4N2AA 3RL2B 3IJEA 3CUPA 3ZYJA 1S3RA 4G7YH 4G2AA 3ESNA 1YEHL 3N1MC 4OCSH 4EI5B 5KEZA 1QLEB 4S1SL 4WEBH 5IFHH 2VAJA 3WN5B 4XWGH 1J5OL 1IAII 4LCUB 1PYWA 5FYLD 5E99L 1T0NB 4FJYA 4KTEL 4XXWA 4NDMB 1G9EA 3NEOA 2WZPD 2HLAB 5FO9A 4PRDB 2BOBB 5FXCH 2ZXCA 4MBRA 1AO7A 1R34A 2UY6B 3IGKA 4ZMYA 5DD6B 3FRPA 1BEYH 4JHZA 1I3UA 1KJVA 1NLBH 2P42B 5KYWA 3VI4E 3K2IA 4J27A 3TYFA 5LGJA 3H42H 4C58B 1IGYB 1N9PA 2QGBA 5EIIG 4QT5A 2ZXEB 4UM9A 3OKOA 2BSDA 5F1SA 2I9LA 4GIOA 1DEEB 4RDBA 4N0FA 5HHOE 4DK6A 4Z7UB 3K6OA 4YJZL 3FCTA 4YGVB 2FCBA 3LY6A 1QRND 2NDFA 5I16B 1U8LB 1QVOB 5EUKB 1UC6A 3P9MA 3NACL 5KVGL 4LEXL 1DBMH 1YJDH 3DPDA 1VCBC 4LSRL 2FJSA 3QDJA 1MAML 3MOQA 3MRRA 4WWKB 4MLIA 5D7IE 2ICEA 3GMRB 4I5BB 5EO9B 3WFDL 1KWKA 4X99A 1NSNL 2XX0A 1H15A 4KI1A 5BRPA 4HDIB 3MLSH 1DDHB 3L5XH 5MHSE 3TIDA 3ATBA 1OOWA 2EXWD 1SBBA 3QUYA 3KPRE 2OR8A 2AP2A 4AC2A 3SQRA 3ILPB 1NPJA 5ESQA 5FUCE 5LO7A 4R4NC 1BZQK 4Z6AT 2WN3A 3BYYA 4P3DB 3QJHA 1NJ9A 3FMGL 4JY5L 1AR1C 4PJ5D 4LF3B 2VZ1A 4DERA 4L1HA 3VFTB 1Q72L 5JO5A 3O41A 1MFEH 3SIKA 2HFEB 3FQWA 3KHQA 4HQQH 5D5MA 4L8CA 1GGIH 1TYRA 3IB4A 3LQMA 2DKUA 3B2MA 3VGGA 1ET8A 5C0FA 4PS3A 2XRAH 5C0IA 4UQDA 4XB8A 4X0KA 1S78D 5CWSB 5HHOD 3T77B 4UT9A 3PWJA 4HFUL 4FNUA 3HOGA 2ED6A 3WJMB 1KCLA 1SDDA 2D03H 4K8RC 4JB9L 5C0AA 2EC9T 1R6VA 2PWEA 4MD5B 2YWYA 3BKML 3QFGA 4FC3E 1I9RH 4ANKA 3MJ7A 4GQ9H 5KWYC 1UB6A 4ONOA 1YNTA 3AQXA 3N85H 2WBKA 3MLYH 2VDPH 4JM2C 4JRLA 2EDLA 1IGIH 3K4ZA 4YHKH 1HQRA 3CD4A 4WGWB 1MCJA 3MLVH 4HKZA 4KKPA 2PXYD 3JWOH 1JZIA 1SM3L 3C6LB 4HIXH 4HSAC 4NNPL 2QSVA 2WP3T 3HG3A 3P1VA 1KENL 4MMYA 4RCAA 2Z8VC 3T8MA 2JJVA 5JQ6L 1N6VA 4P5TC 4X6BB 3GJFH 1SOSA 4GSDL 5TQ2H 4N5UA 4DN4H 1AFVL 2HYMA 4KNQA 5IROC 32C2B 3MXWH 1BZ9B 5C07A 3VWJC 1J5CA 3P73B 3L9RB 1MRFL 3EJCA 3JQOB 3TPUB 3VFRB 4GKOA 4M00A 4K7PY 5BVPL 3ZJAA 2EDMA 4HGKC 2ZX7A 1MELA 1SLXA 3NJJA 1XGQB 4Q6YA 1NBZA 2JKWA 4MA1B 1KYDA 3BKYH 1ZK5A 5JW4M 1DJZA 3MOBH 1C7TA 5AVWB 3RP1A 3GEFA 2AHIA 1NA8A 5IUSA 2Q7YA 5I75B 3ZDZB 4OZGF 4ZUTA 3FO0L 1JHLH 4JQIL 5GSRA 4M1CC 4W93A 3WMSA 3QJFA 4LEOA 4MXQC 4NQCA 1N0LA 3FH8A 3DA0A 5F9DC 4L0YA 5CGYD 4ODVL 4PIRF 4S0TD 1RUQH 2VO8A 1D6VL 5F88A 2L3BA 5LBSA 5B38G 1B2WH 4KRNA 4OGAC 1AIZA 2KPNA 1TYJA 2A9DA 4DGIL 2D8KA 1JNNL 5D1QE 3QORD 2JJSA 4KPHH 2W9DH 3DWTA 4UBDD 2R0ZL 1PLAA 4LLAA 4XCCL 1YSOA 2J88L 3HKFA 5DMGD 3V52L 3BUTA 4AQ1B 3ISYA 4AQAA 3DX7B 3MRDB 3H7BB 2IPKB 2EQDA 2AI0H 2FATL 4JZOA 3EO1B 2FEJA 3DC0A 1DUZA 4PRAB 1LE5A 1JOIA 2YD5A 1F13A 2XZAH 3ILQC 3MX0A 4KXCA 1M7UA 1NOAA 2LTQB 3S5LA 1FWXA 4IJTA 1XGYH 3MRGA 7FABH 1IJ9A 1EJ8A 1GAFH 4L4TD 4TLUA 4X6DA 5D71H 1GGIL 4EUPA 5DI8B 3S88H 3REWB 3LVTA 3OWEA 2PCPB 4O58L 2ALWA 4P2OA 3WLWC 4PY7A 1RJYA 4NB7A 5CP3A 2WNKA 3ZKXC 1T5XA 1P6FA 2NNXA 5L0QC 2G9HB 2ZWNA 4JVUA 4FXLA 4LU5L 2DWYA 3BRDA 4APQB 2DAVA 4LARH 1WTLA 2ISDA 4YXLL 5E1IA 1I8AA 4Z7WB 2ZWLT 5TF1L 1NIAA 2F53D 1ASQA 4UTAH 1HL9A 5KSVA 1Z3RA 3CMGA 4JE4B 5BV7L 2OM5A 4A63A 1J05A 3QFDA 2WLMA 5TF0A 3CSFA 5AW5B 3SYAA 4AMXA 4JQXA 2BHUA 5H94B 3F7LA 5IQ7H 4AWJC 1AXTH 2CKBA 2GJRA 3ZDYE 1GZPA 5DFVC 4F1SA 1IBDA 1SYVA 5LAPA 3ARPA 5K93A 4YUEL 1ZWIB 2QDWA 4XTRC 5JPMC 3PIQA 3ARBA 4QI3A 5IG7B 1CDIA 2BVQA 4AL8L 2R69H 4XMZA 5E0QA 3TBSA 5IB4A 1HINL 2CDGA 4PHZA 3VD9A 4PJ7B 1PG7H 4JPQA 1HT6A 1KXTB 4R7LA 2JLPA 3L3JB 1KNOB 3D07A 1MW1A 2XTJB 1MLBA 5TDOA 1LO3H 2F5BH 4RGMB 3O2DH 1D2PA 4KOBA 3S5ZA 2BNRB 4ZUVA 2QJDA 3FT4B 3ZQXA 5K33A 4RISL 4Z76A 2XQYG 4PR5B 3HS9A 1S8DA 3MA7A 2BXYA 2GVYA 4LCWB 2EE0A 4RGNE 3L95A 5IMKA 1G9HA 1V7ML 1ZLUK 3FOLA 4HETA 5DJ6A 1BZ7B 4X4XB 1P4LA 3WY4A 1IKOP 2FT6A 4UQ9A 2WQRA 5IW3A 1D6VH 1S6NA 3LNDA 3CHQA 4XCYA 3EJUA 4YPGA 3CN4A 3BUYB 4LBEB 4BE6A 3FFDA 3QJUB 4LESA 2OYMA 4HS3B 4AE0A 2IBGA 1U3HB 2JIXB 3NJVA 2VDPL 4LL9A 4AGPA 1YRKA 2ZONA 3GMMA 4IRZL 2VXTH 2YKKA 4HVBA 1VJSA 2BP0A 2K6ZA 2XN9E 2E7HA 2WTRB 3D52A 4QRPB 4W9KC 4X83A 3VXNB 3KH4A 4Q74A 4WU5A 4CDHA 5EC2B 3V4LA 1AHKA 2HUEA 4JQVA 5J3HD 2UZYB 4UQ3A 1CQYA 2YUWA 5LAXA 3WHXB 1BGXH 4FQJH 5TGBA 3BLPX 1H0DA 1ZLEA 4ODHH 4EBQH 2FBJH 3I3EA 2B20A 2BHYA 4I9XA 4J8RB 3QPQD 4DOHB 1XGPB 3QXWA 3BH8B 1FZOB 1PDKB 3FU5A 3C6LC 4L18A 1QLRA 4H8HA 3ZO0A 1J8HB 2YA0A 4N5ED 2K6WA 1AY1H 5DHXB 5HYFA 43C9A 4UU9B 4UU9A 3D2UD 2AAVA 2VXUL 4A37A 1JK8A 2YD1A 1HKLL 4FQXD 4FULA 4XVTL 3GSXB 3DRTB 4HSCX 4ZUUB 1EEUA 5K39B 4KNSA 1ES0A 3JUYA 2BRQA 3LZNA 1OPGL 3TONA 5C0NC 3MGOB 1VEOA 1QBAA 3O6FC 5GS2H 3VTMA 3MCYA 1T5KA 4JPWL 4MA3B 4PS7A 2EADA 5FW7A 4PV8A 5CJOH 4MAYA 1AXTL 5CLXA 1ZHNB 4MJ2A 2OMZB 1DBAL 1VLXA 3QCTH 5IM7A 5IKCA 3RWDB 3FO2B 1MG3C 4NQXB 3IDIA 3OC5A 2Z65C 3CPUA 3X3FL 2Y5QA 5MENE 2YMOA 3GMMB 3V52H 4AX3A 4E36A 5TE6H 4BZYA 2H1PH 1WZLA 3UJIH 3IKCA 2ZXBA 1JWMB 1G7IB 2K7PA 2C3VB 3V2AR 2GJ6D 5F0PB 4KVCH 3QUZA 4B7LA 2IFFH 3V0AC 4W70A 4EF3A 1H3VA 4X9GA 3N2JA 5FWQA 4XCFL 3NA4A 4CBPA 4MNQA 3CU7A 1KIPB 4G8IA 1S3KL 4YHNB 5G55A 3CHXA 5D1QC 3T0AA 4TVPD 3DV4A 1CPUA 3SE8L 3KWTA 1TMQA 1MCPL 5IMLA 1R3KA 1C5CH 5JHMA 2DBLH 3K6DA 3PG2A 4K23L 4YBLB 1KIRB 4OZIF 1IGCL 4Z3HA 2R1XB 2YQ2A 4LU5H 1J8HD 1BXUA 2CRZA 3U30C 4L1SA 3V4PB 3HAEH 1YAZA 5GS1B 1A8JH 3TVMB 3PWPE 1OKEA 3E6FB 4XI5D 1EHAA 1NEUA 3HZYA 4P4KC 5AVRB 4ABVA 4UTAL 5SX5K 5F9AC 2BFVL 2LABA 2K78A 3TCXA 1T4WA 4AM0A 4G6FD 1U95B 4KKBC 4I0PD 2A1WH 4OJDH 3NIGB 1WBYB 5CJ5A 1G9MC 2IOIA 4WF7A 1I75A 2BO0A 1KLGA 4S1RL 2DQ6A 2CUHA 3DRTA 3B7UX 4D8OA 2H8PB 5E5UB 4UAOC 4WFED 4U1HB 4LVHC 5GJSL 1MAJA 3KPOB 2F53A 3BAEL 5DVNA 3L1OH 1R3HB 1FNLA 3ECQA 1EA9C 3X3GH 4B0MB 1G0YR 2XPGA 2AF2A 1VIWA 1A7QH 5AVQB 3QEQA 3WS6C 1A14H 1P7KB 4M9OA 3OZKA 2BWQA 3HBPA 1PG7L 1V3LA 5I66B 1HS6A 4GXUN 3QC5X 2IWKA 2PTUA 5GPRA 4PLJD 3CVHL 2ZX6A 3LTVA 5J0BA 4NQDA 3NPZB 3MNZB 3GYRA 4N5EC 3VMOA 1YEGH 3UPAA 3V5KB 5T3XE 2XG4A 3KGSA 3CXHK 4HA1A 4ISVA 5J6HB 1G5GA 4NP9A 1IL1B 5IMMA 1WFNA 4XVSL 4BEIA 3DOIA 4OQ1A 4WQOA 4XBMA 2ORBH 4EUPB 6FABL 2EDNA 4V2BA 4W9LC 1FNFA 3BHBA 5HHOA 5SWZB 5C71A 3VRJA 4D3CH 1RPUA 4EIZC 1SUJA 1C8PA 5E6UB 1QSEB 3P3TA 1JGEB 1KCUH 1KMGA 2YD3A 4XODA 3TX4A 2EECA 1A7OH 4BXSV 2NY7H 2JI3A 3PHQA 4LNRB 3F12B 3QCVH 5ITFA 3N0PB 4LSDA 5ILTL 3SCMB 2OMBA 2R9HC 2I5YL 3ULUC 1KF9B 1UEMA 1ZEAH 3V5DA 2O5ZH 3MRMB 4NKOA 1AS6A 4UNTA 1S7RA 1N5AA 4HXAL 2WXOA 1MW3A 2BP3A 5B3JE 3VFVA 4P2OC 3CLFH 3QDME 3BN3B 1C5DB 5TPWH 3MODH 5F96H 4KMLB 4LAJH 4H5SB 3L7FB 1GRWA 2NW2A 4FQXA 3RWEA 4EE2A 4WI0A 3GWJA 3FNKA 3G5ZB 4PG2A 3WMQA 2R4RL 1LNUB 3D2UA 4UINL 3AS3A 3GT6A 2J2ZB 3BPOC 3C5XA 4JFDA 1W91A 4K3JH 2VDKH 5IESL 4BSJA 3U30B 4K23H 1EZSA 1ETA1 2HLEB 3UMNA 4KZ0A 2DI9A 3ZUNC 3NCYS 4MJIA 4F92B 5EIIB 1MDAA 5DEFB 5E9AA 4TYUA 1S9XA 5EB9A 5AD0B 1UCBL 4OLZH 5JR1H 4KU1A 1ZHLB 1J0YA 1DFBL 3UYPA 3HRZA 2W07B 1MUJB 5JXAL 2P3YA 1KN4L 1U3ZA 2PCYA 1A4KB 2X9XA 3FO1A 3H54A 5G2NA 5A6IA 3BPCB 4NXKA 1PEWA 3GLZA 3E80A 1SDYA 3SJVA 5EEVA 3TYGH 4XC1H 1G1YA 5DK3A 5JQHC 1R47A 5EG6C 5F3BA 1SJHB 1QEWA 1EAQA 2EXTA 3ML8A 4GXUM 1VKXB 1WFIA 2PW1A 3BP6A 4DQOH 1LO0H 1A6ZA 1YEHH 3FW6A 4H26A 4OCSL 3UFIA 3CAFA 3X14A 4EDWL 4AGOA 3O4OC 5BOJA 1IBZA 1M9SA 1LO5B 1T5WA 2A4CA 3KYOB 4BELD 5J13C 5D7LE 2Y7OA 3S36X 4HG4J 3GMQB 3LQZA 3JVGC 1A22B 3ARGD 1GL4B 2XICA 4JG0L 1A4BA 3T2NH 2MEJB 1N26A 1AG6A 3DDGA 2OP4L 3GJFA 3NVQA 3PWJB 4W6XB 2J5LB 1E30A 3AMLA 3V4VB 4JO3L 3KBFA 3DX0A 3ILQD 2AJVH 2DEXX 1CGYA 4MNGB 1R24B 4BFEA 1RMFH 1JVKA 3O0RH 4TULL 1AZNA 1BG9A 1YC7A 3QJXA 4NSKA 2BM3A 3VYPA 5DFWH 3GTVA 2F19L 2LT9A 3FB5A 3PHAA 2Z7YA 2CCWA 5E8OB 2YEZB 1DTUA 3WIHA 2X4UA 5BVJB 2Y3AA 5CINH 1O9WA 2C9SA 4WI2A 5D70H 4MCYA 5JHLH 1L7IL 5CLWA 1MVYA 3VDBA 5E24E 1NCDH 4LIQL 4NKDA 5FYJD 2A1WL 1MAMH 7PAZA 3PP4H 4G1EA 1BBDL 3L3OA 5JTWA 2EIKB 4GRWE 4JPIA 2DI7A 1EX0A 1NSNH 3TNMA 1WITA 3DK2A 1KB9J 4OB5L 1EAOA 4HJ1A 4XXCA 4Y5XA 5D2NE 3ZZ1A 1GGYA 5LDUA 1M7XA 3LIZH 3PWVB 1WZMA 4YDJA 4NIYE 1G84A 2P5PA 3HPJB 3TZVB 3X3GL 5BS0A 4ABQA 3X14B 3MV7B 2CE6A 2FBRA 1NBZB 2BSRA 4TMPA 1Q9LB 1H3PL 1SXBA 1PGRB 1YHPA 2MNWA 3P0VL 3BESR 3FMGH 1L9TA 4JY5H 4L8SB 3TEYA 3ZKMC 1J87A 1UQSB 2LGNA 3FQTA 3GRWH 1BLIA 3IGFA 4JREC 4KUCD 4XC3L 4XVOA 3DSFH 1EXHA 4MRCA 1FH2A 4F3FB 3FONB 3GBEA 4TVSa 3AWGA 3H85A 3LQZB 4NQTA 3ZIMA 2G2PA 1J1XL 3QARA 4GI9A 3FJTA 4Z7OB 1ZV9A 1LILA 1UGNA 1YNKL 3CTTA 2NNAB 5DGQA 3FUMA 3JZYA 4ZUWA 1HILA 4XPAL 5I73B 3QDJB 2IWGA 1ZTXE 1KT2A 1G9ML 1Z3GH 3QJQB 5D6DC 5AAMC 3TJEL 1E4XL 4I0PB 4IBQA 2WVSA 5DCCA 5ESVA 1BWMA 4BFRA 3KWWB 4PJ5B 4E41B 1J0ZA 2OQJB 2ZYHA 3EBHA 5LCVA 4NDMA 3J2PA 3TYGL 3ZL2A 3RWCB 3VFPA 2XG5B 4YGVA 1T89C 4OIIL 2EVGA 3QUZC 2XYBA 4RWHA 3QG7L 4XP9L 2FX7H 5D2NC 2CLVB 4PJ8D 2ZG2A 5I8CB 5IQ9A 1EH9A 2R29H 3MKGA 4GEIA 2G75A 1MWAL 1CLVA 5D4IA 1SM3H 1BAFH 1QTPA 1TNNA 1F90H 3T4YA 3VRIB 3WY1A 4B9IA 2VYRE 4L5FE 3A24A 3VGEA 2HTLC 3ARGC 1Q9KB 3K4AA 3KH3A 4Y16D 2G3ZA 1PLGL 4NKIH 2K8MA 4K5NA 1MQKH 1F18A 3CZEA 1CD1A 5CGMA 2PWGA 1FH5H 4L1BA 3UZVB 4UINH 3PXJA 3VYOA 4KAQL 2HT2D 1GA2A 5A2BA 4RRPM 2OSWA 3IDMA 1F00I 4TUJB 3ZMRA 1R5WB 1X7TA 3GJFB 4EMZA 4JG5A 2ITCB 4DWHA 4YAQA 4OZFA 3S3BB 2E9GA 3NRQA 2V8MA 4G72B 4ICXA 3NCWA 4MD4B 3M17A 1A25A 1UWEL 1SJVA 3CZLA 4BA0A 4WWKC 2X3BA 3FQXA 2EDXA 4X2UA 3QDMD 2WQWA 1I85C 1DQLH 4W9HC 1H5BB 4EIGB 4MAUH 4BHUI 3S8FB 2CR3A 4HJTA 5D2LB 3ARFC 1RUKH 2R23B 3IN0A 2WZ5A 4YBLC 3IMWA 3D85B 3VMNA 1A6VL 4GO6B 5CJQL 1TQBC 3OR6A 4HX1B 2V9TA 2VLJD 4P59H 1LP9A 4NO5B 1LYQA 3G6DH 2XOTA 4OCNC 1I8UA 3V0WL 3VB8A 5AYUH 5JDSB 3HFMH 3MVSA 3V9FA 3VXRD 4Z1PA 2PYFA 2HG0A 1PZ5A 1U9KA 3WTYA 1SXNA 5A3ID 3REVB 3PS6A 2Y7QB 3WIAA 4WWOA 4ZI8A 2CBQA 5L88H 3PE9A 2MTAA 1ML0A 1CI5A 3ZT6A 3KBHE 5CKGA 5CCKH 3Q01A 4G8GB 3RIFF 2OZ4A 4PMFA 4OKVB 4JL2A 1HNYA 3IJ8A 1A1MB 2DB8A 2UY6A 5ABZA 1HEZB 5LXGL 4F15B 2XACC 3NEEA 3KXFD 4KKLC 3T0BA 4W4NA 1JGDA 1E3FA 2R2EB 2BNQB 3L3KA 2D7PA 2AKRB 4QRAA 5I6NA 3I9GH 1AQHA 1QI3A 4WI0B 4BCXA 5EZPA 1XXFC 5HDQL 4X6EB 3VXRA 2MMXA 2P48B 3IDUA 2CK0L 1MH5B 1RIVH 3W38A 5CIPH 5FR3A 3BDYL 4TQHA 3RWEB 3O9WD 3RL2A 1O5DT 3FTVA 2FR4A 4X5WB 3N04A 5FKPB 4YXKL 2HVJA 3QEUA 3V10A 2B1OA 1VZHA 2PR9A 4JFOB 4E0RB 5DFTA 2OJ1A 5F9JB 2GBAA 1T04A 4L2LA 2QVKA 5BJTB 4XH2A 1NGWA 2AMGA 2VXSL 2Z8WC 1JZ5A 1GZHC 1Z9LA 4LIQH 3X1EA 3S5LG 3BW9B 4U3SB 3CXDL 2EILB 3QIUB 5EIVA 3OGCA 3IJSA 2W94A 4KFZC 3MLZL 4MNQD 4XVJL 5C2BL 3WFEH 2OR9L 3CU1A 4BH7B 2Y22A 3L9BA 4LCWD 1CGSH 5DJAB 5FHBL 3AMKA 4P57B 4IBUA 2WQXA 3WE1A 3MNWA 2W60A 4AQEB 5D1XC 5ANMA 1F6LL 3NJGA 5FCUH 3G3LA 1AE6L 5I1CH 5HDBE 4AL8H 2HPTA 1IO4C 1WD8A 3CFKA 3Q1SL 4JMXA 1HQ4B 5I74C 1ED3A 5BRZB 4OCRL 3CQFA 4UIKH 4PJIF 4IRSA 4K94L 2WC7A 3HE7C 1HESA 3BUIA 5I30L 1AHMA 1SN5A 1UWEH 1XGRA 2FQEA 3D69A 1S5HB 3HI6H 1ES0B 4LPWA 3VA6A 5JW5B 1A6TB 1NCAH 4OW6A 3ROOA 3BEVA 2B4CL 4WEUD 1WK0A 1I82A 1NAMA 4E9QA 2DWTA 2GJJA 1FLRH 2F7IA 2NTFA 2VR5A 2YAOA 4IOIB 4QOKE 2X4OA 4JJ5A 3EDEA 2CNYA 3B6SB 4JM2A 2FL5B 3X1BA 3MFGB 1Y6NR 3KW7A 2VN6A 1KV7A 4JHAL 2BINA 3X17A 3LRLA 1UZ8A 2XN1A 4NO0D 5F9OL 3FB8A 3BN9C 3D39D 1X5KA 1FHNA 2VITB 2XWBA 2X4RB 4W9FC 5F9WC 5HHXL 2F53B 4ZMVA 2AK1H 4BFFA 5MI0C 3FN3A 1EO7A 4TUKH 1A2YB 4Y5VA 3O0LA 4LKXA 5IUCA 2YAMA 5AKSA 4PMEA 5LAXB 2UZYA 3LEYH 4I0CC 3LZQA 3QS3A 5DA4A 2BP5M 3ZL1A 3K91A 1T66C 3KEDA 3JWNG 2D4DA 5IBLC 4KROC 4HEPG 3FB6A 2EC9U 1MI5B 2ZAGA 5B3NA 1R3KB 2HMID 2EYTA 3JBG7 2W0PA 4HZLA 1EHKB 1RURH 3B56A 4HCRH 1KIRA 4N1CA 2X2JA 4KDTC 2EABA 2J4WL 3LS4L 3QRBA 4G7VH 4MTMA 4YSOA 2YAQA 2FEDC 4L8DA 2YLKA 1TUPA 2J56A 2YK1L 3WFHA 4RX4A 4PWJA 3SE9L 3WFHB 2Q0ZX 3FSAA 5ICZB 4B53A 1YNTB 4X8JA 3L2NA 2VERA 5KS9F 1NKGA 1WWWX 3FU0A 4V1DD 5FOBA 4Y5XC 1RSYA 7PCYA 5BO0D 3EIFA 2WXHA 2FR4B 4JFED 4NZJA 1U91A 5L0QB 1BVOA 4JM2F 4RFNC 4P8QA 4L5FH 5EA0H 5F97E 4ELDA 3C09C 4N4YB 4OM1H 1QFUL 3JTBA 1KN2L 3A4FA 1BF5A 4KITB 1VPOL 3T77A 3DBXA 3OKEB 2UXGA 1I1AC 3LZFL 4Q9CA 1KXTA 3GIZH 1ETZA 2IALB 4TQPA 4E2OA 1KY6A 4AH2B 3NZ8B 2AJ3A 4H88L 1M4KA 4G7RB 1QACA 2O26U 5D1XD 2VIRA 2VWEC 3QK0A 4H2CA 5HDLA 1WT5C 4HBCL 2O5XH 4YDKL 2IH8A 2X4RA 3TU6A 4ETYA 5FO8A 3FT9A 3ET9F 4N90E 3UC2A 1RPQA 5LHDA 5IHUL 4FYQA 1DVSA 1E8WA 1MJUL 2VE6B 4OF6A 4FFZA 5FW6A 4ZODA 3P4MB 1CLOL 1XSJA 2ITDA 2XNAA 5I0XA 2Q7AA 2Y7LA 2ILLA 4R3SA 1MKFA 5DUPL 5EBMB 4DZ8A 5FB8B 3NZSA 3OF6A 2MOVA 4YZWA 1RI8A 4MAYC 4CBZA 3H1ZA 1UZ6F 1A4JA 3SE8H 3SE3A 4U4IA 3D69B 3QI9B 4Y19B 3BSGA 2GUOA 1AQMA 1OAYL 2PXYB 4PJ7F 2FO1A 2ICES 2N1KA 3EO9L 5D96B 2GFBB 3U7WL 4EUPG 1KJ3H 3MXVH 2FJFB 4U7KA 4QXGL 4FG4A 1SMDA 1BX2B 5LCVL 2CKBB 2EIZB 3KXFE 5DQ9A 3BP4A 4NKMB 1FFRA 1XR9B 3B5HA 5DYFA 3U4BL 4D9LH 2PYEA 4ONFL 5LN8A 5I75C 1U8NA 1KYOJ 4MD4A 2C4FU 1TU2A 3TFBA 2XBDA 5DWPA 4IMLA 3BUYA 4KK6C 3N06B 4QRUA 3WFEL 4DO4A 3ORJA 1YQVL 2DQCH 2XWJB 4X4MA 4LZKA 4HS3A 3OKNA 4UWQB 3P9LB 2Z34A 1DN0B 3U46B 1A3LH 4NM8H 4FOMA 2K1MA 2A6KB 1XF5B 3MRHA 4WFHE 3FZUD 1DLHA 2AEQH 1BZEA 3ELQA 4LSVL 1XH1A 4KTYA 1DFXA 9PCYA 3GUTB 3NACH 5KVGH 1QWHA 2QQLH 5KSBB 3IJHA 2DN7A 2PN5A 3GSOA 5CXPA 1DHKA 2AK4A 2ROYA 2JELH 4GW1B 4IIQA 3FT4A 2YOAA 3ZW3A 3CVHH 3CPLB 3G5VA 5BCAA 3SPJA 3L4TA 1AI1H 2F54A 2I7OA 2YPLA 3CSGA 5DEGA 2BNUB 2Y6SC 5I0WA 1K9TA 4HMEA 5B38A 2A83B 4YSSA 1N0XH 3N50A 3OJDA 4KOCA 5E5RB 2MCPL 4OZHF 3EYQC 3MYJA 2MFNA 5E1GA 2NX5E 3V55A 3ABZA 1PG7W 4JLRB 3MV01 2A77H 5KBMA 4FX5A 4HAGA 4K8RD 4PJXE 5EFIB 3V6OE 2WIMA 1D9KD 4BWTA 2CG9X 4AK2A 4JM2D 4Q6IB 4O02L 3ARVA 2JKXA 2IH1A 3L3HA 4DKEL 5IHZA 3PWNA 1P84J 3PWNB 4HALA 4TUKL 4EQ2A 1U8NB 1UACL 2I5YH 5KVFH 1IC5L 1R19A 1SOXA 4LPYA 3I6KA 4L9LC 1FL3A 1YPZE 3BPNB 3ES6A 3UBXI 5JMOC 5E6YA 3BP4B 1ZS2A 2IMMA 2P49B 3G5WA 1J0JA 4HOMA 2WLKA 2ARJB 3I3BA 3KLSA 1OOAA 3W57A 3FSZA 2OXGB 2VQ1A 3RVUD 2EYSB 2VWEE 4P5TD 4DK5A 5IMOB 4R4FH 1EZLA 1YMMB 2J5LC 3UERA 3KL0A 1MNUL 3TIEA 1OCCB 1B0RA 3BQUA 7CGTA 3FSOA 1NOLA 3PPSA 4RGOL 3T0ED 1DZ0A 4NS0A 4B9YA 3ZYOA 1SF3A 1I3RA 2KDGA 3D2TA 3ESOA 4IMKC 4KI5F 5C70A 3GO1L 4LRNL 4K9JA 4OIBA 5F7DB 3UTTA 2V9RA 3ARED 1BAGA 4KJPC 1DJHA 1KJ2H 2XY2A 3NYKA 4QHUB 2X1QA 4P5RA 4B9JA 4EQ3A 4TXVB 4OTXL 4MXQD 1CZ8H 4HUVA 4J39A 2VDRL 1E28B 2EO1A 2C9UA 3B9KC 4TUJA 4XNQB 5EU4B 4XN1A 1DBKL 4U6TA 3II1A 2OJZH 3ULSB 4YS4A 3UGEA 3ZE2F 2CCLA 3EO0B 1NEPA 1UG9A 4L5FL 5E7FA 2Z31C 1MCQA 1N68A 3F7YB 4HJIA 4ZOAA 1T0MB 4FG6D 4RFNB 4TQIA 2IGFL 4XRCA 5B7EA 5H37A 5A7BA 1YN7A 5FWRA 5JIIA 3FN0H 5FYJH 4NO0B 3JYCA 4RZCB 2ENYA 4WFGE 1KJ2A 3DRQA 2GTQA 3UCRA 4M93C 3ATAA 2ZYSA 4NQED 3T1FA 1B9KA 3AT9A 4JN1L 3WFBL 5L4FA 3C87A 3RWGA 1R17A 5IVZB 3U6RA 2UYLB 1NC2A 1KTCA 4NRXA 4ZYKB 3QYCA 4JFHD 4CKVX 3FTGB 1HIML 3MRRB 1T83A 2P7TB 3GK8L 4E41E 4MJ5A 1ET7A 1GKOA 4LCYB 4HWZB 4M4PA 2IDTA 5DT1H 2R0ZH 4HGWB 1G6VK 2WANA 5E6SB 5IWLA 1NOFA 4PWHA 1YEIL 1JWMA 1T7ZA 4RMSA 5EU6D 5EU5A 5BRZD 1XIWD 2KZ1B 1JWUB 2I9TA 1CTMA 1KCVH 3RTQA 3CH8A 1RPKA 3MBWB 4Y19E 5J11C 1JN6B 4XBGB 5BZWB 1IBYA 2H41A 2NY3B 2V17L 5D2LF 1N70A 4FE9A 1LEIA 32C2A 1EHLL 1C16B 4YWGL 1FG2A 3RWDA 3O3EB 4LDOB 3BZEA 2WBXA 2GK0A 2JV6A 2QGEA 2XFXB 3COOA 5FAAA 1HCVA 2Y07L 2J43A 1GAFL 3A4EA 1TCRB 5C0AE 3SKOB 4CU7A 5IT2L 3QQ4B 3R1GH 2QQKH 2C3XA 2FHCA 5EO0A 2A6IA 1UACH 1N7ML 5CGYC 5DJ2B 4P07A 5FYKU 1I1YA 2X7LB 1NDMB 4BZ2L 1HSBB 4PRBB 4MJIE 2VISA 2VZTA 1IGTB 4HAFA 4KX8A 2P5ED 2NY4C 4NQEE 2QLYA 4LARL 1RERA 3LKNB 3D0VB 3FSVA 2EKSA 2G3XA 4NO0A 1E7UA 5HGBB 4DNLA 1S7TA 4IGBC 5IB2B 4Q9RH 1S7TB 3T3MB 1FO0L 1P4IH 3GIVA 1A6AA 4HISA 1DVFC 3ZE0B 2BNQE 3CFEA 1PAMA 2UVFA 1DJSA 4NI3A 4NOFA 4CSSA 3QDGB 3HFFA 4NENA 1DSYA 5DUBA 3GSNL 5TDNB 3V4VL 2OI9C 1R24A 5I82A 3Q2VA 4BFIB 1Z5LA 4MDJA 3EJQA 2JH2A 2NY2B 3UOAB 3U0TA 2JJTC 2RQ8A 1CQKA 3CVDA 5FGCE 1JYWA 4G8FB 1XCQB 4JFXA 2WY3B 4Y4FB 1XZ0A 5J8OA 1FV1B 3K72B 1J1XH 3PV6B 1UZGA 3NABH 5EPMB 2YRZA 4OLXL 5F7BA 2WXRA 3D39B 1PYWB 1QSFD 3B9KD 3F01A 1HINH 4KNUA 4JE0A 3BWSA 3WXWL 2G5BB 1AYRA 1QFOA 2ITEA 2Y2TA 4WV1C 4P3CL 3KW8A 4XHJC 4QF1B 2BIHA 2YXVA 1EUTA 1BCIA 5DXWA 2NYKA 4AW7A 2IBZY 3L81A 4ORGB 2K8QA 2VLJB 5SWSD 5FYJL 4XX5A 5KBKA 1IILE 2K70A 3UABA 1DQMH 1FBIL 1B4LA 3OXSB 3TBTB 1Z32X 4QR7A 2RHEA 5E2VL 4BFOA 1TITA 4LIQE 2PCFA 2B0SH 2LLNA 1DSWA 1MRCL 2AJUH 5KUKA 4LSRH 5CZRA 1Q4NX 5C0ND 1MCWW 3FHAA 1ZDQA 2P4AB 1F58H 3BFQG 3JYBA 1YEIH 1UM4H 1U36A 5EOCH 4KKNA 1VACA 4IS6B 1U3YA 3DHJA 5FGBC 1O6TA 1OSYA 1MCDA 4RGNC 4JY4B 5HGHA 2WXJA 3CIQA 4DPBX 1T1WB 4JAMA 2AABL 3CFNA 4JQXC 1RK1A 4YK4C 3TBWA 1BQLL 1GZPB 3EXJA 2YGNA 5TQ0L 4GG6B 1E5BA 1OAUH 3VFMB 4KY2A 3ARGA 2HCZX 2Z0UA 4E68A 3OMNB 1IT9L 5E5MB 1A64A 5C0GA 1EFQA 1EFXB 3ZTNH 3JV6A 3KGRA 3BXNB 1C5DA 4M61B 1QFWI 3MPCA 5KSBF 3CVBA 5IBLD 4ZS6D 2WUBH 1P5UA 4KKRA 3U9UA 1MCWM 3B9EA 1WWBX 4MA7L 2F53E 4YEEA 3SPGA 2FHFA 3GB7B 3RGBA 1RUQL 3EDJA 3MRCB 1A1NB 4CA4A 3EFFB 5EWIL 4HPYH 1OF0A 2QGCA 3KPNA 3K6SA 4TNEA 2B08A 2WOBA 1R46A 1BLNB 1JK9B 2FQGA 4FFVD 4TLKA 5L4IA 4GIAA 4KHTH 3DXAE 4YHZH 3OX8B 3NJIA 3QUYD 1IGIL 4YLQT 8CGTA 4N0UE 3H2WA 2V37A 2Y23A 4N8VB 5AOJA 1ZV2A 2OCCB 3C5ZC 3QNYA 4H8WL 4ES8A 4BDVB 3D9AH 3E9UA 4KKCC 3LKRB 3MLTB 3ZYIA 2DLFL 1VAHA 3AM8A 3MLRH 4FP8H 1SN0A 1WBZB 1RJZB 4G8EB 4DN4L 3UTSE 2W0LA 2YD4A 1REIA 1QHQA 3LEVH 4K3EL 3MXWL 1HHGB 5E9NA 1XGTB 4OCYL 4L9LA 1T1XA 5E8NB 5E2TL 5HYJA 1QG3A 3VRIA 3QO1A 1Q38A 1VACB 3RFZB 2B1HH 2MQ3A 2XWRA 3EYUH 3F2LA 1OALA 4DZ8B 1RIHH 5KG9A 4XAKE 2G3NA 3EJJX 3GHBH 1VGKB 2Q20A 1PAZA 3AG4B 3FU7B 2BY3A 3TTSA 4HSQA 6TAAA 4X5PA 3FYIB 4HWNA 2EDFA 4YVUA 2WVUA 3MZGB 4K3DH 5E2VH 1XGPA 3FPYA 5AW1B 1F2XK 4PRPD 2BOCA 4XMXA 2B0SL 2VGLM 4YOKA 9CGTA 1UHVA 1B6UA 3AC0A 2BHZA 3OKYA 3QQ3B 1VFBA 4Y4HB 1S7SA 1KEGL 4JFZL 2G5RA 1CF8L 4RAVB 1FRGL 4ORGA 1JXJA 2X4QB 3AXHA 2DLEA 4XB3A 1PKQA 2GTWA 4L37A 1H5BA 3NAAH 4F8TA 5ES4B 4KH9A 3Q8EA 3B9KA 3R18A 3NN8B 1QSFA 1FCGA 2BXZA 2YSSA 4UV7L 2Y1YA 3B8YA 3SSGA 3MACH 4WFEE 4LVOB 1JZ3A 5MEOB 3HTLX 1WO2A 5EPMA 2H7WA 1JRHL 1WC7A 2CDEB 2ZUWA 3QISA 2TSAA 5LLIC 3IGLA 5DQ9B 4MMYB 1F4YH 2BCKA 4Z0XA 3TBBA 1BEXA 2H3KA 2OW6A 2A7BA 2Q9OA 2AXGB 3FOMA 1V55B 1JPGB 2XZAL 4AYFA 2DLGA 5HHPA 3TH2T 5JOPE 1H9DA 3EYOB 1BD2D 3EYOA 1G6RB 4KC3B 2QKIC 1ZJAA 3WO4C 3MA9H 2JCCE 2X5PA 3MJ7B 4C56A 2WZAA 3EDFA 3IWUA 4O58H 4J12A 4PR5A 3WFCH 4HWEH 1P6AB 3ZKND 2A9AA 1IM9B 5F7FA 1HEHC 3GD1C 3CLWA 1OTUC 5JHLA 3LOWA 1JTOA 4PJGE 2WAHA 1PZSA 1ND0A 2Y1AA 2O6EA 2ORBL 1NWOA 4ZUSB 5AAWA 4P2QD 2P46B 3QFJB 1E6OH 1FVDB 3CLEL 4XP4H 1QZNA 1P4UA 2PWDA 2VISB 4BSVB 4YE0A 4UNUA 4URTB 2MNUA 4AZ8A 1CGVA 3FFCA 4WLCA 3NSCA 3PF2A 1I85A 2NNFA 4G80A 1IM3B 5DVLA 1KTLB 5F7MC 4GSQA 3I6LE 2CBPA 2DLFH 1TQCC 3MLRL 1TQCB 2XYCA 3UJTH 4E9SA 5HHQA 4M62L 3W2DH 2XJLA 3B6SA 4YL4A 1VADB 2YK1H 1U33A 1JFQH 1XD0A 1FPTH 1ZLWK 1MHPL 4QRSA 1FA4A 5C0AD 3QSKB 4PGBB 1AGEA 3LD8C 2ZUUA 3K1DA 2P8MA 2GITB 3WELA 4PYGA 4KJPD 3H4FA 2IPTL 1EMTH 4J8RA 4I9WD 2Y36L 3KBEA 3CH1A 3NH7H 4YNYA 1U21A 3CV5A 12E8L 3QDGE 2QADD 4ELKB 4JPKL 3IS1X 1GR7A 1AGBB 2QFRA 2PABA 1F4AA 1NH6A 1TNMA 3KR3L 3REWA 1AACA 1OGAD 2IAMA 1MHHB 5TDPA 2H9GA 3S96B 1Z0MA 4UMSA 2YZ1A 3VXPB 1O0VA 4AQEA 4OV5A 1IE4A 4WIQA 2OSYA 4GG6E 1FRGH 3AGVA 4N2HA 3QRGH 2AEIT 1QFWH 2ZCKL 1X5JA 2FECL 3OR7A 4OLWL 3UAFA 3WJJA 4JZOB 5FUZH 4TM9A 3X12A 3HN8A 4HJGB 4NAMA 5DDHB 2P5WD 4QWWC 3WJLC 1BJMA 1UA6H 4Q0XL 1IBFA 3MRQB 2KERA 1YDPB 1NIBA 1HWWA 1A8ZA 1CLYL 4RQQB 5GZOC 1WFMA 2DWSA 4A6YB 3OTTA 4TTDC 3VI3F 1LK2A 2GB2A 1O9ZA 4OCLC 4HUVB 4JFOA 3SBQA 4E0RA 4R90L 4GJTB 2B5IB 3AUWB 4KRPC 5EU4A 1CT8A 1XXDC 4TL5A 4CU8A 5EU3A 3C08L 3BMWA 4GKSA 1FNEA 2XXMB 4DGYH 4GT0A 4LCWE 4RMQA 2VQUA 4K3EH 4N20A 3VTTA 3MO1B 2G4GA 4K07A 3DXAA 1UA3A 1YYCA 3BRGC 3WKMH 5AKVA 1L7TH 2VERN 3UPCA 3IFPB 4R26L 2XTJE 4NLAA 3TIEB 1AD0B 3N40P 1W8NA 3G6AA 3MCKB 3ZKMD 4KROD 3Q6GL 4IGBB 1SYVB 3L1EA 1BQ5A 3BJLA 3I6SA 5HYJD 3TFKD 1RJZA 4G8EA 2WINA 4Y2DB 1BYOA 1LL1A 1I3GL 2P5EA 5BRZA 1FORH 2AQRA 2UWEB 4EUPH 5IB5A 3DX2A 3WEBA 4PREA 3QUMH 3SOTA 3F6LA 3WDHA 1OPGH 4PJ6A 1OK0A 5DD1H 3VTAA 4BSWA 5DYOA 4MMXB 3ZQWA 3DTDA 2H5UA 5JPMB 4MS8C 2CPCA 4Q6IA 4KHXH 5F89B 1CUOA 2R1WB 3W11D 3GSRA 4I13B 4FAAB 5DJAA 5M95B 5IR1A 4EZJA 3HRZC 1AJ7L 3ZE1B 5KYYA 1N5YH 3SKJL 4NT6B 2ZWSA 35C8H 4PRPE 2EDBA 1WFOA 3PV7A 3V5HB 2R0WL 1ZOXA 2UXFA 2V6HA 5GS3A 4AUYA 1SDAB 5AVSB 3LIZL 3HBQA 3MYJB 3AXLB 4KTEH 2FNBA 4ZMXA 3I85A 3C6EA 2PCPA 3MZTA 3FT3A 1E9OA 2ZUXA 3BZDA 1OF2B 3QEQB 4N0YL 1OLLA 4PVLA 4ZX6A 4OT1H 2OYPA 1JV2B 1N59A 1S9VA 4FMKA 4WTWA 4HW6A 3IDMB 4JFWA 3D0LA 2NUTA 5ID1B 4DEWA 3Q3GA 3QUZD 4XC3H 3EGXA 4XVSH 2CM5A 3BH9A 3TOPA 1NFKA 4O02H 1XH2A 3Q5OA 5TFSH 1YPZF 3FULA 1UXMA 5I19H 4IBSA 1CXKA 2AANA 1JNLH 3TNNB 5IROD 2WKGA 2J12B 3NTCL 2O5YH 1W72H 5C0EA 3JV5A 2XVLA 2DRUA 1RZKL 2GEEA 1IGJB 3AM8C 4KMTH 2X87A 1AIFB 5JIMA 2XWJA 4PJCE 5DLLA 1INDH 4Q52A 1DBJL 4UBDC 5IVNA 2YAEA 3A23A 2A9BA 3GDBA 2CD0A 3UYRL 1CFNB 3MLUL 3SBWC 3MUUA 5T1LD 1D2OA 4R4BB 1T2QH 1F42A 4PJDB 3M1BA 5F6HJ 2MNJB 1WWCA 1VHPA 4K71B 1MCBA 1CBJA 5HDWA 1U8KB 2C7UB 1T7WA 2YBGA 2VNCA 4Y2NA 4F80A 3S4SG 3GHEL 3NP4A 1NICA 4O9HH 2LAGB 2LLLA 3FQUB 3RGVC 3Q2LA 2VDNB 1IQWH 1IRAY 3MUJA 1CZ8L 2R15A 2OJEA 4XMLH 3ARDC 2VDRH 2Z6FA 1L7TL 3QI9A 4GW4A 5DD3H 4E42B 2XQBH 5DJZB 3VJ6B 4NM4H 5K59E 2ADFH 3LX9A 3X11A 4Z7WF 1KBKA 1Q0YH 4XN8A 3Q8BA 3Q6GH 4MQ7B 3M17B 3L17A 4FNLH 4BINA 1YEGL 2IGTA 1M05B 2ICEC 1IC4L 4TUUA 4FQHB 5BOPA 1K2DB 1I3GH 1F1AA 4NQSB 2DF3A 5I5MA 4PRID 1E8YA 2NRDA 2IQAB 3F6IA 5DJYA 3CGTA 2YRPA 3VW3L 2A3TA 3NCFB 4AQZA 2IEPA 2HT3C 5DZ9A 4NNYA 5KYXB 4G6JH 1KCSH 3BT0A 2GABA 5FK9B 3TA3B 3TCLA 2B59A 1FCCA 3R4DA 5KVDE 3VX0A 2WMPA 3BKMH 4MS8D 1SHMA 2OTUA 3O9WC 2ZXAA 1A7OL 2NY7L 2WV3A 2R2HA 1U8CB 3T2OA 1II4E 3QFJA 1LMIA 4XN2A 2WAQA 1LO0L 2ID5A 3WO3B 1BYPA 4XAWL 3SDCA 4EI5A 3SDCD 2XQ0A 3GSVA 4MCMA 1P9MA 5EU3B 4R6UA 3BP5A 3UAJC 5E2UL 1U91B 1RK0A 4HXAH 2HT2C 3CK0H 5C0IB 4L3CA 3EYSL 4PH8A 2E6PA 1DQTA 2LW3A 3VWKB 4YDVA 5DJCB 4L3EB 2EKJA 5TE7H 3UC0H 2VXQL 5GRZA 4LOVA 1ACYH 1WEJH 4MSWA 3R7QA 4YDLB 1RIUL 5AAWC 2MCMA 3WIHL 2RBLA 2VCOA 3K6IA 4PSRA 4RDQF 1P0SE 1I7TA 3LXAA 4Y1AB 1OPOA 3ZL4L 2A73B 3IFNL 3V4VA 2VO5A 4XBPB 3C75A 4N8PA 1ZHKB 2J55A 1N7MH 4K3GA 4MQ7A 1TJIL 3VFNB 3DGDA 5F7HA 1KLUA 2VLMD 3QWRA 5HD8C 1OD7A 1RZKH 3G9VA 2BP8A 2WUCH 5C0JB 1KEMH 1MCKA 1SLWA 1XR8B 1TZIA 1ZVYA 2XZQL 4A2FA 3H8NA 3QJTB 5JXED 3P11L 5HJDA 2HJLB 5IROA 3K6FA 3QUGA 4M56A 4YNYB 3UZQB 1AYOA 4CVUA 3IBEA 3DUSA 4WWKA 1B0RB 3BQUB 4K7PL 3C5JB 3E3QE 1BIIA 1Q9WB 2WJ5A 4TVUA 3DYPA 4B5ZA 4QNPE 1HHJB 4QLRA 2XTJC 4XB7A 1XMWA 3V6FA 4M6ML 1ZD6A 5LDSA 2MKLC 4FZ8H 1A4KA 4JPSA 2VDNL 4LVNC 4PCSA 5E4EC 3ZE1E 4L3AA 5B1BB 3VXTB 1F6AA 3SPVA 5CD5C 1GVIA 5I1GH 4H1LA 5EN3A 2FD6L 4GAAA 5FGCB 3LH2L 1NFDF 1TZOA 3P0VH 2BDNL 3KYKL 4D8PB 1L9MA 2VMEA 3V9EA 1W8OA 2DQDH 1ERNA 1PKQE 4HKXB 3BX7C 4U1JA 5F3HA 2XIIA 4RMBA 3VDAA 4UYPA 4CMMB 1XGYL 2YHGA 1TQSA 4FQ2H 1S5HA 5I76A 1ZT4B 4BH8A 4UIKL 3TL5A 3O4LD 3WS3B 4A2EA 5FOJA 2NX5B 5I30H 4OD2B 2PPCA 1FL6B 5B38B 1IKFH 4QPEA 3WJLA 2BIQA 4OSUL 1HXMA 4R7DB 5IIEA 3T5WA 1AOZA 3EYFB 5GGSY 1RFDL 4N8VA 4CSZA 3CQQA 1BLNA 1JK9A 3B8SA 3OGOE 4UQAA 1E4XH 2ZWKA 4H5SA 2W1NA 1PZ2A 2GBVA 3L5WA 3B2VH 3MR9A 4LHQB 4NUQA 5L4MA 3CPLA 4LLQA 4ES9A 3A5VA 1E5YA 5FA4A 4XPHL 4P0DA 1NBQA 2NT1A 1G6RA 4R7NB 4L4JA 4ZOBA 2DY2A 5B21A 2WLYA 4B9FA 5HHXH 1BQSA 1MFBH 1FO0A 5F9JA 3BOVA 2V7NB 1FN4A 1UM4L 5JORA 5FECA 4CVZB 4Y9CA 3PHQB 5AQ0A 2LE9A 5AB9A 3BPLB 3Q2NA 3QDHA 2GJZB 2WYIA 3MNDA 2AQPA 5ACLA 4UDUA 4BSWB 5BUGA 2D7MA 5TE7L 2WVTA 4XVUC 4P23D 3RJQB 4M9PA 1MG2C 2JXMB 5D8JL 4MYWB 3GSUA 2J1YA 3ARGB 4NAJA 1IAIH 4AITA 4YQXL 3NBNA 2PR4H 3PWUB 4KKQA 2DD8L 4OIAA 3BIAX 4RBPK 3C6LD 5HHNB 3SO5A 3TO4B 1BX2A 1UWXK 3K5RA 3MOAH 2KZKA 1BV8A 3WL9B 5FM8A 4P46B 4NC0B 2YGQA 3L7EA 1ICTA 1MEXH 3SGJA 5JIQA 4Q6IC 1VFBB 4G7VL 3T8VA 3QQ3A 1G9NC 1XCWA 2A9CA 1IUZA 4NJAH 1CD8A 5H94A 4YHMH 3D18A 5HPMB 1WG3A 2WUBL 3QFJD 2XQYK 4PJCB 3SE9H 4P5KA 4L4TB 2G5UA 3H9SD 4LASH 5FGBA 5I8KH 1U93B 2DV6A 3QO0B 4H20H 4K7PH 4WTZA 4ZRGA 2MOGA 2Z92B 3HNSL 2YPLD 3ZT7A 2F54D 3KNBA 3QZBA 2PYFB 2A6JB 4ZD3H 4TRPL 5C92A 2FTAA 3P2TA 4GKNA 1IU1A 4N8VG 3TP4A 4ONGL 5EF2A 4WHTB 2C1OB 5H35A 2UWEE 2EO7A 4XAWH 1TZIB 2QHRH 2EH8H 2VIRB 2ZKWA 5D2LA 5K59F 1IVLA 2P52A 4HUMB 3CSBA 3U46A 1F3RB 5CCKL 3AGWA 2VZOA 3OKDA 1TFPA 1FI8C 4IDJH 5IJVB 5HGAB 3MBXL 3S5LB 4AMKH 3U2JA 4ONHA 1TFHA 1U8JB 4P23B 4UDUB 5C07D 2DWDA 2X09A 4FYSA 4QHMA 5E94B 3SOBL 3NK3A 2VXQH 4ZMAT 5IMLB 43CAA 1J8RA 1JG9A 3ZE1F 4X6BA 4Z8FH 1JF1B 4JFDE 3NA9H 3JVFC 4AEEA 4ZNCD 5L2KA 2F18A 3RUGF 3UTPD 5D55A 3M6DA 4F7CB 4IEFA 5JOEA 3QZMA 3T6ZA 3UBXB 3RY6A 4IU2B 3K6NA 3ZDYB 3TJHC 1RUMH 1Y0LA 1TJIH 2DTMH 3S3SA 5G4MA 1BJ1J 1DQJA 4JR9H 3U48A 3CN2A 3MRKB 4H8WC 4L3EA 2EIBA 3B2DC 1DQLL 1RP9A 2EUXA 3V0DA 2VDOH 3I2CH 5D7KD 2IV9A 3MLPA 3TURA 3MR9B 2PKDA 3HG1B 3MXVL 4YBQC 4AJVA 5HGBA 3GXMA 2R0LL 1ORQA 4JANB 4LHUD 1WA0X 5I8EA 1CBVL 1OB1B 4HHWA 2O6DA 1KCRH 2I32A 1ORSB 5HJBA 2X4NB 4YFEA 3KYNA 3HKZA 4GG6A 2YEZA 4M6MH 2XG5A 1QQDB 5HDRA 1XV8A 3BVNA 3L1GA 4PP2A 3O4LB 3RNKB 1SJMA 4WNJA 2ZD0A 4KK5D 5CLTA 3WXVH 1W8EA 1MFAL 5BRZE 3H7LA 5AALA 4KY1H 1YNLL 4QRBA 3A67L 4JX0A 4LSTL 5DRXB 3IDNA 2WXQA 5IB1A 2IIJA 3QQ4A 3CFDB 1PKOA 1RZ8A 1ETZB 1F4YL 1WF5A 2IALA 3MSPA 4XGZB 5CM1A 2DD8H 3P73A 5EZJA 5E6IB 5EIQA 1O7DE 3DIDA 4NN5B 1OGTB 1F3JB 4QCIB 4KJWC 1MEXL 1UT9A 4X7FC 3EJZC 3TIDB 5A2KH 1WT5A 5IQMA 5JW4R 1TJMA 3ARXA 1YN6B 4LQFL 4G71B 3U7YH 4JJ5B 5F8QC 3W39B 3IPEA 4F7MB 1WRFA 1CMOA 3BH8A 4MQXD 4DAGL 4PJXF 4S1SH 2XV6B 5IFHL 3CHOA 4FFZL 1N64L 5LN4A 3NJXA 3TZVA 4NQUA 5I0YA 1BD2A 1UUNA 1UFGA 4P9MH 1K85A 4ZDHB 2BSRB 3ATEA 4UTBA 3T6WA 4OJCA 3UGUA 5JLZA 5F3BB 4RNRB 4JPIB 3OBAA 4GAYA 5MEOA 2E56A 1SFDA 2WTRA 4MWFB 4ZD3L 2DKSA 1SVZA 5I16A 5FM4A 4PLNC 3NEXA 3FFOA 3H9SA 3M1OA 5BZDA 2A77L 1A3QA 3IDGB 1KIQA 2WYZA 1FYTE 4CSPA 3V4PH 4A38A 4X6FB 1N19A 4JRXA 2XXGA 3FPXA 1M1XA 2GHZA 2OMZA 2XKSA 5F93C 2DQHH 1CGSL 5FHBH 2IANB 1P5VA 3ZDXE 1MF2L 4BFBD 5IV2B 5D4HA 4UCFA 3SDAD 5IP4A 1M6UA 3DVGB 4GIPD 5DMJB 2OMWA 3SDYL 5D4QA 1RHHB 4XP6L 1DDTA 2VUYA 2O1AA 5DR5H 2XV0A 4WHTA 5CHNA 1PZDA 2VLKD 3J7HA 3LB6D 5KYUB 2FO4B 1VFMA 2DH2A 2Z35A 1AGDA 3MMEA 2J44A 3PYCA 4MDRA 5CILH 1AD9A 1CG9A 1MHCA 5DHEA 1CGXA 1CFVH 1QFHA 5AZ2L 3FUEA 12E8H 3SDCB 3STZA 3V9CA 1XF1A 3IU4H 4X7DC 1XF4B 3QR1A 4HC1H 3KPSB 2WD0A 3LEXB 3MRLB 1MLBB 2P9RA 2F7QA 2CO1A 3PFUA 4LE8A 3FO0H 4PB9L 3RFZA 2ZTBA 1JHLL 4JQIH 3D8MA 1P69B 3QVAA 1E27A 3RIFK 3QJOA 5JW5A 4K7PX 1EIBA 2R27A 4GKLA 2L7UA 4JHAH 4XR8C 1QFUH 4AIXA 4AYSA 5CEYB 1O9VA 5F0LB 3VQLA 1DVUA 3WS6A 4KXAA 5JPNB 5B1JC 1U4EA 3N43F 4J4PD 1ZXKA 3EOTL 4QTFA 1ADQL 1AZRA 3QZWB 4OKVA 4XZUB 3QFDB 5HGDB 4EXKA 1SXSA 4GH7B 5DHYA 3E2HC 2CO2A 3OAYH 1CLYH 2XBZA 3QAQA 4GQRA 3QWOB 3FU9A 5BUAA 4RVBA 4HHAB 4KWUA 4XMVA 3WD5L 5F1OB 2F15A 2JB5H 4WW2B 4R90H 2VDLH 5CSZA 1T66D 4ERSL 3QZWG 1SQ2N 5CBEA 3O3AB 1GYCA 1FO0B 2QVTA 2YPLE 2CO3A 1S78C 4GBXC 3I02A 1PJ9A 3ZKNC 2DIBA 3VQ1C 3E6HB 5EDSA 3STLB 4A6YH 1ITCA 1RHFA 2QLVB 3IFPA 1IGFL 4FQCH 1M1SA 3GSNB 4FFYA 4I48B 4X98B 2OMUB 3GBNL 5DRWA 4EZKA 5I66A 4HXBL 3RAJH 3L5IA 4ZPVB 4UB0L 2NW2B 5IBTH 3MLVL 1EFXD 3N1PC 2H45A 1LNUA 4WGVB 4B60A 2BC4A 5GS0L 4P9ML 5F1IA 1R3IL 4UT7L 3T6XA 2ZJSH 3FTUA 1OF2A 5DQJB 3DMMC 1KB5L 4R7VA 1AR1B 4FLOA 1TJXA 1OTTD 4JPVH 4X6CF 5I8OH </