1DANU

Complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
116
Chain Sequence
EPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BLOOD COAGULATION FACTOR VIIA light chain
publication title The crystal structure of the complex of blood coagulation factor VIIa with soluble tissue factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 1997-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1danU00
3WCYA 1W0VA 1CXKA 1TZIB 1XCQB 5ADOL 3U9PL 1V3JA 3I3DA 2AJVL 4OCRH 2JJTC 4UDTB 4QKXB 2O61B 4XP4L 2FIKA 3VXRA 4CU6A 5E6ZA 4DKFH 1M71A 4H26B 5JW3H 3S3PA 3INUL 2H3NA 2GITB 4MJ4A 3SDDC 4HKBA 5I2IA 2LU7A 1AGDB 1MHHB 5IR1A 1XGPB 2VYRE 3QUXC 1T89A 5D1XB 2Z4QB 1TIUA 1A6WH 5C0CD 5JXEA 4BK4A 2MCPL 4ODTL 5EPMB 4YDKH 1K3IA 2IQAB 2JJSA 4LSVH 1XGUA 2HJLA 2ARJA 1BAFL 2D03L 1H5BB 2BVOB 32C2A 3MJ7B 5C0BA 1PX3A 4KUCF 4YFLF 2DYPD 4JY4A 5D7LB 5M7QA 1WBZA 1MCHA 3KG5A 2C4XA 1NUDA 3OMZA 4LSPL 5CEXA 4ZMAT 5GGQL 1YEHH 3B2UC 4X7TB 1EO7A 3V6ZA 2ICWB 4JPKL 1QRKA 3GMOA 4P46B 1A7NH 4OCNC 2OYPA 1YQVL 2JIXD 4ZD3H 1XF2A 5EULV 3EUUA 3PWNA 4XCNA 3RTQC 5IEKB 1K6QL 4GLRH 3DVNA 3MGTB 1BWMA 1L6XA 1FYTD 4UINL 2IAMC 5HYEA 1DLHA 3MLYH 3G6AA 4I3GA 5IK3A 3MACH 3O9WB 1VEMA 3OR7A 3T1WA 1MFCL 4JO1L 5IKCA 3O6MH 4OFPA 2C5DC 4HX1B 4JM4L 4PJEB 5LBSH 5BVPL 5D93B 5DMKA 2GY5A 4NZTH 3B9KA 4U6YB 3TNMA 1P2CA 3PGFL 2Z93B 1PG7H 3EOTH 3O6FA 2OK0H 3TYFA 2VXTL 2X4UB 3C5ZA 1BFTA 3V0VA 4XVTH 1S8DA 1P4LB 5F6IB 3B5GA 3DV4B 3ROLB 5D7JC 1F4WL 1ND0A 2E8ZA 1QBBA 3LB6D 4L3EB 2BY3A 3C5SB 3MBEB 5B39A 2CLVB 2EH8H 3VXMB 3LQZB 4NO0B 4HXBH 3AM8C 3RIFF 3SDYH 3BKYH 1NGYB 3O41A 5DGRA 3WUWG 4RGMB 5T1DH 5L7XL 5T3ZH 4JO2L 4XP6H 3BD3A 3VFOB 4ALAH 1KFAL 2ZJSH 3O6LH 2P8MB 2FO4A 5IUSA 1VENA 5BZDA 3LOWA 3WS6C 2EDXA 1CVSC 5C3LD 1HSAA 3IJYA 2K3TA 5DYOA 3DX8A 5E00B 5BV7L 2RR3A 1QSEA 5IFHH 4WJ5B 1FIGH 4QXUH 2ZUTA 3ZTJG 4BELD 3QXWA 1LO2L 1UA6L 5SWQB 3FO2A 4ODSH 5IW1A 4KI5E 5ESAA 1AQKH 5GIRA 3KNBB 1II4E 3VWJB 5DVMA 3FMGH 2EKSB 4NKIL 2EE2A 2CRMA 3ARDB 4ZAKB 1TJIH 4HPOH 1JUFA 5HVHB 3GJEA 1RZFH 4KRMB 2UWEF 1I1FB 4KRPB 5IT2H 1YN6A 2X7LA 3SKOA 3KS0J 1XF4A 1MI5B 4LHQB 1I9JH 4L4TA 5D96B 1HIML 3KYMB 5J11C 2NTFA 4JKMA 4LRIC 4R0LC 1JE6A 5F7WC 1AJ7L 5E2VL 3IU3A 3Q0HA 3GSUB 4Y8DC 2J8UB 3KGRA 4QEGA 4AENA 3FONA 4PRBB 3VXUE 1OPGH 4KQ4L 4U1KB 1Z9MA 3QA3B 1BVLB 3EHBC 3MUY1 1MCKA 2Q86A 4FQQA 3IFLL 2NY1D 2ZCLH 43CAB 1RY7B 1IKFL 1KELH 4Y19E 4KI1A 3ABZA 3TFKD 1CN4A 4GW1A 4YGVA 5KVMC 3BPNB 5A16A 1QSFD 4Q7DA 2JJTA 2ZUSA 4BSWB 3FRPA 4LVEA 5ETUB 2YZ1A 5HGAB 1RUQL 1MHCB 3SDDA 1KJMB 4L8CB 2DBLL 1AY1L 4NO3B 3R0NA 2Y06L 2IBZY 4OGYL 3QUXA 4PJHB 1N5YL 4L4VA 1ZHLB 4X6BB 1JZ4A 4LSRH 4DK6A 4PG2A 5AWNH 3STBA 3WUWB 2YOCA 1NSNL 1DBBH 2RQ8A 3MXVH 1RFDL 1EGJA 1OAQL 3T1FB 2VLRA 1JP5A 1KLGB 1G7MA 1RD6A 4BZ2H 4XAKE 5H37G 5IOPA 2IANA 5F1KC 1UKSA 4HSQA 1RHHA 5KSVA 4HC1H 5DVNA 3LY6A 4MCYA 1T66C 5I9QB 2VKWA 4YWGL 3VFVB 3X3GH 5L6YL 1UCBH 1J05A 4OF8A 2PKDA 1RMFL 1KENL 1QFHA 2VDPH 3OKDB 3HB3C 4S1DD 2FEDD 3KHOA 2QQNH 1LEIB 1CFQA 1Q0YH 2CDEA 4W68A 1Q94A 3EO9L 4JB9L 1TNNA 2A6JA 3T0DA 3RNQB 3TT3L 4UQ2A 3RTQA 1AR1C 4FXLA 4BQ6A 1S3KL 3FAXA 2EDJA 3GNML 2BFVL 3H7BA 2H1PH 1T80A 2H9GA 2AAVA 2OR9H 3CU7A 1NMBH 1HNGA 4G6AD 4V1DE 4XP9H 3I02A 4LSQH 4NN6C 4KI5D 3FFDB 3S4SG 1JHTA 3JWOL 1O7SA 4PTUB 5DRWB 2BSRA 3P0VL 4F9LC 3BGMB 1KC5H 4Y7MA 3ZDXF 1G1YA 1G7JB 4JFPB 2H41A 4KTDL 2A74B 1RAMA 3FB8A 2I25N 5K9OB 7FABH 4XBPB 3E6FB 1HH6B 1N0LA 2NY4D 5IVXB 2X89A 3ELAT 5D7JA 4PJDA 1ZGLA 5TDNA 4QF1B 4R9HA 2ZUUA 2ERJC 3EJYD 3DV6B 1OB1A 4M3JA 3TH3T 3UYOD 5IMLB 4ZPVB 4TTDD 3AM8A 3TJEH 5FUOL 4OLZL 3BEVA 4ZTOL 1CXFA 4PP1D 4OKDA 1RUML 3WFCH 1LDPL 1AHWB 3W0WD 4Y5YB 3WJJC 1N0XL 4RAVA 3RWCB 5BO1L 1VKXA 3ARWA 1P84J 3UZEA 3MCKB 4P3DB 4JPWH 4O02L 1YEFL 4WHTA 5FA3A 2V2TA 1UH3A 4Z7UF 3W11D 2XZCL 3OAYK 5CJXC 1JNJA 5C09E 1G6RH 3O3AB 5I1LB 3BDXA 2XA3A 4XX1E 4M7LT 2R4SH 4ONHA 1A7QL 5D7LE 2HTKD 1DQLL 1B2WH 3U7YL 1MJ8H 1TNMA 3V5DB 1AD0B 4TSAL 3GBNH 1FDLL 1N5AB 3QIWC 1INQA 4X7EC 3B9DA 1ZVSA 4L3AA 5TH2A 1UZ8A 3TBVB 2WLYA 3ARYA 2R0WH 4MQSB 2X4PA 4OF5A 2YWYA 3KYNA 1FNLA 5I74C 3RL1A 2CUIA 3OR6B 3QEHB 4MA8H 2DI9A 4ONGL 3VW3H 1GGCH 2P5ED 4RDQG 4EZMA 1AO7B 1NGXA 1I1CA 4LRIA 5F96H 1KCKA 1UWXH 2CJUH 3MNWB 2F8XC 1MIEH 1G7PA 3DVGA 3KPLB 3ARUA 4PRPB 4OI7A 3QT2A 1E6JH 3MV8B 1RZ7L 5CGMA 1ADQA 4PJEE 2WBJB 5CJOL 4BQBA 1DJSA 1EPFA 4LU5H 1FGNH 2QQLH 5FHAH 1Q9WB 5FKPB 4PREB 5E6IB 2ADFL 4HQQH 5BXFA 1QSZA 2E9IA 2PW2A 1D5BA 3OKNA 4GG6E 4ELME 2A6DA 1BZQK 2R0KL 3S4SB 3MA9H 4XZUB 2DRUA 3OXSA 1JV5B 4U4BA 2H6PA 4LLQB 1I1RA 4X98A 3MLTB 2BC4A 3C6LA 1ZEAH 1QLFA 4EDWH 4DW2L 3HI1B 1WBYA 4M7KL 3JUYA 5KSBF 1RUKH 1NJ9B 4APQB 2NZIA 5BZWA 3D2UD 2X1WL 1DQMH 1SJXA 4HKJB 3VMOA 4Y4KC 4NWTH 3MRIA 2AQ3A 3HAEA 5EO9A 4JY5L 1GAFL 4OFYD 1FZMB 3S34L 4TNVK 2DIJA 1JNHA 2VLJD 2CXGA 3IFOB 2C9AA 2VZUA 1C08A 3QULA 4OT1L 5DMYA 3UAJC 5FGRA 2R2BA 3IGAB 4RAUA 4RMRA 3PV6A 5T5NF 4PJIA 4HBCL 4MCZB 3UJJH 43C9A 4OZIB 2FECL 3TZVB 1S7VB 2W9EH 2X9XA 1UZ6F 5C0GA 6CGTA 1HI6B 4NRZB 5CSBA 1ZOXA 2M1KA 3T77B 2DQGH 3C87A 4ODHH 4LSTH 3GMNA 4FN0A 1QBAA 2HLAA 1FN4B 1X6NA 1YMMA 1ZHBA 2CRZA 2COQA 3IXTB 5C1MB 3JV6B 3H0TA 1U8MB 2F54A 4PR5B 1C1EL 1MI5E 4FNLL 3PGCA 1G6RA 1T7VA 4Y4HD 3EGSA 2ADGB 4HH9A 4PJDF 1VA9A 2YN3A 3ZYZA 5GISL 1YEEL 1KT2A 2J8UE 2F5AL 4JFQB 4HUKB 2J2ZA 3CK0H 3FOLB 4HUVB 4OIBA 4JFDB 2FJGA 4XNQB 5D6CA 5SWZE 4K3EH 5GRWA 4O2EB 3WLBB 4D0DA 1OCWH 4YHPA 4F9LA 2OL3H 2YRZA 4PRNA 3RAJH 1VERA 3CDGA 4WFFE 1CDGA 5D1QB 4JRWA 3J8F7 2I07A 3VG0H 2RCSH 1Z0NA 3QHFL 4U1NA 4BK5A 3MRQA 4YHLL 3B8YA 4NQUA 4X6DA 4WO4D 1NH6A 2R0LL 3ARFD 4YDVB 1ZXQA 3X3FL 1WWWX 5E24E 2H26A 2B1AH 2DLHA 4MNGB 5D6DC 3HZMA 4ODUA 3C60B 4PJHE 2D7QA 4G9DB 5DD6B 5JHLL 5D2NC 2L7JA 3WKML 3PDDA 5FYKH 1R5IB 1CTNA 1BVZA 1SEBA 1RZIA 4PB9L 3A6CL 4JPVL 4HK0A 2EIZB 4OCYH 1IGFL 5GS0C 1ZSDB 5CJXA 1XZ0B 3QXDA 3IJSB 5HYQA 2X5PA 1FNEA 3RKDD 2MFNA 5FDWB 5F1OB 1D5XB 4Q74A 4A2MA 2A77L 4NQCB 3QIWA 4MXQD 1WFUA 2ZUQC 3CFDA 3U4BL 3R06B 2YPVL 4RQQA 4JG0L 4K9EL 4K23H 4LBEA 4L1DA 5DWUH 3P9WB 2GSIA 1R3IL 3LEVH 3GMLA 4D94A 1IGIH 2FD6L 4KQ3L 1AC0A 3P3YA 3VCLA 5FF6B 1IAKB 4X6FA 4N8CL 2R23A 5CEZD 2APFA 4Q9CA 1KN4H 1YYML 3ARSA 4RZCB 3QEGL 1ZT4A 5I1KH 4OAWB 2ID5A 5ITBH 3PQYE 4RFEB 4K7FB 2VH5H 1DN2A 1FJ1A 1FNGB 3SPVA 3AS2A 1F4XL 3CFKB 1HHKA 3BZEA 2NPLX 4QXWA 3QFJA 5D72H 1A3RL 3QSKB 4MNQD 3HLAA 3SDXE 1CDJA 2BCKB 4X5XB 3RA7H 5IVXE 3CFBB 1OGAB 4PGJA 4P2QD 1X9QA 3O3EB 4KDWA 5GS0H 1NANH 2XTJC 1MJ7L 2A9ML 3DOSA 1FZOA 4LGPB 4LCYA 4RGNC 3GB7B 3CIQA 1J0JA 4PJIF 2BJML 4LIQH 4XNMA 2NYYD 3CXHJ 3TNNA 3DURB 1ZANL 4PY8J 1ZWIA 3QB7C 5D2LA 2HTLD 5I16B 1NLBL 1EBAA 3MRMB 4JR9H 4OZHA 4GQ9H 4Y4KA 4G6KL 4DVBB 3T0EC 4PJXE 1TPXB 3SY0B 4JHAL 4YQXH 3C09B 1JGVL 3HG1B 4PJAE 4XPGH 1F11B 1NCBH 5TF1H 4Z7OE 2OL3A 4P2RD 4PBVC 4FQJH 5LAXB 5EUKA 5IP4A 1A2YB 3VXPB 3ZKND 2ICWJ 4YK4C 1MVUA 3CC5A 3P30H 2P45B 4XPHL 2VXUL 5B39G 1VSCA 3FQNA 4XT1C 3CFJB 1YMHA 1UACH 1BBDH 1T4KB 2UWEB 3D69B 1XGTB 5EFIB 1I8KB 1PY9A 3RY5A 1M7XA 3IF1A 3S36X 4K2UL 1MQKL 4LLUB 1G0YR 1LO0H 2XG4A 2Z91B 4R97B 3IDJB 1UH2A 1W0VB 1NCUA 3HNTH 4RRPA 3O8XD 2FLRT 4Z78A 3VXRB 3QWQB 4WU7A 3K2UL 4AT6B 1M71B 4WUUE 5AZEH 4E9LA 4RGOL 2PXYD 4HLJA 1FO0L 1H3PL 4OD1L 4HKBB 1WICA 2Y5EA 4P3WA 1BBJB 4DFIA 2Q76A 2FHBA 1MCOH 4CN6A 3D87B 3BZ4A 4G6MH 4X6DF 2G2RB 2DTMH 1WEJH 5EZOH 2ARJB 4YDLB 1BJ1H 5B4MC 1YNKH 1RIUL 3VRJA 3L3KB 1IEAA 1RUPL 2B2XH 1OQOA 1LNUA 3X12A 4JY4B 4M6NH 1A7BA 4JGJA 4K3DL 1WBZB 4LLDB 3DRTA 3IDXH 4J3XA 1JK8A 4Z95H 4X8JA 1U3HC 1TLKA 1X7QA 5CEXB 4K71B 1EHNA 4DAGH 1G9ML 4LLWB 4P59L 1JZ2A 4NRXA 5T3XH 2EDTA 3OAUL 5HHVH 2F53A 3HC3L 4NC1C 1QSVA 3CSYA 1DEEA 1CD1A 3BPLB 3QDME 3QO0A 2EXYC 4JY6A 4IMLA 3DVNB 2NXZB 2FRGP 5DD5H 5LJYH 4LLVB 3G6AB 1P7QA 1T3FA 5D2NA 2Q6WB 5IK3B 2A0LC 5CIPB 1QPXA 3N1GC 1NL0L 2Q20A 5SV3A 3PUCA 3B9KB 4C83A 2W0PA 1P2CB 4U1IB 1T2QL 5FKAB 5JZ7C 5DRXB 3TYFB 4GXVH 3I6LD 1KN2H 1NBVH 4QRSB 5ACZB 1NGPL 1LEKA 3LKQB 4PJ9C 2J88H 3UZQA 5EBLB 5L88H 2ATKB 3HKFA 5B39B 4FXKB 3T08A 3LH2L 4OCXL 1IM9A 4OFVA 2HWZH 3O41B 4UU9B 4BYHA 5DQDL 4R2GD 4XNYL 5F9DC 5DUMH 1ROWA 35C8L 1XF1A 2IGFH 3LIZL 2FO4B 1ODAA 5BZDB 2OTUA 5D7SH 2ITDA 2YUZA 5FFLA 1HSAB 3IJYB 1C5BH 3RDTB 4JVPA 3BMWA 4N68A 4CMMA 1KUMA 2I60H 1Q9KA 1BPVA 3W0WA 1TMCB 3R1GL 3GBMH 1QLRB 4OZHF 5IW1B 1XGRA 2APBA 1KCUL 5GGUB 5CJQH 4JKKA 5T5NG 2APWA 3CVHB 1INEH 6FABL 4YE4L 1CE6A 5HDQH 4F33B 5ENWB 4XB7A 3G6DH 5EDXA 4CADB 4G9FB 1JUFB 4JN2A 2OJZH 4Z7UB 1OD7A 4R6UA 3PL6B 3GGWB 3UC0H 2BNRD 3MLRH 1TXKA 2E9WA 4LCUA 1KCRL 5I1CH 1IT9L 2YZ8A 4G5ZH 3T0EA 5HI4C 3IU3B 3FB6B 4J4PC 4PRIE 4KKLC 3KXFE 4FTVB 1T5XA 1WBXA 1AH1A 3MV9B 5A2FA 4MJ2A 2WWMD 3FONB 3VXSE 3AFLA 2HN7B 2BNQD 1F6LL 1U8HB 1NMAL 1VFBB 4ZNCD 1PX4A 3ZE0F 3GIVA 5D7KE 1BD2D 3PABA 1MELA 2F8OA 4FQQB 4MJ5A 2VR4A 5D1ZB 2C7UA 4K8RC 3C08L 2AJZB 3WS3A 2PR4L 4Y16B 4UT7H 3QEQB 1DR9A 4F58H 4GW1B 4YGVB 1A6TA 1F6FB 4P9ML 4YXKL 4LCWE 3WHE1 1T21A 1HOCB 4YC2B 4YO0B 5TE7L 1LP9F 2DQIL 3SKJH 4NSKA 4XVSL 3QPXH 2O5XH 3ILPA 4OD2B 1KBGL 1RURL 3N1FC 3SDDB 4WTZA 2CMRL 3JTSA 1M7DA 1EAPA 2B4CL 3MC0A 5CZXD 4B50A 3PNWA 4E0RA 3VXQA 1OSZB 2LTQC 5CEZL 4DZBB 1PKQE 3VFUA 4X7SL 3BMVA 2XXCB 5E2WH 2BSED 1PQZA 5DRNA 5K9QI 2HYMA 3V6OE 5E5RB 2BX5A 4MVBD 4M9OA 5KSBB 1DCLA 1VFAA 3G5ZB 3NTCL 3B2VL 1LILA 2C1OB 2YD7A 3QQ4B 5J3HC 3FHAA 1CXEA 1WFNA 1U8IA 1BQHA 4WW1A 1RHHB 4WI7A 3CDFA 4KROB 3RVTD 1U3HA 1DVFC 5E8EB 1J05B 3BP5B 3RVUC 4ZFOL 4M4RA 4XVJL 2JCCA 2E7LC 5EA0L 4X80L 5DQJB 3CSGA 3S6CA 3D3VA 3FT2B 3AMLA 1Q94B 1S5HA 2ZUYA 3AMKA 1CYGA 3IDNA 3BE1H 2A6JB 4AMKH 4HCRH 4K8RH 4H0GA 4QGYA 3HG1E 5DDHB 3RWDA 5C92A 5DD0H 1HCFX 4EXKA 2H9GB 3ULVD 4MD0B 5JMOC 3SOBL 2Y6SD 4M1GH 3RP1A 4DOHB 1NAML 2FBJH 2IAMB 3I02B 5TGBA 3T2NL 4PFEA 2NY3D 2VISB 2VIRA 1FH5H 3QHZH 5TDPB 5JDJA 3KYAA 1OSPH 3LN5A 4LHJB 5GJSL 1OLZA 2YPKA 1CBVL 2DDQH 3FB8B 4LNVA 4D0CA 1DBKH 5DQ9A 3RFZC 1A6ZB 3AREC 5J89A 4PJ9A 5D7JB 4PJDB 4C56E 4KJWC 1NUFA 3GSWB 1ZGLB 1A6UH 2Q3AA 1PYWA 3FQTB 3T4YA 4EVNB 4ZO6A 4N1CA 4PGEA 1K8IA 4O58L 3K7UA 4NHCL 3D9AL 1CLOL 3BEVB 3QNXA 4MQ7B 4UZGA 2ZSWA 3EFFB 1C5DB 4IRZH 3HS0A 2V5SA 5F1IB 1IGTA 3HI6L 3HI5L 3L7FA 4NC2B 2ESVB 4RAVB 3BGFC 5IBLC 2ITCB 3HPLB 1A21A 1PBYA 3Q1SL 4TVPH 5HGDA 1E4WH 4HIHB 1RJYB 2NY7H 2X4OA 1QO3A 4ZYKA 4PRHD 3U2SA 2PN5A 2V2TB 4H25A 1K8DA 5D7KD 3NH7L 3OGCA 3GBLA 5DJYB 1DBML 1RZGB 5JIKA 4LASL 2Q87A 1UT9A 5EN2B 4NQDA 3CGTA 1OTTD 1CLZH 2HRPH 5JOFA 3GI9H 2VDLH 1T1YA 2NR6D 5HHOD 1QUNA 5DHVH 1I3GH 2XRAH 1X5HA 1UZ8B 1WJ3A 4FZ8L 1M4KA 2HLFD 4LGSB 2X4PB 1PG7X 3KYNB 4G43A 4GBXD 3RL1B 5CKAA 2E6QA 4JRYA 3N1PC 1HCVA 5FOJA 1WF5A 4IRSC 3CCHB 4U0QB 5J11B 3BRGC 5BQ7A 4YX2H 3T3ME 2WIIA 3BIKB 1Z9SA 4R0LB 4YXLL 2VDKL 1BFOB 1G7PB 3HFML 3DVGB 5ILTL 4FFVD 1BLNA 3QCVH 4OKVB 2NY6D 1QRNE 3IKCA 1SMAA 2F8VA 1CI5A 4K07A 3ZKXC 4FQPA 3M1BB 2BZDA 1WV7T 2DTSA 3U9PH 4I77H 4YH6A 1R3HB 2AJVH 4XP4H 1ITBB 4RFNC 1B4JL 1KEML 4EI5C 1U58B 1ZS8A 4M62L 1IGMH 1U0QA 3INUH 5IVNA 3NIGE 5IB3A 2Y9RT 5E08L 3OKNB 5ITFA 2A6DB 1X5YA 3OXSB 1HQRB 1D6EA 4HCRA 4L9LA 1OF2A 4UNTA 2MCPH 3ZE1E 1QLFB 1MHEB 5L9DH 3QDJD 1I4FB 2NLJA 1P7HL 3GSQB 2VDOL 1UQSA 5CGYD 5J13C 4P2QA 1QFPA 3OPZH 4MWFA 1S9YB 5C0JA 1EHLL 3NFNB 3HE6C 2HT3D 1JWUA 1MIMH 2JCCF 3L3JA 4OV5A 2VAAA 4PLOB 4ZQKA 4OLVL 4A6YB 3DARA 2R2BB 4QRPE 4PJIB 1YNLL 1PKOA 2IBBA 5DUPH 43C9B 4FZEL 2P43B 4FMFA 5C0GB 1KCSH 3V5KA 3EAKA 2EZ0D 2AK4D 1YN7A 4M93C 4NFBA 3PWLA 2HLAB 4WDIA 4Z7UE 5IB1A 4WI5A 1ZHBB 5EORH 1DVFA 2E9BA 2OR7A 1NAKL 1NC2A 1MFCH 4JO1H 4NGHL 1SJHA 4GW4A 1YY9C 3PGCB 4JM4H 1G6RB 1QHOA 5DK0B 1T2JA 3GSXB 1J7VR 3S37H 4BSVA 1KT2B 2ZKHL 2EDEA 3D39D 3F12B 3LS5H 1FORH 5I1AA 1KLUB 5F9WC 2NX5E 2PXYA 3MV9E 4NN6B 2J6EL 2FJGB 3KPSA 2FECI 1SMOA 2V2WB 4NKMB 5DHVA 3CDCA 3TWCL 3IAPA 1AXIB 4YUEL 2RB8A 5J6GB 3CDGB 3QDGD 1WTGT 5GJTH 1JYVA 4Y89A 3GK8H 1KLFA 1ZHKA 4IS6A 3DX6B 3NBNA 4O5LL 3PHOB 5HVGB 5I1EH 2WBKA 2VDRH 2WZPD 4JO2H 1GSMA 4LNRA 3QEQE 4WI3A 1KFAH 4GMSL 3OQ3B 2LVCA 2W0FA 2ERJB 1J10A 4KK9D 3RL2A 4EN3C 2BY0A 2H26B 3B43A 3TIDA 3D85D 1DBJL 2DQJL 5JNYB 1YC8A 2N1KA 5JHDE 2XWJA 4I3RL 4WCYL 1A6AA 3HMWH 3AS1A 5EOQH 3H3KA 4WVRA 3WIFB 1ETZA 1SEBB 1D5ZA 4PJCE 4K94L 3BGAA 4RRPG 4TRPH 5GGVH 1CFVH 4Y1AA 1T0NA 4UOW1 3QXDB 5F1SA 2A1WH 2FGWL 4MDJB 3DX7A 4U33A 3RGVC 3HZKB 4KJPD 3QIWB 4GAJL 4UT9L 5GZOC 5H35A 4YDJB 3NFSH 2J12B 1MRCH 4QYOA 4NKDA 3SJVD 1TENA 4NN5C 4PJBA 4DJMA 5E2UL 2X42A 5I74B 3MV7A 4X6EA 1F2QA 3CDYA 2AJXL 4F7PA 1EZVY 3BVNB 1JBJA 4IRSA 2R23B 3DHMA 4LHUD 4ELKB 4DOHE 2JK5A 3ARZA 3AU1B 3TO4C 5L2KA 2VC2L 3ULVL 2VNCA 3QJFB 1XT5A 3KDMA 3ET9F 5E99L 3TV3H 1WLHA 1A0QL 1TVBB 1I7UB 5FYLE 2CR6A 1NFDA 3LD8B 1J8HD 1R5VA 4N5ED 1ZA6A 3WL9A 2IQ9L 4OUUB 5I0ZA 3K4DA 3QUYD 4EI5A 2BRRH 5SWSE 1YEDB 2VLKD 3EOBB 3JWOC 4U1LB 3NN8A 1IGJB 1B0GB 3UYRH 4HXAL 2K1MA 2DBLH 4Q9BA 3OJDA 3KPRB 4OF6A 2V7HA 1GOHA 1FZOB 4LCYB 2FWOA 1N2RA 2DD8H 1SBBA 3W9EA 4XNMB 5F7DB 1AC6A 2DKMA 1MCPL 2P4AB 3UTQA 5K33A 3TNNB 5ABDE 3QP3A 1NSNH 4NN7C 3WHXA 5HPMA 1QVOB 1CD8A 2NX5D 3REVA 1MREH 2ESVE 4AM0A 4OZHB 4U1HA 2PO6C 3E8UL 1ED3B 1S78C 2J3SA 4BM7A 5I76A 2HG5A 4N0UB 1P4BH 1MVUB 3CC5B 2DQFB 1BFVL 2MHAA 5DLMH 5CMAA 4NUJB 3FQWA 3FFCD 4RISL 4KKBC 3VXOA 3I75A 2BNRA 4YWGH 4M43L 2RFXA 5KSUA 1IZKA 1CXLA 1H3VA 2W59A 3QWOA 4X4XB 5B8CB 1LD9A 4UV7L 3IF1B 3P9MA 3AY4C 1YUHB 3T8XA 2WP3T 1Y0LA 5C08D 2DLTA 4NBXB 3GHBH 1Z2KA 4ZUTA 3WV0A 5DA0B 2EDDA 5EOCL 5EU3B 4TQEL 1BM3H 1F4HA 3QUKA 2FNBA 3L5WB 5KW9L 3HZYA 5CSGA 5E7BA 4LPTA 4G8GB 2BNQA 1C5CH 2IPUK 4UMGA 4MD4A 5JHDD 2CLRB 5HDBE 1I8MA 5B3JF 5CEYA 2PYEA 2YPLA 3BAEH 3JWOH 4UBDD 4HKXB 2VDQL 2FX8L 2BRQA 1KG0A 2XN9B 4HUMB 2XZAL 1T6VN 3MBXL 1A9BB 2Q76B 5MERA 4WRLA 3KPQB 4JM2C 1T6WA 4YHOH 1NBZB 2X1PA 3QCTH 4BZYA 1D5MA 4WWID 1JTTA 1MFDH 1FG2B 4NHUB 4BH8B 3NPSB 1MAML 4XMPL 1DZBA 1IEAB 1KB9K 1LP9B 3TIEB 4M9PA 4L29B 4TUOA 1HHJA 4R4NC 4UQ3B 5F88A 3P73A 4HWEL 1CL7I 3BN9C 1LHZA 4XCCL 5FUOH 4OLZH 5FYJD 1DLFH 4XRCB 4ZTOH 4I5BB 3TA3C 1JHLH 2I5YL 3P40A 1LDPH 3CX5J 3ULSA 1UG9A 4KHXL 5GZND 1YZZA 4MJIA 3BO8B 4LGRB 1N0XH 4RBPK 1W72L 4L8DA 1VEOA 5CJBA 5LGJA 3PWPD 3QIUD 2V9QA 4X6CA 5J8OA 4BFBD 1LO3L 4NWUL 2F53B 4JRXA 2VZVA 5FM5M 3X14B 4EN3A 3MLSL 4DKEH 3KS0H 5IROC 5KSAC 3UTZA 3CSYB 4OLEA 4Z0BH 2VWEE 3RY6C 1DEEB 4IMLB 2AXFA 2HMID 1E6OH 2D7TL 1E4JA 3MCG1 4G6JH 1ZT1A 5I8EA 1P7QB 5KVFH 3THML 1S7WA 4JREC 4F80A 1V7ML 3DMMD 1G1CA 4ONFH 3TYGL 1FVEB 5SWSD 2WV3A 1P7KA 4MQXC 1KB5B 2DF3A 5C2UB 5ESQA 4JAMB 3DVFA 1RJLB 5JUEL 4NT6A 1LEKB 3RGVA 4XCEB 3IS1X 1YYLH 2DM3A 1CXIA 4HEME 3VFPB 2ZUQB 5FDYA 5MENE 5CHNA 3AGVA 3OF6D 2XKSA 3WIIH 3KLHC 4P4KD 3CLFL 1DUZA 4P23D 2J4WL 5C0AA 3RHWK 3ZDYF 2CRIA 5DRZB 2X4TA 1ZE3C 3B9VA 5CILL 5TPWH 3GRWA 2R2CA 5ICZA 4MA3A 4WNQB 4M5ZL 4HWNA 2IG2L 8FABA 3NCJL 4YIQA 4WHCA 3SKNA 2GFBA 2ITDB 2W0KA 1BQHG 5D8JH 4N0YL 1QR1B 2FATH 3GMMB 4ZOAA 4JFOA 1R0AL 4ZUWB 1S7RA 2GSGA 1OOAA 3AB0C 1Q9KB 3O6KL 4CN4A 1ONQA 5I1JH 3OTTA 1OM3L 3BW9A 5KS9E 2WINA 1FFPA 4XWGL 5E03A 3ZTNL 1XGRB 4MSWB 1ACYH 1TCRB 4QRUB 4ZNEE 3GJFK 4AH2A 4PRHA 4OJFL 1XF5B 3RIFK 4D8PA 1ZLWH 4Z9KB 5EUOA 3B8SA 4P5MB 1YNTB 1QD0A 4HT1H 3LPWA 2XTJB 4NNYB 3EYSL 4AEHH 3HMXL 1AE6H 1A22B 4TSBH 1BF2A 5D1XD 2OJEA 1HHIA 3I9GL 4OT1H 3GHEH 4PY7A 1N6QH 1QP1A 3VRIA 3IKKA 3T65A 3O4OC 3RWIA 4YHZH 5I15H 1Z9OA 4G7YH 3FCTA 4Z77B 2PO6A 2OZ4H 3MLZH 4HDIA 1JPTL 4M1DH 3C2AH 3GMQA 4ORGA 4ZUUB 1WBXB 1FHGA 2NQCA 3VRLE 5IB2A 3HPJA 4KGLA 2HFGH 2XZZA 3BZDA 2GJZA 1R3JA 1HINL 4XMLH 4R7NA 1EH9A 2YD9A 1K85A 1UM4L 4NZRH 3GIVB 4LSSH 3QXUA 4F7EB 1Y18B 4ZFFB 3AY4A 3BH9B 2F9BT 3ZKMC 2FJFA 4HS6A 1VADA 1AGCB 3SGKC 1R3LA 4L3CB 2XIDA 1X3DA 1NBQA 3OB0H 1YEEH 3ETBF 2LU3A 4NSKB 3TBSA 4E41E 3CXDL 4Z5RB 4X5WB 4OLYL 2W9LA 3DXAA 3FQRB 4FQCH 4YBLC 2X1QA 3DTXA 4PJFA 3JTSB 5EU6A 4PS4H 4DGYH 5I18L 2P5WA 3NCFB 4F3FA 4U3HA 3QUZC 5JW4M 4JM2A 4Z7VA 3REWB 3UTSD 2G60H 3QH3A 1IFHH 2DN7A 1WZMA 3VFUB 2GK2A 3MYJB 5DRNB 4LSUL 5K59E 4YHLH 4WY7L 3T4AA 3ROOA 1B9ZA 4NQXA 1S9KC 1JNLL 2R0LH 5E1AA 5BJTA 5ALCH 2GQHA 4L3ED 5MEND 3MBED 3BKCH 4KK5C 3VXMD 4JEGB 4M48H 3DGGB 5JR1H 1BQHB 4WW1B 2L0DA 3KPRE 3TA3A 2R0ZH 1QLEH 1Q9OA 4KI5C 1U3HB 1J5OH 1A7OH 4TNWF 5C86A 1JL8A 3RWGA 4D9RE 2JCCB 1U8LA 1BIHA 2UYLA 3D3VB 1H3TA 4PB9H 4JPVH 4KY1L 1J1OL 4QOKB 2AV7A 3O4LB 5IROA 3GMRB 5KSAA 1H15A 4U6VL 3RWDB 3RY6A 2B0SL 1BHGA 1VCAA 4IOIA 3BZFA 4KKAD 4N0UE 2J5LC 4G8FA 1QNZL 1F90H 4K7PL 4LMQI 4CGTA 1HILB 4KTEL 3MRCB 3KPNA 1EHXA 5DJZB 4IOFC 3V0WL 5DT1L 3LN5B 4DTGL 1SBSL 4R4BA 4WFHD 3MNZB 3CFCL 2G9HA 3HUJA 4KKNA 1U6AL 1CFTB 3VXTB 5HHMD 4WI9A 5CLWA 2V7NB 2WNGA 1EFXA 4D0CB 4ZAKD 3WIHL 2FD6H 1V5JA 1MHPH 5IM7B 4BKLA 4PJ9B 4G8GE 1TETL 1UYWH 4RMUA 2EXWC 1NCAL 1PYWB 3BQUD 4YHYC 1YYMH 4QRRE 2XNAA 4PGEB 3QEGH 2OZ4A 3P0YL 4JN1L 2O5ZL 2LAAA 1TQCC 2XN9E 4GS7B 5IB5B 5HYFA 4KMQA 3HS0B 2DIBA 1IGTB 1F4XH 4KGJA 3PXJA 4NKOB 5CZVL 4NQSA 2I9TA 2WWKO 5EUOF 4N1HB 2QQQA 1A3RH 4ZOCA 4RIRA 4E42A 4X9BA 1JGUL 3U0TA 1QO3B 2CD0A 3RWHA 3PP3K 1K5NB 3SKUD 2AKRB 3ZE2F 4TOYH 3MXWH 3GDBA 4ZS6D 3GSNL 4OQTL 1LK3H 4AEEA 2ZPKL 3VH8G 3GM8A 5I66A 3SE3C 1T1YB 2CUHA 2X41A 4XPBH 1ZANH 3V7AG 3DYMA 3TN0D 1BZ7B 1RK0A 4HZAA 4PJ5B 1RSFA 1MFAL 1X44A 2V5TA 4JHAH 3P11L 2JJVA 3T0WA 1E4XL 4H1LH 4ZO8A 1NKOA 5D71H 3C8KB 3QNZA 1AKJA 4JRYB 1I8LC 5FB8A 1GZQA 4MDIA 3VJ6A 4YZFE 2B1HH 1NQBA 2BP3A 4TYUA 2YSSA 1BEYH 2PTVA 1S7UB 2LQRA 1EJOL 4AQOA 3O45A 1JIBA 3F58L 3DJ9A 1OP5H 1ZTXH 4EIGB 3TPUB 5DURB 5J9PA 1NGWA 5ALBH 5FAAA 3SQOL 4JPIA 4PJ7A 3N1QC 1CL7H 4JDTL 4HF5H 3IVKA 4M8VA 3H9SD 1YECL 1U8QA 1I75A 1UM5H 4PJFF 4L8SB 3ECBA 1G7LA 4XB8A 3BRDA 4YXHH 4JM2F 5LGHL 4OD1H 1KV3A 4KJQD 3MREB 4MX7B 5HGHA 3H42L 5I8CA 1XH3A 2R9HC 5DMIL 3BESR 3G04B 4UTBH 2FYYA 4OCSL 3MQIA 3RWFA 2PW1B 2G75A 5IQ7L 3P4NA 4NDMB 5C0IA 4Q9RL 2XA8H 4KMTH 2OSLA 5C0RL 2NLJB 1FFNB 2AVGA 3ILQD 4OD3L 4I9WD 1SEQH 4OB5L 5GGRB 2XPGA 2JB6B 5JPNB 1BGXH 5E1HB 3I84A 1EXUB 3MRPA 4MWFB 4LRNL 1E28B 3SDCA 1Q0XL 3W39A 1JWUB 3STZB 1N7MH 1DN0A 1C12B 1FFOB 2VAAB 4QRTA 1RVFL 4NCDA 2EO9A 4ZQKB 3P4OA 4XBGB 5GRZA 3CVIH 5C0EB 4RMTA 4OCWL 2VXVH 3FT4A 3L6FB 5JW5A 1XAUA 1XCTB 1AI1L 2LVEA 2QHRH 4NQVB 5MI0B 3LS4L 2PETA 1H5BC 1N4XH 4M6ML 2IH1A 3QEUA 2OP4H 4CJ0A 3V5KB 1YN7B 1G0DA 3FFCA 5E9DE 1RZ8B 3WNOA 4WDIB 4QT5A 5E2JA 2Q8BL 2IADB 2HJKA 1A4JA 1DVFB 3RX8A 1NC2B 3LEXB 1Q72H 4W70A 4K3JH 4GW4B 4P46C 5JO5B 4NQTA 4ZFGL 5EIIA 2PF6A 5JDSB 2V9TA 4FQHA 4BSVB 1T2QH 3TJHD 5MEOA 5MHSD 4QNPF 2F19H 5CBEA 4PGBA 2WK2A 5I1AB 5C3TA 5J1TC 1FFQA 5H94A 1IQWH 4I2XA 4YDIH 1L9MA 3O9WC 3WD5H 1X5KA 2NY2C 5DHVB 4M03A 1YJDC 4N1EA 5C07E 3NCMA 3SE9H 2I9LA 3CUPB 2BVQA 3K4AA 4H1LA 3GIZL 3U30C 2H2SC 3LN4B 1HXYA 3DUUA 1MJJA 3VXUA 4LNRB 1A47A 4HZLA 3AREB 3LIZH 4PD4K 4QHMB 2VLMD 4OZ4A 3ULUE 2W0FB 1SY6H 3RL2B 5CSZB 1YQ2A 2R56L 3KPPB 3Q6GH 4G3YH 3W5NA 3MOQA 5JA9A 3F7VA 1AO7D 1RI8A 4OGAC 4TSCL 3MO1A 4G80A 4JFEB 1ZAGA 5TJWK 4PRPD 3MV8D 3BGFB 2YEZA 4NP4H 5EC2A 4GRWF 6FABH 2YN5A 3MGOB 3G5YA 3V8CA 5E6ID 3CZFB 4L8BB 4F8QA 2IF7A 2AGJH 2B4CC 1DQTA 4BQCA 4MLIA 3LMJL 5EO1A 4HMEA 1IBGL 4XPFH 1DP0A 3DX7B 1CQYA 4QWWD 5I8OL 4OSUH 3SE8L 3SE3A 3DMMA 1BX2B 3ZZ1A 3VWJC 1YEJH 5CD5D 5H35B 3NPZB 1IT9H 1YJDH 4APQD 2AI0L 3WO3B 2EC9T 4QYOB 4NKDB 3WDJA 4BSJA 1QBLL 3ARDC 1TJGL 5B21A 3O4LE 2GJ6D 5HYIA 5EU7E 5HVHC 2HVJA 1F00I 4X6EB 5FHBH 4ZS7L 1I8LA 4NYLB 4KRPC 4IRSB 3G6JE 3O3BB 3EJJX 5KN5B 1NMAH 1IL1B 3BT2H 2JK5B 5E8DH 4XWOC 3DPBA 1N8ZA 1UJ3C 2QL1A 4GRMB 5L2KB 4BQ8A 3V4UL 3ARGB 1GHFH 1A5FL 5EU4B 5BS0D 3NACH 3TZVD 2DKUA 1AIFB 2BOBB 5JIHA 5LWYL 4M3KB 4V1DA 4JFFA 1J0IA 1HYSC 2NCMA 5HYSA 2WUCH 5K9QG 3S3SA 5KTEL 4RAHA 4GAGH 4ODBD 4HG4J 3RI5F 3L3DA 1EFQA 1CT8B 4POUB 5FK9B 3R8BB 1RURH 1QFUL 3FAWA 2CMRH 3NZHL 4M5YL 1I1AC 2B4CH 3GSOA 1JZ3A 2PYFB 2VZ1A 4JFYA 5KVDL 5ACMA 3CLEL 3W9EB 1RUAL 4DN4L 1GGUA 3WFBL 1XCQA 3QRGL 1UVQB 3C8HA 3IRPX 4UDTA 3REVB 5ESVB 3N85H 1BFSA 3L9RB 4H88L 2VN7A 5J13B 1DBAH 2QADC 2ZOLA 3WSQH 2XQBH 3MR9B 3NTCH 2MQ0A 2MPAL 4FFYH 1MHHA 1XIWB 2Y25A 4KI5F 3L3OA 5I76B 3IYLW 1XGPA 4MGXA 5SX5K 5D1XA 4PYGA 3HE6B 4P5TD 1S9WA 4LFHD 2MHAB 4FS0A 5CMAB 3EYQD 3FOMA 1KJ3H 3I75B 5EPMA 3QWOB 3HR5A 4NNPL 5D1QD 4WWKC 2IQAA 5EA0H 1OW0C 1B6UA 3P9MB 1SY6A 1H5BA 2PTTB 1Y0LB 5JOPD 5C09A 2E6PA 2OXGA 3F6LA 3S98A 4KKCD 1TVDA 2EDNA 4PJ5E 4UOW0 5D7LA 4M93B 4PLKC 2HAZA 3V4PH 4NM4L 4MAYC 4QXGL 4AYFA 2DBJA 4QTHB 4KUCD 1WGOA 3DETD 1NAMH 3C60D 3HRZB 3PWUB 1I8MB 2YPLB 2Y36H 3A67H 2ICWA 5DMGD 5IV2B 1HXMB 4ZDHB 4KK8C 4P46A 5TQ2L 3VDAA 3K1KC 5HYJB 4C55A 5HXMA 3OJMB 2BHZA 2VSDA 1V05A 5GGTH 3RQ3A 1MAJA 2H2PC 3QPQD 2J1KA 4YBHA 1BQSA 1OTSC 5F9WB 3F5WA 2K9UA 2YD1A 1MFBL 3BD5A 3O9WA 3I6GA 4GKZB 4X5LA 2FB4H 4NQCD 1HHJB 5F88B 3WDHA 4P5KB 5DHXB 4HX1A 4XC3L 4XNZC 3MODL 5JA8B 4PJEA 3D9AH 2DQCL 1RK1B 2AJYL 5IF0B 1SJVA 2Z93A 3ULSB 3BRFA 4MJIB 4D9LH 1ORQB 2ZCKL 4L8DB 5LGJB 1P4LA 2DL9A 1BECA 4KXZI 4EXPX 1F3RB 2AJUL 4JRXB 1U8NB 4GG6A 1WAAA 3NH7H 5FUZL 4NO0A 2AW2A 3L5XH 4GH7B 1FNFA 2KQNA 5IG7B 2PNDA 1DBMH 1JF1B 4LASH 2AXFB 1MFEL 1UWXK 2Q1EA 1MCEA 1ZT1B 2BVPA 2D7PA 3UYPA 3VFOA 1Y6NR 2VUYA 2CGRH 3ZTJH 4R8WL 2Q7YB 5AAWA 3ARXA 4ZTPL 4NPYA 3UPAA 2BY1A 1CZ8H 4AIOA 4NQEE 2VDNL 4OFKA 3L1OH 1P7KB 4NUGL 4FZ8H 4LQFL 1OGAD 5F3HA 3S37X 3T04D 1I1YB 4WJ5A 5ESQB 2NY5L 4PJ8C 5HSFA 3EFDL 3NAAH 3ZKSD 5SWQA 4Z7NE 3NCCB 3RGVB 3F62A 5DFVD 4P0DA 2APTA 4XTRC 3ZT7A 3RVWC 1CLCA 3FQXB 3KNBA 5CHNB 1D6VL 5F7FA 2NZ9C 3VWJA 4Y2DB 1JRHI 1S7QA 3QI9C 3B5TA 1DUZB 5F8RC 3QUMH 3ARDA 3Q5YA 4ZAKA 4XPAL 3V7AE 3SEPA 4X7CC 4U7SA 3TBWA 1HSBA 5ICZB 8FABB 1KCVL 1MI5A 3SKNB 3KYMA 5GRUH 2Q8AH 2R2HA 3TO4B 1OAXL 1C16B 1S7RB 2EDKA 2GSGB 3IDMB 1CWVA 4PRDB 2FX9H 2EEAA 3DSFL 2E7CA 1ONQB 1QSEE 1J0YA 3BW9B 3GSUA 2CR3A 2J8UA 1EZVX 2WBJC 4ENED 4IOSD 1FFPB 4P4RB 3ARPA 4HWBH 1T7WA 3QHTC 4PRBA 5SWZA 1S5IH 3VA2C 4U1KA 4ZXBC 3TP4A 3VXRD 1FC2D 4NCC1 3BIBX 5SX4I 4TUKL 3IXAB 3QA3A 4FFWD 1FNSL 3K8KA 1I1AA 43CAA 5ISZB 3CAFA 3MLVL 5GGTA 3D6GA 2EDRA 3OV6A 5JTWA 4JFEE 3VWKC 5JXED 4S1QH 4PY7B 3LZFL 2Z8WC 3SDAC 1F8TH 2VZ3A 3T65B 3LKRB 3RWIB 4DVRL 3FCTB 1JWMA 2PO6B 1GC1C 4TPRL 5FO9B 1OVZA 1JNNL 1ZHNA 1MHCA 1KJMA 2BY2A 4ORGB 4R90L 2DQHH 4N0CC 5C0BD 3TT1L 4NO3A 1FYHB 1Y6MR 2E27H 1NBYA 1XGYL 4N9GB 4PJHA 4OF3A 5I1GL 4H20L 1ZHLA 4X6BA 1R3JB 1E4KC 5H37H 3WUWA 3B6SB 4M8QA 4WWKA 1OW0A 3X13A 3MRHB 4CDHA 4FFZH 3UPCA 2ZZUT 3UPRB 2FJFB 4HS6B 4PBXA 1KLGA 4DZ8A 3TBYB 3DUHA 3WKNA 4F37F 1VPOH 3UDWC 2QLVB 1UWEL 2Z9TA 5I1DB 4P57A 2NXZD 4OF0A 4CNIA 3O2WH 4GJTB 3U1SL 3A6BL 3OKDA 3UCRA 5DSCB 4HJ0C 4JDZA 1LEIA 4PJFB 3TWCH 3S96B 5EU6B 1JPSL 4OF7A 5KG9A 3RVTC 4OIIL 4JM2B 2MCG1 4OI8A 4YFEA 2XWTA 2CO6B 1WWAX 4L4VE 5D70L 3RNQA 4O5LH 3MOAL 3B9KD 5GHWH 4PYHA 4GG6F 4ELMF 3O6FD 4GMSH 3C5ZD 3ROOB 2CUMA 3EYOB 3FFDA 3ZDYE 3S7GA 3ARQA 1GC1H 3PQYA 4NM8L 4PTUA 2VLRE 4WTXA 5DRWA 4OZFH 1ZT7A 4DGVL 1G7JA 1FYTB 3QUMA 1KNOB 2GAZA 1DFBH 4JFPA 3TA3B 4KVNH 1Q9OB 2NY3C 1BJMA 2D0FA 3H3BC 2D7OA 5FCUL 5K9OA 5DZNA 4PJGB 1B0RB 4XBPA 4JFHD 1U8LB 3E6FA 1HH6A 5J7CC 5BRZE 5IVXA 2Z0BA 4NJ9H 5KBNC 5KANI 4QF1A 3EYVB 4LP4A 1CGVA 5KJRL 3L3IA 5IMLA 1U95A 4ZPVA 5FUCE 4CUCA 3WLWD 1H15B 1KIPB 3SO3C 1I9RL 4IOIB 4U1MB 2R29L 3BZFB 4G8FB 2AJSL 2FGWH 3W5MA 5D5ME 2EE3A 2SEBA 2YKLL 2GTWB 3KR3H 4HWBA 5DJAA 3RWCA 4JREB 1CG9B 1CICC 3MCKA 4P3DA 2R1WA 4R4BB 4PJAA 4N90E 2G9HB 2IPTL 3O3AA 5I1LA 4PJ8A 5HD8C 4G9FD 2AJXH 4W6YB 2ZCHH 2X10A 1P53A 1FAIL 1AD0A 1N5AA 1Z3GL 4L4TD 4LAQL 5F9AC 5GQBA 1H0DA 1OGTA 2J8UF 3NA4A 4OCLC 4OCMC 1JN6B 3S36L 2VC2H 3TBVA 3UTTE 3QI9A 1LE5B 5HYJE 3DNKA 4YBQD 5DEGA 4KK6D 5E56A 5FECB 3VFNB 4NQSB 2DKSA 4FTVD 2I9TB 4WUUA 4RIRB 2HJFA 3CZJA 3QEHA 4E42B 2YK1L 3RWHB 4NIKB 4JVUA 1Z6JT 1DANT 5BMFH 1TJHL 2XV6B 3MNWA 1PW3A 3AB0B 3KPLA 3DBXB 2M8XA 4PGDA 5JQ6H 3B5HA 3MV8A 3ES6A 4ODXB 1WZKA 2QEJA 3BP4B 5I66B 2WBJA 5C0NC 4TUJA 2WQRA 3TO2A 4P49A 3V6OC 3V79C 4F7CB 4DQOL 5FKPA 1RU9L 4PREA 5E6IA 1EVUA 3WFDL 2A9NL 3Q5OA 4ZXBA 4M00A 2EYSB 5AYUL 5HI3C 3OKEA 4GRWB 3S4SA 3SDDD 3H9HB 4XZUA 1JI2A 4LLQA 4FQ1L 3QUXD 5DHYB 3VGHA 3MLTA 5FB8B 2P8LB 1GZQB 4RISH 3VJ6B 4Q9QH 1NGQH 3IS0X 3HI1A 2F5BL 3Q2CA 4CVZA 3SDAA 5CCKL 3O45B 15C8L 2NY1B 3O4OB 4H1LG 4UV7H 4APQA 2YUXA 5DO2C 5T1KA 4XPTH 4KHTL 2IFFL 2D7MA 3TC9A 3AAZA 1TPXC 2NY0C 3C09C 4AEFA 3HNSL 4EOWL 4R96A 1QSFB 4OV6F 4GKOA 1NDGB 3IVKB 1X4YA 1FZMA 2IAND 5ELIA 4G8EB 4XP5H 3IFOA 1E4KA 2YBRB 3ECBB 5T3ZD 1XEDA 3IGAA 5F1NA 3B2UD 4CRPA 2BXYA 2YUVA 4MCZA 1E4XI 5DZLA 4KXZH 3MBXH 3QNYB 1S7VA 2FYYB 3I2CL 1HI6A 4NRZA 1WZ1L 3UXFA 2G75B 1Q1JL 3L5IA 5C0IB 3T77A 2V5MA 1OAZH 2OSLB 3RTQD 3UDWA 1FN4A 1L0QA 4NFCA 1U8MA 1MAMH 3MRFB 1JCKA 2FBOJ 7CGTA 4M6OL 3MRPB 4YFDB 1A7RL 3RVXC 1CDUA 4HWEH 2ZSVB 3QUZB 3SDXF 1FLRH 3M8OH 1DN0B 2ADGA 1ZLVK 2W91A 4QRTB 1F02I 3ZHLA 4DN3H 4XCFH 4HH8A 4POYA 5HGBB 2R69L 1KYOK 1QEWB 4IIQB 1QYGH 3RJDA 4HUVA 4JFDA 1LO3H 3V5HA 2X89D 5D7JD 3QEUB 3MLSH 1AXTH 1KJVB 1HDMA 1YEIL 4JG1L 1JRHH 3MCLH 5JXAH 3UTOA 1B6DA 3MRBB 5IMOB 5IFAH 2DWEB 4QT5B 5D1QA 1EEUA 3RWEB 1L0XA 4PJXF 2B39A 3ZE2E 4PJAF 4Z7OF 4GKSA 2ADJA 1YMME 4KPHH 1V7MH 3PE9A 5C6TH 2ENSA 1BOYA 4PV9A 2YMXH 1J86A 5HHQA 5HHXL 4B0MM 1JYXA 3IDIA 4FQHB 5HYSG 4CW1B 3S3JA 2NY4B 5MEOB 1JZ6A 5CBEB 4MAUL 2HP4A 1WK0A 4GOSA 4I3SL 5H94B 1MNUL 4HS8L 2GTZB 3OG6B 1CICA 2HT4C 1EO8H 4GSDL 4UILL 1YPZE 3NABL 4LPCA 4P9HC 4PRIA 4PB0L 2I9LB 3EO0A 3KXFA 3MUZ1 3QO1B 4H1LB 3O3UN 5C0CE 1MCBA 1V3LA 1KPVB 1TITA 1MJJB 3CFEA 1XZ0A 1RJZB 5DR5L 1D5XA 4QGTA 4D3CH 4QHLB 4NQCA 5CD3A 4YHYB 1ZV5A 2NW2B 1EX0A 4OLUH 4UIKL 3HN3A 1RULL 3VI4F 1PLGL 3OX8B 4Y19B 3O6KH 1KF9B 5DEFB 4MJ6B 3FN0L 1OM3H 1C8PA 2VB5A 3EDEA 3AXLA 2M2DA 4JFZL 4XWGH 5DJDA 3ZTNH 5I19H 2YEZB 3BWAA 1J1XL 5IHLB 3CH1B 3H3PL 2FGZA 4XX1G 1IAKA 2B5IB 3RPIB 3T0XA 3G5YB 2X05A 3HCVB 5EZIH 1OWRM 1RZKC 3RDTC 4GFTB 2O5YH 5DTFA 4OAWA 4RFEA 3EHBD 4M7LH 1I7ZB 1V7NL 2X4QB 4K7FA 1DQQB 1FYTE 4FQXC 5IHBA 3I9GH 4O9HL 2Q3ZA 5DGQA 3V6OA 5LVEA 5ID0A 4CU7A 2EO1A 2MQ3A 4PJGE 3QXAA 3FZUC 2BCKA 4WHYH 5CIPH 3CFBA 1OGAA 1QFWL 1F4YH 1MAKA 4P9HH 3R0MA 1VGEH 3O3EA 4Z7QE 3U4AA 1MLBB 3HE7C 3NA9L 4U2ZA 3GB7A 2VKXA 3U82B 5LXGL 1CVRA 1DQJA 3PL6C 4PUBL 5JIIA 1UM4H 1EA9C 1FZKA 1UB5A 5I16A 3MRMA 4F9PC 1KEGL 4UAOB 2XKUA 5TFSL 4DVBA 3U0WH 3SY0A 1IGYB 2NXYC 3HG1A 3LKSA 4BJLA 2IJ0C 1DUYB 2VO5A 5AEAA 1MCSA 1HKLL 4DGIH 3QFDB 3WO4C 1A2YA 4I8DA 4V1DB 2VXSL 1MCIA 4OCRL 4AJ0A 1MCWM 4FOMA 5HYSB 5GRJH 5A40E 3QFJE 4DKFL 4AIXA 2BSTB 3CFJA 5JW3L 1T66D 1T4KA 1IAMA 3D69A 1XGTA 5EFIA 2PTUA 3RIAK 2F54D 4QNPE 1N64H 1RZKH 3HB3D 1FVDA 5D1ZC 2VLJB 1A6WL 2Z91A 5FOBB 3IDJA 4M61B 4Y16C 1DSFH 5IVZB 4YDKL 3RNKA 5T5FH 3S5LG 4C56A 1GGIL 1AR1D 4LSVL 3FO1B 8CGTA 4YC2C 1OD9A 4AT6A 5D2LE 3EIFA 4RDQF 4XI5C 3CVHH 4YPGA 2ZOLB 5B3NA 1JPFA 1L0YA 1NUNB 5MEQA 4YR6B 2EYTA 3L3OB 4Q6IC 4AG4H 1BBJA 1RZJL 3DX9A 1S9WB 3K1DA 1T22A 3FOMB 2VUOA 1T03H 2GW5A 1MCLA 1YEHL 2XKNA 2G2RA 3HR5B 1ULVA 2YD6A 2DM4A 3J7HA 4Y4HB 5C09B 3PIQB 3L3KA 3MRRA 3RU8H 2BK8A 4ZD3L 3ARBC 2EDHA 2B0SH 4LLDA 3TESA 3IETB 4BH7A 4GRWE 3FO0H 3DROB 5F21B 4K7PH 4KROC 1QPPA 3MLYL 3VMPA 2GY7B 4LLWA 3SN6N 3MRJA 3O6ML 1UFUA 2UZIH 3BP6A 2C3WA 1F58H 3LQMA 5LBSL 1LEGA 1N6UA 5EOTB 2MJWA 4NZTL 1CS6A 1PG7L 3EOTL 5HGGS 3T0VA 3WIHH 4XVTL 1QSFE 1WIOA 3ARFB 3BN3B 2A38A 1MF2H 3F5WB 3HZVB 4LLVA 1EGJL 5BOPA 4QXTB 1Q38A 3DRQA 1NCAH 1D9KC 2ZOKB 2Q6WA 3GSVA 2J8OA 2EH8L 3I6GB 2NY2B 4HJJH 1NDMB 4HXBL 1A64A 5CIPA 4WUKH 3QIWD 5E4IA 5F89A 3P0YH 3HTLX 3EDFA 3SDYL 1QRNA 5LKNA 1OL0A 3U30B 1MY7A 4YHIA 4FABH 4U1IA 4XP6L 2LFGA 5FKAA 5DRXA 4ALAL 4QRSA 3ZSTA 2ZJSL 5ACZA 3ARRA 3IB4A 3LKQA 4TNVF 1GIGH 4ZUSB 1JGUH 2HFFB 5EBLA 2P8PA 4GG6B 4ELMB 2ATKA 5BVJB 4FXKA 2GKIA 2FHCA 3EO1B 5IFHL 3BSZH 3CJJA 1HKFA 1FIGL 4QXUL 4Z0XA 4UU9A 1Z5LA 2AXJA 4ZPTA 1CDCA 5AZ2H 1AGEB 1OTUD 4S1RH 1KIQB 1FPTH 2BVPB 4QRQA 4ODSL 1BF8A 1AQKL 3P9LA 4P99A 3OKOA 2CLZA 5C9KA 3QFJD 3FMGL 4NPYB 3S5LB 1CCZA 4EUPG 1MLCA 4LAJH 1Q9LB 1MFAH 3BH8B 3LEYH 3P11H 5F3HB 3RDTA 3QBTB 1E4XH 1E27A 3VFMB 4KZEL 4AIZB 3OZ9H 1S7TA 1IEHA 1RZFL 2K7QA 1D5IL 5IT2L 2E6JA 4ZSOE 3KPOA 4FQXA 4QRPA 1QLRA 1I9JL 1WQVT 3K2MC 4P2OC 2P24B 4QCIA 5GGUA 4HAGA 3CVHA 1K9TA 1CR9H 1S7QB 4F33A 3IRZA 5ENWA 3L95B 4Y4KD 3MLXL 3OGOE 5FYLH 4CADA 2P49B 4MNQB 4G9FA 3TBWB 4Z7UA 5IESH 3HE7A 1HSBB 1YECH 4TULH 3MUJA 4P3CL 1OPGL 1J9CT 3PL6A 3GGWA 1LO4H 5GRVL 4AK1A 2R2HB 1UJ3B 3UAJD 1U3YA 3L5JA 3H42H 4KRNA 2ZCLL 1A4KB 4JE4B 2VITB 1KELL 1QOKA 3FB6A 5I8KH 1MCNA 4FTVA 4IHOA 3W0WE 4NJAH 2Y72A 3MV9A 5C0RH 4X4YB 1NAMB 2XI9A 1NLDL 3EJZC 4J23A 5SWZB 2HN7A 1SYSB 4U6TA 1U8HA 1VFBA 1UJTA 4ZODA 4P2RB 3L3GB 4GRLC 1MEXH 3CH8A 5FYKD 3O3DB 4LRNH 1N6VA 5D1ZA 1I1AB 1Q0XH 3F7YA 4OLWL 4LSRL 2AJZA 5AWNL 5ANMB 5EBWB 4Y16A 3QEQA 3LKPB 2IALB 1A1MA 4FQLH 1DBBL 1DDHB 1HOCA 4YO0A 1RPQA 5JLZB 1JWMB 4N9OB 1HEZA 4OD2A 2AP2A 4MXVE 3ARVA 3TBTB 4U1JA 1IC4L 3D0LB 2QADB 2APVA 1UXWA 1ZHNB 3VD4A 2VWEC 4BZ2L 1ADQL 3O8XB 1NBYB 5KAQG 1JZ5A 4YHMH 5C9JB 1HH9B 1G7QB 1QBMH 4F7TB 2O93L 4DKAA 1OSZA 4UNVA 1CD0A 4DZBA 3X3GL 1UCBL 1PDKA 1I3VA 2P5EE 2R2EB 4M8QB 4WWKB 2VDPL 5E5UB 4HIJB 3O2DH 4PJCA 1WCQA 3X13B 1Q0YL 4FHBD 3TEUA 5KSBA 4DZ8B 3G5ZA 1KTRL 5EWIH 2F53D 1CDHA 3MSPA 2C1OA 3QQ4A 3WNMA 3T3MF 1OAKH 4EUPB 2A83A 1GPOH 5HDOA 2OR9L 4MAYB 2P42B 1NMBL 4P57B 4XP9L 3E2HC 3KYOB 3EYUH 1YEKH 4LSQL 4C4KO 4CNIB 1SM3H 5E8EA 2Y7QA 3BP5A 1CFNB 3GZKA 1P4IL 4O2CA 3UJTL 4H0HB 4BZ1H 2Y4SA 5DQJA 1P7QD 4JDZB 12E8H 1KC5L 3FT2A 1OHQA 3JV5A 4S11A 5KG9B 4GXUN 2FSEB 2XWTB 1LE9A 5GS0D 5DDHA 1AFVH 2WAHA 3NIGF 4HAFA 4MD0A 4LCCC 4AQ1B 2MQCA 1CU4H 2IAMA 2Z31C 1EIBA 2EE6A 2VISA 5I30H 3ZE1F 3QIBC 1A7PL 3PQYB 4KAQL 4U6HB 5TDPA 5T33H 1ZT7B 4XNZB 2JELH 3QUMB 4TSCH 2GAZB 1IM9D 4S0TD 1KJ2L 4XAWL 2VLJE 3WFCL 2ICES 2AJ3B 2UVFA 3UP1A 4UV4H 1NCNA 2IH3A 2XOTA 2KBGA 3SDXB 1NFKA 4A6YH 2XQYK 1A6ZA 1EUUA 4OZFG 5HY9B 3IT8D 3GSWA 4WU5B 3S88H 1UB6B 1NMCC 3FQTA 4KJYA 1CDYA 3L3IB 1U95B 4EVNA 1G6RL 4N8VA 4RMWA 1JFQH 4JJ5A 1K2DB 4I18C 1OAYH 2R4SL 3I50H 4MQ7A 3EFFA 1IBGH 1C5DA 1MJ8L 1AR2A 3UO1H 1WVZA 5F1IA 1CE1L 4KH2A 2SEBB 3FN3A 2ESVA 5DJAB 1WC7A 2ITCA 3HPLA 3WS6A 4PJXB 4HIHA 1RJYA 2R1WB 4PJAB 1NFIA 1GZPB 3IFNH 2AI0H 5ERWB 3VGAC 5T1MB 4HPYL 3VGEA 4Y4FC 1TJGH 3U9UB 1QG3A 5DJYA 4QLRA 1RZGA 1V3MA 4PJ8B 3X11B 1YEGH 5EN2A 2XTJD 1QKZH 3I6KA 1KXVC 4HGMA 4MA8L 5GGSB 4RGND 3VW3L 2VQ1A 1GGCL 2OQJB 4P2OA 3IDYC 5F96L 2CJUL 2R1XA 4GKNA 5MEPB 1H0DB 1OGTB 4X7FC 1MIEL 3V4UH 4IDJH 3QI9B 1E6JL 1A5FH 3MZTA 3T0ED 5DEGB 2H32H 1F6AB 3JWDL 5DI8A 4GMTH 5FHAL 4WUUB 4MNHB 3T3PF 2HJFB 3CFIC 5KTEH 3CCHA 2Y23A 3P4LA 3WXVH 4HQQL 4BFGA 3O2DA 5T3XD 3BIKA 4R0LA 2XZQH 1NC4A 5A2KH 1BFOA 1SJEB 4U3XA 2X44D 3GMPB 1F3JA 1WITA 5IJVA 4PGDB 4OKVA 4Z18A 3ES6B 1RV6X 4EI6B 2H8PB 4DN4H 1ZEAL 4EDWL 4TUJB 1JHKH 3TO2B 4HC1A 4HUXA 3LD8C 3AS0A 3M1BA 3QRGH 1R3HA 5EZLB 3K0WA 3PWJA 1U58A 4NWTL 4ZXBB 2R8SL 4DEPC 2EDBA 1RIVL 4GRLA 4X99B 4GG8B 3SE4C 3VE0B 4JGMA 4YFLI 3OKEB 3VFRA 4IM8A 3FTGA 1HQRA 4XVUC 3O2VL 4PJCF 4JQVC 1F97A 2R15A 2W60B 3VWKB 1MHEA 1BD2B 4CVZB 4NNPH 3SDAB 1I4FA 5DXWA 3GSQA 5DMJB 2W1NA 5T1KB 5B4MD 1H3UA 3AAZB 1IC7H 4OZFB 3QDMB 1PSKH 1S9YA 3LRSB 3F8UB 4R96B 4L5FH 3KWWB 5F97E 2DQGL 2AV1A 3NFNA 4ODHL 4LSTL 2DB8A 4JO3H 2DS4A 4NM4H 5CJ5A 4EBQH 2HKFH 1JMZA 1NCCH 2VLLA 3K80A 3RZCC 4DUVA 4ZO9A 4FMKA 5CEZE 4OZGE 4A6YA 1U3HD 3DUSA 2DL2A 2C3XA 1IQDB 5F1NB 2R4RL 5B8CC 1HN1A 4LMQE 4ODWA 1JMXA 3D3VD 2VDMH 5CGTA 5LQBL 1FRGH 3NZ8A 3D18A 4D0BB 3KPMB 2P46B 3IU4L 1V3KA 4LPWA 3CK0L 4MNQE 4EEEA 2EXYD 4HGWB 2C3HA 4K3EL 4FQIL 4JO4H 3WXWH 2CKNA 4P2QE 5DD1L 4MXWH 1NPUA 2A0LD 3NIFE 2OL3L 4LLYA 3RAJL 1H8OA 3SBWC 5DK0A 5DJ0B 3GSXA 1MPAH 2AJYH 3U46A 3V6FA 2RCSL 1JTOA 2ADIA 3F12A 5JZ7D 1KLUA 4LCCA 4Q0XL 4R26H 5DJ2A 2Z31A 3NPSC 4HFWB 3V5HB 1HK6A 4PJ9D 2V2WA 3QIBA 1INDL 4NKMA 1HDMB 2B1AL 4P2RE 2DQDL 5DD3H 3MJGX 4F7MB 5J6GA 1FBIH 5KS9A 1IAIM 5I1IH 2NY3B 3BPOC 3DX6A 1IRAY 4QHNB 3PHOA 4ZNEA 4GKSB 5ANME 2ADJB 5FYKL 2XY1A 5JW4Q 4UB0H 4OCYL 4PV9B 2ORBH 2C3VB 3JUZA 1PY4A 5HHQB 5IIEB 1VACB 1MH5A 3IDIB 3EZ8A 4U1GB 3QWRA 3SCMC 3SO3B 3LKNA 4F8TA 2P44B 3EFDH 5JNYA 1KPRA 3BOVA 5I71B 5E6YA 4NQDD 4OGXH 3WJJA 1WT5C 5AD0B 1CICB 5ACLA 1IC5L 3WIFA 4HD9A 5MP6H 4PRIB 5DWUL 3EO0B 3G08A 3KXFB 1G0XA 4Y4FA 5C71A 5HDBF 3TCLA 1I9EA 2AEQH 3CFEB 3D1MC 1IGIL 4NBZB 3WNLA 3QG6B 2DQUL 3VXSB 1JGEA 3OKKA 4MDJA 2MWCA 1B88A 1C7TA 4JRYD 5HTSA 3HZKA 4I13B 5CD3B 1MCJA 1KN4L 3OXRA 1X5GA 1UH4A 5I1KL 5CLTA 4YDJA 4RFOH 1BOGB 1UM6L 2YWZA 5DURD 5DZOA 5HI4D 3AXLB 4LCWB 5DJDB 5AG9A 4JZJB 4KKLD 3BWAB 5D72L 4E41A 2QSTA 3BVNA 2RHEA 1UWGH 3RA7L 4ELKA 5FGCE 3AU1A 5GS0L 5DTFB 4GBXB 3VFWB 1S7XA 3GI8H 1KGCD 4I4WB 3MLVH 1PKQB 3QJFA 5F7YC 4LIQL 2WMPA 4K8RD 1TVBA 1I7UA 4U3CA 5CKGA 2XWBA 3ME0A 1WIPA 5ID0B 4KZDH 4AL8L 4OUUA 4DVRH 3QXAB 4JR9L 4GQ9L 5FYJU 2NY6B 1YEDA 4TTGA 3EOBA 4U1LA 4YQXL 3JBG7 5TF1L 1ZLSL 1IGJA 4XPGL 1B0GA 1NCBL 5TE4H 1GXEA 3SE4A 4R90H 1CF8H 4UTAL 3KPRA 1KB5H 3LQAC 3I6LE 4H20H 3B9AA 3P30L 4PJBE 1DQJB 4JQVA 5F7DA 4MA1B 1P84K 4WHYG 3TVMC 1W72B 2D9CA 1UACL 4WFED 2E8YA 1J0KA 1QVOA 1T83C 1UB5B 1FZKB 4P2CG 5E5MB 4HK3J 1LO0L 1ED3A 2YA1A 3PP4L 2NY0B 5DK2A 2BVEA 3LKSB 4F15C 3M17B 2QQKH 3QDJB 4N0UA 3HNTL 5J3HD 4JJHA 2DQFA 4HJGA 3MNVA 1UWEH 3RZCA 2JJUA 4NUJA 2NNAB 3EZJB 2YS4A 1KOAA 5AZEL 2YHGA 1DEDA 4X4XA 3MRLB 5B8CA 1DVFD 3RVUD 4CBPA 2CDFB 1NC2D 1YUHA 4P5TC 4TVPD 1FVDB 3BHBA 1AGBA 1MCOL 3O0RL 5EU3A 2NW3B 3L5WA 3BEWB 3MOAH 3PGDA 3RNKB 3STLA 3MA7A 4C56B 5EZOL 1TDQA 4G8GA 4PGCA 3ULUC 3ALWA 5KANG 2NMSA 2CLRA 2L4OA 1WFOA 1YNKL 1CK0L 1LDSA 1P69B 4OI9A 4YPGB 3VXNB 2AK4B 1JPFB 2B2XL 5MEQB 3KPSD 4HKXA 1S9VB 5KS9F 2EH7H 2EYTB 4RWHA 2XN9A 2EE9A 3MLWH 1A9BA 1NCDH 3LQAH 3DX9B 1FAKT 3KPQA 1T22B 2ENYA 4KUZH 1NCTA 2MOVA 2KH2B 2JE8A 2XKNB 3S35H 1NBZA 1U9KA 2V5YA 5INCA 4XC1H 5T3XL 3OAZH 2BNRE 4XHQA 3VI4E 1IC1A 4Y2OA 1FG2A 4NHUA 5HHVL 4BH8A 5F71A 4OTXH 1VGKB 3OL2A 3MRRB 4KJWD 1LP9A 3TIEA 3BDYH 4L29A 4UQ3A 5C0DB 1G7HB 5E70A 3D39B 1I9RH 1MUJB 4W4NA 3VFTB 1CIDA 4BH7B 4XRCA 4I5BA 5CP7B 5DD5L 2IFGA 2BNQE 3KYKL 1A8JH 3BO8A 4JZOB 2ICCA 3MRJB 1BD2E 2VTFA 3VRLF 1G9NC 3BP6B 5IBLD 1ERNA 2VZTA 4LKCA 1N26A 1LEGB 3X14A 4CJ1A 4J3UA 4JLRB 5EU7C 4RBPH 3SCMA 5D6DA 4GXVL 1KN2L 1NBVL 4Y1AD 4GUPA 4PTTB 4URTB 2J88L 3ULUH 1X5XA 5C7XH 5L88L 4RMVA 3FHQA 1WT5A 5K9JL 3DRQB 3W2DH 2EICA 3GSVB 5D7IE 5E4EC 2DM2A 2IMNA 2YD5A 1UXSB 5F89B 2CQVA 1FVEA 3MUHL 4Y88A 3MJ8B 3PV7A 1QRNB 4GLRI 2I26N 1KB5A 4YHIB 4J6RL 1MJUH 4JAMA 1RJLA 5DUML 5JW4R 2IGFL 3RUGB 3MV7D 2X4RB 2CIIB 2YK1H 4O2FB 2P8PB 4XCEA 2DMCA 5D7SL 3NFPB 3VFPA 4IRSD 4MB4A 1X5JA 4LF3B 2I60L 1I9IH 4Z0XB 5K59F 1Z5LB 4MLSA 5L2KD 2HT2C 4ZPTB 1OP5K 4GS7C 5C6WH 1MCFA 3MZGB 4WW2F 2GUOB 4QRQB 5DRZA 2AABH 5KVEH 3P9LB 5CJQL 1WTLA 3OKOB 4WNQA 2CLZB 4D9QE 4DQOH 1INEL 5F6HI 3WFDH 1T04B 5IHUH 1A6VH 5GS1C 1G9NH 3QRFM 4NNXA 5HDQL 1MLCB 2VR9A 2OTPA 4HIIB 2EEDA 3SJVB 3WEXA 3G6DL 4EI5D 1QR1A 2B7DT 1ORSA 3GMMA 1CFSB 1E27B 1QQDA 3VG9B 4ZUWA 2OJZL 1S7TB 3ULVE 2UVEA 3KPOB 4PG9A 4FQXB 4NBYB 4QRPB 3CSBA 4MSWA 3UC0L 1PD6A 4B7LA 1TCRA 2F5BH 4FG6C 4QCIB 4QRUA 5EG6C 3NIDE 3N1MC 3MLRL 1XF5A 2EIBA 5I1CL 4ODVH 4G5ZL 2IPKA 3QZWG 1Z0MA 2R1YB 3LN9A 4RWYH 4UUJB 4QHKI 4P5MA 1YNTA 4XHJC 4EOWH 5E9DA 4EDXB 3GJFH 3C6SB 3QG7H 4NNYA 2FL5B 1U8KB 1BZ9B 3HE7B 4LOUC 4C58B 4HWZB 3HE6D 3H2WA 2GIYA 3TVMA 1TZGH 1EMTH 5BCAA 4FFWC 3G5XA 2YA0A 4Z77A 2ZNXA 3W82A 2C3GA 2NXYB 3FB7B 5F8QC 4UT7L 4ZUUA 1M6OB 1Q1JH 4F58L 4IHOB 3WO4B 5GS2H 1AD9A 2NX5B 2EECA 3WFEL 4XNXL 3QYCA 2IMMA 1XGQB 3SKJL 3UROR 1CGSH 3ARTA 4N8VG 1J0ZA 2HKHH 2O5XL 4L8SC 4PRHE 3D5OF 5C07A 2AXGA 3M07A 4WI4A 3V4VL 1FP5A 4F7EA 1Y18A 2PYED 2YPLD 4ZFFA 3BH9A 1S7SA 1J1PH 1JPGB 3F7YB 25C8H 1AGCA 4R4FH 5IGXH 1YY9D 4L3CA 4M7JH 1WUNT 2QJDA 1NGZB 2E9JA 2OTWA 2V2XB 3EYFB 3B9EA 5JIPA 3P77A 3SGEI 3VFSA 1A1MB 5E2WL 3JV4A 5HI5C 5ICXA 1N3NB 5HHOE 2ED7A 1HEZB 4OM1H 3GO1H 4U1JB 4X5WA 3MRNA 4Z5RA 2AK1H 1FLTX 1UXWB 3FQRA 3MMEB 4F57H 4Q6IB 5JHDB 2WM0A 3REWA 4KVCL 1K4CB 4N8PA 4P2YA 3BKJH 3MYJA 4PJCB 4MJID 1OT1A 4MZ2A 5MI0C 2VZSA 4MS8C 1IMHC 3BE1L 4MHHI 4YZFF 4AMKL 4HCRL 4JRXD 3ARBB 4EN3D 2VL5B 2YXMA 2EDQA 2K7PA 2A83B 3DGGA 5DD0L 4UT6L 3CXHK 1W0WB 4HLZH 4M1GL 2FBJL 2Y7QB 4O2CB 3KHQA 5F93C 3CMOH 1FH5L 3IFPB 3QHZL 4D9QD 4UILH 3DXAE 3NABH 4RX4A 4QOKA 5LCVH 3NOIA 3O4LA 3PDOA 4UIMB 3GMRA 1LE9B 3ALXA 4Z7VE 1HZHH 1MRFH 4Z76B 3QZWB 4RNRB 3PWPB 1DBKL 3QDJE 3G6JA 5DR5H 2CKBL 1PG7W 1HILA 1DQDH 3MRCA 5DJZA 1AXSB 1D9KB 2JJWA 5GSVA 3RGVD 4NRYB 2VERN 3BP7B 1RIHH 3MNZA 1PLGH 3D25A 5GZOD 2YUWA 4HEPG 4OLXL 3VA6A 1RHFA 3GJFA 3FN0H 2HFTA 5A1AA 1CFTA 3VXTA 2V7NA 5HJ3B 2IH3B 2QR0A 3GSRA 5C0AD 2ILLA 4LVHB 3TH2T 1ZKAA 3PG2A 5I75B 5IM7A 1FE8H 5SWSB 1E4WL 3BXNA 4X9FA 1N59A 4KJYB 4Q2ZB 5I1HH 4G7VH 3UTPD 3GKWL 4N8VB 2XG5A 3ESVF 2AK4E 4JJ5B 3B3IB 4FXGA 3TO4D 2AQ2A 3UJIH 4UDUB 5IB5A 4O51A 1PFCA 2F74B 2HRPL 1MRDL 4ETYA 4NKOA 2JB5H 2VDLL 3KJ6H 1WC7B 1NCWH 5LG1A 4XH2A 2XRAL 5GS1A 1NFIB 5GGRY 1SYVB 3LKOB 3BPCB 1K5NA 2AKRA 3L7EA 3BYTA 4OM0H 2DOCA 2HH0H 1RZJC 3N9GH 4FQ2H 5FXCH 3HR6A 1UEYA 3D39E 3I6KB 5CINL 4B5EA 3M45A 2VQ1B 3PXHA 4YX2L 2FH6A 4P2OB 2R1XB 4GKNB 1BZ7A 2E7MA 1KEGH 4PJ5A 2DLFH 3QDGE 3QCVL 5F3BA 3NCBB 2PO6D 3FKUS 2GYSA 3W81A 4YEFA 1HKLH 3C8KA 1S78D 2W07A 5DI8B 2VXSH 4I77L 2ICEB 3VGGA 2WUBH 3QDHA 2E3VA 5A3IC 1IGML 4KKBD 4XBEH 1ES0B 4M02A 1S7UA 4JKPH 5L8KB 1NC4B 1W8NA 3MUGA 3TPUA 2UUDH 3ARGC 1F3JB 1GOFA 5AUMB 2AEPH 5IJVB 1FGVH 5I73B 9CGTA 4J4PA 3U7WH 3ULUF 4PG2C 5DVLA 3O81A 4LDLB 4LP5A 5L9DL 2B8OT 4HUXB 5ADOH 1GGIH 3RUGE 3PWJB 4L8SA 4CAGA 3OPZL 4GW5B 4GRLB 2VOTA 5EO0A 3UX9B 4WV1B 3MREA 4MX7A 2FZ3B 3VFRB 3DXAD 1JPST 3LPGA 3WFHB 3FTGB 3G04A 1MIML 1RZJH 5EU6D 2P5WD 2PW1A 2OM5A 5TQ0L 3G5VB 5ID1B 2UV3A 4ODTH 4JM2D 4NDMA 4R3SB 5DC9B 3BYYA 4J3SA 1FFNA 1BAFH 3L5HA 5DUPL 2D03H 5GGRA 2JB6A 5JPNA 5FUCC 4G6FB 4JZNB 1EXUA 1KCSL 1YY8B 3A6OA 2BNUB 3SGJC 4NZDA 1E28A 1XIWC 3SJVE 4M1CC 4PJ7E 1HHGB 2AV1B 4R4ND 3STZA 3BN9D 2VLLB 1FFOA 1C12A 5EORL 2WQ8A 4LSPH 5GGQH 1QTYT 3RHWF 3PHQA 1IGCL 4XBGA 3TA3D 5C0EA 4UNUA 3DUSB 3L6FA 2LABA 3C2SA 1XCTA 4NQVA 5IWLC 4JPKH 4NQEA 4ODWB 3UTSB 5I6XC 4A2LA 1YQVH 1AP2B 5BV7C 3NZ8B 3G6JF 3D18B 3S37L 1REIA 5KSAD 3MOBL 1K6QH 1J8HE 3LS5L 1RZ8A 2XACC 1FORL 5C8JB 3HA0A 3E2HB 4UINH 2IADA 4MQTB 1EGJH 1EO5A 5MENB 2VLKE 3KLAB 2E7LA 3LEXA 3P0GB 2QSQA 3VH8A 4GAYB 5JO5A 4LLYB 4BFIB 5H2BA 5BVPH 5GJTL 3GK8L 3RZWA 2R39A 5JDSA 3U46B 1T20A 3PGFH 3V6FB 5I1EL 2VDRL 3F7QA 4MQXD 5CWSB 2VXTH 2ADIB 4LVNB 4X4ME 1MFNA 1EFXD 4LCCB 1OT2A 1OARL 5DJ2B 1KTDB 2Z31B 1F4WH 5EOCJ 4IRJC 3QIBB 4YJZL 3QQ9C 4QHUB 5IFJB 3T3PE 3E3QE 5F9JB 3CUPA 5KS9B 1GOGA 5IB4A 3KLHD 2EKJA 3LN4A 2H32B 3FFCE 5L7XH 4GAFB 1OQXA 4Y5XC 3HMWL 1I3RB 5EOQL 2J8HA 3AREA 5E2TL 4QHMA 4I0PC 5C08E 1NMCB 5CSZA 3KPPA 5HHMB 1MH5B 3NCYS 2X6MA 3VI3E 5BV7H 2FIRT 4TRPL 1CFVL 5GGVL 4I18B 3LKNB 4KZEH 1KPRB 2A1WL 1D5IH 1NUGA 4JFEA 1SVCP 4PLNC 3BQUB 1LO2H 1UA6H 1KCLA 5KOMC 4CU8A 3DECA 4POZD 4XGZA 5IBTL 1T0MB 1YC7A 4I2XE 3G9VA 1K4DB 3MGOA 3NFSL 3VGAB 3G08B 4NKIH 1MRCL 3CZFA 4L8BA 4Y4FB 3TCLB 2OBGA 3MLXH 4IBLT 5E8NB 3MRDA 1JGEB 3OKKB 3RGHA 1AKJD 3WMSA 4P3CH 1EVTC 2DLEA 1U8OA 1HIMH 5L2JB 3SGEH 3OXRB 1FV1A 3IDYB 1BX2A 4LPYA 4Y2DC 2Z92B 5F7KC 5FYJE 2ZWLT 1FCGA 1FFRA 1AJ7H 5E2VH 3LSOB 3VGFA 3TV3L 4PLJC 2D0HA 3C6LC 1M05A 3TN0B 2PUQT 4E41B 4NYLA 5D4QA 1NLDH 3PWPE 3DIFB 2MKLC 2BRRL 1H3XA 3O3BA 5KN5A 1IL1A 4KQ4H 4YHNA 4PBWD 1PGRB 3UYRL 4GRMA 1S7XB 1D3CA 3IFLH 3ARGA 2A2QT 3EDJA 5EU4A 1I8IB 1IKFH 4OLWH 2DD8L 3ZKMD 1BVKB 1AIFA 3RVVC 5GGVY 2BOBA 3QXVA 3FQUA 4KV5E 5LGKA 5F9OL 2XWBB 1IAIL 1MREL 4WW2B 1MVFA 4ZUVB 1CT8A 2VN4A 1IC4H 5FK9A 4DEPB 1RUQH 4WEBL 1YA5A 4Z7WE 1AY1H 3H9SB 2Y06H 1ADQH 4OGYH 1N5YH 1P4BL 2PYFA 3SDCD 5DLML 4JVWA 3GRWL 3QUZD 3BUTA 1MCDA 5BRZA 5H8DA 1UVQA 5TF0A 1KTLA 2EDOA 1RFDH 5ESVA 1NANI 2Z8RA 1OAQH 3L9RA 3GHBL 3WE6B 4U31A 4Z7NF 5DK2B 3MR9A 3SGJA 1BWWA 5EBMA 1XIWA 1BM3L 4HHAA 1WSST 4KK5D 3Q5TA 2VXQL 3RBGA 3HE6A 5D5MA 3BJ91 1C5CL 4HJGB 2WIMA 2RGSA 3MNVB 3RZCB 4LEXL 2BERA 4JFFE 5L6YH 5E8PB 1P4IH 1RMFH 3BAEL 2IWGA 1KENH 1DL7L 3UJTH 5SX5H 2ED9A 5IWLA 3I3BA 3HAEH 4RA3A 2PTTA 5A2IH 4ACPA 3BHBB 1AGBB 4O4YL 3EO9H 2X9YA 4JB9H 1F5WA 2IEPA 4E5XA 1KXQE 4YHOL 3DI3B 3ZT6A 3TT3H 3PGDB 3QCTL 3STLB 1S3KH 3MA7B 4HKZB 1U93B 2BFVH 3GNMH 3U4EB 4PGCB 3TPKA 4QTHA 1MFDL 2FX7L 2FEEL 4QRRB 3HRZA 5J4MA 4KWUA 3PWUA 1D7FA 3QAZB 4S10A 1A7PH 4KAQH 2VABA 4CMHC 3UTTA 5IV2A 1HXMA 4ZDHA 1L7TL 4IOFD 3V8OA 5HYJA 3P0VH 2AXHA 3DHJA 1DLFL 2E7HA 4OFDA 1KJ2H 4KTDH 1JHLL 4XAWH 3VFGL 3JWDC 2GT9B 3T0BA 1G7IA 2HFEA 5INCB 2ATPB 3VXUD 1T1XB 2C1PB 2IPUG 4IRJA 4DKEL 2Q7NA 4NKQB 4GKZA 2EXWD 4R7DB 3T2PA 1CXHA 4Z0BL 2A6KA 4P5KA 5T1LA 4NZUL 4LEOA 3K4ZA 5HHNB 1U41A 1E6OL 4KMLB 1RK1A 4HK3N 5I17B 1ZLUH 4G6JL 5IF0A 1RUMH 4Y19D 3BPOB 1CE1H 5KVFL 2FH8A 4Y5XA 1ORQA 5DUBB 5BO1H 1X5LA 1G84A 4ONFL 3ZYJA 3OKMB 1R5WB 2AEIT 4I0PA 4J1UA 1L7IL 4O02H 1YEFH 2XFXA 1U8NA 1BMGA 4LKCB 1R3KB 3K3QA 2XZCH 4HPYH 4OQ1A 5IG7A 3SCMB 5GRYA 1JF1A 1A7QH 3GUTB 1DQLH 3LB6C 4GUPB 3U7YH 1YYLL 4TSAH 4LFHG 1FDLH 2Q7YA 5ADPL 1OTUC 3WIIL 3E1F1 5GRXG 3JWNC 4XAKD 3UTSE 2QTEA 4J2XA 1I1YA 2JKXA 3JWDH 5TPWL 3JTTB 4HS3B 4ONGH 2E7BA 5D8JL 1WWCA 3FQXA 4L3EE 2FATL 2WWKT