4KKPA

Crystal structure of vibrio cholerae rbma (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
VIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAQQESDALTDGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RbmA protein
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
total genus 45
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA01
4KKQA 4BE6A 4BE5A 4BEIA 4KKPA 4KKRA
chains in the Genus database with same CATH superfamily
1XGUB 4N1CA 4J3SA 1ILUA 1J1PH 1F6AA 2EDHA 3OAWA 1NANI 3TFBA 1DFBL 1G1OA 4Y9BA 2EUWA 1KCRL 3Q8EA 5JQ6H 1OAYH 4Y2DD 2I9TA 3EGXA 5CJ5A 2JLLA 2N59A 3QRFM 3B9KC 2LVCA 4KUCF 5J5EA 3BXNB 4Q6IA 1J1OH 1I9RH 4K71B 1WHPA 1DJZA 4JFQB 4BDVB 3II1A 2C3XA 4N0CC 3RPIA 3V9FA 1RSFA 2FL5A 4LOUC 2V33A 1WT5A 2J8HA 4DGVL 1XCXA 2HTLD 3JWOC 1BG9A 3QE5A 3QNYA 4BSVA 4KFMA 1L7IL 3GSUB 4K9EH 3EHBC 3FH7A 2WVVB 4M56A 3K6SA 4ODTL 5D2NC 2VXQL 2IWFA 4KKAD 1P1ZB 2Z7UA 2IWGA 4A2DA 4JB9H 4TNWF 3WIFA 3IDMB 3NFPA 4WWKD 2R2CA 3BISA 4NP4H 3UTQB 1E40A 1TQSA 3V0VA 3FN3A 2DQCH 2ZUQB 4WJKB 3F62A 3F6LA 3BZEB 2E7LA 3DMMA 4GMTH 1THCA 4UQ9A 1FDLL 5EBLA 3ZTNL 2PYED 4U1GC 4L2LA 3PIQB 1JCVA 3N1QC 1S6NA 1GIGH 2YRZA 5EOQL 5F71A 4N0UA 2APWA 1MRCL 5FWRA 4PRDB 1KG0A 3D9AH 3GSVB 3QPQD 5LBSL 2IANE 4M7JH 5T1KA 4RGNB 5H37A 1NEZG 2HB0A 5C09B 1CGYA 3S37L 4B0MM 4FTVA 3ZDXF 2NY5C 4HUXA 2JV6A 3GSOB 1QW9A 1ZTMA 3D39B 4W68A 3CZUB 3HZYA 1X5LA 2GTZA 4D8PA 4A6YL 1GGIL 2PWEA 1NDGB 4L48A 2WYTA 1MCWM 2R56L 4KPHH 4ZO8A 5DS8B 5TFSH 3BAYA 2NY0D 1UOWA 2G0LA 2UUDK 2ZJSL 4PRPE 1DJWA 1FSKB 1UH4A 2VDLL 3LZNA 4LCYB 1AE6L 5J13B 1A47A 4N28A 3OTTA 3EAKA 1G84A 2BSRB 1A4BA 2Y36H 1OE1A 1M53A 2X1QA 1MXDA 4KMTL 3ZQWA 4JKKA 1LK2B 4P4RA 1KCVH 3P9MA 4ZS7H 1JV2A 4KJQC 4EVNA 1N2RA 4XPHH 4HLEA 3W9EA 2EIBA 1NIDA 4PV8A 4UBDD 4RZCB 5AKTA 3K6FA 1E6JH 5DYOA 4JRYD 3NK4A 3OXRA 4Y2OB 2FK9A 4NWTL 3FCBA 2E9GA 3UCRA 4DAGL 1WAEA 3BO8A 4LCCA 3DMMD 4M00A 4LGSB 5LBGA 3RX5A 4HWBA 1H6TA 5D7LB 3CFDA 3WJJA 1TZOA 1GZHA 4BFKA 1ORQA 2J4WL 2WNKA 1QQDB 2AQNA 3BPOC 4QTFA 1J8HE 1ZT1A 2EEXA 3SGEH 4UI2A 2DQDH 4WV1A 3RWDA 1N6UA 3Q8AA 2LFGA 1NMCB 3MROA 2W92A 4FCAA 1CXHA 3FT0A 5D2LE 5T1KD 3V52H 3CFUA 3B1UA 2Y7OA 3EYVA 4FTVD 3X13A 3EZ8A 4YK4B 2J6EL 3B43A 1FZJA 2VDQL 1GY2A 3A4DA 5F1KC 3RWIA 4GRWE 4G8EB 3GBEA 3OMIB 3U46B 2ICEB 5TQ0H 5K9JL 3QCTH 3W2DL 3ZN6A 2FJHB 2VUYA 3L4UA 2UXTA 2EE2A 1ESOA 3FUEA 4LCWA 1RIUH 5GGRY 4TVPL 4X8GA 2P48B 3J7HA 4DZBB 4LRIC 3HRPA 2EZ0D 2EEDA 2VZSA 4AENA 4GUPA 1SYSA 1A8JH 2DLIA 2CLVA 4P48A 2V7NA 3WIHH 2G2RB 5C07B 2XRAH 4GKNA 1TZAA 1UJ3B 2W80C 5CIPB 3D48R 4GUQA 3H42H 4KOCA 4E9XA 5F0PB 2Z8SA 2MNUA 3PL6A 1XBRA 1C5BL 2O5XH 2OXHB 3LEYH 5CMAB 4NOBA 5CCKH 2CBPA 4DZ8B 4K9JA 2PWDA 2GJRA 5HD8D 4LEOA 3DIFA 5K33A 3LN5A 2HA1A 2AJSL 2HMID 5LWYH 5DD3H 5KJRH 5FUZL 1KXHA 1HHKB 3WS3B 1AI1H 2BP0A 4H8HA 4XTRD 3IAPA 4Q56A 1J1XL 4WFED 4U0RB 4MA1C 1GZQB 4ZUSB 5C0DB 1OY3B 2DI7A 4X7CC 1RZFH 5GSVB 3RX9A 3FBQA 4F7TB 4Z7VE 4PN6A 4F80A 3B5HA 1AGCB 3HHMA 3L45A 4NM4H 3SBWC 4D0CB 2AQTA 3E8UH 4F27A 4LLDA 3W0WB 5I74C 1B6UA 4AVKA 5CXPA 4X8JB 4UQ2B 4DNLA 4ZMVA 1PZAA 4LSRH 4W1TA 1D6EA 4JFHE 1FLRH 5I5IA 2OMZB 3VXMB 1IILE 1R34A 1MCPL 3EDFA 5DQDL 4POZC 5KSBB 3EFOA 4CJ0A 1ZT4B 4LDCA 2QKIC 4O2EB 2Y7QA 1TTGA 3W39B 1N70A 2V3DA 4F8QA 4NSKB 1JDCA 3UPAA 5C97A 2C5DC 2VC2L 1PZDA 4MNQB 3LTVA 5D1QE 3S88L 1ZGLP 3L3JA 4LCWD 4PI2A 3L7FA 4CU7A 1QA9A 3DJ9A 4QT5A 4D9QE 4KQ3H 1HQRA 1XCTB 3S6CA 1SJEA 1S7QB 3KPMB 5CGYD 3TPUB 1INQA 5B3JF 3ME0A 4P4KA 4XP5L 4YXHH 4RDBA 1OPGL 4NHCH 5I8EB 3UMTA 5EOCL 1ILSA 4AKQA 1NIAA 1BVKB 1UENA 3CJJA 4FQCH 3TCLA 1OXYA 1HNYA 4H5SB 1KPUB 3SKUD 1S5HA 1Q0XL 2YD5A 3PL6D 1NINA 4LVHB 3VRIB 2A74B 3P3RA 4CU8A 4WCYH 3WFEH 4CU6A 4ZUUB 5AW8B 5F70A 3WGVB 2F5AH 4V33A 4MJIE 4PLNC 2FUQA 1PKQA 4XZUB 4ZFOA 5FM4A 3GMMA 4GQ9H 5FIEA 4FQQA 3O11A 4APXB 1EHKB 4ZXBA 4OLWH 1K2DA 1U95A 1EAQA 3RJQB 2WIIB 5FF6A 5E1AB 4M7LL 1IGTB 3KXFA 1WZ1H 4MQXC 3SJVA 3T8XB 5L2JB 1M71B 5DD0L 1MF2H 1CG9B 4XN9A 4LQFH 4EBQH 1CI3M 3L81A 5I66B 2VLMD 1BJ8A 1SQ2N 1ZJAA 4E9WA 3TA4D 1UA7A 3FO2B 2CJUH 4DFHA 1SM3H 1S46A 2VGLM 2GBVA 4EN2A 1MCKA 3MTRA 3WDJA 1KLGA 2ZOLA 3PV7A 4OFKA 3SOBH 3ABMB 3KWWA 4R96B 1JZ8A 3QJTB 4FKEA 3L2LA 2VZUA 5CU5A 4NQSB 3U82B 2V8LA 1TFHA 4NCDA 4EQ3A 3EJUA 4R2GD 2LW3A 1E65A 4JE0A 3MXWH 1ZLDA 1OAKL 2NQDA 2NCEA 3RTQA 2H32H 2OMWA 3QJVB 1NFIB 3ABLB 3VA2C 3LKSA 4MJJA 3NG5A 4JDEB 3GMRB 4JHWH 5JW3H 2GJJA 2C3GA 3UJTH 3V9EA 4BJLA 5JPNC 4P4KD 2BCKB 2JB5H 3EKCA 4XCEB 2DQUL 1W16A 3U2IA 1YQVH 3P0GB 2X4RB 3GHBL 1JNNH 1ZLEA 3C2SA 4UTBL 1HN1A 5T3XH 3AS3A 1AD0B 1VA9A 2GTWA 4MXQC 2IH9A 4IBYA 3QQDB 1JV5A 4JRXE 2I07A 1KBBA 4LO9A 3IVKA 3RILA 1YG9A 2VDOH 1VPOH 3D33A 3DA0A 1S3KH 4RAUA 5DVKA 3UBGA 1TVBB 5HGHA 5BOPA 4ZXBD 1N8ZB 3Q3GB 4H26A 2ADFH 2XC8A 1YNLH 4XX1E 1OAUH 3FC8A 5HI3C 3SJVD 3KXFD 4ALAL 3HVDA 1IC0A 2VXSH 4NO3A 4FYQA 2YJQA 2XPYA 4JO1L 3ROLB 5ID0B 1KBWA 3HFML 3H6JA 3RI5K 3FB5B 4OGXH 1A8ZA 5C9KA 4JO8A 3ULVE 3SDYL 1AFVL 4BUGA 1PY4A 2BOBA 4AY0A 4Z0BL 3WIIL 1T66D 4R0LC 1AYOA 4PJ9C 4C55A 3QIUB 1IAII 2YC1B 4Q7DA 4F9LA 1MHPL 2RTTA 4HOXA 2QQQA 1L7TL 3P30L 4UT7L 4MZIA 1XR8A 3V6FA 3K2UL 4ZFGH 1XGUA 2ZKHL 3C5SB 4IJ3C 5IGXH 5EC1B 1HZLA 1WV7T 3RTQD 4BUQA 4XNZB 2G60H 1LILA 3KJ6H 3BD3A 1IARB 2CNZA 5C86A 2UXVA 5INCB 4KXBA 2XTJC 4X0KB 2F7QA 1YNKH 3DVIA 4FERA 4PTTB 4KJPC 2PXYD 1TEGA 3BXNA 1UACL 1UD3A 2W65B 4FRWA 4JN1H 4OKVB 3OKKB 5LN4A 3RKDC 2EXYD 1MWAL 1NGQH 4BDVA 4FHBD 4JFQA 5L6YH 2BSCA 2BW4A 1JE6A 4A68A 2RGSA 2HLAA 3IE9A 4OIIH 1WQVT 3HMXH 4JY5H 1QNZL 1V3LA 4P46C 4P5TC 5GQBA 3GSUA 2MTAA 2ZUUA 2NYYC 3EDDA 3L3IB 4OY9A 4ZO7A 3T8VA 1YY8B 5JXAH 1P1ZA 4QDGA 5TF1H 3CHRA 1NFDF 1PY0A 3PUCA 5HTSA 1UB6B 3GLZA 4N2FA 4YZFF 1CUOA 4ETQB 4B5ZA 3BZEA 1HWHB 3HS8A 4NFBA 2IPKB 4NZRH 2RB8A 5AYTA 3V4PB 3UJIH 3MPCA 1T20B 2XZQH 4LSUH 3T4AB 2TRYA 4HQQL 1DQTA 2LTQC 4PG2A 4EJ1C 4PRDA 3VH8G 4KZDH 3GSVA 2XQYA 2IG2H 1CXLA 2IGTA 2DIBA 2N1KA 5IBUG 2CAKA 2R69L 1F2QA 5IHZB 5C09A 4DSYA 3VD0A 3IRZA 3OGOE 3D39A 3WLWD 3CQPA 1TU2B 4UAOB 2ADYA 4UZGA 1UGNA 1NDGA 5IJVB 1A7RL 3HI5L 5JOFB 4GSUA 2P45B 5K9OB 1BF8A 1FNHA 5DS8A 4GSQA 4DP0X 4KK5D 5GRXG 4XNXL 2NY2B 5E08L 1PZCA 5F9JB 1MY7A 3OGCB 3SQOH 2JELH 1QLFB 2EILB 3VJ6B 1FRGL 2BSRA 1UC6A 3BKJL 2WLNA 1MJ8L 4JNXA 4XWGH 4I0PB 1RZGB 4YEEA 4MJHA 3O41B 2W38A 5DVOA 5DHVH 1U0QA 2YUXA 4OF5A 1JZIA 4Y5XB 3BQUB 3TTSA 5ITBH 4UOQA 5BO1H 1VADB 3HNVH 4GSRA 4KDWA 4NX0A 4RZCA 3WNIA 2DQMA 3TM6A 4C47A 1JIBA 3QW9A 1P5UB 5HDRA 2B3IA 3V4VB 4FNQA 2YGVA 4Y2OA 3TO4B 4DGUA 4WK2B 1QKZL 1X4XA 1ZKAA 2VC2B 2WKLA 3ZDYF 5FO9B 3GZQA 1W91A 4TKWA 1DQKA 1N7MH 3ZDXB 1G9NH 1QQDA 2ZCZA 2VDML 2CE6A 1Q38A 3EZJB 3BHBB 3HPLB 4ALAC 4KHXL 2NY3C 3MRQA 5F21B 4YDNA 6TAAA 1HKFA 5AL8A 3N91A 3IM1A 4RGND 3VGFA 1ETJA 4LIQE 5C09D 4IDLA 3O4LE 1SN5A 4JFYA 3D39D 4JO2H 4JK0D 2LFEA 4HFWB 4G8EA 1UXMA 4XRCB 5SX4H 3U46A 3X3FL 2ICEA 3ZDZE 3WENA 4Z7WB 5BUGA 3P02A 5I0VA 5F7DB 1CBJA 2X6MA 1TQBB 4M8UA 2FJHA 3S8FB 5EIQA 1HEJC 5F7EL 4C4KT 4DZBA 5I1EH 5AVTB 2WZ6A 4Y4FA 2AK4B 3BE1H 2DEWX 4XVJH 1IBGL 1QMUA 4OLUL 2HJFB 2G2RA 2Y25A 2DJUA 2WXPA 1LHZA 2ZCHL 4NDMB 4WW1B 1UJ3A 2XN2A 5B7EA 3GLEA 3HR5B 5D93C 4XP9L 4LCIH 1LDPH 3GZKA 4G8GB 1ZK5A 4UNTA 3GI9L 1O7VA 3EGSB 5CMAA 1A1OB 3SD2A 1UFUA 1Z0NA 4ZFFA 1JPEA 4X5LA 3WKPA 1GPOH 4L0YA 4F7KA 1NL0L 4JREB 1HHKA 3WS3A 1QASA 3QWOB 4LLQB 1OQOA 3E1F1 1HCVA 5IQ9B 2QELA 4M3HA 4C8XA 5DC2A 2YPKB 4B41A 1GZQA 2LV4A 3HN5A 3MLZL 1AKPA 4ZUSA 5GSVA 5DMIH 3UH8A 1DANU 2NY6D 1AGCA 5IROC 1BW8A 4D0CA 5GRVK 2HKHL 1ZV5A 2B1HL 1RU9L 2BS8A 3CFCL 3MODL 4X8JA 5DJCB 4UQ2A 1C12B 1EZSA 3U79A 1MFMA 3ESMA 1V7ML 3DI3B 4AEHL 3FUDA 1XSOA 2OMZA 3VXMA 3QHTC 2QR0A 1SLUA 5KSBA 1L0QA 4M5ZH 1ZT4A 1WP6A 4O2EA 3UEZA 3W39A 1GJIA 4F7CB 4NSKA 4OD3H 1L9NA 4OIAA 3CN0A 4M7ZC 3S8WA 4B9IA 1TJHH 2A2QT 2B4CH 4IKIA 1SUJA 5AW4B 1TT6A 4MWFB 2VW4A 1D2OA 3RY5A 4EDXB 4Y4FD 3U0WH 2DN7A 2CHDA 3KPMA 3TPUA 2M8XA 1V05A 3LVTA 4PP2B 1MZZA 5C07D 2JJUA 1PGRB 3WUWB 1UURA 3MUUA 5I8EA 3TCTA 4PB9L 4QEGA 2V5MA 1BVKA 3CCHB 3FQ4A 2FX7H 2ZWYA 4H5SA 1KPUA 4B9YA 5J12B 3VRIA 2A74A 4FYRA 3QPXH 1XZWA 2YPVA 1F8TH 4ZUUA 4DKFH 4LCUB 1YY9C 4U1HB 4RMWA 4KNQA 2EYTA 3LEXB 1IAIL 3U36B 2C4XA 5IB1A 4XZUA 4N26A 5EIIG 4PRNA 4OZIE 4H20L 4GQRA 4AC2A 3QDMB 4FQXA 2AK1H 1PDKB 2GT9B 4LAJH 3QUZC 5ADPL 2RQ8A 4CSTA 2AKRB 1S4IA 1Z3GL 1IGTA 5E1AA 1XO8A 4FXLA 1TG8A 1UZGA 1WZLA 4GRWH 3T8XA 4MMXC 5L2JA 3GMQB 4LT7A 1G9ML 3QEHA 3V0IA 2AEOA 2KDGA 4L18A 5IJKA 5I66A 3NCCB 2CLZB 1JZFA 1P84K 4KBPA 2IH1B 1BLNB 1NWPA 4ODSH 3VXMD 2XG4B 3K7UA 4M8VA 1X4ZA 2WQUA 5DD5H 4R96A 4TM9A 1NUDA 4OSUL 4KV5F 4D94A 3CPUA 4HGMA 1P84J 2FYYB 4BSWB 3KBPA 2D7OA 3R7RA 1BQLL 2WCSA 4X99B 3BMWA 5E8DH 2G2NA 4UV4L 3ULUL 2E4TA 1ONQB 1DLFL 3GXDA 4Y4KC 4ELMA 5E2WH 2AGJL 4JDEA 3GMRA 3PNWB 5JR1H 1FGNH 3NIDB 5J0BA 2F18A 4NIYE 4UT6A 1GOHA 2BCKA 4XCEA 1WLHA 4YDIL 1CIDA 1HVXA 4B9GA 1RPUA 2X4RA 3L1OL 4LSVH 1WJ3A 5KYWB 1AD0A 4UQIM 3QQDA 3LKNB 3N41B 3K4ZA 3FQUB 4WWID 5GHWL 3F01A 1XH3B 1WDAA 3K6NA 1CPUA 3KL3A 5FYKE 3CSYB 1JTOA 4AYEC 1LO0L 1TVBA 2FVNA 4FQXD 1AIZA 4GBXB 4PYHA 1N8ZA 4NZJA 2CM5A 3Q3GA 4G80B 3VO0A 1CT8B 3BP6B 3O2WH 2WWMD 4PJGB 2OTPA 2EIMB 4WWKC 4BFJA 1P7KA 3HBPA 3PHOB 4NKQB 1WZKA 2PPDA 3SDDC 4F5CA 4MS8D 2PR4L 2MCG1 3ROLA 3D3VB 5ID0A 5I1HL 5C6TL 3FB5A 3NPZB 3CLEL 4NQVA 3ARGB 2D7TH 2OCFD 2ED9A 2YXFA 2BNQB 4FHJA 4ZMOA 4BFBD 5I0ZA 3D34A 4KI5E 1BF5A 1D5IL 2UUDH 5C08A 1HYSD 4APQB 5H8DA 3AS2A 2PNDA 3AITA 3QIUA 4DP6X 2YC1A 3B7RL 4Z7OB 3CGTA 3ZMNA 2HPOA 4GP8B 1V3KA 4MFHA 1XB6A 3C5SA 3NFNB 5EC1A 2F54A 4BFFA 4H44C 3TNNB 1U8HA 1GOFA 2NY0C 4WJ5A 2RH0A 4PJAE 3VI4E 4Q6IC 2BFVH 1ZHNB 5INCA 4X0KA 2FATH 5M7QA 4M7KH 4PTTA 4QD2E 3T6ZA 4NQCE 1UWGL 2OI9C 3OKKA 5SWZB 3F12B 4C4KO 2Q7YB 3OQRA 1XT5A 2WZ5A 3FUIA 4FFYH 3C9NB 2QSQA 4MKMA 4N1EA 5CEZD 3OL2A 3CX2A 1A22B 4EOWH 1U8IB 4LK4A 1U9KA 4PS3A 4ERSL 1BZ8A 2K7PA 3LS5H 5HHPB 3L2MA 3L3IA 3TEWA 2WVTA 4WVRA 1BEYL 1YY8A 1E28B 3EJQA 2WZAA 1GZPA 2BSDA 2KL6A 3FAWA 1BFSA 1IJNA 1NFAA 2F74B 2OSLB 2QFRA 2WINB 3HI6H 5CR8A 1FWXA 3ATEA 1UB6A 3ZE1E 2J57A 4ETQA 3HI1B 2DBJA 2IPKA 2YK1H 3DX8B 3QDGB 4ZPTB 1T20A 4L5FL 3S35X 3V4PA 2HAZA 4K23L 3T4AA 4WGWB 3B1TA 4MMZC 3I2CH 1XF1A 4PUBL 4OF8A 5C08D 4ISVB 4OM1H 2RIKA 3ZHDA 4BK5A 2DM7A 1OT4A 2N56A 5EU6B 1H8SA 3SDAB 5LXGH 4ODVH 3I3BA 3QIUD 1G9MC 2X4SB 1I1CA 4L8SB 1DBKL 5IHZA 1R33A 3MRKA 5F7WC 3ASNB 4JZNB 5DZPA 5H4ZA 2F54D 2NNCA 3U7YH 1TU2A 3WFDH 3BPNC 4G7YL 4HXAH 2PO6B 5IJVA 4N2AA 4ZUWB 5K9OA 3B3BA 1L9RA 5I19H 5FKAB 2EZ0C 3BJ91 4QNPE 2ZX9A 3A0OA 3ARWA 2UWEF 2XXFA 5JPMC 5F9JA 3OGCA 3ULUC 1QLFA 2IQ9L 3D51A 5DEZA 3VJ6A 1LL1A 2DWDB 4XO5A 3GNMH 1NGYB 4QRUB 4AYID 1T6WA 1NFDB 5G5DB 1KLUB 1N26A 4A66A 1SN0A 1V7NH 3O41A 5EN2B 2E0PA 4AMKH 1NLBL 3NJMA 3ULVH 4Y5XA 3BQUA 3FCTB 5EHFA 2G4EA 1VADA 5FCUL 2Y6SD 4XTRC 3N0AA 4LGRB 2WY3B 3V4VA 1P5UA 3FRPG 2FNWA 1FO0L 4JKWA 1AD9B 4J3BA 5DFWH 3T2QA 1ZY9A 4A2MA 5J89A 1XMEB 4AJVA 1I8LC 3DX7B 1FFQA 1KCLA 3WJJC 2ZYIA 4PLJD 5C0AA 2X0VA 3X11A 2P8LB 2VSKB 4OZGB 5FO9A 2ZXEB 5FEBA 3VGGA 5HDBF 3ZL4H 4Z77B 4TPRH 2VR7A 3BHBA 3HPLA 4LSPH 4R8WL 3Q48A 4WQOA 3RAJH 4KKZA 4TUKH 2J1XA 3KPPB 3QR2A 4KHTH 1BOYA 3PWLB 2VR4A 1NMAL 1HL8A 4F8OA 5KWYC 5IOKA 4PS4H 2HFGL 5EF1A 4FFTA 4KUCD 4X4XB 3LHPL 2HUHA 2YLKA 1PFCA 4FZ8L 2AAVA 3VI3F 2X09A 4XRCA 2V2WB 3WO4B 2QSCL 1HEHC 4ILDA 4NLAA 5EOCJ 5F7DA 4YSUA 1BFOB 4FI8A 1BIHA 2L3BA 3WAJA 5F9WC 3NIGB 5B4MD 4I77H 1JHLH 3QXUA 2COQA 2WLHA 3IE4A 2NDGA 1VCAA 5CGYC 5CJBA 3T3MF 4WFFE 1LK3H 2AK4A 4Z3IA 4Y1AB 2OYKA 1Z2KA 4RQQA 4KRMB 4DGIL 1RUPL 2HJFA 4NDMA 3DWTA 3HR5A 4U1SB 4Y9FA 4PJEE 3SDCB 3CFJB 4L1SA 4NKMB 4PGDB 4EIGB 5DRWB 3EGSA 3UTSB 1A1OA 5J8OA 3ZDYB 3BQUD 3MGOB 4Z18A 1NEPA 1YEHH 1JZHA 2P9RA 3QFJE 5DZNA 3D8MA 1NCJA 2YBRB 2OL3B 3MLXL 2UZIH 3RHWK 1Y07A 3QWOA 4LLQA 1R0AH 3T2LA 2H2SD 4N85A 1A2YB 2C7FA 2VTFA 2B14A 2YPKA 5C0AD 1GRWA 3F7LA 1ETZB 3J27A 1SXAA 1MUJB 2WMPB 4YHKL 1OSZA 1KCBA 3QFDB 3LIZA 3E80A 1KXTB 4HPOL 4V1DB 3BAIA 3R7QA 4MA8L 1EDQA 2CMRL 2WQAA 4P59H 4G11A 2ITFA 1R4XA 2X3AA 3H1ZA 3V6OA 1YEEH 2DY2A 5DJCA 2HX7A 4JY4B 3EJTA 2Y7NA 1L0XA 1ROCA 3OPZL 4KDVA 5JLZB 1UWXK 4Z3JA 2Q8BL 1FIGL 2CK0H 3MOQA 1BZ7B 1NAML 3CD4A 3HG4A 3TJEH 2WXKA 4TL4A 1BEXA 1WFUA 4WI2A 3QGVA 3KM1A 3VXUE 3KPTA 2F08A 4K5MA 1XGTB 1ZVHA 3LPGA 4K7PL 4QGTA 4MWFA 3AXIA 1GXEA 5BPPA 4I3SL 2VABB 2AK4D 1VEOA 1QFPA 4IU3B 2DD8H 1COBA 1LP9E 2ROYA 1BJ1H 4OCLC 4PP2A 3RVWD 1MJUL 3PHAA 3PXHA 3WUWA 1MRDL 4Z78B 4L9LB 2H41A 3CCHA 3QJRB 1Z5YD 1M7IA 3O3DB 2KLSA 2OMNA 4K3DL 3FT3B 4PJBB 5F89B 3V0HA 4A2EA 3UXFA 4DVBB 4J3VA 2VJ0A 4LCUA 4U1HA 4WEMB 4HZAA 4GNKB 2GUYA 3JUZA 4L3FA 4ZXBC 3TYGL 4IIQB 3H3PL 1U3ZA 4YL4A 5LXVA 5DDHB 3MOAL 3LPFA 3BFQG 2GT9A 4U3CA 2Z34A 2UV3A 1A6UH 3DIDA 3EBAA 5A2AA 4OT1H 2AJ3B 1DN0B 3HBGA 2AKRA 2QVKA 3AAZB 2K3TA 3K8LA 3NSYA 1XF5B 3DUUB 1KPRA 3GMQA 4ZSOB 4UIKH 5DZJA 4GMSH 4B27A 2COVD 1H6EA 3T8MA 3FK3A 4KX9A 4JFOB 2ZP0T 2CLZA 2I85A 1J5HA 3I50H 5IJCC 2R9HD 2NUTB 5HYSG 1GS7A 5IFAL 1X6NA 2IH1A 1BLNA 1EHAA 1MCJA 4ZS6D 2JE8A 2XG4A 3GXPA 1OAXH 3U6XA 1AS7A 2GBTA 1JF6A 5D1ZB 3TV3L 1TTRA 4L4VE 2VW6A 3LZLA 1EXHA 1EPFA 4JFUA 2FYYA 4BSWA 4FJYA 1A64A 4X99A 4FI6A 1YC7A 4TL5A 4NJAH 1ONQA 5TDPB 2FLBT 2CR0A 1IQWL 5IT2L 2PXYC 5AYUH 1QPXA 1N5YH 1F11B 2EXYC 4KY1H 1OSPH 1RPQA 4E9QA 3TBBA 1UH3A 2N4IA 2WBJB 4QRTB 2YFNA 4MZ3A 5D2LF 5KYWA 2BXZA 3CSBA 3QR1A 2VMJA 2HUEA 2ED8A 1IFHH 4IYKA 4IJTA 1S7RB 3DX3A 1F41A 1E2WA 1KXQE 1P1VA 2WXMA 3LKNA 3VVVA 1IBZA 2AF2A 4GRWF 4IBQA 4I3GA 3FQUA 4JPIB 4MGXA 5C0FA 4O2FB 1XH3A 5KVFE 3FMGL 3CSYA 4V2BA 4QRPB 2V17L 4GBXA 2EDOA 5E5MB 4G80A 2AI0H 3BP6A 4JDTH 3RFZB 3ILQC 4UYPA 5KN5B 2J12B 2MQGA 3MBEC 1FYTE 4TUJB 3PHOA 3NGBC 1M42A 1YEIL 2J5LC 5JW5B 3HRZB 2Z0UA 3AW5A 2Z93B 4HEPA 3D3VA 3SPJA 2Y5QA 4XNBA 4GIPD 3KW7A 1HKLH 2AHIA 3ARGA 5EBMB 5FUOL 2BNQA 4XOAA 3EYFB 4ENED 5FYLL 4MDIA 5B39B 5HP5A 2ZF8A 1I9JH 4WI0B 1OTSC 4YFLF 5I1KL 1N59A 4TUOB 1RZ8B 4ZMNA 4KXZH 5MHSE 5FYJU 4CBZA 4N6RB 4JJ5B 2OR9H 4L8BB 1GJWA 5T33H 2IXQB 1YN7A 5HDOA 1I8KA 4A37A 3QWNA 3NFNA 1GJUA 3CFIC 1N5AB 3OXSB 4Z7VF 3KPOB 3QCVL 4A7GF 4F7EB 4KITB 5I23A 1I1FB 2VH5H 4KK5C 2G4GA 2NCMA 1ZHNA 4RFOH 1BBJB 3FCUB 1G6RH 2Y7MA 4NQED 5IWLA 4X50A 1OHQA 3M07A 4AQAB 2FH8A 5SWZA 1G87A 3F12A 2Q7YA 3BN9C 2R15A 3NJFA 3C9NA 2C9PA 4OGZA 4U1LA 4JPVL 5DJXB 2VKXA 5JHDE 1I9EA 1U8IA 2H1XA 2NTFB 3C5ZA 3AXLB 3ETSA 5HHPA 4QLRA 3F8UB 4J6RL 4GBXD 2XA8H 1E28A 2D4FA 2O6PA 3RE0A 4ADJA 2WINA 2H32B 4HCGA 5LGJB 2OMYB 4OF3A 3D3VD 4YXKL 5I0YA 1B4TA 1LVEA 1KXVA 1CC3A 3ARGD 2BNQD 5EU5B 3DX8A 4ZPTA 5CILL 4NUPA 4F92B 4M48L 4JFXA 4MNGB 4PG2C 5GISH 3QRLA 1UKTA 2GEQA 1JXJA 4L8DB 2BP5M 4KK6D 4GI9A 3W9DB 4ISVA 5AG9A 1IC5H 1NCHA 1Q0EA 2ZOOA 5EU6A 3SDAA 2WP3T 1MCWW 3GXNA 3I3DA 2X4SA 5I2IB 4L8SA 4JM4L 4OBSA 1YNTB 2E7BA 3HN3A 3ZHLA 2B9BA 1P9MC 1XSJA 4JZNA 4K2UH 4P2OA 4DEPB 3VG9B 4U2ZA 1AR2A 1KGCD 5T1DL 1N6QH 1CDGA 1JPGB 2PO6A 3KYKL 1XCQB 4ZUWA 4IRSC 3AQZA 3D52A 3QZMA 5FKAA 5FYKH 5FW6A 2G5BB 3P11L 3BLPX 5DD6B 5E4EB 5J13C 1KB5B 5SWZD 1ZS8B 1RJYB 4J4PA 3ZKXB 1CICB 4LVOC 1JN6B 4D9RE 4U6VL 5HHXH 2VLKB 2XXCB 3QG7H 2DWDA 5CHNB 2J2ZB 5I1DB 5FAAA 1NGYA 5I73C 1QWHA 4YGAB 3TU6A 2R0KH 1JGIA 5G5DA 1NFDA 3DX2A 1DBAH 4B9JA 1KLUA 5EN2A 3C5ZD 4HBCH 4AEIH 3EG9B 4UM8B 3P9LB 3TGXA 4GAJL 1QFWI 4I1RA 3CVCA 3BWUC 4YHPB 3H4HA 4QTHB 1RIHH 2XFXB 4GRLB 3GRWL 4XCCH 3QZNA 4JFFE 1KC5L 1AD9A 1KENL 4JFPA 4W9ZA 2YD8A 3PABA 1A6VH 4NLHA 1Q90A 3DX7A 4C4BA 4NM8H 4YLQT 2NW2B 3B8YA 4YXLH 3BSHA 2NY6C 1HS6A 4IMLB 5LJYH 1GS6X 1KDJA 3RY4A 3LKPB 4WFHE 3MNWB 5I1GH 2FBOJ 3IU4L 1BX2B 4Z77A 4OB5L 1ETA1 1A7PH 3MJ9L 3KPPA 5EU6D 3SDAD 1RZQA 1U4FA 4N8VA 3VUAA 3WMPA 1SXCA 4F58H 3PWLA 3R0MA 1P53A 2AXFB 4YWGL 3VFRB 3I75B 4HJUA 2HZHA 4ZFZB 3JTTA 2OZ4H 4P2OD 3QUHA 5K1VA 4OLYL 2VDNH 2ZCKH 1IL1B 2VDKB 3ZXAC 2V2WA 4DO4A 4ZNCD 2A83A 2PO6D 5K9KB 4XT1C 1GKOA 2A9MH 1BFOA 3WTSA 4DN3H 1TYEB 2A9NL 4Y4FC 1NCBH 1W72L 5B1JC 3ULVF 3D25A 2QDVA 3I02B 2ZOTA 4XAWL 5A3ID 4J4PD 4R4FH 4Y1AA 3JBG7 1KJMB 2YMXL 3F7YB 3UBXI 1OAQL 1QBBA 4JKPH 1BYNA 3APDA 4U1SA 2DEXX 3DXAE 3NESA 3TIEB 3SDCA 5FLUA 3CFJA 4NKMA 3MLRH 2EC9U 1JFQL 3JYCA 4PGDA 3C6LC 5DRWA 4DP1X 3CIAA 3BSGA 3FF8A 3UTSA 4BINA 3A6CL 4HJ0C 1EHXA 1WYJA 3MGOA 5I8KL 5IEHB 3O6KH 1KULA 3N1MC 1YYML 4UNUA 4OFPA 4K3JH 3U48A 5A2BA 2OL3A 5HHMB 2GW5A 2O5ZL 1PLBA 4L2YA 1FHGA 4YSQA 4WI5A 4HZLB 3V5DB 1A2YA 3L1GA 4IHOB 4XCNB 4H88L 1AGEB 2E6PA 3CSGA 1KEML 1ETZA 4G6MH 5F96L 4YDKH 3S3JA 3R1GL 3SKOA 1EBAA 1MUJA 2E9IA 3UO8B 2EECA 4A67A 1XF4A 3HUJB 3QFDA 1FNGA 4P2RB 4V1DA 3NSFA 2EXWC 3SO5A 1IGCH 1RCYA 4JY4A 3SKNA 4DT2A 3DUSB 4PHXA 1QTYT 5JLZA 1JDAA 5DHVB 2P8PB 4JZOB 3T3MB 1VFOA 1CF8L 3EJYD 2LOEA 2HYMA 5E2VH 1BOGB 3U0TB 1EMTH 4HKZA 1JL8A 1XR9A 4TTGA 2CDFB 1XGTA 1YA5A 4YOKA 4FZEL 5DCCA 5IVNA 5CZRA 3KH4A 3DYPA 5TPWL 5EOTB 5DD1H 2AZAA 4KI1A 4AUUA 3HFFA 2NW3A 1EJFA 4IU3A 1CLOL 4AIOA 2Y23A 1C7SA 1Z9SB 1MCEA 4Z78A 2QV4A 3SDCD 1R5WB 4L9LA 4ZW3A 4YSOA 1U8NA 3QORC 1ZHKB 4MSWB 4MS6A 3FT3A 4PJBA 5F89A 4HJIA 2NT1A 4HBQA 2XWEA 4Y5VA 2X6AA 2JKLA 5FC9A 4PV1C 4XBEH 2ARJB 2CRYA 1MFDL 4FQXC 1M3IA 1RFDL 4YLBA 2PCPB 5JIHA 5DDHA 1EXGA 2YN3A 1BA9A 5JOPE 3QPKA 3L3GA 5L0QC 2EVJA 2M83A 4MS8C 4DPBX 1LEIA 2AJ3A 1DN0A 3EJZC 3EO9L 4X9IA 3AAZA 4JFEA 4U2YA 1XF5A 2VSMB 3DUUA 3ZZ1A 4V1DD 3WIHA 4ANWA 2ZPKL 2LVEA 4NCC1 1PX3A 2ZKXA 4KKBC 4OGQC 2AJXH 4JFOA 1FPTL 3IMWA 4YHLH 2EABA 1QYGH 1AZUA 2VXUL 2NUTA 3VMNA 2L7EA 2DLFH 1D7FA 1MWOA 3FB6B 5EF3A 3ZMRA 4DUWA 5F9DC 3DGCR 2P26A 3MYZA 5IHWA 3T0EC 4A2LA 5D1ZA 25C8L 5EEWA 1YECL 4UB0H 2N7AA 4KVNH 1JNJA 1LNUB 4CVXA 4LSSH 5TE7H 3WSQL 2IANB 3UTOA 3G6AB 5HHNA 1N8OE 1SY6H 4ONFL 3E2HB 5KG9B 2VQTA 3IRCA 5TDPA 4O02B 4YC2C 1F11A 2PYFB 3LD8B 2IFFH 4B60A 1ORSB 3FN0H 3EYOB 3MLTB 4QRTA 2WBJA 5C0NC 3F2LA 1FBIL 1AQ8A 4GUCA 5FGRA 1CDBA 1Y1UA 3CG8A 1SMAA 3L3HB 5K1JA 1MW3A 4LPTA 3UZVB 4AQ8A 1LWHA 4DF9A 3G5VB 4YLCA 3VB8A 4YE4L 4B0MB 1AMYA 3WEOA 2Y9RT 4O2FA 3QEUA 3ZBMA 1INDL 5CFAA 3PP3K 1DSWA 4QRPA 2W5PA 4AVIA 2W91A 4BA8A 5J1AB 3WS6C 5E5MA 2YAHA 3RFZA 5KN5A 1E43A 3GGWB 4NGHH 4JFED 5JW5A 4F33B 3HRZA 5T5NF 1YJDH 2QPSA 2Z93A 3S5YA 1I75A 3HLAB 3JZ7A 2VM9A 3TVMD 5KYUB 3LH2L 5LG6A 4NWUL 5IW1B 4BQCA 4N2GA 2OV0A 1UQSA 5EBMA 3IMBA 3EYFA 2DEYX 5E00B 5B39A 2Z91B 2G3ZA 3H54A 4WI0A 5GSRB 4TUOA 4WENB 1RZ8A 4LL1A 3INUH 2W9EL 5EZIH 1RUMH 4N6RA 4AM0B 4JJ5A 5AB9A 4L8BA 2HFEB 3ECUA 1J8HB 1QFWL 2QZQA 2X2JA 3MBWB 5D2LB 4AGNA 3NJXA 4HK0B 1YYLL 5IB5B 1T1XB 1X5YA 3UYOD 4BRVA 1B4JL 3OXSA 3QWRA 4RMRA 3OMNB 4F7EA 4O4YL 4XPFL 1I1FA 4HPYH 4PSPA 1LM8V 2PPCA 2D7NA 2QGEA 3HC4H 4OQTH 1BBJA 4GRWB 2VERN 5EUOE 2NXYC 3QA3B 2WBJD 3PREA 1FORL 2AMGA 3W38A 4AQAA 2ADJB 3G08B 5D7JA 2B77A 1J8RA 5DJXA 1IBHA 1YEKH 1OK0A 3DK0A 4G7QB 3U30B 5DFVC 2Y07H 3ECVA 1KIUB 2JCCB 1T1ZA 5I17B 1R19A 3TO2B 5C2BH 1WWBX 3AXLA 1AHWA 3WNMA 1N3NB 5T1LB 3DDFA 2Y6SC 5ALCH 4QRPD 1PG7W 5J6SA 2ODIA 5DUPH 3SGDH 4G70B 3DC0A 2IOIA 4U49A 2H32A 4W81A 2OMYA 3HNTL 5IUCA 1QTPA 2XWRA 5D8JH 4CILA 1IB5A 2EO7A 5EU5A 2YKLL 2VCOA 1DE4A 3F7VB 1GYAA 4OCWH 2E5EA 4QI3A 4Y16B 4XE0A 4MNGA 5IV2B 3BAKA 4L8DA 3W9DA 1F56A 4JAMB 4X6DF 4PB0H 2R29A 2IWKA 3UZEC 1HSAB 5EDSA 5A2LH 4JRLA 4OZIF 4NT6B 5I2IA 2VDRH 1MSPA 1YNTA 1B0GB 3RA7H 4UAOC 2NXZC 2WOBA 3FQ2A 1OK8A 2J1KA 5EWIH 3ROOB 1DR9A 1F58H 2R8SH 4I18B 1A21A 1JPGA 3H9SA 5B4MC 3K72A 1J5DA 1A3QA 3P9WB 4IEFB 2H2PC 4AGOA 5E8PB 5KVFH 2IBBA 3N85L 5C7XL 3HG0A 5HYQB 2HT3D 2EO9A 2NNFA 2G5BA 2OW7A 4O2CB 4W9IC 5DD6A 1KB5A 2ZUXA 1ZS8A 1RJYA 4LMQI 5D7JD 4UNVA 1BZDA 1CICA 1JN6A 4WNQB 5AAMC 3JXAA 1FC2D 2J2ZA 5CHNA 5PAZA 5I1DA 5C0JB 2PW2B 1KELH 1OTTD 3E38A 3QDJE 1KN4L 1P2CB 2AVGA 1S9VB 1XSKA 1BWMA 3BWAB 2E7CA 3EG9A 5L88H 1U30A 3P9LA 4PVLA 4YHPA 1TJGH 2XFXA 2Y5EA 4GRLA 4M6OL 1SFDA 3Q5TA 3W5NA 1UWXH 4GG6E 2ZNWA 1H3PH 3ZTJG 5IQNA 3G3LA 1C5CH 5HY9B 3K8KA 2BVTA 2JKJA 2D9QB 4MJIB 1HQ4B 1QG3A 2NW2A 5DT1H 5TE4H 3WFBH 4IMLA 4FP8H 2Z7WA 3CVHB 1T6BX 4GSDL 3MNWA 4MKTA 4NKOB 4Q0XH 1DQQB 4X6FB 2OFQA 5T3XD 4I1PA 3UC0H 3NSXA 3C60B 4E5XB 5J11B 1BGXL 3HMXA 1B2WL 2AXFA 2Q86B 3VFRA 1RD6A 3I75A 4PP1C 4AZ8B 3GKWL 3PJLA 4YH6A 1B9KA 3GRBA 4ZFZA 3NCJL 1PNDA 5DR5L 2Z92B 2KQMA 4DP7X 4FADA 1NIEA 1E4WH 5DRZB 1IL1A 1CWVA 3TS8A 1MAKA 1VGEH 3BH4A 3H9SD 5AUMB 1BAFL 2Y5TA 5K9KA 5KBDA 2APXA 1IO4C 2DQGH 1I1RA 2YPLE 5EU3B 2HG0A 2B5IB 3GSNL 4AV5A 4KI5F 3NSDA 1KT2B 3X12B 4M4PA 1CICD 2XQYK 2Z65C 4I9XA 3QH3B 4ETYA 1KJMA 3VXOA 3F7YA 4HMEA 5IHHA 1JZ2A 3TIEA 4QHUB 3Q9PA 3EJSA 3QIWC 4IDJH 3QUYD 2X12A 4CN4A 3AFLA 2Z1KA 5EPMB 1WEJH 1R3JB 4AT6B 5IEHA 4AOFA 1KFAH 2IH8A 2EIKB 4P5MB 4GRLD 3I9GL 5C0BE 4BHUA 5ACMA 4PJAF 3SGEI 3P2TA 4XP4L 3VI4F 5AZEH 4AYFB 4W9HC 2PTTB 1E3XA 4NO0B 2YGOA 4F7MB 4HZLA 5MP6H 4XCFL 1U33A 4XCNA 4IHOA 4AG4H 1AGEA 5JIIA 1Q0YH 3FH8A 4H8VA 1A1NB 1SPDA 4PAZA 3MVSA 3NZUA 2O5YL 3HUJA 3V6OC 4Z8FH 4WWPA 1NM4A 3M1OA 4P2RA 5AW5B 2MCMA 3VI3A 1KMGA 2R9HC 4YHOL 3TFKD 4M1CC 1EDHA 2CHWA 4M5SA 4NRYB 3SN6N 3DUSA 3QXWA 1VJSA 5DHVA 2EDDA 2P8PA 3C2AH 2ZUYA 4JZOA 5BVJB 2JWYA 2Y06H 4WHDA 2C9AA 3MLUL 4N2DA 5ESQB 5BZXA 2B20A 4N68A 1F4XL 2GJ6A 3LZFH 3QYCA 3DKHA 3ZE1F 1BOGA 4R97C 3VD7A 1SNRA 4JG0H 4FNUA 4MDJB 2CDFA 4TSCL 1JPTL 3FPXA 1S3RA 1WCQA 2XIDA 5FYKU 4NQXA 2WJ7A 2WQ8A 5EOTA 5A40E 4MB4A 3M7OA 4QF1B 2XN0A 3R06B 1S7VB 1YVLA 4PWKA 3J8F7 4V2CB 4XN4A 3RX8A 32C2B 3NUKA 3RY6C 1T3FB 3N2JA 4KO7A 4AGQA 4LFHD 1Z9SA 1R5WA 5ICUA 4JZJB 1MDAA 4G7VL 1BYOA 1AP2B 2YSSB 3EO1B 1ZHKA 4MSWA 1LQSR 3LB6D 1D2PA 1XX9C 2MMXA 4TQIA 5HVGB 2ARJA 4HIIB 4WNSA 2HTKC 1A5FH 4NENB 8PAZA 2PCPA 2XYCA 4UMGA 3GUTA 1YEWA 5CSZB 5ALBL 2BVEA 1XL4A 4QNPF 2J88H 1AQDB 1E2VA 3B9VA 4TLSA 4WFGE 2IH3B 3QUML 3EYUL 1PD0A 4F20A 1A6AB 3CSPA 2Q2LA 1QTSA 2WO3B 3NCBB 4RRPM 4NN6C 5KYXB 1E0OB 5DJ6B 4EN3C 4P2RD 2J8UE 5LAPA 3RWHB 5FHAL 3HBQA 5LGHH 5F1OB 1SBSH 5EIIB 5EDXA 3RURA 1GYVA 2EDEA 3GSXB 4H0GA 5C3LD 2CJSA 2Y2TA 1Z6JT 2JXMB 1DBJL 5F3BB 4ORGB 1LO3H 3UGEA 3FB6A 1Y0LB 4DQOL 4Z3EA 4ECNA 2CO6B 2GJ6D 4NUMA 5EU4B 1LNUA 1HL4A 2X9ZA 2BHYA 2PMZA 4QJ5B 2IANA 1HZHL 2XBZA 3G6AA 3MRBB 3N43F 4H13C 4I88A 2Z35B 3AS0A 1LO4H 1FZMA 4GKLA 1A3LL 4JY6B 4QMEA 4O02A 5SWSE 3HHRB 4HF5H 3B83A 2PYFA 1ZA3B 1FFNB 1ZSDB 3EYOA 4OJAA 1A14L 1J1PL 4OBRA 3K4AA 1TTBA 5CBEA 1NKOA 3IAGC 2F19H 1JWMB 3L3HA 4KRPD 1XH2A 1C5DB 2EUZA 5GRZA 2FJFB 3TIDB 2Q2EB 5ADOH 3CU1A 5JQ6L 2O61B 4LLMA 1WRFA 4DKEH 4PFEA 4M62H 4GKSA 4J27A 2APTA 4JUTA 3RNQA 3S48A 3UIYA 4F15C 3KLSA 2E27H 1I9RL 1P4IH 1QRNE 3LXCA 3VRLE 5J1AA 3VSTA 4N9GB 4FEIA 2J21A 2KYIA 4O00A 2HT2D 3UP1A 2NY4C 5ECJE 2HPTA 1AC6A 2WLZA 3GGWA 3RX7A 4QRRB 3ZRFC 3HC0A 3MCLH 4F33A 5LG1A 1BLIA 5KYUA 3HLAA 4F2FA 4HKBB 4PJEF 5IW1A 1CCZA 3FTZA 4ODHL 4PJXB 1YPZF 5E00A 3UTTD 2Z91A 3RVXD 1BVLB 2R0ZL 5GSRA 2YA2A 4S1DC 1UG9A 4O58L 4Y4HD 3I3EA 2P5PA 5I82A 3Q1EA 1UHVA 2DQCL 4AM0A 5L8JB 3BIBX 2HFEA 2L0DA 1J8HA 2K78A 2C9QA 4ZMQA 3BVVA 1GIGL 2IAND 2YAPA 3MBWA 5D2LA 4EMZA 4HK0A 5D7LE 2ICWA 5IB5A 1T1XA 3G5ZB 1NOFA 5J06A 4GW1B 2MPAL 4MVBD 3L3KB 1X4YA 5C9JB 3LV3B 3QA3A 4U1KB 2IADB 3ZDZB 5AAWA 4P06A 1X5HA 3RDTB 2WTRB 3TP4A 2ADJA 3G08A 4H25B 4UZUA 4XB3A 5D2NE 1NIBA 3DLQR 3IGLA 1O0VA 2C34A 5C2UB 4OJCA 4PRPD 3K81A 3C5ZC 1E9OB 3ZTJH 2E7DA 2CD0A 3TBTB 1KIUA 2HRPH 2JCCA 5FA4B 3NA9H 5TTRA 2EYRB 3V2AR 1N3NA 4X4ZA 4N5ED 1CMOA 3HC2A 1H3TA 1XL6A 2OKMA 3O6FA 3REVB 3FQWB 3TEXA 3FFOA 2Y36L 2XT1B 4CKVX 1KXVC 1LP9F 4QRSB 2Y3NA 3CZSA 4HXBH 1KCVL 4ZS7L 3UYPB 5EFIA 3CVIH 4XPHL 3VG0L 2VUOA 3F5WB 3ESPA 3F7VA 3GMPB 4NC1C 3L9RB 2HG5B 3NDZE 4Y16A 5IV2A 5KVEE 1Q9WB 3DK2A 4KOBA 5AWNH 1E6JL 3SDAC 4HS6B 5FO8B 1LE9B 1QWNA 4Z7QE 1MIMH 3TH2T 4JAMA 4L8SC 4UOJA 1O75A 1SUHA 3VRJB 1MFVA 4Z7VA 1HSAA 3PPSA 4A7GA 1ZS2A 4TLUA 5E6RB 4NT6A 4U7MA 4JHAH 4P2OC 4OKDA 1ACYH 1J8HD 1SDDB 3L5XH 1B0GA 15C8H 3KGSA 4TXVB 4D9LL 1ROWA 3AWGA 3ROOA 1ET5A 2K4AA 1CFBA 3ESOA 3EYSH 3QEGH 5JQHC 4HIXL 1N10A 2DQDL 2A6IB 4I18A 1EERB 2DMCA 2HP4A 3HB3D 4WEEA 1TLMA 3W0WE 3N40P 4IEFA 4Y9GA 1R3IL 5E8PA 3NZ8B 5HYQA 1ZVSB 4O2CA 1X7QB 5FUCC 3FOMB 2HFFA 2ZXGA 1TZ8A 3LCYA 5D1QA 4C58B 3EYQD 4XNQB 4G6FD 3U7WH 1U3JA 1THAA 2WUBH 3GI8H 3K0YA 3IFPB 3N04A 4WNQA 5TQ0L 4PCKA 3VW3H 4FL4C 5HJBA 5C0JA 2PW2A 3NJLA 1RIUL 3HNSL 1QZ1A 4XXWC 1S9VA 4BFOA 3FAXA 1WD9A 5J56B 4MNQE 3BWAA 2P1YA 3JV4B 3L1EA 1V55B 4NZTL 3WIHL 3O6FD 2PPFA 1HH6B 2XRAL 5MEQB 1G7IB 2GK0B 3S34H 4PJ5D 4Q58C 1G4MA 3H42L 4D0BA 4TSAH 4YBQD 5HY9A 4MJIA 3JT0A 3LEYL 4ZODA 3DHMA 1HQ4A 3UZQB 4JGJA 2W0PA 3RJDA 4OZIB 3CVHA 4RMUA 4P49A 5TQ2H 4BHUI 2XY1A 5KJRL 4NKOA 5LWYL 4JE4B 4Y16D 3TA3B 3NEXA 1DQQA 3OF6A 4X6FA 3S3BB 3KPLB 1X7TA 1AI1L 3ZZLA 3IJ7A 1T22B 1EANA 4J23A 3OAYK 3KGRA 3C60A 3C8HA 2VSCA 3FRPB 4E5XA 3WBDA 4K9EC 3VFSB 1EQWA 3RHWF 2EQDA 3HZ3A 5HDQH 2K6WA 4AZ8A 1GHFH 4YHMH 3NACH 3IJEB 1S7XB 1AGFB 1ZV2A 3E8UL 3EH1A 1YHPA 2Z92A 4MLIA 1UM6H 2CHXA 5D4IA 1VENA 5DRZA 4JFHD 5I8CA 4HWUA 5AUMA 2MKWA 4LSRL 2XQYG 4BELD 2VM4A 2GG1A 2Q20A 2V5YA 5EU3A 1FLRL 3RIKA 2DJ4A 3WEAA 4TNVK 4ANVA 1KT2A 3IRPX 4NXKA 3X12A 5D1QD 2BIMA 1D7DA 4KX7A 3QH3A 3DGGB 5D72H 4D9QD 4RMVA 2B15A 4OIBA 3PJSB 4QHUA 3E1ZA 4AQ1B 2CZNA 3BVTA 2WCGA 4KQ3L 4PWGA 1TSRA 5HGBA 4WY7H 3RWCA 3A24A 4TMPA 3QO1A 4PLOB 5EPMA 1MW1A 4PWJA 1R3JA 4AT6A 4URTB 3BVUA 1CDJA 2YWYA 4P5MA 3C09C 4LOFA 4NHCL 3M6DA 2YHGA 3R0NA 4AYFA 5AFAA 1UWEH 2F58H 2MQCA 4JRXA 4G9DB 2PTTA 4EE2A 1WIOA 2QQLL 2QV2A 1ZXKA 2OTUB 4MJID 1EUUA 5DJ8B 4F7MA 1MLBB 4XMXA 1AAJA 2JJWA 3WFEL 1RZ7H 2EVGA 2X4QB 4GIAA 1JHKH 3C8KB 1A1NA 3F04A 2F5AL 3ARDB 1MHEB 5HGDA 3BCFA 4TNWK 4UTAL 4GQ9L 3OF6D 5SX4I 2XBDA 1QLEB 3ARBB 2AJYL 4BEIA 1WA2X 5K1NA 3BDBA 4OLWL 4AV4A 3C60D 3HC3L 3K5RA 3ZHFA 4NRYA 1BBDH 3B37A 2Y7SA 4UILH 4HJSA 1WZ1L 1KN2H 3SCMD 5BVJA 1JPFB 4FKHA 1MF2L 4M61B 5CCGE 4PY8I 2VQUA 3JWDH 4LQFL 1S8DB 4EBQL 2C1OB 3IDXL 4PJHE 3JV5A 1BDYA 1DSYA 3B3IB 4LP8A 4MDJA 2R2BA 3DX9B 1MREH 3FRUB 2AJVH 2CJUL 4FNSA 4AIZB 1SM3L 1TKWB 1JPST 4U0QB 3PP3H 3REWB 4BGDA 2FWUA 1WITA 4R84A 2V0AA 3ENEA 3SOBL 4QF1A 4W9KC 2IPTH 3LH8A 3R06A 1S7VA 3AMKA 1KB3A 5DS1A 1B4RA 32C2A 3PHQB 1IKNC 1T3FA 3MXWL 3P77B 3VI4B 1SBBA 5EORH 4EI6B 4Y5VC 3R18A 1RVFH 4JZJA 4WW2B 5J6HB 1P4BH 1H3GA 1AP2A 2YSSA 3MLPA 1MCSA 1IM9A 3EO1A 1HK6A 3S35H 4JHWL 4NQCB 4CN6A 4DFIA 4DOHE 3UJTL 2QEJA 4GP4B 2JB5L 4Q8BA 3QXAB 5IW6B 4HIIA 4RETB 5DJZB 1YQVL 4NENA 4UMSA 1JNNL 1E5UI 4JRXD 5CSZA 2FB4H 4ORZC 1AQDA 1FNAA 2CJ3A 2IH3A 5DU7A 1CFMA 1A6AA 1JGEB 3TVMC 1G7PB 3BW9B 2DQTH 4XP6H 3OD3A 2B9AA 2CBQA 5KYXA 2NSQA 2VDOL 2VE6B 5DJ6A 1KLFB 1S3KL 5D71L 3HS9A 3RWHA 3V10A 1A7BA 4CDHA 5A1AA 5IEKB 3V79C 5EIIA 2ADFL 3V7MA 4H2CA 5DFTA 2BVOB 3HHSB 3GSXA 1OAUL 5JHAA 4EXPX 3QJSB 2UX7A 2JXMA 5F3BA 2A9AA 3HE6A 3K8MA 2K45A 4ORGA 1T7XA 3ULVD 5BRZB 1RZJH 2Y1VA 3PGFH 4GAGH 4RCAA 5GS1B 4U6YB 1ZHLB 1OPOA 4OGXL 4KAQH 3VFOB 2CO6A 2IJ0C 2R1XB 4TQHA 5EU4A 1B0IA 3RGBA 5BZDB 4K7PX 4ESKA 2ZE0A 3MRBA 4TVPE 3E3QC 1F4WH 2Z35A 4MCMA 2F8VA 3U25A 4JY6A 1Z32X 2JJTA 4Z7IA 3QAZB 1OT1A 4HWZB 1ZA3A 2GEEA 3X1FA 1FFNA 1IEAB 1ZSDA 4ZFGL 1HJBC 4HIEB 3ZUCA 5IGXL 3LKOB 1E9QB 2ICWI 3DHUA 4LU5H 5F7FA 2G75B 4M6ML 2QVMA 1E8ZA 1JWMA 1PX4A 2G60L 2F7OA 1C5DA 1IM9D 2XQBH 2FJFA 3KVPA 2CHZA 3KHOA 1G43A 4PBWD 2X4NB 2O61A 3D7PA 1AGBB 1YNKL 5AB2A 3SE4A 3IYLW 4QXWA 1D7BA 4NZDA 2FBJH 1NGQL 2MOQA 5E8OB 5AVYB 5L6YL 5H4YA 1VZIA 4NFDA 3FQNB 4NO2B 4X7SH 4FFZH 1NTDA 4HOMA 4WTXA 4OIIL 4LRNH 2JJSA 5FV1L 5AEAA 3I9IA 4JY5L 5AB0A 1D3CA 3DX6A 2X5PA 1SJXA 3VGHA 2CR3A 1JXGA 2YGNA 5EO9B 3VWJC 4HKBA 1OAZH 3WE1A 4U1NB 4WWOA 2XCMC 4PJXA 4A39A 1JVOA 2YZ8A 4OCXH 3WY1A 1BVLA 3L5JA 4ZMZA 3N43B 1S7WB 3HE6D 1ITBB 1JYXA 2XTJE 3UDWC 4RAVA 1CZ8H 1WWWX 3BEVB 3GJFB 4NZRL 1E8YA 5TK4A 1F18A 4LL4A 5HYJB 3UJIL 2XZQL 4GW5B 1G1CA 3FONA 1DL7L 4KK8D 1X6LA 1Q1PA 1CQKA 3G5ZA 4IRJB 4MXWH 4GW1A 2DICA 4KZDL 2IG2L 3GMNB 3IF1B 2HRLA 1I3VA 4M1GH 1MFBH 4JFZH 2YAQA 3MNVA 1AO7B 4OV5A 5CSGA 3L3KA 3QXVA 5C9JA 2OZNA 3LV3A 4FMVA 5HYIA 4U1KA 2F1BA 1U41A 2IADA 3G04A 1O5PA 5D7JC 1CU4L 3FN9A 3RDTA 2WTRA 4A1RA 4H25A 4G7SB 4J3OG 1OTTC 3KBFA 4RMQA 3LPOA 3K0WA 2EP6A 3QVAA 3VE0B 3GM8A 2HWZH 1AHWC 4Z7WE 4OI7A 3TWCH 3TBTA 4NUGL 2CSPA 5IKCB 3MV7E 1OL0A 2EYRA 4H1LB 4ICXA 4WTZA 4PJEB 3IDIB 3SQOL 3DX0A 3REVA 3FQWA 4GXVH 4DO6A 1WIPA 3AREB 4L4JA 1SJHB 3CIQA 4GYBA 3MRLB 2J8OA 3BLBA 1XB3A 3ZQXA 4FFWC 4ZOAA 2ZXQA 2VQ1B 4G8GE 4K4KA 5I5RA 1KJ2L 1CD8A 1T83A 3L3OB 3UYPA 2AP2A 5ITBL 3KEDA 4KKNA 3II2A 3UO1H 5BO1L 4EIBA 1QOKA 5E03A 3F7KA 1CQYA 3GMPA 3OJVC 3L9RA 2HG5A 2AXGB 1Q9WA 5FO8A 1RUQH 1LE9A 4GQQA 3V8CA 3VRJA 4J7RA 5E2TL 1A9BB 1KCWA 2Y1YA 4G7RB 4WO4B 3C5XA 3CDGB 2X6BA 4AMWA 1SDDA 1N7ML 1G9NL 1E3FA 5FM5O 4MX7B 2A6IA 3O4LD 4M9PA 2A73B 4X7TA 5DZLA 4Z1PA 4QHNB 5CGBA 4E36A 4XI5C 3FT1A 3NZ8A 4L1DA 2I5YL 1ZVSA 1CICC 1QZNA 5DC4B 2DL2A 1X7QA 2P80A 3FOMA 2A6KB 2J1YA 3RDTD 5I75C 2AZUA 5CU9A 4XNQA 3K4DA 2IDCA 2ZX5A 3FHAA 4N0YL 3P73B 1YO4A 5ES4B 4JL1A 3B2VH 3H85A 5E99H 3QUYC 5LQBH 1MCQA 4KZCA 2GY7B 1BZOA 4RGMC 1X5XA 2GABA 3PAUA 2LU4A 1AANA 1UD2A 1N9PA 2R0LL 4QRQB 3STBA 1VFMA 1SLXA 5I1EL 1PZUB 2IGFL 3I6LE 3JV4A 3BE1L 4XVJL 4JO4H 1G7IA 2GK0A 3GPEA 5MEQA 4D0DB 3NTCH 1LDPL 1A9EA 2MCPH 3LOWA 4GS7C 3FKUS 4GXFA 4MHHG 2HRGA 3P69A 4XOBA 3S3SA 2UZPA 3UZQA 4CL7A 3EFFB 1G6RA 1JERA 3QI9C 4OZIA 1W0YT 1EFXB 5BNXD 3DO4A 1BMGA 3OKOB 3WI9A 3HIZA 3TA3A 4A04A 4F9PA 2Y1AA 2BZDA 4TOYH 3BP4A 3KPLA 3QZWB 2F7IA 2XG5B 3Q2CA 1T22A 1L6PA 1U92B 5J1TC 1M6OB 3QFGA 1RUAL 2YUZA 3FRPA 5CJQH 3QDME 3VFSA 1KZQA 2A7BA 3LNDA 4CC1A 1CDHA 3FBKA 2XIBA 2EH8H 4TUUA 2BWIA 3IJEA 4JM2C 1AGFA 3T2OA 2QL1A 3S5LB 1TO5A 3SO3B 3VD4A 2GUOB 4YNYB 5LLIC 1CR9H 4LASH 5TDNB 1F3DJ 2IAMB 2NY7H 5I71C 2WQWA 3OSVA 3IJSA 5C0GB 4HHAB 5FO7A 4J2QA 4IBVA 5CZXD 7TAAA 4JGUA 2N7SA 4CMMB 2P80D 2TRHA 4KMQA 4J3XA 2F9BT 4OD3L 1Q9LB 3DGGA 3GSRA 1TJHL 2B4CL 1HX0A 5CIPH 4OCSH 5MEOB 2IALB 4MZRA 4LLUB 4AQ1A 3U4EB 4A7TA 1J05B 3DSNB 4NPJA 2NY5H 1I3RB 3BIAX 3WE6B 4XXDB 4AKPA 2VLRE 2D73A 4JHZA 3O2DH 1CLZH 5IK3B 2OS7A 4QJ4B 3NIDE 1XB8A 4G9DA 2W0KA 2FX7L 3KHQA 2OTUA 2ENJA 4HK3N 1MLBA 2NDFA 3QPXL 3A5VA 1F8TL 1YAZA 1QHPA 4DKFL 5T3ZE 3CX5J 4BKTC 3C8KA 5DUBB 2H3KA 5HJ3B 1MHEA 2KT6A 3IN0A 3TA3D 2AC0A 5DTFB 3TN0D 1FYTB 3AM8A 4YDZA 1UZ6F 1MAJA 5DGQA 1NPUA 2AK1L 1AGDB 3T0XA 5I9QC 2DYPD 2MOGA 1I82A 3NZSA 2VRAA 3ESNA 1KIQB 3MJ7A 3RLSA 4AITA 1FZKB 4NBXB 4O51B 2Q76B 4PJGE 3SZ6A 4NO5B 1HE7A 1JPFA 3U6XS 2W1NA 4M61A 4XNDA 4HMCA 1S8DA 2C1OA 2BY0A 2UYLB 4HIJB 3B3IA 1JNLH 1OE2A 2OJEB 4M5YH 2XTSA 4DO5A 3DX9A 1AR1B 2OYMA 5JDJA 1TKWA 1T2XA 3REWA 2ITDB 1XIWB 1KEGL 1G9NC 2CGRH 4Z7UB 5DD5L 1R17A 3EO0A 2EDXA 2VN7A 3W11D 1FH5L 1V54B 2FEJA 3PHQA 2BINA 2BHZA 4R6UA 2X40A 1A6PA 3IFLH 4KRPC 4N2KA 3VFUB 1Z9NA 2BDNH 3P77A 3H2WA 2D9CA 3VI4A 4EI6A 4WW2A 4FA6A 5J6HA 3JV6B 4FQIH 1AKJB 1T1WB 5E2WL 4PY7B 7FABL 5IVZB 5TF0A 5LVEA 4C56B 1AZCA 4NQCA 5BXFA 2YPVH 1FGNL 3BKMH 2OZ4A 1CFVL 4N90E 1SEBB 3QXAA 4XNMB 3MRHA 5DJZA 5FHBH 2BZ7A 4LSVL 4QR7A 3RUGB 4I9WE 1WGOA 1WZAA 2H1PH 5IG7B 2YRPA 2HJKB 2YXWA 5FYKD 4NI3A 1JGEA 5AW1B 2H4EA 4CNIB 1G7PA 3BW9A 1I7ZA 4FJZA 3JYBA 2VE6A 4JG1H 1KLFA 4ONOA 1KTBA 3W1ZA 2YIHA 4TQ8A 3NEOA 1G1YA 1WTLA 1QW8A 1UKQA 4X7EC 5KANG 4U6XB 1OD9A 4DKDC 3O2WL 5IEKA 2BVOA 35C8L 2WLLB 4Y4HC 5L8KB 3FU7A 1UXSB 4YX2H 4YDJA 4KI5D 4UT9H 4W4NA 3MAWA 4B3VA 4GG6F 5JHLL 1T89C 1ZHLA 4PMEA 3VFOA 2R1XA 5D6DA 1X7SA 5E9DE 5KUKA 2DAVA 3TJHD 1EK3A 3ATFA 5BZDA 3QDGE 4J3OH 3RTLA 1I1AB 2X2IA 2VXQH 5HYSA 1SJVA 3KWXA 1NUGA 1P4UA 2BCMA 1ZLWK 3AB0B 4N2CA 2OMBA 4RX4A 3GB7B 4HWZA 2DH2A 4UT6H 5MENB 1IEAA 4X8CA 4LP4A 4HIEA 3LKOA 4PWIA 1E9QA 5GIRB 1XV8A 5HI5D 4XZ4A 3OAUL 1L3WA 1VLXA 2FIKB 1I85A 4NQCD 3GTNA 2X4NA 4P05A 1UB5B 2FATL 5EOQH 5JIPA 4M7KL 1PLGH 3EF7A 4XPBL 2PYEE 2A9DA 3IK2A 2GQHA 1QPPA 4J3TA 3SIKA 2ERJB 2XWXA 2B4CC 3S7GA 2EIDA 5FGBA 2Q3AA 3U4KA 4FFYL 1UXLA 3FQNA 4NO2A 4OM0H 3T6XA 3S36X 4ZMTA 3PAZA 2X6UA 3RZCB 5J3HD 3HE7D 4XB8A 4EOWL 3VTMA 4HT1L 3O3BB 3LS5L 3OLDA 5DHDA 4PRHE 5EO9A 4MMYB 5KYYB 4JFFB 2R4SL 1VFUA 3V7AE 4M3KB 2ICCA 2V4LA 4U1NA 2MQ3A 4J8QA 5GGTA 2NLJB 6PCYA 3HI6L 5BOZG 2ZJSH 1KJ3H 3ARYA 1J0HA 3BP7B 5A43C 3MUHL 2BSEA 5CLXA 3BEVA 3GJFA 2XVGA 3PS6A 4CVUA 2YK1L 4U4IA 2PCYA 4GW5A 4G9FB 3MFFB 3TBSB 3I2CL 3LAFA 2EIZB 4OZGE 1MKFA 3FYEB 3OJDB 3BH9B 2FBRA 3HB3C 4IRJA 4OM1L 2ZYRA 3ILDA 1IAIM 5LXGL 3IF1A 4FS0A 4ODVL 1CLYH 3IS0X 3K91A 2XKUA 3O3AB 4RX4D 2Z8RA 5AAWC 3RIAF 1SOSA 5DMJB 5HHVH 4P23C 4ZTEA 4ABVA 2V5SA 3NPSB 4BE6A 3EYQC 3FB7B 5ANME 1XGQB 4NWTH 2JIXB 3ZQ9A 4X5XB 5EF0A 3U7YL 4ZW6A 3ARQA 1GC1L 4HXAL 2Y24A 4JBSA 2P47B 3SKJH 2AABH 3VE0A 4K5LA 3TF7C 4Z0XA 2DJSA 1AQMA 2V9RA 2OJZL 4AW4A 3GFUA 5F3FA 3O6FC 4HEME 3QXTA 4M93B 4H1LA 3DXAB 3NIGE 4PJEA 1UGKA 3GO1L 3IDIA 4DJMA 2BNRB 2F8IA 5HVHB 1CO1A 3APCA 5AKSA 1LD9B 3A67L 3AREA 4G5ZL 3I9AA 3GNML 1SJHA 3NAAL 2VWEC 4KXZI 4Y1AE 2HVBA 1SY6A 2D2CC 4TNGA 3ZR5A 4ZW5A 1TQCB 4Q74A 1E5CA 3SE6A 1V7NL 5FDWB 3QFJA 3LQAL 2VQ1A 4FYSA 1DUYB 4QPEA 3L3OA 4NQUA 3VGAC 3F85A 5K9JH 2VRKA 3AT8A 5IVOA 3T6QC 2DF3A 1V5JA 3SDXB 3UTSE 3KH3A 4LXFA 3V4PH 2XXMB 4LPCA 2AXGA 4BRJA 5DRNB 2BSBA 5AD0B 4Y88A 4A38A 1BF2A 3TTYA 4AIXA 2VJ8A 1NC2A 2ZOWA 3ELQA 5AVZB 1A9BA 2J1WA 5IBLD 5I6OA 1WICA 4HEPG 4J3UA 4MAYB 5ESAB 4WO4A 4KNSA 3CDGA 1W6LA 2APVA 4QJ3B 3ZL4L 1C5BH 4TPRL 1MCIA 3ULUE 4I85A 4MX7A 5LNGA 3RAJL 4OI8A 4IRJD 4HWEH 4TUKL 5IVXE 4KHTL 1ID5I 2A73A 4X6EB 1BIIA 1X5KA 2N1TE 1KZYA 3KWUA 2J8UF 1G0XA 5FUZH 4PS4L 3GJEB 4GO8A 4I7ZC 4QAWA 5D1QC 3LMJL 1TSHA 1PS3A 2XPGB 3NCXA 1ET7A 3T9WA 1AG0A 4FTDA 2A6KA 2J1ZA 4H8WH 3CN4A 4IGBC 3T09A 2BH0A 1DUZA 1U2CA 4CRPA 3KE0A 2WO2B 3P73A 4WFFD 4ZZFA 2X6CA 4U6HB 2L4OA 1LTXA 3MYJB 4JCLA 2NZIA 2H26B 4HAFA 5EZOH 4QWWD 3IT8D 4N5UA 1JHLL 1FFPB 3KDPB 5F0LB 1LP9A 3MX0B 3P0VL 3ISRA 1QAWA 3CSFA 5HJDA 4QRQA 1LK3L 2H6PB 5FOJA 3WUZA 2WSPA 5F6IB 3MRFB 2OM5A 4KKLD 4W6XB 1X9QA 4WKZA 1A7QL 1N0XL 2GI7A 3ARED 4D0DA 2VOTA 1PG7X 5DQDH 3BD4A 4XE5B 5FX3A 5CLYA 5DFAA 1UATA 3ESUF 3QFJD 4LCVA 3KPRB 4H2AA 4PJIE 1OTUD 3EFFA 2WD0A 2VC2H 4CA4A 4BZ1L 1YEHL 2BS71 3S88H 3T08A 2UXFA 3DSFH 3OKOA 4N0FB 4X7DC 3BN3B 2UZIL 1FQ9C 4C54A 3QZWA 5DWUL 2XG5A 5DJYB 1NC2D 1KWGA 1OW0C 1U92A 2V9QA 1M6OA 4YZWA 3SCMC 4XP5H 4WK4B 3QS3A 1JHTB 5LCVL 4WO4D 5DJ0B 4WI8A 3VRLF 1AY1L 1S9XB 3MZGB 5CGTA 1E8WA 4CADB 4EUPG 2V2TB 5LDSA 1VCBC 4LBAA 2YD9A 5IB3B 1RV6X 3WDIA 2GUOA 1G7MB 4ONGH 1TLKA 1F4HA 2DMBA 4ZSOE 1YDPA 5TDNA 1H19A 1WD8A 4I89A 4CSSA 4KDTA 5IOPB 2I60L 2IAMA 3QK0A 4GAYB 3TT1H 5C0GA 5DHMC 5KVGH 4HHAA 3VXUD 2OTWA 1T5KA 2VDPB 1CB4A 3H7BA 3I85A 4CMMA 3TJEL 1I8MB 1X9LA 2ZIDA 3ORJA 1DVFB 1Q9LA 1KUMA 1AHKA 1GCFA 5JA8B 1E4XI 4KNUA 3UYRH 3VA6A 3TF4A 1IKFH 5DD0H 3OWEA 3VWKA 5MEOA 2IALA 4LLUA 3BGMB 3BYTA 3U4EA 3DJRA 2B16A 5F97E 3L5WB 3DSNA 1P5VB 4K94H 1I3RA 4OTXH 3WE6A 4XXDA 2DD8L 3G6DL 1HESA 5IK3A 1NDMB 4JG9A 1NBVL 4M43H 4BA0A 5KZCD 1KXQA 2RJMA 4FLQA 43CAB 3V7AG 1W8OA 4J8RB 1HIML 4ZAKC 4G3YH 3SYCA 5HJ3A 2IDSA 3UTZB 2R4RH 4TSBH 5DTFA 1FYTA 1PNCA 4AC4A 5ERWB 2Y72A 3ZY7A 2FTAA 1AGDA 4P2CG 3LQAC 2J3SA 3L13A 1KIQA 3ULVC 2QQKH 1Z9OA 5I0WA 3GHBH 4H8UA 5HGGS 3QUXB 3A3YB 4O51A 2Q76A 3GBNH 1TPXC 5EZJB 4NQDB 4UIKL 4GMSL 4CAGA 3MNZB 4LEEA 2UYLA 4HIJA 5EIVA 3I50L 3EXLA 1DANT 2IAMD 2O72A 3HS0C 4L4VD 1TNNA 2ITDA 5JW4N 1OAXL 3FSOA 1K3IA 2QMJA 4R7LA 3DURB 1CFTB 3FQYA 5AW0B 4Z7QF 3RWJA 1DFXA 4JZJC 3PQYE 1SMDA 3DPBB 2CPUA 3L95A 1LJMA 3VWKD 3HFMH 4LSQL 4NJAL 2YA0A 5E6YA 5EUOB 5FM8A 1SXSA 3X1NA 2WLYA 1AKJA 1T1WA 3KD4A 5DWPA 4PY7A 5IVZA 5AYUL 3SDYH 3DNKA 3DBSA 1UM4L 4CSPA 1N5YL 1NGWB 4KY1L 1OSPL 1Z7JA 2YOAA 1AVAA 2GCYB 1CXEA 1SEBA 4XNMA 5F7UA 3BPLC 3M86A 3KWVA 4HX1B 3ULSB 2E6QA 1HH9B 1IFHL 1X3DA 4DN4H 5IG7A 2HJKA 3BDYH 4RMSA 1OF0A 3PG2A 2FUTA 4KO6A 4NN7C 4ZX4A 4Y0GA 4CNIA 2JH2A 2MTPA 1H9DA 1DQMH 1MG3C 4FNPA 1FYTD 1MCBA 5BZWB 3CXDH 4U31A 4JDTL 5JHMA 3EH3B 3HE6C 4QRFA 3WJMB 1UACH 4TYUA 1RJLB 3TYFA 4BH7B 1MWAH 1UXSA 2D8KA 4OFVA 3OB0K 3T0WA 3V0EA 1NCTA 4YHIB 4Q9RH 3E6HB 1JTPA 1UVQA 4OCMC 3X1EA 3GDBA 2B3RA 1HKLL 4KK8C 4X6BB 5CM1A 4CDGC 4YUEL 5MHSD 2ZCLH 1TYRA 2K8MA 1I9JL 4XBGB 4G72B 5CZKA 2JJTC 5JORB 2BOCA 4NAJA 2X2YA 2XV6B 3WN5C 1I1AA 4OJEH 2OR9L 4Y7MA 5T33L 1WFMA 2WW8A 3GB7A 2ZUWA 4YVUA 5MENA 1MCHA 2Z7ZA 1R5VB 4N25A 3O4OB 3OMAB 3BCDA 2JCWA 4FXGB 4JCWA 4UWQB 5GIRA 5GJTH 4EPSA 3DRTB 3VFWB 3EXJA 1VSCA 3IDYB 4K55A 5BQ7A 3M8OL 5T3ZH 3SE4C 2FIKA 2C9UA 3G5YB 4PJFE 1UB5A 3ATDA 3VCLA 1R47A 3ETTA 1M57B 4NPKA 1JDDA 4PR5B 4CW1B 1U8KB 4OCNC 3GS0A 1FL3B 5JHDD 2X4OB 2X6VA 1KYFA 2AEQL 3QDJB 1NJ9A 2OXGB 3DARA 3MRCB 5DO2D 1IVTA 5C7ZA 3QIBB 3POCA 4EZJA 3B7YA 4PD4K 3RZCA 2VLKE 2NNAA 4I2XB 4MAZA 2OAAA 3O3BA 2JVUA 3D18B 1XGYL 3ZKSD 1ED3B 5KYYA 1U3HA 1AZNA 3P2BA 1A7RH 4JFFA 4MMYA 4GG6B 2R0WH 2BIPA 2CQVA 3HAEB 3KLHD 2AXJA 2WBXA 4YMPA 3O3EA 2NLJA 5LBVA 4J3OF 5E08H 5E6ZA 1MN4A 5DSCB 2WTOA 3BP7A 3RGVC 3TJPA 1G9EA 1FRGH 2DWYA 1EJ6A 1SVCP 4BZ2L 4X9FA 2P49B 1MJ8H 3F6JA 4R4ND 2HSIA 5GISL 3JV0A 3DYOA 1ES0B 2JI1A 2YO3A 3K1KC 2DH3A 3OJDA 3BH9A 1IEHA 1MNNA 2XY2A 3IMUA 1I1AD 2HLFD 4GP5B 1DQDH 2CPCA 1RMFL 4D2NA 3MV8E 3O3AA 2NYKA 2BP3A 1T0MB 2A99A 2YOCA 4K2UL 5JIQA 3FB7A 1XGQA 1CGVA 1FL6A 2JIXA 4MD0B 4C83B 2CH8A 2GYSA 3L4CA 1S5IL 3FH5A 4GH7B 2VERA 3PWUB 2PTVA 5IBTH 5INDB 4KROC 4U3XA 4PY8J 2ADGB 1Z66A 2VDMH 4LAQL 4PJHF 4RA0C 5DZVA 3TASA 4D9RD 1UM5H 5E4IA 2AQ3A 3ASOB 2VIRB 3WG7B 1EBPA 4S1SH 2DJMA 3DXAA 1YEJH 5HHXL 1JGVL 3QG7L 3WTTA 3DO3A 1LD9A 4FXKB 5AKVA 3M45A 2N0MA 1HI6B 3T77A 3RZCD 1NOAA 1DBAL 3MACL 2ZKMX 4GQPH 4A2HA 5GRVL 3HPJB 4HBCL 4XMZA 5C0BB 5FDWA 3WTWA 1U3HD 1DUYA 5D1XB 4YDLB 4JFFD 2H6UA 5HVWA 4DGYH 2YGPA 4EUPH 4ZTPH 4XCCL 5L4MA 4KO5A 5ABAA 5DRNA 5BW7A 5AD0A 2HH0H 1E4XL 1A6VL 4WFHD 3QC6X 1NCWL 4HJTA 4NM8L 4OLUH 5F0JB 1U8JB 3VD2A 4MCZB 5BV7B 4YXLL 3Q2NA 3UAJA 5ESAA 2BOLA 5I1JH 3QQ3B 1HINH 5B39G 4S1RH 1I9IL 1NGZA 2ZAGA 2ZP8A 1O9ZA 1UD5A 2GVYA 2X10A 4PQXA 3RL2A 2EVIA 3KEHA 4F58L 5AZ2L 3GJEA 5IJBC 4YDVB 4ZRGA 2K9UA 2XN9D 2VNCA 2XPGA 2JIXD 2OZ4L 3B2MA 4Y8AA 3SGDI 3UC2A 3MLZH 3T4YB 2VDNL 4ZYKB 2YAEA 5KVDH 3V8OA 4L3CB 2A9ML 2A6JB 1ZMYA 2EE6A 4XXCA 3WFCH 4DN3L 3MYJA 3LSOB 2H26A 5F7YC 1FFPA 2OA9A 1RU9H 4R90H 4Q9QH 1TF4A 2H6PA 4M3JA 3DXAD 2CKBL 1FAKT 2IGLA 3EOAB 1JGDB 4OZHE 3MRFA 5FM5M 4DQAA 3OKNA 2BVUA 1V7MH 4NXSA 4AEHH 1HOEA 2HVJB 4JKPL 4TNVF 1TMCB 2MNWA 2Y2YA 4NUJB 5CNHA 4L1HA 4KVCL 2ICWJ 4UOZA 3RB5A 4ABQA 1QEWB 2H1LM 4LEBA 3OWRA 5IZ7A 1ZEAL 5FYLE 1A25A 3O6KL 3TN0C 3UPRB 4KTGA 3EUDA 4N0FA 2DKMA 5C6WH 4FC3E 2YD0A 5DJYA 1NAKL 4JLRB 4OLXH 1RIVH 3MKGA 2CU9A 4CC4C 1JHTA 4G6ML 2J8UB 5DJ0A 2EDRA 1NCDH 1BFVL 1OKEA 3DETD 1S9XA 4CADA 4Z3TA 2V2TA 1DVZA 4DERA 4XN1A 4F2ME 5IB3A 2KLTA 4MA7H 1G7MA 5DUJA 4XPTH 3HLKA 4BK8A 5M94B 4WGVB 1IGCL 1QSFB 5IESH 3GXTA 3OLEA 4LNVA 1F2XK 3IB4A 4GAYA 4DTGL 1BM3L 1XXDC 4TLKA 4XWOC 2YJLA 3FTSA 3O8XA 4GLRH 2V9UA 1I8MA 2GHWB 5E2VL 1UXWB 3M88A 2G2PA 2N3JA 3BUPA 1DVFA 1EMTL 1XBDA 3BDXA 2CO4A 5E6IB 1T7ZA 2OPCA 5SWSB 2DWSA 3ET9F 1MJ7H 2GSMB 3ALPA 3BGMA 2VT0A 2OLDA 2OMXB 1FCCA 1L9TA 5DD1L 1P5VA 4CMHB 2EDWA 5L4JA 3FT4B 4FQ2H 3UG5A 5CSBA 2HKAA 4X98B 1NDMA 1XGRB 1HWWA 1J8KA 4HDIB 2C4FU 3OSKA 2OL3H 43CAA 1CFQB 3WHXB 4Z5RB 4J8RA 1IGYB 3EGDA 4PGEB 4R3SB 2DPKA 4IK6A 1QRNB 4OVUA 3AM8C 3MRMB 3C6EA 5E5UB 4DW2H 3LQZB 5JOPD 2G9HB 1A65A 1U58A 4S2SB 1E8XA 5FYJE 4TLTA 4QGYA 3K6DA 4Z7WF 4X83A 5ERWA 5T5FA 4BFRA 1ZLWH 4UAHA 4TQEL 2YSTA 4YDIH 1DVQA 1R3LA 4Z76B 3KYNB 2OX5B 4ZI8A 4YN3A 3L1OH 3QUXA 4AEEA 4QUOA 5EZJA 1YYCA 5C3TA 4IOFD 4PJ8C 3GZOA 5EZPA 3OB8A 5H35B 4WNJA 4BFGA 2ZWZA 5EC2A 4MAUH 2AJXL 4YO0B 2JTYA 4PRAB 2D0GA 4G42B 4LBEB 5KSUA 3QQ9C 1QYGL 5F1NB 5E4AA 3B9KB 3RB7A 2DLFL 1KTJA 1FNEB 2W07B 3DURA 1CFTA 3O8XD 3SGKA 3V6BR 3ZKND 5KSAC 3WEMA 1F45A 4FKKA 4UB0L 4KVNL 2FO4B 2XPZA 3H2QA 5J9PB 1AIFA 4EI0A 3QP3A 4LSSL 1WPCA 1ZANH 2PR4H 4YSSA 3MRJB 4YDMA 2HJLB 4LOEA 3N9GH 5EUOA 5AALA 1INEH 3PP4H 4NQQA 2P44B 4NNPL 1FVEB 2F1EA 4Q9CA 2QTEA 3EHBB 4M03A 1QFHA 1NGWA 3QQ4B 5D2NB 1D5IH 1JZJA 3FN0L 5KBPA 1ET8A 3RVUD 2IDTA 4LF3B 2A6DB 4HX1A 3FO9A 4LFHG 3ULSA 1HH9A 2BW5A 2FLRT 3B7UX 3D85B 5J3HC 3HE7C 4M8QB 3T0DA 2YEZB 1ZIAA 3MJ6A 1BAWA 4U1GB 4B95C 1JD7A 3T0EE 1Z5LB 3RRQA 43C9A 5HYEA 3ARVA 4NRZA 2JCCE 2C9SA 4M4RB 5BZWA 3P4NB 1ZLUK 1H6UA 2XI9A 3PV6B 4WF7A 4B9PA 3CC5B 1RJLA 4JQVA 1UWGH 2V37A 3EH5B 1V3JA 2DIAA 3QUXD 4NGHL 3ZVVA 1YJDL 4YHIA 1MFCH 3LZQA 3E6HA 1BVNP 4PLKC 5GRUH 2NUPA 3PJNA 3ZYZA 4H0LC 4W9JC 1G5GA 3CC1A 3P3UA 4X6BA 4Z7QB 3SB3A 1VAHA 3ARFA 5IQOA 4OLVL 1BZ9B 1XMWA 2WXGA 4G71B 2ZXAA 5LGKA 5BS0E 1Z9PA 2AQ1A 4WO0A 4JJHA 4N86A 4MCYA 3SY0B 5JORA 3INUL 2N0KA 3P4OB 1RUML 2QHRL 2FQEA 3BT2H 3Q5OA 5MI0C 1H5BC 1AJ7H 1NCNA 5FPIA 5A6LA 5D96C 3GK8L 5I16B 5I6XC 1R5VA 3GHEL 2VITA 4LVNC 5HDLA 2JK5B 4FXGA 1I85C 2NZ1A 3DRTA 3VFWA 3ZL1A 1A3RH 4U1MB 4HH9B 3QWQB 2XTLA 1ZGLA 4HPYL 3G5YA 4OQTL 3UAAA 4UM9A 4LDLB 3CXFA 5ANHA 3VDBA 5JIMA 4YL9A 4IBSA 3MOBH 1CN4A 2Z8VC 3KPSE 3LZPA 4PR5A 2PWFA 3ZT6A 4CW1A 1AXTL 4LVEA 1KCUH 1FL3A 3O6LH 2X4OA 2XLLA 2BK8A 4ZD3L 4QXTB 3ZE0B 5CJXA 3QDJA 3SE3A 1RZKH 2OXGA 3MRCA 3VACA 3QIBA 1U8OB 1DP0A 4E9LA 4YPGB 1MFUA 2OCJA 4I2XA 3KVQA 4GY4A 4U1JB 5IF0B 1RY7B 2E8YA 4ZJ9A 1O7SA 1ZVNA 3D18A 1XXFC 4G7YH 4ZMXA 1ED3A 4HJJH