4KKPA

Crystal structure of vibrio cholerae rbma (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
VIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAQQESDALTDGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords RbmA protein
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 45
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA01
4KKPA 4KKRA 4BE6A 4KKQA 4BEIA 4BE5A
chains in the Genus database with same CATH superfamily
2H1XA 1J10A 3KDMB 1OCZB 3EYUH 5D2NA 4N8CL 3V52H 3C6LB 4LLVB 3VSVA 3QIWD 4WHDA 1M2VA 1KEGH 2EO7A 5B3JE 1AZZC 3O9WC 2XWEA 1MCOH 2BSDA 2K7PA 1RZKC 2FEDD 2UUDH 1AQHA 5E08L 4HJ1A 4EE2A 2LTQC 3QZNA 2P9RA 3TONA 1BYNA 3QORC 1I1YB 1S9XB 2GSGB 3N1PC 3N85H 4NQVB 2KT6A 1UGKA 2YUXA 2IWEA 2DYPB 4LLUB 3ZZLA 4ZG1A 2LU5A 2VDOL 3CFQA 2FEEI 1CTOA 5K5YA 1QTSA 2X4NB 4PW9A 3U30C 2C3GA 2XDHA 2OCCB 5D7EA 2EIBA 2VXQL 3PY9A 3D2TA 2BY1A 4G9DA 2OK0H 3QFJA 1SY6L 1X5FA 3ARRA 1YNKL 2G5RA 1H15A 2OTUA 3OAYK 4W81A 3LAFA 2XPZA 3IJYA 4JS7A 1M6OB 1H8SA 2BNRB 5FO7B 4AZ8B 2C9SA 4PWKA 4WI0A 3GSOA 2VQ1A 2DD8L 3ELAT 4WSKA 5AW7B 1XXDC 3HZYB 1HN1A 4M61A 4ZX5A 1C5DB 4B7LA 2OZNA 3LEYL 4LHUD 1OW0C 4D8OA 1CD0A 1MCBA 3G5XB 1W91A 4Q9CA 3EFDL 4F7KA 1EAOA 2WKOA 4NPKA 4PJ8C 4YBHA 5AALA 3MFGB 5E70A 2R56H 5LBSA 4P5TC 3DROB 3GSRB 2PYEE 3LY6A 4CVZA 4NBYB 4X9YA 1ZT1B 4IYKA 4RNRB 5CMAB 3RIFK 1RJYA 4N2BA 1I9RL 3UG4A 1CU4L 1FVDB 2QQNL 2M83A 1T03H 3E1ZA 4NO3B 1Y18B 2CLVB 2P3YA 1PZBA 5IOPA 5CILH 4HMCA 1FVEA 2AAVA 4U3SB 2OSXA 3CZEA 1R6VA 4OJFL 3LSOA 4KZDH 5FYLL 5E2JA 3VFVB 1CBVH 2N7AA 1VCBC 4CDHA 1GZPA 4P23C 1IGTA 4PJAF 1XL6A 4YQXH 1G84A 4FQ1L 2HAZA 2OL3A 5CLYA 3X13A 3AXHA 3LB6D 4I3SH 3WJMB 1IEHA 4C55A 3QQ9D 4K7FB 3MUGB 4DPBX 3UJTL 3UX9B 4U1JA 4OLWL 1L6ZA 1WQVT 3JTSB 4XCNB 3ZGHA 1CICC 4JQXC 3TJEL 1UFUA 2R29H 4ALAC 3U83A 4X5LA 1MW0A 1GGBH 4LKXB 1JD9A 2WKGA 2OAAA 5D55A 1G9EA 5TE7H 3JT2A 5F7EL 1SOQA 1HEZA 1MCWW 5IFAL 5I8KL 2Q6WB 1XAUA 5EC1A 1QBLL 5IW1A 5KSVA 5E5MB 5DUBA 3VXUE 5D9SA 3KEDA 4MZIA 2COQA 1IKFH 4AW4A 1QX1A 3NEOA 4U7SA 4ZTPL 2LAGB 4NNXA 5C71A 3QCUH 4K94L 1XGPB 2F8VA 4KXZH 1MCNA 1LE5B 2G3NA 1BD2E 1DQLH 4LP5A 4OUUB 5FECB 2H32A 4FHBD 1TKWB 1IVLA 1RUKL 5FYJE 1ZV9A 2EZ0C 4BIKA 4X5WA 4L3FA 4DK3A 3AY4A 1TF4A 3U4EB 3FRPB 3B34A 3RWCA 3KPNA 4BXVA 2CLZA 5AOLA 3BGMA 5FW7A 2A74C 2BVOB 3CV5A 3MBWA 3RVVC 3BP7A 2DPKA 3QZWG 2AEQH 5FOBA 1HILB 1MI5E 2KYIA 1KPUA 1UCTA 4J6IA 1BZ8A 3WUWG 3MACL 4KFZC 4FABH 3BW9A 3UAJD 1J18A 3IBOA 1URLA 4P3CH 2ATKB 3CUPA 3W2DH 2RD0A 3L7EA 3MJ9A 3DJRA 1XB8A 2AK1L 5TDPB 4AENA 4DVBB 3BP4A 3LH2H 4NQED 1NCWL 5HHOD 3L1OH 1K6QL 4FYQA 4JK0D 3I9GH 1LE9A 2YKLL 3WJLA 1EZSA 4PG2C 1JCKA 1F4WH 1L6PA 1ZS8A 4GAJL 3KYKL 3O3EA 5D7JA 3FQUB 3GF8A 1S7QA 3BDYH 3K6SB 2AJ3B 1OAXL 4WJ5B 4QHUB 2R0KH 4F24A 1MW1A 2ITDA 2OSLA 3GO1L 4NZDA 4F2MB 3D0VB 4Z7QB 2WJ7A 4OF3A 4JN1L 2ENQA 2UUDK 2OZ4H 4LDEB 4OCXL 2HVBA 1NDGB 4TLSA 5GZNA 1E4KC 4PRIE 4AXWA 4XPTL 1AE6L 4OQTL 3KLAB 4F15B 5I74C 3IE9A 4QLWA 1W8EA 5ETUB 3H9YA 4AI7A 3C60C 3OMIB 5BRZE 1XH3B 2B20A 3DDGA 3GXUB 4JPKH 1RL1A 5JHLH 4L29A 5C0IA 3OTTA 3NZ8B 1FNGA 3RTQC 4PM1A 4NI6A 4JHZA 2QLVB 1RZJL 3FQ2A 3E3QC 4U4BA 1HHHB 4WWID 3LN5B 4A2EA 3FFCA 3OC5A 3FQRB 3KXFE 4RZCB 5MEOA 1TTCA 2HRGA 1QFWM 3ULUH 1F8TH 2GJRA 2AXFA 3KPSE 3QJHB 4QAMB 2NT0A 4GXFA 3AGWA 3UYOD 5IMOB 3O4OC 1E0OB 5EEXA 1IM9D 2OJZL 2FQGA 2XTLA 3BEWB 3OMZA 4OZFH 5J57B 4C56E 4KJYA 3VQLA 5J0BA 1JIBA 3AQYA 4GSXA 4ZPVB 4WENB 2UXVA 3CIAA 4GAGL 1QZ1A 4U1HB 3NCJL 2BVQA 3OWEA 3H9SD 5FUZL 2OM5A 3IJEB 2WMPB 5FA3B 3HRZA 2FEEL 4V11A 3TM6A 2O6CA 3CJJA 2WO3B 4FQHA 1IJNA 5KUMA 1ZLUH 4CL7A 3RWGA 5I1KH 2CCVA 4FQXA 5FUOL 5IHLB 2B77A 4R0LA 3VXME 5F2FA 3BDXA 2JCCB 1E4JA 4ZFOL 4HJ0C 3KLKA 4GFXA 4L8CB 1IKNC 3B37A 4NIKB 4ERSL 1ZA3A 4AJVA 5C2BL 5CO1A 2KL6A 5KVEL 3TZVC 3FO9B 2YC1B 4X5XB 3D30A 4GMSH 5ILTH 5CCJA 1KBVA 4M43H 1ASOA 3QYMA 2NYYD 4FFVD 2YPLE 4XNYH 1AD0A 3ARPA 2Q8AL 1ZV2A 2IOMA 3P2TA 2P52A 2G9HB 2VSDA 2CRZA 3CQPA 2AJVH 3HC4H 3STLA 5ISZB 3FSZA 1E9OB 3OR6B 2UYLA 3GRWA 3BVVA 1D7DA 3O6LH 4PB9L 3AUVA 5EIQA 3AG2B 5BV7C 4Z5RB 1GY2A 1TNNA 4XCYA 4Y4HD 4MJ5B 1UURA 2AABL 3V79C 2IAMC 2VL4A 4NRYA 5DRXA 3MNMA 1KGXA 5IJKC 1BVZA 1FGNH 1XGTA 3P77A 4Y5VC 5SV3A 1QEWB 4M8QB 1TPXB 3M86A 4O2EB 1BAFH 4BJLA 1FL5A 1WEJH 1CE6A 1JG9A 1U8JB 1J9QA 2ZX6A 2H47C 1DFXA 3WN5B 2XQBH 2FX7L 4OCWH 5AVWB 5F93C 4QRUA 1ZXQA 4PJEF 5DRNB 1I7UB 3R18A 1G7QB 3S3BB 4KHXH 4PRAA 3F84A 4XP6L 1MDTA 2NNRA 1QBMH 5A2AA 2BMKB 2OJ1A 1O6VA 4KBPA 4QRRD 1M7UA 3R8BB 3UACA 5AKRA 1MHPH 2WAHA 2VXSL 4DIXA 4CGUB 3BRGC 3M1BA 4ZSOB 1KXVC 3BP5B 1JWUB 3CVDA 3GKWL 3P02A 4PJ7F 4PWFA 1A0QL 1G7MB 4MD0B 4WW1A 2F7PA 5DD6A 5I18L 3QJXA 2IAAC 3OC8A 3LNEA 4MS6A 2E7HA 3GRGA 4JDTH 3V4PL 3VX0A 2R1XA 4ISVB 3DOSA 5C6TH 4M3JA 5I1EH 3GDBA 3NPZB 1RMFL 4XHQA 4J6RH 3O2DL 1OL0A 1QKZL 4QMEA 2M1KA 4YHOL 4K73A 4HCGA 4M62L 2JTDA 2XZAH 4FQIL 4H13C 1CFNA 4ESKA 5IROD 3CFEA 2MCAA 1D6EB 3B4NA 3PV7A 5ADOH 4TQIA 3ZLQC 4OGYH 2WNGA 3OKLB 1H3PH 1R3JB 2FH6A 1ZDSA 4DHLA 5I16A 2DQUH 4KJWD 3ZIMA 2V17H 1G7IB 3EJYD 1G9NL 3S5LA 2BVPB 2I27N 2YA2A 2A77L 3ZOAA 1YY9D 1PZAA 2GCYB 1LP9E 4NC0B 5EIIG 1L9MA 2VZUA 5C0GB 4OT1L 4PJIE 3FUNA 1KYOJ 2AQQA 2E4TA 1A5FL 1UZ8A 4G5ZL 4OIFA 4PJAB 4DW2H 3DX7A 5EOTB 4HDIB 1R3IH 4HWUA 3TBBA 5CJXC 5JIHA 3EGXB 2VH5H 2CGYA 3VMNA 5KYWB 4EJ1C 3V0AC 4TPRL 2WO2B 3PQYB 3WXWL 1XR9B 3QH3B 3RVXC 2P24A 1HHJB 3HHMA 5B8CB 3C5SA 5F9DC 2F7QA 3IU4L 3MRRB 3GZPA 3BXNB 3LXBA 4YHZL 5LXGL 3NA9H 5GRYA 3HG1E 3QEQD 1QSZA 5EORL 5C09D 3HNVL 2R4SH 4IOSD 1IQDA 3OAUL 1A3LH 1HAUA 3BUQA 1PZ5B 5T3XL 3VXPA 4O51A 2CJTA 3DECA 4PR5B 4X4YA 2EYRB 4JVPA 5C0CA 4CA4A 1UYWL 3KMDA 2RBLA 4Z3TA 1C5CH 2QKIA 1NA8A 3RWFA 3IS0X 4XPGL 2FBJH 1ZD6A 1EA9C 2IFGA 1PAZA 1WBXB 1SM3L 4IKKA 1T22A 2NXZC 5DS1A 1MHEB 1RZGA 1BFVL 1JGEB 3Q6FA 5ECJE 4NEHB 4XODA 4HLZG 3RX9A 2C7FA 3UDWC 4P5MB 4GRLA 5E6YA 3TO2A 1H3TA 3BLPX 4FLRA 5GJSL 3S3JA 5DHYA 3V55A 4RLDA 1CVSC 4YNYA 1RVFL 1T6VN 1WFIA 1Y0LA 2VITB 4H4NA 5I6PA 1D6VL 1CF8L 1OWWA 3ALXA 5H94A 1A65A 1V7NH 2IBGA 1ZLUK 3WTVA 4OCYL 4I18C 3MV9B 2GUOB 2KERA 1INDL 2K4WA 1Q38A 3KHOA 5ALBL 4PP1D 4U1KA 3O45A 3HCVA 5AWNH 4KRNA 3D3VB 4I9WD 1T89A 1JERA 5AW5B 1OCCB 3SCMC 3NYKA 2B1HL 2WC7A 5E1HB 3P73B 3MREB 2PPEA 2FQDA 1ZA6A 4GUPA 3APNA 5FA4A 3OMAB 2B3RA 4NWTL 2PYED 4M93B 3KWUA 2MHAA 2MKWA 5GGRA 5F9JA 5TJWK 1F11B 2PR4H 4P2RB 3E3QE 3EOBB 4M5SA 3K72A 3WFDH 3RG1C 1A7QL 1XQ4A 2ZXWB 1IQWL 2EDMA 2X2JA 4MNQD 3T0XA 2VR8A 3DMMC 4BDVA 1QUNA 1XZWA 2MQGA 4QCIB 3NAAH 2QQLL 3FUIA 4H25A 4H1LA 2BRRL 2KLTA 2NOYA 2I7SA 3PGDB 1SLUA 4LKCA 1H3WM 4CJ1A 2JWYA 1BEYL 3CPUA 3IU3B 4S1DC 5T5FL 2AW2A 4IMKA 5KSUA 2EEBA 5E2TL 1W6LA 3H3PH 2L04A 3D5OF 1R3KA 2ZKHL 4J28A 3MUZ1 2Y07L 5CKGA 5LWYL 4U6YB 1YN6A 5H4YA 4OJEH 5HD8C 4UU9A 2CUIA 1OT2A 5DD5H 4YHPB 2Z1PA 4IHOB 1A02N 3HI1A 1NAMH 3KCPB 4FS0A 2DQHH 4M8UA 3GSNA 1OSPH 3KM1A 3VXUD 1E6OH 1QATA 2XHNA 3E2HC 4FERA 4MJ2A 5ANME 2FH8A 1NMAH 2PWGA 3IDMA 1YRKA 4UZGA 5D7KE 5FV2A 3IKKA 1UWXH 5JLZB 2VC2L 1EBPA 4YHIA 4WV1B 4ZUWB 1UXLA 2VLLB 1BD2D 4N3TA 3PXJA 3LPOA 2X6CA 5AAMC 1OP3H 4ZMPA 4UQCA 3H7LA 1UA6H 5FYJD 3BMVA 2ZKYA 3EGSB 3IFLH 3O11A 3RL2B 4TV3A 4WHTB 4F3FB 1QI5A 4Z77B 4OTXH 1YUKB 4XP1L 4LEXL 2YSSB 1YVLA 2YEQA 3MNZB 1MLCA 2FJGA 5F0MB 1L5GB 3S6CA 3H42H 1CG9A 4JDZA 2Z8RA 4M5YH 5T5NF 1WFUA 2J25A 1FDLH 4HWZB 5L0QB 5C86A 4Q9RH 1MI5D 3PHSA 3CZFA 4K23L 3BH8A 4ABQA 5C8JA 1NZRA 4FE9A 4HQQH 5ACZA 1B0IA 2HT4C 4PVNA 5IQ7H 5D7SL 1U95A 3I85A 1GC1L 1NFIA 4PJ5B 4R26L 3TGXA 3PF2A 4R7XA 5ICXA 2R2EB 1KJ2B 1O7VA 4K2UH 3F00A 4KKBD 2VR3A 4TVUA 2W0FB 4UM9A 4ZBJA 2CDFA 1L7IH 5K1NA 2VWEE 5EWIL 1BLNA 3ZMEA 2AV1B 1SHXA 3AM8A 4LAQH 1TYEB 2V2WA 1K8DB 1CO1A 3EBIA 3THMH 3TBVB 1MCSA 5DEJA 5HI3D 4MA1C 4EAEA 1E5UI 1DO5A 3N2JA 5F96L 4OGAD 1OPGH 2MQ0A 1KJ2H 4JEGB 4KOCA 1AGDB 4JQIL 3D1MC 3HI5L 4PRID 4O2FB 4MA3A 4PJEB 5EPMA 4L48A 2BK8A 5J89A 5GGTL 2HYMA 4KQ4H 4RMUA 1EHNA 1BWMA 4E9RA 2KKQA 4TVPL 5BRZD 1M71A 1ZCRA 1GIGL 1KDIA 3B3IB 5KSBE 2IMMA 1XO8A 3SZKC 3U6RB 3NP3A 2ID5A 3EBAA 5DMGC 4Y2DD 4NQQA 3MBEB 5DHMC 1D5IH 3MOAH 4H0IA 3KXFD 3FAXA 4U6TA 3PHQA 1MCCA 4RFEA 1P5UA 4OM0L 1UWGL 2D31B 4KY2A 4PJ7B 4XMUA 5EO0A 2CQVA 3VA2C 3L3JB 1AKJD 1MFUA 3I9PA 2XIBA 4DO4A 2VE6B 3KPSD 3HUJF 2DJUA 3Q48A 3FQYA 2ADYA 1IAKA 4CU8A 2JKNA 1GOHA 1LEGB 1PZ2A 2P46B 4ZUUA 2ARJQ 5GRWA 1MFMA 4GG6E 4JFYB 3QNXB 1WAEA 2Q76B 1I8IB 1OM3H 5HYJA 2EEXA 1DBJH 1KYOK 2CHXA 3SKUD 3C08L 1VESA 4WWOA 1OXYA 2EDXA 1PYWA 1FE8H 1M3JA 3F7VB 3CSBA 3U4AA 1DSYA 1P7QA 1MF2H 3DOIA 4JG1H 4WTZA 4BCZA 2BERA 1AJ7L 2VTFA 2YR3A 1ZKAA 3M7OA 2G4GA 5AYTA 4FA8A 1FI8C 2HG5B 2WP3T 4KJPD 5HHMB 3AG1B 3SKJL 1KEGL 5EBWA 3SSGA 2HVKA 4WU5B 3VFRB 2YAHA 3EG9A 1X5JA 2J8UE 1T0MB 5T3ZL 3O9WD 3UTZA 3QR1A 2ICEA 2A38A 2ZF8A 3QGVA 2E6JA 4I0PA 5CIPA 1RLBA 3LX9A 3W0WE 4HUWA 3SEPA 4XNQB 4EN3A 2ZPKL 3GHPA 1MJ7H 2FWOA 2R1YB 4N8VG 4YO0B 4BFOA 1F41A 5LGHL 1OF2A 5HVWA 1F6AB 4P2QA 4P46C 4MYPA 1IFHH 5BUGA 1NIBA 1X44A 3GBLA 3ZZSA 4WWKB 1XIWA 2EICA 4MBRA 3T6WA 2NX5A 5DHVA 4A7QA 1IVTA 4GQQA 3AXLA 3S8GB 1Q0XH 1M9WA 1GGIL 3Q9QA 4IS6A 1JNLH 1V55B 4WGKA 5L6YH 5I75B 3BAEH 1A9EA 2ICWB 1W80A 5DUPL 3OG4B 1KTKE 1JVOA 4PJXA 1KLGB 1UWXK 2ZUSA 2HA1A 4JRXB 4MAUH 1EVUA 4PJ8D 1M56B 2YMOA 5E8DL 3CVIL 4KNUA 1JPFA 3UIZA 1NPUA 4KPHL 1UQSB 4MZ3A 2IG2L 3VYNA 4F9PC 4N1EA 5BVPH 1JF5A 3VU1A 4UM8B 1T03L 1M57B 1HL4A 3U7YH 4OBRA 5L2KD 5B39G 4XXWC 3U0PA 5D4HA 3SPIA 1CLYL 3IMTA 3S48A 5E5UB 4MA7H 2QJDA 4M3KB 1YPZA 3B7RL 3PABA 5IQ9A 1SUHA 4L9LA 4KZDL 5A6LA 2NW3A 4KGLA 1CBVL 4XMPH 1BM7A 2YEZB 4GSUA 4HGWB 4QXVA 2A6IA 3ARXA 3MTXA 4M56A 1C1EH 4P23D 2Y5TA 4ONFH 4ADIA 3L2NA 1EERB 1A6UH 4P0DA 1SXBA 3GMRA 1VKXA 5K1VA 2Z1KA 4HP5A 2AEIT 5DO2C 1CICD 1GGBL 2W38A 4EKJA 1KV3A 5MERB 3VQMA 4ADJA 4D0BA 4PWIA 2NTSP 1NFDE 4LCCC 1HSBB 5HDBE 1SN2A 1XH1A 2DQJH 2FCBA 3GINA 3W3BA 1S7WA 1MZZA 1JGDA 3C5JA 1ERNA 5DEGA 2IANE 5HP5A 2XVBA 4JHAL 5DTFA 2HX9A 1F56A 4YXHH 4ELMF 1IKFL 1O0VA 2E7LA 1BBJB 2J2ZB 3L3OA 3NIGF 1E6JL 5JHAA 3DWTA 4YHKH 2Y7OA 3UTSE 1DFBL 3NJHA 2ZUWA 3ME0A 1DQLL 3HBZA 1D5BA 1QEXA 1R17A 2DRUA 3IFOB 3M17A 3NJIA 2VZSA 3CDFA 3Q2VA 4GSRA 4DVRL 1KG0A 3BZEB 4DZ8B 3HG1D 3RWEB 3MGTA 2JJWA 3KPPB 1JGUH 3O4LB 1TR7A 3MRNA 3CXDH 3V0VB 1AG0A 2KQNA 2VJXA 4JY4B 3NPSC 2Q10A 1AGCB 1T3FA 4YSEA 4X8JB 1QABA 1TQCC 5E6ZA 4ELKA 2AEQL 3RB5A 3RVVD 4B53A 2ZZUT 4LF3A 4ZMWA 1L0YA 2EIKB 3T2LA 4B0MM 5FFOA 2H26B 3DHPA 1CFSA 4XXDB 2HMIC 4GYBA 4IRSA 3ZE2F 5K33A 2QPSA 3HLKA 1Z9SB 2PXYB 3SPCA 4ZQKA 1D5ZB 1HHGA 5DC9B 3OKOA 3TBWB 2XG5B 1TT6A 3L1OL 3VWKA 2EABA 3ARZA 4Y2LA 3WLWC 5BS0B 5TE6L 1F4WL 3SJVE 1I7TA 1J1XL 3WTUA 4P06A 4E5XA 4PCTA 4QHKJ 3QI9A 4PYGA 4HCRH 4P8QA 4HOWA 1WLHA 3H2PA 3FCSA 4Q6IB 4Q97A 4ZNCD 3QPXL 3B2DC 4ZD3L 4IBSA 3KR3H 1ZGLM 5C0BB 1QQDB 4XCEA 4HKJB 1U4EA 1WBYA 1X9UA 3HC2A 2UX6A 2I69A 1JN6B 2I24N 4TRPL 5SWQB 1CD9B 3VRIB 4Q9QH 3VXNB 1LO0H 1J11A 3GPSA 4XN1A 3C60D 2JIXA 3QDJB 2WZ0A 3ZL2A 1FAKT 3GI9H 3PUCA 1TZGH 3RTQD 2O5XL 3TIEB 4XP4L 3TF7C 1AZRA 1IGCL 5AOMA 4NHCL 5HVFB 1WD9A 4DUWA 2B9BA 3GK8H 2BPBA 2GW5A 3RFRA 4QXGL 5DS8A 5EZOH 3UBXA 1XHHA 3IDYB 3OHXB 1IBFA 3FKUS 4XHJC 5BO1H 1D5XB 3TS8A 4ZUSB 1JVKA 4AYGA 2WBJB 3C8HA 5I24A 4A2DA 3ZYIA 2W0LA 1TEGA 1U8NB 4NKOB 4CVXA 5KJRL 4J3OH 2CK0H 5ICYB 2H6OA 1QUPA 2HPTA 1XX9C 5M94B 4WK2B 1J05A 2XY1A 5AYQA 3NJGA 5L4JA 1A9VA 4KV5F 1V05A 1W8OA 3GMNA 1NCJA 1KTDB 4WI8A 3GHEH 3U9PL 2HRPH 4JO2H 3ZHKA 1M7IB 2ARJA 2IC2A 3K8MA 4KNSA 3HUJB 1YHPA 5F3HB 43CAB 5GS1B 5IP4A 4CN6A 4G8EB 5DZ9A 3ETSA 5ITBL 3NQKA 3U9WA 3MOQA 4HKZA 4OKVB 1BYPA 1AIZA 4UV7H 4RGNC 5E95B 4JFDE 1I85C 2PTUA 2VN6A 4Q4EA 5ILTL 4JFFE 4LARH 3TZVD 2IOOA 2E0PA 3QDMD 3HN5A 3CH1B 5GGQH 4UT7H 5C92A 3O2VH 3MLYL 5C97A 3DSFL 4M7LH 3QEHB 3X1NA 3HC4L 3ZKNC 1MHHB 1XXFC 5A2KH 4AMXA 1ZT7A 4TM9A 3O6LL 4JO3L 2F74A 3FQTB 4JPIB 5EUOA 5E24E 3S3PA 3SDAC 5FF6B 1N3NA 1JF1A 1IAII 1F90L 2ZXAA 3QUXC 2AJYH 2V37A 1QZNA 2IAMD 2X1XR 4IBYA 4S2SB 4U05A 4Y4FB 1XF2B 1PG7W 1FPTH 35C8L 4K0OA 3OHMB 5IHWA 5JW3L 1TYRA 1CGSL 4XE5B 5DLLA 1ACYL 3ECUA 5CSZB 3I3DA 3UABA 2QSCH 5IEHB 3WTYA 3S5LG 3SDYL 4BSVB 1A6AA 2GTWA 2ZSWB 4AJ0A 4YH6A 3T8XA 5J7CC 4U6HB 2B08A 2Z8VC 3T2PA 1J8SA 1AS7A 1CTMA 4LSSL 5I17A 3R19A 4WWPA 3U4KA 3NRPA 5BZWA 1BVNT 4U6XB 4LHQB 1QBML 2IBZY 4MLSA 1FZOB 2PWHA 2LE9A 1XZ0A 3C12A 4TN9A 4IOIB 4FTVA 2DKMA 3NP4A 4TNVF 4ZMAT 4PW4A 3CFKA 3LZQA 2CDEA 3B5TA 2P5WB 4W4OA 3G5VA 2OYPA 3T0EE 3RGVB 4H0LC 3T3PE 1EJFA 1UA7A 3SE6A 3UAAA 2AFNA 5JIQA 2OV0A 1XGQA 2MPVA 4Z3IA 1QA9B 2OYMA 3VWJB 4J6RL 3MHZA 1BG9A 2X4RB 1NCTA 1VA9A 1J7VR 2Y7QB 4NUGL 5I0WA 2V2XB 1WHOA 2IQ9L 2X4SB 5AYUL 5KZCD 2QSQA 4PJGF 1Y6NR 3V10A 4HVBA 2OMZA 3LVTA 1IGYA 4DGUA 3DX8B 3AUWB 2F5BH 2ZQKA 5IWLC 5KBPA 1FL6B 1KCVH 1B90A 1ID2A 1B0GA 1R47A 4WUUE 4X6EA 4ZMXA 1U30A 3BWUC 4GBXD 4JFPB 1GGYA 1FVCB 2EXTA 2YZ8A 1R19A 4GXUN 5DK0A 1WWWX 3D2UA 4RDQF 4MKMA 2HTKC 4L4VD 5FR3A 1BAGA 3OPUA 3U4BH 2B2XH 5IIEB 3VSUA 1K9TA 4JPVH 1FG2B 2X3BA 5I8OH 4HWNA 4PGCB 1K8IB 3RVXD 1DBBH 4Z76B 4XO3A 3KDMA 3ZTCC 2XWRA 5ESAA 1NUDA 3C6LA 3RAJL 4LLVA 2R4SL 1UCBH 4CILA 2HKHH 4LL4A 2Y4SA 1A3LL 1R5IB 1L7TL 4KUZL 2MCPL 3ECQA 2GHWB 3LKNB 1QASA 2DYRB 1Q0EA 3C5ZC 3P40A 1A6WH 2OULB 4ELMB 1S9XA 1FHGA 3NIGB 4NQVA 5LCVL 4F57H 1B9KA 2DYPA 5TPWH 5CJOH 1H5BB 3S35L 3LJ3A 4UOW1 2X4NA 2XUWA 3W0WD 1TCMA 3MXWH 3Q2WA 4H1LG 2NXZD 3SGDH 1ZK5A 5JDSA 2O61B 2J8OA 4LIQE 4HJEA 5I71C 3WDJA 3ROLB 1M6OA 3N1QC 2JMRA 4UAOB 4AZ8A 1JZJA 1AG6A 1V7NL 3MMEB 5IV2B 3SGJA 1F3RB 1MWAL 1XSOA 2A9MH 2XSKA 5DQDL 3ULVH 5MP6H 1QBBA 3BT2L 1NFKA 1C5DA 3CN1A 1JHLH 1WC7B 1R3LB 4Y7MA 2ZCKL 2FRGP 2ZUXA 2VXTH 3G5XA 4PGBB 5AWNL 4BELD 1MCHA 1NBYB 3JWNE 3ARFA 4DP5X 5I2IB 1GAFL 2CXKA 1U8HB 4LL1A 3RVWD 2FT8A 1IE4A 3QIBB 3ZE2B 3QQDB 1QFOA 4GKSB 2MNUA 3DROA 4YX2H 2WAQA 1MZYA 2DW5A 3KPRA 3SCMD 3OM3B 1ZT1A 1IM3B 1OE1A 4RNRA 5CMAA 2QPEB 1QNZH 2VLRD 4GH7B 4L37B 3WKYA 1U33A 1FVDA 3WV0A 3BHBB 4L1SA 3CE1A 3V4VB 2AQ3A 3A5VA 4NO3A 1Y18A 3A4AA 3BSHA 3E6HA 2CLVA 4YDZA 3I50H 5SWZE 2WZ6A 4QRTB 2X4QB 3VGHA 4WI4A 2QHLA 4Y4KD 3WFDL 3O6MH 4U3SA 5F7WC 3A6CL 3ARED 3W11C 3DO7B 5JR1L 2GJPA 1UOLA 2D0GA 1YUHA 3RWJA 4MQXC 3NAAL 4JMXA 4PIRF 3VFVA 3IGKA 4HKBB 5E4IA 5DVLA 2NY0B 1DUZB 1OO2A 2UWEE 4ETYA 3P11L 1G7JA 2YFOA 3WJMA 4HLEA 3AWGA 4WHYG 5I6XC 2JJUA 2LFGA 5KJ4A 2G75B 4K7FA 4HJGB 3MUGA 1NPNA 4S1DD 1V3JA 4YDMA 2CH8A 2VDQH 4ZJ9A 4XCNA 3QDGB 4E41B 2ED9A 1HDMB 4YLCA 4N90D 1KEML 1NMBL 3H8NA 4XOAA 3Q06A 3CN2A 2GC4C 2CUAA 3ILQD 3MLUH 3VW3H 5D1XA 3EO1B 3NGBC 3KPLB 1E90A 1HQ4B 3Q8EA 2Q6WA 5DD5L 1B2WH 5HD8D 2WNXA 1NAML 1IAIL 5J5EA 2DQHL 3FOLB 2IAND 3UTTE 3WFHB 1IL1B 1XGPA 2ZCLL 4JW3A 1GTNA 1TVHA 1KULA 3U6XS 2BC4A 3MX0B 1P4LB 4OUUA 3K3QA 5FECA 5JOPE 1UH2A 4WEMB 1TKWA 3WG7B 1KCUH 4BK5C 2JKTM 4KTGA 2O5NA 3FT3B 3HMWH 3FUKA 3B2VH 3P4MB 4OVVA 4WW2F 4XMWA 4MCNA 1Z66A 4DK6A 2BVOA 2WBXA 2GUYA 1CFQB 2IDUA 1AHMA 1HILA 3KYAA 3ATBA 1NC2B 1T2JA 1FDLL 3RZCB 3WNMA 1QD0A 2LAAA 2ZD0A 3G6DH 4ONOA 3ZGIA 3P30L 5AVXB 2ATKA 3GXFA 4Z0BH 4HU8A 4LCWA 4QXTB 5FGBA 4IIQC 5TDPA 4DVBA 5KYUB 1KIUB 4GMTH 1EDQA 2BDNL 2Q1EA 1J5IA 1A8JH 2JXMB 2YA1A 2OZ4A 3PGCA 1NLDH 1X5AA 3BPOB 5LDSA 3IRCA 4MHHI 3BAXA 5HGAB 3FQUA 4K2UL 3K6SA 4MB5A 3BUDA 4WJ5A 2O1AA 4J1UA 4PJ6A 4KQ0A 4F2MA 3D0VA 3O3BB 2F54D 4XVTH 5JHLA 4NC1C 1AAJA 5ABZA 1A4KB 4DP4X 2KPNA 5FDWB 5DJ8A 1XBDA 1T66C 1PEWA 4TXVB 2XACC 3CFBB 5F1IB 5I1HH 2B9AA 4WTZG 2VSMB 3KLAA 1OPGL 1XTMA 4E42A 5KVGE 1YEGH 5ETUA 4N22A 3SOBL 2PP9A 4WEUD 1XH3A 2FWSA 5IKCB 4J3UA 4KQ4L 4HT1H 4ZFZB 5C07B 1OE3A 1HWWA 3DO4A 5KVFL 1HHHA 3LN5A 4E9QA 5EU7C 3FQRA 4JHWL 4NRXB 2FK9A 4RZCA 4WI2A 2QKSA 2V4LA 3O6FC 3CXHJ 2CO4A 2GJZB 3F6JA 3SN6N 4BZ1H 4XNBA 3MOAL 5DMGD 1I3GL 2H6PB 3BEWA 1OCOB 1F5WA 2VLKD 1N64H 4X6BA 5TK2A 2F7OA 2LOEA 3BLBA 3GJFH 3FCGA 3P2DA 1JYXA 2O4EA 3QIWB 1J9RA 5D7LE 4ZPVA 1PMYA 3LZFH 3PWPD 4QYAA 2EE0A 1UUSA 1V5JA 3L4YA 3QQ3B 4U1HA 2EDQA 2WTPA 2H0EA 2D2CC 1DN0B 3IJEA 2WMPA 2FO1A 2Y23A 2G4EA 3FH5A 5I6OA 1DBKH 1OM3L 1G7LB 3D0AA 1LMKA 2Q3XA 2UXGA 1DDHA 4PJGB 4C57C 1QSEA 4NO0D 1A7NL 2J5WA 3G04B 5CLZA 2B3IA 3N40P 1FO0H 2JCCA 2YARA 4K5PA 1BQHA 1DR9A 4AL8L 3U25A 2IPKB 4WK4B 2YC1A 4X5XA 4JFVA 4HSAC 2L8AA 4QKXB 2FBOJ 1W6WA 2GFBB 4MBOA 4Z9KB 3GNMH 1ETZB 4JFDD 1BJ8A 3AXIA 4JFFD 4NZRL 3VVVA 3ZTJG 4OLYH 5I8EB 2VDRH 2HJLA 4ZTEA 2G9HA 4LHUB 3RLSA 4TLKA 3UZEC 1CDYA 1E9OA 4KO9A 4HIXH 3Q8AA 4XOCA 3GZQA 1UADC 1MJ7L 5IR1B 1TJIL 4Z5RA 4GB9A 2XICA 2DTML 5L7XH 3WS6A 3FMGH 4MJ5A 2XT1B 4CW1B 3IWVA 1FLRH 3CX2A 2XQ0A 3VRLF 4HJJL 4B3VA 2F0CA 1TU2B 2WYIA 4HZLB 3JV0A 2DL2A 2ISDA 1QEWA 3B7TA 4O2EA 5DURD 3MJGX 3PWVB 1C9SA 4XBPB 3RURA 4JM2C 1U8JA 5JNYB 1JFQL 5E1AB 2FGZA 3P9WB 3WN5A 4BHUI 1KN4L 1MFCH 2EUWA 2A0LC 4G8GE 2DWDA 1KBGH 3BAEL 3NMEA 3WN6A 5EN3A 3QUYC 2WZAA 4DGIL 5CR1A 1JBJA 5DRNA 4TNGA 1I7UA 1RZKL 3KE0A 3ASWA 1AQDB 5FO9B 5CEZD 1RZ7H 4L0ZA 4EI0A 4LMQI 3WD5H 4HUKB 1XGYL 2BMKA 5KVDL 2WUBL 3PWLA 4G6FD 3DUHA 2H7WA 2HLFD 3KAAA 4DUXA 3GI8H 1VGKA 4OFIA 5AD0B 4ZSOA 5JW4N 4UNIA 3TA3A 3Q13A 3BP5A 3FB6B 1JWUA 3MBXL 2H1LM 4NAMA 1FNFA 4YJZL 1G7MA 3FBKA 4MD0A 5LHDA 1N12A 3TASA 3GIZH 1G0DA 1T20A 3D4ZA 5HVHC 5FM8A 4ISVA 5HHVH 3WHXB 1JGLH 3SYPA 1S7TB 4HWEL 4K9EH 4IDLA 3NSXA 4LPWA 4XMPL 4PTTB 5B3JF 1CDHA 3AT9A 1Y6MR 3L1EA 1D6EA 3BUTA 3VFUB 4ONFL 2VOTA 1TZ8A 2R39A 3OKLA 1R3JA 4JO1L 3ERXA 5CBAB 1VZIA 3UYPB 3E8UL 2PNDA 3TN0C 4HCFA 3UC2A 1G7IA 3F6IA 2BVPA 2TRHA 3IDJB 2CO6B 5MHSE 3MLZH 5CEXB 4PD4J 2ZP9A 5DO2D 5C0GA 3AAZB 2WB1A 3HAEH 4G43B 2V7NA 3OD3A 1NL0H 3D6GA 1KDJA 4PJAA 4HHGA 5MENE 4HDIA 2X09A 4WUUD 4JCLA 2APSA 4Z7NE 5BOPA 1LEKB 5F0LB 3EGXA 3EUUA 3I02B 4P4RB 4E5XG 3RFZB 4KY1L 4NKMB 5KYWA 3EKCA 4YXHL 2ITEA 3D39B 3PQYA 1XR9A 3QH3A 3JWDH 5B8CA 3P4NA 3DRQB 4YHKL 4P59L 4AEEA 1VGEH 3MRRA 3BXNA 3V0WL 2BS8A 3LQZB 3F7KA 5I82A 3HG4A 5EEZA 1MCRA 1E5YA 4V1DE 2NNXA 1WAPA 3NEXA 4KKRA 2CG9X 4MMXC 2YMTA 3BCFA 4Z7VE 3RL1B 3NTCL 1PZ5A 5DGRA 2NZIA 5A16B 4PR5A 2IWGA 4U1SA 5HHOB 1L9PA 3UCQA 2EYRA 2BCKA 5D2NC 2I85A 4XMLL 3TEWA 2I9TB 4R4NC 1MRFL 4JE4B 3PRZA 1KXQA 3M1OA 4ALAL 4GI6A 3GJFK 1I8UA 1WBXA 5E8PB 3CZNA 4MJIA 1MHEA 1JGEA 4TNVK 2AJSH 3WIIH 3UBXG 3I74A 1OTSD 3S36H 1N2RB 4P5MA 4YVNA 3NSCA 1Z5LB 4PJDF 1GRWA 4S10A 4WW2B 2NUPB 4CU7A 3ZKQD 1U8KB 1X9RA 4H8WC 1NM4A 1PGRB 4XP9L 3ZL4L 3JUZA 1RERA 2VITA 3TIDB 3VGAC 4UI2A 2XX1A 2WCGA 3MV9A 2EYTB 2V9QA 5F6IB 3SPHA 3HZ3A 4FTDA 1XFPA 1TSRA 4FQJH 4HCRL 1WGVA 3AABA 1NCBL 1INEL 1WFTA 3FTGB 5EU6D 1AYOA 3WIFB 1BVOA 5C9JB 5ES4B 4F91B 4KTDL 3EYSL 3P73A 4U7KA 3ZKXB 1IM9B 1BJMA 5ID1B 3CHQA 4DAGH 3WFEL 5GHWH 2ZX9A 2GG1A 4Z8FH 4N2CA 3QXTA 2Z92B 4R96B 1NANH 3M46A 2DDQL 4NLHA 4P2RA 3EOBA 5TH2B 4NOBA 3DTXB 3H9SB 4TSBH 3GI9L 3D4GA 5J12C 4AH2B 4OFDA 3NRQA 4AK1A 1YYLH 4JPWH 4QCIA 1F58H 3ZDZE 4PRBB 1I31A 3CXHK 1UH4A 2IEPA 2IWKA 3PGDA 2NRDA 3N3EA 1EXUA 4MJJA 1OAQH 4XHJD 1HHIB 5A43C 1P2CB 4W9EC 1QYGH 2BNRE 1IGJB 2IH9A 3HE7A 4AVHA 3JWOC 2C3WA 4MWFB 2X4UB 1S5HB 1RSYA 4PRNB 2EDBA 4EOWL 5DRWB 2HVJB 2FL5B 3C5XA 5FO2A 1DEEB 1F4YH 4U6YA 5H8DA 2PO6D 3VTMA 4GRWE 2IBBA 3HPLA 3QWRA 1AC6A 3GHEL 2ERJC 1NMCC 2WV3A 4JFEE 3F83A 3LZRA 1RP8A 2HRPL 4YHPA 3NFSH 2VGLM 3US0A 5JW5B 4IHOA 1U3HB 3VD1A 3SBRA 3ATDA 4QOKA 4UAHA 3KCPA 4GT0A 4J2XA 4Y4HB 2ZXCA 1NGWB 5E5LA 2F58H 5H35A 3QXVA 5LUMA 3BSZH 1S7UA 4N6RB 3OJMB 3UTTD 1IBBA 4QRPD 1U8IB 4RGND 4WV1A 1T1YB 4GKOA 4ZUWA 2VLLA 5GGQL 4B96A 1BQUA 3CDZB 2KLSA 2CM5A 1M7DB 3EGSA 3QFDB 4WHTA 1ADWA 3SQBB 2YSSA 1GZHA 3OPZL 3MNZA 5TDOB 3ZYJA 3DXAA 3ZKND 1KLUB 1L5GA 2XA8L 4YEEA 1OK0A 4F8TA 3AY4C 2Z64C 3PJSB 4HWZA 3QDHA 5E4EB 1CGVA 3MRBB 2PP7A 1XF5B 4NKIL 4QRRB 4W4NA 5H37A 2AJYL 4GSDL 2Z4TA 3S5ZA 3JSSA 5AKSA 4XVJL 5DD3H 4BZ2H 3QUXD 4NJAH 1RIUH 2BNUA 3PUUA 2MIZA 4S1QL 1CDCA 2WWMC 5ICUA 2BNQB 4PJ5A 4U0RB 2MJWA 3EYVB 3S8WA 1ASQA 4OFQA 4HXBH 5JXAL 3QHZH 1EEQA 1KJ2A 1WUZA 3PL6B 2NXYC 2W0FA 1FYTD 2X5PA 2XJLA 2OR9L 1XCXA 1YMMB 1K8DA 3T4AB 3WJLC 1D5MB 2YWYA 3TBVA 3BWSA 4NZFA 4S1SH 1A3RL 3KS0H 2VO8A 2Z93B 1OZTG 1ORQB 4JAMB 1GKOA 3FHEA 1OALA 4U1MA 5JMRA 5BV7L 2CAKA 1QSFD 4O2FA 3GC3A 3RY4A 4LLWB 4PJEA 4PWHA 1DJYA 5D5MF 5DEZA 2P45B 5GZNC 5KSAB 3JZYA 3SYCA 4XGZB 1KELH 2PW2B 3B3IA 1VFOA 1HOCB 1YEJH 3GMPA 4HFUH 3W56A 3FT2B 1IBZA 3U6RA 2X9YA 3TBSB 3ARBA 3VD5A 3MBEA 3WO3B 2VLJD 1OD9A 1WDAA 3AU0A 4YSPA 5HGGS 3ML9A 1HZHL 2D31A 32C2B 4HUMB 4PJ7A 2EIDA 4WI6A 4F27A 3L3JA 4AIXA 1UACL 2J5LC 2VE6A 3Q3GB 4FL4C 4DN3H 3QEQB 5C09B 5GS2D 3MNDA 3M1CA 4OIAA 4RA0C 4D9LH 3IMBA 3CDYA 1D9KD 1LXMA 5D2LE 4OH2A 1E42A 1S7VB 2A1WL 4FQ2H 5D7LD 4F20A 4H8QA 1JRHH 3D51A 3VFGL 3T3ME 3HNTL 2Q76A 1I8IA 4F7EB 3IDXL 1EHLL 2R8SH 1EAPA 2OI9C 3EO9H 4G6AC 4DETA 3DYMA 3D4YA 2FVNA 4PW3A 3BKYL 1DYZA 2ZWLT 3HE6D 4WAFA 1JK8A 2B2XL 3GBNL 2HTKD 3F7VA 4JPVL 4WFGE 1G6RB 1YNLL 2X70A 1BJ1J 3HRZC 3WIHL 2FJUB 3FUEA 1DBBL 3S3SA 1LQSR 4Y9GA 4E9VA 5IMKB 3AS2A 4W9CC 4FQXC 1AP2B 3FH7A 4R0LC 5EBGA 2ZXBA 2OYLA 5DHXB 1JGVH 4AC2A 2I60H 4ADGA 2OMWB 4WU5A 3VFRA 5IT2L 2IO5A 1T0MA 1OAZH 1FFTB 3LHPH 1G6RH 4LOVA 1J5OH 2ZUUA 5F9OH 1QI3A 1YSOA 4ES9A 3S35X 5DZAA 1DLFL 4QY8A 2X44D 3QA3B 4XNQA 1EWHA 4FQLH 5HDQH 1CDJA 2R1YA 4ODWB 4PN6A 4YO0A 4G7YH 2FIKB 1RY7B 4M1DH 2VIRB 3TFBA 3IWUA 4H8UA 3QJOA 3IPFA 3QZBA 2NY2C 5F3FA 5J1AA 3R7RA 2XWJB 4OCSH 2PYEB 5GGSY 3UO1H 4C4KO 3HW7A 1QFWL 3RWIB 3WTTA 4OJYA 3VD0A 2PKDA 3L45A 4KROC 3VGFA 2X1OA 3BESR 4UQ2B 2QVMA 1ZWIB 1JHLL 2JJSA 1SJXA 4MNQB 1KPRB 2ICWA 2ZWKA 4LOFA 1KC5L 2WXNA 2P47B 3V6FB 3EJJX 5GQBA 4PJDB 4JRXA 3LRKA 3TU6A 3WI9A 1WWCA 3TPUB 1HNYA 2XETA 4YX2L 3WBDA 2AEPL 1B4LA 1X7QB 3FO2A 2ZOOA 2JB6B 1OB0A 1LP9F 1UQSA 2MQ3A 4P04A 2GBUA 4IBWA 2B5IC 2VR4A 4UM8A 1KFGA 5A1AA 1AGBB 4IRZL 1WAAE 4WNSA 1VEOA 1BJ1H 1KTRL 3JQOB 1DBML 2UZIL 4JL2A 2QSVA 1FFQA 2H2SD 4R2GB 3GS0A 3WUZA 3FRPG 1FLTX 3W11D 2CRYA 5AZ2H 4DKEH 4LCIH 4F7PB 3IMUA 1FG9C 2VABB 2YEZA 4AQEB 5KW9L 3FPXA 4G3YH 3TYGH 5I76B 1FV1B 3VXUB 5AG9A 4PQXA 4PIBA 1LK3H 4QGTA 3RPIA 5I0YA 2VDQL 4ZO7A 1MHCA 1PZDA 1QTYT 5J56B 2AQ2A 1BD2B 2FNWA 1J0JA 3GBMH 4K3GA 3EJSA 4PS4L 5EC2B 4QO1B 1HSBA 4Q74A 4JR9H 4YXLL 1CR9H 2VDKL 4LVHC 1FIGH 1NOAA 1PX4A 3JV4B 3RB7A 1LVEA 1UD2A 1H3VA 1LNUB 4YXKH 1S7RB 2FTAA 2WB7A 4H8HA 5B1JA 2GSMB 2R51A 4PV9B 4JVUA 3I2CH 3QRGL 3JXAA 3DIVA 1BBJA 2J2ZA 2KZ1B 4FCHA 2JQAA 4IKNA 5DRZA 2XXFA 4YGVB 1OGSA 5FYJH 2BFVL 1MI5B 5DZLA 3O3DB 2M8XA 3X1GA 2P48B 1KCUL 3IF1A 1XCQB 3QEUA 3TO4A 4A37A 3HMWL 3BZEA 4O02H 4DZ8A 3RWEA 2BJMH 1ECZA 1PSKH 3O4LA 4KK5C 2XA3A 2F6AA 4JY4A 4I1RA 5ALCH 3HJEA 1AGCA 2XWTA 4TULH 3BUYB 4X8JA 4LRNL 3F04A 5HDLA 3FF8A 1U3ZA 1X4YA 1PKQE 4UILL 3CZKA 2E56A 5KVMC 3L4TA 2H26A 2QKIC 3G6DL 4H2CA 2WQRA 1DHKA 3EYOB 2BSTA 4IIZA 3FFDB 2OMVA 4OV5B 3OMNB 4XAWL 4FG0A 4ANVA 4A38A 1Z9SA 4DEPB 4L0YA 1D5ZA 2WINA 1MFDL 4I3RH 4PRIB 2XG5A 3TBWA 5MEQB 5IBLD 3BQUD 5BS0A 1AIFB 5CJ5A 4W9IC 2VMCA 4GRLC 1H8OA 3U6XA 5HVGB 3R1GH 5BRZB 4OLVL 1GYVA 2AMUA 3HHSB 2O5ZH 2XOTA 1A1MB 4Q6IA 5JXED 2IDTA 4K5LA 3DX6A 3RKDC 4Y2DB 2CGRL 4N2FA 3UBFA 4YPGB 3OZ9H 2X7LA 2RFXB 1UOKA 1FZKB 3KXFB 5C0BA 1QQDA 5LAPA 4HIIB 4HKJA 3RWDB 1V10A 4GQZA 1AKJB 5F70A 4LSUL 1JN6A 3EJQA 1RUPH 1WA2X 1YEGL 3KPSB 2EDNA 1T89C 2MPAH 3O0LA 5SWQA 5H4ZA 3VXNA 1I7ZB 1UB5B 2C9PA 1UM6L 2ADJB 3AT0A 2AK4E 1TCRB 3RX8A 4EN2A 4LPCA 1Q1PA 1JDCA 2WLNA 1RZFH 5C7XL 4AEFA 2NY5H 3SPJA 1Z32X 4YZFE 1DQQB 3DHJA 3TIEA 2N3JA 2YZ1A 2I32A 3L4CA 4HHAB 4M8RA 1GGCH 1OT1A 3A4DA 3O6FD 1JZ2A 3OHXA 1HSAB 2QADB 5DC4B 1D5XA 2EYSB 4ZUSA 5D72L 4M03A 4G9FD 3Q5YA 5D5MB 1H9VA 4X2UA 3VXMB 4BKTC 1GSMA 1OOAA 3RY6A 1U8NA 4NKOA 2WXJA 3RKPA 1SMAA 5ICYA 3FU8A 2ITFA 2E46A 3TBYB 1AD9B 4WTQA 1QHOA 4I77H 2X6VA 2V9UA 3ZK0A 1EJ8A 3FN0L 1DBKL 2HXAA 2AJXL 1NANI 4IMKC 1KTDA 1TENA 3K6FA 3D3VE 1M7IA 2AI0H 4ODVL 3K2KA 1FGVL 3HS0B 3QS2A 4PI2A 43CAA 3HUJA 5GS1A 1FO0L 4V2CB 3MA9H 1VERA 4GP5B 4JFED 5HJBA 4QRQA 5DMKB 3QCTH 4FNTA 2DMGA 1ZVNA 3DX2A 1JMZA 3O3AB 3TNMA 1U92B 4PJ9B 2Q86B 4NN7C 3FHAA 1F00I 4RX4A 1FBIL 3SQOL 4MJ4A 4EI5A 4GJTB 2JQZA 3O2DA 3BN3B 5DGQA 2DWEB 1OCWH 2VDRL 3QEHA 4R90H 3D9AL 1MHHA 3NT0A 1LWJA 1DJXA 2K9UA 1I9IL 5HHQB 3FQTA 2GI0A 3FN9A 3LNIA 3IDIB 2XX0A 3RHWF 3ESNA 2SEBB 4JPIA 5ECGA 4IRJD 4PSRA 5C08E 5FKPB 1RPQA 5FF6A 4KZ0A 2J55A 2AV7A 4Z7WE 1EGJL 2XI9A 2LHAA 5KSBF 4QHLB 3CBJB 4Y4FA 1A6ZB 4S2SA 3VCLA 1XF2A 4K4KA 2ATAA 4DPAX 3ARVA 2CUMA 4YSQA 1B3JA 4Y8DC 1P4BL 2JFCA 5CSZA 3QEGH 1J86A 3LRSB 5IEHA 3P9MB 1FNEA 1QPXA 5AVVB 4LLYB 1MFCL 4GXVL 4JM2D 4BSVA 3A6BH 4AVIA 3BH9B 1KBGL 2ZAHA 3X11B 1DE4B 1Q9LB 1E40A 4U6HA 3VTAA 2A0LD 4K9JA 2V3DA 5FK9B 3CZJA 1UHVA 4MA8L 5CP7B 4TUOB 3WD5L 1CXLA 4BFFA 3PPSA 4U6XA 4U2ZA 1FZOA 2DJSA 4E9WA 3AB0C 3P2BA 2YUWA 4MQSB 4GG6F 1TFHA 2J88H 2MH4A 3ZTEA 1DJGA 5KUKA 3AM8C 4HW6A 4XVSH 1BA9A 2P5WA 3CFCH 4BEIA 1YECL 3BZ4B 1SMDA 4J3XA 3RGVA 1CICB 3GIZL 2FGWH 2NT1A 5HHVL 3MTRA 4P9HC 3MI6A 4JFSA 3RI5K 5J11B 3VWJA 4NJ9H 3KGTA 2FUQA 2X4RA 1LP9B 3LOWA 4XB3A 4HF5H 2WXIA 2J8UF 4G6JH 4N2IA 2DIEA 2X4SA 3D50A 4L3EE 4OIBA 4W9KC 1MIEL 3MXVH 5D96B 4OF5A 5CEZL 5I73C 3DSNB 3WTXA 4FKKA 2PF6A 4JX0A 4XPFH 4EKXA 2HJKB 4AE0A 4E9YA 4U33A 2B8OT 5CNHA 3BFWA 1MY7A 4RGOL 1FL6A 1P5UC 2VN4A 3KJ6H 4MAYA 3HG1B 3S3CB 3WNNA 3H7BA 3GMMB 4MZRA 1TVBB 4JFPA 1FVCA 1BZDA 1KLFB 3BT0A 4HH8A 5ELIA 2YPVH 2W5PA 1FJ1A 4K7PH 2E9IA 2A74B 1EJOL 5GZOD 1AO7E 4TUKL 1FG2A 4FZ8H 4PGCA 1K8IA 3K4ZA 4MMZB 4ZNEA 2XTJC 4Z76A 2YLKA 2EADA 4OF7A 2CKBH 1R1CA 4M9PA 4AEIL 1CT8A 1MCPH 3FT4B 2WYZA 3WGVB 4TLTA 1KTJA 3RWHB 1T4KB 2IFFL 2KPWA 5DHDA 3FUFA 1KT2A 3CK0H 8CGTA 1L0XA 3LKNA 1Z9NA 2W60B 3P0YH 4DSYA 3HZMB 5G2NA 4HBCL 5EO1B 3WFBH 4ELMA 2DQCL 3KLLA 5BQ7B 5F8QC 1WGOA 1ZLSH 1TJHH 2XWXA 1G7HB 2YS4A 4R4ND 1L0QA 2DY2A 1JRHI 1H5BA 2W0PA 1PS3A 1FQ9C 2ICEC 3JYCA 4PTUB 1MAML 3L5HA 4KC3B 4DK5A 4Z3JA 5BCAA 4NFBA 2Y0SA 4Y19E 1D2PA 4I0PC 4KH9A 3S36L 4XP5L 4EN3C 1D3CA 3CVHH 5AFAA 2X53A 3QWQB 5I74B 4FZEH 1BVLB 3MMEA 5IV2A 4DKFL 5EDXA 3UADA 1XIWC 3QFJD 3QQNA 4DEWA 4K55A 1WC7A 1R3LA 3LYRA 4FQJL 4PGBA 4Y1AA 2V2TB 5ACMA 5DQ9B 3R7QA 1NBYA 4MTMA 2ZCHH 1B4JH 4MZ2A 1U8HA 3TEXA 4P99A 4LSRL 5J13C 3QIBA 4MDIB 3BQVA 4GQ9L 5FLUA 5FHBH 1WP6A 1UKTA 1OOWA 5J6GB 3LRGA 1IM3A 3CDCA 1NFDF 2D3VA 4L37A 5HDBF 5JZ7D 5E6IB 3BHBA 4OJAA 4P4KD 1NCCL 4Z8FL 3V4VA 5C0RL 2V5TA 2XXGA 4OLUL 5AL8A 2HLAA 1QLEL 4QRTA 5EBLB 4E0RB 2H6UA 3L4VA 3DO7A 2VW7A 1Z3GH 2DM4A 4H8WH 3HLAB 1JYVA 3B7UX 4HKBA 2E7CA 2X42A 3MLWH 3L9RB 5ABAA 4JO4H 1DUZA 3ZZQA 5E9DE 1SDYA 3HA0A 2ZOUA 4RZKA 4Y9FA 2OQJB 4PGDB 2P28B 3KGSA 5CN3A 4FMVA 4L9LC 1JUFB 1YEIL 2G75A 2YKKA 3GJEA 3PWNA 4HJGA 4F37F 2ENPA 5EFIB 3LV3B 1F3DJ 5H37G 2P80D 5JPMB 3QDGA 5F88A 3AY2A 1HDMA 3TZVB 4YS4A 4N0FB 1UB6A 3QDMB 2CDGB 3VE0B 1H6UA 3EO1A 3FT0A 3FU3A 1HQ4A 2ZCZA 3NSDA 4JM4H 4E9TA 4UB0L 4XC1L 5BW7A 2IGLA 3KJ4C 3IGUA 4BFNA 2QELA 4RGMC 2VKXA 1PPIA 5FCUL 1P6WA 3FOLA 3WFHA 1IL1A 2F58L 4A63A 3QWOB 3MLXL 1BQLL 3A3YB 3BSZL 3TP4A 3WEBA 1FN4B 1XSKA 3MX0A 2ADGB 4H20H 2A4EA 2IAMB 3W9DB 4BQ9A 1NEUA 2H45A 2E7LC 3L3OC 3V7AE 3FT3A 3P4MA 4R97C 2F1AA 1UEMA 3MRKB 5LGJB 5I1CH 4FNSA 2DIAA 4YWGH 4Y0GA 1CFQA 4FGMA 1C7TA 4KI5E 4WSJA 4HGMA 4J5VA 1NC2A 4M6OH 2ZWYA 4OAWB 3KL0A 5TQ0L 1GPOL 2F53E 2H2PC 2WNWA 1S2EA 3NJJA 1U93A 4XTRC 3GXTA 3FL7A 2X4TB 4MCMA 5DD3L 15C8H 4I87A 4QXTA 2DLTA 4XNZB 1KIUA 5HDOA 2WWNA 1ED3B 2VB5A 1NSNH 2WQSA 2WWMD 3HB3D 2BSED 1KYUA 1T0PB 4IRSC 5HGAA 1LTXA 2PPCA 5B21A 5DZJA 1AMXA 4TSCL 4XCCL 3CFJB 2D03L 3HZKB 5HJGA 2NXYD 3O3BA 3VWKC 1E4WH 5KSBB 3WMQA 1GHFH 3OL2A 4F7CB 5HGDB 4MDRA 4DP6X 2VZTA 5FDWA 2H32H 3SOTA 5F1IA 3CFBA 4MXWH 5JIDA 3QI9C 5D6DA 5KZCB 3QRFM 4PAZA 1SF3A 5E5RB 5L2JB 1RZQA 1AZBA 1N18A 2DLIA 2X38A 5KBLA 2QZQA 1ODAA 5IW6A 4BZ1A 1J0KA 1MQ8A 2MWCA 2DQEH 4X6CE 3ULSB 4OKDA 5IKCA 3IFNH 4IDJH 3DV4B 4FEMA 4MRCA 3WY3A 2Z0UA 1DL7H 3KZ8A 3VXQA 2HZHA 1KELL 5C07A 2YOCA 4ICWA 3Q05A 4GBXB 4YE4H 2AK4D 1NCUA 3GJFA 4NRXA 1BZ9B 2GJZA 4AJYV 5EUKA 4JREC 4GG6B 4L4VB 4DQAA 4GAYB 2H6PA 5D93B 2QPUA 5JMOC 3MJ9H 3E9UA 3FFCD 4F8PA 3O41B 2D3LA 2F2HA 1PW3A 2KZBA 5B38B 3QAQA 2VDNB 3T65B 2GEQA 3LZNA 3QQ3A 3FQXA 3IM1A 3OLEA 1OAUL 2ADIA 1DN0A 3HBPA 1JRHL 2CO7A 2IH3A 2B4CH 2J8UB 3AT8A 1G7LA 2IIJA 2EC9U 5KVGL 4PJGA 4J8RB 4UTBH 5JW4R 4G6AD 3G04A 5I66B 3DV6B 4KAQH 4R83A 2ZP0T 5KVEE 4W93A 2V5SA 3LIZH 1CDIA 3EUDA 4DCQB 3W0WB 3CFUA 3NVQA 1CYWA 1UVQA 2NXZB 3WU1A 3N6YA 4LQFH 3X3GL 1KBPA 2YGOA 2P8LB 2I60L 1C5BL 4G7RB 2E47A 2JLPA 2WQVA 4UOJA 3FB7B 3QDJE 1TZOA 2NTFB 2GFBA 3PP4L 5F9OL 3QSKB 1J1PL 5F21B 3A4FA 4TQ8A 5I8EA 1OANA 4LHUA 1Y7VA 4LLMA 4NNPH 1S8DB 4L2LA 1A9BA 1VACB 2IPTH 2NZ1A 4FQLL 1MOEA 3BZ5A 1ML0A 1BLIA 1I8KB 2V3EA 4G7YL 2G2RB 4M1DL 4TUJA 1T80A 1CJYA 4OB5L 3T3PF 3SPGA 3SCMB 1TQBC 2WCSA 2K78A 1AVAA 2BINA 5DUMH 2VLRB 4E9XA 4HZLA 4CSSA 2DLFH 2NY2D 3TVMA 3BMWA 2D7PA 3N1GC 3PWVA 4F80A 4XBPA 1UD3A 5JNYA 3H54A 4QDGA 5E1AA 1F4AA 4Y4KB 4BUGA 4P48A 2ESVE 2HX8A 2DWSA 3AREB 3C09C 4AE1A 4FG6C 4XT1C 1FUNA 3O8XA 4AYBA 1IGFH 1KN2H 1AQDA 5FO9A 3BKMH 4M7LT 4WQOA 1EDYA 3X3FH 1OLLA 2ZXDA 1HC1A 2BWQA 3LXAA 2VUKA 3OKNB 2RB8A 4NQCE 3TT1L 5DZNA 5E4AA 3QIUA 4F7MB 5AD0A 4HG4J 1UOVA 3FB6A 2YD4A 1QRNE 4OLXL 1TTRA 1L9QA 2Z31D 5BXFB 5GS0H 5F9WB 1WUNT 3PJLA 1VAHA 1JPSL 1XEUA 1NDMB 1NIAA 5T33L 3KCWA 2ROXA 3WHXA 2CPUA 1XVSA 1S7TA 1MEXH 4W4OC 1FAIL 1KBKA 2Y06H 5AUMB 4DKEL 5DR5H 3IPEA 4UIKH 3INUH 1OGAA 3JUYA 1NFDB 3NCWA 4IJ3C 4PMFA 4PTTA 5HDBB 3MUY1 1MNNA 3ZMRA 4PRHE 1S4IA 4W6XB 4G3YL 2IANB 3VFUA 1Z9MA 4IQHA 4L4TE 2WLKA 3WELA 4XNUH 4PY8J 4UT9H 4NP4H 4HIHB 5CBAA 4OLEA 3UYPA 2YIHA 4RRPA 3T2NH 5EH1A 4AGMA 2VLMD 3IDJA 2CO6A 1P7BA 1H3GA 2XG4A 5CEXA 1X5IA 1VPOH 3M45A 3AAZA 4AV5A 2Y3NA 2YBGA 1QHPA 1F4XH 3JV6B 1RSFA 1CR9L 4ODTL 1KZYA 3SZ6A 2QDVA 4LFHG 1EAQA 4XCFH 5T5NG 4ABWA 1LEKA 2DJ4A 1KV7A 5LQBH 2MNJB 4NKMA 4R4FH 1DJZA 1M1SA 1CFTB 3D39A 3LD8B 3MV8E 3AZUA 3U9UB 2V8LA 3BKJH 4QTFA 4YK4B 5LO7A 2AGJH 3ZQXA 1UXMA 5T3XE 3RGBA 2RQ8A 3P0VH 5A2JH 3LQZA 1UT9A 3LQAH 3T1FB 1AO7D 5DSCB 1A47A 4NPYA 3RL1A 3GB7B 4J8QA 4ZUTA 3UL4A 4ZFFB 4A04A 5F97E 5A16A 4LGPB 1GZQA 1X6LA 5HHOA 4RDBA 2XZZA 1LYQA 2OKMA 4X5QA 5GSRB 2I9TA 3OXRB 2VN5A 3D69B 4KK5D 5I30L 2CA3A 1TLMA 2HFGL 1PDKB 3ZR6A 4FXGB 4PB0L 2W65B 1R0AH 2MFNA 2ZG1A 5J6HB 3VDAA 3SJVB 2LVCA 3GGWA 5E8PA 4UZSA 2F54B 1ZSDB 1BXVA 1MRCL 1U58B 1UT2A 1V3LA 2WXFA 3FO0H 3ULAB 3ZDXF 5C0CD 3FUDA 1PX3A 1YEKH 4NB7A 1N2RA 1XF3B 4NP9A 4PJHE 4WW2A 3MODH 3QPQC 5IBTH 2NUPA 4BCXA 1U8KA 1QW9A 2X89D 4JB9H 1WZ1L 4BBWA 4Y19D 3TIDA 3T04D 1WFOA 3G3LA 4U1IA 4I3RL 1WYJA 3NH7H 3SY0B 4WKXA 1FNSL 5JO5B 4YMPA 2EYTA 3ILPB 1JZHA 5KS9E 4ZTOH 5GRUL 3R1GL 2V5RA 3UZVB 3ZHFA 4GKLA 5DF0A 1KY7A 5E00B 4FNRA 1BQRA 3FTGA 1LEIB 1WA1X 1MNUH 4N9GB 1DCLA 5E23A 3SGJC 2W9EL 3OZ9L 3RKDD 3Q9PA 2YUZA 1LDPH 1HJCA 2FT6A 4DKDC 5ID1A 1IM9A 3CSPA 4UT6H 3ZY7A 3ARFC 3DJTA 5EEUA 4J12A 2F15A 2MPAL 2R9HC 2Z92A 3CSGA 3PWPB 2A7BA 1WH0A 4U1NB 1AHKA 1KTLB 4N86A 5TH2A 3DTXA 3H9SA 4M8VA 4TSAL 1U8LB 4LB8A 4QXWA 4AH2A 4N0UE 5I8CB 5TF1L 1B4TA 2G3ZA 2WNKA 1E67A 1A25A 1Q0YH 1T6BX 4PRBA 4TQEH 2WIIB 4NN5C 3HJ0A 4PJBA 5FAAA 1DSWA 3O0RH 4W6WB 2R2BB 4L1HA 2F8OA 1QLFB 3KYMB 1HHIA 3KL3A 1HQRB 1P2CA 5BNXD 1XF4B 1IGJA 2CCWA 4Q0XH 5E9DD 3QYCA 1WPCA 1P6AB 5HJ3B 3WNOA 3BE1H 4KQ3H 1PJ9A 3IK2A 1S5HA 4PRNA 3T6QC 2XN0A 3ARTA 1PZSA 5DRWA 2HVJA 4I77L 2FL5A 1KTBA 2GY7B 1DEEA 1QO3B 1W8NA 3G9AB 5KG9B 4JFDB 4A2HA 3AROA 5CN2A 2C4FT 4JFFB 4AYDC 3IAGC 3LEVH 2AJUL 4BUHA 5I1DB 5G4MA 1ADQA 2AI0L 1U3HA 2O5YL 5IQLA 4KMQA 2VO5A 1EO8H 1VFBA 4IKIA 2MCMA 1DEDA 4Y4HA 1PG7H 1Q9OB 5D1XC 2GVYA 4GRMB 1CE1L 1CLZH 1NGWA 3L3GA 5IB1A 3T77A 5FGCB 4EUPB 5TGBA 3V6OE 4LBEA 3CG8A 4MXQD 4D9RE 4N6RA 5F7UA 1OHZA 1U8IA 4KVNH 4WJG3 1T1YA 5DURB 3F12B 2R0LH 5DUJA 3OF6D 3PWJB 5DJYB 4HPYL 3TL5A 3CDZA 2XYCA 4LOUC 4MX7A 1DQML 5FHAH 2GK0B 1A7PH 4CN4A 1XD0A 3EFOB 2P5EE 3QFDA 4WY7H 4R90L 4EUPH 4XN2A 4BZ2A 3SQBA 4LVNC 3EOTL 1B4RA 5TDOA 1A7RH 1JHTB 1QFUH 1KLUA 4C8XA 4JPSA 1MIML 4NQDA 3PJSA 2P1YA 1KJVB 1KTCA 4O5LH 5CLXA 4KI5D 2OW7A 4XRCB 1VHPA 1XF5A 4YDVB 1U42A 3F7PC 4OCNC 4DGVL 3MCG1 4QRRA 1UTDA 1M2OA 2ZOLB 4FULA 6PAZA 4O58H 1TTUA 3V0GA 4ZS7L 4E41E 3WGUB 1ZV5A 4WGVB 3QEGL 2BNQA 3EYVA 3PNWA 1BG1A 1JF6A 4WFFD 1FZJB 4XWGL 4ODBD 3KLDA 2Q3ZA 4XPHH 3KD4A 3PL6A 4JKPL 2K1MA 5FGBC 3T3PB 3KPQB 5TDNA 1KB5L 4A6YL 2VYRE 3DK0A 1E9PB 2NY6C 5C0DB 5K59E 1SFDA 1YMMA 2ZX8A 5EOQH 3T4AA 2XZCL 3S34L 3KLHD 1G87A 3UEQA 3IJ7A 1VJSA 2Z93A 1ORQA 4JAMA 1N10A 3MLRH 4DN4H 1XAKA 4UM9D 4XVSL 4TVPE 3R4DA 3RPKA 1QFHA 1TMCB 2C9AA 4HG4K 5LCVA 4OZHA 2PPDA 3HC0B 5DJ2A 5KSAA 4LPUA 1EFXA 1FORH 4WJKB 4HULB 4XGZA 4F15C 3PS6A 2PW2A 2J1XA 1G4RA 1HOCA 4NJ9L 1FA4A 3ESVF 3ULUC 3BI9X 4WUUB 2Q8BL 4GS7B 3EADA 1PZUB 1N5YL 4F5CA 3UJIL 1BQKA 3PXLA 4NCC1 4UANA 4UCFA 4GAAA 3T0AA 1E3FA 5BVJB 1Z9LA 32C2A 3IFPB 3ZZ1A 4G6ML 3Q3GA 2XFXB 3OBAA 1DJIA 2FX9L 3QEQA 2XZQL 3FPYA 4N28A 3RX5A 3HKZA 2J6EH 4R7NB 1QWHA 3KJ6L 3GXIA 3SBPA 4KK8C 1S7VA 3WSQH 5AAWA 2ORBL 2D3JA 4YBLB 5SX5H 1JPTL 3IE4A 3EYFA 1KXTB 5CWSB 1UATA 4KUCD 4XNMA 4UIMB 4M7JH 5CSGA 2QGDA 3C2SA 1G6RA 4PY7B 1XL4A 1T5XB 2TRYA 1LWRA 1U8QB 1IC7L 1S7SA 1GCFA 1SQ2N 2CKBL 5T3ZE 5JIKA 2J4WH 2XN9E 1AP2A 4X0NA 3RA7L 4CADB 4ZO8A 1E65A 5EA0L 1ZHBB 2CMRH 1EBAA 5EF3A 1SYVA 2GJ6E 4YE0A 2YQ3A 3L9BA 4UQIM 4XPAH 3G7TA 4KRLB 5T1DL 5A2IH 1NGQH 3S36X 1QHQA 4ODWA 3S4SB 5EU6B 3KWWA 1HYSC 4LIQH 2X6MA 3FT1A 2VIRA 3BGAA 5CHNB 2BP5M 3MV01 3PAYA 4JJHA 3UPAA 4I0PD 3B9KD 1HU8A 4XN4A 4NGHL 4QI3A 1U8PB 3EDEA 2XWJA 2PYEA 4EN3D 2NY7H 4FZEL 5E8EB 5IFHL 3LHAA 3WS6C 3RWIA 3GZOA 2EXWD 4X98B 4NUQA 4UQ2A 1IGMH 1HH9B 3ARSA 3EYQC 5T1KA 2BSCA 2N7BA 1ZWIA 3W5NA 4S11A 3ES6B 4AYMC 1KPRA 3ZDXB 1TPXC 2WTRB 1TTGA 3H0TB 2ZYRA 5CKAA 5IB5A 3S5YA 3HS9A 4S0HA 1X5HA 5DK3A 3TPUA 1OGPA 2JKJA 3BAKA 1CXKA 1X7QA 1DQKA 3UP6A 3ILDA 2JB6A 4WNQA 2VQUA 3QG7H 3QO1B 1XDTT 2W95A 1N0LB 4F93B 1AQKH 5KYXA 1AGBA 3PHOA 4Z7NF 4G7VL 1LO4L 1HINL 2NY4C 5JUEH 3EFFB 3Q5OA 1I1AC 5EZIH 1QRND 2C7UB 5CJ8A 4BFRA 1J0IA 4H8WL 1IAIM 2PO6B 3DVIA 2OMYB 3TA3C 1CMOA 4P2CG 1MJ8L 2VABA 5T1MB 4HJTA 3MCYA 4AQEA 2IVFC 5DHVH 3TYFB 4I5BB 3LNDA 5I76A 3BGFC 1FV1A 2Q87A 5C7ZA 4APXA 3BP6A 5LN4A 3VXUA 1G1CA 3ABGA 2J1KA 5I15H 4PRHD 2EDLA 3H6AA 3T6XA 3UTTB 1CTNA 3OGCB 4KX9A 4ZMNA 1CS6A 4L4TD 1BGXL 4RGNB 1WJ3A 1BD2A 1PBYA 2JJTA 1SVBA 3VTTA 1RJZB 5EC2A 4X80L 4ODSL 4QO1A 2BVUA 3NJKA 5IVOA 4E2OA 3BUIA 5H2BB 3JV4A 4MS8C 4Z0XA 5LBSL 3VXTA 2QGEA 2QSTA 4R3SB 1LNUA 5FM5M 1S7RA 3U0TA 5LLIC 4O02A 4AIZB 4FN0A 3IGLA 1ANUA 2ZXGA 1MPAH 4QWWC 1TJGL 3VD4A 4YGVA 3IT8D 1UC6A 2PLTA 4LASH 3Q2LA 4IMLA 1BXUA 1MI5A 4H20L 3N9GH 3QJFA 3V9EA 3DHMA 3STZB 3ARUA 4DO6A 3QUXB 1XCQA 5I0VA 1GW0A 2Z4QB 1UD4A 3LPFA 5B8CC 3L08A 2OTWB 2VDPH 3C6EA 3SHSA 2FE0A 3D25B 4EDWL 3UIYA 3F85A 3JWOL 2VXVL 5I5IA 3LRMA 4OR1A 2YLHA 3RU8L 6PCYA 2OL3L 3PXHA 2HKFH 4AEHH 1YQVH 4HC1A 4I48A 4J27A 2R7EB 1G43A 2XFGB 7CGTA 5C0AE 4DQOL 3EYOA 2H2PD 2B0SL 3FFDA 4XTRD 4B0MB 1H3UA 1TQVA 1FHNA 5SX5K 3UZQB 4AYFB 4LGSB 4PRIA 1SEQL 2ZNXA 3ZDZF 5MEQA 4NYLB 4GI9A 3MRJB 4IM8A 4C59B 1DZBA 3MRMA 1CK0L 3VB8A 2CRIA 2OLDA 4IRSD 5DYOB 3HHSA 4MDJB 4AC4A 4PJFF 1XH0A 4GUOA 4BCYA 5J06A 1E4WL 4Y2DA 2R59A 1RURL 2F08A 5FV1L 2VLJB 4X4ME 4YPGA 5T1LD 3OAZH 4F7TB 3KXFA 2RFXA 1FZKA 1J0YA 4PWGA 4MXWL 3S96A 1SMOA 4HIIA 3QUZD 3MOBL 2NR6D 1AKJA 1WITA 3QI9D 4KHTH 5D71L 4BRVA 2J72A 4GRWF 3KPSA 4IW4C 5BZDA 1ZGLB 1UB5A 4Z7UE 1EUUA 1L9NA 4NQEE 3N55A 2ADJA 5CN1A 1TCRA 4N2LA 4C56A 4Z78B 1D9KB 1GKEA 3NFNB 1I9JH 5D7LB 3H85A 4JFTA 1DQQA 4RDQG 1BP3B 4GP8B 1OE2A 3LS5H 1HNFA 1LD9B 4HHAA 5DQJB 2CBMA 2DYSB 4HUVB 4KMTL 4WHCA 2ZJSH 3HNSL 4M6NH 4LGRB 2HT3C 2YRBA 4LHUG 5DEFA 5TE4H 1P7KB 2BFGA 3HE6B 2GTZB 4KKLC 2JIXD 4FLSA 4H2AA 3IDUA 2EYSA 4RMRA 3MJ9L 2FJHB 3P3RA 2F19L 2JE8A 3C75A 3I6KB 3LNHA 3VXMA 2EEFA 4KDVA 2A6JA 3X12B 5F8RC 3QJVB 3ZQ9A 3NDYE 4KKQA 4AM0B 3TBYA 1AD9A 4X50A 2WIMA 3WEAA 3FQWB 5DK2A 1L6XA 4ENZA 4DGWC 3IAQA 2DQTL 3HE7C 4W9FC 1PIGA 2YPLA 2X1PA 2VQ4A 4TLUA 3NACH 3V0JA 3HS0A 4JM2F 4PV8B 1MCQA 4KAQL 5B1BB 1E43A 3AGVA 2NMSA 3I6GB 2ZG2A 1KIQB 5L8JB 5GRVL 2A2QT 5DMKA 5F7DB 5D4QA 4EIGB 1NBVL 3RDTA 4PJ9A 2CLRB 3KPMB 3OJVC 1TETL 3D85A 5HGHB 2FJFB 1E4XH 3ZT7A 4N1CA 4W68A 1MCIA 1II4E 3GMQB 2EE6A 1MVUB 3ISWA 4S0SD 2RGSA 1NCDH 1AGEB 2DWEA 4XC3H 1CZ8H 4G8FB 3WCYA 3S9DB 5D4IA 4M6ML 1CFMA 2VRQA 3GLEA 2W9DH 1XV8A 5KTEL 3APCA 2UV3A 3RBSA 4E9SA 3BKCL 3K8LA 1L9TA 4WV1C 4XOBA 4OIIL 5HHQA 1U2HA 3II2A 3K1KC 4XX1G 2BIPA 3OKMB 4OGXH 1G9MH 1UWYA 2IADB 3RUGE 5DJZB 4FFYH 4G8GB 1DVUA 1HIMH 1ILUA 2DBLL 3IDIA 2SEBA 3WKPA 3K6IA 1Y1UA 5FKPA 1RPKA 2EXYD 2FB4H 1UJ3B 1GZHC 4RQQB 2E27H 1RK1B 4JCMA 4XWOC 4L8BA 1MJJB 1W72B 3LZOA 5L0QC 1F42A 3HFML 4RRPG 5KOMC 4O4YH 1NIEA 1CPUA 4LLYA 2PYFB 4HFWA 4AY0A 4B5ZA 1S9YB 2GITB 3BH9A 4WZ9A 2HUHA 1DE4A 4AOFA 2IH1A 3LH9A 4KXCA 5E7FA 4OD3L 4R7LA 5CP7A 4TUOA 4FG6D 2YD5A 3RIAF 1MFAH 1I8LA 1W72H 1QWNA 4WI3A 5TFSH 5T8IA 5DD1L 2PP8A 2HFFB 4X8CA 5D2LF 5AB9A 3F58L 5I0XA 3T3MF 2F8IA 2RA1A 3UYRH 4EIBA 3NUKA 3JVGA 3ABLB 4M7KH 4N20A 4LNRB 5EF0A 4M7ZC 3BZ4A 3WMSA 4TL4A 4LSVH 1KCWA 2B16A 1LILA 1N6QL 4LQ1A 4QTIH 3ATAA 3GRWL 1YEFH 3ZUNC 5DJCB 3O2WH 1IIKA 1MEXL 1N4XH 3LKOB 5DR5L 1LP9A 2KDGA 3NGBB 3EH2A 1CQKA 4X9BA 4PJIA 2P7TB 1ZVYA 4GLRH 1NJ9A 5HSFA 3GLAA 3GSVA 4G6KH 4BH7B 4NZTH 4BSWB 3CVCA 1BMZA 1BMGA 4Z7NB 3S7GA 4WCYH 3DSNA 1JWSB 4QUOA 4NP4L 2HJKA 2YEVB 2YPVA 4Q6YA 3ARBC 3VFMB 1JYNA 1U3NA 1JNHB 3T2NL 4FFZL 5AZEL 3GXPA 1CDGA 2X4OB 2Y3AA 4R8WL 3VFNB 1ZHKB 4HK3J 3TT3H 1NKGA 1RU9H 3HG1A 3JTBA 4LPVA 2DQIL 3GMMA 2EUZA 1TVBA 3OAZK 4V1DB 3W57A 1F18A 1UH3A 4RISL 1KENL 1KLFA 2RJMA 3MNWB 5FGSA 1K5NB 2OR8A 4N26A 4Z95L 4R4FL 5E2VH 3WFCL 3BKJL 2AF2A 2OMXA 5E9NA 4MMZA 1VDGA 3MRDA 1O7SA 1HAWA 1WCBB 5DMIH 5I1JL 1LO2H 1MCJA 1J48A 3FT4A 5C70A 4QIRA 4DERA 1KGCE 4JFOB 1Q9WB 2ICES 3CHXA 5EU4B 5FX3A 3DURA 3RWHA 3S2AA 4CNIA 1TEFA 3U36A 5HI4C 1G0YR 1GYWA 2W60A 3BQUB 3GZKA 3HZMA 3V95A 3REWB 3IGAA 5CJQL 4LSQH 1BM3L 5HHPB 1HEHC 4MGXA 4AQOA 3CVHA 2GJ6D 5F7NC 5EO9B 3ALWA 3BEVB 4C58B 3LKPB 4MMYB 4QGYA 5EIIB 3CMOL 3T71A 1WAAF 2ZG3A 2NPLX 1INQB 2BIMA 1YEKL 2QV2A 3WYRA 3FB8B 1UKSA 2X4PB 4MNGE 5J3HC 5G5DB 2ZF9A 3N91A 5C09E 2C26A 2R0ZH 4XMKH 3UBHA 1YDPA 1K4DB 1VFAB 1DBAL 5E1QA 5JORB 4CC4C 1BVLA 3SDCB 2W59A 2ZX7A 4X0KB 4AUUA 3DTUB 3C8KB 1J5HA 3A67L 3ISRA 1OAYL 4ZTOL 2CPCA 4K8RC 1D7FA 3BYTA 1NH6A 3MDJA 5E2WH 2V2TA 3E0GA 5DQ9A 1XR8B 1KWGA 2EVHA 4RAUB 3K0YA 1MNUL 3ZDWA 4D3CL 2EH7L 4I8DA 2VERA 2FNBA 1ULVA 2ZOWA 4MDIA 4UOW0 1LDPL 2JJSC 3PCYA 5G4NA 5J6GA 1H6FA 3ZDZB 2KBGA 1KMGA 4GUQA 1Q90A 3LZLA 1A4JB 1PKOA 5E6IA 1O6SA 4AK2A 4KKZA 4WEBL 3ARFD 1EV2E 5ID0B 5C0NC 3D18B 1MFEH 3EIFA 1BDYA 4GXUM 5CR8A 1L3NA 1UWEH 1SDDA 5EBLA 3KPRD 1RIHH 5KBNC 4E0RA 2NY3D 2ADFH 4KXDA 1TXKA 4MVBC 4EBQH 3HLAA 4Y8AA 5EBMB 1BXXA 4G59C 5D8JH 3DVGA 4I9WE 2R27A 3L9RA 5T1JA 3GSUB 4GRWB 3BPCB 4B9KC 1C8PA 2ODHA 4I0CC 4F58L 4JFEB 2OQJA 3K6NA 1ZLWH 2BS71 4PGDA 3TTYA 4BFEA 2R15A 1JUFA 1O9ZA 2O30A 1ACXA 3LCYA 2J57A 2N4IA 3HC3H 4Q0XL 5KN5B 5FYKH 2P43B 1H0DB 3LV3A 5JPMA 3W37A 2ENJA 4OI8A 4ZZKA 2VDMB 5ANMA 4YSUA 4N0FA 3QULB 2CDGA 1COBA 3PDDA 5CEYA 3VE0A 3EBGA 4MNQE 4YPJA 1MH5B 4M29A 3MRPB 1IIIA 2QT6A 4YFEA 1K4CB 5HYQB 4WDIB 1CI5A 1JNJA 4ECNA 3U2SA 2Q0ZX 5LDUA 2G60H 3MRIB 4PJDE 4TKWA 2QHRL 5A2BA 2VDMH 1WVZA 3NIDE 3WXVH 4N8VA 2OJEB 2JVUA 4IRJB 5I1GH 4TNWF 3QWOA 3PWUB 1JPGA 4QOKE 2YMXH 4P2OD 5D1XD 1FN4A 1NAKH 5E2UL 3DK2A 5B1JC 4GP4B 2IAMA 1JXDA 3W9DA 1NKRA 1QOKA 2PWFA 3VXOB 4KKPA 4FNLH 2B1AH 4CRPA 4YC2B 1T4WA 4RFOH 2DQMA 1R33A 5LGJA 4JM2B 1FIEA 1KCSH 4JZNA 4K3EH 2G3XA 2Z91B 3F05A 4WY7L 3CMGA 4GO6B 3T6VA 3WL9A 4QJ5B 3TO4C 1RUMH 4H44C 3MO1B 3I3BA 5I1IH 1FNAA 2H8PA 1TZHB 2ZONA 4ELDA 5D1QE 5IQNA 3L48A 4RSYA 4URTB 4OAWA 2VW6A 4J2QA 1JZIA 1CXFA 3FZUC 3TJHC 4HHWA 2JF1A 1NOLA 3WY1A 1RFDH 4YZFF 1A7BA 3BIKB 2GY5A 2D7NA 1RUAH 4X6DE 4O58L 5C0AD 3FQNB 5EZJB 1I7RB 1OTTC 5EN2B 4ZOEA 1ED3A 2Y5QA 3VUAA 2PW1B 3U7WH 5B39A 4H8VA 4QXUH 3K0WA 2D7TL 5HVHB 5F3BB 2WYTA 4LCWD 3ETBF 3GSNL 3CFJA 5C0EB 2EH8H 4RFNB 2APVA 2BSRA 3HZKA 3QZMA 4HK3N 3N43F 5EOQL 5FPIA 1UM5L 5KSBA 3BAJA 1L9OA 2NY6D 3VGGA 4F7CA 5HGDA 3IAPA 4YHLH 1OSEA 2JLLA 4L8SA 1F02I 5DD0L 1SVCP 1EHXA 5CCKL 3REVB 5IESL 1HXKA 3GEFA 5L2JA 4AKOA 4Q6IC 1I3UA 1AHWB 2C1OB 1I1FB 1P1ZB 1V7ML 2EDDA 2OMUA 4PGEB 3K71B 7TAAA 5KVFE 3ULSA 1RZIB 4L1BA 4YDKH 3JYBA 3DV4A 4L5FL 1DVFD 4FOMA 12E8H 1FORL 2F8XC 3ZHDA 4CN1A 3MUHL 1HYRC 2C8NA 4GBXA 1T04B 4W9DC 3IJ8A 1PAMA 5EZLA 2Q9OA 4KK6C 1BZ9A 2YFNA 3B9DA 2YRLA 5D2LB 2VM4A 4FKEA 1RIVH 2BX5A 3ULUD 2VM3A 4GG6A 4L05A 4LVOB 3SE9H 3EZJB 3T3MB 3NJXA 1K5WA 2P8PA 4GAYA 4TF4A 1XTLA 2W80C 3CLEH 4J3OC 4OGZA 3FUJA 3MCLH 1MSPA 3CFIC 3MV7E 4UTBA 1DJHA 3ESUF 5B38A 1BZ7B 4PLJD 5HHNB 3OHXC 3IDYC 3T65A 3TJPA 1NBCA 2PWEA 3MGOB 4X7TB 4AMKH 3LIZA 4AGQA 4HIJB 3F64A 5E99H 1ZT4B 3WSQL 5DJ0B 4B9JA 3UERA 3TCTA 3RY6C 2J8UA 4ODHH 4QTHB 4ATTA 1U8MB 4Z7WF 4J8RA 2YA0A 1FF5A 2KC0A 5CM1A 3D7PA 1M2VB 2V9TA 3SBQA 1E8WA 5C9KA 3RQ3A 5I66A 4Y1SA 3DV6A 2ILLA 3WNKA 2H1PL 4P9HL 4DCQA 2APFA 3CHPA 4RMSA 4YUEH 3W0WA 1U8OB 4NPJA 5IHUH 5AW4B 1MJUH 4F1SA 4UTAH 4HXAL 2P8LA 1NCOA 1QSED 2OMNA 1AXSB 4MD5B 5GS1C 3FB7A 4PS3A 3V0HA 1T1ZA 1GCYA 5GIRA 3MLSL 5GRZA <