4KKPA

Crystal structure of vibrio cholerae rbma (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
VIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAQQESDALTDGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
molecule keywords RbmA protein
total genus 45
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA01
4KKQA 4BEIA 4KKPA 4BE5A 4KKRA 4BE6A
chains in the Genus database with same CATH superfamily
3LPWA 1CE6B 1D7CA 1P4IL 3D0LB 5E6ZA 1JVLA 5C09B 3ZTNL 2IOMA 2J2ZA 3SGEH 1JP5A 4UBDC 2CO1A 1F4YH 2W9EH 1BXVA 4WK4B 1SYVA 1CD0A 2I60H 1JTTA 4BDVA 5LGJB 4Z7WE 2UVFA 2ZUSA 5B1KA 3UTZB 4PYGA 2HRLA 1GL4B 2PO6D 3GMOB 3GXPA 4XAWH 3SB3A 3VFRB 4WO4A 5D71H 3FYEB 5C07E 2KLRA 5B39A 5DUBB 2QSTA 4UIKL 2XRAL 2NY1C 1X7SA 1YEHH 1K4DB 3M1BB 1CGWA 4HMEA 4CADA 5C0DB 4FD0A 5DQ9A 1R0AL 2ITDA 2KUTA 2Z7ZA 1NCCL 2OW7A 4NN7B 4FAAB 4XN8A 2H47C 4URTB 4W4NA 5J7CC 4HISA 1IBGH 5DJCA 2X38A 5F9WC 2V5TA 2DTML 3DXAB 3FQUB 5B8CB 3C2SA 4BRVA 3MBXL 2BWIA 1MCFA 1ITCA 4MA3A 1ZV5A 4XMWA 2E7LA 1HAUA 5CIPA 2HSIA 2DWTA 4FKEA 5ERWB 2DMGA 3HRZA 4TQEL 1K5NA 4WKZB 1CL7H 2ESVE 2O5ZL 3QIUA 4IOSD 3QUMB 5IFAL 2AP2A 4ELME 4Z95H 2Y7SA 3MJWA 5BJTA 1MUJA 5IHUH 2O4EA 1DBML 2MPAH 4WWPA 2R0KH 4CN4A 1IL1A 1XGUB 1NPNA 4F1SA 5KN5B 1UHVA 3FFCB 3GMMA 4HS3A 5D71L 4I7ZC 4PS4H 5ELIA 2DAVA 3C12A 3BH9B 3J27A 1A9VA 2XRAH 2PW2A 2IQ9L 5FLUA 3WKQA 1ZA6A 2YK1H 2ZP9A 5JPNC 2CJ3A 1IARB 3VX1A 4QRAA 3W39A 4KVPA 5DEGA 1IC0A 1T20B 5IQ9B 1VGKB 1S7UA 3FB8A 2VMCA 3O3EB 2OTUB 4ENZA 4ECNA 4LEOB 3QDMB 3MBXH 2FWOB 3QEQB 4ZO9A 2X4PB 3G5VB 5EUOB 3V0VA 3KS0H 4IU3B 3L48A 3QK0A 1DVQA 1OSZA 4WW1B 3WE6B 3FQTA 4HWZA 4DN3L 4PRPD 1W8EA 4LSRH 5JUEL 1JWMB 1HDMA 4G8AC 3VFNA 5BV7B 1A14L 1G0YR 3HZKB 4FZ8L 2XUWA 3NIGF 4PG9A 3VFVA 5EORH 2H45A 25C8L 3H2PA 4OGXH 4MWFB 5HTSA 4PJ9D 3B9KA 3F6LA 2IH3B 1MFBH 3D3VD 3ULVE 1O9VA 3IU4H 4EJ1C 3GSWB 2XBTA 5T1LB 1C5BL 2Y6SD 2D0GA 3EKCA 4CDHA 5I16A 3RFZB 5AW9B 1M6OA 5AVXB 2XPGB 1I85C 2ADIB 2BM3A 2V9QA 2IQ9H 1QRNA 4NHUB 3S34L 2X5PA 3QVAA 1HHJB 1YUKB 5FKPB 1IAKA 2AKRB 5LWYL 4HEPG 2O1AA 5T1KA 1XZ0A 2EH8H 2FATL 3WELA 3ARRA 2P5WE 1ETZB 1S78D 2BVUA 2EEDA 4KK8C 5T1KB 4P59H 2N3JA 1H19A 4GIPD 1FL6B 1QG3A 4NP4L 5DTFA 4Y5XA 2G5BB 2X1XR 3GLAA 4LFHG 1QSED 4LGSB 3PHQB 1CURA 2E4FA 2A0LC 3O4LB 5TDNB 1JTOA 4TSAL 1O7DC 1BIIB 3KGRA 3RDTA 1I7RA 2XFXB 3HPLA 5GZOC 3DO3A 5A2JH 5ID0B 3TS8A 3HR6A 5FKAA 4PRID 4JG5A 5CLZA 1PZ3A 5T1KD 3M6DA 2NCMA 1OGAA 3ZK0A 2PPDA 4FG2A 4HSAC 4PG9B 3VFVB 1F0LA 5C2UB 5F7UA 1I1AA 3M7FB 4EN2A 1DBAH 3GDBA 4TV3A 5ABDE 1NAMB 3ARFC 3L9RB 4HZLB 5D1QE 1YEFL 4FEMA 4NIYE 3U0PB 5DQJA 1X5GA 5CJOL 2F18A 4RVBA 3AS1A 5A1AA 3DX2A 3UTQA 4JG1L 3P4MA 4WEMB 4QD2E 2IO5A 1MRFH 2GIYA 1AGBB 2PWDA 1G7QB 3WFBH 2CHDA 5K1VA 4YDVA 4F91B 2CKBA 2JVUA 1IZKA 1OP4A 2EEBA 2FDBP 4XCFL 4G3YH 2OMZB 1RJZA 3DV6A 3CPUA 2FWOA 5TK2A 4PJEF 2NSQA 2H32A 3ARSA 3L5JA 3EJUA 3CFKB 4BZ1H 4YXHH 1S7XB 3QXAB 2MCAA 3SDXB 5DYOB 1WIPA 3HBGA 2Q6WA 2SODB 3EJCA 3KPRB 3MRHB 1KV3A 3DHPA 4JZNB 4ZTPH 4AIOA 1QRNE 2R0LL 4OAWB 1MCBA 2Y25A 3D0AA 1INEL 2AI0L 4GSQA 4UB0L 4XN2A 4F7TB 3E9UA 1A4KA 1CCZA 2WW8A 3UBGA 3VTMA 2X89A 3LS5L 1AY1L 2WB7A 1WBYB 3G08B 3UZVB 1I8IA 1L9OA 2PR4L 4MXQD 3MRIB 4AVHA 1HXYA 4KGLA 4JREB 5AW6B 5D72H 1I75A 2H32B 5AW0B 5JPMA 2WNGA 2DEXX 5D1ZA 1K3ZA 4ODXB 2EO7A 4ODWB 3MA9H 3LH2L 4PBDA 2FT6A 5C07D 3U1SH 1WLHA 1BFOB 1IC5H 2FJFA 4WW2A 3S8WA 2LQRA 3IXTB 3PP4L 4WUUA 4IU2B 3FT3B 4OFVA 3QI9C 1N19A 1UADC 5AW2B 5DK3A 4MNQE 3HBQA 3VG9C 5ITBL 1XZWA 2AJXL 5L88H 1G1CA 5KJ4A 2JV6A 1MHEB 5DMJB 4OGYL 4PJ5E 4QRPD 5DRWA 1K8DB 4KXCA 4PMEA 1QTSA 3CSFA 1SDAB 1NJ9B 5DC4B 3MODH 3SY0B 1ZLVK 4EI5A 1T6WA 3FB7B 5EUOE 4XE0A 5C0CE 3GJEA 3VYPA 2D0HA 2Y4SA 1MH5A 4YIQA 1GZQA 5H4YA 1DN0A 1Q9KB 4K94H 3VW3H 3OPZH 1GVIA 3PXHA 4OFYD 3ULVC 4HUVA 2JTDA 4K7PL 3LZNA 3ARGB 5IQOA 1I1AC 1MFNA 3BESR 5CZKA 5FDWA 3RUGE 4PS7A 3W38A 5KS9A 3MLXH 4R7LA 3LKOA 2ITFA 5T5NF 4HCGA 1QVOB 4UTBA 4XBPB 4PB0H 3EH3B 3GSNB 3KPOB 4PJIF 4EQ2A 4PJ8D 3FT9A 1IC5L 4W70A 4F3FA 4A6YL 2QMKA 4PAZA 4L1HA 4UIMA 3RTQC 2ITCB 4OZHA 4C56E 4FXGC 1D5BB 4X4XB 4K3GA 1RZGA 4ZSOE 3WIHL 2KZWA 3G5YA 1CZ8H 4FFWD 1T03L 3WN6A 1P7KB 2QADD 4JPIB 3TEUA 3SGKC 3FB5B 5LBGA 3TZVB 4RMSA 2XG5A 4P3CH 4G8EB 4QXVA 4LDCA 4HX1A 3TJHD 3VJ6B 5E1QA 4LOFA 1BLNA 1AACA 4RMVA 2DH2A 3LH8A 4OLUH 1CC3A 2ZKXA 3LPFA 4PRAA 3IAGC 3I6KA 1D5RA 5EA0L 5JXEA 2MHAA 3BUIA 2YA2A 2ED8A 2XXCB 3LY6A 5TE7H 4OVVA 3LB6C 4AYBA 3DXAE 1H9VA 5AVSB 1YY9C 3QQDA 2EEAA 4NJAL 1FVDB 1UKTA 1N4XH 1R3LA 3ARTA 3VE0B 4HV8A 4PJ5A 1IQWH 3IFNL 3V0JA 1NOAA 2E5EA 3DX8B 1DQQB 1Z3GH 3MLYL 4NPYA 5SWZB 5E99H 2ZUTA 1R33A 3B2XA 1CICD 1OPGL 2OXGB 2XN9A 4R96A 3QAQA 4J3WA 3T0WA 4HKXB 3BVWA 5G2NA 3HG1A 4QEGA 1U21A 3UFIA 3TV3H 1ILSA 2TSBA 4Q4EA 4UOW0 2OPCA 3AJ7A 3L7EB 4W9GC 1PYWB 3RWHB 1VFMA 3CPLB 4BUHA 3S3CB 1A6TA 1KXTA 1MHHB 3C09C 1BPVA 3PHOB 3DJRA 4G8IB 2AQQA 5DWPA 2GTZA 4X6EB 4XP1L 5BPPA 3EYOA 3L3OA 1ZWIB 4HIXH 5KS9E 4KRMB 1G9NL 3FPYA 3OKKB 1O7VA 4X7CC 4Z76A 2IAMB 1ZT1B 1JD9A 2NR6C 3OR7B 4P3CL 3UTPD 4FQIH 3QRGH 4FI8A 4UTBH 2P8LB 4M3KB 2R4RL 1H3TA 4ZZKA 5F7BA 1KB9J 3LH9A 3IU3A 1S5HB 4L3ED 2AQRA 4JE0A 1OGTB 4Z78A 2H41A 2DQMA 1MJJB 2WZ6A 2VR7A 3LKSB 5IBLC 2JI1A 3QCUH 5I1EH 1C7TA 3BGMB 1AFVL 3AMLA 2OMTA 1NMAH 3PGFL 1LO5B 1VF5C 3IE9A 1RUAH 1P53A 3D2UA 4NFDA 2BNUA 1Q38A 1T6BX 2B1HH 3BD5A 4ZFFA 1DDTA 3I02A 5A43C 1Z6JT 4KO7A 4G43B 3GQFA 4A2HA 2A6IA 2AV1A 3GM8A 2ZWYA 1ECYA 3CZFA 4OCWH 1BJMA 1FO0H 2V9TA 4A37A 3GYRA 3L3JB 1FUNA 1P4LA 4L29A 2VXVH 4HGKC 5IMKA 4GFTB 2WSDA 4KX7A 5HHVL 1KXHA 4JUSA 4L8SB 1NGQL 4MJ5B 2J8OA 2P24A 1J1PH 1UZ8B 1OOWA 1B3IA 1ZLWK 3K8KA 3RIFF 3V6BR 3VU1A 5T1LD 2BP5M 2ZYSA 3FRUA 3OHXB 4X4YA 3LNIA 3VD2A 4MX7A 2CLRB 3DOSA 3V9CA 4DFIA 2A83A 3ATDA 1CLVA 3MRLA 4IBSA 5HI4D 4EE2A 4CILA 3QRGL 3UC2A 4W9IC 1KIPB 5CD5D 3HMXH 1X5JA 4JVWA 1P5UB 5IFHH 3QP3A 3ZDXF 3AFLA 3ASOB 3PWVA 3EDJA 4JG0H 5AW7B 5KWYC 4OY9A 4U1GB 3DKHA 4A68A 4M5TA 5DWUL 4KKPA 1BV8A 4OCLC 4DH2A 6CGTA 4U6TA 4I3RL 5D1XA 5JHLH 3LEVH 4F58H 2DKUA 5DMIH 3OKDB 5ALBH 3D5OF 1B6UA 4AQ1B 5B1BB 3RKPA 2QV2A 5E7FA 5D9SB 3B8SA 4JB9L 4AL8H 1I8MA 5SX5K 3L8QA 2LTQC 2FUQA 4ZDHB 1MCLA 4XNQB 3NCWA 4P4KC 2CSPA 4RIRA 2J1ZA 6TAAA 4IJ3B 4AENA 4AT6B 2LTQB 3REVA 4N6RA 5J89A 4EDXB 3ZE0F 5IVNA 1A4JA 4ODWA 1IGML 1MAML 4XODA 3FO2A 3VFWA 1BX2B 3CFCL 2V5MA 2RQEA 4NUJB 4OLZH 1PAMA 3UP1A 4P99A 1BPLB 5JIKA 1MCEA 1V5JA 2D73A 3Q48A 4NRYA 5KBPA 1H3UA 3LMJH 5H2BB 1U36A 3E3QC 3SDXF 5I17B 3GIVB 2GC4C 2GJZB 1V7NH 5B38B 1A6WH 1ZS8B 5AZEH 3KVDD 5L8KB 5HGAA 5JW4Q 2Z93A 4QKTA 4Y16C 1VA9A 5LBVA 1YQVH 3VI4E 2DQGH 1IGJB 4PGZA 3IBEA 1LDPL 4LARL 5LN8A 4AJ0A 1Z2KA 1Q9OB 4JO4L 4B6ZA 4M4PA 4WHTA 2P26A 1J0JA 2AC0A 1IKNC 1RZ7L 3DGDA 3RJQB 5DZPA 2DWEB 3GMRB 3EOYG 3L3IA 3MGOB 4GSDL 2IDFA 3DVNA 3WFZA 4BK8A 2HFFA 2MNWA 3P11H 1BQKA 3DX7B 1U33A 5IFAH 3NSDA 2H1PL 4JQXC 4D0DA 4G6FB 3QO0B 4F7MA 4RNRB 1Y0LB 5F9JA 5F6IB 2NW2B 2CBQA 2F8IA 4QOKE 2YD0A 4HJSA 3S5LG 2W94A 3UO1H 4LLUA 1AD9B 3EZJB 3HPLB 2H2SD 2FRGP 4HCIA 1YEKL 2VDKH 4EN3A 4HWEL 2NYYD 4ZMOA 4ZO8A 4M1GH 1GSMA 2FX9H 2NY5L 1UKSA 1MJUL 1CFBA 3QUXB 2J3SA 3UP6A 4DN4H 4N2CA 2R1XA 3VXQA 1FA4A 4HKBA 2FO8A 3NRFA 4HT1L 4BCXA 1YQVL 1ZKAA 2XDHA 4A7SA 2APTA 2E6PA 1IBYA 4H25A 4X42A 3QARA 3IETA 5FO9A 3UBHA 4B5ZA 3MRMB 3MYJA 2CIIB 5FM5O 2WBWB 2EE6A 2MCPH 3WDIA 2Y5EA 3QUMH 4YL9A 4K8RH 3CFDB 3L3HA 4G9DA 3V9FA 1DVFA 4RMBA 1BWMA 2QLYA 5J6GB 3A22A 1NFKA 4WLCA 3CFDA 3GUTA 3BP4A 1S7SB 3DIVA 1I3RB 1C5DB 3US0A 4R7NA 1TTUA 5CEXB 3HCVB 4DSYA 4H0LC 2IBZY 5T1LA 3MU3A 3QORA 5KSBE 3NBNA 4WUUE 4IOSA 2EIEA 2QADB 4JO5A 3PUUA 5EORL 2ZYIA 3PL6D 3HI1B 1OM9A 2PO6B 4OCRL 1X5XA 4JPSA 2FO1A 3NN8B 2DQFB 1UD3A 1IFHL 4HPOH 1KELL 5GZOD 1HESA 5L2KD 4M62L 4M1GL 4JPKH 4ZAKD 3T6VA 1YA5A 3HAEB 3NMEA 5L2KA 2WWOA 1CLOL 2CPUA 3V8CA 3B9KC 3TCLB 1QATA 1A6ZB 2BSBA 2AJUH 2Z92B 4X6BA 4BWUA 1BREA 3L4CA 1JZIA 1LWJA 1VCAA 2IPKB 2AQ2A 4W9LC 1QEXA 4HUMB 2NW2A 4XWOD 1TO5A 1HINL 4Y5YC 2EH8L 2FATH 5HHQB 2HT4C 5AG9A 4XR8C 5J6HA 3NGBB 2VLRE 4FYQA 4PWGA 3TC9A 3FAWA 5JW4R 1J5OH 3MV8A 4G6JH 4UINH 1G9HA 2K8MA 5ILTL 3MKKA 1CFTA 4WNQA 3KDPB 2Y7MA 4L8CB 1ODAA 2VLKE 3HN8A 3T6QC 3FQ1A 3MGAA 3PP3K 5E94A 2VDQH 3HAEA 4X4ME 3BDYH 3DI3B 4DHLA 2BHUA 5GGVY 1Y18B 1S3RA 1UWYA 2B39A 3PJLA 1M4KA 5LXGH 1K8IB 4Y2NA 4PGEB 3FQNB 4R7XA 3R1GL 4Q6YA 3B56A 3V79C 3GMMB 2J73A 4IDJL 3QNFA 4RAUA 4WO4D 4HETA 5D96B 4FMKA 1YPZA 2YEZB 4ZW5A 5EIIA 5I6MA 3A47A 3DYMA 1MFAL 4F2MA 5ADOH 4KQ0A 4MQ7A 3U46B 4Y88A 2NMSA 2LFEA 3HMWL 7TAAA 1G1OA 2X42A 1F3JB 1CLOH 1J8HD 1R17A 4HSQA 5FUOH 3W2DL 5HDBE 5E94B 3VQLA 2AJUL 5FYLL 5MEOB 4JKNA 2GUYA 4W4OC 5I24A 5I6NA 2K78A 2D9QB 2VLLB 5EOCL 1NBZA 3VXRD 5A7BA 3ZYJA 2HKFH 4G7YL 4PWJA 2NSXA 3DVGB 1R46A 2QPEB 4QOKD 2WINB 4TNGA 4E5XB 3ZKSD 3N85H 4PTUB 5HHQA 3BYTA 4G3YL 4O58L 3MOBL 2X2HA 5A16A 5IMMA 4FFTA 2WLMA 5ILTH 1Q9WB 2BOCA 3TIDA 4D8PA 1AR1C 3IMVA 3IWVA 5L4JA 1FZJA 4P4RA 1HXMA 2K6ZA 2WXMA 4XMTA 2VDQL 3RTQD 3WIAA 3L95B 3KPMB 5D7IE 2VERA 1OD7A 4M29A 1XD1A 1HZHL 1S78C 4DCQB 3KYOA 3AREC 3ULVH 2AVFA 3G5WA 1EANA 1VGEL 4JW3A 2ZCLH 3W1ZA 5DGRA 4GBXA 4HALA 2IXQB 3BIKA 5E9DD 3EGSB 5EZJB 4U1KA 3FT2A 1UXSB 3MV8E 4YXLH 5DSCB 3CE1A 2AJ3A 2CXGA 5LUMA 5IJKC 4QJ5B 3N1QC 3WEMA 2MOVA 5E51A 3IKKA 3UMNA 4GQZA 2RJMA 3TA3B 3VB8A 1MREL 4KU1A 4RWYH 5FOBA 3KWTA 4J3TA 1FYTD 3QO1B 5D93B 1V3JA 1SNRA 5J6GA 2Z4QB 2GSGB 2D0FA 2H0FA 3OKNA 3TX4A 2A9CA 4LHUD 5I0DA 4G8GE 5HVHC 3NSYA 5E70A 1WWCA 1CLZH 1DSYA 1EGJH 1NFDB 4X80H 1OCRB 4MA8L 2BP3A 4JGNA 1VIWA 1KCRH 2WO4A 5CEZE 5E08H 4GUQA 4QCIA 2X7LB 1E65A 1JPTH 4JFHE 3WS6A 1RZFL 3FN0H 2ZSWB 1FQ9C 5FYJE 1EZLA 5BRZA 1MFEH 1BFVH 2BNUB 5HHXL 3MTRA 1I7UB 5DFTA 4FQCH 5C0EB 2EICA 1HX0A 1SRDA 2GIXA 4WWKC 4M48H 4PJDF 4BXSV 3IAQA 1MCKA 5I8OL 2UY6A 2ZKHH 4KPHH 4F8OA 1CBVL 4RISH 3W9DB 4GG6E 3JWDL 3VW3L 1FZMA 4JMNA 4R2GB 2O5NA 5HYJD 1QEWB 2EDNA 5ANME 3QUKB 5DD5L 3LKPB 1ZV9A 2W92A 1E3FA 1UJ3C 2VDPB 1EO5A 4NS0A 5LNEA 4NAQA 2EXSA 1EHNA 2YRZA 3CHQA 1KXQA 3TYFA 2Y23A 1MREH 2YPVA 3P30L 4H2AA 4HH9B 4G8IA 4LPCA 4HU2A 3PJSB 2P80D 4EOWL 3WL9A 4QMEA 4TUJA 4NN5C 5DHVH 4PRIB 3TWCH 5DC9B 3R7RA 3CLWA 2H1LM 1X7QA 1EDYA 1JUFA 4H1LH 4JN2B 4ONHA 5GS2D 3US9A 3O45A 4BSVA 1RZFH 1IAMA 3FN0L 4LASL 2XZZA 4PFEA 5FYJL 5ITFA 3PFUA 2R39A 5IJDC 2UUDK 2OMWB 1OAXL 3A24A 4H8QA 3V8OA 4B9YA 3NZ8A 4TPRH 4IS6A 3FCTA 4AZ8B 5GIRB 4KVNL 1SN5A 1FG2A 1Q0XL 4MLSA 4P04A 3U4EB 3CCHB 1N4XL 2BSSA 5IVXA 3QIUC 1UOLA 2V3DA 5FCSH 3OJDB 3OD3A 4I9WE 3K0YA 4WDIB 1Z3GL 3QDJD 2ALAA 4X6CA 5HY9B 2E8ZA 4H1LB 3BKMH 4IRSA 4R2GC 4FA8A 3ZT5A 3LEXA 4MDIB 1QLFA 4M7LH 1A7PL 1HEJC 3AROA 1FDLH 2AXGA 2IDUA 4S1SL 1GZHA 5D9SA 1ASPA 3WAKA 2VQ4A 4TVPL 5IJBC 4JM4L 4AKOA 3SKUD 2P3YA 1IVLA 4KXDA 4KKQA 4QF1B 3Q2LA 4TL5A 5LGKA 1O5PA 3DYPA 3ZRCC 1UKQA 4AQAA 1M9SA 2NY0B 4H26A 3A5VA 3O6FC 2W0LA 1S5HA 2MQGA 2ZWSA 4YHKH 1AHMA 3OBAA 4F20A 2AZUA 3MNVA 4JGUA 2JJUA 1JHKL 1UZGA 1XIWA 5EWIL 1D5BA 2B9AA 2HH0H 5T1JA 2C3WA 4XX1G 1OP5H 2R4RH 5IW6B 2UZXA 1OZTG 4JE4B 3D30A 4Z7OF 3AQDA 2J44A 1PLCA 1QZNA 1AJ7L 4FHJA 4NCC1 1CPUA 2GITB 1IM3B 3LEXB 4D3CH 1RERA 5TE4H 3CX5J 4I1RA 3QCUL 5F6HJ 4FFZA 5I1EL 4DP0X 1AFVH 1L6ZA 2Y7NA 3WS3A 1OM3L 2GEQA 3VXSE 4X8GA 2WWMD 2H3KA 4NC1C 3Q8EA 1EAOA 4JJ5B 4LT7A 4DPCX 3OG6B 1EEUA 2ZNWA 3CCHA 2W91A 1EHAA 3D12B 3HHSB 1J9QA 5DUJA 5FXCH 1Y1DA 2WANA 5EC2B 2NCEA 3GSOB 4IS6B 1ZE3H 1LO4H 3FH8A 4XN4A 3AW5A 4HV8B 1A25A 1AZUA 3GXDA 1OTUD 2CZNA 4YSOA 3CFBB 5HHVH 3GIZL 1N0XH 3EHBD 5JHBA 2DYPA 3GXNA 2VTFA 4D9LL 4E5XG 1FFQA 2FB4H 3IJSB 4FHBD 1BVNT 5DLMH 3QQXA 1RU9L 1IGYA 2H8PA 3N43B 4PRAB 5J06A 1MVFA 2VXTH 5JMRA 1FZOA 1XIWD 1NIBA 3DDFA 4H40A 1FJ1A 2AZAA 4P46C 1YNKH 4J2QA 1E8YA 5IG7B 4OFDA 2MKLC 1E5UI 4XZ4A 1NIEA 4JEGB 1AZZC 2AEPH 4YQXL 2QKIB 5C70A 1PD0A 4PV1C 4YPGA 4ODTL 3V4VB 2DM4A 1T83C 3W9DA 3QPQC 5CCJA 3FNKA 4G42B 4F58L 5C0BE 3AB0C 3UCRA 4JQVC 4EBQH 3P2TA 4Y16D 3U4BL 2YMXL 5F9DC 3VI3B 3QZOA 4ZW3A 3U48A 3QZLA 4AGPA 2F54D 1PKQA 8CGTA 1HEHC 3KZ8A 1ED3B 1MCCA 5F72S 1ZVSA 2YUXA 1URZA 2L3BA 4J3OG 3P4NB 4DVRL 1J5HA 2B0SL 5FDWB 1XQ4A 1R5WA 2X3CA 5JHDA 1Q8MA 2F19H 4TUKH 1PD6A 3MNWB 4AQZA 3VSTA 5IEKA 1N0XL 3PDDA 4N26A 3ECUA 1FVDA 3GSUA 4RCAA 5HBBA 4HUNB 1YLBB 3TA3C 2WBJD 3D18B 5D6CB 3VXSA 2BVPA 5K69A 5HHMD 1NKGA 3ZQWA 3GJEB 1SY6H 1U8QB 5D1ZD 1IAOA 4Z3TA 1T1YB 1F4WH 1JYWA 4JN2A 5L9DL 1GGIH 3S88H 3QWRD 4LBAA 1PU0A 3KLKA 2YQGA 5I1CL 3QWRA 1ETA1 5CSZA 3ARDD 3N1MC 1Z9SA 2A73B 3N0PB 4WUUD 1A7NL 2JCCA 4JM2D 2KZ1B 2X89D 4M6OL 2VDOB 1E9QB 2ATKB 4J3UA 4YQXH 5KJ7E 1IM9B 4AL8C 1KGCD 1F41A 3IK2A 4JO4H 2C7UA 3ZKXC 1KLUA 1C16A 4R4NC 1PJWA 3GMPA 5JIMA 1YYLH 4R7NB 4TQHA 1RZ7H 1KFAL 3RWCA 5IKCA 2BVOB 5TD4A 1FFTB 4AM0Q 1BW8A 2ZXGA 4X5XA 2QGEA 4GSDH 2VIRA 2R8SL 2R2CA 1U8CA 4Y9BA 2BDNL 2V7NA 4MNQD 4N3UA 5IJVA 4P2RB 3WXVL 1NC4D 3EO0B 1ZPUA 3T0VA 2WNXA 3SGEI 1PZ2A 4JBSA 4PRNB 4NKOB 1UZ6F 3WHXA 2FYVA 3ZGIA 3VCLB 2O6DA 1S9XA 1FG2B 4N2AA 5DRNA 1YEKH 1EZVY 1BZ9B 4PI0A 4U1JA 1W91A 1XF5B 2NY2D 3S2AA 3ZHKA 5I19H 3UROR 3MRHA 1ASQA 1GGIL 1NCAL 1MJUH 3IFOB 1AC6A 4Y7MA 1SMAA 3CZEA 3QZBA 1PNDA 3WJMB 2Z6FA 5JHDE 4YHYC 4PTTB 2NQDA 3ZHFA 1QBLL 2NUPA 4Y4HD 1PBYA 5EPMA 1KTDA 1KB5L 3I9GH 3MJ7A 3DROB 3MUUA 1FFOB 4X0KB 1Q72L 1WFOA 4R3SB 3MROB 3K80A 1L0PA 1U8PA 3JT2A 5EU4B 2NW3A 4RBPH 2AJ3B 4DP4X 1LP9E 4RA3A 3L3DB 1KOAA 2W60A 4HK0B 4P5KA 4OUUB 4Z7WA 5AZ2H 2XLLA 3KYNB 3RVTD 2BY1A 4CW1B 3QZWA 5I6XC 5L4MA 5K9KB 4YN3A 4R5TA 1NEPA 4QIRA 2WUCL 2D7TL 5HYJE 5AUMB 4PV8B 4HKJA 2ICCA 1G9MH 2CBPA 3UBXI 3CFJB 2OI9C 4C54A 5SWSE 2ZWZA 3GSQB 3LNHA 4KRLB 1IFHH 3MV7A 3SDAC 2WXPA 3SDDC 4B9PA 1E8XA 1YHPA 1Z9NA 2ADGA 3JV0A 3PYCA 3T09A 4E41D 5BRZE 1GR7A 4E41A 4S10A 3W39B 4PJCA 4R90H 3GF8A 1JCVA 4B9ZA 2HJKA 1AIZA 4JR9H 3NH7L 3MJ8B 2C34A 2UXTA 4V1DB 3I50H 1KBWA 4D7PA 4NYLA 3VUAA 3Q43A 3H3PH 4UU9B 5KN5A 3POCA 7FABH 4PLKD 1CXIA 4ADJA 5J1AA 3CZNA 4LF3A 3RX5A 3TBYA 2VH5L 4AGQA 1IGIL 4C56A 4XOBA 3UG5A 1JZEA 2AHIA 4JFOA 4HMCA 5J12B 5B7FA 3N6YA 4X7SL 4NZJA 1AMXA 2CR0A 5C0GB 1QSVA 2J88L 4X8XA 3OKMA 3RFRA 3A67H 3MNMA 3T0EE 4CSPA 2HKHH 1GKEA 2WCSA 1NCTA 3ZL4L 2IH1A 1BZ7B 3FN9A 3BVDB 3GUTB 1W16A 3T2PA 4KXZH 3ZKMD 3A23A 4D0CB 4KNSA 2QFRA 3E8UL 3JWNG 1X9UA 2NW3B 3BFWA 3H7LA 3IFPA 3MXVL 1RSYA 3QUXA 4FQXA 5IESL 2OR9H 3INUL 2I25N 1WH0A 4MA3B 4HU8A 3RWEA 2MJWA 3EOAA 3TASA 3IBOA 4MHHG 4ZNCD 2L7QA 2KDGA 1IEBA 4HWZB 2N01B 1MW2A 2VJ0A 1LEIA 4AH2B 2WWKT 1JK8A 4PI2A 3UEQA 2LU7A 1U8KB 2E4TA 3MUGB 4AYDC 3HNSH 3EYFA 5D1XD 2BK8A 3KXFB 2HFTA 4BKLA 3QPKA 3I6GA 2JJTA 4NQDD 2DJMA 5D96C 4IKLA 3BZ4B 3MRRB 4O02H 4GBXC 4BKTC 2P8MA 5LBSL 3STLB 1I3UA 4G7YH 5IK3B 3GS0A 2XTJD 3IGAA 3KGUA 3VG0L 3TVMB 1I9JL 2DEWX 3AGWA 2BMKB 1RIHL 3B2MA 3GJFB 3REWB 3RYMA 4BZ2H 3NFPB 4EKJA 4J28A 1WZMA 4PIRF 5E56A 2EVHA 4FLQA 4R97C 2LVCA 2HG5B 1KT2B 2HLAA 1JNLL 1I9IL 5CUSL 4PGJA 4MAUH 2OFQA 1TF4A 2HN7A 4ZOCA 4ZQTA 2EUVA 2XFGB 1AQKH 3B7YA 4LP8A 4ES9A 1SN2A 3BPNC 3DTXA 4TL4A 5EEYA 4XN1A 1OSYA 1A66A 1DLHB 1FN4A 1BG1A 5DZLA 4N24A 1U8LA 3PDGA 4NO2A 1RK1B 4Z5RA 2LU3A 1P9MC 4XP6H 5CHNB 3QHZH 4KKZA 4JN1L 2NX5E 4C47A 4JY6A 3BP4B 3DMMC 4NUGL 3S37L 1E6OH 4AK1A 5IG7A 1NCWH 1TIUA 4O9HH 2NY3C 4AMKL 3F62A 5HI5D 3HZVA 4M7JH 4CMMA 2ZP0T 5GJTH 3RVXC 5I1JL 4MQXD 1FP5A 1KCSL 1UA3A 2ARWA 1W8OA 1XBDA 1WBZB 5DHVA 3VH8B 3HRZB 4OJEH 5EO9B 2CO6B 1IB5A 1P6AB 3KWWB 4RGOL 3K8LA 4XO9A 1WD9A 4C8XA 4X6CB 3HG4A 3CFBA 1MNUL 4HHWA 5HYFA 3D0VA 1GY1A 5F3FA 5GRUH 4HUUB 2Y6TE 4P46D 4J2XA 5A40E 2NR6D 1UM4L 1EHKB 1PEWA 2YZ1A 1KCVH 1IT9H 1HE7A 3CSBA 5JXED 1BFVL 2EEXA 2XWDA 3LIZH 3VGBA 4I77H 1HJCA 1YYML 4LSSH 1KJ3L 3HE7B 3S36L 3V0EA 4FTVA 1OGAE 3BN9C 4Y1AB 4FJ6A 2FQDA 3V4PH 1XGQB 1VFUA 4K8RC 4XCNB 4BQBA 5LQBL 5J5EA 2CLZA 4FI7A 4GQPH 4OM0L 5T3XL 5DA4A 1SXCA 4GSRA 4Y0GA 1DZ0A 3IJYA 4BJLA 2YD6A 3QNXA 4QHMB 1NBYB 5AVWB 1D9KB 3TJEH 4Z7AA 3NPZB 5A7EA 2JQMA 2RQ8A 3WL9B 1MCPL 1W2KT 2X4SA 1N18A 4OD2A 1XR9B 3C5JA 4N0RA 5I1KL 1F6FB 3N43F 2DQDH 5MI0C 3I9IA 1JWSB 4W6WB 4NB7A 1U4EA 1S7VA 5CXPA 2J6EL 1EBAA 1UOKA 3APFA 4QRRE 5CLXA 4C58B 2X44D 1L9QA 1F42A 3BWAA 4CL7A 3NCYS 1IC7L 3JYBA 5C97A 3FHQA 5I8CA 3GRBA 3R0NA 5PAZA 4KQ4H 1K4CA 1NEZA 4PVLA 3K72A 4RMWA 1AXSA 3W0WE 1FFPB 2B4CC 3IJSA 1K4CB 1KJ3H 1SLUA 5IGXL 2BSSB 3O0LA 5B1AB 2YXFA 1ZA3A 4HWUA 3ETBJ 4ZUTA 3MLUL 1MJJA 2D03L 5BRZB 4L4VE 1ZANL 1OP3H 5FGCB 2O5XH 3INOA 32C2A 4RFEB 3UJJH 5SWSB 3LZFH 3MNZB 2B5IB 4WFEE 3AACA 2HJFA 4I0PD 4L8DB 2CM6A 1FE8H 1BCIA 4QTIH 4ANKA 5I1LA 4LRIA 3Q1SH 1URIA 4P23C 4WEBL 2C3VB 1GIGL 1UD2A 2C1PB 3DO7A 1JK8B 1DQML 2EXYC 1YSOA 5GRJH 2MRYA 4R6UA 1NM9A 1TPXB 2JELH 5EC1B 2B15A 3DURA 4K7FA 1IVTA 1A9BA 3SDDA 4JJHA 1TQSA 1NAML 5C0CA 3M88A 3WSQH 2DJ4A 2CRZA 2FJGB 3W0WD 3CH1B 3ESNA 4UYQA 4U1HB 3DX9A 5KANI 1M57B 5EWIH 3TURA 1G7LB 3DX8A 1NL0H 2DJUA 4PIBA 1LEKA 4GW4B 4X6DE 2Z0UA 2JXMB 4YO0A 1YJDH 4L8SA 3L3GA 2QSCL 4NZRL 4ZMTA 1I8UA 3KJ6H 5EUKB 1FZKA 4GO8A 2BIMA 4TSBL 3OWRA 3MJGX 2XKNB 4D3CL 2XTJC 2B3RA 4E9LA 3NIDE 2Y24A 3KYKL 3MRQA 2PTTA 3LVTA 1ZVSB 2W0KA 1OM3H 4PEEA 3W0WB 3LNGA 3LZFL 2D3LA 1J8RA 3L4ZA 3Q7JA 5HDBF 5BVJA 2EZ0C 3W0WA 4OZHE 2XY1A 2WLNA 3V0FA 1JFQH 5BZXA 4XMKH 1FH5H 1VFOA 3DSFL 3QQ9D 4ZSOA 3TFKD 4MJIB 1PZ5B 3CXFA 3PDOB 3TBBA 3SGJC 5JNYB 5I1IL 5EO0A 1WBZA 1JV2A 5AW1B 2G3XA 1FWXA 3VH8A 4YBLB 2BCKB 4D0BB 3U7WL 4J3OF 3V4VH 1GGYA 3Q8BA 3NFSH 4D9LH 4HJJL 2XYCA 1F8TH 1A4AA 3SYOA 1RK1A 3F7LA 1XB3A 5KYNA 3GB7A 5D1ZI 4EDWL 1MVYA 3WFEH 1OE1A 1ZT1A 3QA3A 4QXUH 3RWJB 3S3PA 3P1VA 1U58B 4KNQA 5I1DA 2O61A 5JQ6H 2EUXA 1EGJA 5I73C 4U4BA 1THCA 1YAZA 3VFSB 1M05B 1SDDA 1TKWA 1A6AA 1NKRA 2A6DA 3TH2T 4OUUA 3IDMB 2VSKB 3L7EA 1ZDQA 4K7PX 5G4MA 5HYJA 4UT9L 1BM3L 2HVBA 1JGEB 4L5FL 3DIDA 4XNYL 4B9CA 1PY0A 2K7QA 4Y1AE 1VFBA 3KYKH 4L3FA 5C0ND 4EBQL 1PX4A 3KLDA 2L7UA 5CCHE 3WUZA 4QJ3B 1TTCA 4P2OD 5SWZA 3KXFA 4BM7A 4K3JL 2FX8H 1G43A 4GIOA 4PRBA 1UG9A 1FZJB 1HYRC 4HLZG 1M42A 1OQXA 2DKMA 2XVBA 4I0KA 3CC5A 3QR1A 1OZUA 5CR8A 3Q6FB 4XMKL 3HB3C 1GZHC 3MUY1 1RJYB 3QUYC 4MHHI 3U4AA 2VDNB 2V9UA 3F3HA 4WWID 1OVZA 3RWFA 3MREB 4UV4L 1BZ9A 4LK4A 2EKSA 1KG0B 1IKFL 1RAMA 1D6VH 2BWDA 3BGMA 5E1AB 1UH4A 2WLKA 3TZVD 1S7RA 4ADIA 1EAQA 3O2VL 4GS7B 1DEEA 5DZVA 4ESKA 4ZAKC 3AG2B 4G6KH 3WY4A 2QV4A 3AG4B 1F4WL 1A1NB 1UB5B 1JHLL 1NC2D 1IU1A 1CQYA 3SO3C 3D85A 1WGVA 4QF1A 4AC4A 1A1OB 9CGTA 3BFOA 3BPOC 2YJLA 2GJ6B 1OALA 3JVFC 4MCZB 5DZAA 3ZYZA 5F7AA 1LJMA 3RQ3A 1OAJA 1T1WA 1KXTB 4ZFZA 5H94A 2YUVA 3MLZH 3VXTA 4XP5H 4OLXL 1ZSDB 5TPWL 2FX8L 2G3NA 4ILDA 5IHBA 1J05B 1H0DA 1PLGH 1GGBH 5J8OA 3AAZA 4WI0A 1RZ8A 5FX3A 3VXQB 2YRBA 3N55A 2CRYA 3EO1A 4DGIH 1ACXA 1T7VA 3B7SA 1IMHC 2X2IA 2TRHA 2N1TE 4R4FL 2X6UA 3GSQA 3LQAL 3VWJC 2E6QA 3THMH 3VGDA 4EUPA 1QP1A 4OM1H 5CD3B 1MCOH 2HTLC 1JMXA 3D3VE 5F0PB 4EI5B 1EHXA 5CZXC 1PDKB 5KTEL 4MZ2A 2DIBA 3IF1B 5EUOF 5FUCE 4WK0B 3WEOA 4ZI8A 1IJ9A 5I19L 2KLTA 3C5ZD 4G5ZH 4LKXB 3JWNE 4HCRL 2J5LB 3GXUB 5CBAB 4R8WL 4PM1A 1PSKH 3F7YB 1RFDH 4K8RD 3ZHLA 2X9WA 3GMRA 1RKRA 3L3IB 1GYAA 1QMUA 3EYQC 4K5OA 2HTLD 2LU5A 5MP6H 1D9KD 3VI3A 4P8QA 4OV6F 1A7RH 4U1IA 5JXEC 1M7XA 1QASA 5A3IC 3VI4F 1AGEB 2X87A 4E9QA 3DIFB 4FQQB 2FQGA 3JV6A 2HPTA 4DAGH 2PCXA 3NACL 1O0VA 3MQIA 4XOAA 5JW3H 1MQ8A 1OARL 1JPSH 1L5GB 5DRZA 1A1OA 1RK7A 3FFCD 2D31B 3GO1H 3CH8A 3EDDA 4NZ8A 4TVPE 3B5GA 1DANU 4H0GA 3L81A 5B4MC 1NWPA 2GBVA 2GI0A 3P69A 4OLYL 1MXGA 4LPUA 3KPSB 1DBJH 2MSPA 5KTEH 4OCYH 2EAEA 4IRJA 4GKZA 3MAWA 2KH2B 4KTYA 3KAAA 5IHHA 2BNQD 3IWUA 1DQDL 2WOYA 5I0WA 5HVGB 1KPUA 4KH9A 4BELD 4QAWA 4MB1A 4MB5A 3SZ6A 4LCUB 5E1GA 4HCRH 3LZPA 4DZBB 5A6IA 3SE3C 1AD9A 4IMKA 4TOYH 3AREA 5F7EL 3LKNB 1J8SA 1RVFL 3VDAA 5J6SA 1E30A 2AEQH 4EZLA 4RIRB 1DQIA 1CXHA 1PIGA 3GMPB 3TT1H 2DH3A 1PQZB 2I9LB 1OO2A 2G9HB 3F7RA 3QDGE 4ZD3L 2JJVA 6PAZA 4N1HB 3UGXA 3WIIL 4R7VA 2CM5A 1MJ7L 2RFXA 5K9OA 1AQ8A 1NBCA 5C6TH 2HKAA 2ATKA 1I82A 2H0JA 2VLJD 4PD4K 2NT1A 3HG1D 3EYQD 3R4RA 5T3ZE 2BERA 3RGBA 4GMSH 5LAXB 1PD1A 1MCNA 3QHFL 4AEHL 4V2CB 3FUNA 2QVKA 5EBGA 1JGUL 4S1RL 3A67L 4LEEA 1B4LA 1MRCH 2G5UA 1U93A 3ZLQC 3FTXA 1Z5LA 2A4EA 2VN3A 2AQSA 3GHEL 4FYRA 2ITEA 2Q7YB 5CEXA 2IOOA 4HFWB 1I8KA 2NY0D 1BIIA 3O4LD 4J3OD 3TT3L 1N7ML 3GINA 3ILPA 4Q56A 4QTHA 4JCLA 1KWKA 1OEZW 2E47A 1KIQB 1YECH 2XIIA 1XAKA 3IJHA 3CVCA 5IEKB 2TSAA 4RZKA 3C9NA 1AG6A 1VGKA 3FMGL 3CXHJ 4N2BA 5F2FA 1H0DB 3G6DL 3UTTA 1ONQA 4KDTA 5IVXE 2MOGA 4ANUA 4NM8L 3HBZA 3W5NA 1NBZB 4ZYKB 4NO0A 3D1MC 5DEJA 1WCQA 5IM7B 3DV4A 1JI2A 3CLFH 2GHWB 4EN3C 1B3JA 2VDLL 3K6OA 1WZ1H 9PCYA 3K6NA 1NDGA 1FVCA 2B1AH 3ZO9A 2GK2A 1CD9B 5KBMA 4I1PA 3BKCL 4W9HC 2L8AA 2NRDA 4PCKA 4QRRB 4G8GB 4J1UA 3ZE2F 4F2MB 1L7TL 3T4AA 1I9IH 2YSSA 5DJ2A 4QT5B 5A2KH 5IQLA 3KL5A 1ZXQA 2R56H 4HD5A 5GJSH 3MRBB 3CNKA 2J6WA 4PGEA 1QFOA 2UV3A 4A1RA 5C0JA 1SF3A 4P5TD 4MMXA 1A5FL 1MI5A 5AWNL 3H54A 4MXWL 4XP6L 4ZX6A 4YS4A 1KWGA 3T2QA 3X3GH 1JF1B 1I9RL 2NY1B 4JVPA 3S4SG 3RWFB 2LVEA 4N8PA 5FHBH 1K5WA 4XB3A 4CADB 1A6TB 1NUDA 1RZIA 2K0RA 2O93L 5EU3B 5GJTL 5LVEA 2UZYB 3UAJD 3FSVA 2DLGA 3CIAA 1JZ7A 3QORC 3EUUA 2Z35B 2PPEA 4WI0B 4KXZI 4TKWA 5HGHA 5MERA 2ZUQC 3GI8H 1I1FA 3UTZA 1I7TA 5D2NB 4BHUI 1I3VA 1SOKA 3I3BA 2EVGA 2FIKA 2G60H 3QUKA 1U2CA 2M1KA 2QHRH 1GMEA 2YMTA 3LRSA 1UXWB 5EO1A 3HPJA 4KK5C 3VMNA 4BFIA 1ZEAL 3V4LA 2WM0A 2YPLE 1DFXA 1QPXA 1TQVA 4JPVH 2PO6C 1VZGA 3W9EB 3BKCH 3GLEA 4MAYB 5DVLA 3FT4B 5C0BD 3NN8A 1UM5H 1X9LA 3SDCA 4TSCL 4U6XB 3ZZLA 1YY9D 2WYHA 4EAEA 5GJSL 3O2WL 1M7DB 3IMSA 1JK9B 4OB5H 1UURA 5C09A 2IVFC 3FOLA 2EINB 1K72A 1ZJAA 1A6UL 1UCTA 3BD4A 3S3BB 2YD9A 4ZS7L 1A5FH 4M9PA 4RRPA 3G5XA 4QRSA 2ZJSH 3B9KB 4KJQD 4UAOB 3DK0A 5IT2H 1JGVL 1K5NB 2NYZA 1KTCA 2AJZB 4YL4A 3CVHH 1JMZA 2WJ5A 4HC1A 4XZUB 3K1DA 1AAJA 1WHOA 1INDH 3FTVA 1HKLL 2WXGA 1I53A 1JPST 4HK3N 3CN0A 2WN2A 2GSGA 4MNQA 3U6XS 4DKFL 2AXGB 2B2XL 3MBEC 5F44A 3SKMB 4YHZL 1NAKL 4CSZA 1TUPA 4XPTH 2VDML 4AITA 4NNPH 3G5VA 1MFDL 2BHFA 4NO5B 1KY7A 1UXSA 3F85A 2F54B 3NJHA 5DSCA 5CP3H 5D7IA 4LVEA 2Z65C 1AZBA 4CVUA 5IOPB 2JXMA 1U3HB 4X5QA 2IV9A 4WO4B 2R1WA 2WAQA 1GW6A 3T1FB 5BZWB 3KPQB 1KYOK 1MH5B 5E2TL 4JLRA 5BO1H 2WSPA 2PW2B 4BSVB 4YMPA 4OJAA 3KL0A 1DVSA 2VXQL 5IHLB 1KJ2B 4ZPVB 5D7JC 5C09D 2AMUA 2VMDA 2IEPA 1A6UH 1R4XA 3I9AA 5F8RC 2O5XL 4GRLC 1O6SB 2P44B 1N2RB 3LRHA 2E3VA 1EH9A 4UI2A 4HWBH 4PRIA 4Q97A 5CU5A 5ICXB 2IV8A 2I07A 1JV2B 2AABL 1RULL 3Q2VA 4WUUB 4B7IA 2DMHA 2EDLA 2MTPA 4TNVK 2UWEA 2BVQA 4P2CG 5KVGH 3CXHK 5IB1A 1J8HB 3DGGA 4YAQB 4TVUA 4XXWC 3H3BC 2AEWA 3CVDA 3OVUB 2DLTA 3HZVB 1AP2B 3KBHE 2X4SB 4H8HA 2Z93B 1QOKA 3BWZA 5C0IA 1S5IH 4FQ1L 2C5DC 1MLCB 2G9KA 1PLBA 2GC7C 4RFNC 3K2UL 2E7BA 1J0HA 1V27A 5CKGA 3ECQA 3ARBA 4FQ2H 4G8FA 4WU7A 1TU2A 4UIKH 1NCDL 3QULA 2JMRA 1J10A 3ARBD 2VL5A 3JT0A 4I48A 4Q6IA 4P3WA 3J2PA 5BZWA 2E7LC 4U1MA 2IANA 1GCYA 4HIPA 3IPBA 1HKFA 3HLAA 2KYIA 4QRTA 3GI9H 1ZK5A 4MS8C 3CFKA 3FJTA 1F3DH 2BNQB 4K3EH 2Z0BA 4N0CD 3DPBA 5J11C 3E8VA 2XNAA 4WEUD 4KOBA 3GBEA 3NIDF 5I74B 4X99A 1CTMA 5KVEH 3NRQA 5AKVA 2SEBB 3QNZB 3LDBC 3WFCH 4E0RA 3NJGA 2JKXA 2NQCA 1JWUB 4BH8B 1YN7B 1WDAA 3LN5B 2KHAA 3RIAF 2A9NL 4W6XB 3MCKA 1B90A 5FCUH 1YN7A 1BM7A 5GGRY 4JL1A 5KVFL 2AJYH 1BIHA 3MC0A 3TA3A 4JKLA 5TF0A 1VAHA 2Q76A 4XB7A 3WE1A 4Z8FL 2CBOA 5IHUL 1ILUA 3V5DB 5I66B 2Z64C 4G1MB 1F58L 4OKVB 4HX1B 5EN3A 1QW9A 1U8JA 4PWHA 4ZMQA 3WUWG 3WFEL 3IDIA 1KXVC 2E7DA 5E5RB 1BVZA 2HT3C 2XQBL 5EIVA 3UAJC 1ZA3B 1I1YA 1BAGA 1C5CL 3UX9B 1KPUB 4X50A 4NI3A 4NO2B 3O6KL 5FLVA 2CDGA 1HU8A 5I6LA 4BSJA 3FT4A 2DWSA 5GGRB 1I4FA 1TU2B 4F9LC 3I75A 1B0RB 4NDMA 4AW4A 2UVEA 5DVPA 4GO9A 3TJHC 4D2NA 5FYKU 1HCFX 4F9PC 5EDXA 4HUKB 4ORZC 3VWKA 1QNZL 1K6QL 1IGCH 2BSRB 4IHOA 3NTCL 3UYRL 5BS0D 4PJCE 4ZAKA 3QEUB 2AK1H 3LRSB 3C6LC 3WNNA 4J3VA 2EADA 5IP4A 1P2CA 1KEMH 3VRJB 1BLIA 3RX8A 3LZQA 4MD5B 2A9NH 3ZZ1A 1FNSH 1SBBA 4FE9A 4JM0A 3BUPA 4LLDA 3EOBA 2A74A 1TTRA 1MWAH 5KVFH 2Z35A 3KJ4B 4JCWA 3T8XA 2ZKYA 4FN0A 1HQ4B 1E4JA 1O7DE 25C8H 4NBZB 2AFNA 2EILB 3OGCA 1GXEA 2Z4TA 4M3JA 4NN7C 2WBKA 2XX0A 4PJ7A 4O2EA 3T65A 1F58H 3QJRB 4JDVA 1HNGA 5E6IA 3GXMA 5IVZA 1IV8A 2FNBA 3BH4A 3WFHA 4MNHB 1XCQA 4ZXBA 1IO4C 3BO8A 5E8NA 3ABKB 4FMVA 2WIIA 3PWPD 1WAEA 4ZXBB 4DGVL 3HZYB 3TBVB 2WN3A 2DLIA 2YA0A 3SJVA 4XCCH 1EJ6A 4AI7A 1BVNP 1BQHG 1FGNH 2GSMB 1GY2A 4HHGA 1FORH 4QY8A 2AJVH 3BE1H 3LAFA 5EZOL 3BMVA 1QNZH 3IDYB 1FFOA 3NTCH 3UYRH 3TU6A 2GW5A 3OKEA 1MCHA 2A38A 1MXDA 2EYTB 3KWUA 4DP6X 3E80A 3KR3H 2XPYA 4LNRA 2AXWA 5CZRA 2KT6A 5DCCA 4OVUA 2OCJA 2F58L 3AU1A 3CZLA 5E2JA 4POZD 5F1KC 5DJ0B 3G04A 3MLRL 4HDIA 4KI1A 3VWKB 1E4XH 4YE4H 3A6BL 3SKJH 4A7VA 2BHZA 2VKXA 1E42A 1RHFA 3RWIB 2J4WL 4PRHB 3QORD 4MQTB 4AJVA 3AG1B 4APQA 2CNZA 4OD3H 4Z7OB 2RB8A 5INDB 2QKSA 4N5UA 1CS6A 3CMOH 2OK0H 1FC2D 4J8RB 5ETUA 3UPRA 2BNRD 1CF1A 5DJZA 2IG2L 4M6MH 4R9HA 1DVFB 1NGWB 2XQYA 1YEDB 1CICA 2ZPKL 4FXTA 4JJOA 5IWLA 4GBXD 3HR5B 3ZRSA 2J20A 4UIMB 3TFBA 2ESVD 1I3GL 2Z4QA 5MP6L 1PKQE 2EE0A 4NYLB 4KI5D 3BE1L 2YD7A 3AM8C 3QQNA 1PMYA 4DKEH 4K07A 3TF4A 1TZGH 2IGFL 3SZKC 2PMZA 2BSTA 4NLAA 1KIUB 1R3JA 4KQ3H 5CD5C 1KTDB 5JW3L 5HHOD 2GAZB 3T4AC 5DEFB 5J12C 3RAJL 1DEDA 3P0YH 1DUZB 3WTYA 4GKSB 4XXDB 1XR8A 4XCYB 5TFSL 3PABA 1RZQA 3NABL 2R29A 4OD1H 1AZRA 4EN3D 4XNDA 3WNKA 1INEH 1JGEA 2AI0H 3GK8L 4UB0H 4OLYH 5JPMC 4PGCB 4TRPH 4M61A 3Q2CA 1DHKA 3D18A 5D6CA 4OCYL 3VXSB 1ML0A 1WVZA 2Q3XA 4JRFA 3S2CA 3GBDA 1F6AA 3UADA 1SXZA 4F92B 5MEQB 4GINA 5D72L 2Y7QB 2BSTB 3KLHD 2ZONA 3WHXB 1BXXA 3QEHB 4OLWL 4N87A 1T4WA 1UYWH 1HL4A 1AXIB 5ACMA 5KG9A 2IG2H 5JOFB 3U1SL 5H8DA 3QXDA 4H5SA 3MXWL 4XOCA 5HGDA 4IU2A 3JV6B 4HFUL 1OWRM 1SXNA 1CICB 3IN2A 3P3UA 4MBOA 3SPVB 5BV7H 4FYSA 5C0FA 2FWSA 1DTUA 4XVSH 3PHSA 3RWCB 5IKCB 3FO9A 4ZSOB 3KPTA 3MJ8A 3MRDA 5G5DB 3L13A 2Z31C 2C7UB 5SX4I 2F5BL 4JDTL 4XNAA 4B0MB 3NZHH 2FO4B 2R9HD 1XFPA 3CD4A 2IH3A 1WUNT 5IJKA 1WA1X 2FEEI 5AVVB 2MQ0A 4ISVB 3QEHA 4N86A 5L0QC 2NY2B 3LHPL 5AKTA 4HJ0C 3ETBF 3IF1A 4KTEH 5DJ0A 5I0VA 4PHXA 3QNYA 1B0GA 1QFWH 1DQLL 4DO5A 4TRPL 3CFEB 2HAZA 4U31A 2V3EA 3U25A 4GW1A 4ADGA 5CBEB 4YHOL 3PHOA 1RZJL 3F65A 3H1ZA 3P3YA 5JO5A 4G7VL 4N6RB 2AQ3A 4RQQB 1WZKA 3GSUB 1HHHA 3H7BA 1S3KL 1Q1PA 3FO2B 2WKGA 2EE9A 4ZFOL 3FTUA 4JFYA 4PCYA 4K23H 2BVOA 1OF2B 4GUPA 1EJOL 1BFTA 1WIOA 1JZJA 5GGUA 3FUIA 1GAFL 5H35B 3FQWA 1LE5B 2VLKA 4MJ6A 2YQBA 3AXHA 1G7MA 2Z31A 1R5VA 4X4MA 1U91A 2P9RA 3SKMA 2DPKA 1E9QA 2EO9A 3F84A 2QEJA 2YD2A 4G1EA 4PRIE 3T0EB 3BT0A 4EUPG 1HEZA 5I1LB 3WFHB 2ZX6A 1G6RA 2ZUVA 4HBCH 3RY5A 1XF4B 4Z3JA 5KBKA 5IEHB 3HI1A 1T1YA 4F2ME 2KZKA 4QRSB 4GSXA 1VPOH 3A4DA 1X5AA 2WGNB 1VCBC 3ESPA 1DLFH 4RMQA 4P4KD 1IILE 1TZHA 1K85A 1CD8A 1RZGB 3QFJD 2N0KA 2N7SA 2VDPH 1RZJH 3KYMA 1KBGH 5E99L 4N2DA 2EDBA 1AYOA 5DVNA 3OJMB 5LHDA 3MRNB 4F24A 2ATPA 2PETA 4P9MH 4P5RA 4I0PB 4LP5A 3BWUF 3SBRA 2IH9A 1AS8A 4AUYA 4XI5C 5GS0D 2R69L 5ACZA 1NEZG 5I76A 3PLYA 4K23L 1GGTA 3KPRE 2HUHA 2F15A 3WS6C 2VJXA 4OZ4A 5BRZD 4ODHH 1X5FA 2QHRL 4JPQA 4WVRA 2VAJA 1GOGA 1MNNA 4NQCA 3VSUA 3US1A 3C60C 3WKML 4P5MA 4GG6F 1CLYH 1G9NH 5FFGA 1FO0A 3ENEA 3LKRB 3IMTA 2WBJC 4N8VA 2E27L 2P8LA 4NGHL 5FW6A 4E9WA 2VZVA 1DO6A 2BLFA 1MCDA 3NZ8B 4OQTH 3I85A 1E7UA 1JF1A 4EEEA 5CN2A 1HILA 4ZX4A 3LOWA 1XCQB 2NPLX 3P4LA 1UWEL 3LRGA 2A4CA 4NFCA 5EEUA 3U9PL 3DLQR 3C08H 1SXAA 5IT2L 1A6VH 3O81A 3AS3A 4JRYA 3QA3B 4IGBA 1EZUA 1YUHA 3DUHA 3GHPA 3NRPA 2VR8A 1HOCA 2EC8A 3BVNB 3KLHC 3PY9A 3GRWA 4IU3A 4K3DH 1WE5A 3WKNA 1OSPH 5BMFL 1KJVB 4F57H 3LV3A 3G6AB 3FSZA 3MGTA 1TETL 5D7IB 1UB6B 2FH6A 2V3FA 4YEFA 3UAFA 1Z3RA 3SSGA 4YDMA 1QR1B 2D7MA 4J27A 4IIQC 4UTCA 2I60L 4BQ6A 4WHDA 4KKBD 5SWQB 2V2XB 1XH2A 2CD0A 2PTTB 5GGTA 3QULB 5DMKA 1DBKL 1R3LB 4N2OA 1TT6A 3T3MB 1BYPA 5DJAB 5HI4C 3ATFA 1T0PB 4CMMB 2C9XA 4M1DH 4QI3A 2JB5H 2QPFA 4IGBC 1LEKB 5GRZA 3AUVA 3HMXL 5F1SA 4XBMA 1NSNH 3IDJA 3WO3B 5ANMA 4NUJA 5I2IA 3VXMA 3M7OA 1KMGA 5HDBB 4GT0A 4KUCF 3T4YB 4ACTA 4LOUC 2FBRA 1IBGL 4MAZA 4AG4L 2KLSA 5D8JL 3L7FA 4QRQA 1A9BB 3SDDB 3QIUB 2DI9A 3T6WA 1T89C 1ZV2A 2UWEB 1WFUA 4UCFA 1E2WA 2D7QA 1X5LA 1JV5A 3OAWA 1GHFL 5MI0B 3Q2NA 1G7QA 4FA6A 3EBAA 4JB9H 4AL8L 1MG2C 1AHWC 4JRYB 1PNCA 3FH5A 5IB4B 1HSAB 1M56B 3WXWL 4IOFD 3GJFA 4WWNA 3REWA 2G9HA 4PVMA 1F11A 4XXCA 3EDEA 3CSTA 4LSUL 5DHDA 5EFIA 4K55A 3X1FA 4KV5E 5FO2A 1PJ9A 1DBMH 2MPAL 2YKKA 4BKLB 3P3TA 1ET5A 5HHME 1I9EA 5F96L 4R2GD 1LP9F 4ZXBC 1M2OA 2J72A 3GHBH 4NN5B 2CCVA 2V9RA 3K2UH 4N2HA 4RSYA 4UILH 4YSDA 3STZB 3SE8H 4IBUA 2JCCF 2JB5L 3QIUD 3TEXA 2QBWA 4NQQA 4GB9A 3DETC 1SMOA 3DMMD 4ZUTB 4F9LA 3L95A 3MCYA 4BDVB 3WAJA 1MIML 3OX8A 3IKCA 5TDNA 1JZFA 3S37X 4DETA 4X6CE 3KHOA 2Y06L 2H0EA 5DZNA 3ULSA 1P69B 1G1YA 3O41A 3PGDA 1KBPA 2ZSWA 3KE0A 4LXFA 3BEVB 4XXCC 5ESAB 4WJG3 4DKTA 2LAGB 4ZO6A 2AGJH 4HIEB 1D6EA 2ED6A 1LVEA 2MFNA 3OZ9H 4LLYB 4ZK8A 4QRRA 1I1AD 1RK0A 2UYLA 1Y6MR 4PY7B 1NLDL 3GKZA 3O2DH 1DCEA 1DQJB 1L3NA 2ICWB 4XMXA 3BP6B 4Z3HA 1DJHA 1JWSA 3VWJD 15C8H 3KBFA 2PWFA 3L7FB 1QLEL 4OBSA 2AERT 2AJYL 3M45A 1UWFA 2VQUA 3FT1A 4MVBD 1RZPA 5JORB 4LSUH 3WFDL 4QYOA 2PYFA 3QR2A 1QRKA 4KI5E 3BN9D 1CFQB 3IPEA 1ZPLA 4ONOA 5E8DH 1Z7JA 1CG9B 1OSEA 4R4BB 3ARYA 3GJFK 4LPXA 4C56D 4IOFC 2V2TB 5D6DA 4B50A 1MQKL 1N59B 2FSEA 4BA8A 4K2UH 4U1NB 2AW2A 1VFAB 5MENA 2GTQA 3NIFF 4PLOB 4OSUL 3DX9B 2F8OA 1PG7H 2X7LA 1P84J 2F1EA 4Q4IA 2Q6WB 3V7AG 5IOPA 2A1WL 3DJZA 1UB6A 3FCGA 4ENEC 4F15B 1BP3B 1EAPA 2JKIS 3SEPA 3SOBL 4RETB 5CLYA 3KDMB 4LCWA 1F2QA 3P4MB 4QAMB 4M7KL 4QOKB 1QR4A 5FYKL 3QB7C 1JHTB 2AK4A 1MCJA 1VEPA 3EOTH 1AGBA 1FCCA 1FL5B 1YUHB 2LGNA 4Y5VB 3PV6B 1VKXB 4PJAB 1JG9A 3N41F 2FO4A 12E8L 1FYTB 2H3NB 1KLGA 4DQOL 1A47A 2BIOA 4FXKB 1LO3H 5BVPL 5FO8A 3MLWL 3T6ZA 4ODVH 4ZTEA 5F6HI 1N26A 1VACA 2X2UA 1YN6B 3G5XB 5AAMC 3Q6GL 1WS8A 2W38A 3S48A 4NI6A 2CBMA 3O3AA 4I0PC 1CJYA 4A7GF 2NYKA 1IM9D 2VUOA 3ARGD 3FO9B 4O02B 4PJFB 4BH8A 2VDMB 3MJ6A 5TH2B 4AIXA 3P0GB 5D7JA 5KSUB 5DGQA 4I2XB 3NCYP 4FFVD 4UUJA 4XH2A 3E0GA 5A2AA 4M8VA 3D2TA 1ZTMA 2R29L 1SY6A 3K72B 3SD5A 2UZIH 2MOQA 1XDTT 2ZOOA 2Z91A 2WXFA 3JWNC 1S9WA 2FBOJ 3BCFA 4CKQA 2ATPB 3UTTE 3S7GA 2VLJE 2UXVA 4PYHA 4YZFE 4J6RL 3ZPDA 4YE0A 1GOHA 5KYXA 1UWXK 4KDVA 3VFPB 3NP4A 1KGJA 1HHJA 1RJCA 4DN3H 4PGCA 1LO3L 3EOAB 4NIKB 4AC2A 1D5MB 2VUYA 2P7TB 1A14H 2OMXB 3QJXA 3VI4A 5DD6A 4KX8A 1NMCB 2UY7B 3VI3F 4BWTA 3BJ91 4MZ3A 3K91A 5EOCJ 4N9GB 1AGCA 4WI5A 5FA4B 1MFAH 5D1QB 4DEUA 1UCBL 5F7NC 4ODSL 1VEOA 2PR9A 3FU0A 4OFKA 4OFYA 1RPUA 4MWFA 5MEPA 1LP9B 1CK0L 3LKQB 1MI5E 4Y89A 1R3IL 3MJ9A 2DWXA 3MA9L 3ZDWA 4LCYA 4N28A 2IQAA 5DJ8B 1IAIL 3IDXL 5AW8B 3QFDA 5E6IB 2ZPKH 2WLHA 4OFIA 5EUOA 5ESVB 3V0VB 1EO7A 4YHMH 3IB4A 3O3UN 1UVQB 2VR9A 3MI6A 1GYWA 3X1EA 4QLRA 3CHPA 1BYOA 4HUWB 3ZE2E 4LP4A 2NZ9C 4EUPB 2AJXH 4FG4A 4LF3B 1KCUH 1YY8A 2IGFH 5FGCE 1BJ1H 2CIIA 5HPMA 5GGSB 1FLTX 5KUMA 3RUGA 2EH7H 1RZ8B 4J6RH 3K6SB 5HD8C 4NWTL 4BCYA 2H2SC 4B60A 4KY1H 4HYTB 5GGVL 1SJHB 4TSAH 4PW9A 1WBYA 3G08A 4N3TA 4TN9A 4XNUH 2YAMA 3GLZA 4HVBA 1J86A 2OZ4A 1JNNH 4OD1L 3OKEB 1BF5A 1BGXH 2FSEB 1SM3H 3DK2A 1GS6X 4XN9A 4CC1A 3KEDA 1EA9C 3GK8H 2APVA 3QJTB 3VXNA 5E4OA 3TEZA 3L3GB 2KPWA 1H8NA 3KBPA 2FK9A 3FTSA 3CDGB 4HOMA 4LLUB 1P6FA 1ANUA 3FRPB 2ZZUT 5DJXB 43C9B 1GTNA 2HG0A 2DYPD 1AANA 5ICUA 2NUTB 3X1BA 4HS6B 3TOPA 4Y9GA 5DEZA 1RH8A 5BXFB 3IDXH 3LNEA 1TJMA 4K5PA 5EIIG 2ICWA 5EZIH 35C8L 2R2BA 3FDWA 4P2OC 3UBFA 4ZDHA 2GUOA 4YHIA 2Q76B 4V11A 1OT2A 4OF6A 1DVFC 5I71B 2VDRB 5AVZB 2QGCA 3MLSL 4Z7VB 3VFTB 4FZEL 5ADPH 4UOQA 1NQBA 1NLBL 1YJDC 1J0IA 4BINA 3BO8B 5E8NB 3O41B 2QVTA 1M71B 4ZFOB 1CFNA 1X5MA 4MJJA 4DKAA 3QEQE 1LL1A 3Q05A 2IAAC 1XXFC 2IAND 4ZUSA 1P5UA 1W0WA 1C12B 1N5AA 2ZKHL 4F9PA 1BGXL 1DVFD 1IM3A 1Q94A 1UJ3B 3MV9D 1NIFA 3GRWH 2VN5A 3BISA 4KI5F 4A67A 3LS5H 1XGTA 5L7XH 4IKJA 2J8UA 3UO8B 2OL3L 3DOIA 5DD5H 3O0RH 4Z3FA 3UACA 5GGRA 5HVFB 3PAVA 4R0LB 5DD0L 4NO0D 5DFVD 3D0LA 1BECA 1MCWM 1P4BL 2A4ZA 3ARBB 4G8FB 4KKLC 1OPGH 4P3DB 2EABA 2J57A 3VI3E 3WO4B 1XB8A 3HCVA 4O02A 1HWHB 4MMYB 4XMLL 2EZ0D 2NLJA 4OF8A 5EU6E 3REVB 3MRPB 1O6TA 2DI7A 5DD3L 3FUHA 4ZT1A 4ELMB 1T1ZB 1GAFH 5CZXD 5EEZA 4EZMA 4IRZH 1RK0B 2UYLB 2FLBT 5CR1A 2XWBA 1H15A 1LO0H 3VQ2C 1QWNA 1I8LC 5DUPH 1OAQH 3MLSH 4KK9C 4OQTA 3SHSA 3TNNA 4HMDA 4PWFA 3NEOA 2F61A 2OJZL 1L9SA 3ZSTA 1JL8A 4I1NB 4KO6A 4LPWA 4UQEA 2DRUA 5DMGD 4QXGL 5HYEA 5D1XB 1OAYL 2HJKB 4HG4K 1GPOL 2WXKA 2J43A 4M8QA 3VX0A 4FX5A 1H5BB 4PN6A 3GZQA 1TZOA 4BXVA 1QBMH 1OL0A 4XRCA 4NXSA 3ZKND 4Q0XL 4NRXB 3CBJB 1ADQA 1VERA 2GT9A 3MLTA 3R06A 3UJIL 1IAOB 1WC7B 2WQSA 1YPZF 2ADFL 3MCLH 2KKQA 4NEHB 2B7DT 2CIKB 1MFCH 1T04A 3CZKA 2OYLA 4ICXA 3F01A 1N67A 3OKLA 5HJBA 5F97E 2J1YA 4ZUVA 4U1GC 2R69A 2Q20A 4YC2B 1HI6B 1FO0L 1XSKA 2FJGA 2Y7LA 4MJ4A 4PB0L 2IDQA 5JDSA 2G3MA 1QFWM 3CZGA 3TCTA 2ZTBA 4WI6A 2FQFA 2QR0A 4ZJ9A 2A6IB 3SYQA 2O6CA 2WNWA 1HSAA 2VW6A 3NQKA 4L1SA 3V4VA 1X5HA 1TDQA 2OJZH 1JCKA 2C3VA 5HD8D 4KAQH 4R4BA 4CSTA 2P5EB 3UZEC 2EDOA 2GFBB 3KLLA 5EU6A 3U82B 2A83B 2YGNA 2WGXA 3DECA 3N44F 5EA0H 3L5XH 3FUDA 4G8GA 4J1UB 1N9PA 2N7BA 1PVHA 4XGZB 1R5IB 4HUXB 1QSFE 4NZUH 5TE7L 2Q10A 5E7BA 1NCBH 4QRUB 1TJGL 2V7HB 2KI6A 2XZAH 1KNOA 3JUYA 5ICXA 8PAZA 5IMKB 4XVJL 1CDIA 5I28A 1GJWA 2RACA 3DETD 1SBSH 4BFBD 3IGKA 4O2FA 3L5WB 3EO0A 2XBDA 1ACYH 3N1GC 1MY5A 3UBXG 3GS4A 1OAUH 1FNAA 3PGDB 5J11B 1ONQB 2G0LA 2CR3A 3IGAB 4G72B 4CU8A 5GSVB 3TV3L 4GRLB 4PQXA 4RESB 1DVTA 4K5NA 4L3EA 3AT0A 2OCFD 3GIZH 1G7PA 1CR9H 4YOKA 2OW6A 3MBEA 4PJXF 2YS4A 3SKOB 1I1FB 3APDA 5DUBA 1EV2E 2R9HC 1F02I 3VB9A 3EAKA 4AH2A 5IMLA 3GMOA 4I0CC 2F54A 2J56A 1A3RL 1WEJH 3D05A 3WDJA 4QHLB 4JX0A 3H42H 4M03A 4FQXD 5D4HA 4DERA 1QLEB 4QO1B 3NCXA 5T5FH 1ODUA 4PJAF 2AEPL 4N2KA 2WO2B 4NZUL 3RWGB 4DVBA 4M43L 4IBVA 1H3PH 4JANA 1ZGLP 3ZMRA 3FRPG 3MBEB 3BAIA 5F7MC 3SOTA 3TFKC 3IEAA 1G7PB 1E9OB 1NMAL 3PGFH 4AYFA 2XX1A 3SKOA 3TA3D 1UACH 4TUUA 5CEZH 1XEUA 1PZ5A 4GG8A 2IWGA 4AQEB 3P4NA 1TQTA 3QJZA 2WSKA 3WTXA 3DPDA 2BC4A 4LZKA 1F97A 5HI5C 2H1PH 1FC1A 1JK9A 3ARVA 3B43A 4DZ8B 4GKNB 1QSFA 4OJYA 5TK4A 4JY4A 1N5YH 5I75B 1J1PL 2ZKWA 2VABB 3ZSSA 5I1AB 3QDJA 3K2KA 5E6UB 5MEOA 4F2EA 5AFAA 2K6WA 1OGTA 4Z78B 2PP8A 3RTQB 4RDBA 4ZTOL 5EO1B 4PUBL 1A3RH 1WEJL 3BQVA 1DVZA 5CKAA 1GZQB 3RNQB 1TTGA 1X9RA 2WQWA 3VTTA 3NP3A 5C7XL 5J1TC 3CSGA 4JG0L 4P4KA 4FQLL 3SPHA 1VZIA 1ZHNA 2WBJB 2B9BA 3QUYA 4JKPH 4JHAL 4X6EA 3F7VB 2ROXA 2XHNA 1BOGB 2ZCHH 5EBWB 5B1JA 3DBXA 3H3KA 3OZ9L 4KV5F 3FCSA 4K3HA 2WLYA 4KMQA 5C0RL 4LQFL 3TYGL 3FQWB 1LE5A 5IF0A 3SCMC 2O5ZH 3MV8B 4BGDA 4WFED 3ZMNA 3QXUA 4D9RE 1QLEH 3ZTNH 2DQHH 2W07B 5JIIA 4JZJA 5GRWA 3HS8A 1ZHKA 3RNKB 1TQWA 3PWUB 1N5YL 3ULVF 3R4DA 1TVHA 4WUKL 2VLRA 2QHLA 4LSDA 3R06B 5DC0A 3T2OA 2YEQA 4X6DA 1OGAB 2AMGA 3OXRB 3ZY7A 2PYEA 3RB5A 3KCPB 2YD5A 3I6KB 4QHKI 4G9FD 5INCB 3HOGA 2DQFA 4LEXL 4NAMA 1OHZA 2B08A 2R7EA 3F7QA 4P2AA 5K39B 1S9VB 2BOBA 4GXFA 4Y4FA 3CJJA 2NY3B 5IW1A 1HH6A 2CU9A 1T22B 1L9RA 2DQGL 3ZHDA 4WEEA 4M02A 1LDPH 3H4HA 3EUDA 4NQSA 2ZNXA 2EACA 1IZJA 3T0DA 5FYKH 4RGNE 3WMPA 3NT0A 3MRPA 4FP8L 1GJUA 4FDWA 3RPKA 3L4YA 5IEHA 4M56A 5D2LB 4GUCA 5C0RH 3UYPB 3U6RB 2OMVA 3HJ0A 1P0SE 4C4UA 4CVWA 1W0YT 1T5WB 3OG4B 3O4OB 4UV7L 5EZLA 4BSWB 4Q9CA 1TMQA 5CCGE 4U3XA 5G4OA 1FG9C 1SUJA 3N0AA 4Y16A 4LVHB 3RGHA 3PU7A 4OGXL 1NAMA 4WGWB 4WUKH 1CB4A 4D7BA 2FD6L 3DX4A 4AY0A 4Y5VC 3U9WA 2VSMB 3UO1L 4H8WL 2ADYA 1ETB1 4Q8BA 2BWQA 2A0LD 4P23D 2NNCA 2R2HB 1SVZA 3TP4A 2FX9L 2CA4A 1U8QA 4I88A 4PS4L 1XO8A 3HE6C 1QHPA 3O6FD 1JDDA 4OCXL 3VRIB 4R26L 4EN3B 1JZ3A 2D2CC 3Q0HA 5FYLH 4HIHA 4AGMA 4DN4L 5CINH 4Q58C 3NCEB 3F5WA 1Q9WA 2BOCB 2C9PA 5SWZE 2X3BA 2YK1L 1EUTA 4GKZB 3RGVC 3TIDB 4ZUSB 5I6KA 2HKFL 5GPRA 5GQBA 3CFEA 1YEJL 3EH4B 3UG4A 5KYXB 5HGHB 4JDEB 3MRCB 1E6JL 4TNWK 1J9RA 1KIUA 1EEZB 2AQ1A 3DRTA 4OH2A 2HRPH 5JTWA 2GUOB 4YHIB 3U36A 1KC5H 3S5YA 3OF6D 4OZIA 3FCSB 1OE2A 3PREA 2ALWA 5JW5A 3BUBA 2AXHA 4UQCA 4IW4C 4QDGA 3ULVL 1QYGH 4OR1A 2J88H 3HZYA 3EIFA 2IJ0C 2NXZD 2E0PA 2ZCLL 4P2YA 4FLOA 1DN2A 1RURL 2NUPB 3OLDA 1U58A 1FIGH 4CRPA 3QEGL 1XL6A 3GXTA 1OE3A 2YOAA 1GSKA 2GJ6D 1CGVA 1WT5A 4K15A 3P2BA 5LN4A 1JNJA 2H6UA 3WIFB 5I75C 1AOHA 3OGCB 3B2DC 5JYLA 1ID5I 4FS0A 4M62H 4AEFA 3RTQA 2DQIH 4U2ZA 5JW5B 4J3XA 3O4LA 4JQIH 3U7YH 2F53D 2HFEA 3M17B 4JFZH 4JG1H 5E1AA 1YEGL 4L1TA 4P9HL 1SOSA 3RUGB 4U6HA 3RY4A 2J25A 1CLZL 2ZOWA 3LZLA 1RJZB 3DV6B 3X11A 3JWOC 4FNLH 3WFBL 2HLEB 4P23B 3CN1A 1TQUA 1IUZA 2C9RA 2J1XA 2R0ZH 2W88A 1RJYA 4KDTC 2DIJA 3ECWA 1PFOA 1Y6NR 1RUQL 4HIHB 4OV5B 5IVOA 5ID1B 1KXQE 3VD0A 2WHVA 3CFUA 2ZOTA 3LSOA 1P7QD 2JIXD 4M48L 4ELDA 3S98A 2PABA 2JSFA 4K9EL 1RPQA 3U4KA 1VFBB 2R0LH 1SM3L 3EF7A 4UT6H 5K9KA 4NAJA 7PCYA 1TQBC 2GQHA 3VD4A 3PABB 1QI3A 3QJFB 3PS6A 4BKSC 3X13B 1ES0A 1QPPA 1V3LA 4AGNA 4UT7L 3SYAA 2KC0A 2BVYA 3BT2H 3E6FA 3LIZA 1WA0X 3BLBA 2O30A 1TYRA 1G4RA 1EXUA 1JFHA 1D5MA 2F7IA 3CHOA 4L9LB 5I1DB 4QYOB 3D34A 3HMWH 4ODBD 3K7UA 2BZ7A 3P30H 4H26B 1CGSL 2NXZC 4NZDA 2CH8A 4AX3A 4WGKA 4XPFL 3ZKQD 4XBGB 4M5ZH 4PTTA 1KTBA 2FSDA 5D4JA 4UT9A 3EDKA 1WHPA 3NJJA 1FPTH 3V52L 3GTVA 4L1BA 1MRFL 1BVKB 1N8OE 4N0YL 3TWCL 1WP6A 4H2CA 4X7FC 4Y2OB 3OV6A 4PJBA 4RFEA 4B9IA 4LKCA 1UM4H 3MV7E 1XF5A 3WY1A 5INDA 5FYJH 1HS6A 3O6ML 4G43A 3QJHA 4L1DA 2ICWJ 1WTGT 3CC5B 4WW2F 2CBTA 5KSUA 4NC1E 4N9OB 5DHMC 3RVVD 2GK0A 3FXIC 2ZF9A 5C0AD 2JLLA 3NEXA 1QWUA 4OM0H 5T3XH 1VGEH 5E00B 2BRQA 3TO4A 3AY4A 4HIQA 3GSVA 1U8CB 1SJXA 4HJIA 4JQVA 4AIZB 5LLIC 1QFUH 3CFJA 1BZOA 1NIAA 5F8QC 4M6NH 2R2EB 4M93B 4P2RE 2C3HA 3QZMA 4TVPD 5IVXF 3P3SA 3VXME 1PCSA 4U0RB 3VVVA 2PR4H 3BT2L 3TJEL 4G83A 1VACB 1V10A 3CVHA 1Y18A 4I8DA 3T77A 4HWBA 4RWYL 3ZIMA 1CGSH 4U1IB 5JOPD 4XPFH 3IMUA 5CIPB 2BVQB 4KHXH 3HE6B 1XCXA 4ONGL 1A3LL 1QPKA 2OXHA 3BI9X 3SGJA 2BW4A 2CUMA 2WZPD 5JR1H 1PZDA 3PV6A 1ZLSH 4U49A 4PD4J 1CZ8L 2ICWI 4LKXA 5JHDD 5L88L 1MRDL 1C1EL 3B2VH 3PG2A 1TJHH 4LVHC 3UOAB 3V0DA 5D6DC 4DK6A 3ARUA 3L54A 4U3CA 5KOVC 4YWGH 3OLGA 1WWBX 4QNPF 2H1XA 3OSVA 4D94A 2X6VA 2A99A 2N1KA 1GCFA 3FSOA 4HS3B 5A3ID 5JNYA 4KI5C 2DS4A 4UM9A 2I32A 2W0PA 3JWDH 3SE6A 3NESA 1ZANH 3TIEB 2XKNA 4K94L 1RLWA 3UJIH 3VXMD 5LGJA 4JY4B 5AYUH 2EP6A 3AITA 2ZICA 2FECL 1CG9A 2YFNA 1KB5B 3BZFA 3OF6A 3P02A 3QW9A 3LCYA 2FL5B 4Q9QL 3U30C 4F7KA 1TSHA 2XT1B 1ORQA 4WEBH 3SDAD 4KRNA 2EIBA 4LBEB 4YHLL 3FO0L 4QCIB 2XWTB 2V17H 3PCYA 4PJDA 4RRPG 5DHVB 4LL4A 1UWGH 3X14B 5I1HL 4XWOC 2W8CA 1HNYA 2IPUG 4GG8B 4H88L 3WLBB 1CD1B 4LSVL 5C9JB 1HOCB 3ELAT 2FJUB 5ABZA 1NAMH 1ZAGA 4ZRGA 4XP1H 1UGNA 3QH3A 3VMOA 3CH1A 4P2OB 5TE6L 5KVGE 1C1EH 1DYZA 2HPOA 4Z5RB 2YAOA 1GZPB 1S9YA 1B2YA 2NX5D 3AZUA 2F1BA 1O75A 2HJLA 4G6AC 1YVLA 4UF7C 3BZFB 4U0QB 2A7BA 3EJJX 4YHNB 1XGTB 2QSCH 1BVLB 5KYUA 4BUGA 2E6JA 1LWRA 4I9WD 1R24A 3HC0A 4GJTB 3MCKB 3OMZA 1OTTD 2ENQA 3OC5A 1Q0XH 3L1EA 1A65A 1JZ5A 2C9UA 3APNA 4NJAH 3RIKA 3PWUA 3STZA 2K8QA 1SZNA 3VM5A 3HS0A 2C9VA 3BSZL 3LNFA 4J3BA 2GEEA 3MLYH 3EFDL 4X6FA 2BNQA 1X7QB 2Z8VC 3G6JB 3KLAA 4LCWE 3DVGA 2Y5TB 4GAYB 4OGAD 4R0LC 1KGUA 4MMZC 5TGBB 3MRNA 4HJJH 3QAZC 1BQHA 1MWAA 5HHOB 2RCSL 4EDWH 1JTPA 1AGDB 1BZ7A 5E0FA 1RIVH 1BQRA 3D4CA 4LBEA 4RMRA 2NUTA 5JQ6L 1A7OH 2HH0L 3UTSA 2D4DA 3GBML 4NSKA 5AOLA 4Y1TA 4B9KC 2VC2B 1ZS8A 1Q4NX 2QQNL 4OU3A 1RHHB 4M6OH 2HCZX 3UXFA 2P49B 4C56B 1BM3H 3D39A 3ZVVA 2RR3A 3W9EA 4NKDA 1MHHA 4HG4J 2QT6A 2IFFL 3JXAA 1JBJA 1E9PB 3QRFM 1J87A 3S8GB 4F5CE 3BAWA 4LSPL 3BSZH 2X1WL 2K9FB 4G9FE 4ZMXA 1G7MB 1V05A 5A2FA 5CEZL 3QR0A 5JLZA 3MN8A 4GXVL 3RL1A 3LS4H 2ED9A 5FWQA 3MRFA 1O6SA 4WFHD 3F04A 4LDLB 1OK8A 1ZSHA 2XPZA 2P5ED 4KX9A 3E9TA 1FZKB 5HJ3B 2VXVL 4DEPB 3EJYC 4MB3A 3IJHB 2XQYK 2WCPA 2WXOA 4PJHE 3FH7A 3EYFB 1YNLL 1K9TA 2GITA 1DP0A 2YWZA 4NKQB 3SPJA 1SXBA 1RIVL 3KPRD 2J71A 2NY5C 2ADJB 3FONA 2YAQA 3FTGA 1Q0YH 3VWKC 5HYQA 4MSWB 2IALB 4PRDA 3GBMH 3LN9A 4DKDC 1G87A 5C6WH 2P43B 4JFDD 2E9BA 3MUJA 3L3DA 1OXYA 2MQ3A 5I23A 5FEBA 4JKPL 2WVVA 2AANA 5FGBC 4M8QB 1WV7T 4ODTH 2C1PA 1KB5H 4POZC 1X6NA 2EDTA 1OP5K 4HF5L 4B3VA 2BNRE 3BEWA 3QUGA 4M00A 2A6JB 5KSAA 2CJUH 2IMMA 2YMXH 2HJFB 1DL7H 1CU4H 5D2LF 3V0GA 4ELKB 3WUWB 2D8KA 4GRLA 3ZDYF 4H44C 5CN3A 2OP4H 3NZUA 3WMSA 4J3SA 3KEHA 1JPGA 5DTFB 5BRPA 2ZQKA 1OB0A 2IDSA 4UM8B 1HN1A 3H0TB 4PR5B 1AZVA 2B0SH 2JWYA 1A22B 2WINA 3P3RA 3UYOD 4E5XA 1DLHA 1FN4B 4XNBA 1E4KA 2DQHL 2F19L 2ZD0A 4TUKL 4I0PA 3TPUB 2AV7B 4L4VD 4L8BA 4GG6B 3T3PE 2NY7H 3ML9A 3HE7C 2E9JA 4U6HB 3DJ9A 2UUDH 3ROLA 3TIEA 1ZLDA 1QRNB 1NFDF 2VM3A 4WJ5B 2IANE 5D5MF 4HWEH 3P4OB 1F3JA 2GKIA 4FQHB 4GMTL 2NY5H 4WK2B 1RXLA 2JKTM 1REIA 2XIDA 1Q0YL 1NMBL 5CGYD 3L3KB 3FOMB 3IFPB 4UOZA 1W0WB 2OSLA 4M5SA 4L9DA 1X4ZA 3WNIA 5B22A 1E7VA 1U8IB 4Q6IC 4OI7A 2OMYB 1EFXA 3NQIA 4MNGB 4X6DF 5C0GA 5EU3A 1SQ2N 1FFNA 4ZW6A 4X8CA 1CU4L 4C4KO 3QCVH 1L9MA 4MNGE 4MYPA 3TTYA 5CILL 4WNQB 4H7VA 1GYUA 2Z7WA 2OXGA 2XN9B 5FOJA 1A7QL 1X5ZA 3E7JA 4ZUUB 1F90L 5L6YL 3CHSA 4G71B 1NM4A 1WZLA 4QKXB 5E8EB 5J6HB 4DCQA 1FSKC 4MAYC 3ZTJH 2E7HA 1F4YL 2CO7B 2F7PA 1ND0B 4BQCA 4NHCH 1UUSA 4M1CD 3E1ZA 3VXRA 1PF3A 2DLFH 2QDWA 2I24N 3TCLA 1N59A 2D7OA 5FUZL 3UPCA 5A16B 5IMMB 5BRQA 2VDKL 2UY6B 2ZG3A 5KYYA 2F7OA 2BJML 3C5XA 2CCLA 3QDAA 4FNQA 2V6HA 3NEEA 2IFGA 3DO4A 4R26H 1NMBH 4TOYL 3AM8A 4CMHC 1NOLA 3ZTEA 2KQMA 1MCWW 2UWEF 2B3IA 3ULUC 3BGFC 5T8IA 4F93B 2P5WD 1ZD6A