4KKPA

Crystal structure of vibrio cholerae rbma (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
VIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAQQESDALTDGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
molecule keywords RbmA protein
total genus 45
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkpA01
4KKRA 4BEIA 4BE5A 4KKQA 4BE6A 4KKPA
chains in the Genus database with same CATH superfamily
4URKA 4W9KC 2WBXA 2DMGA 4HPOH 4WFGD 4PJ9A 2FUQA 3QI9C 1RAMA 1S7SA 2OL3B 4AKQA 4BFRA 2UX6A 3QUXC 3TM6A 1GZQA 4S1QL 3FTGB 3VM7A 4NYLB 5L4JA 3EO9L 5IQ9A 4AL8H 2QPEB 1Y18A 4U1NB 2BXYA 4PJCF 5TE6H 4BDVA 1IGFL 4JM2F 4JE4B 1C5CH 4F8NA 4DW2L 3EUUA 2O5ZL 4ZXBA 2GJZA 2NZ9C 2Y0SA 3W39A 4UUJB 2C26A 5I1GH 3CMGA 3D2UD 3GBML 4Z7UF 1WFUA 4J8QA 2P24B 1QKZL 2A4EA 2PPFA 3G5WA 1UQSA 2ADIB 3LKQB 5TFSH 2K70A 5TQ0H 1DQQB 5KVGH 2AK1L 1XSIA 5MEOA 1TYRA 3NYKA 3LMJL 2EZ0C 3NIGE 4LOUC 4GAJL 2XZQL 5IF0A 1FNEB 5BS0B 4FFZH 1GTFA 1LVEA 1A4KA 1NGZA 4ILDA 4LSTH 4APQA 1ZPUA 5F3HB 1T0OA 4JANB 3FU8A 1G4MA 1TVDA 3GMMB 1YNKL 1XV8A 3UZVA 1A6PA 1UJTA 4OD1H 3GMNA 1I3VA 4N24A 3ARFA 1EAPB 3S5LB 4L3ED 1AHWC 4YS4A 3VA2C 4ZD3L 3BAKA 5HHXL 3BPNC 4PI2A 4V1DE 5GGSA 4L29B 1E4JA 3L95A 4JGNA 3CZNA 1SLUA 4YDMA 2EDEA 1K4CB 1NIAA 3FCBA 5D2NA 4XHQA 1E6JH 5F7DB 2BZ7A 4R7XA 1K6QL 1KBWA 1NBYB 3L48A 4P5TC 2V6HA 4RMBA 5JDSB 4PHZA 3FRUB 2R0LH 4HWNA 3UBXA 3K6DA 1T21B 4LPYA 4F37K 1U8HA 2V17L 3ESNA 3OR6B 2BVTA 2YMTA 4Y9GA 5F88A 5D5ME 2HJKB 1MOEA 4HIXL 3SKMA 1G9NC 2ESVD 1JYVA 3LKRA 5A2IH 1DQML 1DVFC 3OGOE 4FQ2L 4CU7A 3KXFD 5HGBA 3HHRB 5D55A 4NP9A 3NSYA 5EUKB 5L8KB 3SB3A 1UZGA 2APSA 1HQ4A 1EEYA 2P52A 3DUHA 4NDMB 4TM9A 4YBQC 2WGXA 4DEUA 2VAAB 1NL0L 4JQIA 3IJYA 2P43B 1X5ZA 2FJHB 4QYOA 1ORSB 5ITBH 1UATA 4Y5XC 2O6CA 2E47A 3B7RL 1I7RA 4LCCB 3TIDB 1J1XL 3O2VH 1KPVA 5AW0B 4EMZA 4BEIA 4IRSC 5HHQA 4IK7A 3PQYB 1Q90A 4LLMB 3TT3L 1CDGA 4P59L 3B6SB 4PJCE 4UINH 3ROOB 1YEFH 1S4IA 3BSGA 5L4FA 3RIKA 1G7IB 3DKHA 1JXJA 2NY5C 4YC2C 1IC5H 3N06B 1DE4A 3H42H 4FI6A 1NGYA 2JK5A 3HRZA 4BKLB 3QS3A 3F83A 1QRNB 1LDSA 3G7TA 2LR4A 1AD0B 1PZ5A 1T7XA 3CDZA 3WKNA 2A2QT 1EAOA 3DUUB 3WUZA 4BFFA 3NTCH 1L7TH 3L3DB 4NO5B 1YY8A 3B5HA 5E1QA 5HI3C 2OR8A 1S7XB 4BBWA 2NXZD 2YD6A 2H3NA 4AQOA 1BECA 1BJMA 5C0JB 5AQ0A 4R4NC 2M2DA 1E40A 2MHAB 1AGDB 3PXLA 5LLIC 2JKRM 1HCYA 4XBGA 1C1EL 3HAEB 1OLZA 5T5NF 3ESMA 4ZXBC 1MNNA 1IM9B 1T0PB 5BRZE 4F7KA 1KXTB 3HBPA 3FT2B 1BBDL 4KDVA 2E7LA 2OS7A 1QPXA 4IRZL 5FYJH 1I3RA 2B2XH 1WGVA 3VXPA 1YEJL 3M86A 1OB1A 5B3NA 1AZBA 1MDAA 2QPUA 3D8MA 4HAGA 4YHNB 3BAXA 5EIQA 4QOKB 3DX0A 5DS8A 5GS1C 3DVIA 4CN6A 1ASQA 3HKZA 3WMSA 5C07E 4KO6A 5IV2B 4JPWH 4HYTB 3MRJA 2YGNA 4NKIH 3CH1A 5BRQA 5T1DH 5T1KD 5I5RA 5E1HB 2JCCF 1OP9A 2KPWA 3HG1B 1KY7A 4WEBL 3NJFA 4ZMQA 3WNOA 3CFBA 3WIFA 5K9JL 1CG9B 2CO6B 2X2JA 4QRAA 3MRQA 1DVTA 5GJSH 5DO2C 3ZL1A 5IGXH 4IDJH 3BKML 4FG6C 3CFMA 3DROB 1HHJB 3SYAA 4MJ6B 3LNHA 4HIEA 2FB4L 3A6OA 2ENPA 3QUZC 1PJ9A 4PFEA 4WJ5B 4Q7DA 1WAAE 2VL5B 4QO1B 2H1PH 1CMOA 3D0LA 1O5DT 2Z8VC 4PB9H 4YDIL 4ZUTB 2FWUA 4Y89A 1UADC 2WLMA 4JB9L 3F12A 2GJ6D 4TUUA 4XMPH 1JJUA 3V5KB 4A67A 1JPFA 1ZK9A 4HC1H 3BKYH 1OCZB 3QUYA 4JZNB 5DRZA 2VZTA 3WFBL 4PGDA 4I77L 2G3NA 3QA3B 12E8L 5LGHH 3L7FB 3O6FD 5CMAA 4JM0A 3UTSA 2WWKT 1KJ2L 4GRLC 1EEZB 3WO4C 4DFIA 1X9RA 4Q9RL 4DP7X 1C5BH 3D34A 4KHTH 2IDCA 3SPIA 1T20A 5CINH 2A73A 5AAPA 3U4KA 3N44F 4M7KL 3DV6A 3B9AA 5F6HI 4LQFL 2WBWB 5F9OL 5J7CC 3LKSB 3RPKA 1KB5L 3TYGH 2EO9A 3SIKA 3BT2L 5DR5L 2VDPB 4E68A 4XMTA 4IRZA 4KNSA 2DEWX 4M1CD 4WJ5A 1OARH 2UVEA 4U6HA 4KKCD 3ISWA 1KIRA 1G9ML 1NSNL 3LRGA 4Y5XA 3W5NA 3V5KA 2W94A 2W65B 4N68A 1E3FA 2X4PA 4N6RA 1WCQA 5C0AD 5E8NA 4GSDH 1G87A 4KTDL 1H6TA 5AB9A 4GO6B 2B4CL 2KC0A 5B21A 5I82A 4Y2DB 2YSTA 5FCUH 2Q3ZA 3UBHA 3II3A 3QYMA 4GT7A 3ARPA 4RQQB 3QJUB 2GY7B 4BWTA 5J06A 3WHE1 4MZIA 1I3GH 4LKXA 4K15A 4G8AC 4YHIA 4G3YL 3BUYB 5F96L 5DZAA 3QUMH 1ZAGA 1U21A 1C5BL 3STZA 5TK2A 4F2FA 2JMRA 1AC6A 3D39A 1OAYH 2B4CC 5AG9A 2HFEB 2OMYA 3HS0A 4LMQE 1QBML 4Q9BA 1XR9B 3IJ7A 4UQ2A 2OQJB 3KPNB 4KC3B 5FV1L 3GPEA 4XE0A 2YBRB 5DJ8A 2Q0ZX 4G7SB 4HUMB 2G3MA 1PPIA 4F15C 5KBLA 1NEPA 2R4RL 2CUAA 3HUJB 4PY8J 5I1LB 2R83A 1DVZA 4GLRH 1OM3H 5DJ6A 5IKCB 3CSTA 4U1GC 3BP4B 3NJHA 4PJBA 3NZ8A 1J0HA 3GZPA 4OSUH 1CFBA 4NRZA 2ITCB 4G7RB 4P5SA 3KWWA 2ADJB 3VI3F 3B34A 3DHUA 4LCCC 4RQQA 2BVEA 4NAQA 4KTEL 3L16A 4NN5C 5F97E 5A6IA 3CFKB 3RVTD 3ECVA 3ME0B 2QDVA 5A2BA 4JG0H 2ZT9C 2X4SB 2FJSA 3GSWB 4QJ3B 2YXWA 1S78C 5CEYB 4XPHL 4HETA 3WTXA 3BWAA 5EO1A 3C60B 2EXYD 1M1XA 3O11B 5FOJA 1AQKL 3GSOA 3QXAB 1CIDA 2OJEB 4WK2B 1JTTA 3PNRB 4GXUM 5IM7A 2HT4C 3TEXA 3GRWL 4N3UA 3VFTB 4CMHC 4QF1A 1QFPA 4N2DA 4YUEL 4NO3B 1BZ9B 1SNRA 3GC3A 4CA4A 2C8NA 3GHPA 1AE6L 3KBEA 3O2DH 2VABA 5JIQA 2E0PA 1X7QA 3LKOA 3JUZA 4LL1A 2PW2B 3G6JF 2B08A 3V0JA 1BAFH 2FTAA 1FBIL 1XH2A 1N0LB 3UAJD 1NANH 2YZ8A 1U95B 2PO6D 1JV2B 2WLKA 5IP4A 1QFOA 4OB5L 4ODVH 3AUVA 3VQMA 4ZFZB 5JYLA 1AR1B 3QIUA 1W0YT 1ZS8B 3AG4B 2H1XA 3VXOB 4X5XB 4H26A 1SEBA 2OMUA 3UZVB 2YPVH 2L7JA 2AI0H 2FQEA 2H26A 5FHBH 4X50A 1D5ZA 2OCFD 4KJWD 4MMYA 1AP2A 1R9FA 4PRPD 5D7KD 1U93A 2ALAA 4ZT1A 5D7JA 1A3ZA 3H3PH 4BM7A 4JO3H 4OM1H 2GSMB 4JE0A 1CLOL 5JXED 3IDGB 5TQ2H 4E9RA 2WN3A 3MSPA 3KW8A 3X14A 1D7FA 1FPTL 2QGDA 1U0QA 1FVCB 1XGYH 2WGNB 1KPRA 4XR8C 4B41A 4BFKA 1K4DB 3HC4L 5DDHB 5C0BB 2D2CC 3HHSB 4UB0L 3FB5A 3Q05A 4G8GA 1RUMH 4Z0BH 4YN3A 2X1XR 2EUXA 3OXSA 2H2SC 1QBLH 1CFSB 3QCTL 4I9WE 4JM2D 4ELMA 3PL6D 1P53A 1CXEA 4I0PD 2JKLA 3VYOA 1TOXA 4HJGA 2V7NB 2NYYC 3DJTA 4RMQA 4KKZA 2H26B 3R8BB 5LXVA 3ARGD 3R1GH 4QTHB 1SXSA 4P2QE 1PKQA 1A9EB 3QUZD 1PZBA 3V4PB 1KCSL 4GP8B 2WBJC 5HGHB 4LOFA 1C5DB 4CSSA 2G5UA 1P7KB 1XDTT 4LOEA 5HHQB 2VWEC 3NN8B 3B9VA 5DWPA 4HLZH 1F58L 1N68A 3HPLA 2AEQH 1DQQA 4HCIA 3WY4A 5I5IA 1HNGA 2NYYD 2X42A 5E5MB 4TVPD 3M1OA 4DN4H 1N67A 2Z7WA 4PV9B 4G9DA 1IFGA 1VGEH 4YDKH 2VR8A 3PWLA 4KXAA 4NQSB 4X0KB 4X98B 5SWZB 1OSPH 5ICZA 2A6IA 3EG9B 4WW2A 1CFSA 2YEVB 3K4DA 4WHYG 2B8OT 3I9GH 5DHVB 3CVDA 1JNNL 2C3XA 4D0CA 5BO0D 2EKSA 2E6JA 4X2UA 1TJMA 2XKUA 4N26A 4AX3A 3KCPA 5KSBA 1FORL 4XBPB 4ZFOB 3FONB 4NCDA 5E6ID 2W9DL 5EBGA 1KEML 4U3SB 3V95A 1ZV9A 2DQJL 2DYPA 2QJDA 2YMXL 2FECI 3U0TB 1MI5D 4D8OA 4WF7A 4U1SA 3IVKA 2IANA 5E2JA 3EJJX 5EN2A 3VA6A 2R2BB 3L6FA 1MRDH 1W91A 5DEFB 3ZE2E 5I8EA 2Y4SA 4W9LC 2QQLL 2TRYA 4J3VA 4LSSL 1NCGA 4B5ZA 3ASNB 5EOCJ 3Q44A 3EYSL 3L9RB 2BO0A 4LDOB 4A7GA 4QHNB 2D9QB 1T2JA 1ZIAA 4IBQA 4Z77B 1U8QB 1YLBB 4N8VA 1AIFB 5T1MB 3I2CL 3LXUX 4C58B 5EHFA 4MHHI 5ILTL 4PJ9B 4LPVA 2AJYH 1JGDB 4WSJA 4YHPB 3WD5L 2PW1B 4GKLA 4OAWB 5DJCA 4PGEA 2H32A 4LRNL 5DUBB 3T3MB 3GT6A 4K23H 1XB6A 3QRBA 3CVIL 1IAIH 3D1MC 3UAEA 1LO2L 3EOTH 2DQCH 4Z7UB 3CX5K 2AJUH 1F6LL 3MMEA 1AI1L 3ECBB 4WI2A 1SXBA 2DQ6A 1UHVA 2A9ML 4Z7QB 3MRPA 5HYSB 4KMTH 1XD0A 3NFNA 1SXNA 3CFBB 3MV9B 4FNRA 3WIFB 3ZXAC 4EVNB 4TNVK 3FT4A 4P0DA 1OGPA 2EDKA 1HL8A 2R1YB 5LG1A 2VC2H 3H4HA 2WXHA 5CJQH 5LKNA 1K8DA 4XCFH 3AT9A 3WCYA 5BJTB 1KZYA 1D5RA 3VI4E 3ZTCC 3IMTA 4LBAA 1DZBA 3RWDB 1JWSB 2VIRB 4WHYH 5I2IA 4R0LC 4LLYA 4XN4A 2VL5A 5BVJA 1GSKA 1YEEL 4UT9L 5GZOC 1S78D 2OV0A 1E27A 1OF2A 3WTWA 1PSKL 1HE8A 5GISL 3GMOA 3O0LA 4ZFOL 1CCZA 1GYCA 5CEZD 1IIIA 1YUKB 3HIZA 4PREA 4BQBA 4GPVA 1D5IL 2R8SH 4GMSL 2Y06L 4P2RE 1BZEA 1ZLUK 2K6WA 3RZCC 1ADQA 3F7LA 3RVVC 1KPUB 4CC0A 4QR7A 4L3EB 2L04A 4IMLA 1NC2A 1E5ZA 1S7WB 2X87A 2I85A 2J5LC 4AUJA 3MRLB 3PPSA 1T22A 4P5TD 2GIXA 1FFPB 2HRLA 5BPPA 2K9UA 3AS3A 4KI5E 3QDJD 1LMIA 3T09A 1FDLH 3BW9A 5L4MA 3QNXB 2KZKA 5IJKC 4XNAA 4OZHE 4ALAL 3DOHA 1F11B 3AG1B 2OW6A 3OZ9L 5BVJB 4G6JL 2ZYSA 2DRUA 4LLYB 5EF2A 2APTA 2G2RA 1XXFC 4OZGF 2NY0D 4U6HB 3TBTA 2WK2A 3DX6A 4NZ8A 2KPNA 4LCWA 2NY1D 3DPBB 3SGKC 4RA0C 5DRXA 1WF5A 2OMZB 3QJFA 5C7XL 1BA9A 2BNUA 3DMMA 4QXGL 3OKNB 1U3HD 5E6RB 2VDOB 3AB0B 2BPBA 1LNUA 1U8PA 2OW7A 1AGBB 2J43A 4WFFD 1IJNA 5D1QB 5KSAD 1BHGA 1OOAA 4QJ5B 1SBSH 3CWGA 1CXHA 4Z23A 1QRKA 2X53A 4OZFH 3W81A 3WAKA 3SGKA 3ZSTA 5I1DB 5IB3B 3CVHL 2Q87A 1DQLH 4R7NB 4NWTL 3ETSA 3KLQA 5JMRA 3PU7A 3BW9B 4UU9B 3IAPA 4JNXA 4UV7L 3IXTB 2UVFA 1OPOA 2CGRH 2F7PA 1CE6B 3P9LA 3D4ZA 3ZHFA 1DQIA 4HALA 1FFOB 5FA4B 1QFWI 2E3VA 4X6DF 4XO9A 2NOYA 1AZUA 4KI5F 2HLFD 2B77A 4YIQB 1CU4L 2WY3B 2IALA 2VZOA 4UOQA 1RZIB 5JXEA 1B0RB 1RZ7L 2QVFB 3Q0HA 3QC5X 4G8EA 1IAII 4MMZA 1JCKA 4EN3B 3Q6FA 1TXKA 2G4GA 1YY8B 3MO1A 3ECUA 3IS0X 1IL1B 4Q9CA 3BGAA 1T2XA 3QIUC 4ZMPA 4PRPA 4L4TB 2E9JA 1CBJA 3MLTA 2EYTA 4EIGB 4G11A 1DBJL 4EIZC 1FLRL 3DHMA 2EDNA 2UYLB 2VLJB 3CFEB 4K73A 2YWZA 3FUNA 4NZUH 1QAWA 4HU8A 1QBBA 1RZ7H 1PNCA 1JDDA 4DKDC 4MX7B 1Z9LA 4DN3L 4XBGB 5TE7H 1AMYA 3MUZ1 3WDIA 3NH7L 3C9NA 3FO2A 4X6EB 5E8PA 3WLBA 5EO1B 1GIGH 1S5IL 2XWEA 4GEJA 4A7QA 4MNQE 2XWXA 3VI4F 2IBZY 3SGEH 1ET8A 3NDZE 4MDRA 5C1MB 2AJ3A 3FBKA 3VE0B 2AS5M 4NHUB 4AW4A 4LHUA 2Z7ZA 4YSEA 4L18A 4NPJA 1B0GB 4P2YA 2FHFA 4MA7H 1F90H 3BP5B 3FT0A 3O6KH 1JHLH 4YFLF 4RAUB 2R0ZL 2RAMA 3WTTA 1N64L 1I31A 4Y4KD 5I66A 2IAND 4RWHA 4PP1D 1EIBA 4XP6H 3L9BA 5IW1B 1FAIL 3ATAA 3HI6L 4DUXA 4H0HB 4OGQC 4PB0H 2QMJA 4HCRH 4KMQA 4AMWA 4GAYB 1SHWA 1JV2A 2ZKWA 3RGVA 1TQCC 5T1DL 3V0GA 2DQIH 3F7PC 5L7XL 2ICEC 1ZKAA 1UB6A 2WWKO 5SX4H 4PRDA 3IGAB 4ABUA 4BSWB 5IMOA 4L8SC 1QSVA 4N2MA 3T65A 3PV6A 4ESKA 1V3KA 3PWPB 4X4ME 1USQA 2NX5A 4FQHA 4CC4C 1XEUA 4P5MB 4E36A 3GK8H 4PJ9D 3VGFA 1ZT1A 2ARWA 2ITDA 4Y5YB 1YAZA 3S3CB 2BIIA 4M56A 3F7VA 3PREA 3H9HA 4LQ1A 4MD5A 2B2XL 3NJLA 3QDMB 3UZEA 3HC0A 5IEHB 5J11B 3TCLB 5FUZL 2AJSL 3FB8B 2FBRA 3P3RA 4WO4A 4Y4HA 1L6PA 3MJ6A 2HPTA 4JFFB 4UUJA 2WWNA 1CDJA 3KYKL 4D8PB 5CHNB 1N59B 4Y8DC 1WEJL 2A6KB 1AGFB 2Y2TA 4LIQL 3MN8A 3WNPA 43CAA 4HBCH 5AAWC 1BQSA 1QVOB 1OTUC 3II1A 4FNPA 4PP2B 4JL2A 5JLZA 5EBWB 3D18A 2ZCLL 3IMWA 2UUDK 4I0PA 4JFOA 4KKLC 4BSVA 3TBBA 4PJCB 1V54B 4I48B 5FW8A 5CM1A 3N41F 4EI5B 3S4SG 3GHEL 4G8GD 4TUOA 1RZFH 5CXPA 4PR5A 4HF5H 5F7EH 4F9PC 4K9EL 4YVNA 4NGHH 4DGYH 3ZDXE 5L88H 1PX8A 2CKBL 5F9OH 4ZFFA 4OQTH 5JQIB 3NK3A 1IAOA 1YC7A 1NCJA 2EDQA 4PVLA 5EFIB 1RZJC 1F86A 3C87A 2ZQKA 1TKWA 4PJGF 1JGIA 1XGUB 4WU5A 2YFOA 4HFUL 3QJOA 3ZKQD 4LO9A 3K6FA 1MY5A 3W9EB 1JPTH 2VQTA 1VESA 1BBDH 3VU2A 2JLPA 1BREA 3IGFA 3BUYA 1NAMB 2ZSVA 3G6DL 4NQEA 1NFDB 4I1RA 5CGTA 4M7ZB 1D5BB 1F4HA 1UM6H 2V7HB 4DVRL 3C5ZD 5HJ3B 3AXLA 4XPGL 3V0VA 4MMZC 2AW2A 5DD3L 5JR1H 3GXIA 4UOW0 3OKDA 3G5YB 5I76A 3I75B 3DX7B 1AIZA 1NCOA 3GDCA 3B3IB 3BH8B 4JKKA 2K6YA 1EQWA 3TWCL 1JD7A 4ANWA 4KK5C 4JMNA 1LDPH 3G6JA 4IKIA 5LNEA 1DLHB 2GUOA 2YAFA 4E41D 3IVKB 3EJYD 2EYSB 4U2YA 5AW9B 2VDQH 1C8QA 1DVFA 2PCPA 2EVJA 3UDWC 1PLCA 4JO2L 1HEJC 5DLMH 4XRCA 3AS0A 4PYHA 5DHMC 4OFVA 4GG8A 5I24A 3RP1A 5JPNA 4IIQC 4WNQB 2GABA 2DYPD 5D2NC 4N9GA 1IVLA 3EO1B 3N55A 3F7YB 2NQDA 2GITA 2ZCLH 4C8XA 4NHCL 3BT2H 2F08A 5DR5H 3NG5A 2D3LA 1KMGA 3QEUB 5AKTA 2EUVA 4Y1AB 2XYCA 4WFED 3C5ZB 5IMMB 2ITEA 4NCC2 1PGRB 2E8ZA 1U58A 1LNUB 1U8PB 1SOSA 2A9DA 5D1QA 1GZPA 1SQ2N 5C0AB 4J4PD 2OSLB 2D7MA 2FIKB 5DEJA 1PKQB 3CC1A 4LL4A 3TFBA 3T8VA 3MV9A 4EVNA 4YSTA 2O5XL 2X1PA 3RKPA 2QGCA 3LB6C 4NNYA 4BQ8A 4HWZA 4FQXD 4MB5A 4QRQB 2AXFA 2I9LA 1W80A 2HKFH 2NDGA 3L13A 4WEEA 3CHRA 5E5LA 4WQOA 1AZNA 1NH6A 1LO3L 2NY5L 5JPNB 1T0MA 1HH6B 1INQB 5MHSD 5I6PA 1BAFL 3OKEB 3AXIA 1D7CA 2VZVA 1N3NB 1KIQB 5ESQB 4MD4A 4K07A 4XPBL 3VXQB 2CUHA 4WDIB 5F8QC 1MHEB 4BWWA 3O81A 2NCEA 2VISA 1PG7X 1KGCD 3IF1A 1A4BA 3OMNB 4FKHA 3WEXA 1E5BA 4ZX3A 3FO1A 2VZ3A 5EU4A 4I2XA 3SDAB 3QR0A 4ODXA 2JF1A 4DOHE 1SHMA 3VXUD 1LE9A 3IDNB 1Q1JH 4ZPVB 1ICTA 1S9YA 4OGXL 5F7LB 5ID0B 2KYIA 2NY3B 5FK9B 5D2NE 3MNMA 1G6VK 1CGXA 4R4FL 1LEGB 4JDEB 4OJCA 3SKNA 1NCCL 2GT9A 1AO7D 1IU1A 1X6LA 5FOBB 3T4AC 3OKEA 3T0ED 3UTPE 5BUGA 2WXIA 3G9AB 3MV11 1RL1A 1TTFA 1CZ8L 4UYQA 3KLHC 5I0VA 1A7NL 2FIRT 4NC2B 6PCYA 4PJHB 2PKDA 2BP8B 2VDLL 4TLUA 4BZ1L 1TPXB 3U9UA 2WIMA 2J57A 3O6LL 4TVPE 2GY5A 5TDPA 3I84A 4HIJB 4OLZH 4XNUL 4JLRB 2H41A 3HG1D 3RQ3A 4KK9D 3S35X 3GS4A 5AW5B 2BZDA 3OAZK 2E27L 5EZJB 3RNKA 4H1LB 4YUEH 1YAIA 2PPDA 1F3RB 1V7MH 3K8MA 1NFIA 1HXMA 3VXMB 4AC2A 3NGBC 1K85A 1INDL 1NBQA 1PF3A 5FHAH 1P1ZA 2AQTA 4V1DA 1KBGH 2J8UB 4JM4H 1LQBC 4QRPB 3CN3A 4YEEA 2GK0A 2XRAL 2ZP8A 4AJ0A 4A55A 5IHUH 1GJWA 3HS0C 2IV8A 3I6LE 1KFAH 1J0JA 4LCYB 4N2FA 3ERXA 4X0KA 4YSOA 4MMXA 3NQKA 2IWGA 3LEYL 5D70L 3QYNA 5L88L 1RVFL 3MRFA 1OP3H 1MFCH 1WBZA 4XP4L 3TA3C 1H8LA 1OGAA 2F58H 1QWNA 4BUQA 3D39B 3IYLW 3B4NA 5T1JA 2IQAA 4N28A 1T04B 4ZMYA 1E4WH 1KJ2B 2IAMB 2P8MA 1OD7A 5FYKH 2PP8A 4PRPB 1KWGA 5J1TC 2XBZA 3KYOB 2AI0L 5DD6A 4GRWH 4ZW5A 3VWKD 2PWHA 5T1LB 5TDPB 3WBDA 3CCHA 1V3MA 4YXHL 3WGUB 3EF7A 1J5IA 4Z7OF 3H1ZA 1QVOA 5D1XE 3BKCL 5JHDE 1JGEB 1JAEA 4UT9A 4E9YA 4JO5A 2B20A 3L4WA 4HK3J 2WLIB 5L2KE 1E67A 4GXVH 2BWIA 1MHHB 5GS3A 5INDA 3I6GB 4KRPD 2NSQA 4IGBD 3FFCB 1L6XA 3TS8A 4LRIC 1E8XA 4D0BA 5IQ7H 4Y9CA 3BVXA 1F2QA 1MHPH 1CZ8H 2L7EA 5DI8B 2Z7UA 3GJFB 4K94H 4UDUA 2BHUA 4R0LA 4TQEL 4QCIA 3BSZL 5F71A 4WWKD 5EC2A 4M61B 3UXFA 2G0LA 4G43B 1I1RA 2UXVA 1A9VA 4HH9B 1CFQA 3PNWA 4PB9L 4YDIH 4X9YA 4K0OA 3MJ8A 4GI6A 2EAEA 1A6VH 2QT6A 4MD0B 3UYRH 3P2TA 4BA8A 4PD4J 3VXTB 5A3IC 3OR7B 2H8PA 3NCYP 5C0AE 4G6FB 2GG1A 3X3FL 3FPXA 4X5WA 1BZ9A 5IMKA 3RVWC 5IESL 3JVGA 2UY7A 3MRHB 4AITA 2G5BB 2DBLL 3OJVC 1JK9B 3UTQB 3DJZA 4W1TA 2ZXAA 4J6RL 1KCUL 4LLQA 5HYIA 1RERA 3TNNB 2CM5A 4Z5RB 2LAAA 5CNHA 3ZR5A 1JZJA 2VGLM 4F37F 3GMOB 4XH2A 5DU7A 4IJ3C 4C56E 2Y5EA 2AJYL 3C6LA 3CFCL 4JFFA 4TQEH 3TCXA 3OHXA 5CEZH 2XWTB 1MAKA 2UXGA 3V9FA 3BHBB 3BP6B 2HKAA 1IAIL 1NDGA 1FYTA 3CLFL 2O5ZH 4HD5A 5DMJB 5FLUA 3TA3D 4LSVL 2JLLA 3T8XB 1R5VA 3HNSL 2YPLB 3MACL 1KXQE 5HVGB 1A0QL 3D18B 3JQOB 4JFOB 4GFXA 2ICEA 3CQQA 4QKTA 4QHUB 1N9PA 3RU8L 5JW4M 1ED3B 5KJRL 4ZXBB 4R7LA 4M93B 1I1YB 3I2CH 4KKCC 3SYCA 4HC1A 1UVQA 1FLTX 4MZ2A 1UM4H 3ZMNA 3I02A 4FXKC 3EYSH 1D9KD 3TNNA 1J8HE 3MR9B 4J6RH 3BCFA 5DZLA 1ZS2A 4FS0A 5AFAA 1GSMA 3MNDA 2CMRH 3MRBA 4MA1C 4PI0A 1XB8A 3IGUA 5GIRA 4AYDC 4K3DL 1Q1JL 5KVDE 3BYTA 2JK5B 5K39A 3H55A 1LXMA 3ZE1F 3BHBA 2VLKA 4HWBA 4FL4B 4LEOB 1Y7VA 3FU0A 1BVLA 4OQTA 2GBVA 2GBUA 2X4NA 4LLDB 2GAZA 3WUWB 5F7UA 4QXGH 3ARBA 5HYJD 3S98A 3UEQA 1S7XA 1FH5L 2VMFA 1DTUA 2X6AA 2X7LA 4AYEC 4HFWB 1NL0H 1U2CA 3CDCA 1A7PH 1EZUA 3OX8A 3KGTA 1ZEAH 5FHBL 4O9HH 1J10A 3AXLB 3RWEB 1A0QH 4WKZB 2MNWA 4PLJD 5IBTH 1A64A 4D2NA 4TV3A 5C0DA 2H45A 3W11C 3F84A 5BOPA 4DH2A 4H8VA 1OLLA 1X4YA 5DQ9B 5IFAL 1KXTA 2ZOTA 2X9XA 2UXFA 2W0FA 3GGWB 3TONA 2DJUA 3T1WA 2EXSA 3MKGA 1MSPA 4K2UL 5MEPB 4AV4A 1EH9A 4MD5B 3DETD 3FZUD 3V4VH 1HC1A 4ELKB 4TTGA 1AXTH 1Y6KR 5EDSA 1C12B 2COVD 3DMMC 4Z3IA 5ICZB 1CVRA 4A2DA 1QRND 1AC0A 1U30A 2R2HB 4GUPA 4JQVA 3E9TA 4XRCB 2G60L 4L37A 2B1HL 3ZKSD 1MIML 2EYTB 1KTLA 3HFMH 3QZPA 1D5IH 1MELA 3QARA 3ARBB 2YFNA 4MKMA 4U4IA 4F7PA 2R8SL 1QHOA 2I60H 2A6KA 3HE7B 1BVLB 4HX1A 4WWKA 2EIZB 3KR3H 1IM3D 4QHMB 4NP4H 2H5UA 2Z31C 4JFYB 4ZUWB 3MRCB 2N59A 3QPXL 3QZWG 2RBLA 1RVFH 3NSDA 1I7ZA 2XVKA 4YHKL 4LLUA 1RULL 5A40E 4N86A 3RVXC 3PQYA 5D2LA 5H4YA 4ZD3H 1QNZH 2J8HA 1QUNA 3KPQA 5H2BB 3RZCA 1X4XA 4MJ6A 2HWZH 3GSNL 5GGRB 1DANT 2MCG1 4LHUB 5EWIL 4WGKA 4JKPH 5CGMA 4B96A 4MNGE 4JFHE 3SJVE 5ICYB 1YYMH 4G6KL 4IOIB 1FNEA 5KUMA 5BS0A 5KANI 1RI8A 3L6FB 5M94B 5C7XH 1S9VB 1T89C 1UA6L 3BGMB 2WVSA 3O6MH 2BNQD 2CDFA 5MENE 2AV1A 2OFQA 3WHXB 3JTTA 5E2VH 4XVUC 2YXFA 3L54A 3ARFB 4G70B 3BYYA 3SJVD 3JV0A 2H3NB 3T2OA 4GUOA 2L4OA 4GIPD 3MLYH 2B59A 3ZE0E 3T2QA 3CIQA 4LPCA 3NZHH 2DF3A 1RV6X 1T04A 2FAUA 3RZCB 3SPVA 4YPGB 3B3IA 3BH8A 4Y16B 4Y4FB 4ZQTA 3H9SE 2APBA 3LZRA 3ZBMA 1AYRA 1R47A 3NA9L 3W37A 3P4LA 2X6UA 5C71A 2X40A 3QFJE 3P3TA 4XVTH 3ZK0A 3B9KB 2HWZL 4HGWB 4OCNC 3UTTD 4GAFB 4DGIL 3FQWA 1SFDA 4XXDA 4GKSA 1UJ3B 1O7DE 2O6PA 3K3QA 3NFPB 4MFHA 1SJVA 1M6OB 5D93B 5E6ZA 1WAPA 4KK8D 4TLKA 5F7MC 1S9VA 3EJSA 2R29L 4NC1E 4XC1H 4NKDB 1BLNA 4QXVA 4OJDH 4M1GL 4DK6A 1LO5A 4XNDA 5DEGA 1YUHA 2F7RA 1OAZL 3HE6A 4Z1PA 2H6PA 2FJHA 3DLQR 1QZ1A 1ZXQA 1E7VA 4CILA 3VGDA 4AQ1A 4XAWH 3LVEA 3GJFA 5CGYD 1U3NA 2FGWL 3O41B 2Y3AA 5T8IA 3VRLF 3F01A 1SY6A 1EEQA 3MRNB 2F54A 3NQIA 4XBEL 1AS6A 4MXWL 2WLNA 1CWVA 2AXJA 4JDZB 1PLGL 4PJGB 4PR5B 5IHWA 2VMCA 2XPGA 1MVUB 4OZ4A 1OAQL 2XWZA 4JGMA 1REIA 5MEQB 2FX8H 4JLRA 4AXWB 4W9DC 3QW9A 1RXLA 2XPYA 1ZIBA 4OQ1A 1FO0H 4LRIA 4TOYL 5EUOB 2CRIA 4LSVH 4XXDB 1CDHA 3ES6A 3EH2A 4MAUH 5I18H 1F97A 2YUWA 4NNYB 4WUUE 2F68X 3F00A 1TZ8A 4FZ8H 4F5CA 3PWUA 3GBLA 3E8UL 4X9FA 4I0CC 3VFNB 1F02I 4J5VA 3R0MA 4NRZB 1Q94B 3H6AA 3MBEC 2JKNA 3P0YL 1NICA 5AKRA 1F0LA 3PWVA 1T03L 2DH2A 4H8WC 5HYFA 4GMSH 1G1CA 4WEUD 1A3QA 2JKWA 3K80A 2X2IA 2NT0A 4XT1C 2X70B 5F6IC 3IE9A 5DK3A 5E2WH 2HJLB 3B9EA 3FPYA 4AC4A 2Z4QB 3MJ7B 5A2CA 1J9SA 3L2NA 1QSFE 3MUGA 4N2BA 1ZY9A 2V5YA 1A7RH 3PDGA 2NZ9D 1JWMB 2DQMA 4J4PA 3FQXB 4P2QA 2E56A 4PJIA 2Y2YA 5JMOC 3ABZA 4XXWC 1R3JB 2IXQA 2BNQB 5HVFB 1HKFA 3DUSA 4FI7A 3FQNB 4WHTA 2VR5A 2BSEA 4JPKL 4QXTB 5DA4A 3HTLX 1VFMA 1KTRL 3BISA 2UYLA 4YSQA 3BIKA 5K9OA 3QAZC 4F58L 1M05B 1MF2H 5EU6A 3NMEA 4RGMB 5E5RB 3W9DB 1IGML 4NNPL 3GSQA 2PPCA 3ROLA 3O3BB 3KPMB 5DK2A 4EN3A 1QNIA 3GMLB 4ZX6A 2Y1YA 3SKJH 1A21A 1U8OB 4AL8L 3K8LA 1CQYA 2Q7YA 1L0PA 2OR7A 1CICB 1GOHA 3KHQA 4EZMA 2YGPA 3N40P 5IHZB 3RHWF 1SMOA 3TJEL 4CNIA 4YO0B 4YSRA 2GTZB 4R97B 3VFRB 1G94A 4V2BA 8FABA 4XPTH 2YAEA 3QQNA 4H8HA 3EYFA 5JIMA 1ZVYA 1KGCE 5AALA 5EZIH 1F6FB 2FL5B 2WNWA 3VI4A 4HWBH 1Q0XL 2XN9A 5JXAL 5DQ9A 3SQOL 3RWGB 3MQIA 3FQNA 4ZUVA 3I50L 3TV8A 2V5TA 3MOBH 4ZZKA 1XH3B 5J11C 4BFJA 3OHMB 1ZK5A 5C6TL 1A02N 1M05A 5EU6B 1NMCB 2E7MA 4JRXB 2ORBH 1NGPL 1RUAL 1IQDA 4B9GA 3BWAB 3RHWK 2PYFB 4UT7L 3T0EE 3FFCD 3HE7A 2V7NA 3HLAA 3QEGH 3GMPB 3GWJA 2H9GA 2ZXEB 4XAKE 4MJ5A 4X99A 4F57H 1LE9B 3EYQC 2YPVL 2V9UA 3O6FB 4I5BB 1DUYA 1RK0A 2CA4A 5DQDH 2DAVA 5I1KL 4DVBA 4FNLH 3U4EB 3X17A 5SV3A 8FABB 1BZDA 1FSKC 3VXUA 3RA7L 1P84K 2XA8L 1IAKA 3R0NA 1NKRA 5TD4A 1NEZG 4LLUB 4FTVB 3CN1A 4KI1A 3L3KA 5GS0C 2HSIA 1WFTA 1N59A 1P4BL 4JPKH 1NFDE 3TN0B 2CE6A 3VFGL 4PMEA 2AJXL 1W72H 1KYFA 4LK4A 3MV7E 4Y1AD 3F65A 1NKGA 5EO9B 3BXNA 3DBXA 4NNPH 3FUJA 1AXIB 1UZ8A 4KY2A 5KEZA 4PRHA 3FXIC 3WI9A 3PWNB 4Z7WB 4HK0B 2HH0H 3K2UH 5IQ9B 1R5WA 3VACA 3MJ9H 3VWJB 5ACZB 3CXHJ 4KJPC 3FONA 1RK0B 2IV9A 43CAB 4NBXB 5FF6B 1VEMA 4N4YB 5I17A 1CE1L 3LV3A 3ZDYE 4IU2A 2IADA 1DYZA 1FE8H 3VD2A 3AU0A 3NBNA 3VXUB 2OJZL 3DYMA 2ICWA 4MQTB 5LXGH 1YDPB 2Z8SA 2I27N 4ABQA 4QRPD 4S11A 4KZDH 3KGSA 5A6LA 4G1EB 1CLZH 4MMXB 4Q14A 3SYOA 5TDNB 1E9OA 1OWWA 2H0EA 4ZMNA 5JHBA 1UOKA 4DKTA 1TQSA 5E4AA 4NI3A 1T7WA 4B3VA 5AYUH 1TR7A 2YSSB 5EO9A 1Q9KA 1M6OA 4FFTA 4HV8B 1T5WA 4NNXB 3C6LB 4DHLA 3AFLA 2FWLB 4OCXL 1DDTA 1G7JB 3RAJH 5DFAA 3SE6A 3VWJA 3DOSB 2XU9A 4YDJB 2FD6H 2QADB 5DJ2B 5EEVA 2Y7MA 1X5IA 4N85A 2WLIA 2P8PB 3ML9A 2N0KA 2A6DB 4WSGA 5E94B 1K4CA 3HI5H 4LVNB 4U3HA 4YHMH 3EO0B 1C9SA 1KC5H 3W0WB 3UJTL 3K72B 1QFUL 1JSYA 4L3CA 5KS9B 2Y5TB 4L0PB 4HLZG 4NIKB 2VLJD 1QBLL 2AK4A 5BQ7A 2D03H 5MERA 1PZ3A 1TU2A 2V8MA 1I3UA 4G9DB 3IDMA 2XG4B 5C6PB 1TETH 1EDHA 5ES4B 2GJPA 4OFYD 1M2VB 3WJLC 2YD2A 5EC2B 1A7RL 2IGFH 3JTSB 4LFHG 4MGXA 4BINA 1XGYL 3O3AA 2DQJH 3LSOB 5C0GA 2VKWA 4I1PA 5DMGC 4TTDC 1NAML 2NCMA 4NT6A 4YHZL 2PPEA 2BNRD 4QDGA 4B3EA 2EH7H 3DJSA 3O2WH 4NZJA 5TQ2L 4NZRH 3BDYL 2D03L 3ML8A 3NFSH 5SWSA 3MZTA 2DS4A 3FB6B 1PX4A 3HN5A 2WQ8A 4OSUL 1UD6A 1SXZA 4PJ8A 1OAKL 3KH4A 4M8RA 5DVOA 4XCYA 5DCCA 3BQUC 3MNZA 3TC9A 4KK6D 4KQ4L 5LQBH 4U6YA 3GZOA 2QKIB 5LNDA 1NBZB 2I32A 4WNSA 4YDVA 3ORJA 4TMPA 2ZJSL 2NLJB 1OQOA 5ESVA 5EPMB 3CLFH 1K4DA 4HCRA 2HKHL 4HAFA 6FABL 1I1FB 3FFDA 2FZ3B 5FKAA 1AD0A 3LQZA 2YUXA 1NUFA 1FFTB 2VCOA 4HMEA 1F00I 5FPIA 3QDGE 5D7IF 3TBSB 4M5YL 1UH2A 3SE8L 5AVZB 3K2IA 4I3RL 2AQNA 3HOGA 2CGZA 3CSYA 4HCGA 3FQ2A 3QCTH 2H2PD 2ITFA 2MHAA 3L4VA 2ZWNA 4K7FA 4RMRA 5BV7H 2OKMA 1GH7A 1UACL 3QDJB 2KI6A 5ECJE 1J0IA 3H2WA 4JJHA 2B7DT 5I8CB 3T77B 2W91A 4MNQA 3RYMA 2YQGA 1B6UA 4P4KB 2RALA 5AUMB 4D9RE 4N90E 3WEXB 3T5WA 4FMVA 2DEXX 3GXMA 3WFZA 4AXWA 4R7VA 5IHZA 4S1RL 1Y0LA 3W11D 2GI7A 2K78A 3EGXA 5K39B 3FCSA 3X13B 4BFIA 5ISZB 1OF2B 3TESA 4M02A 1Y1DA 1G9NL 3KBHE 1I8KB 1WITA 2ERJB 3BX7C 3PJNA 2F54E 4URTB 3F7KA 2LGNA 2WNKA 3GD1C 2F53E 4U1IB 1LEGA 1OP4A 1ML0A 3RDTD 4ODTH 5A2FA 3A6CL 1RLWA 4PREB 4M5YH 5EBLB 1MCPH 3C08H 4X5QA 4ZOCA 4PJDA 5IQNA 4PRIB 4XP9L 4P5RA 5DK0B 4B97A 3GXPA 1GCYA 4M62H 2FEJA 3QWOA 4XMWA 3V4PL 3ZRFC 5FYJE 2DJ4A 3N1FC 3DGGA 3CN2A 1WZKA 1U8KA 1CDUA 1HK6A 2WVUA 1T22B 2BDNL 2OMTB 1SM3L 2HRPH 1UURA 2J8UA 3NABH 5D7LE 1J5OH 4BD4A 4AW7A 3QEQA 4LAQH 5JXEC 4P4KA 4NO0A 3ZDZB 4J1UA 4KWUA 4QHNA 4R4FH 3CZFB 4GBXC 1HHGB 1SJEA 2QQLH 3US9A 2WXMA 4OLXH 3TURA 1CXLA 5HJBA 2D7TH 2YBRA 3P3UA 2VRKA 2QQNH 4NQDE 1A3RL 4C47A 1MREL 1S7RA 3PDDA 4GXUN 1R3KB 1N5AB 2OJZH 4K3EH 4ECNA 4JDVA 4MQXC 4CSPA 1GY2A 1MZYA 4OH2A 2FHBA 1AVAA 1BLIA 3OV6A 5AVYB 1S7UA 4ODHL 3OC5A 1WFMA 3JSSA 4APQD 5KJ7E 2XN9E 2X4RB 3KLAA 3F85A 1PLAA 5F93C 4GG6B 1UZ8B 4WK4B 2ZD0A 3K81A 3PIQB 3U2IA 1GHFL 4L4VE 5C3TA 3WYRA 1F3DH 4L8BA 3SCMC 2ARJQ 2M83A 2ZKHL 4HK0A 1MI5B 4RRPG 5EIIG 5TE7L 1J5OL 2IPKA 3ARFC 1XF1A 4OZGE 4UM9A 5DD6B 3LD8C 4IRJB 4ABWA 1ZGLP 4YSCA 1YG9A 3QQDB 3LMJH 1OY3B 2UZXA 5EUOA 2X6VA 3MV9E 1CTNA 3BFOA 3HMXA 3PJSB 3GBDA 4FQCL 1R3HB 4WI3A 2N7AA 3B2MA 4KVCH 5ETUB 2QR0B 1DCLA 2FX7H 5GQBA 4A7SA 1DSFL 1MHCB 1WZ1L 2EC9T 2VSMB 1C8PA 4W9EC 4L29A 4XMKL 4NM4L 3TCLA 3P9WB 5SX5H 2R9HC 4KKAC 3VI4B 2BSRA 4AMKL 4BV1A 1NCWH 3TVMA 3SE4A 1YMHB 2WZPD 1ZSDA 2H7WA 4L3AA 2EIMB 3HB3B 1JE6A 3DHJA 3QFJD 4JFEA 4LCIH 4ACPA 4IKJA 5JA8B 3D69A 4M8VA 4EDWL 4ZMLA 1LO0H 4A68A 4XCCH 3VXTA 3VXQA 1HCZA 3KLAB 3CFEA 3M1CA 2VDRB 1ZEAL 4KXDA 3MX0A 4AEHH 4HHGA 4NN6B 3ZE2F 4I18C 1NCDL 4PJ7E 3CVBA 4FQQB 3B5TA 4JRYE 3G08B 4GT0A 2PYFA 2OZ4H 4KKQA 3LPWA 5TH2A 1RFDL 2MRYA 4LP8A 4LSDA 3OB0K 4IRJA 4M4RB 3CK0H 1ID2A 3GUFA 4NZRL 1KYOK 5C86A 4IGBC 1V10A 2R0ZH 2RHEA 4F8LA 4ZFFB 1MHCA 4LE8A 2OP4H 4LCWB 1ZSHA 4KITB 5IMKB 1GA2A 1J9TA 5B1BB 2GJZB 2DI8A 3BP5A 3IFLL 3OD3A 1BXUA 1R3JA 3SQRA 4L1BA 1E65A 1MIMH 1EVTC 1U8IB 4JQXC 2O6FA 3OAYK 1YMHA 4R5TA 5IVXF 1MH5A 1T1XA 3BWUF 4L3CB 5KS9A 4DQOL 1AACA 1RP9A 3BIKB 2ZOLA 1JHTB 2A6JA 5LB1A 4A2LA 3ARDA 1TJGH 2G5RA 2XTJB 4Z7VB 1MW3A 1HXKA 2R2CA 2C4XA 4F1ZA 3QGVA 4RGNE 5B7MA 1EFXA 2HKHH 4Y2LA 1FNHA 2W0LA 1NFDA 3HRZB 4BKLA 2DYSB 2HUEA 3NCEB 4FN0A 4KZEL 1HH9A 5JA9A 1K9TA 4U3XA 3LNFA 3ILPA 5D1QE 4GY4A 3CH8A 4MBOA 3P9LB 3NPSC 2D0GA 4K3JL 1OTTC 2KZBA 4XMLH 1GKEA 5F7NC 4DGVL 5DC9B 2K4WA 5LG6A 2QHRL 3DARA 5K69A 1FN4B 3ISYA 1BOGB 4S0TD 4HXAH 3BPCA 4YR6B 3GRBA 4PJ8B 3FTXA 3T8MA 4NN7B 3Q6FB 4QHUA 2VMJA 3HFFA 3ZTNL 4BH8A 2K45A 4CN1A 2DIBA 4KAQH 5HHME 5T3XH 5F6IB 1G9EA 2PPAA 2NX5E 2BFGA 1YSOA 3IDXL 5JPNC 4IBUA 3OKKA 5IQMA 4UQ3B 1AGFA 3S5YA 4AGQA 3DK2A 1LP9B 4LBEA 3T71A 4RBPH 1V7NH 3S48A 5IBLD 5JOFA 4MCYA 2XFGB 1SEBB 4FQLH 3QH3A 4I7ZC 1PIFA 2P46B 4O02L 4R6UA 1XCWA 3U82B 4YDZA 5D4IA 3VXOA 4OF7A 1ONQB 1UCBH 5HDRA 2YAHA 4G83A 4NYLA 1WP6A 3TZVB 2QZQA 3QFDA 1G7LA 1NOAA 2OSWA 1PLBA 5J12C 2GEEA 3AACA 3B2UD 3OB0H 4ODWB 3BPCB 5AOLA 4YR6A 3WKQA 2JIXD 2HFGL 2W59A 2ISDA 4AIZA 5C8JB 2J8UE 2WQWA 2P8PA 5KYYA 3D30A 3PWJA 2CJUL 5KSUA 3MOQA 1MLBB 5I8CA 3WFCH 2Z1PA 4RIRA 5E9DD 4LSUH 4NXKA 4ELME 2VH5L 3G6DH 3TEUA 1IIKA 4NZFA 4TKWA 3X14B 4DQOH 2VLLB 1SJHB 3UC2A 2IPUK 4L48A 2EKJA 3PUUA 3QIBD 3EGXB 3Q2CA 4MCYB 3TPUB 4G8GB 2GB2A 4X6CB 3SDCC 4KNTA 3ETTA 1IFRA 2VDPL 3PWNA 1MHEA 4MYWB 4LT7A 5F3BB 3KPQB 2KQNA 2W92A 1EAPA 2ROYA 3S5LA 3VNYA 3R06B 4JK0D 2NNAB 1CGYA 1MCDA 5FO2A 4GG6F 2R7EB 1SLXA 4UDTB 5HHXH 1X9QA 3QDGA 4Y5VB 1V3JA 2YQ3A 2G2PA 2IADB 4Q8BA 3AM8C 4LLVA 4Y4FC 4A66A 5ADOL 5I5MA 1NAKL 3MNZB 1DVFB 3LS5L 4H5SB 3VCLA 1HHKA 4HUXB 1J11A 3MROA 4Z0XB 2J88L 5HI4D 3O45A 2YAQA 2OCCB 3MRGB 1F1DA 3ZL4H 5FECB 1H5BC 3EGSB 3O4LE 4PJBE 1XVSA 3VGAC 4QD2E 3SQBA 2I69A 1HSBB 3SKMB 2VIRA 3LZQA 2G9HA 5JIDA 2P26A 4O02B 4WNJA 1FSKB 4Y5XB 5EUKA 5HI3D 3UZEC 4WW2B 4D0CB 3IRPX 5MI0C 3VMOA 3FL7A 5CP3H 1NLDH 5DHVA 2Q8BH 2LLGA 1TEFA 4BZ2H 2CCWA 1XIWC 5F3BA 5E9AA 2BHFA 2C1OB 5SWSD 2IGTA 5C0AA 3DXAA 5F7AA 4HUWB 1JWUB 2F19H 3U0TA 3PWPD 2Q86B 1FP5A 1FBIH 2L0DA 2EQDA 1EX0A 2OL3H 3U2JA 2NUTA 1DBJH 3HLKA 2YPKB 4F2MA 2VXSH 3EJYC 3V7AG 1XQ4A 4G2AA 4HUXA 3RWFA 2GJ6B 2MEJB 1IRAY 5J0BA 4TRPH 4JVUA 4PS7A 1EWHA 5BW7A 4TULH 5IQOA 1U8QA 4N8VB 3Q6GL 5J89A 3HNVH 4FJ6A 1JGLL 2UZXB 2FBJH 1J1OH 1S8DB 4M6ML 4PGCA 2X88A 1JXGA 1CF8L 2PR9A 4IMKC 2CBMA 5HDWA 3DPBA 4RCAA 1EXUA 4MJJA 5LJYH 4NKIL 3QUYB 1RKRA 1A9BA 2EC8A 1FYTE 4U4BA 5DD0L 5EH1A 1VACB 4JG0L 2OYLA 1VEOA 4PEEA 1RMFH 1DUZA 4NWTH 2BSCA 5ALCH 3DNKA 5CBAA 5IVOA 4NQDD 3ZKNC 1X5GA 2ZF9A 2BNQE 2N3JA 3KR3L 2XTSA 4XVTL 4L9LB 3IU4L 1TENA 2NSXA 2DWYA 5DUJA 1XGPA 2WSPA 2F54B 3LNIA 2VW4A 5I8OL 1TF4A 2P5EA 2KHAA 1LHZA 5D7IB 2FH8A 3IKCA 4UWQB 5A16B 5C0CD 1BZOA 3PL6B 2XETA 5I6OA 1AJ7H 4I2XE 3RLSA 2F5BL 2BSED 2R51A 1M53A 1P4LB 4OD3H 5CS7A 3FAXA 4NO3A 1UWXH 2VSKB 1IEBA 4RFOH 2X05A 4BQ9A 4PJXE 5F7HA 4LSQL 2HX9A 2VLJE 2DIJA 2CRMA 5HYSG 5DT1L 5KSVB 3MV9D 1YPZE 3CSYB 4XHJD 1UA6H 1KT2A 4PJ8C 1ZWIA 1MXDA 1QLEB 2A77L 4HXBL 4Z76B 1HOCB 3ZLQC 1D6EA 2R4SH 1RZGA 2APXA 4X5WB 4K7PY 3TO4C 3IT8D 2ODIA 2FBOJ 4P2CG 4ZUSA 4L1LA 2QTEA 5AUMA 4L2LA 1JFHA 1ZHNA 2D2OA 1O9ZA 2NY7H 5D7IA 5IR1A 4Z7OB 4AV5A 2W07B 1BP3B 2LE9A 2R4SL 3QQXA 4IU3B 1QRNA 1IARB 1BIIB 1OANA 4G80A 1RZKL 5H2BA 1AHWA 3BWSA 4FG0A 4C83B 4R2GB 5T3ZD 1A6UH 2IQ9L 3QI9D 5L0QC 1XF3B 5GSRB 3GIZL 4LCUB 1N2RA 2NW3A 4WV1C 3SDAA 1KJ3L 1CQKA 3LNDA 4HZLA 1ZLUH 1YECH 4C4KT 1T7YA 5DS2A 4CC1A 4U1LB 2NQCA 1L9TA 1OSEA 2RIKA 2MQ0A 2NMSA 1OGAE 3ZE1B 1QW9A 4NZTL 4XXCC 3GMQA 3GMLA 3K4AA 4X8JA 1UT1A 4JFFE 5CZVH 1JS4A 5D1ZD 2NXYC 1QABA 4JG1H 1FGVL 4NHCH 4OCWL 5AENA 1AQHA 1CICA 3D3VE 1BW8A 1Z3GL 1JPGA 1OT4A 5IG7A 4QTHA 2W65A 1EHLH 5DHEA 2J6EA 4LKCA 3KH3A 1SOKA 4NKMA 15C8H 2VABB 2OXGB 4JHUA 4O4YH 5FW6A 3FTVA 4HZ1A 3BKMH 1IQDB 2KLTA 3L1FA 3DSFH 1ODUA 2XUWA 5T1KB 1IL1A 5ESAA 4HOXA 3O8XD 4W9GC 1OP3K 3D3VD 4AK1A 1OL0A 3JWNE 1BAGA 5JZ7D 2IDTA 2A77H 3JTBA 2QBWA 3HVDA 3ARGB 1EO5A 5IFHL 1ZDSA 4Z3EA 4PUBH 3MLVH 1BG1A 1KGWA 3M07A 2E9WA 3CVHA 4NQQA 1RIHH 1T1ZB 2J56A 2K0RA 5JW5A 5G2NA 4OU3A 5FM5M 2GK0B 2X4UB 2CLZB 4U3CA 1U42A 1BVKA 4BCYA 3LN9A 4PW9A 4MNGA 4ZS6D 3SJVA 3R06A 1JPGB 1PQZB 2BVYA 2PYEB 4Q9RH 2DYPB 3W82A 3S3JA 4HOMA 2M8XA 3F12B 3LEVL 2XWBA 1SF5A 4DAGL 5B38A 3UP1A 3LEXA 3ZGIA 4RMVA 5BS0D 4H8WH 3UX9B 2KL6A 4WEMB 1QR1A 1FNGA 4HEME 3T3PE 3QQ3A 3VGBA 2CO4A 4JY4B 1VERA 5ACZA 1FYTB 2IFGA 4XGZA 1MNUH 3DI2B 4NUPA 3WFDH 7CGTA 4ZS7H 1U3HC 3VFOA 5CJXA 1U8KB 3DPDA 2AITA 2XKNB 3RVUC 2IMNA 3GZQA 4PUBL 4KTDH 3F7QA 3PV6B 1A14L 1QHQA 5F3HA 1WHOA 3L9YA 2X10A 2NT1A 1JI2A 3QFJA 3NAAL 3DV4B 4FFWD 4L05A 5IY5B 4YLCA 1H9DA 3TFKD 4G71B 1SJEB 3WIAA 3B7UX 4XPFH 1JHKH 4AQ8A 1MFDH 4KJQD 2HMIC 2A7BA 2XN1A 4WFGE 4OY9A 1JVOA 4U6VH 3N91A 1NC4D 2NZ1A 2W81C 4AVKA 1JNNH 2ENSA 1ZE3C 5GIRB 1NANI 2OXHA 1TTGA 35C8H 3UTTB 5JHAA 5EC1B 1SBSL 1X7QB 4P04A 5CHNA 1QFWL 2CBQA 2BXZA 4HU2A 2YN5A 2ADGB 4GMTL 5ID1B 4MXQD 3RDJA 1V7ML 5E1AA 1WISA 4NBYB 2NR6A 4M6OL 1X5AA 4A04A 4ANUA 1KB5A 1I7TA 4E41A 4ODVL 1LO2H 3L3HB 3AQYA 3IETA 3LKRB 1GYAA 1Q9KB 2LV4A 4GQ9L 4HV8A 2OTUB 4LF3B 1DSFH 2R59A 4YLQT 2FO4A 1DVUA 2RCSH 3GO1H 2VXQH 4BSVB 2BOCA 3GYRA 3BGFB 1HTYA 4JEGB 4DUWA 3BKJH 4PJAB 4Z3HA 4ZFOA 2WHVA 4H0LC 5D1ZB 4MXVE 4ETYA 4QAWA 2JQMA 4YSAA 5KBPA 4FLHA 2GBTA 2Y1VA 1QYGL 3HUJA 5I74C 3JXAA 4X4XB 1M7IA 1MRFL 2OSLA 1GR7A 2OI9C 5ICUA 5IVXE 1YN6A 3Q9QA 3CLEL 3ARRA 2XZAH 1R5IB 1YEEH 4LCVA 3V5DB 3VDCA 2Z35A 4UNVA 1VADA 2Z4TA 4HWZB 2EH8L 5IREA 4WFEE 4AI7A 3QO1B 3SDDA 3PAVA 1TU2B 2CUIA 2B1AL 4V1DD 3SDXA 3KXFA 1A1OA 2AVFA 2JH2A 2ZNWA 4JUSA 4PBXA 3FTZA 3QDME 3WL9B 1YEKL 3PDOA 1UFGA 2XV3A 2XICA 1DSWA 1FVDB 1CI3M 1ED3A 1ZDQA 3VRIA 2LU4A 4B53A 1XCTB 2QV2A 4JGUA 3PY9A 5DJCB 4C4UA 3I9AA 1K5WA 1ZVHA 3O9WB 2R2EB 3ZZLA 1C16A 4G5ZL 3BPOC 1NMAH 3BJLA 3VVWA 3A67L 4DP2X 4TS6A 2G60H 1K8IA 5SWQA 5CIPH 3VFTA 5EU3B 1JGVL 1XH0A 4TUKH 3NA9H 5CN1A 3NOIA 5IROA 1P7HL 1RSYA 4K5MA 1BQKA 4P4KC 4IOIA 1SUJA 1A3LL 1OVZA 3E7JA 2KZ1B 3M7FB 3UIZA 3JTTB 4K3JH 1TVBA 4KXBA 3TNMB 2FH6A 3FRUA 1T83A 1FFOA 3QNYB 3DX9A 3Q2WA 4A7UA 1A7NH 1DDHA 1QPKA 3KPOB 2DDQL 5CIPA 3EFOB 5SWZA 1U36A 2GSIB 3SDXB 5FA3A 1DBMH 3LIUA 4AQ8C 4TVSa 4JG9A 2OTPA 2OMBA 4JKWA 1UD3A 1B90A 1M3JA 3MODL 2CGRL 4L9DA 2GI0A 1VCAA 4FQPA 5E0FA 1EV2E 1HQ4B 1MJ8H 4ZW6A 1Y1UA 4LARL 5D9SA 1OW0C 2FATL 1X5MA 5C6WH 1QQDB 4S0HA 3MLTB 4BFBD 1HI6A 3ASOB 1CU4H 5DUMH 5MEPA 3B7SA 2GKIA 1FG2B 1H15A 1PZCA 3BRFA 2DIEA 4JM4L 4X83A 2WTPA 1BBJA 4ES9A 4IS6A 3F04A 3MROB 3SGJA 4EI6A 1Z5HA 3LH2H 3ARGC 3S96B 1FVCA 1MQKH 1BOYA 2CPUA 4MB1A 4HS8H 1F11A 3VRJB 4Z95H 2TRHA 3BFWA 2VJ0A 4AV0A 1IEAA 4GAJH 3E8UH 5C0FA 5F1NA 1CGWA 4JFYA 4ZUWA 3HJ0A 4DJMA 5I15L 4BCXA 3E38A 3IM1A 4MAYB 2ZUYA 1KCSH 1HHIA 4LPXA 3GSQB 3ROLB 1FVEB 3BAIA 4AT6A 2FT8A 3PCYA 4OD2B 2TAAA 3S36H 1X7TA 2NY6C 2VH5H 3B2PA 2BIOA 3D12B 1NCWL 3G04B 4WIQA 3MLYL 1JPEA 4DGVH 3ECBA 1B2YA 1WICA 3V9CA 4OJYA 5DK0A 5B39G 7TAAA 1Z7JA 4R8WL 4O2CB 4OFYA 3IDNA 4RMSA 5DURB 2OMWB 3CVHB 4J2QA 4M7JH 1EJOL 5FYKE 1CJYA 1MLCA 3LD8B 3OKLA 4IRJC 2AK4D 1WWBX 2O1AA 2UY6B 4B7IA 4JQIH 1JWSA 1ZLWK 3HI6H 3MCKA 3PGCB 5A2AA 5E8DH 4FMFA 3QG7L 4P2OC 4LPWA 1U8JA 3VXPB 3SD5A 5LCVA 1G5GA 5K9JH 2YARA 3AW5A 4H2AA 4PD4K 4PRHE 2QFPA 4Z0BL 1MRDL 3LRMA 3IFOA 3CFIC 3JWOH 2J71A 5C2BL 1GC1C 3VSVA 2OMXA 3L4TA 2OP4L 3ZY7A 2PO6C 3WEMA 2BIPA 3D3VA 1X5YA 3VSTA 5CZRA 4F15B 4BYHA 2XACC 4KV5E 2O5NA 1OHZA 1KENL 3OQ3B 2DJSA 4UQ9A 1T1YA 2P3YA 1XR8B 1CDCA 4OJAA 5TFSL 3QDGB 5IESH 2P7TA 3S37X 4DUVA 3VFPA 4OCLC 1MJUL 1RUKL 4YSSA 4DT2A 3AJ7A 2YRBA 3CFUA 4P2OA 4PP2A 1NFIB 2QV4A 4MX7A 2I60L 3S8FB 3ELQA 3ULUC 2VN7A 4OI9A 3KYKH 4H13C 4M7JL 4POYA 2PF6A 5DRNB 4ZSOA 5B7EA 3OZ9H 4JQVC 3S3PA 4EIBA 1F58H 5I6XC 4PCTA 1YUHB 5DZOA 5JQHC 1ZRUA 4NHUA 5TPWL 1WJ3A 2CA3A 3UO1L 3ARVA 1U91A 4GLRI 3V4LA 3IS1X 1FL5B 3C6EA 5HGAB 2O61A 1M7UA 2GJRA 2VUKA 5JIIA 3SE3A 1BM3H 1Z9OA 5L2KA 2CKBA 4Z7VF 2HUHA 1VJSA 4Q6IB 3RVTC 4HKZA 4YEFA 2XPGB 2KLSA 4M7ZC 2H1PL 4HBQA 4GEIA 5TH2B 3QUZA 4JO1L 1V5JA 2Q7YB 2IFFL 3MMEB 3HEIB 1O9WA 1ZV2A 4LLWA 1EO8L 2AERT 4LSPL 3FYIB 3ULUE 5JQ6L 5EU6E 4W93A 2R9HD 4KKAD 1RUKH 3PP4L 5DD1H 1MHHA 3DGCR 4AYSA 2XC8A 3EYFB 5CEZE 5E2WL 4P06A 2WAQA 2CSPA 1K8DB 4TVUA 4ZUUB 3MV8D 3LS5H 4LNRA 1L7TL 1CE6A 2QKSA 3MLZL 3SEPA 4BKTC 4PG2A 1EA9C 4BGDA 1M9SA 1INEH 4UTCA 1VDGA 2BY1A 3ULUD 5CD5C 3OR6A 2YJLA 5C0IA 4M3JA 3MLUL 4WI4A 4HJ0D 4Y4HD 5C08B 4YHOH 4IIQB 1EERB 1J05A 2XY2A 5FDWA 1QSEE 1R33A 3M46A 4M8UA 2FEDD 4XCCL 1S9KC 3RFRA 4HH9A 1LWHA 3V52L 1HHHB 1ERNA 3GTNA 4E0RA 3RFZB 4M61A 4M43H 4H25A 4PJDE 3RURA 1SEQH 3EOTL 5ANHA 1M4KA 4Z7AA 1KIPB 5FUZH 5FYJL 2BNRA 2H9GB 2K6ZA 2GAZB 3WUWA 1FN4A 1AR2A 1X5XA 1OM3L 3KPTA 4HJSA 1A6TA 1A6ZB 1KB9J 1E4XL 2CUMA 2VTFA 3GMQB 4J28A 4N2CA 4A2FA 2AFNA 2BS8A 4JS7A 4OT1L 3B2VL 4ZUUA 5HP5A 3JWNH 3L3KB 3RB5A 5C0DB 4GG6E 5C3IA 4KGLA 1E6JL 4PTUB 2PNDA 4YL9A 5AZ2L 3SD2A 1M1SA 5IROC 5EO0B 1P4LA 4JVWA 2HT3C 1GC1H 4JO4L 2VDNH 3QDAA 4ZJ9A 2NY4C 1CL7I 1OK0A 4Q6KA 3MFFA 4PHXA 2JSFA 1KJVB 4P4RA 2BNUB 3DMMB 3EGDB 3HVNA 35C8L 4OGZA 4XTRD 2V5SA 4PIRF 4APQB 4AH2A 4OLVH 5ALBH 5BXFB 5CLWA 2A1WH 2IH1B 3UYOD 4F9LA 3LSOA 1NDMA 1CT8B 1PDKB 2C4FT 4OQTL 1WA1X 5T3ZL 2BOBB 3WDJA 5KW9L 3BEWB 3BP6A 1KIPA 4W6XB 1RHFA 3D48R 4UYPA 3KLHD 1P5UA 4LGSB 4HJUA 2F6AA 3ZIMA 2Z31B 2GSIA 4ATTA 3MA7B 4EOWH 3TH4T 4PVBA 4XC1L 1AGDA 5AL0A 5HHNA 4UCFA 2NUPA 2VMDA 2KH2B 3UADA 2J21A 2D31B 3DO4A 4CRPA 1ONQA 4HJJH 4N0FB 3KPLA 4LVOC 3C60D 2BINA 4XPGH 1T4WA 2VN5A 3IAGC 5IEHA 4QRTB 2EVHA 5C0ND 1U2YA 2BVPB 4POZD 1OM9A 4PJEB 1SPDA 1MLBA 4JHAL 4L5FL 1WIPA 4HMCA 3X1BA 2FT7A 4X8GA 3OPZL 3NEXA 4E5XB 4YWGH 1OF0A 1CD9B 2JB6A 3MXVH 5DURD 4IBSA 3L5JA 4XMVA 5J6HA 2R0LL 4RMUA 1R0AL 3ABMB 3MBXL 3OX8B 3OMAB 1CD8A 3UYPA 1PZ2A 4S2SA 3M7OA 1CYGA 4UBDC 5GSVA 1GGTA 4PJCA 2COQA 5E8PB 5KYWB 4EXKA 4FDWA 5F3FA 2KMWA 1DQDL 2W9EH 4Y1AA 5E8OA 3UBFA 4B95C 3QFJB 3D08A 2WTRA 4HIEB 1KJMB 1K8IB 2HTKC 4LDEB 2BY2A 4MMYB 1BEYH 2G9HB 2JJTA 4MJIA 5EF0A 3GI9L 4U0QB 4TSBH 4BZ2A 4D9LL 5F1IB 2IH8A 4ONHB 4CSZA 2Z34A 4PGJA 5IHUL 2CJSA 4WWPA 2Q3AA 3Q7JA 1TQBB 3QVAA 1MJ7L 3KPSE 1FC1A 1DEDA 5I66B 1TZIA 4QRRD 5C09B 3V6FA 2DLIA 4XP5L 3TA3B 4XNMA 2C7FA 4YNYB 1I1AD 5EZLA 3NACL 2VJXA 4GAYA 4HXBH 1QFUH 3KBPA 1DR9A 5DZVA 1UM6L 3RJQB 5ABDE 3K4ZA 3OGCB 2R1XA 3KDMA 4JN1L 2DW5A 3RGBA 2NUTB 4MHHG 3CN4A 5ENWB 1EBPA 3O41A 4RWYL 1BXVA 2CLZA 1HFUA 2YXMA 2ZWSA 3TVMD 3SDXE 3E80A 1EXGA 1XGQA 1M7DB 4BGLA 1A4JA 4KUZL 3U7AA 1F4WL 1E9PB 2SEBA 4HAKA 2C1OA 3LKSA 5ICYA 4JY5H 1A6UL 2MPAH 3QUXA 2K3HA 1P4IH 1S3KH 2GSGA 4XX1G 3TH2T 4DGUA 3NFSL 3KM1A 1FRGH 3N41B 4OIFA 3TT1L 4N5ED 3LEYH 5D70H 1IUZA 4PJAF 2YPVA 3C2AH 4JQXA 4LDLB 4TVPL 3GB7B 2GJ6A 4HF5L 3VB8A 2J5LB 5KYUB 5F9JA 3PP3K 1KGUA 1CFNA 3A4AA 2PTTB 5E5MA 1RZ8A 4G7YH 4F3FA 3FB7A 4Q0XL 4QYOB 4Z8FH 1NCIA 4C55A 3ZT5A 1SOXA 1MRCL 1INDH 4EN3D 2UZYB 3BVVA 3MKKA 1OTSC 4H20H 4LHJB 1FVEA 4YK4B 1ZLSL 4EI5A 4ODSH 3D09A 4C57C 3J8F7 3C5ZA 5I0YA 5IMMA 4PV8B 3I3BA 3NJMA 4X6BA 1OSPL 3QBTB 3QUXB 2HJLA 1VPOL 4ZBJA 3K7UA 2VLRE 4A63A 2ZXCA 3WFEL 4B9KC 4RGNC 1R3HA 5GGVL 1EK3A 2PYED 5KOMC 2BFVL 3MCLL 4U1MA 4XOCA 1FWXA 3D4YA 4FMKA 3NEOA 3UABA 2IXQB 3IFPA 3GXTA 4ZMTA 5KYUA 1JF1B 1CI5A 5I74B 1Q9LB 4JL1A 3ULVE 5K9OB 1FL6A 3TBTB 3RTQA 4Z78A 1TT6A 3BUTA 4JN1H 5L6YH 4DZ8A 3H0TA 3DTXB 3IJHB 4YHPA 2ATKB 4ORGA 3US1A 1R3IH 1X5HA 4U6YB 2F0CA 3MRNA 1UM5L 3GQFA 2YXVA 3IRZA 4O5LH 4AG4L 3O11A 1AMXA 3APNA 5J8OA 1LQSR 1I8AA 5AW1B 3GLDA 4ZPVA 1TEYA 3K8KA 4NFCA 3MVSA 1YVLA 4M6NH 4U6VL 2YOCA 1GOFA 4N8PA 1AHWB 1I9RL 5EF3A 2CM6A 4JDEA 2XQBL 2JXMB 3EOYG 3QSKB 5IB1A 2J7LA 4KPHH 3V9EA 1U3ZA 3QEQE 3VGHA 4J3SA 3V6OA 5T5FH 2A9MH 3RWDA 3WO4B 4HQQH 5I1JL 1TZOA 4OZIF 4LQFH 5IR1B 4QRRA 1WFNA 3CQPA 1I8LC 3L3OC 4UTBL 5DT1H 1WG3A 4U1LA 3MRBB 5CJQL 1OGSA 3WEBA 3KCWA 3TTSA 3IMSA 1U8MA 3VFSB 4BXSV 1HSAB 1N6VA 1RPQA 4CBPA 4PP1C 3RIFK 4FJYA 5J9PA 3WLWD 1U8CA 1UOVA 2V2XB 3B8YA 4UI2A 5BOJA 3DVGB 5I23A 3EO9H 4K94L 2IPKB 3CFJA 4ZFQA 3OPZH 4W9HC 2XJKA 3EYVA 2CR6A 2WD0A 4QGYA 5BUPA 5FFGA 4FA8A 2ZYIA 5IFAH 3RPIB 5ISZA 4Y4KA 2XLLA 1Z0NA 3IMVA 1SDYA 5IB1B 4X4YB 3UG3A 3ULVC 4JN2A 5ADPH 3QAQA 4PJBB 5L9DH 3BE1L 3GXUB 5DFVD 2BRQA 2IOOA 1FH5H 2PCFA 1BQRA 4G9FE 4PMFA 1ASPA 3L17A 3CFQA 4WVRA 2R0WL 3ZHNA 5BZWB 1TSHA 2P49B 4O00A 4QRTA 5D4QA 3QHFL 2EEAA 2Q2EB 5FYKL 2YC1A 2XWRA 2CBPA 3F64A 4PJFE 3UZQA 1TQVA 5SX4I 1AO7E 4RAUA 2BP3A 1QPPA 4TQPA 5DC2A 4BSJA 2AXGB 5J13B 3PHSA 4G9FD 4JANA 4PY7B 4J1UB 2IAMD 4XTRC 1FCGA 3NJKA 3FU5A 1XF2A 4UTAA 3AU1A 1NTDA 3VD7A 4B9IA 3PHOA 5E24E 4PJXB 4K8RC 4YBHA 4Y5VC 1DN0B 3BUIA 2WLYA 3ILQC 4PS4L 2X4OB 1KNOA 2YAMA 3B2XA 3QG6B 3OG4B 2QHRH 1NIEA 5I19H 1QSEA 5HPMB 3Q01A 1L9MA 2Y69B 5D5MF 4BZ1H 3EXJA 1MCJA 1Z9SA 1BZ8A 3RY4A 5J56B 1JRHI 4HKBB 4U1JA 1BD2E 1H5BB 2LFGA 1QUNB 2O4EA 3KBFA 4JY4A 3VGAB 1B88A 2XN2A 5KVGE 1FNSH 3FOMB 1J88A 5DI8A 1JFQL 5LAXA 2IALB 4JY5L 3N40F 1XIWA 3HW7A 2ZWKA 4YSDA 4ZRGA 3X2QB 2JI3A 4J39A 1IZJA 2O5YH 5E00A 3ZYOA 1S46A 1T5WB 3C6LC 1GTNA 3M17A 1H6UA 2F7IA 1RIHL 2WLHA 1NC4A 3M6DA 5G55A 1U8NA 3A67H 3SDYL 1O7VA 4RDBA 3CXDH 2H6OA 2ZCZA 4YAQB 2JJWA 2WLZA 2ADFH 4Y16C 4GQZA 3RZWA 4UDTA 2VT0A 5I5JA 1TFHA 4WK0B 1T5KA 3ZTDC 1IQWL 4WKZA 4QRPA 5FWQA 2PMZA 1ZSDB 1ZLWH 2XTJD 3VTMA 1Z9SB 1UQSB 2ADIA 5E9DB 4HP5A 5ANME 1ZLVK 5FYLE 2ESVB 3ZYJA 3NCBB 1AOHA 3WTVA 1JK8A 5D1XD 3ZQ9A 2DLFL 3RUGE 1KXQA 2AK1H 3RY6C 2I07A 2R29H 2X5PA 3RVVD 2YIHA 1JUFA 1AGEA 2J6WA 3MCG1 4KY1L 4Q74A 3VFUA 1RPKA 3FHQA 3WFDL 3F05A 4LU5L 2BOCB 5IMLA 3PFUA 4IRSB 2K8MA 4LSTL 1CF1A 2V2WB 1ILUA 3GKWL 4MJID 4OCYL 4DF9A 2ZAHA 4XCFL 4CAGA 4HCFA 3GB7A 4ETQA 1ADWA 1HL4A 4PV1C 4NZUL 5KVEH 1KB5B 3HNSH 4IM8A 5FYLH 2EEXA 3BO8A 2XG5A 4X5LA 3ALWA 2ZICA 5E2VL 4W9ZA 2EXWD 2WXFA 4OKVB 4X4ZA 5BCAA 2VDRL 5D7SL 3SGDI 1E43A 1TZAA 3KLSA 4GSXA 4PJAA 2WUBL 4PJIE 4FA7B 1AFVL 1KCBA 4L8CA 5IOKA 2VLLA 5TDNA 1N8OE 3TVMC 1U95A 1KSRA 1QNZL 4MA7L 4A2HA 2D4FA 3MV8E 2E46A 3UPRA 2VLKB 3V5DA 1PYWA 3QXWA 5D7JD 3QDHA 3TA3A 5F7KC 3HC2A 2HTLC 4OD1L 2ZKYA 4FFYA 3QPXH 4KNUA 4KI5C 1D5ZB 1NAKH 1T6WA 2EABA 2H8PB 1OP5K 1XAUA 3INUH 5HD8D 5BZZA 3TIDA 3DVFA 4L3EA 1ZHLA 3N85H 4F8PA 2R1XB 2GITB 1Z9PA 5I8KL 4P2OD 1JNJA 1TJIL 3H0TB 3IJHA 4H5SA 1JPSL 2J1WA 1JG9A 2W0PA 3RWIB 1KWKA 4UMGA 3GNMH 3PHQA 1WC7A 2E75C 4NPKA 5E8DL 1G1KA 4UQ3A 2BIQA 1Z3RA 4AYID 5HYJE 1OQXA 1HSBA 5F7FA 2BIHA 1DJXA 1QW8A 2OMVB 1GGCH 1BCIA 4NJAH 1Y0LB 4PRBA 3IGKA 3KD4A 3CDZB 2C1PA 3KAAA 1L5GB 3W56A 1CVSC 4XN5A 1KLFB 4AQAA 1LD9A 3G3LA 2CH8A 2KERA 5E56A 4OAWA 1YPZF 5H94B 2AXFB 2I9LB 1J8HD 2VXTH 1IGMH 1CFNB 3AGWA 2CXGA 3V52H 1SVZA 1AGBA 4AGLA 3AGVA 4PJDB 4Y19D 3W5MA 4PTTB 5E8EB 1N6QL 3HZ3A 1BJ1J 1S7QB 4N2AA 3O4LD 4RISH 4WCYH 4P9MH 4ZW7A 2J6EH 1ND0B 2WANA 5GGQH 3N85L 4WDIA 2XIDA 3M8OH 1NUNB 4XCYB 2BJMH 2YAOA 3GHEH 1KCRH 1S9XA 3I6KA 5F7DA 3IXTA 4G7VL 3DV6B 1MFBH 1OSZA 2CDEB 2CKBH 4IGBA 3SOBL 1DLHA 3BZ4A 4PRBB 4KVNH 3FU6A 1MREH 2YMOA 3MV7B 4FERA 5EOTB 2VDQL 3UPCA 1BQHA 1B4RA 4KDTA 2ETWA 4IK6A 5G5DB 4CMHB 5IOPB 2WXGA 4ZNCD 3S88L 3D50A 3DSNB 4QHLA 1IBBA 2YD8A 3TEYA 3D4GA 1JIBA 1RUQH 5B4MC 1MCOL 5DJDA 1VGKA 1IAIM 1XMWA 3WNMA 4LARH 4BK4A 4HZLB 3F2LA 1MAJA 2IJ0C 4U1SB 2J8OA 1P6FA 3TBVB 3DJ9A 1SYVB 5IJVB 4LVNC 1QRNE 4BZ2L 5JHDB 5KJRH 3VD3A 2EINB 1S9XB 1E4XH 1NMBH 2WBKA 2ATPA 4Z0XA 2IBGA 4OD2A 1LE5A 2P8LA 4IBWA 3N50A 4NAJA 3HMWL 5DJZB 3E0GA 4M3HA 1E7UA 2Y7SA 3Q1SL 4ANVA 1K2DA 5J4MA 4N8CL 4HIJA 1S7VA 4K55A 3RL1B 3SBPA 2ARJB 3RWJA 1T3FA 4O02A 2VQUA 4HCRL 3AM8A 2K4AA 1BQHB 1IE4A 1JWMA 1P5VA 4CVUA 1FGNL 3MV7A 4QIRA 1DVSA 4KH9A 5HPMA 5DRXB 2IVFC 3W2DH 4RZCA 1JGVH 5DRZB 1IGIL 3BAEL 5H4ZA 4KJYA 2OYKA 3TCTA 4AYFA 3P0VH 1M42A 1MKFA 1JTOA 3IBOA 4UZUA 1VFAA 1O6SA 1EEZA 3FUHA 4TQHA 3TBVA 5EORL 5KVFL 1NSNH 3GI9H 1UKTA 3CFKA 3KPPB 1QHPA 3OPUA 3NEEA 1ZV5A 3C8KB 3Q8EA 3QRGH 3OKOB 1J1OL 1SXAA 4JO8A 4JRYB 4U05A 3T08A 4WLCA 4JDTH 3HUJF 4YLBA 3FHEA 2DQEL 3EHBC 2BIMA 2QSVA 3HAEA 2WMPA 2C9VA 1AY1H 3AREB 1UD5A 1U92B 2IBZX 3PGDA 4TPRL 4AQZA 1A8ZA 1DBBH 5EU4B 4XPBH 2VXSL 5IVXB 2YD9A 4PW4A 1RJYB 3IU3B 4CMMA 3U6RB 3GS7A 5BZDA 2X3AA 4RDQG 1MCWW 2EXWC 4W9FC 3SGEI 4QF1B 4FX5A 1AH1A 3V6FB 1MWAA 3N1GC 5H35B 1E3ZA 4G1MB 4XN2A 1MG2C 5TTRA 3RBGA 5L8LB 1WK0A 4JHVA 4DW2H 3LN4B 4LZKA 3FUFA 1HWGB 3PWVB 3N42F 1UXSA 2LQRA 5DHXB 3T6VA 1AZCA 4ZDHB 5JHLL 5DJYA 5CLZA 1U91B 5AVTB 2OZNA 5ISZE 3V4UH 5GZNC 2YR3A 1EFQA 1YEDB 3FULA 5L7XH 1B6DA 1BMGA 3MRQB 1ZT7A 2FDBP 1VA9A 4Q9QL 4HJJL 1WTLA 3U0WH 4H26B 1UEMA 2QADD 4XO4A 3PGDB 3QDGD 4X99B 4QT5A 5DYOB 1KULA 5EWIH 1J0ZA 5I6KA 4F24A 5IKCA 3U4EA 2V3EA 4TSBL 3HE6C 1F4XL 1OARL 1URLA 5F0MB 4ISVA 1NCTA 3AMKA 3JWDL 4NXSA 1N18A 2B14A 2WLLA 3IEAA 4PCYA 4YHLH 3E9UA 5D1QD 5FKPA 4PW3A 1UXSB 3VWKC 3E2HB 1H3PH 4D9RD 3L1OL 2BLFA 4JFED 3W9DA 4NERA 4YZFF 1KBGL 5ANMA 1A4KB 1G6RH 1NGZB 2VDLH 3IDIB 5JOFB 3X12B 4FFVC 1M1XB 1FFNA 4W9JC 1DEEB 1HXYA 3L1GA 1AKJD 1EAQA 4HC1L 4JZJB 5LBSH 2GJJA 4FL4C 4H8WL 5A6MA 4TQ8A 3HG2A 1FV1A 1CFTA 3BKCH 3NACH 1AYOA 5BRPA 3N2JA 4ZS6C 5LGHL 4XO3A 1QSFB 3EH3B 1GCFA 1P4UA 3PV7A 1EZSA 5C0CB 3I6GA 2PUQT 2J4WL 1C5DA 1WAAA 3BP7B 2A5UA 3LQAC 1RZKH 3NA4A 2Z91A 1MH5B 1T1XB 2IAMC 4X80H 4OLUH 2VJ8A 5D7LD 3PGFL 4D0BB 5IUSA 2P47B 2X9WA 5C07B 3NP3A 1CR9H 2ZUUA 1IBFA 4X4MA 5AB1A 4Z78B 2EH7L 3O2WL 3O6FC 4EEEA 1S2EA 3CX5J 4R0LB 2BRRL 4EUPB 1VKXA 5CU5A 2WWMD 4ZFZA 4JPQA 4Y5YC 3L4YA 2V2WA 1KV7A 3BEVA 5L2JB 4N0FA 1H9VA 5E9DE 2EDFA 4WSKA 4K94C 5GJSL 3JT2A 4HEPA 4M1DL 1DN0A 4NOFA 2OTWB 1KIUB 2Z31A 1BOGA 2Y5QA 4J3OC 2P5EE 4LCCA 3UTTA 1ZE3H 1BVOA 2QGBA 4J3WA 4ZTOL 4K3GA 1AGCB 3P11L 4DPBX 1Z3GH 2WXRA 4WHTB 5DMKB 2GYSA 1TMCB 2F1BA 2Z91B 4TL5A 1A6WL 1NGWB 2AJXH 4N6QA 4XNBA 3SDDC 2WUBH 2OCJA 3J07A 4NRXA 4Z18A 1C1EH 1H3VA 2KT6A 3OKKB 1A1MA 3GBNL 3TJEH 5ILTH 4BK5A 3QZOA 4O2FB 3KG5A 1NEUA 1EGJL 3ZTEA 3RDTA 1EMTH 2Q8BL 3MRIA 3SPGA 3BEVB 2ZJSH 1ZXKA 2CR3A 2HN7A 4FJZA 4GUPB 3CGTA 2N4IA 5KSAA 2MNJB 3L3DA 4NO5A 4FQCH 2DTML 4OIAA 3V6ZA 4B9ZA 1N70A 3R7RA 2XFXA 1N7ML 2MTPA 4AEIH 3SY0B 4ONFH 1ZHBB 4TSCL 4XNXH 1R5VB 4QRSA 3D6GA 1RSFA 3L2MA 5E4IA 2FQGA 5B38B 1WV7T 4AIZB 4LP5A 4XPFL 2DQUH 3P4OA 2GFBB 2OMTA 2YBGA 3GM0A 3WS6A 1LE5B 3RL2A 2FR4B 2D7TL 3UIYA 1KTKE 4GIAA 1OCWH 4XOAA 1BGXL 4TYUA 4AVIA 5EIVA 1NCDH 4F7EB 3ARQA 3EHBB 4Q58C 4X6FB 4L3EE 3VH8B 1D5XB 1NC2D 4MA8H 2P44B 5AKVA 1MRFH 1NWPA 2OK0H 3DOSA 1IBYA 3RTQC 1IKNA 2JNZA 5KSBB 2DTMH 4NLAA 3QISA 4FHJA 1OIOA 3JWOC 5D4HA 2GBAA 5DO8A 1ORSA 4OCMC 1HESA 5IQ7L 4DK3A 4MA3B 3POCA 2CRZA 3GM8A 1TIUA 5EUOE 2RJMA 3CDYA 3C8KA 2HXAA 2IDUA 5EC1A 3BAJA 4A6YL 3RI5K 4RGND 4GQ9H 3D0VB 3FT9A 3G6AA 3GPSA 2XCMC 4FF9A 1AJ7L 1KLUB 4V1DB 5CCHE 1P9MC 3D25A 3B6SA 4M62L 5K1VA 1NCCH 1XBDA 3U1SH 1TTCA 5INCB 5F44A 1CD1A 3ZKND 5HVHC 4XN1A 2X3BA 4QWWC 5GHWH 2XBDA 4X6DE 1UJ3A 1NIDA 3UCQA 2R69H 4X6FA 1D9KB 1N3NA 3MTXA 3C5ZC 5I15H 2EIBA 4KO7A 4A38A 4CVXA 2DBLH 4PLOB 5HYJA 2J20A 1I4FA 1TFPA 2BP5M 3ABKB 3MUHL 4HPHA 1TLMA 2C5DC 2QKIC 2X28A 3S97C 5F9JB 4R7DB 1GGBH 4MXQC 4PRIA 1VIWA 5DEGB 4XCEA 3HMXH 1VEPA 5SWZE 4F27A