1JTOA

Degenerate interfaces in antigen-antibody complexes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
VQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibody,hydrolase
molecule keywords Vh Single-Domain Antibody
publication title Degenerate interfaces in antigen-antibody complexes.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jtoA00
5F96L 2HKFL 4P3DA 1MAJA 1AP2A 1GJIA 2YPVL 3QCTL 2E7LA 4HCRA 4WO4B 3QT2A 2KBGA 1X4YA 1R0AH 3ILQC 1O7SA 4K55A 4FQQB 3Q5TA 1T3FB 1GGBL 4CN6A 4JKPH 4L4VE 1FZMB 1R3JB 1BOGA 1MCLA 5B8CB 4FQ1H 3B6SB 5LAXB 3QIWB 1OARL 1ED3A 5HHXL 1FVDB 2OM5A 4YLQT 3AREC 1RUAL 5BV7L 4JJHA 3WUWA 1FPTH 2F9BT 5CEYA 1UQSB 4U1SA 3OKYA 4JVUA 1X5FA 2P8MB 1BZ7B 1DJSA 3GMMA 1UWXK 1JNNH 3QUKA 4UOW1 3MLXH 3KLHD 2NY5C 4DGYL 2WBJB 5BO1L 5IW6A 4NJAH 4ELMF 3K74B 4C83B 3BKJH 2VR5A 3FQNA 3OGCA 2GJ6B 1CIUA 1WK0A 4ZDHB 4JHBA 3MA9L 5C7XL 1JTOA 1BOYA 4NM4L 4LPTA 2R2BB 4BZ2H 1B0GA 1U58B 2EDDA 3BPNC 3CFBA 5GIRB 4JPIB 3O6FC 1Z3GL 4Q0XH 2XYCA 2A9ML 4W6WB 4GW5A 3BHBA 3PDDA 2VLRB 3T0EA 4PG2A 4AIXA 4LARH 3M8OH 2OR9H 4DUXA 1KEGL 1F6AA 3DVNB 3VGEA 3BZEA 1JMXA 1IGML 2EECA 3G6JF 3L3GA 4FABL 4D0CB 5J12B 4MQ7A 1EAJA 1ZAGA 2EDLA 2AJVL 3BX7C 1KJMA 4GG6A 5IG7A 3RVTD 2HA1A 1X5AA 4GQPH 5H8DA 5IVNA 2AK4E 1QYGL 1LE9B 3GGWB 4ZG1A 2C7UA 3KR3L 4PJXF 4CADB 4X7CC 2DM4A 5C08A 3L3KA 1L4IA 2VDML 4YBLB 1G7QB 3BAEL 5CSZA 2APTA 4OFPA 3VG0L 5BS0B 2WIIA 1ZHKA 1TTGA 4I48A 3MBEC 1ES0A 4Z7UF 3J7HA 4J3TA 2RCSL 8FABA 3ARBD 3MREB 3HR5B 1R5WB 1MHHB 1ZVSA 1TXKA 1CT8B 4FMKA 5JLZB 4Y4FA 4NNYA 3DV4B 1ZT7A 1HH6A 3BVNB 3OJMB 2ZUSA 1MCEA 2AQ2A 2IALB 5DA0B 4H8WC 4K8RH 5DMIL 2R2CA 4OZIA 5J11C 1T4KB 2AV1B 2YKLH 1K85A 4KRPB 3ZDZE 5CIPA 5DJDA 3BESR 3BT2H 2DTSA 4HH9A 5MERB 2R15A 4KTEL 4QTIL 4NFCA 3S96A 3FO1A 3ZE2E 4DFIA 4J8RB 1PSKL 4KXZH 3AXLA 3SJVB 3FQXB 5DF0A 2HJKA 3REWA 4S0TD 5I17B 1ORQA 2GIYA 3R0MA 1AJ7H 5IJVB 5HY9B 2DAVA 3HCVB 4NUGH 2DBLH 1G7LB 2C26A 2NTFB 3D2UA 4MJIA 5DJYA 4HXBL 4H26B 5ERWB 3BXNA 2X4QB 3NIFF 3LRSB 4CVXA 3CLFL 5C2BL 3ZDYE 4OV6F 3SO3B 4QTHA 4DN3H 4LRIC 3RWGA 4YQXL 1IARB 1X5ZA 1FH5L 3P4OA 3QXDB 3TFKC 5IB1B 3OG6B 1VESA 4GRWE 4M1DL 3RIFF 4HJJH 1AO7D 5I1DA 5F9WB 3QDMA 4B53A 4MJ2A 4NWUH 5ACLA 3VWKA 4P2OC 1MOEA 2BVQA 4U1KA 4RDQG 1HQRB 1QPPA 5FYJH 1BQHB 5F44A 4QXGL 2IPKB 2ICWA 3INUL 4OCXL 3BPCA 2G5BB 3R1GH 3ZTJG 4DQOL 5E9DE 1SY6L 1CTOA 3P4MA 5DGQA 4O4YL 3TYFA 4OCMC 4DVBA 3IJHB 4KHTL 1GAFH 1CFTA 1DQQB 5F71A 1ZANH 4F37F 5GRUH 5JXAH 4EI5A 2EDYA 4QF1A 5DLMH 2JELL 1F6LL 3FB8B 1WF5A 1C8PA 1PX4A 2YUWA 3WN5B 5DWUL 3LDBC 2XRAH 3LQAL 4HEPG 3ROLB 3TPUA 1QO3A 1IBGH 3TNMA 5GRJL 1P7HL 4MD4B 5HYSG 3A67L 1AQDA 4MCZB 2DI9A 1JHLL 1UXSB 4ODTL 4BM7A 5CHNA 3RY6A 1VDGA 5JO5B 5CD5D 1M6OA 2IH3B 1A3LL 4IRJD 2P5WE 4C56E 1JGEA 3GMOA 4NGHL 3V2AR 4H5SA 5D9SB 1JPTH 2OJEB 3T65A 4MA3A 4YBQD 3Q0HA 1MI5D 2IBZY 3P9LB 5DJCB 3MACH 4ODBD 5DUBA 1ULVA 1Y6NR 4Y2OA 3DMMC 4HKZA 4OQTA 4NRYB 3QFJA 5DGRA 1PZ5A 5EBMB 3CDFA 2R29L 3WIIL 5JDSA 3NBNA 5DR5H 2W38A 4RGMB 3HHRB 2R39A 4GAJL 2VXTL 2B5IC 3QCVL 4RGND 4O00A 3QUXB 3F8UB 1D6EB 2VDOH 2A77H 1ZHLA 1D5XB 2ZKHL 3GI8L 2YEZA 4D9RE 3QUYD 3FQUA 1I1AC 4PJEE 4CW1B 1A5FL 1OAYL 1WISA 4X6BA 2F74A 4M6NL 4ERSL 3RIFK 2HWZL 5IF0A 1H3UA 2DD8L 1AD0A 3UAJD 3VGGA 4YUEH 5T3ZD 3T3PF 1S7UA 2FH8A 2CXKA 3ULSB 1IFHH 5I9QB 3NN8A 1I85C 2VAAA 1A4KA 2JJVA 1F4XL 3GSUB 3CPLA 3PDGA 2GT9B 3CVHL 1HIMH 3QXWA 5EWIL 4WI9A 1GGTA 3HMXL 4JRYD 1J0HA 4TUKH 2FO4A 2K9UA 1FNEB 4FXGB 3SKMB 1A7RL 3MLUL 3GSVA 4X5WB 5LGJB 4ALAH 5EUOE 3VXRB 2E7LC 2A6JA 4WI3A 4F37K 5JR1L 5HGHB 4JKLA 4JRXA 5BCAA 4HHAA 5FO9A 1T2JA 35C8L 3VFVB 1ODAA 4Y7MA 1FVEA 3LKOA 5ANMA 5TH2A 1NLDH 1U42A 3F12A 1AGFB 4G80A 3IDIA 3PUCA 4XX1E 2NPLX 1LQSR 1JJUA 5BV7H 1AGBB 2QBWA 3VGAB 1FO0A 3CVIH 1OAXL 5BZDA 3DWTA 4V1DB 2B0SL 2V2TA 4PJ9C 3D39E 3DSFL 2HT3D 3QRGH 1KIRB 2FJGA 5JXEA 3STZA 1FORH 2GUOB 2XN9B 5C92A 1JWMB 1A1OA 1J88A 4OKVB 5GS0D 2R2EA 3D0LB 3QDJD 5E03A 3AB0B 1YQ2A 5E6IA 4AIZA 2CRIA 3RUGF 5C7XH 3U7YL 5IGXH 3QEHA 4NM4H 1SM3L 4L8SA 4CU8A 5DD0L 4P9HL 4HUXA 3BH8B 1Q9KA 3MRRB 1BBDL 5DK2A 4FG6C 4POUB 3DUSB 3OJ2C 1FGVH 2GK0B 3QUZB 1BFOB 5F1SA 3LN5A 3F7VB 5CMAB 3V4UH 5E2JA 4MAUL 1IGMH 1JGLH 4ZQKA 1Z9MA 1M7DB 4BH7A 1FNSH 2AXFA 4JZNA 3UBXB 1HWGB 2H26A 3RDTC 4JLRB 2NXZB 2JKXA 1MFNA 1Q9OB 2A9NL 5E6YA 5IB5A 1WFNA 4QRQB 4N9GA 4QOKD 1NCBL 4PY8I 2C9AA 5D72H 1QYGH 3PHQB 2RQ8A 3TBTA 2XA8L 3BAEH 4YHPB 3ESVF 2DRUA 3REVA 4JY4A 1RZ8A 1LILA 2BSRA 4N0CC 3STLB 2Z4QB 7FABL 5KS9F 1S5IL 3WSQH 3ZKQD 1UB5B 4PRID 5C09D 3VXMB 5I66B 5D93B 2BVPA 2GITA 3BP7B 5K9KB 3DYPA 1EO8L 3SY0A 1AY1L 3KLSA 5JOPD 1LEIA 2UYLA 5ADOL 5C0GB 4X6DF 1YZZA 3RVXD 4S10A 1UADC 4ZFFA 1YC7A 4PGJA 4RFEB 4Y4FC 1MCNA 2BY0A 5JHDD 3ESUF 1S7TA 4LSPL 3M1BB 5HI4D 3TBYA 5TFSL 4QTIH 1JP5A 1AKJD 2EDEA 3FB5B 3DXAE 3WE6A 1CGSH 3LEXB 4G7VL 3AREB 4PJ7B 2H2SD 4YC2C 5HGAB 1NPUA 5SX5K 3EYQD 1TENA 3OXRB 4ENED 2BRQA 3FOMB 3MUHL 2W65B 1MJJA 4OGYL 4MMXC 4IS6A 3BN9D 5HGBB 1NCNA 1AC6A 3VFNA 5CEZL 4HXBH 1G7JB 3MV9A 4LSSL 5DRNB 5C2BH 1YMHB 5KSBB 4DCQB 4NKMB 4YQXH 4U3CA 1C5BH 4M8QA 2JIXB 1BQLL 4PJDF 4NC0B 1XCQB 4M1DH 1VHPA 1IC5L 1S7XB 1U0QA 2XTJB 5BJTB 5F8QC 4I5BA 4OIIL 3IAQA 1D3CA 2ZSVB 5HYJA 3GM0A 4Y4KB 3VI4E 3BPNB 5AG8A 4OI7A 3PWPD 4QXGH 3GSNB 2Z92B 3VWKC 1J8HA 2H32B 4DUVA 1G9NH 2AXHA 1U8NA 3BZ4B 3O6ML 1FZOA 5C0JA 4NM8H 3KYOA 1UYWL 3O2DA 3L9RB 4XXCA 3RTQD 3ULVD 1RZKL 5DD5L 3IB4A 4UU9B 2LFGA 3S6CA 1FNLA 4Y2DC 3VWJC 1QD0A 2VKWA 4JFFD 3L95B 5DWUH 1BECA 4Y19E 4XAWL 1YEDB 1S7QB 1T7YA 3H9SB 3A67H 4B7LA 1A7OL 3HTLX 2ENYA 3AU1A 4H0GA 4F58L 2AS5M 1W72L 4YX2L 4P48A 4PJIE 3JV6A 1QSEE 4JZJA 2C3XA 1ZLUK 1TQBC 2AJUL 3MJ6A 3ZDXE 1NUFA 3IS1X 4NGHH 1AFVL 4W4NA 4XNYL 3DX8A 4LLUA 4GRLC 3PHSA 4HX1B 3EGSA 3G6JA 2D9QB 1N5YH 3EFDH 5T1LA 4Z7WB 5J6GB 4M5YL 3L5XL 4OFKA 1I3VA 3V0AC 1T66D 1JPSH 3LEYH 4L4TD 2APFA 2R1XA 3UTSD 4PJXA 4KVCL 1CXHA 4NCC2 1XGTB 4F9LC 1GYAA 3MA7A 2VN4A 5IEHB 1LO3L 3VD5A 3IDNB 1IKFH 4TVPE 1JFQL 2VXTH 3MC0A 3ARGA 1WCQA 5GHWH 1KLUA 4LEOB 4PJFE 5LGKA 2IAMD 3VXTA 4Z7UA 3RI5F 2LVCA 1WBYA 2ZKHH 4HUWB 3GI8H 4ZXBC 1M7IA 3MFFA 4ODSH 5IW1A 3C5ZB 1DQDL 3U4BH 4WU7B 4FZEL 1NBYA 5DSCB 5I1IL 1A5FH 1E6JL 4IHOA 5KOMC 5DJ6B 2YSSA 4OIAA 3WO3B 5D7KE 2Z8SA 4Z95L 5DVNA 4M7LT 3O2WL 5IHZA 2IEPA 4POZD 4DJMA 5KVDL 1FYTE 1T1YB 2AAVA 1XF3B 2NY3C 2V9TA 1N8ZA 3BGFC 1KG0B 3VA2C 3MXVL 1F4XH 4PR5A 3F7YA 2JLLA 3MV8E 4HK0B 4ZPVB 5T1MB 3HMXH 4HCRL 3VXUD 4NQEB 2YPLA 5T1KB 3MLUH 4XHJC 5TQ2L 2OP4L 4LLAA 4X7FC 1DBAL 3T1FB 3P3YA 1L7TL 4HLJA 1KTKE 4JDTH 1LO5B 4WVRA 3VXOA 2XZAL 2KKQA 5JR1H 2GSGA 5D7JA 5C86A 1N0LA 4XTRC 3QQNA 2Y23A 5H35B 1JUFA 5FKAB 3MV7E 4G9FA 1ZA6A 3V0VB 3VXQA 3V0WH 2CPCA 3LDBB 3NGBC 4G8IA 5B3JE 3ZE0F 1CXEA 3S4SB 4OLUH 1XCTA 4X7TA 3SCMC 2Y6SD 3ZT5A 2QR0A 5TDNB 1P7KB 4LMQI 1A6WL 2DQGH 4MB5A 2HN7B 5ALBH 3WLBA 2NY5H 4K94L 3RAJH 2B0SH 1YMMB 5GSRB 4WFFD 3V5HB 2FEEL 4PGBB 5H37H 1KJVB 5D7LE 4GAGL 1BBJB 4BFIB 4LIQE 5IM7A 3IXAB 2F53A 2P5ED 3MGOA 4JG1L 4BQCA 4ZS7L 1YEJH 3PABA 1H3PL 3ZDZF 1ZHNB 4P3CH 4LCWD 4Z9KB 1R5VA 3GB7A 5D70H 3ZE2F 1FNGB 4EN3A 4JAMA 1ZV5A 3GSNH 5DD0H 1X5GA 2H32H 2AEWA 1HYSC 5FHBL 1Q1JH 5GGQH 2AJSH 2EE3A 3CSGA 1YA5A 1UEYA 4NQDB 3VRIA 2ADIA 4I3RH 4K7FA 5IMKA 3RI5K 1RK1A 4IDJH 3C09C 4O2FB 2DTML 3BQUB 3ZDYF 5KG9B 3P0VL 4MAUH 1BIIA 5JHLL 3BD5A 1FZJB 3ZE1F 4HKXA 2DLFL 5JPMA 4P4KC 4YXKL 2Y5TB 4GRWF 3ARFA 5IMOA 2A9NH 4X5XA 3SKOA 5IWLA 2IMNA 4JJ5A 4FFZH 3NCCB 3B8YA 1DTUA 4KRMB 1UWEH 3RP1A 5I1HH 1W8NA 5ENWA 2CUMA 1X5IA 2A6KB 3IVKA 4M6OL 1EK3A 4W68A 5L6YL 4XPGL 3K4AA 3H9YA 7FABH 3MOAH 1MH5A 1S5IH 1QLFA 5FUCE 4J3SA 4P3DB 2HT4D 4MZ3A 4NHUA 1UB6A 4M4PA 4P46D 3MCKA 1XF5A 5C0ND 5ADOH 1DFBL 1CL7I 4X83A 4M02A 4GFTB 2BXZA 3O3UN 1HKLL 2YPKA 3SDAC 1R5IA 3HI6H 1F4YH 5ISZD 5TFSH 2R4RL 1OT2A 1BOGB 1U3HA 5CLTA 3D3VD 3G5ZB 4QHNA 2MQ3A 3ZKXC 3B9KA 4G7VH 4PJAA 5HDQL 1KCKA 3O6LH 4P23A 2CDEA 3S37X 1MQKH 2R0KL 4G8GE 2WANA 3C6SB 2D0HA 4Y4HA 3P30L 2WLYA 4PJ9B 1I1CA 2YC1B 2HVKB 1EMTH 2VXUH 2BDNL 1PZUB 2BZDA 4HUVB 1NAKL 5I1JL 3QUKB 4X6EA 3ARWA 2O5XH 4IRZH 5TE4L 2X6MA 5D1ZD 5I8CB 4MNQA 1IC5H 5GRWA 5IW6B 1GL4B 5F9AC 3N9GH 1NBVH 2VLKB 3W82A 4LGSB 4J3OC 5E70A 1BFVL 2NZ9D 4ZOAA 4MS8D 1D5MA 1HQ4A 1EDQA 2ILLA 1F58L 4DWHA 1NGYA 5EO9B 5IKCA 3V79C 3OZ9H 3CFBB 3KPRE 3HC0A 3HE7D 1UYWH 1WJ3A 3JWOC 4PJEF 1B2WH 4LQ1A 4X6CB 5DJ0A 3BHBB 3T0EB 5DD5H 4Y16D 4HGKC 5TDOB 1F6AB 2DL9A 4YNYB 3QNYA 3BZEB 2YUXA 5DUML 3RUGA 1EJOL 1T83C 4W70A 1F3DH 3MRNA 3L3GB 1CVRA 3BSZL 4GOSA 4OKDA 4MQ7B 3GBNH 4OZGE 3ALPA 1KJMB 3SE9H 4GG6B 4GSDL 5IG7B 3SBWC 5C0BE 1X44A 4F58H 1P5VA 3UPRA 5DURD 3CH8A 5E5UB 1ZLSL 4UQ3A 3IT8D 2C7UB 3PGDA 3O3DB 5EUOF 1FIEA 5C08B 1CDBA 2IQ9H 5CSZB 4LCCA 4L3EE 4JZJC 1Q94A 4I48B 4TQEL 3V8CA 4X0KA 1ES0B 3TO4A 4LKCA 2IBZX 4PRPB 1CFQA 8FABB 4P2RE 3TA3D 5FUOL 3KDMA 4FP8L 5E8EA 5HHVH 1CLZL 1CE6A 5HI3C 1QRND 2XIDA 1R3IL 1D9KA 4Y4FB 1XGQA 1ZT7B 1HH6B 4O51A 4AEHH 1JZ2A 1P4BH 2ID5A 3V5KA 4F3FA 4TTDD 3HG1E 2R4SH 4OZIB 4UQ2A 1LO3H 4IJ3C 2GTZA 1CN4A 3U9UB 5DJDB 1JFQH 4M1GL 3S96B 3FO1B 5FXCH 3AXLB 4HWZA 5KS9A 2HJKB 1MJUL 3REWB 3EFFA 1P7QD 5C6TH 4HS8H 4P4RA 2CDGA 4FZEH 1RZJC 3CC5B 2UZIL 1Q9LA 1NKOA 1WTGT 2GKIA 3RWHA 3D2UB 4MJIB 4X6DA 2OMNA 3HNVH 2FIRT 4WUKH 1RMFH 3BXNB 4YR6A 3CFJA 4CVXB 5ID1B 4YH6A 2ARJQ 2BRRL 3O2WH 3D9AL 4QTHB 3RWGB 1TVBB 4MAYA 3P4OB 2I26N 1JF5A 5ADPH 1V05A 1XR9A 3QDMB 2IC2A 3QI9A 3VWKB 4HCRH 5D2LE 2BVQB 3LV3A 3U4EA 5GZOC 5TQ2H 1IEHA 3BIKA 4V2BA 4P2QA 1L7TH 2VZ1A 2H45A 2ICWB 3NFSL 4EDWH 1DUZA 3BPCB 4APQC 1E0OB 4KDVA 4KJPD 2CKBL 4LHUB 3P4MB 1QVOB 1MLCB 4Y2DB 3TYFB 4JFXA 1OQOA 5IROA 1CFTB 4UNUA 1DBKL 2J4WH 3PP4L 4EI5B 4QF1B 2H41A 3RL2A 4TULH 5BOZG 4LP5A 3LQAC 5ITBL 5FYLD 4OV5A 1Z2KA 2YRZA 4MDJA 4ZUWB 3MUGA 3TPUB 4YXLL 1FO0L 1QO3B 4U3XA 3TNMB 5T3XD 1CDCA 3ZHDA 1KV3A 3TEUA 4CN1A 3HE6A 2DQDH 5J9PA 3OR7A 4G8EB 5EOCL 1OW0C 3O9WC 4ISVA 3FKUS 1UACH 1P53A 4YHLL 4LRNL 3ZKSD 3SGDH 1X7QA 4QHKJ 1AR1C 1M6OB 2V5YA 3S37L 4Z18A 3GMOB 4H5SB 3T65B 3E3QC 1S9WA 1PG7W 5JW4N 1CF8L 4PRAA 1YY9C 2Q87A 5DMKA 4P3WA 1MVFA 1KT2A 2X42A 4HKZB 4XNUH 5D4QA 4EN3C 3R06A 3AGVA 2ZUQB 1PZ5B 3S88H 1B6DA 4HKJA 5J89A 2X70A 4MJ6A 4ZFOL 1VADA 4AL8H 1NL0L 2F8XC 5DHYB 4CAGA 5JDSB 3IU3B 1TITA 3VG9C 3VD7A 3IFLL 4P5KB 2CMRH 5GJSH 4HPOH 4TUJA 1IC4L 1YEHL 4L4VA 4K3DL 4JM2D 1OF2A 1ZHLB 3O3AA 4IIQA 3BWUC 2Z0BA 2YEZB 2EDJA 1EGJA 2PW2A 1TJIL 4F7MA 3SGEH 3T09A 3FO2A 1HZHL 2F74B 3SDCC 1G7PA 2DQJH 2NY3B 5EDXA 4JY6B 2CUIA 1FBIL 4PGDA 4NQUA 1S7UB 4M7JH 2QSTA 4OZHE 3X13A 5L2KE 4U0RB 3I9GH 4JR9H 2YXFA 5JNYA 4LSRL 1U3YA 3CPLB 5SWZD 5KW9H 2X4NB 1L6XA 4RQQA 3TP4A 1FFOB 3DI2B 2FO4B 3K8KA 3SJVE 5KVEH 2VLLB 4OF0A 1IC7H 3GSVB 1MCRA 1HKLH 1K8DA 1YY8A 4X9HA 1VFAA 1UFUA 2PN5A 4J6RH 5E2UL 4NBYB 4A2LA 2V5MA 2WLZA 4ODWA 12E8L 3BH9A 5CKAA 4O2EA 4F7CB 2KL6A 3HZKB 5IBLC 3DNKA 5TH2B 3GNMH 3F12B 1HXYB 4DOHB 3EO9L 2NNAA 3K2UL 4G80B 3GK8L 3IDIB 2Z31A 2G2RA 3P30H 3ZDXF 4OGXL 2WINA 5TGBA 2R0WH 2BNUB 3PWLB 1FO0B 2V9RA 4PJ5E 1RIUL 3HZYB 3ULUD 2AJYH 4WFGE 2E7HA 1EFXD 5E2VL 1MF2L 5KOVC 5I1JH 5C07D 4IOIB 1J9CT 3STZB 3P4NA 4C54A 4KVNH 3TYGL 2AK4A 5GGRY 1A9EB 4ZTOL 1DEEB 1A1OB 5DFVD 4NN6C 4TSBL 1YDPA 2R2EB 3MFGB 1UJ3A 5J1SC 5F1NA 3QWRA 4ZUUA 4N5ED 4AIZB 1UM4H 5EOQL 3BEVA 3QEHB 5E5RB 2DS4A 2B1HL 3U9PL 2VABA 4XC1H 4P9HC 1U8JB 3DUUA 1NCAL 2F5BL 3X14A 5DI8A 4Q7DA 1J5OL 2YK1H 3CFEB 4YXHL 5DK2B 3VDAA 3C09B 2J5LC 3OB0K 1NMBH 3ARRA 4I9WE 1YECL 2PYFA 2CRMA 2DKUA 2HFTA 3QXTA 5LGHL 1LO4L 3IAPA 3CIQA 3L3IA 2V5RA 4E42B 2E6QA 2NY7L 5A16B 2JJSA 15C8L 3OAZK 4ZQKB 3MOBL 3D1MC 3O4OC 5IHUH 3BSZH 5D8JH 1X4XA 2E6PA 2H26B 1XMWA 1DVFA 4Z7VB 3MRLA 1OP5K 5IB5B 5F3HA 1OQXA 1W0YT 1H8OA 1C1EH 4N9GB 4YDJB 3T4YB 1XH3A 6FABL 4WV1A 5F7EL 5ETUB 5M7QA 4P5MA 2D7MA 3MLRL 3EW3B 2F54E 3CXHJ 5C9JA 3TBTB 5K59E 3BW9B 3IU4L 3WFEH 3GHEL 1OAUH 4JY4B 1KJ2B 1RZ8B 1CD1A 5HHMD 3MJ8B 2BSRB 1XIWA 3EJYC 3S36L 4XP4L 4J7RA 4OTXL 3RX8A 3SO5A 3PWNA 1UCTA 2E7CA 3P77B 5KN5A 3OJVC 1QA9A 2BVPB 1A7BA 2GITB 5B3JF 5C0RL 3SY0B 1R3IH 3TO4C 4OQTH 3WD5L 4DVRH 5K33A 2R69H 2UYLB 5EC2A 1VERA 4R2GD 4GLRH 2XXCB 4OLXH 3RL1B 2CJUL 3GMQA 3ZT6A 4FQXD 1JI2A 2VIRB 1WV7T 3D25A 2JF1A 4ZFFB 5E8DL 1D9KC 3ZKXB 5E7BA 2RR3A 1S7TB 4QY8A 5ESAB 3TBYB 3JTTA 1IM3B 5BXFB 1MJUH 4FQCL 2DDQL 2I60L 4WCYL 5CBEB 5D5MB 1MCPL 1E4XH 1ZLWK 4NZJA 5I15H 5I1KH 4IS6B 3KGRA 1G7HA 3HFML 2HFGL 3VFNB 1WEJH 4EQ3A 2BRRH 2ITDA 1FC1A 1SJVA 3WLWC 3ARDA 2AJXL 1KNOA 4NUJA 1GC1C 5CFHA 4M8QB 5LXGH 3S35X 3BIAX 3W9EA 5DUPH 4NO0B 3MRJA 5I71C 1VGEL 3QHZH 4I5BB 2KDGA 3C08L 5J1AA 5HYJB 3UTTE 4C56A 4G6ML 3VFSA 5FYKD 1SJHA 1J8HB 2DYPA 1U8NB 1GGIH 3NPZB 4BZYA 1FZOB 3D18A 1SYSA 3KYOB 4K9EL 4ZODA 4TNWF 4FZ8L 4M6AA 3VFOA 1NQBA 1KCVL 1DBKH 4V1DE 2HRPH 3PP4H 1DBJL 3IYLW 4Q9RH 1H3TA 1SVZA 3FAWA 1IGJA 1XAUA 2WNGA 5ITBH 3ZTNL 2OMBA 2XN9E 3NCFB 3KJ6H 1FO0H 1Q9WA 4CL7A 2YA1A 3H9ZA 4KJWD 4ODVL 4PJHE 3AU1B 3GIVA 4HUMB 2BVEA 5F3BA 2DQUH 5DVKA 4PV9B 4PJEA 4JZJB 1DQMH 3HE6C 4YHLH 1X6LA 1OGAD 2BHUA 5CGTA 5F9DC 1KGCD 2DWDA 4JO3L 4XPHH 3CX5K 3S37H 1ERNA 4Z6AT 1PDKA 3SDDD 4R4ND 2AXJA 1QSFD 4LLUB 3EGSB 3G6JB 4XPFL 5LWYH 4E41E 5T1LB 1BD2B 4F57L 5MI0B 4ETYA 1RUMH 1UXWA 3PIQA 1CLOL 4P2YA 5DYOB 3WO4C 2NY2D 1D7FA 4QKXB 3GBML 5E9DD 5GGRA 1P2CA 3QIUA 3T8XA 3H7LA 4U1HA 4XP9L 1CFNA 4PJXB 5EUOA 4AYFA 3MA7B 3FZUC 2E8ZA 1BJ8A 1FN4B 1TQCB 3ARGB 1YEHH 1PKOA 1JHTB 1IGCH 1A1NA 4YDVA 3DX6A 1HNGA 4UT6L 3VXTB 3QSKB 1WBYB 1M7IB 1NCCH 3MFFB 3TM6A 2HLAA 2P24A 1A6ZA 3WIHA 4WW2F 1NBYB 3GEWB 1MEXH 1MRDH 3HRPA 4U6TA 1MWAA 3BZFA 5DD6A 1FBIH 2ZUVA 3RVTC 5IHZB 4Y1AD 2NY6D 3MRQA 3D39A 2P5WD 2QHRL 1H5BC 4LGRB 3OPZL 1AXTH 4D3CL 4QHMA 3FQTA 4PR5B 3BOVA 3F7YB 3L3HA 1OP3H 3K4DA 4WEBL 2B4CC 3TVMA 5DEFA 1LO2H 3T0WA 2OJZH 3C5JA 4RRPA 3U7AA 5JDJA 2YPLB 3KYMB 4JFHD 4MVBC 5EA0H 3B2VL 4PJ7E 3ARBC 3VXOB 4YHMH 2C1PA 4X9BA 4OZGF 2BJML 3U2SA 3RGVD 5E2UH 5GXBB 1NCDL 4EQ2A 3EDEA 4G9FB 1K2DA 1ZA6B 4J4PA 2G60L 1U9KA 1J0JA 4G8IB 1QBAA 3WFBH 2QQKH 3EO9H 4RAUA 3EYUL 3K2UH 3GK8H 4X7TB 4F15C 4PGZA 5DQJB 3GSOB 2UWEE 4RA3A 5JORB 3K46A 3O9WB 1RIUH 4WRLA 4QRRD 4K94C 5E2VH 2LQRA 4CMHC 1MF2H 4GXUN 1DL7H 3ZYIA 3TYGH 1RPQA 2XKUA 4AY0A 4L8DA 3QXVA 4NPYB 1CU4L 4UNTA 4U1JA 3Q6FB 3S3PA 4J12A 5HYIA 4WI6A 4FNLL 3HAEG 5E99H 1IZKA 1Q0XH 3PABB 3UTZA 3P4LA 3LKQA 4WWKA 2OYPA 1R5VB 2A2QT 3GB7B 2CK0H 4EN3B 3U9PH 1TTFA 3JWOH 3WIFA 5FYKU 4YXHH 1MCIA 3VG9B 4XNXL 4PUBH 3O2DH 1PX3A 4JKWA 2FHBA 4R7NB 5C0AB 4K7FB 2VWEC 3H9SE 4LSVH 1DCLA 3V5DA 5IMKB 2I9LB 2G75A 2WP3O 2VDLL 3QCUL 4XT1C 5LGHH 1LO4H 1M71B 3QIBA 3P0GB 3ZT7A 1KPUB 2NY7H 15C8H 4HKXB 5GGTA 4NHCL 3DXAA 3WFHA 5JPMB 3KPQB 1W0VB 1KJ3L 3ARFB 1IGYA 4UILH 1T5WB 2VXQH 1KELL 3WBDA 5IMOB 3TBVA 4QXUH 4X5XB 3SKOB 1NC2D 4FS0A 4U3HA 3SDCB 4DKAA 4F80A 2BNRB 1EBPA 3DROB 1G7IB 2VLJB 3N85H 4Z7WE 3MRMA 2XG5A 1MCWW 1FIGH 4R6UA 1I9JL 3KPMA 4Z0XA 4KU1A 5ENWB 3GHEH 1MFBL 4W81A 3IVKB 1T2QL 2FEDD 1KN2H 3ALXA 3Q48A 4MXQC 3S36H 1U8LA 3LH2L 5D96C 1I7TA 1KTRL 4OTXH 3SOBL 1AGDA 1NGWA 1QLFB 2PKDA 3PQYD 1RFDL 1XIWC 5C0RH 1CGWA 4M7ZC 1UB6B 3TJHD 1S3KL 2LU3A 5HDOA 1XF5B 4FQIH 4YBQC 2FX9H 2CJUH 4HS6A 3U30B 2NY1B 3VH8B 2YPKB 4NBXB 3KXFB 1R5IB 4Y5YC 2FNBA 2X05A 1QFUH 3G6DL 1Q8MA 5J0BA 1U3HB 4JPVL 4QHNB 4PJAB 3O8XD 1RZJH 3GBLA 1P69B 2I60H 2EXWD 1NFIA 1JTPA 4RZCA 1MCPH 4RISL 1SQ2N 3QO1B 5CSGA 3O3BA 3U7WL 4XVTL 4Y19A 1OB1A 4LQFL 2A6DB 3KS0J 4L8BA 2BOCA 2CH8A 5KSAA 1N6UA 1T0PB 2ED8A 3QUYC 4OM0L 3PGCB 4CNIA 4NQEE 5C0DA 2AJXH 4NN6B 4X6EB 3NZ8A 4DKFH 3CFCH 3UTQA 1WBXA 4Z7NE 2JCCE 4UIMA 2VNCA 2I24N 4PJIA 1QSEA 3UAJC 2A38A 3C08H 1UA6L 1YYML 3I84A 5GGVY 3A6BL 5DZOA 1D5MB 1HQ4B 2J5LB 2ESVE 1CR9L 1QFWH 2VYRE 3QAZC 5IKCB 5LBSL 4X8XA 4HAFA 2C3VA 2FD6H 4XZUA 3C60A 4O5LH 4EVNA 4FQJL 3C2AL 4YHKL 5DJ0B 1Z5LA 1YEFH 1FJ1A 2FZ3A 1MIEH 3O4OB 4XBGA 1BVLB 1FCCA 1TZGH 2NLJA 3K80A 2YN3A 1JRHH 3WV0A 3EYVA 3RUGB 3V52L 1S8DA 2IG2L 4FTVD 4EOWH 3MRNB 4QT5A 4OZHF 4PJFA 3GKWL 4IEFB 4EXPX 4ODVH 5A2FA 1I7ZA 4KUCD 4NOBA 2M8XA 3QA3A 4XWGL 3T0BA 2EDQA 3QQ4A 4UQ3B 4LLVA 3PGDB 5F88A 1H15A 2P4AB 1TLKA 4LCCB 2CD0A 2HT3C 4NQDE 2PYED 4KROD 1Q94B 4X9GA 5FGSA 1OAZL 4UTBH 1FYTA 4LOUD 4X0KB 1B4JH 4XPFH 3E8UL 4LKCB 3TO4B 2X4RA 3TBWB 4OGZA 1CFQB 4LCYA 5GS0C 1GOGA 2YD8A 1JF1A 5E8EB 2AKRA 3MV8A 4ESKA 1D9KB 3EHBC 5HPMA 4RSVA 1NCWH 5C70A 3V5KB 2Q1EA 4F3FB 3MO1A 4OFDA 2J1KA 4NKDA 4UQ2B 2GTZB 1NJ9A 1PQZA 4HPYH 3B9DA 4HV8A 3UROR 4HWZB 1KCSH 3MV7A 3IJYA 1ZK9A 3OKOA 5F97E 1MFCH 4OLWL 2N7AA 1EGJL 3TT3H 2CDGB 3HC4L 3Q5YA 5CJQL 2OI9C 4JKKA 4M5ZL 5CGYC 3RWHB 5CZXD 1UH3A 2EDHA 1HXMA 4LL9A 2J88L 2E27H 4OD3L 4YR6B 3CFJB 3WXVH 1P84J 1RZIA 4KKBD 3K8LA 3CXHK 5I71B 4EUPB 5CJ5A 3V4VL 3VFMB 1S7SA 1ZSDB 3GI9H 4P59L 3X12B 2P42B 2MCPH 4NQVB 5T5FH 1JBJA 5D7LA 4M03A 3G5YA 4H20H 4KAQL 4D0DA 4LSTL 4U6YB 2V9QA 4LLQA 1EAPA 3DO7B 4MNGB 2W60A 3I2CL 4M1CD 4Z7OF 5JPNA 4AZ8A 5EBWA 2FECI 1PYWA 4P2QB 3TVMC 3M45A 1DUZB 5E2WH 1FP5A 1EH9A 3GHBL 5GS2H 1MFAL 2BJMH 4OF6A 1MCWM 3HB3D 5EO0A 1EEZA 2QV2A 5INDA 4JFXB 3RVXC 5AZEL 3C6LD 1A7PL 4FFVD 2D4FA 2WZPD 1A6TB 1IM9D 1F5WA 5HI4C 3RL2B 4DKEH 3HS0B 4U1LB 1JGVH 2E7BA 2HJLB 1O5DT 2ITCA 1T20B 5IQ9A 2O93L 5C1MB 1VFOA 4OV5B 1QHPA 3MUGB 1M05A 4M62H 5D7SH 1REIA 1RUKH 2VLKE 3HE6B 4ENEC 3FO9B 3C8HA 5J9PB 3MRGB 4M3KB 3VRJA 3G9AB 4ZO8A 5EU6A 5F7NC 5FA3B 3QRFM 4KFZC 4ONOA 1X7QB 5CUSH 1NGXA 4FNLH 2V17L 4JN1H 3NH7L 4X6CE 3GMPA 5DVOA 1S9WB 4JG0L 3DYMA 3WO4B 4DGVH 1J0YA 4PRAB 5I19L 5SWSD 1ITCA 5DMKB 2JB5L 4Y5VC 4O58H 4XBPA 1RJLB 4IRSD 1CDYA 3O6KL 3R06B 3AM8A 2DBJA 3S35H 5CAYB 4HKJB 4KMTH 2X70B 3V6OE 4Y5XA 1A3RL 1VADB 4QRPE 4HKBA 2VLMD 1QEWA 2M1KA 4HWUA 1ACYH 3EOAA 4TUJB 1F97A 5M95B 4PREA 4J23A 4JPKL 4L4VB 4F9PA 3RTQC 1AXSA 2BY3A 3ULVC 4GBXD 1KJ3H 3WNKA 1KELH 1H0DB 1HHGA 3IGAB 4ZAKD 4YEEA 4HUUA 4JO2H 3LY6A 4F7MB 3T2NH 5KJRH 1NEZA 4YPJA 5I74C 5FGBC 3L5WA 3FO2B 1TVDA 4PRPE 4WUUD 1QNZH 1G7PB 1QLRA 2DKMA 4X4XA 2AEQH 1MHCA 3T2QA 5IHLB 3UJJH 4PGDB 2WM0A 4TTGA 5FECA 1T2QH 3LVEA 1X9QA 4XRCA 3X13B 3DIFA 1T03H 3BP5A 5D1QA 3OR6B 1VFBB 5JNYB 4O02H 3LIZL 5IT2L 2ADGA 2XWTA 1NLBL 4RQQB 4WEUD 1PEWA 3ARBB 1CZ8H 4XCNA 4DN4H 4DGIL 1TETL 1SMAA 2R0LL 1KF9B 3TBSB 1YNTA 5E00A 5BRZD 1YY8B 3MMEB 5MEND 3O4LE 2VQ1A 3G6DH 1B6UA 3KPRA 4YPGA 3BH9B 3MRIA 4O2EB 4N8CH 1X5KA 1RUQH 1HHIA 1NBZB 2NNAB 1LEKB 4NRXA 2G2RB 4CMHB 2WINB 4GXUM 1W0WA 5TGBB 2IAMC 4LPXA 1AHWC 3BPOC 1GC1H 2ATPB 5L2JA 4OZGA 3LS4H 3TV3L 4KKLD 3BKYL 5C0BA 4FRWA 5CJ8A 1I9EA 2VO5A 3CCHB 2AK4B 3H2WA 5ICXA 5KSAC 1S9VA 4HG4J 2YUZA 1YDPB 1UJ3B 1S7RA 5IB2B 4POZC 2Y1VA 4ZUUB 1C5DA 1UA6H 2HJFB 4G6JL 3BEVB 2ZUXA 3PDOA 1AD9A 1UM6L 2VABB 4XPAH 4QNPE 1RV6X 3DUUB 2XQBH 4I1NB 4BH8A 4NFDA 3PJSB 1OAQH 4P2RA 5T33H 2WW8A 4HZAA 4QHKI 4FQJH 3C2AH 4YHKH 4KZDL 1LP9B 2HMIC 1V7ML 3FFDB 5CZKA 1EUUA 2YRLA 2Z8WC 4NWTL 1NAMA 3O11A 5K9JL 1G1YA 3HG1A 3L3IB 4H0HB 1VEPA 1TZHB 1YJDC 4XB7A 1PVHA 2IG2H 2R2HB 4G8GD 5FF6B 1TJGL 5T1DH 3GKWH 1L9NA 3IFOB 2NX5E 4KY1H 3H42L 4E5XB 1DVFB 1QR1A 3CFIC 2FB4L 2X44D 1XH3B 1TTUA 4UV4H 2Y6SC 4K7PY 1UWGL 4P5MB 3I02A 2FGZA 4PJ7F 4S1RL 3QDGD 5C9JB 1RIHL 4UTAH 3MLZH 4HIHA 1LMKA 2OXGA 4WO4A 1CD1B 1D5IL 4KKCD 1XIWB 2XY2A 4F7TB 1OAZH 2VKXA 4KXZI 4M7ZB 1AXIB 1WFUA 4N0YH 3PWNB 1MCSA 4YZFE 1KXVC 4KMQA 1MI5B 2D7TH 2VDQL 4P5TD 4GT7A 2X41A 2XXMB 1R3JA 5EC2B 5B8CA 5D2LA 1AH1A 2H2PC 5LAXA 3QIWA 2UWEF 5E08H 1KB5A 5F6HJ 3D25B 2J8UE 1MHEB 5FHAL 1C5CL 4NOFA 4QY8B 1ETZB 3RBGA 4I0PD 3JTSA 1FVDA 3I3BA 2M26A 4B41A 1IQWL 4OLWH 1EGJH 3KPSD 2P8MA 3WIHL 4M5ZH 1G7HB 2EDFA 2A73A 2WBJA 2J88H 1YYLL 1MREL 5E8PB 2ITDB 4RFNC 3WNLA 5F89A 5HYQA 1BQHG 1W2KT 1KNOB 1B0RA 1HKFA 2QHLA 4L3ED 3BYYA 3MRJB 3F58L 3T3ME 1WGOA 3MRFA 4K8RD 5CZVH 2AEPH 3QULA 4KAQH 4X7SL 1V3JA 4LSTH 4CDGC 3O41B 3P0YH 4JPIA 4HUNB 4C56B 3QAZB 4GAYA 1TFHA 1CXFA 3VFSB 3ARTA 4JRYB 4KZEL 3GRWA 1SJHB 4M8VA 2NW3A 5IVXE 2HT4C 3LN9A 2DYPB 3GHBH 4TSAL 3OF6D 3D18B 3U1SH 4W4OA 1JWUA 1PKQE 1SYSB 3U0WH 5FUZH 4P46C 4EBQL 5C0NC 3CU1A 3VFOB 4D0CA 4Z7WF 3VGFA 3DGCR 3FJTA 4PRHD 3AY4A 4HIXH 2HTKD 1FHGA 2ERJC 4JFYA 2X4OB 1OTTD 1JGUL 4PJGE 1RD6A 4YFLF 1Q9WB 4CADA 5DJ2B 3BWAA 1QFHA 3VFTB 1L7IH 2VMFA 4PJEB 4FQHA 5FYJD 4S2SA 5L0QC 4R0LA 3FMGL 5C8JA 1MHHA 3C8KA 4CMMB 2V17H 3IDXL 4C4KT 3NH7H 5FCUH 3QDJB 3H3PL 3TESA 3BVNA 5D1ZC 4X80L 4OZHA 2IALA 3FQRB 5L2KA 5EZIL 4DAGL 1UXWB 3RVUC 1OCWH 1EEYB 1WIUA 3EDKA 3QPXL 3NTCL 5MERA 3O6KH 2NZ9C 4J8RA 5GGRB 1P2CB 3SJVA 3FQXA 4U1HB 5I76B 1CFNB 2VH5L 1A3RH 4Z7VE 3E2HB 5EUOB 3HE7C 1IRAY 3PL6D 2NZIA 4XP1H 5ICZA 5FGCE 4NZRL 1A1NB 2NTFA 4I2XE 3DX6B 3EJZD 1T89A 2AEIT 4JFDD 4U31A 2JJWA 4H26A 4LEXL 2JCCF 2ZJSL 3S8WA 5E7FA 4FFYH 3QG7H 4YAQB 2BOBB 2HLAB 2GJ6D 1CE1L 2YZ8A 1A6ZB 4NKIH 4QOKB 2VSDA 1T7ZA 5C0CD 3B4NA 3CMOH 4LLWB 5IB1A 2L0DA 1MWAB 5DD6B 2HKHL 4KUZL 4PJ5A 2CRZA 4LF3A 3L1OL 4OT1L 2PNDA 3MRQB 3D39B 1R24A 43CAA 3D87B 4JQVC 4YHIB 2Z8RA 5KAQF 2VLRD 3BISA 3AAZB 2IPKA 3FQTB 3I6GA 3LIZH 3L3HB 5IT2H 3RZCA 1DN2A 3LEVL 3DV6A 1NLBH 3TVMB 1J1OL 2EE2A 1LEGB 1WC7A 1X5HA 4RAHA 1CG9B 3H3BC 1OSPL 4KQ3L 3TA3C 2ZPKL 2C1PB 1CTNA 3U46A 5D5ME 3U2SB 1G0DA 5JHDB 1K2DB 2WUCL 1AKJB 3QDHA 2F58L 3PP3H 4XCYA 1OWWA 4KK5C 4WFHD 2DIAA 4RAUB 1TNNA 5DJAA 5BS0D 1MAMH 1UXSA 3B9AA 1CIDA 4R96A 4YFDB 1S7VA 4YHOL 5HJ3A 3CZFB 2FGWH 4OAWA 5JO5A 3SDXB 1GVIA 5FM5M 3TV3H 1P84K 3JVGA 2IF7A 2X9WA 1J11A 5D9SA 4WENB 2X4PA 5T3ZH 4LGPB 3BIBX 2OXHA 4JGMA 4H25A 5GGSY 4JQXA 5H94A 4FQ2L 3P9LA 1O7VA 4U1JB 3QO0A 2F54A 4NJ9H 2VC2L 1Q0YL 2MMXA 3MYZA 4OQ1A 4NRYA 2WWMD 3LKQB 4Y5VB 1KLGA 5D1XA 3V6BR 5EBMA 2W9DH 4WW1A 4ZUTA 3NFNA 2XWJA 3ZYZA 5KVMC 1NCUA 5L88H 3WIFB 1MRCL 2BSED 1H9VA 1GGCH 2P44B 4A6YA 5L9DL 1NDMA 1UC6A 1UT9A 2JJTC 5LKNA 3DTXA 1D5XA 4PBWD 4NYLA 2G75B 5K9JH 4KH2A 1Q38A 4KJPC 3QNXB 4RNRA 4LU5H 4TVPL 2DQHH 3DXAB 3WFHB 4C58B 2LTQC 2V7NA 1IGYB 3RRQA 3KPPA 3TBVB 5SX4H 3I6LE 2FB4H 3AFLA 3A0OA 3NIDE 5FM8A 1FGNH 2FHFA 1UWGH 4MLIA 4MQXC 2W0PA 3QEQE 1BD2E 3MRMB 1A4JA 4IMKA 1U2HA 3EAKA 2BNQD 1T7WA 2D0GA 4ORZC 5LQBL 1A7QH 3KPMB 4Z0XB 2Q8AH 5BVJA 2GT9A 1DLHA 2FBJH 1G9ML 1IKNC 1U8LB 2W0LA 3SKMA 4X5WA 5LGJA 1G84A 3B5TA 5ILTH 1NGWB 4MD0A 4X4ME 2VDQH 4K23H 4ODHL 3MJ9L 1N6VA 3RX7A 4U1IB 2F19L 2R9HD 3UTTA 1NGZA 4EKXA 1U91A 4RFOL 3G08A 3VFVA 1AE6L 4HS6B 3VA6A 5EZLA 1C5CH 1KBGH 1AGFA 4YDIH 4P99A 1V7NL 4IOFD 1AGBA 4GKZA 1IQWH 3SPVA 1KIPA 2FECL 4Q6IC 1RIVL 1NFIB 2IAMB 4V1DA 1AHWB 3BPOB 4RZCB 2A74A 1CFVL 3A6CH 5HXMA 1J1XL 1GZPA 4X6CF 3O3BB 5GISL 4JM2C 2IFFL 1OB1B 4FHBD 4Y19B 1MWAH 4LCIL 5DC0A 3BKMH 4L8BB 2BOCB 5KSAB 2Y5EA 5AG9A 3GDBA 1MREH 1WUNT 3TJEL 3W39A 1GSMA 2YPLE 4PJHA 3NZ8B 5SV4A 3UTQB 5DC9B 4W6YB 4YWGL 5TF0A 4BK5A 1WBXB 3QHFL 1EPFA 4UIMB 1CFSA 3LPFA 4PJIB 3TH2T 3X3FH 4LIQL 5H2BA 2H1PH 4FOMA 5MEQB 4GG6F 1A7NL 5MP6L 3NZHL 3LRGA 2RHEA 4WFED 4ZFGH 3B9EA 4JFED 4XVJL 4I18A 4AENB 4KZEH 4PB9L 3VXUB 2GY5A 3QUXD 1JHKL 1A6UL 3MV01 3VDBA 4E41A 4L1HA 3FRUB 3CMGA 4XZUB 5CMAA 4EVNB 3SE3C 4EBQH 1YN6B 5I18H 5GQBA 3NABL 1Z5LB 4HMDA 3UBXA 2FZ3B 1PLGL 5FO8B 1CICD 3MODL 1Q9OA 4XBGB 2NLJB 2FX7H 1GHFL 2FJFB 4LAQL 3WEXA 3VW3H 3TIDA 2Y36H 4HXAH 3VMOA 5CILH 3CAFA 3MCLH 1S78D 1JGUH 3U6RB 3E3QE 4PJFB 1YEGL 2CXGA 4K71B 4M00A 3G5XA 2XY1A 4YHPA 2LVEA 5HDBE 5D7IB 2ZUWA 5B4MD 3W2DL 5TDPA 3QA3B 2VTFA 3QQ4B 4LLVB 4RMUA 2OL3A 1H15B 1HINH 1HNFA 4HQQH 3VXRD 3ULUC 3JV0A 5I66A 2FDBP 1U8QA 2HFEB 3BP7A 1T04A 3IDXH 4HG4K 5C0AE 1R0AL 4X80H 2X4RB 5DFVC 5EZIH 4DAGH 2P8LA 2IWGA 4QO1A 1JF1B 3EO0B 2AKRB 3QPXH 3NTCH 4JKPL 3E0GA 4AEIL 4FQ1L 5GGSA 5F7DA 1RZGA 3AREA 3MO1B 4J3XA 1X6NA 4PJ7A 3SGJC 2O61A 4NKDB 4R90H 1NJ9B 1PQZB 4TYUA 3TGXA 2BNRE 2VLJE 1BPVA 4LVHC 3FOMA 2W65A 1FPTL 5HVFB 1KEMH 5GGTH 3MV7B 3IJYB 2YWZA 3GSXB 3OKOB 3S34H 3LN4B 4LEXH 2XN9D 1N4XH 4TN9A 4NC1E 4DTGH 4NKMA 1JNNL 1T89C 3CD4A 3MLXL 4RFNB 4M93C 3RIAF 3GO1L 2UWEA 2HKHH 3N1PC 4NJAL 4U6HA 4KUZH 4QNPF 1RZIB 3BKJL 4OLZH 1WBZA 3DX9A 1I8KA 2VXVL 3OAUH 3O6FA 4BZ2L 1A14H 3UTPE 3G5YB 3KXFE 5DZNA 3LEVH 5I8KL 1J1OH 1KXTB 32C2A 2CLVA 3OKEA 1EAPB 3WMSA 3D85A 4Q0XL 2XT1B 2W60B 3L9RA 5C3LD 3ARPA 3G04A 3OAZH 4NQCE 4WI8A 3CH1A 2YBRB 3S4SG 1PYWB 4P46B 4QYOB 4UOJA 2NXZD 2OSLA 3I75A 4OGAD 2VDPH 1F2XK 5KAQG 5ISZB 5INDB 3O3EA 1YEDA 2VRAA 3ZKND 3D3VB 2XZCH 4M9PA 3LKSA 4NKOA 3KYNA 1WITA 2VDKL 3KYAA 5C0IA 1QQDA 5JW5A 3FFCA 4D8PA 4YHOH 1JF6A 3IKKA 2YR3A 5ALCH 3MBEA 4HBCL 1EV2E 3VXMD 3TN0D 2DJSA 2X1XR 2ZUYA 2G5RA 5L0QB 4YK4C 5HHNA 3VRJB 3MRPA 3RWJA 3T2PA 5EU6B 4HX1A 1INEH 4Z7WA 1H3GA 4PJ8D 5D1ZB 5TQ0H 2J8UF 1NGXB 1TJHH 1MQ8A 3DHJA 4MJ4A 2GAZB 5GRZA 4GS7C 4JQXC 3GMPB 4UIKL 4ZOBA 1PAMA 2IAND 4K8RL 1HHHA 5EH1A 4CJ1A 1MRCH 1QKZL 1FV1B 1IGTB 2ED9A 4ZTPH 3HE7B 1HH9A 4Y5XB 3VXSE 1YJDH 3EJJX 4HKBB 1QEWB 1XGPB 3EOAB 3CFKA 3OKKA 4NUGL 4PREB 5DSCA 3VFGH 4HW6A 2DBLL 2DM2A 4TVPH 4YGVA 2JIXD 1AXSB 3RIAK 4LRIA 2W07A 1S9YB 1U93A 3T3MF 1U41A 2XTJD 4AG4H 5IUSA 2QADD 4BELD 4DN3L 4K7PX 1NEZB 4Y4KD 3L5WB 3BGMB 4P2OA 1QLRB 2EC9U 4HJJL 4KJWC 5I1EH 3B8SA 4HK0A 1MHCB 1UH2A 4X4XB 5HBBA 3VE0A 2EH8L 3RA7L 1G9MH 3KPOB 4CVWA 3CDYA 2FLRT 4NQEA 1G0YR 2XPGA 4XRCB 3HI1B 1GIGH 1QPXA 2MKWA 3BP5B 5FYJL 1N0XH 4NDMA 3T0AA 2JCCA 4YGAB 2ADGB 2XWTB 1PG7X 4XCNB 5DHXB 4ODHH 4R4NC 3TA3B 4UDUA 2DKSA 4JHZA 3IFPA 3TCXA 3RKPA 3V0VA 4I8DA 4RFOH 4RAVA 4TVSa 1F8TL 1GAFL 4PJGF 2J6EA 1YNTB 1KB5L 3VDCA 5E00B 2Y07L 3WJJA 2ESVA 3H9SD 5JXAL 2CO7B 3BDBA 5DLML 5ESQA 3WUWG 2VQ1B 4FFWD 4RBPH 1V7NH 1TNMA 2MNUA 1VPOH 4YPGB 2XRAL 4R4FH 1Q72L 3MRIB 3ZSSA 1I1YA 2DQCH 3OB8A 1IBGL 2HN7A 4BFBD 4HDIA 5GSRA 5HHOE 1CFVH 3P9MA 4NRXB 3V5HA 4NO5B 4G7YH 5AZ2L 3GSRB 2C3WA 5GISH 1BBJA 1W0WB 4BFIA 4PGEB 2RAMA 5J1TC 4LCIH 4U1NB 3ECBA 2Y4SA 3RPIA 3TJEH 5L2JB 1G0XA 4HIJA 1F13A 4MNGE 1N59A 1FL5A 1ZHNA 1MCQA 4YWGH 5ICXB 3DMMA 5C9KA 1S9VB 3QHFH 4Z7VF 3MACL 3PWUA 4OF7A 1S7RB 2AK1L 5BW7C 2NY6C 2ZUUA 1C5DB 1JMZA 4NQDA 2OR7A 2ARWA 3GUTA 1I7RB 3PDOB 4PB9H 1AD9B 2GHWB 3DRTA 1SMOA 1CDJA 1A6UH 5DR5L 4BH8B 2O5YH 4I18C 3C5ZD 3QZWA 4TOYH 5KG9A 1I1AA 5CEZD 4URTB 5F21B 5CS7A 4PGCA 3PXHA 1NAMB 2LTQB 5CP7B 3HG1B 4U1MB 3RGVC 3FRPA 1YNLH 1N5AB 3QUMA 1HHKA 3QDAA 1HDMA 5I8OL 1YEGH 4OFYA 1WQVT 1F42A 1I85A 1QR1B 4PP1D 4YUEL 3RWEB 1MFDH 3WL9A 1KFAH 2DF3A 1IFHL 5T1KD 3OKDB 3I02B 2VZ3A 3PWJA 5A40E 3BRFA 1HIML 1QTYT 4HIHB 3B5GA 5D5MF 1ZEAL 4TUKL 2NW2B 4YHYC 4ALAL 4R26H 4U6VH 1TPXC 5F7MC 3M17A 4U05A 3G5ZA 4AEIH 5D2LB 1BQUA 1KB5B 2YMXH 4F33B 3JWDC 3HUJB 5J6HB 1ZT4A 1NLDL 4Z8FH 1JNJA 1YMMD 4N0UE 2VR9A 1L0XA 3C6SA 1NEUA 3JTSB 5CKGA 3TT1H 5FDWA 1FRGL 3FN0L 5GGVH 4PJ9A 2YC1A 2HVKA 4KJQD 3F7PC 4M3JA 3UYRH 3CVIL 4HUVA 2IQAA 1MJ8H 2VDRH 4JM2B 2PTTB 3TNNA 1WZMA 3MRCB 1I8IB 3QRGL 1E27A 1R3KB 1FORL 2YD6A 3GO1H 5I8CA 2A73B 5EOTA 2M2DA 1LNUA 2CIIA 5KVFL 5CJXC 5F89B 4Y8AA 2VLKA 5HYQB 3RPKA 1OTSD 1B0RB 2VXVH 1JTTA 5E94B 4BFGA 5IGXL 4G42A 3MRFB 4ACPA 3KYKL 3NCJH 2GW5A 3QULB 2K7PA 5EO9A 1JYXA 5I8KH 2PO6D 1DP0A 1ZGLM 4HJ0D 2FEDC 3BQUD 4GAYB 4LNVA 5GJTL 4X6CA 5IMMA 3W81A 1FNHA 1FGVL 1OP3K 2NW3B 5TDOA 2J7LA 4N9OB 5TE7H 4YNYA 1WCBA 1SHMA 1JWUB 5FCSH 3MZGB 3WNPA 3RDTA 2FEEI 3V4UL 5B39A 2OCFD 4LASH 1DEDA 3E1F1 1JGLL 1BZ9B 1N64H 4NKQB 1RSFA 3W0WD 3UJIH 1FNSL 4B7IA 1TVHA 2X89A 1MVUA 3SGDI 3V6OA 4QRPA 5I0ZA 4EI6A 2VDKH 1JN6A 5D72L 4JFYB 1RURL 5DA4A 4JKMA 2YA0A 3AS3A 1E4JA 3MROA 1F3JA 5C6PB 3O3DA 2EXWC 1AO7E 4HBCH 4U1GB 2FBOJ 3BWAB 1EFXB 3UDWC 4FQHB 5I75C 4S2SB 2YXMA 4PRPA 4R0LB 3WSQL 5C8JB 2VWEE 1QP1A 2BVOA 3C8KB 3H7BB 1RI8A 4QXTA 1K9TA 1LP9E 3BEWA 4UIKH 4OZHB 4KQ4H 4X4ZA 5L2KB 5KZCB 1QKZH 3U9UA 5FDYA 4KI5D 1SEBA 3SGEI 1FVCA 1CGSL 4Z0BL 4Q6YA 4LVHB 1JGDB 4FQLH 2RGSA 4JFQB 2ZG1A 1NAMH 4JREC 5IVZB 1U95A 3CC5A 3O4LA 5ICZB 1NGPH 3ETBF 5ID1A 4RX4A 5F6HI 5T3XH 2JE8A 4PTTA 1TVBA 1C5BL 3KJ4C 3MRBA 4YDLC 3WKML 1MI5E 5JQ6L 1T21B 4PJ5B 3GJFA 3SKUD 1NC4A 2EH8H 4LF3B 4UT9H 3RA7H 1JWSA 3RFZC 1G6RA 1QLEL 1R24B 43CAB 5HHMB 2PXYA 2OR8A 3T0ED 3I6GB 1WSST 3TLRA 1OM3L 5J57B 1G9NL 3RZCB 3DV6B 4Z76A 4LHUA 5IBUB 4NM8L 3RU8H 4KROC 1WC7B 4H88H 1QVOA 3Q5OA 1MLCA 4KTDH 4LOUC 4Y2DA 4RGNE 3VWJA 1FDLH 2B2XH 5DD3H 1F8TH 5I6XC 1KB5H 1KCLA 2Y07H 8CGTA 3EO1B 4BSVA 2Y72A 4X6FA 5HDBF 3U46B 4WTZA 4J2XA 4YHZL 4RMQA 5F6IB 2DQEH 4NQXA 2EZ0D 4TPRH 1Q72H 3QEGL 3WJJC 4ZUWA 4Z7QE 4UDTA 4PLKD 4XCYB 5C08D 5DJAB 5T3ZE 2DM7A 1WIPA 4G8EA 5AZ2H 4R96B 1S7VB 4YK4B 5F9JA 2UZYB 5HJ3B 4OAWB 4GRLA 1ZHBB 2ICWI 2NX5A 4OUOA 4S1SL 1JPGB 1ACZA 1J18A 2LAAA 2FRGP 4JRYE 2X4PB 4Y4FD 2PTVA 5CZXC 4H25B 5H94B 1SJEB 5IMLA 1N5YL 3EFDL 1L0QA 1OT1A 2F54B 2NR6D 3QO0B 4U6XA 1CDGA 5DJ8A 2AK1H 4Q9CA 4XVUC 4NSKA 1N3NA 4F9LA 1KLGB 1JPSL 3WDIA 1MCDA 1MSPA 5D1XB 3LEYL 4OD1L 1CXLA 3GRWH 4WW1B 4ZUTB 3NFNB 5IB4B 5DHYA 2XWJB 3IU3A 3SKJH 1M7XA 3LKRA 3O45A 4P5KA 1FAKT 1IKFL 4A6YB 5JA8B 4ZXBA 5GHWL 5EIIA 1NDMB 1UGNA 2X40A 3D2UD 4GKSA 1XGYH 3DTXB 4MJID 2XQYK 1T0MA 4NYLB 5I8EB 2J8UA 4ODSL 4LBEA 3QPQD 4RNRB 3U4BL 3HB3C 4DK6A 5GS1C 2YD7A 5I8OH 3LB6D 5F7YC 3BO8B 4UV7H 3C6LC 2V7NB 4OZFA 4FFVC 2MPAL 3KPPB 4JY6A 2AJ3A 4I3SH 3QDMD 3ET9F 3IDUA 4YE4H 3QDJE 3WFCL 2Q86B 4BKLA 3ULUH 3VWKD 3U0TA 1URLA 5CSBA 4GLRI 4RGOL 4PJAF 1A4JB 1I3RA 2OL3L 3WHE0 5BVJB 2X4NA 1OGAB 4N1CA 2E9IA 1DLHB 3KNBB 2JB6A 1FFOA 3VFPB 2DWEA 1ZEAH 3OJDB 1T22A 4HAGA 2VLLA 2VB5A 4MD0B 2NXYD 3FTGA 4JDTL 2DI8A 1NDGA 1XGUA 3UC0H 3RKDC 2G9HA 2IPTH 2P46B 3WJLC 5DS8B 4EI5D 1CQKA 4HIIA 1E4XI 3UTTB 4ETQA 1NGZB 5IOPA 1U91B 1KENH 3G08B 4N68A 4F7CA 3SCMA 3V0WL 3HZKA 4LLYB 5EZLB 2Y06H 5IVXA 4AMKH 1HXYA 4K07A 4ODUA 4OLUL 4IRSC 5INCA 4QOKE 1PKQA 1FRGH 3FN0H 2GSIA 4GKZB 2BNUA 2DQGL 3CZJA 3PWLA 3SPVB 1KIPB 4HBQA 5ALBL 3HZYA 5F7LB 3HNTH 2NY5L 3RAJL 1OSZB 2A74B 3NCEB 3O0RH 3OKNA 4IOIA 4M61B 5ESVB 1GZPB 1NUNB 4GBXC 1A9EA 4AH2A 1DEEA 3WHE1 4PJGA 4ZAKC 4IDLA 4KHXH 4MQSB 4PRIE 5C09E 2FL5B 5KVFH 1KIQB 1YEJL 1U3JA 3W39B 4PJHB 4P3CL 5JOPE 3TIEA 4D9LL 3QFJD 5D70L 1VKXB 5J13C 1X3DA 5ITFA 4OF3A 1CFSB 3GSNL 3KYKH 1U8JA 5H2BB 4MXWL 1WZLA 1Q1JL 5GGQL 2AJSL 1IAIH 3LD8C 5JHDE 3CFEA 4X4YB 5E4EB 4K7PH 3VD3A 5GJTH 4BQBA 4I18B 4I3RL 5IESL 4ZD3L 4JRWA 1T0NB 5A2IH 1EFQA 3FAXA 4E41B 1OY3B 4YBHA 4IDJL 4U7KA 4P4KA 4XNZB 3NAAL 4E42A 3N1FC 4GMSL 5A16A 1INQA 3DI3B 3RGVB 2RJMA 4JFZL 3SDXE 4TSCH 3BP6B 4MB3A 5CD3A 3K3QA 4Z7VA 2NY3D 2JJUA 2DLHA 4YDJA 1PG7H 4KK6D 3T4YA 3WEXB 3TIDB 1MY7A 4FFZL 4H0IA 1RURH 5ETUA 3V6OC 1UWEL 1FQ9C 3FQWB 4I2XA 3G5XB 3ILPA 2D3VA 3BW9A 5I1HL 3VI3E 5MHSD 2CIKB 1X5JA 1KJ2A 5DMJB 5TDPB 3MJ8A 1DBBH 2EXYC 1A0QL 4XXDA 1WWAX 3MOAL 3PWPE 2OL3B 3PE9A 3P77A 1FFQA 3ARSA 1U8QB 1CGYA 2APWA 2KH2B 1T04B 4KKLC 1DANT 1TPXB 3JWNC 5E1HB 4JRXD 3SDAA 3PV7A 3RL1A 4PRBA 1FZKA 3HZVA 3PHOA 3ULVE 2VIRA 1I8LA 2P8LB 4JO4H 3HI6L 1F4YL 5ESAA 4AM0A 4A6YH 3T0VA 1IM3A 5BXFA 4JFFE 2VDNH 4Z0BH 5GGSB 5F7DB 2AGJH 3O6LL 1RZGB 2O61B 3V4PH 1BP3B 3KHQA 1MQKL 4HWNA 5CBEA 2VXSH 5D5MA 5JXED 2DLIA 2RB8A 2Q8BH 1EMTL 1IGFH 2VXUL 2CGRL 1KULA 5DRZB 3ZYJA 1EUTA 4OBRA 1IAOB 5E6ID 1NC2B 4MA7H 5GS3A 3SDYH 1OTUD 1GOFA 2O5XL 4IRZL 4J3VA 3WKMH 5DMGD 2A1WH 4NO0A 2UWEB 3NCYP 4L9LC 5JQ6H 4U6HB 1QSZA 2ZCHH 1VACA 4KPHH 1MRFH 1JZ3A 2DI7A 3N9GL 1NBVL 1WBZB 3DX9B 1I8KB 2ATKB 3PWVB 4R4BA 1QLEH 1HYRC 2XQYG 3O6FB 1K4DB 2WV3A 2P43B 3E6FB 3K4ZA 1MAKA 2Z35A 3UTSE 1OM3H 1KN4H 3WXWH 2CDFB 32C2B 3OZ9L 2CLVB 1JNHA 3OKEB 3PQYB 4KKCC 3RNQA 4PLJD 2PXYC 3D85B 4WW2C 4MA1C 1B2WL 3G04B 3L5JA 3CH1B 2HVJB 1YEIH 3RWFA 1T83A 3VD9A 4P5TC 4M7LL 3KWWA 2OSLB 3I75B 4YHZH 1VCAA 4RMTA 3QEGH 3O3EB 5TPWH 3SBWA 1J05B 4D9QE 2N4IA 2QEJA 4N8PA 2PCPA 4WEMB 3GBNL 3SE9L 3JUYA 3LKSB 4I0PC 4NKOB 3KYNB 1HWHB 5C0IB 3EDJA 4Y8DC 5CJBA 1QQDB 1T1ZB 5JW5B 2AV7A 3FFCB 4PV9A 4D8PB 1FSKC 1TMCB 4OFVA 1TZIA 1ZGLP 2HG5B 2IQ9L 3MBEB 1VENA 1FNFA 5I75B 1AQKL 4S1SH 4NZUL 4MQTB 4OFIA 5HHNB 4KDTC 3F6LA 3MRPB 3RWJB 3VXUE 1MCCA 3S98A 1BJ1H 3QEQA 1BD2A 5GGUB 1KCUL 5HHVL 5DYOA 4ELME 5J11B 3CDCA 3IFNH 3H0TA 4L4JA 4ZSOB 1TCMA 3RQ3A 4AEHL 4ZOCA 4OD1H 2EICA 3CK0H 1H8SA 1P4BL 4K8RC 2IGFL 3TZVA 3DYOA 5J56B 1HHHB 2R4SL 2FYYA 4X4MA 1FN4A 4JREB 1JHTA 4KV5E 1P9MC 3BN3B 1HH9B 2FLBT 2OLDA 2NCMA 4KKAC 5D7IE 3MV9D 1F2QA 5EO1A 5C6TL 2C5DC 3MJGX 4HS8L 3CFKB 1IGIH 3OKKB 4WFFE 3FN3A 4YGVB 5FK9A 3QBTB 4DW2H 1HE7A 3BE1H 4MDIA 2MPAH 3KJ4B 4FTVB 3HNVL 2P5EE 4WUKL 1RMFL 1U93B 3QEUA 4YDLB 3DURA 1U3ZA 2HTKC 1RULL 3WFCH 1NSNH 3MLVL 2X7LA 5HYJD 3CDGB 2XNAB 1OTTC 4RGOH 4LCWE 4N90D 4P2OB 3CSYA 3LZFL 5ADPL 1KACB 2OL3H 2PR4H 4NO3A 2VOTA 1J8HD 4PV8A 3VE0B 1MCKA 3EOTH 2DM3A 1YEKL 2MJWA 2WMPA 4GKOA 4IMLB 4OCRH 5IR1A 2XPGB 4APQA 3KYMA 4UB0H 1SY6A 3X11A 1FAIH 4NDMB 2JCCB 4EDWL 4S1QH 1BAFL 3GMRA 2XKNA 1UVQB 4UDUB 4LLMA 4M48H 2Z8VC 2DQFA 3IFPB 4XNQA 3MLTA 3S5LA 5D6CB 4RAVB 3EBAA 5I0DA 2J4WL 2ESVB 2NTSP 3QQ9D 5CCKH 3BDYH 5ESQB 3KS0H 4NP4L 3W5MA 4TULL 5GZND 4KRNA 5DQJA 3GSOA 4JO1H 3BKCH 5JORA 1I1YB 4MCYB 1OW0A 3O9WA 2C1OA 3Q2CA 4HDIB 3P9MB 1YQVH 2DQDL 3PL6C 5BMFH 4HEME 4LFHG 3HLAA 4EZMA 1LP9F 4UAOC 4LPYA 1INDH 1JIBA 1UACL 3H6JA 5HI3D 4PLNC 4NPYA 3GSWA 2I5YL 1QFWI 3ECBB 5T1LD 3Q6FA 3RPIB 5DFWH 4HIJB 1N59B 2QL1A 1FL5B 4HGMA 4D9LH 5HHPA 3DMMB 1ONQB 1EEQA 4HULB 4MXWH 5JA9A 3PWUB 2W0KA 1FG2B 1JRHI 3CU7A 4XNUL 5ISZE 5C0AA 3ARGD 4R7NA 5IESH 3GUTB 4ZD3H 3D3VE 1RUPH 3S88L 1HILB 2B5IB 3DRTB 4GQ9H 4AL8L 4G6KH 2I9LA 1U8HB 2XZQH 3KPTA 3NAAH 2CMRL 1M71A 3QZWB 4HPOL 5GJSL 4BZ1H 4GMSH 1KPUA 25C8H 4BUGA 3BMWA 4JFZH 1I1AB 1PBYA 1W0VA 2EIZB 3KPQA 1QBLH 3R0NA 1T5WA 2BMKA 4PGCB 1JK8A 1T6VN 2X4TB 3DVIA 3C6LB 3SDCA 1UKTA 4JN2A 4GW1B 3V7AG 5EU6E 3QUMB 1HHKB 1HDMB 2BNRA 3DROA 1G7IA 2VLJA 3C5SA 5IFHH 2O5ZH 4QHUB 2P7TB 4WI4A 2H9GA 2DQJL 5K9OA 3UO1H 5E5MB 3BD4A 1UZ8B 3OAYK 3WL9B 4LVOC 3CVHA 5FEBA 1T2XA 5F7HA 4M7JL 1A0QH 2YPLD 4K2UH 2OTUA 3IETB 5HVGB 3I9GL 4JR9L 3PWJB 1OLLA 4WY7H 5KW9L 2GTWA 3EUUA 4HSQA 4H8WH 1QFWM 5JOFA 5D7JD 3VRLE 5J06A 1QZ1A 4CDHA 4ONHB 5KVEL 1LK2A 1RU9H 2FCBA 1IC7L 4G9FD 3IDMA 4Z7QF 2NY0D 3VH8A 2QSCH 4GMTL 3KXFA 3JSSA 4J6RL 1FFPA 3M17B 5DK0A 5IV2A 1I8LC 4IRSB 4NQCA 3F5WA 4I13B 3TF7C 3MTRA 1ZT4B 2AQ1A 2YA2A 3GNML 5HGDB 1OOAA 5FDWB 1AR1D 3QO1A 5BV7C 4PB0L 2CGRH 2R0WL 3FO0H 4NZTL 4RWYH 4AEFA 2IQAB 2A6DA 2EKJA 3A6OA 2MTPA 1ZWIA 2F53D 5L7XH 4FXKA 4GBXB 1FLRH 2AJYL 4P9MH 3TNNB 3NPSC 2RFXA 3OGOE 3PGCA 4L1DA 4ZAKB 4G6AD 1IC1A 1E27B 4KVNL 3GJEA 5EOTB 1ORSB 4BK4A 3X3GH 4EN3D 1LNUB 2CIIB 4WUUB 1I1RA 5J13B 5F9WC 5CEXA 2YWYA 2B1AH 1DLFL 5D2NA 4PJBE 1DN0B 1G6RL 1UM4L 4U0QB 2SEBA 3TCLB 4G42B 4XC1L 4Y88A 3MLSH 4N8VA 5B22A 2YK1L 2X9YA 2Q7YB 1NMBL 5IMMB 3CLEH 3S97C 2J6EH 4XP5L 3ARFD 4M7LH 1WCBB 1BVLA 5I1CL 4RA0C 1CXIA 3RDTB 5B39B 5MENB 4X99B 4EIZC 2R9HC 5EBLA 3D5OF 3S3JA 5IHUL 1TVHB 1QOKA 5D8JL 5IBTL 1MVUB 3KVQA 3VXSA 4QRPB 3N1QC 1CLCA 1C1EL 2CR6A 3MBXH 4EI6B 4LHJB 1JN6B 4IOFC 2MKLC 4X9FA 2HFFA 3MROB 1F3JB 3PP3K 4XMLL 1AQKH 4NZUH 4ZS6D 3WFEL 1OAUL 3N1GC 1V3LA 5AUMB 5IQ7H 4JHAL 4F2MB 1BIHA 2B20A 3TBWA 5J3HD 1IVLA 1ZTXH 1E28A 1F90H 2BVOB 2NY1D 1KCUH 1YNKL 3OSKA 4QXTB 4GH7B 4OQTL 2ICEA 4DVRL 5KVGH 4G6FB 2R69L 4OLXL 1U3HD 3BEWB 4MZ2A 1PFCA 3IDJA 4XAKD 3B9KD 3SE8H 2IGFH 5EPMB 4P23D 4JM4H 3LMJH 4U2YA 5MEPB 1UCBL 1TDQA 3NA4A 3NA9L 3FT4B 5FV2A 3V9FA 3F6IA 1MIML 1OHQA 4YC2B 4K3HA 4Y4HD 1SEBB 2D03L 3TZVC 1FVCB 1XFPA 5D71H 3QUXC 5FYLE 5DFTA 2WWKO 5IK3B 5I73C 4WHTA 1F3RB 3RY5A 5T3XE 4CKVX 3QFDA 4RDQF 1U95B 2D7NA 1MNUH 3O4LB 3QUMH 1CLYH 1E4XL 5F9OH 5I15L 5I1KL 2AABH 1H3WM 4LFHD 3B43A 4W6XB 4MNQD 1CICC 1WEJL 3FB7B 4YIQB 2FATH 1EERB 2DQTH 4XPTL 1RULH 3MLVH 4EUPA 4PTTB 3VFMA 5HHOA 5LXGL 1ZSDA 2R56H 3X12A 1CCZA 3N0PB 3OV6A 4BSWA 3MRBB 4NQVA 3QG6A 5DUPL 3LZFH 1GZQA 4JGJA 4KC3B 1B3JA 3GJFB 3P11H 1NC4B 3QHZL 5I30H 2EDOA 3AS1A 4U6YA 1JWSB 1YEKH 3G5VA 3QDGB 5B4MC 3S3SA 1ITBB 2DMKA 1G6RB 3DO7A 4MNGA 3IS0X 5GPRA 2PXYB 3HUJE 5EBGA 4MA1B 3SDXF 2R23A 1GGIL 4Z76B 1BAFH 3OKLA 1GGYA 4XCEA 3U36B 1Z9OA 4MMZC 1PGRB 4JFPA 3LQMA 3VWJB 1XT5A 4HGWA 5E8NA 4FN0A 3V8OA 2HRPL 4BSVB 4X6FB 4ZFZA 1A6TA 4NP4H 4NQSA 1XF4A 4Q9RL 3VI3F 1YPZB 3HS0A 2XA3A 4U1LA 2HJLA 1P4LB 4NQXB 1T20A 4I0PB 3KJ6L 1J0IA 1DZBA 3VGAC 2VE6A 4UDTB 1Z9LA 4AT6A 5ACZB 1YEEH 1TQBB 3FO9A 3MRGA 2DQUL 3KPSB 3H9HA 3UJTH 5F9JB 5FA3A 1NFDE 3VU2A 4PJCB 1DQML 3TO4D 4GRLB 2I5YH 3O2VL 2ZNWA 3ULVF 2NX5B 3D48R 4XPHL 3DRQB 5SWZE 3K1KC 3EOBA 2WP3T 1D9KD 1DSFH 5LWYL 4PJDE 5IMLB 2WK2A 4U6XB 4OF8A 4HWEH 1RUML 5DJ8B 4NSKB 1N3NB 1ZGLA 1RJLA 4OCWL 4ZYKA 1Y6MR 4XVSL 3EYOA 2QQLL 4J1UA 4QXWA 1P1ZB 2ICES 1RJYA 3LKRB 3O45B 3OX8A 2AI0L 4ZUSB 4ZXBB 5EIIB 1IGCL 2BCKA 1CGVA 2UV3A 4OF5A 2D0FA 4LSQL 4GKSB 1T0MB 3IGAA 1H0DA 2Q7NA 2NXZC 2J8UB 1NCCL 4YDKL 4LBEB 3ULUE 4OGAC 4XNMB 1II4E 4PRHB 5C07E 4N0UA 3VI4F 4MAYD 5JUEL 1MEXL 1MRDL 3HC3H 3ZKNC 3QJFB 4OZFB 1H5BA 3MJ7B 2AJ3B 3BGFB 1NANH 1PEZA 2W0FB 4QCIA 3QI9D 4BKLB 5E4IA 4QWWD 1KJ2L 3U0TB 1AI1H 2FIKA 1AXTL 1U8MA 1VFBA 3OR6A 4JPWH 1I3RB 4NC1C 4P2QD 4GW4A 2O26U 3TN0C 4DZBA 5D93C 3K8MA 3WFDH 3ARBA 2MHAA 2JB6B 1LO2L 2DWEB 2OJZL 5C0FA 1QSVA 1BZQK 1T22B 5TE6H 3HN3A 2CQVA 5EA0L 3MRDA 3TBSA 1B0WA 4PJ8C 3FTGB 1NDGB 1XGUB 1EVTC 4YHML 4GMTH 2G9HB 3MMEA 1U8OA 2QKIA 3NGBB 5F72S 1BWWA 3GMNA 4HIIB 2Q76B 3U48A 1IL1A 3HNSL 4ETQB 5IOPB 2EIDA 2ZG3A 4UBDD 4PJIF 1KC5H 1QG3A 3SCMB 2D2OA 3NCYS 2Z9TA 1NBZA 5IVXB 3QQ3A 3WFBL 2QQKL 4C59B 1CVSC 1G6VK 4ODUB 5F7FA 1LEKA 5ID0A 3HE6D 2N7BA 5INCB 1J0ZA 5HVHC 1PKQB 1WAAE 5EORH 2GSIB 4PB0H 3PL6B 4NZTH 1EEUA 1A2YB 3NFPA 4NNPH 1IT9L 4UAOB 2ATPA 1DQLH 4JFDB 2HTLD 1HI6A 3OKNB 3DSNA 4L8CA 1DL7L 5HHME 3CCHA 4GUPA 4AH2B 4H1LA 3KG5A 2YOCA 5CJOL 5C0CB 4PJGB 3MRHA 4ZO7A 2XTJC 3GJFH 3RZWA 1AO7A 2QADC 5IB2A 1U8KA 1LO0L 3OBAA 5E99L 5F7UA 3W5NA 1DLFH 1Q0XL 5FO7A 4X7EC 1G6RH 4Y4KC 2HJFA 3TIEB 1ZE3C 3FZUD 1FNAA 4O9HH 4P2CG 2CK0L 2X9XA 4PJFF 2HAZA 4KV5F 5ITFB 3JWOL 4WHDA 5HYFA 4PRDA 5D7IF 5D2NC 4JFOA 3NOIA 2JK5A 3PJSA 2N56A 5EB9A 2QJDA 4L9DA 4ONGL 4GXVH 1CGXA 3O2DL 4PUBL 4KKNA 1LP9A 3Q6GL 4L4VD 5DEZA 4R7DB 4LSVL 1U2CA 3FFDA 4XP5H 1KPRB 2EEBA 4QRTB 5I1CH 4P4KB 3TO2A 4N0FA 4XB8A 3OG4B 1E4WH 1TZHA 3FT3A 4DKDC 1INQB 2GEEA 3N50A 2R2HA 2L4OA 5FF6A 2UY7A 2J8OA 4K3JH 3IFOA 1LHZA 2BSSA 5IBTH 4UILL 3UZVB 3VFWB 4E5XA 3WS6A 2VXQL 4E9LA 5B38A 5CD3B 1WZKA 4QXUL 4MWFA 4FFWC 4Q9BA 3ZE0E 3LQZA 3DETD 4AEEA 3I6KA 2GCYB 5FGCB 3L3DA 3N85L 4LVOB 4I2XB 1FIGL 2W9EL 3ILPB 5JW3H 4XMLH 3MNVB 2A0LD 4MVBD 1CXKA 4IRJA 1KN2L 4F7TA 3H3KA 4JHAH 1C16A 4XXDB 2HYMA 5FYKE 5J4MA 2AXGA 3N06B 1MI5A 1YNKH 3L7FA 2WQRA 1CBVH 3SDAB 5D6DC 4Y5YA 4FQIL 3MPCA 2FX9L 4PRBB 1FZKB 3HZVB 3PHOB 2P1YA 4P57A 2I07B 2MQCA 1MHEA 1UCBH 5A2KH 3NA9H 1ETZA 4XMPL 1MIMH 4AM0B 1QFUL 1RHFA 4JDZA 2Z31D 2D03H 4L3CB 1BEYH 5SWQB 1RZJL 3QXAB 5BV7B 5DDHA 5I16A 1P4IL 2UVFA 3C5ZC 4XX1G 3QUYA 3NPSB 3QH3A 2AK4D 1FC2D 4OZFH 3ZE1E 1OGAE 4MSWA 1KGCE 4TRPH 5E8PA 4XPTH 1BF8A 5ELIA 4G8FB 1ROWA 3BD3A 3CSPA 3QWRD 4ODXA 4ZMAT 4GKNA 4DKFL 3CFCL 3SN6N 1QSFE 3THMH 1KPVA 2W9LA 2CO6B 3MRKA 4L3AA 5DVMA 1HOCA 1SJXA 1VACB 4RRPG 4PP1C 2BNQB 3O41A 4M7KH 4R4BB 3TH4T 3AVEA 4XCCH 1EIBA 4JRYA 4I77H 4OLVL 2DQIL 2Z35B 1QFWL 4DEPC 4Y0GA 2Q6WB 2FD6L 2GYSA 4IOSD 1JNHB 4Q74A 4O5LL 3RNQB 2IPUK 3WDJA 1I9RH 3JZ7A 1W8OA 1RZKC 3RWFB 1YEFL 3IJSA 1MIEL 1QBML 1X5YA 5EUKB 1DVFD 1TZGL 3KWWB 5DJZA 3ISWA 1JRHL 2DJUA 4YEFA 2X4OA 4EOWL 1IZJA 5HI5D 4HS3A 2IH1B 2PCPB 2PUQT 4MXQD 1VFUA 4U2ZA 3V6ZA 5DJ2A 1P6AB 4RBPK 5DQDH 3OMZA 3BRDA 4OZ4A 4Y1AE 2ZG2A 5IIEB 3VRLF 2UUDH 2AV7B 3VFTA 4KJQC 1XIWD 4N5UA 1TZIB 2OK0L 3FT2A 4XI5D 3O2VH 2VL5B 2BY1A 4BJLA 4CMMA 1MCOL 5CP3A 3QDJA 3UYOD 3KLHC 4UTBL 1BVKB 1B4JL 4JFHE 3QEQB 3FQRA 1WZ1H 4NCC1 3IF1A 1EEYA 1IEBA 1OTSC 4OCWH 4IJ3B 3H0TB 4XVSH 5DRXB 5F1IB 5I76A 2QQLH 4CGTA 1NCWL 4JFEB 2EC9T 3ARQA 2QLVB 3HMWL 3TZVB 5SX4I 2E3VA 2PO6C 2FYYB 5I73B 2AI0H 4HPYL 4HJ0C 3BQUC 1RZ7H 2E9JA 4OCSL 1KCSL 4LSQH 1I3GL 3M07A 5ICYA 2KZWA 1MFCL 1HEZA 5EO1B 4YDKH 4QRRE 4YAQA 1KCRH 3TT3L 2BOBA 1CICB 5HTSA 3ARDD 3LS5H 4QOKA 4UMGA 4X7DC 5JUEH 4PJBF 5FK9B 4LLWA 4MDIB 4EIGB 2E27L 3QEUB 3WXVL 3ZLQC 3DURB 5F96H 2X7LB 4LPWA 2HKFH 1KJ2H 3GI9L 4C56D 2OQJB 2YPVH 3QCTH 4YHIA 2MCPL 5T5FL 3CSYB 1CD9B 3AAZA 1DE4A 4NO3B 4PV8B 4H20L 2DYPD 4PRIA 5C09A 4IBLT 1LEGA 2YUVA 5IR1B 2ZSWA 4HMEA 4APQB 1BQSA 4TNWK 1GGBH 2CKBA 3X11B 1CG9A 5E2WL 1EO7A 4ZPTB 4DZ8A 1OARH 3GMRB 2XKNB 4X9IA 4LLMB 3BZDA 3HNSH 5HHXH 1X5XA 5JHDA 3UXFA 2DQFB 4XNQB 3MLTB 3S5LB 1AKJA 4ZNEE 5CBAA 1RUAH 1JPST 1ZLVK 4DKEL 4KI5C 4D9RD 1JGVL 2P45B 1S9XA 3DUHA 5HYSA 1CDUA 3FOLA 3CZFA 3MNWB 1IT9H 2C1OB 2Q3ZA 1MLBB 4M62L 5D7SL 1F02I 3SDXA 1RUKL 4DGYH 5BO1H 3OKMA 5E0QA 1Y0LA 3R8BB 3HLAB 2FHCA 3ELAT 3PNWB 4GG8A 5CJOH 4HH8A 3MA9H 3GSWB 3EHBD 5L8KB 4MGXA 3PQYE 5CUSL 3WNMA 3F65A 1LO0H 3HR6A 4CVUA 4JN1L 1D6VL 4D0BB 4Y5VA 5HHPB 1Z3GH 3QIUD 4DGVL 2A9MH 2HT2D 5DTFA 3PWPA 2R1YB 3MOQA 4O58L 4ZFOA 4XGZB 1GH7A 1KEGH 1BJ1J 2DJ4A 4ONGH 4HJGA 3Q6GH 3S35L 3VJ6B 4YO0A 5DT1L 4KMTL 3T0EC 4PG2C 1T1WA 3GKZA 5BZWB 1A1MA 2F8OA 3RTQA 2ARJA 3LAFA 5CGYD 5I1LB 5EFIB 4FABH 1ACYL 1RVFL 2ZCLL 3QNXA 2E9BA 3FFCE 2AJVH 1F4AA 1MCFA 5FA4A 4JFFA 5FGBA 2BMKB 1JK8B 4JN2B 3KR3H 3SKNA 4JO2L 1IAMA 2VDMH 3T2NL 5KJRL 2LE9A 2EZ0C 3D39D 4GRMA 3UPCA 3FONB 5D2LF 3C5SB 3VG0H 2X1OA 3WS6C 1QNZL 4KTYA 4PLKC 2H9GB 2W9EH 3HUJF 5K9OB 2AEQL 1BJMA 2IPUG 3UJJL 2X1WL 2RCSH 4J3WA