3V4UH

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
EVKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVANINYDGSSTYYLDSLKGRFIISRDIAKNILYLQMSSLRCEDTATYYCARLTNGYLDVWGAGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLESGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH01
4P0DA 3IDIB 2J8UF 1MPAH 4F7TA 1XH3B 2BNRE 5DD6B 4KC3B 4WNQA 3FZUD 4PGEA 4UBDD 1QVOB 2XZCH 2W91A 3V5HA 3KPNA 4YHIA 3BFOA 1DP0A 1DBAL 4YAQA 3G6JA 3ZKMD 1BWMA 4X6DE 4PJHA 3U7WH 5CSGA 4Y19D 3CFBA 4HDIA 1VESA 2FYYB 4LPUA 5DZOA 3MJGX 1FFRA 5E08H 2A2QT 2YXFA 4U2YA 3TPUA 2NY6B 3QPXL 5KSAA 3GMQA 5IR1A 5B3JE 3QUZA 3DV4A 3IS1X 4ENED 2R0ZL 1JNLH 1BLNB 1F42A 4FNLH 4YX2H 1LK2A 3TO4C 3CSYA 4TYUA 4P5TB 2JCCE 4LLDA 1RIHH 3FT3B 2Y07H 1RZKC 1LDSA 3M8OL 3X13B 2NY4B 3U82B 2J7LA 1T2QH 1J5OH 1I1CA 1IAIL 1QBMH 2PR4L 4DFHA 1EH9A 3UTTA 1HILA 1ZLWH 4LLAA 4OM1H 4J3SA 1U42A 4MJID 1P9MC 5FGRA 1CU4H 4XNZC 4DGIH 1BIIB 1CFBA 4KJYB 1IEHA 5J89A 4HS6B 2PW1A 3WO3B 1BP3B 2C3WA 2NZ9D 1BLNA 3AS2A 4S1DC 1QBAA 4HULB 3MOQA 4EBQH 4P5TA 3PWJA 3QXWA 3U79A 3P30H 5SWSB 1JHTA 1NLDH 3C08H 3IGAA 4GOSA 5E8PA 2EDLA 3QFJD 4MXQD 5DUBA 4KK6C 2XA8L 4XRCB 3PWNB 4LQFH 3VE0A 4GRLD 5I16A 2IQAA 3H8NA 5DMYA 1P84J 3F6IA 4P2OC 5IBUG 3THMH 2AI0L 1TJGH 3GDBA 4UV4H 1BIIA 3IXAB 1LP9F 4JVUA 3KR3L 2HFFB 4HS6A 2O5XL 3PQYB 1NBQA 4FMFA 4OCNC 4LLUA 1NANI 5AWNL 2WK2A 1T7ZA 4WW2F 1HNGA 1OGAB 4NQDA 3WS6A 4TULH 1G0DA 1I85C 4JFDE 5JIHA 1ZGLA 2IFGA 1QLEH 1FN4B 5SWSA 4XNZB 4UUJA 1KXQE 1QYGH 5IBLC 4Z7WE 4NO5A 3O6MH 2OM5A 3DYMA 4PJ5A 4XRCA 3PWNA 4QNPE 3FB6B 5E2WL 2X89D 4ODHL 3RUGE 4DGYL 2QQNL 3EAKA 3F7YB 1WTLA 1HKLH 4LAJH 2YC1B 2YUWA 4R6UA 5F7LB 4RX4D 4CW1A 4PY8I 3RHWK 1TETH 2HFFA 2H32H 1YMME 5CBEB 5LAXB 5E9DD 3I02B 1JF5A 3MUY1 1A6UL 5J1AB 4OGAD 1DUYA 1ETZB 4HCRA 1BBJA 5BVPL 4P2OB 5EO1B 4PGJA 2R8SH 4X7DC 5CEXB 3WHXA 1WWWX 4UB0H 5BZDA 4FFZL 3ZDZF 3GSNB 2Q6WB 4OCWL 5IM7B 5L0QB 2JB5H 4XGZB 5F1OB 3GNML 4KK8D 4NNYB 4M1CD 3UTOA 2YC1A 1X5ZA 5D7LB 3W11C 1D5MB 3PL6C 2PXYD 3O8XD 4BH7B 3BEWB 1FNSL 4P3DB 4GW5B 3M17B 1CR9L 5CBEA 5LAXA 2OR9L 1NLBH 3F8UB 3JWOL 5BV7H 2I07A 5F6HJ 5J1AA 1A3QA 1HOCB 2P8LB 3EYOB 3PV7A 2R0WL 5EO1A 3NBNA 3OAYK 3KPPB 3FN3A 3V0AC 5J12C 3A6BL 4ZOEA 2IALA 1KJ2B 1YY8A 2ZUVA 2Q6WA 4YHNB 2FR4B 3HMWH 3MFGB 5ITFA 1OAZL 4XGZA 2EIDA 1JZ6A 1EJ6A 2Y6SC 1D5MA 4BH7A 1OAYH 4P3DA 4S0SD 3I6KB 3P11L 3V7AG 5C7XH 5LGKA 2ADFL 4BA8A 3NIDF 4HHAB 2KKQA 4JFQB 3EYOA 1MF2H 3WE6B 5E94B 4PJGA 1VDGA 2OYPA 3ULUL 5I30H 1HE7A 1TQBC 3PL6B 2XT1B 3LQZA 1MIEH 4HLZH 2VDKH 3HE7D 4DZBB 1KN4H 1KJ2A 4G3YL 1SEQL 4M7JH 3HNSL 4GW4A 5IT2L 2FR4A 3UBXG 2BNUB 4KU1A 3VFRB 4U49A 3BP5A 5C0CA 1WFOA 4NKIH 4X6CB 4WHYH 5DMIH 1RURH 3GSUB 3I6KA 3NCBB 3IFPA 3UDWC 5FGBA 4H88L 3U36B 3CFKB 1JJUA 3MLYL 3MRLB 2BHYA 4JFQA 5DVMA 1HEZB 4PJBE 4PJAA 1MCSA 2FWOB 5GZOC 4QEGA 5E94A 4XNMB 5FGSA 2Z8WC 3RTQB 5TF1H 1X5KA 2W9EL 2O5YH 5D96B 2BRRL 4JPVH 4H0IA 3REWB 3VXQA 2NY3C 4R2GC 4ZFGH 3AROA 5A2FA 5GS3A 3CFJB 1TTFA 2BVUA 4S10A 3LEYL 3FFCE 3VFRA 1WFNA 4X6CA 4D9QD 4RBPK 3TNMB 2P8MA 2DF3A 4WVRA 5E2TH 3EIFA 1ZHLA 1CVRA 4ZD3H 2I5YH 2P5WD 1V7MH 2L4OA 5EU5B 1HEZA 4OZ4B 1INEH 2EE9A 3RTQA 4XNMA 3LB6D 2YOCA 5A43C 1Z5LA 3ARBC 3CMOL 5DK2B 3K2UL 1UGNA 1Z3GL 1MAMH 1IGML 2B1AH 1A5FH 2XQYK 3BZDA 1OWRM 3V4UH 4G6FD 5E00A 2VC2L 1AGCB 3CFJA 3FMGL 3QDJB 1FL6B 4I3GA 3SCMD 5CCKH 4G9FB 3T1FB 4L8BB 5E6IC 2WSKA 1SM3L 5LQBH 3SDYH 2ATPA 1B0RB 2BY1A 2HRPL 3DX8A 2P49B 2PTTB 1MFAL 3O2DH 3JV4B 4HJ0C 5HTSA 1T04B 3QAZB 2Q87A 4PS4L 3VXSB 1MRFL 4OZ4A 4L4VB 4LCCA 1CK0H 15C8H 5C07D 4YBLC 5LXGL 1EGJA 5I0ZA 4RFOL 1JGVH 4LMQI 1A1NB 1D9KC 1EEYB 2EZ0C 3L3IA 2QHLA 3U0WL 1QHPA 1DLHB 4LSVH 4OFIA 3VU2A 3F65A 1PYWA 3QDJA 3TN0A 3DIFB 4JDZB 4PD4J 1KXTB 1WFUA 2MQ0A 3CSGA 1DN0B 4YBQC 3SKJL 4UOW0 2Q76B 3PE9A 2A6DB 1J12A 3OGOE 3KPRD 2V17H 3CLFL 4ONHB 4XWOC 4L4VA 4PLNC 4FQHA 1OSPH 3UJTH 2AEIT 4QT5B 1EFQA 3HUJE 3CFDA 1MFBL 2WBJA 4ORZC 1GC1H 3UAJD 1HWGB 1A1NA 3GFUA 4Y1AB 3UX9B 4PJ7A 1QEWB 1UWGH 3MRMB 3BX7C 4IRJD 5FYKE 2YUVA 2MOVA 4XH2B 3BP4B 2GK2A 3LQAH 2YD3A 2BOBB 4JDZA 5T5NF 1E0OB 2ARJB 5F1KC 5KSVA 2DTSA 1DN0A 3I85A 5I9QC 1TZGH 4TQEH 3T8XB 2GKIA 1R24B 1JYVA 2Q76A 2I60H 1D6EA 5IK3B 1D9KB 3QUYA 1VCAA 4HKBA 1NAMA 2ZG3A 1G9ML 3DNKA 4QCIA 1A1MB 1IILE 2CDFA 4CU7A 2SEBB 4URTB 5C2UB 2F53E 4OKDA 4QT5A 2NXYC 3QCUL 3QHZL 3MGOB 4J3OC 2EKJA 4QWWC 4Y1AA 1QEWA 3SBWC 3QIUD 4U0RC 3DO7B 4XH2A 3BP4A 3G6AA 3O3BB 3R8QA 2IH1B 5FHBH 2DYPA 4K3HA 1HCFX 1R3LA 2DDQH 2JJTC 1DBJH 5FK9A 2VJXA 1R24A 1PEWA 3SEPA 3MNWB 3VXTB 3MYZA 3WKNA 4Y0GA 4YHML 4FFVD 3CFEB 5K93A 4RA3A 3H3PH 2G2RB 4OQTH 4R7NB 3TPKA 3RL1B 5I9QB 3WNPA 1DANU 4Z7UE 2VXTH 4TTDD 4P23D 2CK2A 4JFEA 3DO7A 43CAB 3O3BA 2QR0B 2VLLB 5I8CA 1B4JL 2BNRD 5F9WB 5FECB 1LO2L 4H0HB 1JRHL 3QG7L 3MNWA 3VXTA 4KJPC 4KH2A 5ICXA 3M1BB 4DUVA 3B6SB 3LKNB 4KXZH 3T77B 2A74B 4K2UL 4LHJB 2YPVL 1U8QB 3TT1L 1BZQK 2BNQB 2ESVE 4R7NA 4CN4A 2W0KA 3RL1A 4MLIA 4X8JA 4EUPH 4HMCA 4HK0B 3SN6N 3MRKB 1UJ3A 3QPQC 4JO3H 4X98B 4XVSH 3U0PB 1NMAH 4GBXC 43CAA 2ZKHH 5D5MA 1EXUB 3ARTA 4N8CH 5FECA 5F9DC 1QA9B 2UZYB 1CLYL 1MREL 3NFNA 1PG7L 1GGCL 1X5HA 5C0AE 5DQ9B 1DE4A 2WNGA 3EOBB 4NHUA 4UI2A 4JB9H 4GS7B 3EYSL 1QACA 3B6SA 4J23A 3T04D 1FIEA 2PO6D 3LKNA 3T77A 2A74A 3V4PH 1BGXH 1RUPL 5BW7C 1ZANH 1D3CA 2OL3H 2X4SB 5F9OH 2HYMA 3B2UD 3MRKA 2JK5B 4X98A 4M48L 3VWKD 4G8GA 1EXUA 3Q6GL 4RAVB 4LSQH 4W81A 5DQ9A 1PSKL 4TSBH 3UTQA 3EOAA 4JY5H 3RX7A 3WNNA 3EJYD 3U9PH 1MPAL 2AP2A 3HPLB 1F4YH 3B2VH 5CINH 5KS9F 3U7YL 5FOBB 3ALPA 4G6JL 5CZXC 5EULV 1U8IB 3DURA 3STLB 3G9AB 1AD9A 2GT9B 1YQVH 4JFOB 5HVHB 4XMLL 4YK4C 2X4SA 1Q0XH 1R6VA 4ETQB 2VDOH 4WI2A 2JK5A 1Q9OA 2D7OA 1BVKB 1IBGL 1QNZH 3GGWA 1GPOH 1K4CB 4TOYL 3D69B 5HHVH 3PG2A 4FG6C 4JFDD 1AD0B 2VKXA 4RMRA 3WD5H 1QR4A 5E1HB 4YHLL 1FSKC 4PP1D 5LGJB 1XT5A 2FL5B 4O2EB 3ARWA 8FABA 2CQVA 4RGNC 2Y36H 4UDTB 3MODL 4QHMB 4U6VH 1Y6KR 3STLA 2E5EA 1U8IA 12E8H 3X11B 4KWUA 1INQB 5DQJB 4HWBH 1ZHBA 3QO1B 4JFOA 3GRWL 4PV9B 4B50A 1LEIA 4PR5B 4QRRE 1Y0LB 4E5XA 3IJYB 4ETQA 1CXIA 1RUQL 2NW2B 4F8TA 1YMMD 2NY2D 4RSVA 4WO4B 1CDBA 5C6TH 3BI9X 1FFNA 2BC4B 2LE9A 2VAAB 5IQ9B 1IGJA 5I71C 4RQQB 3EO9L 4NHCH 4S1RL 3OR7B 1CU4L 4XVTL 1DBML 5KVEL 2CUHA 3W81A 3MCKA 5LGJA 1G7IB 4O2EA 2I9LB 3JWNC 1YYMH 2NYYD 4JVPA 4QHMA 5EUOA 2WP3T 5CWSB 3QRGH 4JM2D 4DN3H 3QIBC 4D0CA 4LIQE 2BSTB 3QO1A 4OCRH 4KRPD 4PV9A 4PRNA 3SE8H 2LU3A 2GEEA 4PR5A 1Y0LA 3IJYA 2NW2A 1FBIL 3IDGB 4WO4A 1E27B 3IJSA 2AW2A 4HSQA 3S35X 4XVUC 4ZTPH 5L9DH 5LVEA 3THML 3VFSB 1P2CA 3OR7A 2OJEA 3K74B 5JMRA 2YRLA 4HBCH 1IKNA 1N5AA 5D9SB 3QO0A 1MI5A 1F4AA 4K3JL 2YD9A 2ADIA 1ERNA 5DYOB 4TULL 5CWSA 4C56B 4CNIB 4ZUTB 2CH8A 2BSTA 1S9KC 4PRAB 3RNQA 1CLZH 4NZTH 4QXUL 2ZUTA 3U1SL 1FAKT 3BE1L 5IMKB 3IDGA 1E27A 1A4KB 1KELL 4S1QH 4JO4H 1ADQL 4HWZA 4HZLB 4LHUG 4LLYB 3TWCL 2XZAH 5AZEH 4EIZC 4F57H 1X9QA 3CMGA 3C2AH 3C6LA 4GLRI 1QQDB 4M7LH 1I1AC 1TETL 1KYOJ 5D9SA 4R4BA 3TVMA 4TUOB 5JZ7D 4QHKJ 5DZNA 1MCJA 5DS8B 4C56A 5ACMA 3DECA 4ZUTA 3HNTL 4WV1B 3N9GH 1OM3L 4UU9B 4N0YL 4KJWD 2D9CA 3L3KB 5E99H 1A4KA 4I3RL 4D9RE 3T0EC 1TCRB 1V3JA 5IB1B 3EDDA 1S7SA 4PLJC 4HZLA 4LLYA 4PJIF 3E8UL 2VQTA 4QRUB 5C0EA 3K8KA 2YRZA 1OP9A 1QQDA 1BREA 3A6CH 4XCFL 3LHPH 4NQEB 1RVFL 5KANG 5BV7L 3FL7A 4TUOA 1F3DH 1AE6L 3MRCA 4QXTA 4UILH 1JMZA 3FFCD 4NN7B 1R3KA 5D1ZC 1W0YT 3DSNA 3QHFL 1IGFH 3C8DA 3BP7B 3CD4A 4PJCE 4PUBH 4UU9A 1F4XL 1YNLH 2EDXA 5D7JC 2P48B 1N7MH 3MNVB 4HV8B 5F7EL 5IB1A 1K9TA 1ZLVH 1J11A 1HYSD 3ARDB 4HPYH 1CE6A 3CXDH 4Q9QH 5KSBF 3SJVA 4P46A 4XCYB 4DVRL 4W4OA 1IC7L 4FQIL 4NQEA 5I66B 2MTPA 4RBPH 2QQQA 1FO0L 2N7BA 4UDUB 3T0EB 3QA3B 1WIPA 3S3JA 4WRLA 1OCWL 3FKUS 3EZJB 1NGXB 2VDKL 4Z95L 4M7JL 3BRDA 2DQCH 3G5VB 1OT2A 4L4TA 2AJVH 3MNVA 2VUOA 2VXUL 4U1LB 4OV6F 3E2HB 5CIPH 3V8OA 3BT2L 3ARDA 4OF5A 5IFHH 1DDHB 2FX7H 4U6XB 4KKCC 3RKDD 3WXVL 4G6KL 5GGVL 3WEXA 4EDWL 5DMIL 2YD4A 3BJLA 1KN2H 2W07A 3WNMA 2P5EE 2PYEB 4K94L 4UDUA 3QA3A 4KTEH 4F3FB 4HXAL 5GRYA 1MJ7H 2C26A 4XMPL 5CJ5A 1VGKB 1WLHA 2VDPH 1NGXA 4QRPB 3RFZC 2KDGA 4ONFH 2DQEL 3C8KB 2AK1H 4HUWB 3T3PE 5JXAL 1NGQL 4WFFE 2JJUA 5F3BB 2OMNA 2RFXB 3WBDA 4PJ9C 2VABB 3F12B 4BM7A 5BXFB 4LEOB 1YEDB 3V6OE 3WNKA 2FH8A 3MMEB 1HXMA 1LO3H 1P7QD 3HRPA 4H8WH 3RWIB 5I76B 1EMTH 2DTMH 5FYKD 1OTSC 4OTXL 4Y4KB 1TITA 2XKUA 3MJ8B 1TZHB 3G04B 3VDAA 5ETUB 1LO0H 1X5XA 4QTIH 2B20A 2KUTA 4QRPA 3PHOA 1QFOA 1V8HA 5MHSE 4OLEA 1H3TA 3C8KA 4HUWA 1EVTC 3S5LB 4Z7QE 2QLVB 3INUL 3MV01 5F3BA 3BUYA 1CD0A 5CCKL 3OF6A 4KUCD 5BXFA 3ULVC 2Z35B 2W0LA 5CP3H 1RZJL 1MCPL 3VRJB 1J8HB 2F53D 1ZGLP 4X9BA 1P6AB 3BSZL 3WS3B 2FB4H 4R97C 3RWIA 4OAWA 1I4FB 5I76A 4QHNA 2PETA 2JKXA 4PJXE 4EOWH 3NCCB 3VGAB 1B4RA 1TZHA 1HNFA 3G04A 4KDTA 5ETUA 2CLRB 4M62L 4X4MA 3NZ8A 3QNZB 1XGTB 4ZPVA 1LDPH 5TQ2H 3DI2B 3B5TA 1JNJA 2ENSA 1NANH 1QR1B 2MCPL 5HDBF 5IOPA 4MVBC 3FQUB 1PW3A 3U30B 3SDAB 4XPFH 4FN0A 4HJJH 1VADB 4YUEL 4NRXB 5DEFB 3WLBA 3WS3A 4QHLB 5DVOA 3V6ZB 3NPZB 3FFDB 1Z9OA 3GBML 3KJ4C 1AO7E 4K7FB 1A7BA 1WC7A 5ESAB 3C87A 1BECA 2VR4A 3PWLB 3RWCA 1ZV5A 2J5LB 4HGKC 1EBAA 3UJTL 4XWGH 1CXEA 1KBGL 2J88H 3QNZA 3SGKA 1XGTA 3EYUH 4LVOB 1VSCA 2X4QB 3P9MB 3MXWH 4XHJD 3QJFB 2CRZA 5DD1H 3C5ZC 4LASH 4LKCA 4YNYB 3RVUC 3FQUA 1Q1JL 4LSSL 5CZKA 4YPJA 3SDAA 3VD5A 2ESVD 3VMNA 4NRXA 3GI9H 1UACH 3QEGL 3IFLH 4HFWA 3JVGC 3V6ZA 3S36L 1G7HB 2DQUH 2H26B 2ICEB 4YFDB 5I15H 4PJEE 2X5PA 1NCUA 5ESAA 1BOGB 4G9DA 5L7XL 5C3LD 3QJHB 4OFYA 3PWLA 5F96H 2X70A 4FHBD 5C0AD 4WI7A 1FZOB 4TUKL 4P4KD 3KJ4B 2VDML 5T33L 1CL7I 1S7RA 4F33B 1QO3B 4UT7H 4J4PD 3BOVA 3IU4H 1O7SA 3NAAL 3MV9E 5HGHB 3D39E 1DBJL 1KG0B 1G7HA 1INDH 4K3GA 3NFSL 2ICEA 3HI6H 1N3NA 4PJDE 4Z76B 1MY7A 1BOGA 2PN5A 4F7EA 3X3FH 4H5SB 2W60B 5L2KE 3C5JB 1JN6A 4OQTL 4GKZB 1A6TB 4GRWB 4JM4H 3BH8B 1FZOA 2VXTL 2LFGA 1BD2A 4MQTB 4P2RE 2X9XA 3BVNA 5DFVD 4F33A 1EUTA 1QPPA 3MOBL 1VFAA 4DOHB 4U0QB 3VDCA 3EKCA 4MA3A 5HGHA 1KG0A 4RCAA 3HR6A 4N0UB 3HB3C 5KW9H 3DHMA 1UJTA 3W2DL 1DQLL 5LCVH 4H5SA 2W60A 1KIRB 4KKBC 3T3MF 3Q5TA 4GKZA 1A6TA 4WUKL 5HHXH 3TZVA 1K4DB 3BH8A 4XCCL 2IMNA 3H6JA 4JO3L 4UV7H 4P3CH 2ZKHL 1HDMA 4JKWA 3FO9B 5HPOA 1KPUA 3F58H 3FB5B 2CRYA 4EDXA 4DUXA 3U7AA 1C1EL 4KV5F 4PLOB 5C6PB 4G7YL 1JIBA 3DROB 4QRRD 3X14B 3DUUA 1I3GH 2YD5A 1BF2A 2YBRB 1D5ZA 3V4PL 4FQQB 3MRFB 4J12A 3TC9A 1G84A 3QXVA 4P9MH 5D7SL 4OF0A 3MJ9L 5D71H 4PJCF 1U6AH 3CDGB 1I9RL 1N4XH 5GS1B 5A40E 1VFMA 2NTSP 3VXME 1U8LB 1FFPB 3LZFL 1NJ9A 4P2QA 3W9EA 1FGVH 1T7XA 1T1XB 5HPMB 4K9EH 2VDRL 1I3VA 1A6ZB 3FB5A 3EFFB 3ME0A 2GTZB 4IOFC 1N0XH 3GI8H 4LPVA 4MNGA 4DKFL 3DROA 3NACH 4JY5L 4OLXL 2X10A 4ZUUB 1U8NA 1YEHH 4AEFA 4GUPB 4F9LC 1RUKH 3MV7A 3BGMA 4FQQA 2OTUB 3MRFA 4PRBB 1ULVA 4M6OL 3RBGA 2GITB 4PJ8A 2G75A 5EFIB 3W9DB 5HGBB 3CDGA 1OARH 2QSCL 1Q0XL 4M6NL 1DQDH 1ZLUK 1U8LA 1R0AL 1FFPA 2AKRB 4IIQB 4TVPE 2D31A 2FCBA 5H2BB 5JUEL 3RZCC 1UWEH 1A6ZA 4NGHH 3EFFA 4KJQC 4Y19B 5K9JH 3PGFL 1S9XB 3SDCA 3STZB 4JG1L 1KFAL 2GJZA 2Y36L 4GUPA 1YJDC 4CVUA 5MERB 2XI9A 3VG0H 4PRBA 4OBSA 5EOCL 1IGIH 2GITA 4HWBL 5I73C 3IETB 5I74B 1X5FA 3H9SE 3GRWA 3L3JB 5CSZB 1A3RL 3ROLB 1QRKA 1GH7A 1UM5L 2AKRA 4Z7OE 2YMXL 3L5WB 5IBTH 4NHCL 4E0RA 1OY3B 4XBEL 4Y19A 1NBZB 2Q20A 4U6YB 2RGSA 5GHWH 3BGFC 4MJIB 1S9XA 1LE5A 2YS4A 4UAOC 3MRQA 4D9RD 1IM3B 4LLVB 2P7TB 5EPMB 5DJ6A 1MCKA 5D1XD 3RZCB 3IETA 1MIMH 1JGUL 3GJEB 3WN5C 4Z7QF 2HT4D 4ZSOB 1JNNH 5C9KA 1WAAF 3ALWA 2CK0H 4NN6C 3L5WA 4ZTPL 1IGYA 3OXRB 2FO4B 2CMRH 1NBZA 5JNYB 2V7HB 5J6GB 4U4BA 5IHUL 3GZKA 1Y18B 4MJIA 1QBLH 1CXLA 3SQBA 4JREB 5A16A 3V5DA 3D9AH 2IFFH 4PJXF 2Z92B 1IM3A 2HA1A 4GG6B 5EPMA 2QKIB 5DRXB 3CUPA 1ES0A 4YHYC 1IAIM 3IFOB 3IAQA 3HZVB 3H3BC 3GJEA 5TE6H 1SYSA 3RVXD 2IQ9L 1BQHB 3BGFB 4BSVB 3A0OA 5C09B 4TTGA 4CN6A 4S1QL 4JO4L 4UAOB 3QFJA 2A77H 3OXRA 2IAMD 3HKFA 3TJHD 5C1MB 3LS4L 2YPLB 1I7TB 1ADQA 1A22B 3L3DA 1PZUB 5JNYA 2V7HA 2EE3A 4NC0B 3EJZC 1P4BH 2J8UB 4WWKB 1IM9D 1FDLH 1PG7W 2A6KB 5CP7A 4O4YH 4Y2DC 5BV7B 2EKSB 2XOTA 3P73A 2QKIA 1NGPH 3C60B 5DRXA 2Z93A 4KVNH 4HKJB 1YYLH 1U95B 5DSCB 3U0TA 2P5ED 4NM8L 2DLEA 5C09A 5A3IC 2IANE 2OTPA 4WJ5B 4Z7VE 4UMGA 4LSPL 3QFDB 5GSVB 5DHYA 4AEHL 1QD0A 3F7VB 1RULL 2X89A 4Z9KB 1J1XH 1SYVB 4JQVA 2J8UA 4L8SB 5C08B 3NIGF 2HKHH 3GKZA 2B2XH 3MLUH 3BH9A 4RX4A 1A2YA 5GS0L 2PF6A 4D8PA 3Q3GB 2EKSA 1CDIA 1MLBA 4WFFD 1ZTXL 3CFIC 2BSSB 2WQ8A 5E9DA 1T5WB 3C60A 1OP3K 2C9AA 3QEQB 2NLJB 2VH5L 2VIRA 4L9LB 4YQXH 3QDGB 2NQCA 35C8L 5K9OB 4M7KH 5BCAA 1FE8L 4WJ5A 3MLVL 4Y2DB 5HYSG 2ICWI 3QFDA 5GSVA 3CXDL 1C08B 1OD7A 1UB6A 1ZXQA 4Q9BA 2XG5A 3F7VA 1VGEH 3TYGL 2HH0H 5T3XH 5J0BA 3BESR 4MCYB 4L8SA 1GHFH 5EZOL 1JPGB 1J9CT 4TRPL 2PXYA 3O8XA 1H0DB 2R4RL 1NUFA 5E2UL 3SGJC 5MHSD 4U1KB 3Q3GA 4HIHB 1J1OL 2BSSA 2WMPA 1XF4B 4UOJA 1FO0A 3AMKA 2BVEA 3ISWA 2ZSVB 3O9WC 1QFWI 3FO2A 1HQRB 4L9LA 1F3DJ 2DD8L 1GGTA 3PQYE 3KG5A 3K8MA 3R06B 4OZGF 5K9OA 5FEBA 4DW2H 1KLGA 2K1MA 1OGAE 3OKKB 4CU8A 4Y4HB 4DAGH 5FHAH 1C08A 1LP9B 1E6OH 4H1LG 4YR6B 5J9PB 3ZYIA 3HE6D 3IDMA 1MCOH 4WW2B 1JPGA 1NMCC 4M6ML 6FABH 5CMAB 4U1KA 1PQZB 2DMCA 2BP3A 3TN0C 1FIGL 3BEVA 3ZDXE 3N06B 3JV6B 2WQRA 5KSUB 1CI5A 3HLAB 5TE4H 4ODSL 1NCTA 4HQQH 3T2NL 1HSBB 3BIKA 2WBWB 3OKLA 1AO7D 4J8RA 2E9IA 3OKKA 2XTLA 4LLMB 4Y4HA 1EO8H 3N85L 3G5ZB 1LP9A 1KTLA 4IMKA 4XBPB 1MNUL 5J9PA 4PLKD 1YECH 4WTWA 4EKXA 3DUSA 1LO3L 5C0ND 1PX3A 4JANB 1GC1C 1SJHA 3HAEB 4LDEB 4OLUH 1J1PL 1MHCA 1PQZA 5GRJL 5CAYB 3LQAC 4BFGA 1F8TL 1TJHL 5J4MA 5D7LE 2P5WB 4IOIB 5KSUA 2V2TB 3HLAA 4Y5XC 1HSBA 1P1ZA 3EDKA 2YKLH 1AXTL 1EEZB 3QUYC 2DQTH 5JDSB 1LE9B 3K4DA 3UEZA 5FAAA 3MCLH 3RVVD 4XBPA 1EFXD 1TDQA 2GYSA 3O4OC 5C6WH 1JHLL 1S7WA 5LGHH 3SCMB 5DMGC 4HFUL 2FB4L 2GY7B 3HAEA 1L6XA 1FYHB 4HGWB 4EOWL 4JQXA 1GGUA 3HFML 1MQ8A 2P5WA 2V2TA 3BKYH 5I8OH 3BPNC 5CILH 3MV9D 3Q0HA 5HHNB 3D39D 1G0XA 2APBA 2NY1C 3X12A 5TQ2L 4X4XB 3BWAB 5F6IC 2R2EB 4NJ9H 1LE9A 3LEXB 3OB8A 4U33A 3MYJB 5E8EB 4RFEB 1U93A 4OJFH 5L2KD 2WWMD 4XPFL 1MHHA 4PYHA 3RDTC 4HJJL 3UJJL 3WFDH 1RJZB 4N0CD 3SCMA 3L6FA 4Q0XH 4IHOB 2HP4A 3MA9L 2IH3B 1GGBL 4P99A 5JO5B 5FO9B 3VJ6A 4P2RD 1IE5A 3P77B 4OD2B 4X6CE 4OGXH 2AJZB 3LSOA 4GLRH 5HHNA 5HYJB 2X9YA 4D0DB 2EH8H 1A14H 1DQQB 5D2NB 4KRNA 2R2EA 1A0QH 5ECJE 1MFCH 3LEXA 5DD1L 5E8EA 3MYJA 4FQXB 4RFEA 4LEXL 4H20L 2FJHA 1CN4A 4OLVH 1RJZA 1N5YL 4JFYA 4XX1G 5BS0E 5TDNB 2IH3A 2ZCKL 1UJ3C 1UH4A 4U1GC 1XR8B 2GSGB 5DURD 2NY1B 3IDJA 3TIDB 4C54A 1CCZA 5JO5A 5FO9A 4TPRL 1N2RA 5T5FH 3HZMB 4OD2A 3KPRA 4D3CH 1U3JA 4OUUB 1LNUB 4L1DA 4POZD 2LVCA 1YY9D 4Z78A 3WSQL 2NZIA 1J10A 1DQQA 2IJ0C 1PKQE 1H3XA 4FQXA 4UT7L 5IIEB 4LQ1A 4XNXL 4IRJA 3IU4L 5GSRB 4PY8J 4GO6B 1NBYB 4K8RD 3JSSA 5DMKB 3QXAA 5EZLA 5TDOB 1FAIH 1TVBA 5TPWH 2WV3A 3HI6L 5FKAA 2MQCA 3VXMD 2I25N 4LSUH 4ELMA 4KZDH 1EHXA 1YEIH 3HZMA 4G9FE 1NDGB 5E2VH 1JNHA 1QSZA 4OUUA 5I8KH 4NKMB 4XP5L 1JWMB 3DVNB 1WSST 4L3EB 3ES6B 1QLFB 3FJTA 1JF1B 1RIUH 3CC5A 1AJ7H 3MRGB 3VXSE 2Y72A 4NQXA 3BKML 5JPMB 1DBKH 4WEMB 5GSRA 1NBYA 2ITDA 5DMKA 3WCYA 2D7MA 2AXGB 1C5DB 3L95A 4GAFB 2DKUA 3RIAF 4TVPD 5KN5A 3LAFA 3DXAB 2ZCHH 4F9PC 5HD8C 1ZMYA 2DQDH 4QTHB 1CGSH 5DEGB 1LK3L 3WIHH 4HIIA 4OGYL 1NGYB 4JFXB 3RVWD 1DQMH 1LMKA 2HWZH 1JWMA 4KRMB 5HDQL 3QR2A 4I77L 3MRGA 5CGMA 1FZJB 3CFCL 2FBJH 1NSNH 4P23A 1QSVA 3WJLA 1UADC 4PV8B 1ZLUH 2E6PA 3VWJB 2E6JA 1OTTC 2GI7A 2DI8A 2APFA 4M6AA 5C0FB 3H9SD 4KI1A 1G7LB 1S7UA 2XZZA 3RI5K 4NO2B 1I3GL 3MBEB 5GGTH 3WV0A 4HIXL 3Q1SL 3MXVL 1YPZE 5DEGA 4X6DA 5B39A 3PIQB 1JFQL 3FB7A 4YFLF 3RGVB 1UFUA 1NGYA 4JFXA 3MJ9A 4C4KT 5K9QI 1S3KH 4XZUB 5AZ2L 1TJIH 1I1RA 4RWYH 5T3ZH 3LD8B 2AJUL 3OB0K 4HWEL 5FO8B 2UZIL 3WIIL 4NFDA 5D8JL 2VR5A 4PV8A 2W9DH 3VWJA 4Y2OA 2GK0A 1S5IH 5FYJH 2ITCA 4XPTH 4XC1H 2JCCA 5C0FA 1BFVH 4M5ZH 3NZHL 4AIOA 3RGHA 2VZOA 4NWUH 2VDQH 1KJMB 2FGWL 2PO6A 1OW0A 2CKBH 3B8YA 3T65A 1CGXA 1IKNC 1RK1B 2C5DC 3IDYB 4GMSL 3TBTA 2DWEB 1GGIL 4RA0C 1HHIB 3VWKA 3ZL4H 3QB7C 3VCLB 2W65B 1K85A 1YEGL 3LMJH 1QKZH 3TF7C 4LCIH 3Q5OA 1SVCP 4P5KB 4JFDB 1TVHA 5CD3B 3VFMA 3ZE0E 4Y4FD 2VQ1B 2VSDA 1MAJA 3VG0L 4G8FB 3S97C 3AAZA 3ZDXF 2X9WA 4ODVL 2KZ1B 4Z7WB 1IGIL 3GMMA 1KJMA 3GBNH 3OPZL 3MRHA 3S98A 4UIMB 3C6LC 4NT6A 1RK1A 2DWDA 4OZFB 3TVMC 2R23B 2DWEA 5MEQA 3K0WA 3BXNB 5IBUB 1A7QH 1HHIA 1T66D 1YMMB 2NY2B 3V4VL 4CDGC 2BNQE 5F7HA 1PLGH 3VFGL 2Q3ZA 4CL7A 3K2MC 1N6UA 2WIIA 2W65A 4F7PB 2B5IB 3OKMA 1WBYB 4P5KA 1C7SA 4JFDA 3GSVB 5D1QD 3MREB 3QUXD 32C2B 2VQ1A 5IW3A 1ITCA 5I75C 2IAND 3QUKA 3FQNA 4MHHI 4Z7WA 1CTNA 3WFHA 5IESL 3E3QE 3HS0B 3OXSA 1WZ1L 1UCBL 3RUGA 3V9FA 3BP6A 4OZFA 2R23A 4KRPB 4Q58C 4U7KA 4EQ2A 3T0VA 3BXNA 3VRIB 1YMMA 4MD0B 1UVQB 2BY2A 1DFBH 1UKQA 2CMRL 2FIRT 3SGDI 4WENB 1HZHH 5DUPH 3HI5H 3LV3A 1U9KA 1B0GB 4F7PA 5F7DB 4NP4L 1WBYA 2BVPB 3O6FC 1CZ8L 3QQ3B 2KBGA 2VXSL 1JPSL 2X1OA 1CL7H 1Q72L 3VXRB 3VXOB 3UTPE 1PAMA 4TSAH 1DL7L 3PGCA 2XN9B 3HS0A 2QHRL 5TE6L 4K3EH 5HHOB 4JM2A 1QFUL 1ZVYA 3L9RA 4PGCA 1X4XA 2E27L 3CVIH 2VLKB 1N59A 3VFVA 4YGVA 1OP3H 2A9MH 3T0BA 2A77L 3VRIA 3TO4D 4MD0A 4K3DL 2FLBT 1UVQA 1HN1A 1T2JA 4LNRB 4R4ND 2DBLL 2GTWA 3CLEL 3FOMA 4GAJH 5IW6B 2VDLH 3IS0X 3GHBH 3CVHH 4OB5L 5KS9B 2P8PA 3PQYD 4JFPA 5T1KD 3QQ3A 3OG6B 1XCTB 1OGAD 3VXOA 1AQDB 1R3JB 1WQVT 1F6LL 1URLA 3QWOB 2GJ6B 3LPFA 4X7CC 3IDUA 5E56A 1WCQA 4LLQB 1EK3A 4UT6L 1A6WH 3KJ6H 3O6FB 2AK4E 3IU3A 2NY0B 1T4KA 4S1DD 1GJIA 1IT9H 5AYQA 3DV6A 3PDGA 3SO3C 5IW6A 1ZA6B 4FXLA 1D5BA 25C8L 2BVOB 1QFHA 4PG2A 3D0VB 4KY1H 4KK6D 4Q7DA 1XCTA 5IF0B 4UT9H 3NCMA 3BKJH 4QOKB 1AQDA 1R3JA 1G7MB 3QWOA 4MQSB 4P2OD 1U8HB 2GJ6A 4LARH 4U1HB 5IMLA 4YQXL 4N68A 4LLQA 3FFCB 1MRCL 3MLZH 4LSTL 5TQ0H 3PWPE 2C4FT 3DBXA 4N5ED 1I9JH 5D7LD 5DJYB 1ZA6A 1CYGA 4ZDHB 2EYRB 4R96B 2BVOA 3KYOB 5GJSH 5IBLD 5F3HB 3D0VA 2O26U 5K9QG 4JR9L 5ACLA 2C1OB 2GY5A 1SBSH 4K71C 2AERT 1PKOA 1G7MA 2VOTA 1EHLH 1U8HA 1XZ0B 4KDVA 3FFCA 1FV1B 4PRDB 4DW2L 1EUUA 4FS0A 3CU7A 4H1LH 1KOAA 4MDIB 4BQ9A 5BOZG 4U31A 5CKGA 4C56E 4OLYH 1E6OL 3ZYJA 4XHQA 4KDTC 1NUGA 5C0BB 3MNZB 2QSTA 1HHJB 3BZFB 5DJYA 5L2JB 2Q8BH 4F7MA 5FOJA 3MLXH 2R69L 4ZDHA 4R96A 5JLZB 5CJOH 4R8WH 5F3HA 5IHBA 4RRPG 5C70A 1IQWH 3KWWA 3SKUD 3ZE1E 4GSDH 4DQOH 3FT2A 3P4OB 2DI9A 5DO2C 3W11D 3PL6D 1T21A 1XZ0A 1X5GA 4S1SH 4RIRB 3OMZA 2ADJB 2VN4A 3ZHDA 5I1JH 4AK1A 4MDIA 4NZUL 3IXTA 2XWBA 4HF5L 4K71B 2COQA 1YECL 3TO2A 5JW5B 3MNZA 3RA7H 3V95A 3BZFA 5CFHA 5L2JA 3SGKC 5IJVB 2X4NB 4OCYL 3VI4F 1JHKL 2P24B 5JLZA 4JN2B 2ATKB 3PHQA 3D0LA 4Y5YC 2Y5EA 5ILTH 4Y5VC 5CGYC 1T0MB 4LRIC 4WFGE 3ZDYE 1P5VA 2BXZA 5IGXL 2FX9H 4DVBB 3NA4A 5GRUH 4HK3N 4ZS7H 3HMXL 3P4OA 4ZUVA 1V5JA 1AR1C 3LCYA 2F8XC 5TJWK 3MACL 4M5YH 1U8KB 2FEDC 4NQEE 5BS0D 4HJGB 2YKLL 4OIIH 2ADJA 3W0WB 5JTWA 4PJIB 5LWYL 4U05A 1B0WA 4GMTH 4XCEB 1LEKB 2FEEL 3VI3F 3ROOB 4OBRA 4JGJA 5E95B 5JW5A 1SY6L 5IJVA 4K23H 4MHHG 4RGOH 3ULUE 5EU6B 4JN2A 3TBSA 3GSWB 5FFLA 3HUJA 2QQLL 1BJMA 1P7QA 2JELL 4R26H 1CDUA 1MY5A 1YEFL 5EBLB 4YXHH 5JW4N 1KPVA 1JWSB 3HC0B 5FV2A 4WY7L 1AP2B 5CILL 4EN3C 1U8KA 4I0KA 3OKDB 2RJMA 2D4DA 3C6SB 5DJ0B 4LCUA 5I1GH 4YZFE 5DQDH 1I75A 3P4MB 5KSBB 4AQ1B 3T0EE 2HFGL 1LEKA 1JTOA 3ROOA 3RY6A 1X4ZA 4G9FD 5GZOD 3R1GL 4BUHA 5ABDE 2XPGA 1XGQB 4XP1H 4YDIL 5EU6A 4J1UA 2JJWA 3DGCR 4BZ1H 2APVA 4NWTH 2F53A 2NY3D 2OK0H 3N1MC 2GSIB 1G7JA 5FUOL 1ZE3C 4PY7B 4ZQKA 1T1YB 3F6LA 3NGBB 1OGTB 3VXSD 4ACPA 4Y8DC 1QUNA 1SJEB 1N6VA 1KJVA 5IVZB 1JWSA 3HC0A 8CGTA 1AP2A 3O2VL 1RU9L 1JPFB 1K6QH 1RFDH 1W0WA 3OKDA 4O58H 5DJ0A 1I8MA 4NPYB 2PYEE 4O5LH 4Z5RB 5EIIB 4RZCB 4LBEB 5D7IF 2ZPKL 3BKCH 3O81A 3X17A 5JMOC 3NN8B 4OLVL 1P6FA 3TZVC 1T03H 4XNUH 1MCEA 2X7LB 4B5EA 2PW2B 2RBLA 2ESVB 1OAQH 1CFVH 2D7QA 1AQKH 3JTTA 1MRDL 1UKTA 2GSIA 4PY7A 3SOBL 3WXWL 1T89C 4APQC 5T5FL 5EDXA 3G5XB 1JYXA 3QWRD 2H9GA 2D2OA 4YWGH 5E6ID 3LKRB 4G42B 4KQ4H 1OAUL 3NPSC 3RU8H 2MNUA 1JPFA 3LS5H 1CIUA 4Z5RA 5EIIA 1IJ9A 4P9HH 4LBEA 2AJXH 4HJ0D 2VZ1A 1A8JH 3I50L 4YPGA 1D5IL 4LGPB 5ALBL 4AL8H 1C5CL 2AQ1A 2PW2A 3IT8D 2OZ4H 2ESVA 2Y06H 4QO1A 3ARFB 1CD1A 5FYKU 4WI5A 1D9KD 1U8PB 4O2FA 1JGLL 4LSUL 4RAHA 4F2MA 4KI5F 5GRVL 3ILQD 1J0YA 4K9EC 1B2WL 3GJFK 1I7ZB 4PBVC 4WTZA 5DLMH 1J8HE 2IGFH 4YIQB 3LKRA 1ZHKB 1KCRL 1S9WA 1I9IL 4G6MH 4YBQD 3L3GA 1EAPB 5I2IB 4X7FC 5C0AA 1UB5A 4Z0XB 4GJTB 4NDMA 2AGJL 3GB7B 4FFWD 4HUXB 4XWOD 1CICB 1DUZB 3BZ4A 4J4PA 3DTXA 4K8RL 3NPSB 2P45B 1EHNA 3ARFA 1EO7A 4Y88A 5GJTH 4X83A 1CGSL 5C2BL 1CBVH 4FQ2H 1PZ5B 4ZXBB 1FQ9C 3Q6FA 4YIQA 1ZHKA 1IAOB 2HVJA 4FXKB 4BKLA 1EAPA 3SDCC 5I2IA 4RISH 3ZE2E 4OLWH 4QGTA 4Z0XA 2YD1A 4UIKL 3MLTA 5J8OA 3GB7A 5KVDL 3KLSA 4OI9A 1ZVHA 2R0LL 1CICA 1CXKA 1RD6A 4JRXB 1DUZA 3SE3A 1YUHB 1AY1L 2DICA 3PP4L 1DSFH 3LPGA 5EWIL 5GRVK 3MRRB 3TJEL 4NUGH 1NEZG 4O02H 3LN5A 4QWWD 2A83B 4R0LC 2XTJB 1W0VB 3LIZH 3VXUB 1FH5H 1DLFH 2BCKB 2BNQD 2H45A 1PZ5A 5DJZB 1T5XB 4EI6B 1XIWB 3GMNB 2BVYA 1JGEB 4FXKA 3CXHJ 1T1ZB 5CEYB 5DMJB 3VFOA 5HVFB 1M6OB 1FNHA 3QNYB 2IBGA 3B9KB 1SBBA 5HDOA 2W59A 4NN5C 4JRXA 3ET9F 1S5IL 4YHPA 3HZYA 1GXEA 3RWJB 1VEOA 1YUHA 3O3AA 2AAVA 4Y7MA 1MOEA 5FYLH 1BFVL 1S8DA 3MRRA 5JIIA 4PBWD 2CR3A 4DJMA 4YHOL 4ODWB 4R3SA 4QRRA 1NCAL 4YDJB 5IROC 1M71B 2VDQL 4HT1H 5D4QA 2A6JB 2BCKA 2CXGA 1IGTB 2YWZA 5MI0C 4G7VH 1T5XA 4N1CA 2CKBL 4F37K 3OKYA 4I0PB 1BBDH 4LCYA 1CG9A 1T1ZA 2P1YA 2XNAB 5CEYA 4BSWB 4NNPH 5KJRH 1SQ2N 2G60L 3PDDA 4KJPD 4ODTH 3B9KA 2NZ9C 1FGNH 2P43B 1DQJB 2IADB 3UTPD 4GRWE 4I3SH 5AUMB 1QKZL 2Y1VA 3HC4L 3KVQA 1KV3A 2JIXD 1IGCH 2UY6A 5CS7A 3KXFB 4Q74A 1KTDA 3QPQD 1RMFH 1JZ3A 5MEOB 3I6GB 1UXSA 4ODWA 3MBXH 4YDJA 1A3LH 2A6JA 3QRFM 4GRLC 1BZ7B 3QCTL 4O2CB 4NN5B 4OFVA 1VKXB 4I9WE 4I0PA 2XNAA 3AXLB 3H42H 4XPBL 2P46B 2EDBA 4N0UE 1T3FA 5HXMA 1TVDA 3NH7H 2DLIA 3PNWB 5GQBA 1ORSB 3S34H 3T09A 1DQJA 1TMCB 2IADA 2XXMB 4ZUSB 2E3VA 5AUMA 5HSFA 5GPRA 1RJYA 1XGYH 4M1GH 1MWAH 5GS2H 2XQBH 3ZDYF 5MEOA 5C0DA 2AK4D 1FLRH 3IDXL 1C5BH 5F93C 1KCSH 4O2CA 1VKXA 1R3HA 2VL4A 5D1XB 4YDVB 3ZKQD 2GAZA 5F1NB 4HUNB 5IWLA 5F9JB 2EEAA 3G08B 1ORSA 2A1WH 4PREB 4JVWA 2FDBP 1DFBL 5DD5H 1T6WA 4ZO9A 1A6VL 3RKPA 2V2XB 4E42B 1KCVH 2O5ZH 2BFVL 4ZTOL 4O51B 1OAXL 2PTUA 1VEMA 1WV7T 4PJCB 4DEPB 4H26B 1CT8A 1MHPL 1S7TA 4KZEH 1NMBH 3PWPD 2PTVA 3FQWB 4FG6D 5DF0A 5D1XA 1L6ZA 1OQXA 4R4FL 4Z7NE 5BQ7B 3O8XC 4H25B 5EU4A 1MJUL 5DJCA 3HC3L 1D6VH 1EX0A 3FCTB 1OQOA 4XP6L 1A7NH 4PREA 3PHSA 4EI5C 4NO3B 2HLAB 2YSSB 4N8VG 2G5BB 5DGQA 2ZUQB 4E42A 1DVFB 2VDLL 2EECA 3DOSA 1MJJB 3E6HA 4C83A 2NY5H 1H8OA 4PJCA 1V3LA 3NABL 4C56D 1KLFA 1OHQA 5GRZA 3E1F1 4KAQH 4NYLB 5DRNA 4ZNEE 4LDOB 5E1AB 2VLRB 3WFCL 1C8PA 3NCYP 3W39A 4H25A 4DN4L 4MNQE 3BYTA 2UZXB 3FCTA 2XRAH 3ZTJG 3EHBC 1KCUH 1EHAA 4JHZA 2P5EB 5F1IB 4NO3A 2HLAA 1S5HB 1X6NA 2G5BA 4NSKB 3T0AA 1DVFA 2V5TA 4XAKE 5I1DB 5DRZB 2AQ3A 2IAMA 5EORL 1RZKL 3GHEL 4UZGA 1KT2B 1NCDL 1GOFA 4JQIH 3HE7C 1IM9A 2I24N 4IMKC 2DJSA 5FUZH 5MP6H 1EJOL 2OJZL 4LARL 4RMUA 4MX7B 1WT5A 5FKPB 5GISH 4JKMA 5DD3L 5E1AA 2VLRA 5EO0A 3ELAT 2EO9A 5IMOA 1N64H 1U58B 1H5BC 3MLZL 2J6EL 4IS6B 2P5EA 4WFGD 1CFNB 5F1IA 4NSKA 2DRUA 2WLZA 3O45B 1E4XH 1GZQB 4TNWK 3BDYH 5DRZA 1KT2A 4ZSOE 5EOTB 4NQED 2GFBB 2QL1A 1IMHC 1YN6B 4UNUA 1MFDH 3TBVA 4Z0BL 3EYQD 4WI8A 2VZSA 1TPXC 4LOUD 3KYMB 4PTTA 5HI4D 4X7SH 1EHLL 3RJQB 2CGRL 2IBZX 1BQLH 1FNLA 4AENA 4LFHG 4MX7A 5FKPA 3ULUD 4N1HB 3V6OA 5I8EB 3QSKB 2LAGB 1J87A 2E6QA 2WUCL 4Q6IA 4GG6E 2R2CA 3GSNL 4TNVF 1CFNA 2RCSL 3JWDC 2R2HB 3MLSL 3X3GL 5JR1L 4XPGL 2Z31B 5L88H 4OD3H 3FN0H 2X4TA 4PJXB 5FGCB 1CE1H 1MEXL 4ZO8A 5ESQB 1FL5B 1AGBB 4R8WL 4OZIF 2CIKA 1IFHL 5D72H 5C09E 5T1LB 1YN6A 3WO4C 3MLRL 5C3TA 3T0ED 3KYMA 2BOCB 1C7TA 2CLZB 4PLJD 2YPLE 4UINH 3K4ZA 1Q9LB 5CJQL 5I0DA 4FQ1H 3ZE2F 1F3JB 3DLQR 1MSPA 3MV8B 5I8EA 1AFVL 5IVXF 3LRHA 5F70A 2DJUA 2FNBA 4CMHC 1WK0A 3ULVF 2AABH 1C12B 2R2HA 1V7NH 5DJAA 1MCWW 2ZSWB 3NA9H 5D1ZD 5EC1B 4PJXA 3ZHLA 1FL5A 1AGBA 4IDJH 2OTWA 1CDYA 2PYED 3HE6A 2DJ4A 5DR5L 3O0RL 4LU5H 5EC2B 2F5BL 1KJ3H 5DHVH 2BOCA 2FX9L 2CLZA 4WHYG 5GRUL 1Q9LA 1CD9B 3MLWL 1F3JA 3U48A 3HMXA 5C08E 4NNXA 3JV5A 1XEDA 3F5WA 2UY7A 1EBPA 1WCBB 3B3IB 2H3NB 4HS3B 4CJ1A 2FHBA 3QYCA 2NXZC 1AO7A 2FJFB 3MRBB 4FZ8H 1XF5B 4YHKH 4NCC1 2YA2A 4PJEB 2JE8A 1BOYA 4G8EA 4MWFB 5AYUL 2Y4SA 3QEQE 3IJHB 5EC1A 1SY6A 1EFXB 3QDGE 5FDYA 1U91B 3UAJC 3FT4B 3QDMB 2ZCLL 5GGQH 2H1PL 3WKML 2NY7L 5H37G 3DI3B 4Y4KD 4IRJC 1KCKA 4HKXB 2J12B 4KVCH 1MQKL 3SGDH 1F2QA 4D9LH 2JJSA 1P4IH 1B3JA 4DK6A 1WCBA 3M07A 2H3NA 4HS3A 2DI7A 3MRPB 3V79C 2WM0A 2FJFA 2YPKB 3NTCL 5CUSL 1T20B 4PJEA 3CK0L 1J8HD 3IJHA 3WL9A 2YXMA 1EFXA 1U91A 3TT3L 2XICA 3NOIA 1WEJH 3OJ2C 3QDMA 5DTFB 4F58L 3QQ4B 3QIUC 3KYKH 5JOPE 3SDDB 5ICZB 2NXZB 3TH3T 4P2RB 4OZGB 3BQUC 5IVOA 3WDHA 4ZODA 1A9EB 3GJFA 3PF2A 5J13B 3EO0B 3RIFK 3D39A 4Z77B 5EN2A 5B4MD 2X4OA 4FFVC 2YPKA 3ILPB 1G0YR 4PJDA 4XP9L 3SQOH 1FZKA 4IOSD 5AD0A 1G7QB 2Q7YB 1U2HA 5CLTA 5DK0B 3P3YA 5L2KA 3OJMB 4L5FL 2IWGA 1CFVL 3OZ9L 1AQKL 2F15A 3TESA 4TTDC 4P23C 2D7TL 1IAII 1DBBH 4OFYD 4UTAH 5INDB 4YWGL 1BM3H 4P2RA 4OZGA 3NCJH 1F6AA 3P0VL 4JHBA 4JN1L 3LS5L 5J6HA 5IKCA 2CJUL 1FYTE 5IHZB 1A9EA 3EO0A 4HC1L 4C57C 1H3GA 4NC1C 7FABL 3EGSA 2FZ3A 2YD2A 3GIZL 1Q9WA 4AMKL 3ZDZE 2F8OA 2Q7YA 5DK0A 2YUZA 4PJHF 1J05B 3BQUB 2Y06L 5MENB 3U2SB 4YE4H 1UEMA 3UO1H 4XNQA 2B1HH 1NCCH 1P53A 4FTVB 4IRSB 1RUAL 1KLUB 5GRXG 5IFJA 5INDA 4POYA 2R1WA 2B7DT 4OI8A 1FC2D 1T6VN 4JJ5B 3S6CA 5KG9A 3RRQA 3H9HA 3P2TA 5IHZA 5EU3B 3KPLB 1O7VA 2X2YA 4KROB 1S9VB 2PO6C 1OW0C 3DX6B 2M8XA 2HKFL 2YA1A 3MROB 1O0VA 2AEQL 3AMLA 4HAGA 1J05A 2V7NA 3U2SA 4NKOB 2X44D 1U92B 1CWVA 3H9ZA 4NJAH 5GJTL 5CJXC 3GO1L 3VWKC 5B8CA 4IRSA 3VXMA 4FQ2L 2E7HA 4LF3B 4L1HA 3RVUD 5ADOL 3NIDE 4MXWH 5DD0L 4AY0A 5F8RC 3P4LA 1J0HA 4CRPA 4MQXC 5EU3A 4PTUB 1OTUC 2UVFA 1Z0MA 2ICWJ 4GXUM 3K1DA 4LVEA 3EJYC 3KPLA 3QG6A 2H2PC 1S9VA 4MJ5B 3QUMA 3TNNA 3MROA 4LVHC 4HH8A 4XPAL 1DSFL 4I9WD 4M93B 5HYJE 2W38A 4ODXA 4ZUWA 5D2NE 1OP5H 2E8ZA 3TH4T 1E28B 3H9SB 4AJ0A 1P7KB 5ITBH 4TVPH 4LF3A 1ND0B 3BN9D 4OD1L 1UC6A 5J06A 1MELA 2CKBB 5ID1B 3V7MA 3IDNB 2HAZA 4PP1C 1HWHB 3G6DH 5L6YL 2ZUYA 3F62A 5I1AB 1CXFA 4S2SB 3GSQB 3DRQB 3QEUA 5HY9B 3OX8B 2Q1EA 5SWZB 4M7ZB 1TTUA 3H9SA 3CX5K 1OWWA 1SHMA 1P7KA 1T80A 4KQ3H 2D03H 3GMOB 1A9BB 3RPIB 1AXSB 5HGDB 5ID1A 2HJKB 5D70H 3UC0L 3IDNA 3DJ9A 4PRHE 5IQ7H 4BQ8A 1KC5L 1NFDE 2OSLA 1HHKA 3B5HA 3MA7A 4LL9A 1FGNL 3L3HA 3OSKA 2LAAA 3D18B 4Y8AA 3V52L 2WANA 4P5MB 2OBGA 3S37L 3DRQA 5CZVL 5ELIA 1A1OA 4L3EE 4A2LA 4LSDA 1RHFA 1EEUA 1KB5A 1OB1B 4U2ZA 1TNMA 1NC2D 3T4YA 4RMTA 2VKWA 1AKJB 1HH6A 3GMOA 3JUZA 2DL2A 1AXSA 5HGDA 3ARGB 3U4EB 2V5RA 2IMMA 4NM4L 4ZAKC 2BDNH 1SJVA 2FJGB 2LTQB 3DXAE 3WFEH 5JXEC 1F90L 3TBYB 4QRQA 4OV5B 4P5MA 1AI1H 4KMTH 1XGYL 4KHXL 1MWAL 5SX5K 1OB1A 2KQNA 3O6KL 4MNQD 3T08A 4A6YA 3LKPB 2AQ2A 4A2MA 5DT1H 5J1TC 5D1QB 2FIKA 1C5BL 2OX5A 1AKJA 3QUXB 4MA8L 4R90L 1KCSL 4Y4FA 3IDIA 5INCB 4CUCA 4IRZH 5JOFB 3AB0C 4RMVA 2IANB 2UUDK 1X4YA 5EA0H 1XH3A 4Z7VB 4XAKD 5DD6A 5I1EH 4GAYB 3U4EA 2DQHH 5IJKA 1QVOA 3DMMB 1HKFA 3MCG1 1GAFH 2FECL 3NIFF 5I1IL 2R4SL 4AEIH 2ZG1A 4O9HL 4PJGF 3OBAA 5SV3A 2O5ZL 2FYYA 3VH8B 2WW8A 1R5IB 1IAMA 5JW4M 2DMKA 3AS3A 2UV3A 2R0KL 1A7PL 3AY4A 4FQJL 3B9DA 5E03A 3CVHB 4XXCA 1RZ7H 1U8JB 3K80A 5D1QA 3U4BH 3QUXA 3RZCD 3WYRA 2CLVB 3QXTA 1IKFL 3IYLW 1JPTH 2IANA 4RMSA 4KJQD 4YJZL 1UM4H 4Z7VA 4B53A 4GAYA 3BRFA 3FT3A 2R9HD 2V2WB 5HHMB 1I8LC 4KK9C 3X13A 4PJAF 5BJTB 3SY0B 5EOQH 2EDOA 4QRSB 1J86A 2R1YB 3TO4B 2F5AL 2DM3A 1U8OB 2B4CC 3VH8A 4L3CB 3RQ3A 2HT2D 5SX4I 1T7YA 4OLZL 2VISB 4B7IA 1KNOB 4KJYA 1FG9C 2AJ3B 1U8JA 5GXBB 5T1KB 1JTTA 5I1CH 5JOEA 1YEEH 1UT9A 1HYSC 1MCWM 1P84K 1S78C 3I2CH 3ZTJH 2V2WA 2WUBH 3L5HA 3OKNB 5HYSB 5C09D 3DSFH 3SY0A 4NOBA 4JFZH 1TZIB 1MH5B 1YJDH 2R1YA 2YPLD 4KPHH 3AC0A 3S37X 3TO4A 1H3PH 1U8OA 1ACYH 3VG9C 4Z8FL 4L3CA 4K7PL 4WWKD 3VW3H 2G5RA 1M05B 5E0QA 1KNOA 3IXAA 3LEVH 4JQIL 2AJ3A 1XF1A 1Z2KA 3PQYA 3AREC 4Q2ZB 4X4ZA 5T1KA 3C60D 4HCRH 1E4KC 1OGAA 1YEJL 5IB4B 1OOAA 4P59L 4AM0B 5GISL 3QIWC 3D3VE 1WTGT 2F8VA 2A0LD 1FN4A 3R4DA 1PD6A 3OKNA 1P9MA 4IEFB 1N64L 4DKDC 4HD9A 4U1SB 3RWDB 1MH5A 4EJ1C 2J6EA 3WFBL 1E4XL 1UA6L 3FB6A 3FRUB 4M43L 2X4PB 5C08D 1ZLSH 1F2XK 3F7YA 5D6DC 5SV4A 3SKMB 5BMFL 1MFDL 4WDIB 2VWEE 4XPHH 1FNAA 2X1XR 3I02A 1AGDB 2EO1A 4DTGH 4X7SL 5CKAA 3LDBC 4Q9CA 2IG2H 5E6ZA 1BWWA 1ETZA 1NAKH 3QEQD 3EJZD 3VG9B 4P2OA 3QDGD 5TH2B 5DI8B 1XFPA 5CEXA 4JHWL 1DN2A 1UQSB 1IC4L 4Y2DD 3VXRE 5TE7H 3AREB 2XN9E 3CPLB 4FQLH 3GSNA 4OD3L 3FRUA 5IM7A 3CX2A 4PJ7F 5HHOE 3RY5A 2MKLC 2GCYB 2X4PA 2EH7H 4NNYA 4BYHA 1I85A 1K8IB 2VXQH 5D7LA 3T0DA 4OT1L 2VLKE 1KTKE 4WDIA 3NFPB 3BEWA 3QH3B 4GW5A 5BRZE 3M17A 1OAKL 4KKLC 4JO2H 4ERSL 4JKKA 3IFNL 1HOCA 4FQ1L 2P8LA 2FX8H 2W0FB 2VDNH 4HPOL 5KVGL 1MCBA 5KS9E 2EE2A 3UTZB 3O2WH 5TH2A 5DI8A 3KPPA 1JRHI 5HBBA 1UQSA 1KJ2H 4Y4HD 3RAJL 4JHAH 2AABL 3BD5A 3CPLA 4AT6B 5JOPD 1ZEAL 3D2UB 4YHNA 2GJ6E 3B83A 2RIKA 1F58H 1UYWL 3MUJA 2GCYA 1WBZB 1JUFB 1K8IA 1AGFB 5BO1H 2Q8AL 5EBMB 1CFSB 2XQYG 4UQ3B 3FQRB 1KEGL 4OKVB 4PPTA 5J12B 2GUOB 1AGEB 1FFQA 1I3RB 1LO4H 1WBXB 2V5MA 4HHAA 4JKPH 3V7AE 2RR3A 2W0FA 2R29L 1NL0H 5F88B 1K3IA 1KB9K 3I75B 3UPAA 3WE6A 4OM0H 3TBWB 4HIEB 5IFAL 1EEQA 2W1NA 4QRTB 1HIML 3PL6A 4ZOCA 5BS0B 3GK8H 1NPUA 4DZBA 4QOKE 2EXYC 4HW6A 4XNYH 4YHKL 2QQKL 2XKSA 2Z8SA 2BNUA 5CEZH 3H0TB 3GKWH 1G9NH 2C7UB 2FHFA 3UTSB 4K7PX 1JUFA 5H37H 1AGFA 1FYTD 4JCMA 3KYNB 1Q0YL 4P9HC 3GSUA 1BQUA 4N90E 1TQBB 2GUOA 3U36A 1CTOA 3CFKA 1WBXA 3J7HA 2G9HB 1PKQB 1CDGA 3MRLA 4GKSB 4D9LL 1KIUA 5F88A 3H9YA 2FWOA 4JRYE 4LPYA 3TBWA 3TIEB 1FORL 1NFDF 1QSFB 2LVEA 1A7RL 2OQJB 5BS0A 3REWA 4KTDH 5E4IA 3O3EB 3H0TA 5CBAB 4JZNB 2F19H 5D5MF 3OAUH 3KYNA 3FB8B 4K07A 1UH2A 3TNMA 5FO7B 4P4KC 2NY3B 4R2GB 1UM6H 3MOAH 4ODBD 5C0BE 2K9UA 4NZRH 3K3QA 2CO7B 1PKQA 4J4PC 5DDHB 5F97E 5EU5A 2FD6H 3ZTNH 1Q9KB 1Z6JT 3OV6A 4OFDA 4XMKH 1EGJH 1UXWB 1KEML 5DK2A 3D85B 2MJWA 2OQJA 5A1AA 4LLWB 4D0BB 1PVHA 2DLFH 5T1MB 3UDWA 2DS4A 1AGCA 5C0RL 1FL6A 3O3EA 4W6XB 5GZNC 4G9FA 3T1FA 4L8BA 3CH1B 2KL6A 5FV1L 3ARBB 1B0RA 2A38A 2XWTB 4PRIB 4E41E 4OI7A 4RMWA 4LSRL 2PTTA 3DVGB 3JV4A 3A67H 1T04A 3OTTA 1E4WH 2WWKO 5DDHA 3VXSA 5JW4R 2NTFB 1Q9KA 2UWEF 5DMGD 5HYJD 4YDKL 4NBZB 3D85A 5E6IB 5KVFL 5EIVA 4HXBH 1JI1A 2F58L 4HWNA 5FM4A 1RJCA 1EEYA 1VPOH 4FQXD 4HC1A 4RAUB 2R56H 3L5XH 1R3IH 1FL3B 4KKAC 1DLHA 2Z8RA 5DJDB 3DYOA 3DIFA 3MRDB 1YPZB 3UO1L 3ZKNC 3W0WE 4PJIE 2NY1D 4F15C 3LKQB 4YBLB 2XWTA 4PRIA 1NAMH 1EZVY 2A6DA 3RX5A 1XGPB 5KTEH 4FABH 1HINH 4ONHA 1RZIB 3RDTD 3ULVL 1QLRB 4JPKH 2NTFA 2HRLA 5EU6E 3AM8A 4XVJL 1CF8H 3QWRA 1NCBL 5E6IA 3CH8A 4PG9B 1VENA 3O6LL 2DQFB 4J6RL 4MAUL 2F9BT 3MRMA 4OF6A 2X42A 4DFIA 1FL3A 5DJDA 2IPTL 2Y7QB 2OLDA 2MPAL 4CKVX 1N6QH 2BOBA 3MRDA 4UOW1 1YPZA 2E9BA 2ARJA 5FIEA 4AIZB 5LBSH 5KSBE 3T8XA 3T4AB 4PRHD 1VACB 4NO0B 3WJJC 1OD9A 2DQJL 5IK3A 1D9KA 4FQCL 5FF6B 1A1MA 4YHZH 1MJ8H 4JO1H 4JPWH 1QLRA 2SEBA 1I1YB 4OCXL 4L3ED 4YFEA 5EUOF 3RHWF 4FP8L 4M7LT 3MGOA 4F15B 3N1QC 2ORBH 4OF3A 2FATL 5DUMH 1REIA 2YK1L 4LGRB 3FN9A 4WU5B 5C92A 4I18C 1XGUB 5ANME 2IH1A 3BPCB 4X8XA 1RZFH 1WFTA 2VLME 4CMMB 2J1KA 1F3RB 4AIZA 2PKDA 1WUNT 3T4AA 2NXYB 5TFSH 4X0KB 1BMGA 1FPTL 1GVIA 3DXAD 4ONGL 2FHCA 3B9EA 4U0RB 5D7KE 1KENH 3CFEA 1L7IH 2VAJA 1CLOH 3P9LB 4KI5C 5D7IB 2G2RA 5I6XC 2MQ3A 1OPGH 4OQ1A 3GIVB 2EDNA 3N1PC 3OAZK 3V0WL 4BK5A 3GMRB 4X9GA 1NCWL 4OIAA 3H7BB 3VWJD 3BJ91 2QR0A 2VLLA 4GQ9L 3E0GA 3KLAB 1XGUA 4G5ZL 3LH2H 3KNBB 2C4FU 3I9GL 4XXDB 1XGRB 3MBED 2EDTA 4GKNB 5M95B 1FNGB 3S3PA 5SX5H 5JQ6L 1AHWC 3M1BA 4KQ3L 4L9DA 5B38B 3S7GA 3RGVD 3QZWB 1UZ6E 5ISZB 1U8QA 3EFDH 3P9LA 1J8KA 3P9WB 2BNQA 1MFEL 4K7PY 4OCSL 1YNKL 2VLJE 3BPLC 1QZ1A 3Q2CA 2JJTA 3ZT5A 3WLWD 4M9PA 3GMRA 4HK0A 3U0PA 1PX4A 5I1HH 3H7BA 2NNAB 1BEYH 4MD4B 2CIIB 3KLAA 2DQGH 1X3DA 4KMQA 1QA9A 2ARWA 1QBBA 2WINB 2C1PB 3EOBA 1MWAB 2JIXB 1MCNA 2YZ1A 3QI9C 1V3KA 3HR5B 5B38A 4GBXB 3QZWA 2P47B 2DAVA 1I8IB 4MDJB 1OTTD 2VE6B 1JCKA 2XZCL 2NY5C 2W0PA 3LVEA 2XY1A 1DBAH 3L3OB 3U7WL 2BHZA 1AI1L 2CIIA 3EOTH 4QYOB 4RAVA 1JP5A 2EIZB 5E08L 1DJSA 2EC9U 5HDBE 2E7LC 2WINA 2C1PA 2ZNXA 3RVXC 3QPXH 3KPMB 2JIXA 3T2PA 5DT1L 1WWAX 1JNLL 4FNLL 3S88H 2R0ZH 4HKZB 4YX2L 4IRZL 4JRXE 2AK4B 3HPLA 1L7TH 5HGAB 5HI3D 5FOBA 3TJHC 3RPKA 3MLPA 1RIHL 2Y07L 3K1KC 3J8F7 5HGGS 3LPWA 2GT9A 2XTJE 1T2QL 3OKEB 4AEIL 3AU1B 4G43B 3VXUE 4CVZB 1J5OL 1QBML 1IZKA 1IAIH 3WHE1 1GL4B 1BVKA 3QI9B 4YC2C 4QYOA 4OM1L 1K4CA 3D69A 3QQ9D 4DGIL 3D3VD 1AD0A 5BW7A 4TUJB 1CGTA 3KPMA 4YK4B 5EO9B 2BXYA 3FRPA 2FL5A 4N0FB 2AK4A 2NR6D 4UDTA 4JPIB 1UM4L 4EBQL 2YEZB 3X11A 3N1FC 1JTPA 1INQA 5DQJA 3PWPB 3TA3C 3P30L 4DGVH 4LMQE 1RJLB 1NLDL 3C08L 3OKEA 4G43A 1JL8A 1FSKB 4LQFL 2ZOKB 2BC4A 5IQ9A 2VAAA 1KULA 1U3HC 4RGNB 4RQQA 4HUVB 1PG7X 1TJGL 2HTLC 4UV4L 4KUZH 4D94A 4TUJA 4Q6IC 1WWCA 1G7IA 1WJ3A 2O5XH 3GSRB 5K59F 3VXRD 4N0FA 3VA2C 2I9LA 3EOYG 5AWNH 2XN9D 5I71B 4YC2B 5HHOD 3I2CL 3PWPA 1QLEL 3KXFE 1TENA 4NIKB 1I7RB 3PABB 2VLKD 1QYGL 3ARVA 5BRZD 1ZLWK 3O6ML 4MB3A 3OAYH 2ZOKA 3HPJB 4BSJA 3O11B 1H3PL 5E2WH 4MAYC 3AUVA 3VFSA 4DGYH 2QQNH 1HKLL 3QIBB 3K4AA 3TA3B 3BZEB 2AXJA 5GS0D 3GSRA 4NCC2 1ZKAA 4RGMC 1A6UH 1X5YA 3F7RA 4LPTA 2GJ6D 5DYOA 1U3HB 4CNIA 2YR3A 5J56B 2ARJQ 5EBWB 2R8SL 1FVDB 4PRAA 3T3ME 3O6FD 5GGRB 1I7RA 3PABA 2NY0D 3PWUB 4UB0L 1KACB 3TCLB 5IMKA 3ZYOA 4FFZH 4ESKA 3HPJA 3O11A 2JB5L 4U1IB 4OCWH 1WISA 1LQSR 1ZLSL 1EDQA 3GNMH 5IVNA 3QIBA 4MQ7B 1PJ9A 4JRWA 1FNSH 1CR9H 1NLBL 2OR9H 3BD4A 4KV5E 4QOKD 3JWOH 3KGRA 3DYPA 1IEAB 5DS8A 2A73B 1U36A 3KYAA 3OGCB 3W5NA 3GEWB 3IF1B 4X7TB 4WV1A 5FB8B 1KTRL 4WI3A 2X6MA 3PWUA 1I1AB 3A6BH 3TCLA 4N90D 1G6RH 3UROR 3L3KA 2DMBA 3HMWL 1TCRA 4RGMB 2JJSC 2BX5A 1OAZH 2EH7L 4JRYD 4JY6B 4QRUA 4MQ7A 1QSEE 1OAYL 4MGXA 5C7XL 1WIOA 3SDXF 2ADFH 3ORJA 4OZHF 1LEGB 2QJDA 3W5MA 1MF2L 2A73A 4YO0B 5I30L 5FB8A 2ADGB 2BJMH 3IKKA 3BP7A 1I1AA 1MIEL 1X5AA 3OG4B 1KN4L 1MCIA 4G3YH 9CGTA 1SEQH 3HNSH 4HV8A 5IT2H 4NKQB 5C0BD 1F58L 4PJFF 3ZKXC 2VLRE 4JY6A 4NKIL 2Q3AA 5D1ZB 1RURL 4XCYA 1AXIB 3EBAA 2XZQH 1IEBB 1W8NA 3U9UB 5E7FA 5I66A 4H88H 1Z9MA 5D7JB 2ZOLB 1LEGA 3MLYH 3AS1A 1NL0L 2E7MA 4BFBD 5J11C 3T0EA 5T3XE 4XI5C 5TF1L 4YO0A 2O5YL 5FM8A 4JPVL 2BRRH 3D87B 4E41D 4ZFGL 4LHQB 3S4SB 3G5VA 4NKDB 2Q7NA 4U1LA 2X1WL 1BFOB 1DDHA 4U6XA 3G5YB 1L0XA 5EU7C 1DEEB 5D1ZA 3DVFA 4JDVB 4JZJC 5E2TL 3U9UA 2PYEA 1UZ6F 1YC8A 4ZD3L 2I5YL 5D7JA 2ZOLA 1V7ML 1INEL 4F3FA 5B21A 2M26A 3CMOH 4JLRB 3W0WD 1VGKA 3ETBF 4N5UA 3K2UH 1MAML 4MSWB 3VRLF 2DN7A 1Z3GH 2B1AL 1A5FL 1IGMH 3K8LA 2BRQA 3S4SA 3V4UL 1HCVA 2NCMA 1WAAE 2VC2H 3FMGH 2RFXA 4CDHA 1BFOA 2VABA 3F12A 4MLSA 2F54B 4HUKB 5DO2D 5SWQB 4LEOA 4HMEA 2DLHA 1YEDA 3G5YA 5EU6D 1SM3H 1CFTB 5LQBL 3SDYL 3MMEA 1S7XB 3O2DL 3MOAL 3CZJA 3HAEG 4TVSa 4PS4H 4Y4KA 3BHBB 1CK0L 15C8L 1NEUA 1MRFH 3MJ8A 5FGCE 4PJ9B 1EGJL 4K8RC 5SX4H 4NRZB 4JLRA 5DFTA 4MSWA 1JGVL 5B8CC 4RFOH 5HI5D 4LKXB 2DLFL 5CGYD 3S5LA 3EYVB 4LSVL 3U0WH 1FP5A 3LN9A 4OZIB 3O3DB 3WIFB 1ZS8B 3MQIA 1XAUA 1AR1D 4W68A 2Z35A 3MV8E 3VRJA 1J8HA 1R5WB 3QISA 5DJXB 1IC5H 1S7XA 2JLLA 3SKJH 4HH9B 2VQUA 1I4FA 2V17L 3CLFH 4OSUH 2OI9C 3BHBA 5IVXB 1OSPL 2ZUSA 4PJ9A 2F74B 2IF7A 2CLRA 2VLMD 4I5BB 1T0PB 3BRGC 1GC1L 1MFBH 3DUHA 3V6BR 1UWGL 3WFZA 4R97B 4LCWB 3PJSB 3AVEA 1OT1A 1QR1A 3LQAL 4FMKA 5D7KD 5FM5M 4WGWB 4HIJB 5IW1B 1TZGL 2XIDA 1VADA 4TQEL 5DEFA 4Y16C 4WTXA 4DCQB 4QHLA 1LVEA 2I60L 2JB6B 4XBGB 3FFDA 4HH9A 3NIGE 1K8DB 4K7FA 1EO5A 1U8MB 3BAEH 1G9MH 4MJ6B 4V1DB 3RNKB 2PCPB 3DX7B 3RY4A 4HX1B 1A4JB 3RWEB 3QDME 4I5BA 3QCUH 3QHZH 4ODUB 2MKWA 3U4AA 2FH6A 2X4QA 3P9MA 3PJSA 3LRGA 3OAZH 3LQMA 3QJFA 5C0JB 4ETYA 2HFTA 2OI9B 4U6HB 4YNYA 5FHBL 4PGZA 5IW1A 4ZPTB 5D93C 2DDQL 3ARFD 3BIBX 2VLJD 3I6LE 5AAMA 2JB6A 4S0TD 4XBGA 5ERWB 2H26A 1J0JA 1ACZA 1K8DA 2VNCA 1MJ8L 5EBGA 4V1DA 3H3PL 5FA4B 2PCPA 3QJHA 3DX9B 5E4EC 3RNKA 3C5ZB 1F5WA 4HX1A 2QADC 1A4JA 1T1WB 5E70A 3CNKA 2UVEA 4ODUA 2APWA 4Y16B 5FA3B 3FOLB 5AAWA 4APQD 1CICD 5JW3H 3V0VB 4OZGE 5C0JA 3EYFB 3FTGB 1QO3A 1SEBB 1B4JH 4U6HA 1RZFL 5B3NA 1LO2H 3L7FB 1JRHH 3ZKSD 2YN5A 1KSRA 4GH7B 3KPOB 4M02A 4Z76A 4PB9H 4ZXBD 2UYLB 3C5JA 1OPGL 4KFZC 5KSAC 1T1WA 1HQ4B 3QUZC 5IUSA 4MS8D 4Y4FC 1MHEB 3JVGA 5FA3A 4XVSL 3CX5J 1NMAL 3TV3H 1RQ5A 4JRXD 3S35H 3FTGA 4N8CL 3BO8B 1GOHA 2KQMA 1MREH 1PG7H 1GGCH 2QADB 3CZFB 2XTJD 1DTUA 3L7FA 3BDBA 4JB9L 3VXUD 3KPOA 3EYSH 4N0UA 4ODXB 1Z9SA 4J3UA 1XIWD 1BGXL 1KIRA 1NUDA 2UYLA 3EFDL 4QHUB 1RUPH 3QBTB 5MENE 1ZANL 2NY6C 5B39G 1K4DA 2OL3L 3KPNB 1CDCA 3QEHB 2HG5B 4YHIB 5F9OL 3B9KD 4YAQB 4FTVE 4ZO6A 3FAXA 4PJHB 1SVZA 3OJVC 2YN3A 4P5TC 3FO9A 3Q6GH 3BO8A 4LSQL 5F7UA 4MA1C 4G6AC 2NY4C 3TPUB 5KSAB 3CZFA 1PSKH 4TSBL 3QUZB 3CCHB 3DV4B 3S36X 3VFPB 3WDJA 3U9PL 3X14A 1LK2B 4QKXB 2YBRA 5BZWB 1RV6X 1F4YL 3B2VL 5CINL 3CSYB 1NC2B 4XB7A 4FXGB 3U7YH 4I0PD 1H3UA 4LLDB 4QHUA 4G6JH 5D6CB 1JZ4A 4IBLT 2MMXA 1YQVL 3QEHA 4XMLH 2CRIA 2HG5A 4WCYH 5GS1A 2VDOL 2BMKB 4PGBB 4NC1E 3WS6C 5HYFA 1QNZL 4HBQA 3UTTB 1HILB 3EOTL 1GPOL 1IBGH 1T1XA 3PXJA 5HPMA 5T5NG 2VSCA 4TOYH 5HHVL 2BK8A 2GTZA 3KXFD 5T3ZE 3WD5L 3CCHA 3PDOB 2PW1B 3VFPA 4ZUUA 4YHLH 3S88L 1BFTA 1RHHB 2EEDA 4AIXA 3FO0H 4MNQB 5BZWA 4TN9A 1L7TL 4U6VL 2OTUA 1NC2A 3MODH 1WVZA 4FXGA 5DFWH 2VUYA 12E8L 5D6CA 5E8DH 4R4NC 3MUGB 3C8HA 5FYJE 3PWJB 5EFIA 3W9DA 1A6PA 5HGBA 3BMWA 4MA1B 3GRWH 1JHTB 5I1LB 3IGAB 4N8VB 2BMKA 5E8PB 4PGBA 5DUBB 3UPRB 1RUQH 4BUGA 5C6TL 4IIQA 3VE0B 5I16B 5H2BA 1ZT7B 2IQAB 1A6AB 3EO9H 4S1RH 4XVTH 1DBMH 4ZNEA 5KVEH 3PDOA 3STZA 3F7QA 1RHHA 1TNNA 4LLUB 4MNQA 1YYML 4D2NA 3I3EA 5MERA 4NQDB 3FONB 3QRGL 3MUGA 4DN3L 3KS0H 4OCRL 1OF2B 5GGVY 5SWZE 4DGVL 1ZGLB 3SE8L 4UUJB 3MC0A 5I1LA 4LHUD 3L3JA 4N8VA 3DVIA 4M8QB 5CSZA 3UPRA 4NO5B 3QXDB 4GXVH 3OHXB 5HYQB 1FBIH 5J1SC 3ROLA 4PJ5B 4OZFG 1IVLA 5EB9A 2APTA 2H2SC 4F9LA 5L9DL 1ZT7A 1A6AA 3MTRA 4WHDA 5I73B 4KUZL 4HBCL 4ONOA 4U6YA 4CW1B 2WZPD 4L4JA 4K3JH 2H32B 1P5UA 4WI9A 5L0QC 5E5UB 1DUYB 4LLVA 5A2LH 2P7TA 3FONA 3RZCA 1BBJB 4N5EC 3ZT6A 1OF2A 1CLZL 4NZTL 1QOKA 1QSED 3WHXB 4QXUH 3VDBA 3U1SH 4M8QA 4P57B 3QXDA 4ZSOA 3OHXA 5BZDB 3BE1H 5HYQA 1BAFH 5FCUH 1KELH 1JE6A 2IC2A 5B22A 1DVFD 3ZYZA 1ADQH 2FO4A 2XZAL 3TWCH 5AZEL 5K9KB 4F57L 3C2AL 4M7LL 5J6GA 3WN5B 1Y18A 1NH6A 2H32A 2I07B 2Z92A 2ERJC 4GG6A 4NN6B 5HVWA 3IFOA 2AXFB 2VLRD 3HNTH 3HZVA 5GGUB 1WZLA 3N9GL 4CADB 3O4LB 1BQHA 5FGBC 1HYRC 2IALB 4P57A 1OM3H 2EXWC 4N0YH 4BSVA 5E99L 1YY8B 2EDJA 4I3RH 2ZNWA 5K9KA 5T3XD 2YPLA 1I7TA 3E8UH 2KPNA 3PV6B 3R0NA 4YHYB 2B0SH 5A2IH 3TFKD 3A6CL 4JEGB 4XCFH 3LHPL 4WWKA 3WN5A 1RVFH 2A6KA 4EI5D 4AZ8A 1AE6H 1G9NC 4UILL 4HKJA 2AXFA 3ZO0A 5GGUA 1MFNA 1U95A 3KLHC 4PJGB 1IGFL 3QHFH 5DSCA 1H9VA 4PUBL 3LKSB 3O4LA 3OKOB 4CADA 1G6RL 3LQZB 2BSED 1YNLL 1F4XH 2L0DA 2ICCA 3BUTA 1N7ML 4GW4B 5F7EH 2VMFA 4HPYL 2ERJB 3RTQC 1ZT4B 4Q9QL 1EVUA 4BQBA 2HJFB 4PRPE 3PV6A 5HHME 3BP5B 5D96C 5C0CB 1SYVA 4CGTA 5C08A 4DVRH 1IC7H 3IFPB 4FQIH 3G9VA 5DA4A 3HNVH 3EHBD 3T2OA 2ZG2A 1FO0H 1T5WA 4ZFZB 4PJAB 3S3SA 1BJ8A 3D1MC 4DKEH 2BJML 1OCWH 2FGZA 2YRPA 3QEQA 2NLJA 3LKSA 3OKOA 1O5DT 3VXQB 3QDGA 2Q86B 2DQCL 4V2BA 4Z95H 2MCG1 3IRPX 1FRGH 2AJVL 2Z31D 1CQYA 2VXUH 1GYAA 4Y2DA 4LCCC 3MGAA 5IFHL 2FX7L 1ZT4A 3BT2H 5IB3B 4L3AA 2HJFA 1KB9J 3WXVH 4G6KH 1W8OA 5GGVH 4EDWH 5T1LD 4MCYA 1KN2L 1H3VA 1GZPB 2P8MB 2XZQL 5HHPB 2VZVA 1ZHLB 1H0DA 4K94H 4HIHA 4KTEL 4ZFZA 1XF4A 3RJDA 3IB4A 1MJ7L 4HXAH 3MV8D 5TGBB 1Z5LB 4XMPH 4ELMF 2ZSVA 2VDPL 1IAKB 1HQRA 2DM2A 1MCLA 1ZLVK 2Q86A 4ONFL 3R06A 2AK1L 2DQEH 3QAZC 5JXAH 3MRJB 5E00B 1NGQH 4MXVF 4G80B 5IB3A 4YR6A 4MJ4A 5KZCB 4I0CC 2WBJC 1L4IA 2ATPB 3O9WB 1GZPA 3DX8B 1GRWA 4WW2A 4YEEA 4DK3A 4H8WL 5HHPA 1FYTB 5CMAA 1EMTL 2DTML 5ENWB 4M61B 4WI6A 4C58B 1H3WM 4OTXH 4LCCB 5F89B 3JV6A 5TGBA 1AR2A 1LO0L 4QTIL 1IAKA 4NUJB 5EIQA 3QULB 3L3IB 3TH2T 1NMCB 1BF8A 2GQHA 3MRJA 3INUH 3SGJA 1PYWB 4LLMA 3G5ZA 4G80A 3TN0B 3AM8C 3PP3K 5E2JA 1RZJH 1MCPH 4ZMAT 3QDMD 2VXVH 3O9WA 4JANA 3HAEH 3BSZH 4NOFA 1FYTA 3O2DA 5ENWA 1MCQA 1ZAGA 1QFPA 4M61A 4U1JB 2GW5A 4M9OA 5F44A 3JWDH 5F89A 4FQHB 1F97A 4IOIA 2X41A 3B5GA 2HLFD 3CFDB 4M62H 2WBJB 4NUJA 5JA9A 4X6DF 3I6LD 4X5WB 4DUWA 1LDPL 3QULA 1EEZA 4PJ7B 3ARPA 3ILQC 5JDSA 2CPCA 2MCPH 5J57B 3WUWB 5B3JF 3UYRH 4EZMA 5KSVB 4YUEH 1IC5L 1A64A 1FNEB 4Y5XB 3GBLA 1D6EB 3GBMH 3QUYB 3SDDD 1AIFB 2NXZD 4HKBB 1NAMB 2JCCF 4FFWC 4QCIB 4U1JA 3M45A 4OSUL 2CDFB 4HGWA 5A2KH 3O4OB 4XWGL 2J88L 3TYFB 1KBGH 3ZHKA 3VGHA 3EYUL 4X5WA 3HCVB 2HTKD 4X4XA 1EPFA 3BWAA 3MXWL 3G6AB 1OVZA 4KK5C 4LASL 3WUWA 1Q1JH 4LSSH 1UENA 2DYPB 3GI9L 1R3LB 1UACL 3IFLL 4IHOA 3QEGH 3BPNB 4I48B 5FK9B 2DQUL 1FNEA 4Y5XA 4Q97A 3S36H 3C09C 2P4AB 5C0IB 4PP2B 5I15L 1AIFA 3BAEL 5DWUH 5F6IB 5L7XH 5F9WC 4LAQH 2BVQB 3P77A 3UTSE 5JPNB 5F96L 5HJ3B 3RDTB 1MLCB 4P3WA 1RZGB 3TYFA 2AJZA 1I8KB 1U2CA 4X4YB 5HYJA 3HCVA 4D0DA 3OL2A 3KDMB 1JZ2A 4TUKH 5D2NA 4JFEB 2VDMH 1DR9A 5T33H 4U3XA 5I8CB 3BQUD 5MEND 4CJ0A 3NAAH 1QSFE 3AFLA 4I48A 5TDNA 1ZVSB 1INDL 1XR8A 2GSGA 2LABA 4FTVD 3NFSH 4IRSD 5C0IA 5ICXB 4PP2A 3TIDA 4PRHB 4XX1E 1B90A 5D2LE 5JIPA 3X3FL 1NFDB 2BVQA 3E3QC 5JPNA 1LNUA 5HJ3A 4JM4L 3RDTA 4OQTA 4Z7WF 1MLCA 1RZGA 4WTZG 1I8KA 4GS7C 4X8JB 4X4YA 4QNPF 1UJ3B 3KDMA 4KROD 4U1GB 4EUPB 3C09B 1IC1A 5JW3L