3V4UH

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
EVKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVANINYDGSSTYYLDSLKGRFIISRDIAKNILYLQMSSLRCEDTATYYCARLTNGYLDVWGAGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLESGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
total genus 40
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH01
3WNLA 4NO0D 4M62H 4J8RB 1PDKA 2L4OA 5MI0C 3Q2CA 2Q86A 4X6CF 2RFXA 3DETC 3ILQD 3L3GA 4OGAD 1FG9C 1UWGH 2WINB 3QDJD 4UDTA 1FGNL 2NY2D 4FFWC 5F1SA 5KVEH 1TZGH 1OTTC 3JWNC 2JJSC 3UYOD 1ULVA 4UOW1 2EIDA 1UXWA 4FQCH 2LTQB 5B38A 4G5ZL 2R1XA 3IDXH 2Y4SA 4TYUA 5E08L 3LN9A 2ICEA 3UBXI 1KJMA 1J5OL 3EJZD 4P4RA 1TPXC 3VFPB 1OP3K 4AMKH 3ARBA 3ULUC 1YQVH 4ZXBB 3RVUD 1KG0B 2VZUA 1W0WB 4YX2L 4S1QH 5DRXA 1ORSA 1T7ZA 4E9LA 2ZZUT 5DRXB 5ALCH 3UO1L 3PF2A 4LVNB 1ZVHA 1H3PL 3VXRB 3KPTA 5JOPD 4TTDD 1BFSA 1Z0MA 4JKMA 2GT9B 3H9YA 3RJDA 1YEHH 2DLTA 3TPUB 3QQ4B 2PW2A 3MOBH 1LEGB 4FQXC 5SWSD 4JFZL 5DLML 1P2CB 4Y2DB 2ITCB 4YXKL 4UT9L 4JFEB 3STLB 4Y1AB 4MNQD 3UBXA 5KVDH 5KS9A 1KNOB 5IOPB 3SCMD 3UC0L 1XGPA 3EDKA 3EZJB 4OLXL 1YNLH 3TFKC 3BO8B 5ICYA 1JF5A 5IEHB 3D69A 5DD6A 3WJLC 4NQDE 3OAUL 1AJ7L 3V2AR 3ZKXC 2XYCA 1S9XB 3BEWA 1KIPB 5IW6A 3QQ9D 1N4XL 4ZOEA 3VD5A 4JVPA 1YN6A 3PV6A 5D70L 5T3ZH 4G8EB 3NBNA 2NR6C 3WE6B 1AXIB 3MRQA 2VABB 4PRPB 2AXGB 4JKKA 5IJKC 1YEGH 1YN7B 2EDXA 3SDXB 1F90L 2VITB 2H9GA 5JNYB 4J3OC 5BXFB 3MLYL 4HKBA 4X6DE 2OZ4A 5T1DL 4JR9H 4ISVB 3FQRA 1PG7X 4K9EC 4WTZA 2FZ3B 4IRJC 4LF3B 4ISVA 3VA2C 4QLRA 3SQOL 5GGRY 1IILE 3OJDA 2C4FT 1DSFL 5C07E 1NCDL 4GS7B 4NRZB 4X7SH 1FZMA 3QIWA 5EBLB 5EU3A 2DQCH 5I17A 2C1PA 3AMLA 1X5GA 3IXAA 3H9ZA 5JPNB 1CDIA 3TBVB 4AENB 1VPOH 4ZD3H 5A3IC 2EECA 4RWYH 1IC5L 2R4SH 4L3EA 4MJ6A 2EYTA 5DJ2B 3VXMA 5DJYA 3VFMB 3OMZA 4XMLH 4LLAA 3KJ4B 3IJHB 4KKBC 3CVIL 1ONQA 3KVQA 4MMZC 4JB9H 3IJHA 3BT2H 4GKNA 1MJJA 4Q7DA 2FBOJ 5EO9A 4GAYA 4NZTH 2Y07H 4PJEF 4BQCA 1SJEB 5FEBA 1MRCH 1BD2E 4NP4L 4IHOA 4LCUA 5ANMB 3BI9X 1D5IL 4KRMB 4NBZB 4OGXH 1EBAA 5EOTA 4N68A 4X0KB 4F15B 1FE8L 3DVGB 1NGPH 2W0LA 1I1AC 3MNZB 1QSFD 2HT2C 3FQTB 3MV8A 5EOCJ 2R2CA 2YSSA 2E7CA 5GRXG 1VEPA 1WZ1H 4GRWE 5HD8D 2DKSA 3IETB 3NIGF 4UT6L 1AO7A 5IW3A 4XPAH 5D9SA 5IWLA 4OFDA 2ICWJ 5DK2A 3Q6GL 4DQOL 4PG2C 3EYFB 1JGUH 4HXBL 3MV9D 2X4UA 1UWEH 3CXHK 1JYNA 5GRVK 4Z5RB 3FB6B 3O6FA 4MMXC 5F96H 32C2A 3UTSE 1Y6MR 1NPUA 2ORBH 3RVUC 5C0NC 5ISZA 1CDYA 4S1SL 4LU5H 5DJDB 4S11A 2B1HL 5FHBH 1WCBB 2LV4A 2AJVH 5D8JL 5C07A 4BQBA 1PQZB 1BWMA 2AJYH 4MAUL 5DJDA 4PJ7E 1ZWIB 4HIJA 4DEPC 3CSGA 3PWNB 4R26L 3S35L 3HZKA 1HKLH 1RUKH 5EU6D 5GJSL 1UJ3A 3BUYB 3O3EA 5DFVD 2DTSA 4OLUH 1E6OH 1I7TA 2DRUA 2B0SH 4BH7B 2FATH 3L3DB 5GHWL 4K23H 4S0SD 4PV8A 4CMMA 2ICWA 5FK9A 3SKJH 4I18C 4UBDC 1X5FA 1FCCA 1X5ZA 4HIXH 3D9AH 3CFBA 4POZC 4G6MH 4ZOAA 2IEPA 4EOWL 1FNAA 4JAMA 5KW9H 2X5PA 3ISWA 4KVNL 1XGTB 4PRHB 1IAIM 4LLYA 1KGCD 3DV4A 3MLTB 4LLYB 1Z5LA 1A3RH 2ZUVA 5CZXD 1YMMB 4JHAH 2OJEB 1A4JB 3LD8B 1MCQA 5DTFA 3V6FB 4Q9RL 1RIHL 5FFLA 3JSSA 3DX6A 4JDVB 3RWHB 4F7MA 4R7NB 3O8XB 3WNNA 1NCAL 1H3GA 5HVFB 1GGCH 3SJVD 1Q9WA 3C6LC 3MLZL 4BH8B 1QRNE 3IAPA 2YA1A 5JDSB 4Y4FB 5EIIB 2H2SD 3UAJD 3LIZH 3G6JF 1JPFB 5B8CC 5IBTH 1IGYA 3GBNH 1CICD 5D7SL 4I77L 15C8L 2BVUA 1ZT7B 5CJ8A 3GMOA 5I30L 2VMFA 3TIDB 1KLGB 4OZFG 3GO1L 1HEZA 5K9JH 1KLGA 1KT2B 3TYGH 4PJBB 3JV6A 4NKOB 4LKXA 4XBPA 2VAAB 4ZTOH 4FZEH 4F58L 3LPFA 2NXZB 1X5AA 3L7EB 2F19L 3LRHA 1P4LA 3FN0L 1B0GB 2YD8A 4WGWB 3FZUC 2YD1A 3R8QA 3RVWD 3Q3GB 2VSCA 3CMOH 4X4XA 3GHEL 4Y4HD 1CG9B 3L3KB 4NNXA 4LASH 3STBA 5DVKA 3RVXD 3RRQA 3V6OC 1ZVSB 4XHJD 5FYLE 2XWTB 3P4OB 1JF1A 4HF5L 4D9LL 1ZGLM 1CFTA 2OI9B 4JGMA 4KTYA 3MJ9L 5C0JB 4RGMC 5C0BE 1CDCA 4HSQA 3WBDA 5HDOA 3VFNB 5E8NA 3THMH 3GI8L 4M7LH 4OCWL 5EDXA 4P2OD 1CBVL 1J8KA 3BZ4B 2MHAB 4JANB 3LN4B 3PGCA 2VLLB 3G5YB 1ORQA 5I1LA 2GJJA 4TRPL 4W81A 1M6OB 4ZUTB 2J5LC 1FYHB 3GSWB 5EO0B 3O45B 4J2XA 5H8DA 3D0LA 3TO4C 4QY8A 5EO0A 1JHLH 5I1GL 3BMVA 1HINH 2O61B 1AQDB 4MB3A 4HKXB 3MRNB 4NO0B 3W9EB 1MF2H 3UTZA 4K3EL 2V7HA 4WHCA 3VD3A 1DP0A 5KBNC 3PGFL 4JFOB 4YHML 2V7HB 3IFLL 4UV4L 4KJQC 2EKSB 1CZ8L 3QQ3A 3GK8L 4PGDA 4NSKB 1NSNL 5BS0B 4YHKL 3NCYP 4NSKA 5KVMC 2RCSH 2H3NA 2WIIB 1BFTA 4P9HH 2COQA 1N64H 5D5ME 3VXUE 4S1DD 1L9NA 3PXHA 3EO9L 3HMXH 1MFBH 1C12B 2VDOL 4NC0B 4JHZA 4MZ3A 2FIRT 5F7UA 3SDYL 2DOCA 4KK6C 5CBEB 1IC7H 3QUXA 1YMHA 5ID0B 2R2EB 4G8FB 1U8NA 2G60L 1T22B 1EEUA 1CGVA 4QOKD 2KQMA 2XQYG 5T3XE 1A2YB 2GY5A 1FYTD 4PD4K 1EZVY 3HMWH 4JEGB 4PV9A 4KJPD 2D7TH 5CFHA 1DLFL 1KYOK 1YNTB 3OAUH 4LP4A 1NL0L 4UOJA 4H25A 1JGEB 1D5MB 4TUOB 5E9DE 5KSUB 2OXHA 2C9AA 4EBQL 3BDYL 2GSIA 1BJ1H 1UVQA 2V9TA 3C8HA 3BKCL 4H8WC 3FCTB 2NY4C 4M6MH 3MBXL 3WXWH 4XRCB 4TNVF 3QI9D 2BSTB 1U2HA 3EYVB 2DM2A 1URLA 3PIQB 5KZCD 2CO7B 3QIBA 4OF7A 2B7DT 4PJ9B 1MCRA 4MCYA 3NCYS 1S9YA 3W82A 5JR1L 5CGYC 1QFWM 1J1XH 4OLZL 4LPCA 3UDWA 3BPLC 1BVKB 1YEJH 1BEYH 5DUMH 1BZ7A 3TYFA 3BKYH 3IRZA 3BZFB 3TYFB 2FLRT 1XF3A 4F57L 5DO2D 4ALAH 4M61A 5HGAA 1DANU 1FBIL 1FN4A 4YBLB 5IKCA 4OF8A 3ZKQD 3CX5K 4FP8L 4LMQI 3RAJL 4ZSOE 4IJ3B 1RUQH 2PYFA 2V2XA 2WLYA 4PGCA 4W6YB 4CVWA 1HHKA 2GUOA 1OTUD 2BNRE 4POUB 5DMGD 5HVWA 4JY4A 3ARSA 1G9NC 2Q86B 3ME0A 4G9DB 4NFBA 4KGJA 4M8QB 5E6YA 3N1MC 4RFEA 4J7RA 4LVEA 5EWIH 3BPNB 3VI3E 3ZDZE 5E8DL 4HS6A 4JKPL 2GJ6D 1BZ9B 2YPKB 4YR6B 3K2UL 1W2KT 2DQFB 3NZHL 3TLRA 4UU9A 5ICYB 1BM3H 3D85D 1FE8H 4FFYH 2ICEB 1P4BL 5DMIL 2OR7A 3P4NB 3VFPA 1YA5A 1GGTA 4XVUC 3O2DA 3PJSA 1KIPA 1G7IA 3S36H 3AXLA 4GG6B 3WV0A 5B39B 1ORSB 3QXWA 4K3DH 5INDB 1WZKA 2APTA 3MJ8A 1G0DA 3QEQA 1UG9A 5J11B 4IBLT 2Y72A 4WY7H 4HXBH 2C3VA 5GRWA 3V6BR 1U93B 5I66A 3U4EB 5J6GB 4WI4A 5TE7L 5IB3B 3MRDB 1W0YT 2ICWI 3RKPA 2X9WA 2XWJA 3E6FA 3MRGA 4CADB 5D7JC 1NANI 1A7QH 1QLRB 5GZOD 4XTRC 1U8QA 5EFIB 3E3QE 1ZLWK 3MA7B 3GSNH 4CDGC 4LGRB 1J7VR 4DW2H 5I1DB 3H6JA 1F4HA 4R0LB 4LEXL 1U6AL 3BIBX 3RHWF 3IXTA 5FF6B 3HPJB 1F3DJ 4XNMA 4KHXL 4L3EB 4HUNB 1SJHB 2FATL 3IXTB 5CAYB 5FF6A 5C0AE 4G8EA 4BYHA 3RZCA 3OV6A 2R4RH 2BNRA 4G42A 3L5JA 4PJHB 1RK0A 3P0VH 4M7KH 3T0EE 4HK3N 3SY0B 3PWPE 4G43B 4GAGL 5AG8A 4HK0A 2JIXB 2Q7YA 5T1MB 1HCFX 1HH9B 4FMKA 5ALBL 3KS0J 3DGCR 4QXUH 3F7VA 2DQIH 2YD5A 1XGYL 2A6IB 2I9TB 3FQRB 1BGXH 3SGDH 5EIQA 1UM4H 1LDPH 5EZIH 3OKKB 3CSYA 3P2TA 1ZA3B 1Y0LB 3O6LH 4JRYA 4DCQA 1IRAY 4D0BA 4BSJA 1NANH 3WUZA 5D7LD 2ED7A 3RWGB 1T83A 3TCXA 4DGIL 5I8CA 5EZOL 4HGKC 3U48A 4BZ1H 2FECL 1A1NB 3C08L 1OP9A 1T0MB 4XP6L 4F8TA 4LVNC 4YX2H 2P8PB 4U4BA 5C0BB 3M1BA 3U0TB 1JNNL 4CVZB 3H3BC 2ZOLB 4OZIF 2AABL 3MRLB 1RIVL 2YR3A 1GGBL 2XA3A 4NHCL 4JFDA 2VZTA 1XCTA 4QF1A 4OCSH 4P4KA 5DQ9A 1FIGL 1KCRH 4XPHL 4HLZH 2AJXH 1MJJB 3ARVA 5GGUA 5JDJA 4U3CA 5MEQB 2IGFL 2GEEA 3TJHD 1M7DB 2M26A 1K8IB 3RI5K 1MIMH 2ICCA 3EJYD 1M7DA 3SO3B 1JMZA 4OZGE 1CFQA 3K8MA 1FLTX 1F6LL 4XBGB 1DCLA 2B39A 4LSVL 3T2QA 4C56A 3LDBC 5D5MB 4I3SL 4Q58C 3BAEH 1MI5A 1NMBH 4JO3H 2CIKB 3CLFH 3CVHH 2DQGH 4E42A 2UWEA 5GGSY 1T2JA 3BSZL 5T5FH 2OCFD 5TH2A 3KYKL 4LHQB 5F88B 4LSSL 4RAVB 4OAWA 4EIGB 4X5XB 4H20L 3FTGB 1HHIB 3GBLA 3PWPA 1JGLL 4OI8A 5BZDB 2A83A 1HHIA 2O26U 1YEGL 5CWSB 4P46C 5HY9B 3NN8B 5LGKA 5J1TC 3LVEA 3O2WH 3C8KA 4N0CC 4NN6B 2NW3A 4U1HA 4RFOH 5F1OB 4L29B 1FNEB 4JRYD 4WWKA 5EUKB 5C86A 1D5ZA 3EOBA 4Y5YC 2HJKA 4JFED 1BX2A 3W2DL 1T6WA 5ACZB 3SDCC 1X7QB 2DQCL 4TRPH 4QXWA 3IYLW 2VLRD 3TWCL 4F9PC 4KHTL 5ACZA 1ZT1A 4K7PH 5FYKH 3ZE0E 1VPOL 3H9HA 4L3ED 1JNHA 1PKQA 3QH3A 3GBMH 4G8GA 1GC1C 1KTKE 4YHIB 5KTEL 5I6XC 4KTEH 4LCYB 3WEXA 1MUJB 3SKMB 5EN2A 3SKNA 4N1EA 1T2XA 2C5DC 4K3EH 4HCRL 2OZ4H 1I9IH 3FMGL 1OAKL 4ZUVB 4BQ9A 4H8WH 2ARWA 1ZT4B 1RZFH 3ARDC 3D5OF 2VKXA 4HAGA 4WFFE 1OGAA 1ZHKA 1DDHB 2DQUH 2OBGA 3QPXH 4WHTA 4KI5F 4E41D 3QNYA 3MRKA 3EO9H 3HMXL 3TCLA 1FZKA 4EUPG 1T7YA 4M4RA 4PJ7B 2EDDA 1SBSL 4IRJA 1HSAA 2HRPH 1JYWA 2XZQL 4GKZB 2ICES 3HNSL 1LE9B 1IARB 5GRJH 1L6XA 2G60H 3T3PE 5I1IL 2ZSWB 3ESUF 3QO1B 2H32A 1DE4A 1UM5L 4JPVH 3MRHB 4Y4HC 4YGVA 1VA9A 3QWOB 5L2KB 3C09C 3SJVE 5FYKD 3RA7L 1YEDA 4QXGL 2W60B 5DDHB 4FTVB 5E5UB 5J4MA 1QSFA 3N1GC 1RZIB 4QTIL 4M7LT 3BDXA 1FORL 4QRPD 3HLAB 4X7CC 4HV8A 1NCWH 2I5YH 4NJAH 1HQRB 2AQ2A 2VQ1A 2AI0L 2F5AH 5DJCA 3LN4A 1ZHBB 1SJVA 5AYUH 1P9MC 4GW1A 2EE9A 1B0GA 1E6OL 1QQDA 3UAJC 4PGJA 1VGEL 1EHLL 2B0SL 4OUUA 4F37K 5H94B 4ZUSA 1DQLL 3D39D 3B2VL 1D6VH 4MA7L 3QHTC 5IMLA 3VFUB 4X6EA 3WCYA 3CZJA 5T5NG 5ID1B 3MCG1 3SDCD 4BSWB 2PYED 3BGFC 4L8BB 1JK8A 1LEIB 1J12A 1I85C 2B1AH 5LCVL 4KVNH 4OCMC 5IWLC 2V5TA 2WMPA 3K0WA 3QG7H 2OL3L 5GRVL 5TDPB 2X1OA 4MAYD 3V4VH 2JCCE 3HRZB 1K4DB 5HPOA 3KYNB 2VXSH 4JFYB 3GM8A 5EZJA 5BOPA 4OQTH 3MXWH 4Q9RH 1I4FB 1HSBB 3ESVF 2DWDA 2QSCH 3KPLB 2Q6WB 5HPMB 3PHQA 4WTZG 4WUKH 1K3ZA 3GGWA 4KROC 3NAAH 1QO3A 2OX5A 5E8PA 5DJ0B 5JMRA 4NQVA 5KVDL 1NGYA 3QCTL 3GJEB 3NZHH 5C0CE 3PNWA 3U7WH 2PTTB 3HZMB 1W8NA 2AK4B 4K8RL 2Z8RA 3BGMA 3C5JA 3ZKND 4GT7A 1P53A 2FL5A 3C5JB 1SYVA 12E8L 5EORH 1QSFE 5DT1H 5FOBB 4K3DL 5CEZE 3CH8A 5JW4R 15C8H 2EC9U 3JWOC 4EDXB 3QFJE 4NNYA 5SWQA 4CRPA 3WFHB 4NQEB 4XPBL 1I1FB 4R4FL 1QACA 4WCYL 2JB6A 4OCRL 2ADIA 2QBWA 1Q0XL 3IU4L 3LZFL 1KACB 1SY6L 1DVFC 3TN0D 4P46A 1JCKA 3I75A 4X5WB 3QWRD 3UTTE 3ULUL 4IIQA 3U1SL 3H42L 1IGFL 1UA6H 3NZ8A 5EO1B 3KLHC 4Q6YA 3PWJA 4WV1B 5BQ7B 3FN0H 3C09B 3OPZL 4W4NA 1JE6A 2NY3C 1TVBB 3EIFA 4Y19E 3GHBH 1UB6A 1MPAH 2VXUL 1GIGL 3TT3H 2XT1B 1O5DT 5DUBA 2YWYA 4PRBB 3V4PL 3VGHA 4DAGH 5DUBB 5E2UH 5J1AA 5DRZB 3X12A 4NT6A 1ZANL 3EDFA 4KHXH 2F58L 1T1ZA 4K94L 3ECBB 5MERB 4HF5H 4QRTB 1N6VA 2DQJL 3VE0A 4JZNB 3TC9A 2CLZB 5E8EB 1IFHH 1KJ2L 2F5BH 5ESVA 1UVQB 2P47B 3HB3D 5CD5D 4QRPB 1A6AB 2FECI 2BOCA 5HHOA 2QQLL 4Q0XL 4MD5B 4NUGL 3PDOA 3RX5A 4NZTL 4JRWA 1J87A 5E5MB 5B21A 1AI1L 2WUCL 1QVOA 1NCBL 3FFCE 2JE8A 4XMKH 5K59E 2J2ZA 4XPTL 3WFEH 4YR6A 4KI5E 1IBGL 3RTQB 1JPST 2DMCA 2R0ZL 3DX9B 3KPSA 4MNGA 3WL9B 2YA2A 1G7PA 2ARJA 2MJWA 4FN0A 3RNQB 5BJTA 1QSEE 2FO4B 3U0PA 2XA8L 1FFRA 1YPZB 3SDCA 1JZ6A 3K4DA 4Z18A 1FNSH 3D25A 3K1KC 4Y5XB 4Z7WF 1OAZH 3TZVB 1IGCH 4N0CD 5IVZA 4U2ZA 4MD4A 5IB5B 3CDGA 2RCSL 1L0XA 5MENE 5F6HI 3ZYIA 1KCRL 4XPHH 2UZIL 2YPLE 4P9HL 2CR6A 2H45A 5IQ9A 5IQ7H 3RY4A 4RDQF 3IDUA 2CKBA 5ICXA 3SE9H 3B6SB 5EU5B 3VJ6B 1MIML 1VFAA 1C08A 3VJ6A 1ZHNA 3BD5A 1VFUA 4C56E 1C8PA 4L1HA 2ERJB 3H0TA 4AEHL 3S3SA 4Y1AA 5DI8B 5SX5K 1T2QL 1HKFA 4K71B 1RZJH 4EDWL 2YD9A 3HMWL 1KNOA 1JHKL 1RAMA 5ISZE 1F58L 1I1YB 2CXGA 5GGTL 2D7TL 2EDEA 2Q3ZA 1NMBL 4LMQE 4GRLB 4DKEL 5I1HH 4IS6B 2HTLC 1CFBA 3MLWH 4Z7WB 1DEEA 3DARA 5TQ2L 2Y25A 3OKNA 1NL0H 4L3CA 3RY6A 4WRLA 2WWMC 2GCYA 4HDIA 4IMLA 3M8OH 3BP7B 3L95A 3GSQB 4PLKD 4GW5A 3TESA 3SDXA 1RK0B 4F80A 3BZEA 1UH4A 4HUKB 2JIXA 2AEPL 3QP3A 1AKJD 1Q0YH 3O2WL 3K2MC 4C54A 5D4QA 4BFBD 1FCGA 3E6FB 1FGNH 5T1LA 1EEZB 2BMKA 5DJ6B 4KUCD 1PVHA 5T1LB 1YEEL 4XP1H 1Q9OB 3LAFA 4U1LA 3TJEL 1E4XH 4JRXD 3RIAF 5F3BB 1ADQL 1FNFA 3MA7A 3MUZ1 2D3VA 4FQCL 4NQCE 5AAWA 4Z77B 5I16B 1A7NH 5I1DA 1GJIA 4A6YL 1YUHB 2FNBA 1WTLA 1TETH 1ED3A 4Z7OF 1U8PA 4NKIL 4FTVE 3REWB 4TUJB 4F57H 3IXAB 3FKUS 2P8PA 5C0BA 2OTUA 4XCYB 1YDPA 3IFOA 5L0QC 1G9ML 3CXDH 4XVSH 4HHAA 1KELL 5FV2A 3G5XB 3OG4B 5I75B 2P7TA 2FEDD 3RU8H 3AB0B 4K55A 1JRHH 1LEKB 3ORJA 3FQWA 3PQYA 4R9HA 1HHHB 2IBZX 4YQXL 3GIZL 3LSOB 2CJUL 1OGAE 3ES6B 4HIEA 2JF1A 3O3AA 1Z9MA 4P0DA 3MQIA 3VG0H 3PHSA 3LEVH 4LNRB 5C92A 2HKHL 1RIUL 1CICB 5DUPL 4JFZH 2JKXA 3H9SA 5F3HB 4YC2C 2QJDA 2P8LA 3E0GA 1OAXH 1TQBB 2WBJB 4B7IA 3WIIH 1A6TA 3NFSL 3X17A 1MFCH 4UT9H 3ARUA 3G6AA 3QEGL 1DVFA 2CDEA 3QSKB 3QDHA 4PJBF 2QQNL 1SEQH 2CLVA 4UILH 1U95B 4ZTOL 4OLXH 5AD0A 3NACH 4U1KB 4RAUB 3CVHB 3OB0H 4LSDA 2R56H 1MRFL 3MV11 1VB9A 5C0DB 1KV3A 2HT3C 4O58H 4BA8A 1LILA 1OP5H 4LCCC 3WNOA 1U8OB 1RHHB 3CK0L 4NO3B 5L6YL 4WJ5A 3TBWB 5FHAL 5DK2B 4KJYB 4FXKA 2GK0B 1CGXA 3KDMB 2B5IC 1OWRM 5F9OH 2NY0C 5D7KD 32C2B 3MGTB 3NCBB 3ZYOA 2E8ZA 2V5SA 5F72S 5ISZB 4AJ0A 3BYYA 5FB8A 1CFSB 2VLMD 4L29A 5A2FA 4L8DA 3V5HA 3S34H 4EN3C 2X10A 4CU7A 4PJCF 2OQJB 4HIHB 4YWGL 1OF2B 3LB6D 3WJJA 1A9BA 3LRSA 1GXEA 4PGEB 1OF2A 1T4KB 1T89C 5F6IC 3TH4T 2F5AL 4KJQD 4FA8A 3EHBD 3LMJH 2B2XH 1AR1C 3WFCH 5AYUL 2BCKB 1Z6JT 4GRLD 1A21A 2CRMA 4TSAL 4X7SL 3FFDA 2IJ0C 5HYEA 4GRMB 5LXGH 1K6QL 4G8GB 4TSBH 1B2WH 1XIWB 5I76B 4ZD3L 2X09A 3K4AA 4R2GB 1HOCA 1D6VL 3B2VH 4MA7H 4RGND 5ITFB 3TO4D 4GRWH 2GIYA 2GSGB 3BH8B 5DS8B 2BNRD 2R4RL 4RDQG 3SDAC 4XMLL 3VFOA 1WT5A 1AY1H 5AZ2L 5GSRB 3T09A 2ESVB 4HPOL 3I50H 1II4E 4PG9B 3TBYB 3MRIB 3O4LD 5C9JA 4KFZC 1CXFA 3PWVA 4HS8L 3WNKA 3MUHL 5C9JB 4UV4H 4JAMB 2Y1VA 4M7ZC 3SCMA 2EH7L 1YC7A 1MSPA 3W81A 4GMSL 3PWUB 4NQDB 3KPNB 4YDLB 3WFBH 3V6FA 5L9DL 3P11L 1DQQB 3OKMA 5IT2L 1D7FA 4KTDH 2UVEA 2NXYC 2FRGP 3UTOA 4MX7A 3QQNA 1K3IA 2F74A 1BHGA 3MUGB 5B3JF 4MQXD 2CD0A 3FT2A 3DX6B 4JDVA 4WWKC 5ICZB 3HUJE 4D9QE 3QXDB 5F6IB 3ARBC 3HNTH 1DE4B 1BFVL 1WBYB 3QCTH 5MHSD 2E27H 3MODH 1IAIH 1Q72H 1S7QB 1GGBH 7CGTA 4NHCH 1DVFD 3VWKD 2HVKA 1BIIB 2GJZB 2NYYD 3SKNB 1NDMA 4ZFOL 3CFEA 1WFOA 5EORL 5J9PB 5HHQB 3EO1A 2X4TA 1G0YR 5BV7C 4DTGH 4FXGA 1MIEL 3BYTA 3MV9B 1RZIA 5F7EL 5IR1A 1OWWA 4JN1H 4MJID 1IGMH 2P1YA 5E0QA 5M7QA 4OCRH 4IRZL 1OL0A 1DBKL 4LKXB 5D2NA 3D2UA 5ETUB 4WW2B 4LU5L 1OT2A 1IGIL 2F8OA 3H42H 4HH8A 4XCEB 2AJVL 5D8JH 3EKCA 3BP4A 3L5WB 4MS8C 4OCXL 4NCC1 1ZHBA 2JK5A 1NH6A 4Z7VB 3BAEL 5T3XD 5B4MD 2R2HA 4TVPD 5E8OA 3WHE1 2H2SC 3L7EA 5EU4A 2PXYB 4JFHD 4X6DA 3UPRB 1EDQA 4OD3H 1UQSA 3HAEH 3VMOA 4Q9QL 5ISZD 1XZ0A 1T1XA 4CVXB 2Q8AH 1MPAL 2VXUH 2W9EL 4UTBH 5EUOA 4X6EB 5TGBA 4K7PY 2VN7A 3QDMA 1ZOXA 3QAZB 2IAMA 1BBDL 1EMTH 3U36A 2AP2A 4BSWA 4LLWB 4X4YA 1NDGB 4P48A 4C56D 1J10A 4NNXB 5FA4B 5DJ8A 4MAYC 4KH2A 1CQYA 3IAQA 1J0KA 1R0AH 3DVNA 3LQAH 4CMHB 1JF1B 3KLSA 4HXAH 4NZUH 2P8MB 2MOVA 3DXAD 4RFOL 3OWEA 1LO2L 4J1UA 3MV01 5DRNA 1BOGB 3DI3B 1A6ZB 4QRUB 5FUCC 4JHAL 2BFVL 1B0RB 3MLPA 1HSBA 1MAML 2QSQA 1XR8B 1A6ZA 4Z7OE 3RFZC 5DJCB 4P23D 4N0FA 5DEGB 4U7MA 4ZS7L 4XMKL 3I02A 3FHQA 2IPUG 2NY6B 1IBGH 2EYSB 5HGBB 3AB0C 2IFFL 5FGRA 3TH3T 1T83C 1ZV5A 1DR9A 4UQ3A 3MRRA 1CLYH 1MLCA 4YHLH 5I74B 3MREA 5GQBA 3RWIA 4PBWD 1MELA 2YHGA 1KB9J 3VXSB 1M05A 4IJ3C 5ESAA 4P9MH 1IGCL 3W9DB 2BDNH 4K7FB 2CLRB 3BIKB 1J18A 5B38G 2YBRA 2YK1H 4PR5A 1Q94A 1KB9K 1XH3A 1AIFB 4Q9BA 4OZHB 5FXCH 1N0XL 3PABA 2D7PA 3VXNA 1KJ2A 4YDVA 2R1WB 4HGMA 4NKDA 4LHUA 4OGYL 5T3XL 5I73B 4LHUB 1FC2D 4IRSA 3EZ8A 5GS0C 4RRPA 1BFOA 2NY5H 5HBBA 2R2EA 4G8FA 4JLRA 5L2JA 1MCIA 3O4LB 2BVOA 3PNWB 1TVHB 3E6HA 3AFLA 1WEJL 4C57C 4YFLF 4OLVL 4OFIA 2GK2A 2C3GA 3DXAB 3RUGA 5KVGL 5I1AB 4RISL 3HE6B 2K9UA 2JJTC 3AAZA 4I0PA 3RA7H 3SDXE 3L1OL 2YMXL 1RUPH 3P73A 3P0GB 3EYSL 1RZGB 3D39E 5CIPB 4QRPA 3HE7C 4NHUB 3QNZB 4YAQA 4PJ8D 2A9NH 1WVZA 2AEPH 3QUMH 4F7CA 5E6IC 1GHFL 2RHEA 4HWZB 3OGCB 2C1OA 1WZLA 3DTXA 1YECH 4PJEA 4BQ8A 3VFVA 1TFHA 3MBED 4CVUA 3T2PA 1YEEH 3DTXB 4U1SB 1NC2A 2HJLA 1LO3H 1S9YB 1E4WH 1E4XL 4LLVA 4LLVB 2CK0L 2P5WD 3KPSB 3JTTB 3WSQH 4AK1A 1I9EA 4A6YH 4N90E 4YZFF 1FPTH 1HYSC 1BVKA 2AGJH 4NKIH 4MGXA 4BZ1L 1HXYA 1KG0A 3X12B 3SDAB 1QKZL 4OZ4A 3DOSA 3MNWA 5FM5M 3CFDB 2AVGA 5ECJE 1MVFA 3QG7L 3V4VL 4P46D 3EYQD 5ENWB 1NBZA 4DVBB 4KPHL 4O2EB 3OHXA 1KTLB 1U2CA 4YDLC 2OR8A 3PL6A 3HUJF 1KTLA 1V7ML 1AE6L 5T33L 2NZ9D 2NPLX 2Q76B 1C08B 2WINA 4UDTB 3QCUH 1JJUA 1OAXL 2AKRA 3B83A 1MFCL 5CD3A 1U8IB 3EYUH 1FDLH 3DX7A 4FQQB 4Z7NF 4LSVH 4FMFA 1MHPH 3L7FA 5C09B 4KY1H 5I0ZA 3VH8A 1AD9B 1MCOH 1I1YA 5J13B 4XP9L 1BQHB 1EFXA 1N6QH 2MCPL 2VIRB 4I3SH 1N26A 1DFBL 1G7PB 4JO3L 1NCNA 3PP4L 4HEPG 5ITBL 2AJ3B 1CLCA 5FDYA 1KEMH 2C4FU 1AQKH 4PTTB 4LLQA 1P84J 3QFDB 5JW4M 1B4JL 3G5ZA 4RMQA 4AG4L 2VZSA 3ARFD 3OKOA 4LSSH 2VABA 3BDYH 1WWAX 3KWWB 1N5AA 3IU4H 4O02L 4NDMA 2D7QA 2GITB 5DEFA 1A14H 3EYOB 4M6ML 3DUHA 1IEAA 1MCFA 4LFHG 5D7LB 4ZAKB 1IGFH 3RDTD 3RDTC 1UWXH 3U4EA 4Y1AE 2FB4L 1QA9B 1YJDC 5IW1A 2X44D 1JWMB 1YQ2A 2FJFA 4MDIA 1LWRA 2ITCA 2A6KA 1AHWC 1E0OB 3V8OA 3B3IB 4RGNB 3KXFA 4PFEA 4ZYKB 2B2XL 5DK0B 5C2BL 3DRTA 3ARGC 4KROB 4GRLA 4D0DB 1R3IL 3REWA 2AK4E 3BVNA 3QUMA 3FONA 1DEEB 4ONFH 2FIKA 1BD2D 2OTUB 1A7RH 1MWAB 5SWZE 4OV5A 2OTWA 3S4SG 3SOBL 4PJ9D 3NCJH 3PV6B 2VDNL 1D6EB 3HUJB 4KTEL 4L9LA 2YRZA 1J1OL 4OM0L 1F45A 1OQOA 2G2RB 4PREA 3MV7A 1TVDA 1HHHA 5AZ2H 5HDQH 1RUQL 4HPOH 1MLBA 4OLYH 2X4OB 2NX5A 2BHYA 3GMMA 2H9GB 4Q0XH 4S1RH 3BWUC 3TBSA 3BD3A 4Z78A 1OSPH 1XR9B 1NFIA 1RU9L 4IOIA 4XI5D 1IAKB 3QUKB 1XR9A 4KV5F 4LSPL 5IB2B 3C5SA 4LF3A 2A6IA 3TN0B 5CEYB 3O3DB 1Q9OA 3BX7C 1JF6A 4XPTH 5IROC 5E8DH 5IESL 1S7WB 1H3XA 3GB7A 1YY9C 1ZGLB 2WWKT 5FYLL 5FGCB 5J7CC 3T3MF 1WGOA 1F4WH 4ZFOB 4I18A 1XF5B 2UYLA 5D7JD 2BVQA 4R7DB 4R8WL 2EO9A 1YPZF 5FUOL 1HYSD 1AGBA 4Q2ZB 1BFVH 3GRWL 1QP1A 1FNSL 4JPIA 3RWJA 1XF4B 2DJSA 1S9KC 5D2LE 1REIA 4CVZA 5TF1L 2DI7A 4DJMA 1JPGB 1KPVA 1JV5A 3GSUA 1DANT 1KCKA 2FJHB 3IS1X 4W68A 1JPGA 3I6GA 5CP7B 4LPWA 1ZLWH 5MEQA 3RWFB 4X80H 3QFJB 5HHPA 3DHMA 4JN1L 5F3HA 3DO3A 4X98B 4WW2C 4QHNB 2YA0A 4QTIH 4PJ8C 3FB5B 3GJFK 2QHLA 3HE7A 5A43C 1LNUA 2F53B 3LPWA 4GSDL 1MCPL 3TPKA 1CU4L 3G6AB 3OR6B 4EUPA 4XVTH 3V6OA 4WFHE 5FA3B 5HGGS 4H88H 1X6NA 1NBQA 2ATPB 2O5ZH 3ZDXF 2IALB 5IMMA 4NNPH 5C7XH 3OKYA 5BO1H 3FO9B 1YMMD 1OTUC 2E9BA 5E99H 3U2SA 2H41A 3FT3A 1VKXB 4DZBB 4ZPTA 3IU3B 1QR4A 3KYMA 3LQAL 4P5TD 3VXTB 2X1WL 2HG5B 1CR9L 5DD1L 4NZUL 5C0GA 2FYYB 3GMPA 5HVGB 3PGDA 1BGXL 4JJ5A 1S9WA 2VH5H 1A4JA 1U8LA 4XP1L 2R39A 4JRXA 2VL5A 3GMRA 1HHGB 1KCVL 4RGNE 3O2DL 4WUUD 2I26N 3BKJL 1U3HC 4M1DH 3MV8E 4XX1E 4GLRI 4N0UE 5GISL 4LPVA 4LCWE 4ELKB 4HC1L 4MA3B 3QI9C 4PV8B 4CMMB 4PB0L 4TSCL 4DFHA 5IB1B 1NAML 1MNUH 3W39B 3WMSA 4YBLC 4C83A 3SKMA 4X6BA 2H1PH 2MKLC 1K5NB 4YQXH 3GIZH 3V4UL 1FIGH 4PG9A 2AXFB 1R3HA 5MHSE 1SMAA 3CSPA 3FFCA 1NGQL 3FT4B 3EO1B 1NQBA 1R3HB 3HC0B 4LQFL 2Q87A 3D0VB 3MLTA 4QOKB 1OSZB 2VZ1A 3PWPD 5FGCE 1HEZB 2YK1L 3CFCH 2X89D 5ERWA 1UACH 2A6DB 4Z8FH 4WCYH 1NMAH 3CUPA 1JYVA 1F2QA 5EC1B 1ZLUH 4R6UA 1I7ZA 1Q1JH 4MX7B 3FB7B 3L3JA 3FB7A 1WC7B 2XQBL 2Y7QA 5CILH 3RZCD 4MA1C 3N85H 5GIRB 5GJTL 5FO8B 5GIRA 1CL7H 1DBMH 3TO2B 3KYKH 2UY7A 2QADD 1EJOH 3DRQB 1O0VA 4I9WE 1G7HA 1U3HA 3QUZD 4RFNB 4O00A 4H20H 1AXSB 1NDGA 1AR2A 5F9OL 1YEDB 5JORB 5IHZB 5ILTH 5DJXB 3BJLA 2E7MA 3VXMD 4OD2A 1WTGT 1KFAH 4P5MA 4MS8D 3WD5L 5HGHB 3U9UB 1TCMA 3GUTB 1F4YH 4KRNA 4M5YH 2Y6SC 3U9UA 4P59H 5IFJA 4BFGA 2R29H 4WNQA 3DUSB 4Z7UA 3DSNA 3ARPA 5IFJB 5KSBF 2VWEE 4ODVH 2CDFA 4AIZB 3OAZH 4D8PB 2QQLH 1IQDB 4Z7UE 1MWAH 1UCTA 3BP4B 4CKVX 2EDYA 5J8OA 5I8OL 3I6LE 2JJVA 1JWUB 2EIZB 4V2BA 1OD9A 1Y6KR 4TSAH 1QFOA 1VACA 4LSUH 1H5BB 1EVTC 2NLJB 3VWKC 5FYKL 4NKMA 5TQ0H 2DWEB 5A2KH 1H5BA 3IDIB 3OXRB 3UPCA 3IDXL 4Q6IB 1FQ9C 2R0ZH 4YO0B 2F8VA 4LCIH 3W9EA 4L1DA 3QDJB 4YGAB 1NCTA 5BV7H 5C09D 3VG9B 3AY4A 3MV8D 1QSZA 4AMKL 4JG0L 4BJLA 5C0IA 1WAAF 4WFGE 3BWAA 4PS4H 4U6XB 2FJGA 2Z91B 4QRSB 4U1NB 4HUXA 1OAZL 3LKQB 5A16B 5ALCL 3LKQA 1E28B 4K8RC 4H1LH 5D7IA 4JVWA 4QRUA 4KTDL 3CPLB 3JTSB 2DIJA 3HZVB 5CBAA 5FM8A 1A1OA 2Z4QA 1LK3L 4YIQA 3IDGA 3RP1A 1DQDH 2IH1A 3DBXA 3BN3B 4NQVB 2XZCL 4PJIB 1T22A 2RQ8A 3SDAD 1VADA 4QY8B 3Q1SL 4R97C 1UM5H 1HZHH 1VSCA 2EDQA 2R9HC 1MLCB 1ITBB 2Z35A 3VGGA 3U82B 2A1WL 4XNUL 3UZVB 4JZJA 2DTML 1T3FB 3WFDH 2Z35B 4JFOA 2FBJL 3P73B 4OCYH 2OP4L 2XN9D 4QXGH 3OKEB 3G5VB 4P49A 3QDAA 1OAQL 1EBPA 2YBRB 3OKEA 2XG4A 1DLHB 1NFDA 2PYEA 4ZXBD 1M7XA 2P5ED 2ZOKB 5MEND 1KIQB 4PJHF 3QRGH 1NCWL 3ROOA 5IFHH 3UPAA 5BQ7A 4UIMA 4V2CB 3CMGA 1KJVB 3RZCC 4XNXH 5IBUB 2D7OA 8FABB 1KCSL 1OPGH 1VENA 4HBCH 4NN7B 1VGEH 4YBQD 5FV1L 3NFNA 4WI8A 1UB6B 3KPQA 4LCCA 4NZDA 1C5BH 3D48R 5JHDA 3U7YL 4ODXA 3TP4A 4HWUA 4LPUA 2A6JB 4UUJB 3ECBA 4XXCA 3AAZB 1HNFA 3MRPB 5I2IA 1G6RL 3VGBA 3GI9L 1U8HB 4GQ9L 3GSNB 3SOBH 2DBLL 4HLJA 3MRPA 1YY8B 3A67L 5I1KL 2B1AL 5LCVH 4Y4KC 5DURD 1UJTA 5JO5B 4LVOC 5IFAH 2OL3H 2PYFB 1QR1B 3R0MA 3SE8H 1G7MB 2DKMA 3P40A 4MD5A 2I07B 1CE6B 2ARJQ 2RFXB 1KXVC 2Z93B 3D85B 2BFVH 4M7ZB 3O41A 3OL2A 3T2NH 3MXWL 4M8QA 5DWUH 3BPOC 2QR0B 3AU1B 3QIBB 3O2VH 3L3GB 3ZE1E 4P99A 4TPRL 2KKQA 2MWCA 2NQCA 2HKHH 3UXFA 1I3GL 3LKRA 5C6TH 2ED9A 1ZTXH 4MNQB 5B38B 2V2TA 4KMTL 4XWGH 1SEQL 2PUQT 3GKZA 2BY1A 5T1KB 1CGSL 1BIHA 1KEGL 4ZFZA 1DL7L 2EDRA 5FM5O 1I3VA 3QUXD 3PJSB 1PY9A 2M8XA 1I7RB 1MRFH 3LKSA 4M61B 1JGVH 4O58L 4KQ4H 1P7QD 3VGAB 4ODSL 3QIUC 2XKUA 3TNNB 4J3XA 2UWEF 1RZ7L 4P5TC 3T1FA 3AREA 4XPAL 2FSEB 4M6NL 1GAFL 5HI5D 3RVVD 5IB5A 1KLUA 2ENYA 1ZS8B 4ZDHB 5IG7B 5IQ9B 1JMXA 1FO0H 1XIWC 5J3HC 3P9LB 2IQ9H 4NYLB 3VXQB 3T77B 3L3HA 5F96L 4PY7A 1XF1A 1P2CA 2AJSL 4Y2DA 2YD3A 2Q3AA 3FL7A 3DX7B 4FQQA 4PLKC 43CAB 3HI1A 5LGJB 1NAKH 1P6AB 1CDGA 4ETYA 3F12A 4KUCF 4JFPA 1ERNA 1PYWB 3DRTB 1PYWA 3GM0A 4YUEL 4JCMA 5ADOH 5JOFA 3F6LA 1J88A 3HPJA 3LKNB 1UEMA 3NFPB 1G7IB 4PJBE 3F58L 4RX4D 2FLBT 3V5DA 1OB1B 3KR3H 4R4NC 1OOAA 4LSQH 2GCYB 5A2JH 4L9LB 2XN9A 3O4OB 3DMMD 1B88A 2NXZC 4G43A 3LV3B 4Y4KB 5BXFA 2LABA 2GYSA 3HKFA 4JO2L 4P2YA 5CEXB 1G7LB 4PLOB 4Y16B 4ZAKA 1CR9H 4ENED 3DGGA 7FABH 4UZGA 2YUVA 1S7TA 5KAQF 3VWJC 4ODUA 1NCBH 5C3LD 2EEAA 2ZUUA 1H8OA 2GW5A 3MJ7A 3AROA 1E4WL 3QO0A 3MCKB 2ZUQB 5D6CA 4L4VA 5KSVA 1MQKL 3MCKA 1J0IA 4NRZA 1ODAA 4ODWB 5C6WH 3NA9L 1ES0A 3CX2A 4Y0GA 4HG4J 1F3DH 4EI5A 1S78C 4NRYA 3MFFA 4XCYA 4OBRA 1T0MA 4N90D 1GZPA 4GAFB 2FX8L 1SYSA 4ENEC 1SJHA 3TA3A 1KUMA 2DDQH 1SYSB 3L3IB 4LEOA 3QEQE 4NQUA 3MBEA 5DJYB 4YXHL 5GPRA 4KRPB 4KXZI 3UO1H 1QHPA 2GTWB 4PJHA 3TF7C 1OTSC 1BWWA 2Z8VC 2ZG2A 4QNPF 2BC4B 4JFDE 5IQ7L 2ADJA 3E2HB 3B5GA 1S9VA 3WJJC 1S3KL 4KDWA 5F7EH 1FFNB 1CD8A 5J12B 3C5SB 4IOFD 5GXBB 2CDEB 2YPVL 3ABZA 5FAAA 1A6TB 2M1KA 4JRYB 4APQB 4DCQB 2WNGA 1MHEA 4G8IB 1IGIH 1GRWA 1K2DB 1Q9LB 4X7TA 4EDWH 1JZ7A 4F58H 1JHKH 2KUTA 4HFUL 4BKLA 2XQBH 1Q9LA 3SDDC 3VFWB 2D0HA 5GGTH 4AYFA 4DKAA 4I18B 5C08D 4NQSA 4PB9H 3SPVB 2RB8A 5DYOA 2LU4A 1OQXA 2DL2A 1CXEA 1XF2B 4FQXD 2J8UE 1JI1A 1N4XH 1NFDE 1U8OA 2PYEE 4X9GA 4PBXA 4OKDA 1EJOL 3WIHH 4I5BA 1UFUA 1DQMH 5DMYA 1VEOA 2GK0A 3BRFA 3RWCA 3FB6A 3O6FB 1A9EA 5CP7A 3KPOB 3T4AB 3KYMB 1NLDL 1N8ZA 4PBVC 1KN4L 3WD5H 2FYYA 1EXUB 1A6PA 4HPYL 3VXPA 2QSVA 4P59L 2ZUTA 4QHNA 2AV1B 3ARGB 3LS4L 2VL5B 4LRNL 1U8MA 3AREC 1D9KB 4Z7VF 4XMPH 1TMCB 5DVMA 1R3LB 3CGTA 3T4YA 4IOSD 2NY1C 3HZKB 1DSFH 1R3LA 1QBML 3INUL 4LLUB 5BMFL 2ATPA 4HW6A 1IC4H 5T5NF 1TETL 1SBBA 1TQCB 2NY2C 3MGOA 3ZKNC 5I76A 1FC1A 2GSGA 3ARTA 2IG2H 5I1GH 2OJZL 4EI6A 5C0RH 2ESVA 1J1OH 4OM0H 2A83B 1JRHL 1SHMA 5DR5L 5JXEC 3ZKSD 1MF2L 2OI9C 4JG0H 4AEEA 1CGUA 4KROD 4OLEA 2BRQA 4U7SA 4APQD 1OSPL 2P24B 5DUPH 1MCBA 3PGDB 1X5JA 1WAAE 2LTQC 4LFHD 1WCBA 5IJVA 1WBXA 4ZNEE 3TCLB 3CFKA 3RTQC 1ZLUK 3KPRB 3PQYD 3BDBA 2DI9A 1EEQA 2VDOH 4OBSA 4NGHL 4AL8H 4NQCB 4UIKH 3O4OC 2LFGA 4R3SB 3QDGA 3BP5A 3Q5YA 2VQUA 4LIQL 2NY4B 1TLKA 3R06A 5C07D 2JB5L 3EUUA 1H0DB 4D2NA 3HAEG 2ICWB 5FO8A 1WZ1L 2B4CH 3TA3D 4O51B 5IB1A 1W72H 4I48B 1IEBB 4X9HA 5T3ZE 3FQNA 3VFRA 1EUTA 1MI5D 2L0DA 3ZZ1A 4P5TB 4JY6B 4ZFFA 4WEBH 3GSOB 2VR9A 1EUUA 3KG5A 3TIDA 4J4PD 3HC0A 1RUPL 2Z31B 3JVGA 3GMLB 4KZEH 1YMMA 2AXHA 2GTZB 5KS9E 2MQ0A 3VXSE 4F7PB 2ORBL 2A6DA 4KKAC 1CU4H 3D2UB 1J8HE 4P2OB 3SKOB 1EHXA 4R96A 3LKOB 5GGVL 4OKVB 2RGSA 1GHFH 4XGZB 4X6CB 4G8GD 3O8XA 5EU4B 4YLQT 4N8CH 1CD1A 4YNYA 4QRQA 2NYYC 1FIEA 1EGJA 1X6LA 3LEXB 4OUUB 4XPFL 1XCQB 3PWLB 1NGXA 1F3RB 4M00A 1U9KA 1FHGA 3CDFA 3K4ZA 1G9NL 4HUVA 1T66C 3C9NA 5DUML 1A5FL 3QJHB 3PHOA 3RBSA 1ROWA 3MXVH 5E95B 4CN6A 1W8OA 3B9KD 1KPUA 3RL2B 1QKZH 2FJGB 2LE9A 1YQVL 2IPUK 1FBIH 3FOMA 4OGZA 5FYJD 1Q38A 1U8JA 2VN4A 5IFAL 1N59A 1U92B 4I8DA 2VH5L 1B0RA 3C8DA 3D6GA 1S7SA 4JFQB 4JCLA 3L6FA 3DV6A 5L9DH 4JM4H 1AFVH 3T2NL 4OZHF 2C26A 4R0LC 4N0FB 2XXCB 4QYOA 2F54B 3CNKA 3ARDD 1RIHH 1V7MH 3O2DH 3BKJH 2MHAA 5IVXF 2JJWA 4X6FA 3DVIA 3Q3GA 4PJIA 3QA3B 2HVJB 4O2FA 1R24A 5DJ0A 1P7QB 4HC1H 4FXLA 2IANB 2YZ1A 3D0LB 2E5EA 1FYTB 3QZWA 2HWZH 4L8SB 1A6VH 1NC4A 2APXA 2BK8A 4PB0H 1HH6A 4TSCH 2E27L 1CG9A 2YZ8A 2O61A 1IAIL 2D31A 1CGSH 2G9HB 3BPCB 4XB8A 4F3FB 3SDDA 2ZPKH 1DL7H 3RL1A 3SE4C 4OZFH 4B53A 4EXKA 4I2XE 2X4PA 1MCSA 3NPZB 5J12C 5AG9A 5D7SH 1B4RA 1RZ7H 3VFNA 5JIPA 3W0WD 5I30H 3E2HC 4EI5C 1IGML 1G7JA 2WIIA 1T6VN 2H3NB 5KSAB 4PRNB 3FJTA 2Y36L 1DBKH 4P46B 1QFHA 3U6RB 5CP3A 4TUKL 4P3DA 4WY7L 1K4CA 4FQ2H 2YXMA 1K4CB 4WV1A 4JQVA 1Z9OA 4DN4H 4J4PA 2IADB 3G6JB 4KK8D 2H6PA 5JW5B 4F15C 3QUXB 1A7QL 5CILL 5TDOB 2WIMA 3NFNB 4HUUB 5IHLB 1RVFH 5TDOA 4HS3B 2IPTH 1F13A 1HIML 3B5TA 2W9EH 3MPCA 3O4LA 3MGAA 1T5XB 3C6LA 1BVLA 2OL3A 5C0AD 4Y5VC 5DQJA 5K9QI 1BBDH 4H1LA 3EO0A 4H1LG 4JHBA 4LHJB 4RNRB 4POYA 5CZVL 3V79C 2NXYB 4BUGA 5HHXL 3QRFM 1NEUA 5E8EA 1KPRB 4OD1L 1T20B 4OZIA 1F4YL 5HYJD 3ALPA 1NAMB 1NFDB 2PYEB 2IFGA 4NWTL 4MDJA 1KXQE 5F1IA 3QDMD 3SE4A 2XWBB 1N7ML 4G7VH 4JO2H 3HFMH 4IIQB 2HFGH 2F8XC 1CFNB 4M43L 3MRBA 4YHYB 4QXUL 2ZUWA 4HWEH 4FNLL 4L4VE 1TXKA 4NQXB 3ALWA 1C5CH 4NM4L 2FEDC 4FQHB 3LS5H 5EZIL 4LSUL 1WITA 5TQ0L 4RGOH 4QRRD 3DWTA 3OR7B 2J6EH 1IKNA 4MHHI 4MNHB 4QHUB 1FJ1A 4U49A 4Q6IC 4JQVC 2EC8A 2GFBA 3MNWB 3SDCB 3KPSE 3M17B 2DI8A 5CMAA 5I2IB 2DIAA 4GFTB 3K46A 1IJ9A 3UEZA 3IFLH 1HXMB 2L7UA 1JNNH 5KSBA 2FDBP 1NSNH 1G7QA 5MENA 4JRXE 4Z0XB 2VAJA 1G7QB 5MENB 4K94C 1AXTH 5ENWA 1KLUB 4XVJH 5IIEA 4N8PA 2CKBB 5LVEA 4LHUD 5E5RB 2GJ6E 1JGUL 5HI4D 1WBZB 4GXVH 4B7LA 2PETA 1LK3H 2APVA 4PLJD 2AKRB 1J8HD 2NY1B 5E2WH 5IF0B 4YK4C 1D3CA 4HS6B 5C0EB 3V52L 5JA9A 5HGDB 2BERA 1U58B 2IPKA 4J23A 3TNMA 5HGDA 1PX3A 4GSDH 4CMHC 2R1YB 3QWRA 1RZKH 4RBPK 3ARBB 2AJYL 4MAUH 2W65A 4HFUH 3ULUE 1RURL 2ZCKH 2P5EB 3RY5A 4GAJL 5HYQA 5I8EB 4X99A 1QLEH 5IW6B 1JNJA 3FO2A 3MRFB 5T3ZD 5B8CB 2FGZA 3FQUB 5HYJA 3TNNA 5BO1L 3WIHL 1IKNC 2D4FA 1T21B 3P9MA 5GHWH 5FECA 3QQ4A 3A6BH 3VXUD 4XTRD 5EBMA 3IDJA 3ZHKA 1LP9B 3VD4A 4MQ7B 3SO3C 5DEFB 4ZQKB 1NLDH 1G7LA 1AP2A 6FABH 5IVXA 1IGJB 1TJGL 1DQJA 3OKDB 2YC1A 1VFAB 4LK4A 1S7TB 1DQJB 2VC2H 5FM4A 1BZ9A 2HMIC 4LL9A 1WT5C 1A3RL 5KS9B 1RI8A 3IRPX 1I8KA 4OT1H 1J1XL 3FONB 4UTAH 1D9KC 5C0AB 1BECA 1U8KA 1DN2A 3TWCH 5C0AA 3D18A 3MLRL 3NFPA 4L4TE 4HDIB 3SGJC 3G04A 1EAJA 1MLBB 4JZJC 1J8HB 1YJDH 3G04B 1RV6X 3SJVB 3PL6D 2HRLA 3ZDXE 4FG6C 5T1MA 4HIEB 1OP3H 4IOIB 4RQQB 4OZGB 1MJ7L 4Y1AD 1AE6H 4NO5B 5EG6C 1NEZG 5IV2A 2V5RA 3DECA 4Q9CA 5I0DA 5GGTA 1P7KB 5CINH 4JQIL 1DVFB 2MFNA 4KMTH 3MJ7B 1P7KA 3IDMB 4I0PC 3O3DA 3K2UH 3DVGA 5BZWA 5F7FA 5AUMB 2EDJA 3I9GH 1BM3L 4LNVA 4R0LA 3RWGA 2DF3A 5I17B 1N6QL 2KZ1B 5A2IH 1N5YL 4AENA 2JB5H 3HPLB 2X70A 3PUCA 3G6DL 1J0JA 4PJAB 1QSEA 4LEOB 2IF7A 4U6YB 2ADGA 3QEHA 5DMKB 2HKFH 2VLRB 5DD0H 3OGOE 2HH0H 4RCAA 3VCLA 4YDKL 5EO9B 5EOCH 3QUYD 3K8LA 2BC4A 2FJHA 4Y4FC 4N9GB 4H26A 2Z31D 5HHPB 4XCFH 1KFAL 2V9QA 3BEVA 1N2RB 4JG1H 5J56B 3UTSB 2R2BA 2HFEA 2MQCA 1ZA3A 2AJSH 2NY4D 5I1EH 1ZWIA 4HIJB 2XACC 3GI8H 4OFKA 3WLBB 4G9FA 1DUZA 3CVHA 5C2BH 3MNZA 3GKWH 1LGVA 1WISA 3C2AL 4LDLB 5CP3H 2NTFA 1U6AH 4XPFH 1MFAH 1P1ZA 3SGEI 3S88L 5IMMB 4NO3A 3PWPB 3FTGA 1KB5L 1UH3A 1JHTA 4LSQL 1E27A 4FXKB 3DIFB 2VXVH 1P69B 3RKDC 3HI5L 5HYJE 5CWSA 5HYIA 5IEKA 4XNQB 1FZJB 5JOEA 5BV7L 3P0VL 3VRJB 3T0AA 2FHBA 1TIUA 4KK6D 4ZPTB 5A40E 3VWJB 5M95B 3FRPG 4WW1B 4S1RL 2AEWA 3PGFH 4PJCE 1X5YA 5FB8B 4PJFB 1CZ8H 3MUY1 7FABL 1ZA6A 4YPJA 3GMPB 4LSPH 1WBXB 3RY6C 1UXSA 1AFVL 4PGEA 4OQTL 4N8VA 4XAWH 2NTSP 2KH2B 1DQTA 3NA9H 1LO0H 4R3SA 4WDIB 1IMHC 2Z92A 3L3DA 4FABH 1PKOA 1RQ5A 3ROLB 3U83A 3U9PL 3F62A 5FO7B 2IAND 3C08H 1S7XB 1NBYA 3L3OB 1XGUA 3JZ7A 3QH3B 1L0YA 4YFLI 5E6ID 1IM3B 5H35B 3U7WL 3UTQB 5C8JA 4PJ5B 1BLNA 4K8RH 4LCYA 1EGJL 3WEXB 3MACH 1P7HL 3FFCB 4K3HA 4UINL 5CD5C 4CU8A 3D3VD 5HHQA 1KTRL 1QOKA 1S3KH 3IJYB 4BUHA 3RPIB 3S37X 2RJMA 4DGVL 2WBJD 2JIXD 3LZFH 1GSMA 4G9FE 1MCPH 3V6ZB 2AJZB 3VGFA 5I9QB 4RMRA 2HJKB 3QJFB 1JUFA 1FZKB 2QL1A 2VB5A 3UZQA 4ELMA 4OM1H 3MC0A 4LARL 4P4KD 4XHJC 3I3BA 5I15H 2CH8A 1RJLA 3WXVL 2PO6D 3CLFL 3O6FD 3LN5A 4WI3A 4YGVB 1T03H 3L9RB 3LHPL 1ADQA 1KF9B 4X7DC 1XAUA 1CXKA 2FWOB 3GHBL 3TIEB 5C7XL 3DO7B 1HYRC 4O51A 1IL1B 1IEHA 3TN0C 4WO4D 4BSVA 4G6FD 2G5BB 1YEJL 4A6YB 4ZO7A 5IVXE 3VRLF 1TCRA 5DDHA 5IHZA 1ZANH 4K94H 2OTPA 3GUTA 2DBLH 4YHPA 3T2OA 2IBZY 2MNUA 3T8XB 1HI6A 3UJJH 3RAJH 1R5VA 3PG2A 4LSRH 2W1NA 1XFPA 4FQJL 5D7JA 1HQRA 5E03A 1C5DA 1IQDA 1ZSDA 1UH2A 4HJJL 2WANA 1LE9A 1F4XH 2CGRL 1CI5A 1P4LB 1LK2A 1PX4A 4NM4H 1EV2E 3QIWC 3K74B 1JTTA 4PG2A 2W0FB 5KG9B 2NMSA 3RIFF 1UENA 3O8XC 5GRUH 1OCWL 1QPXA 3VFGL 5K59F 5C08B 5KG9A 2D31B 1QFWL 4IM8A 4F2MA 4LSTL 3TH2T 5GSVB 4NRXB 1N6UA 1BJ8A 2HJFB 4C58B 1X44A 5DR5H 5CLTA 4JFEE 4KV5E 5TE4L 1OAUL 4KUZL 3FMGH 1OP5K 4L8BA 2V7NA 1HE7A 5A16A 1CFTB 2P44B 1QBAA 5FOJA 5BVJB 2P8MA 4P3WA 3NTCL 4LQFH 3FQXA 3RTQD 1GPOH 5HVHB 4HV8B 2DQUL 5KSAA 3HZVA 3QIBC 2VLLA 3FO1A 5TDNB 3NCEB 4NCDA 1RD6A 2WQRA 3QT2A 5F8QC 3T0WA 1PY4A 4IRSB 2XZQH 3G6JE 4FFVC 3IDGB 4NFDA 1A8JH 1EEYB 2ZNXA 3PXJA 2QQKL 5CS7A 1NC4B 3RUGE 1T5XA 2AK4A 2EKJA 4JREB 1UGNA 4JZJB 1I3RB 2EKSA 3DXAE 4ZSOB 1A1MA 3GEWB 3C2SA 5GGQH 1LEIA 4DZ8A 4LEXH 5TQ2H 5GS2H 1TNNA 1JWSB 3PP3K 4XC1H 1NMCB 5SWSE 3KR3L 4YHOL 2CIIB 5EIVA 3MCLL 1B9ZA 5E2VH 3MJGX 3WIFA 1WFTA 5D6DC 4NHUA 3HC3H 4M5YL 5KAQG 1R3KB 5F1IB 2JB6B 2DD8H 2X1QA 3EYVA 4M7KL 4HWBH 4QT5A 5L0QB 4ODVL 3PHQB 1OM3H 1A3LH 2EYRB 3ARFB 1MY5A 2VLKE 2VC2L 3WLWD 1K8DA 5BOZG 3O4LE 4LBEA 3GJEA 3EFFA 1RUAH 3LKPB 5CJOH 4PJXB 2BVOB 4IMKC 3X3FH 4EJ1C 4WU7B 5CJXA 1MQKH 1YEFH 4QHUA 1CFVH 4UUJA 2FL5B 3JV4B 4FQIH 2YD4A 4Q74A 4TOYH 4LCIL 1ZVYA 5F1NA 4KXZH 5F89A 1T1ZB 5JO5A 4XRCA 2DDQL 1YC8A 5CSZB 3FAWA 1H3UA 4M6OH 4CNIA 3MLXH 5MEOA 3DROB 5CSZA 4I0KA 4NN6C 3IGAA 3I75B 4X5WA 1AHWA 5FGBA 1WWBX 3MA9H 5CCKL 4LLMA 4RFEB 1CFNA 5CUSL 2WV3A 4Y5YB 1ZHLA 4GRLC 4JFFE 4HUWA 1S7UA 1DQDL 3PP3H 3WIIL 3ULVF 4NFCA 5DHVB 2FHCA 4YZFE 5E7BA 3RTQA 2DQFA 3QULA 1LE5A 5J57B 2HWZL 1BQHA 4K2UL 2EH8H 1R5IB 4I3RH 2AS5M 3V8CA 5LGHH 1VGKA 3IFNH 1FVEA 2R56L 4YFDB 4PRAA 3WFDL 1A0QL 2FX9H 5B8CA 3CFDA 5HYJB 5JXEA 1A64A 5E94B 3AREB 2APFA 4UDUB 2DQTH 3HC4L 2OP4H 4ZPVA 5I8KL 2HH0L 4G6AC 3TPUA 1AH1A 1E4XI 5J6GA 3V7AE 4N5ED 1PW3A 3U1SH 2K3TA 3ULVD 2BY0A 1XEDA 3STLA 4YJZL 2C3XA 5I18L 4GMTL 5DURB 1F6AB 3ZE1F 1VFBB 3BD4A 3CFJB 1IZJA 4YWGH 3OPZH 5IEHA 1AGCA 3R4DA 2WQ8A 4LRNH 2Y5TB 3KPMB 1HIMH 2P49B 3UX9B 1KC5L 1GIGH 3LMJL 3TT3L 2IH3B 3QCVH 1ND0B 1D9KD 1ACYH 2FO4A 5B39A 2IH3A 4MQTB 3I85A 4P2QA 5E2UL 4ZUUA 3QEQB 1V3LA 3G5ZB 3TFKD 1KB5H 4I4WB 4XNYL 5CJBA 3J8F7 1KENL 3A67H 2GY7B 2FX7H 1KJ2H 5C0RL 2V5YA 5C0FB 1NFDF 1MVUA 3W0WE 4PLJC 1KN2L 1DBAL 2G75B 3TBSB 1U93A 3WDIA 1HHJB 3DGGB 5IB3A 2YRPA 3F7VB 4M02A 2YC1B 4M43H 3QI9A 1AI1H 2WUCH 5IV2B 4JKLA 3TN0A 2EH7H 3K8KA 5D2LF 4GMSH 3HHRB 3RVVC 4N1HB 3QNXA 1I3GH 2A77L 2OR9L 4OZFA 3CFIC 2H26B 3A6CL 4AEIH 3QDGD 4JFFB 5I8CB 3BW9B 2W59A 3ZHLA 4Z77A 3P30H 3MFFB 5TE6H 1NFKA 4MJ6B 3BN9C 4LIQH 1U8PB 2J8UB 3EJZC 3LOWA 3TBVA 3VFMA 4CL7A 2YWZA 3UTPD 3BKML 3FQWB 4LCWA 1MHCA 3ALXA 3P77A 4Y5VA 3MACL 1YN7A 1CD0A 1KPVB 3GSUB 5DGRA 5IM7B 4YEFA 1CDHA 4M6AA 5F6HJ 1GAFH 4ZTPL 2FR4A 2DJ4A 3LQZB 4MVBC 3SGJA 2EE6A 4WEBL 1HH9A 3O11A 3SE9L 2IQ9L 3BN9D 3HG1E 3QUKA 3FB5A 4RZCB 4DGVH 5CEYA 1MHEB 4G8IA 5BRZD 4NQCD 1UKSA 4XNZB 4GG6F 5FYKU 4M1GL 2NCMA 1LD9A 2BHZA 1CDBA 1NAKL 4OCXH 1QBBA 3HNVL 5BZWB 4Z7UF 1V3MA 4H5SA 3SPVA 3GIVA 1AGEB 3ULVC 5DJ2A 4Q9QH 1XCTB 9CGTA 3JV5A 2O5YH 4V1DE 4O9HH 3RWJB 1WWCA 2NW2A 3ARQA 3BQUC 3M8OL 5DXWA 3EYFA 4D3CL 1G9NH 2NY5C 4NO2A 4E41B 3VRJA 1HQ4A 3EAKA 1N8ZB 5D1XC 1E6JL 1TZIB 4ONHA 2H32H 5EH1A 4LLDB 4GBXA 2YN3A 4RMSA 5L2KD 1M4KA 4JJ5B 5D5MA 5C07B 1H15B 4C55A 1INEL 4UI2A 2X9XA 1J5OH 1H15A 1RZ8B 4JY5L 1F11B 5DJAB 5AD0B 3EOAA 3C5ZB 4CDHA 3FO0H 1F11A 3BUYA 3O3EB 4MJIB 5DJAA 1IAOA 3RBGA 1I9JL 4JM2F 4B50A 1EERB 1IAOB 4G6FB 2NZIA 4LLUA 1TJHL 2YPLB 3MLUL 4HLZG 4ZS7H 1J1PH 4ELKA 3BESR 1UYWL 3MGOB 2DYPB 1G6VK 4MLIA 5BRZE 1AO7E 4BZ2H 1G9MH 3VFOB 5EN2B 1S7VA 3NIDE 1SEBA 3OAZK 2DMKA 5DHYA 4XNQA 2ZPKL 3U0WL 5DD5L 5GSRA 4Z5RA 3NN8A 5TE4H 2VR5A 2CJUH 2LAAA 4LOUC 4IMKA 4P2CG 2HLFD 3PWUA 4W6WB 3UC0H 4PJHE 5HVHC 1QSED 4L8DB 3V5HB 2NY0B 3ULSB 1GPOL 2N7BA 3VXOB 1RIUH 4GUPB 1JZ4A 4ZFGH 1D5ZB 3ZDYE 4RAHA 3I3DA 4PJ7A 5MEPA 2A73A 3CFKB 1BD2A 1HHGA 2C7UB 5D7IE 5DVNA 4U1JA 4GRWB 1KCLA 3GSVA 5FYLD 5DF0A 4GXUM 3WS3B 1UA6L 4F7MB 4OF6A 4XBEH 3BP5B 4Y5XC 4FQXA 3F5WB 4BH8A 3QIWD 4XB7A 1RVFL 4P5TA 4YHZH 2ZUXA 4MXVE 5DD3H 1V05A 4YC2B 1FL5A 4RISH 5IMKB 1JPFA 5T1LD 3MV9A 4NC1C 2W60A 4WFGD 4ZFFB 3GMLA 4PY8J 5B22A 2YMXH 3RQ3A 1P5UA 3UZEA 1CLZH 1KN4H 3MRKB 4ODTL 1WUNT 3X14B 3RPIA 4XBPB 3LH2L 4M62L 3DSFH 2AJZA 4Y19D 1FZOA 4Y8DC 1OM3L 5JW3H 1T5WB 4KJPC 2E9JA 1YYML 3INUH 1TZGL 4X6DB 4N0RA 2XXMB 1IC4L 4NKMB 1LO3L 4ZUSB 3BT2L 4TSBL 3O6FC 1T1XB 1UADC 5D1QB 4HUVB 4RGOL 4G5ZH 3DRQA 2OJZH 2VXVL 2XOTA 2W9LA 2AEQL 5DJ8B 3A6OA 1CXHA 4MA8H 3P4OA 1INQA 2QLVB 4EVNA 1C16A 4PUBL 1HILB 5DRWA 3S4SB 4JFDD 3HRZA 5E8NB 3VH8G 4D9RE 3KJ6H 5JW4N 2VQ1B 1T1WB 4Z7UB 4UV7H 3V7MA 3MA9L 3N9GL 1NEZB 4J4PC 4BFIA 1LQSR 1I8MA 1AGFB 2MQ3A 4Z7VA 1RJYB 2XPGB 4JM2B 3EBAA 5JXED 3WNMA 5IMOA 4O2FB 5DZNA 2IH1B 5D1XA 4EN3A 3I02B 4UBDD 4X9IA 5J06A 2IANA 1EEYA 5HYSB 3ILPB 4HMCA 1FDLL 3TZVD 3O0RH 4DQOH 1CTNA 3QHZH 2G9HA 1RZKL 2D03H 3BGMB 3QIBD 2B4CL 2XG5A 4XP9H 5D72L 1W72L 2ERJC 4NPYA 3IFNL 1DFBH 4H0IA 5F7KC 4N0YL 4OUOA 3H7BB 1U41A 1AQKL 4K07A 2ZSVA 2ZG1A 3HR5A 5LBSL 3B9AA 1B4JH 2I9LB 2XNAB 3SGEH 2ZSVB 1Q94B 5D2NE 4NQEA 4OF0A 1Y18A 3RIFK 3BJ91 4DTGL 5BVJA 1MH5B 5CZKA 4PRNA 3E3QC 1C12A 1DJSA 1TQCC 2NY2B 4JZOB 4U3XA 2Q8BL 1XR8A 1KIQA 1OARH 3P4MB 1LP9F 1TTFA 3H7LA 4ESKA 3U6RA 2A0LD 2NNAA 1A1OB 1KJ2B 4YDVB 6FABL 4OM1L 4LARH 2NNAB 1GGIL 2HLAB 5ID0A 3MLYH 3WUWB 3VDBA 5I15L 5CLWA 1QO3B 1UZ8A 1SM3L 2BJML 4JR9L 4JLRB 5INCB 3RVWC 5L2JB 1A2YA 2P48B 4PP2B 4HIXL 1T03L 3D9AL 3SGKC 2Z9TA 4AM0B 2QV2A 2VLKD 5DQJB 2K7QA 5DVOA 4WI9A 3CAFA 2A6JA 4L3EE 5K9KB 4TUOA 1A5FH 1EMTL 4P9HC 5I1AA 4PGDB 1U8HA 3MXVL 2HFTA 1OGTA 3W11C 1CL7I 2ATKB 3X3GH 2O5XH 2GAZA 5J0BA 4E5XB 1IC5H 2R4SL 4GS7C 3NCJL 5FYKE 3DROA 1KELH 2ADIB 3AM8A 1YJDL 2VXTL 1A6WL 2A38A 1PG7L 4OLYL 4RRPG 3T08A 1CGYA 3UJTL 5IHUH 1JZ5A 2F9BT 3TA3C 1NCAH 1AC6A 4HH9A 3DVFA 5DA4A 1KTDB 4OTXL 4EZMA 1CGTA 1FVCB 1NJ9A 3CC5A 4NQXA 4P4KC 2X05A 5CJ5A 2OR9H 5KSAD 3OG6B 1BOYA 1JNLL 1WF5A 4HMDA 4OGXL 3KYOB 1FJ1B 4KJWD 5LWYH 1M71B 2IFFH 5JHDB 2UY6A 4PRBA 5D7IF 2B5IB 1M71A 2BVPA 5D2LA 1IT9H 2DLFL 1XF3B 5AYQA 4OIBA 1JGDB 1WIPA 1IM9D 3RGVB 2CLZA 1X5XA 3STZB 4P9ML 4MD4B 3CK0H 3NTCH 5HHOB 5KSBB 2LVEA 3BOVA 4X6CE 5L6YH 3WUWG 2KZWA 5DEZA 4F9LC 5IBUG 1WV7T 1RFDH 4JFHE 2C3WA 4NIKB 1N0XH 2Q76A 3B6SA 1VDGA 1FL3B 4FG6D 5FYJU 5JXAL 3OGCA 3SE3C 3PL6B 4N1CA 4PY7B 3O6MH 4XCFL 5TFSH 2H2PD 1KIRA 3UBXB 2IPKB 5C0EA 4XAKD 1TJIH 1OW0A 2OYPA 4YHNB 3CFJA 1AD9A 5D96C 3S34L 1S5HA 4LASL 1FNGA 5LQBH 2B1HH 3G9VA 2BOBB 1FO0A 2OMBA 4FQLL 4H88L 1HXYB 1MCJA 1WEJH 4D9LH 3OF6D 3P0YL 3WFCL 1FVEB 1MCHA 3GKWL 5KN5B 1S9XA 5GJSH 4JN2B 4WIQA 3FQUA 3NH7L 3S98A 4NNPL 3BFOA 2Z31C 4XXDB 3BXNB 1PEZA 3D39A 5CZVH 3TJHC 4LKCB 3BXNA 1SJXA 3N06B 4LQ1A 2NY7L 1O7SA 3OKOB 3CCHA 5I66B 2X2YA 4P23A 3RKDD 3RX8A 5LJYH 4U1GB 2A9NL 2XN9E 1CIDA 4LIQE 4YDIH 3HI6H 4M93B 4HWBL 3EDEA 2XWJB 4G7VL 5EA0H 3P9LA 4K3JH 3O9WA 2FJFB 5DD1H 3VRIA 5IOPA 4U0QB 1G9MC 4TTDC 3MRGB 2MSPA 3IF1A 1X4XA 1F6FB 4HIIB 1F6AA 1EJ6A 5EUOE 3TGXA 5DI8A 4LVHB 1JPTL 1XGPB 2MKWA 4IDJH 4EQ3A 3K3QA 3JUZA 2H26A 1MJ8L 4ZO8A 3BEWB 2C1PB 3BMWA 4X8JA 1L4IA 5EZLA 4NRYB 2A74A 4HGWB 5D5MF 3BVNB 5DFWH 4MSWB 3NPSB 5TF0A 4ZUUB 5IBLC 1OB1A 4KKNA 5I73C 2XTJE 1GGCL 3MV7B 2QTEA 2VDML 3QUYC 3G08A 5HDLA 4NDMB 1IKFH 4HX1B 3HUJA 4PP1C 5IVNA 1OTSD 4RMVA 4MWFA 5DD5H 3QR2A 4R97B 5D1ZB 4PRPE 1AC0A 4XVJL 5KSBE 2ESVE 4G80B 4TNWK 1CE1H 2I9TA 5C2UB 4Y16A 3BE1L 5L8JB 4KI5C 2VXQL 5IB2A 4U05A 3H8NA 3QCUL 1MIEH 3T3ME 2XRAH 5HI5C 2BMKB 5DJ6A 4NZJA 2PR4H 4ODHH 4XP5H 3GO1H 3V0VB 4D0BB 3V52H 1NMAL 4U1LB 4XP4H 1I9RL 3QBTB 4M5ZL 3QIUD 1T7XA 1U95A 5EU6A 5D1QC 4I0PD 4K2UH 5I16A 5E2JA 4TUJA 5F9AC 1MCOL 4TQEH 4EEEA 1NGWA 3K81A 1UEYA 3PP4H 2K1MA 4WFED 1XF2A 3TBTB 4A2LA 4YBQC 2EYTB 4PJ7F 4JPIB 4AG4H 1S5IL 2CR3A 4G42B 4WO4A 2HFFB 1QSEB 5DZOA 3BHBA 4P4KB 4S10A 2DMBA 2QHRH 4G3YL 1G6RA 1A14L 4DVRL 2GKIA 1H5BC 1MAJA 2YOCA 5FCUL 5C70A 1EXUA 4XCCH 2BZDA 4ODTH 3FB8A 2FB4H 5FKAB 3BGAA 4M03A 5JUEL 3MROA 4K7PX 4KMLB 4JDZA 2OQJA 4OFYD 1A7OL 2CQVA 4XH2B 1FNHA 1HWHB 4HBQA 4FZ8H 2X6MA 1FL6B 1EX0A 4QHKJ 3T4YB 4KVCH 5JIKA 2X7LB 2BCKA 1F3JA 3NIFE 5IGXL 1OGAD 4R7DA 2R9HD 4O4YL 4UTAL 1AGEA 1JTPA 5D9SB 5E4EB 4ONFL 1F00I 3X13B 3U30C 3VD9A 1P1ZB 1AD0A 3W5MA 2DS4A 3TBWA 1JHLL 4RIRA 1JHTB 1YNKH 1HINL 1JV5B 2AEQH 4K9EL 3VI3F 1QFWH 3EFDH 1KN2H 3MRMA 4P57B 3QAZC 4MZ2A 3KJ4C 4ONHB 3KXFD 2NW3B 4PS4L 3DV4B 3VGAC 4Z7QF 3QFJA 1WFUA 3IU3A 3U4BL 2Y9RT 5DO2C 5JPMB 2NY3B 4W70A 1JBJA 1PQZA 5C0GB 4MD0B 2MCG1 1A9BB 1FAKT 1I8LC 4WEMB 1FFOB 4PJFE 5CINL 3S37L 3VMPA 2JCCA 1L7IH 5B3JE 1Z0NA 2BNQB 1MI5B 1WSST 2BNQA 1IVLA 4OI7A 2VWEC 4BH7A 3AS0A 3P30L 3ROLA 2E6PA 4XWOD 3AM8C 2DLGA 2NX5D 2RAMA 3ELAT 3F5WA 3WN5C 4NM8L 2CRIA 4FFWD 4CBPA 5K9QG 4OZGF 3NVQA 4HKZA 1JZ8A 1Q9KB 4PGZA 2J8OA 3Q1SH 1QBLL 3SQBA 2I24N 4OGAC 1BIIA 1HZHL 2XFXA 5D72H 1S7VB 1IM3A 5C8JB 5H35A 1FYTE 1SY6A 3NCCB 1F4AA 5FKPA 3HZYA 4M4PA 4YDKH 3VXTA 5AZEL 3JUYA 2X4TB 1XGTA 4PRHA 4R90L 1CK0L 3ULUF 4L3AA 4P2RA 3MV7D 5GGVY 1ZT4A 4YHYC 4WHTB 3X14A 3MCLH 2XKSA 5HHVH 3V6OE 1CN4A 1OGAB 3S35X 2R69H 2OJEA 2MMXA 2EICA 3I6KB 1YMME 1QNZH 5MEPB 4XVTL 2CDGB 1T5WA 5IHBA 3HRPA 4UAOB 4R7NA 1D5BB 4KK8C 3VRLE 3L3JB 2P45B 3H9HB 4M1CC 4R2GD 1PEWA 1KCSH 1OPGL 5CJOL 1ZLSL 3RHWK 3SE3A 3MJ6A 4PRDA 1MEXH 1QHOA 5BVPL 2EXYC 3OTTA 3CDCA 1AXSA 3TIEA 2X4NB 2CK0H 3L3KA 4FHBD 1YEFL 3FRUA 5E99L 4NC2B 1TZHA 3H9SD 1TCRB 1AO7D 4TOYL 1A6UL 4RA0C 5LAXA 1OHQA 2KBGA 1EIBA 2XWTA 1C1EH 1KPUB 4LRIC 3UTTB 5B4MC 1A02N 1NKRA 3X3GL 2AQ3A 3S4SA 5DJXA 3WDHA 1PGRB 2JTDA 4FTVA 4PJDB 5DJZA 4KRPC 25C8H 2VAAA 2CK2A 1F42A 3L5WA 2CDFB 2DAVA 1XMWA 1HI6B 4F7EA 5D7JB 3FFCD 1QFUH 3H3PH 4BM7A 2XPGA 5CCKH 4D8PA 1T1YA 2YUZA 4N0UA 4GKZA 3OZ9H 5DWUL 4OTXH 4P5KA 3VA6A 1M6OA 1UKQA 5DZLA 1RIVH 3QA3A 3QEUB 5H94A 4ZUWB 4FABL 1GOGA 5HYSA 5I9QC 5DSCB 4WI7A 4XWGL 3GDBA 5HGBA 1A3QA 4JKPH 3TVMA 4CUCA 5LWYL 4UQ3B 4M8VA 4QXTA 2NX5E 3ZL4L 1S8DA 4NPYB 3OX8B 4FFYL 1IAII 2C4XA 5LGHL 2LAGB 4UQ2A 3BRDA 3UP1A 5L88H 4OD2B 4LVOB 5D6DA 2ZUSA 4UQ2B 4HUXB 4M93C 1JGVL 5HHOD 1A0QH 2FX9L 2DQTL 3S97C 1H3WM 4KK9C 3UCRA 1M7IB 2YD6A 3ZT7A 5F9WB 3KPRE 3RVTD 3O8XD 4KZDL 3P4MA 4LVHC 3B9VA 3CVHL 1P6FA 4O02H 5GS3A 4NKDB 1D5XB 5SWZD 5TPWL 3G5YA 4YIQB 4U0RB 2X4QB 3GSWA 2IMMA 4QRRE 1RUMH 1TVHA 4YO0A 1CL7L 1DBML 4B5EA 1A4KB 3C60D 3GSNL 4QHMA 3RWDA 3O9WD 5EU7C 4DW2L 2J4WL 4TNVK 4DN3H 4DZ8B 5L8KB 5DD3L 3RWIB 3VDCA 4CU6A 1CT8B 5ILTL 2PO6A 1ETZB 1I1FA 1LVEA 1CLZL 4JFYA 2AQ1A 4EDXA 2NY7H 1UCBH 2YKLH 3LB6C 1KSRA 3QYCA 1AIFA 1R5WB 1T66D 4LAQL 3LH2H 2R29L 2J1KA 5HDQL 1DBAH 3KPLA 3DSFL 5SV3A 4KHTH 4FQJH 5JW3L 4K3JL 3F7YA 1OD7A 1T0PB 5KTEH 3D3VE 2AV7A 2ZCLH 1QSVA 3UMTA 5E6ZA 4R4BA 2JJUA 2PXYC 5F9DC 1UM4L 4OFPA 4R4BB 4XCNB 2IBGA 1A7BA 5IESH 3MNVA 4XCNA 4KKAD 3J7HA 2VISA 4H8WL 1OCWH 1EFQA 5DRZA 3VFGH 2HT3D 4AY0A 1SQ2N 1MFNA 4LSTH 4DGIH 5K9KA 4QRTA 5EZOH 3SDAA 2BRRL 2GSIB 2IAMD 5HGAB 5F9JA 3QPXL 4APQC 4NZRL 3QUYB 4ORGB 4LDEB 4PUBH 3GSNA 3CSBA 4IOFC 5IJKA 1NC4D 2R0LL 1YYLH 2XV6B 2BNUA 1UZ6E 4Y7MA 3O3UN 5GS1B 1BP3B 2AJXL 3AU1A 3N9GH 5EO1A 2BSTA 2YEZB 4PJEB 3CH1A 5BV7B 4YH6A 3BE1H 2VXQH 3PWJB 2F54D 4HWZA 4QNPE 2VDLL 5FUCE 5BRZA 1U58A 3M07A 3MV9E 4HWBA 4XP4L 3O0RL 1FG2B 2VKWA 4MAYA 1FLRL 3JTTA 3OBAA 4ZFZB 1JRHI 1BZ7B 3IVKB 3U0PB 2VZVA 1J05A 3HTLX 4DKFL 1W0WA 4H0GA 3EOTL 2BVPB 4LLQB 1P84K 4PJDF 4PB9L 4GG6A 1YZZA 5GGQL 5D71H 2O5YL 4IRSD 3MLVH 4ZO6A 4W4OA 4XC1L 3B2UD 2K7PA 1DQML 1V3JA 3ARDB 2EEBA 4EQ2A 4ZNCD 2Y23A 2ZKHL 1HHKB 2GUOB 1JGLH 4G6JH 4XI5C 2Q8BH 1QG3A 2HAZA 5IB4A 1L7TH 5E5MA 2DD8L 4A2MA 2PW2B 1WBZA 4XHQA 1NBVL 3RWEB 1BZQK 3MJ9A 1WQVT 2BSRA 4KWUA 4E41E 3HI1B 3SDDD 5DMJB 5CGTA 1A7OH 3TNMB 2EDWA 2X4SA 3ARZA 3L7FB 4M48H 4NOBA 4HBCL 4KU1A 1ND0A 4KVCL 3C6SB 3WFZA 4DKDC 3BO8A 3QFDA 4Y89A 5EZLB 3S6CA 1CFVL 1QBMH 1U8KB 4G8GE 1L0QA 3UTSD 1VFOA 3S5LB 1J1PL 5INDA 2E9WA 1A7PH 3T1FB 3GBML 2AXGA 3BP7A 3H3KA 4GXUN 2G2RA 3F8UB 4K9EH 4PREB 5FECB 2WUBL 4KKBD 2EDKA 1MVUB 1A6WH 2EE3A 1HHJA 4XPGL 5GRZA 2AJUL 4S0TD 1QEWA 3V4UH 1IGJA 1QLRA 5CEXA 2YUXA 4LHUG 1NGQH 1QA9A 3VDAA 4JFEA 1MI5E 2UZXB 1VEMA 3QO0B 4JRYE 4ZYKA 3CFCL 1Y0LA 1K9TA 4LGPB 3S37H 1ZTXL 2SEBB 3B3IA 1ES0B 3LCYA 2OSLA 3TV3L 3UJIL 4F7TB 2E6QA 3JVGC 2XI9A 5DK0A 4PRHD 1QD0A 2OSLB 4IS6A 4ZFOA 2CUIA 2EH8L 4M9OA 1RJZA 3WIHA 3CLEL 1YUHA 4HGWA 1RJZB 1AGBB 4Q2ZA 1X5KA 4XPBH 4V1DB 4D0CB 3M1BB 3U0TA 2DLFH 1PLGH 4XZUA 3MBEB 3VG9C 1JZ2A 1ONQB 2OM5A 4ODSH 1XGRA 4HHAB 3G08B 1YEIH 4PY8I 4N5UA 4Y4KA 4FS0A 1LEKA 3WHE0 3I6GB 3OF6A 3UYRL 3RPKA 5IM7A 4U1IA 5CJQH 1G6RB 5F7WC 4R4ND 1EFXD 4H26B 3CZFB 3ES6A 4JHWL 3T0XA 5JXAH 4OZGA 4LCUB 5ANMA 3IDNB 5KS9F 3O6ML 1UM6L 1B3JA 1NFIB 3HN3A 4X98A 3DI2B 1UZ6F 3GNML 4KZEL 4KAQL 1S78D 3T65B 2D9CA 3GSRB 3U7AA 4RZCA 2CLVB 4KGLA 3DURB 5F93C 1PZUB 1S7WA 4DAGL 2Z0BA 5EOTB 4L9DA 1MWAL 5JPNA 5HHNA 1BQSA 1EHAA 5E6IB 4BKLB 4N8CL 3P0YH 5HI3C 3VWJD 1VFMA 4TVPE 4YUEH 3TEUA 4ELME 2F5BL 3HPLA 1F2XK 3L