3V4UH

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
b'EVKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVANINYDGSSTYYLDSLKGRFIISRDIAKNILYLQMSSLRCEDTATYYCARLTNGYLDVWGAGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLESGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
molecule tags Immune system
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
total genus 40
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uH01
4ACPA 1NBZA 4Z7WE 4YO0A 1IGJA 1AQDA 2DMBA 2OZ4H 4DFIA 1J5OL 3ARDB 4K7FB 3SKOA 4G6MH 4KZDH 2W07A 4KFZC 4XVJL 1YN7B 4FQQA 3FTGA 1TQBC 2EYRB 1DQMH 5EZOL 3STZB 2BNUA 1NMCB 5HHNB 1BM3H 3VH8B 3GHBL 2X4PB 2V2XA 3LKNB 4I48B 4M1CD 5EU6D 4G5ZH 3MUJA 5I6XC 1I1AA 4TNVK 1ZLWH 4APQD 4G8IB 4LOUC 3U1SH 4W6WB 1KCSL 4WI2A 4KXZI 5DMKB 1G7LA 3M17B 2FJGA 5CSZA 5EPMA 1F97A 3C87A 4FQHB 2D2OA 4OLXH 5DD1H 5F8RC 3BH8B 5TPWL 1CICA 3I9GH 1OAXH 4RA0C 1V3MA 1LO0L 4XPAH 5FO8B 1KYOK 3B2VL 4MJ2A 4K8RH 5AUMA 4Y19D 5C07A 5HYSB 1IGFH 3VXME 2M1KA 4FZ8H 3U2SA 2P49B 4JJ5A 2CIKB 2DDQL 1RZJC 1RURH 4WU5B 1MJ7L 1ZHNA 3TF7C 3I6GB 1DVFD 5A3ID 5HGAA 3ZYZA 5EORL 3NABL 1JJUA 3DMMB 3UDWA 5D7IF 2OBGA 3F7RA 3HNSL 4MLSA 5EZLA 4YAQB 3ZE2F 3DMMC 1CFSA 2LU7A 1QSEE 1QSVA 4RAUB 4H5SA 1CE6A 3UTZA 2HFTA 2ZUUA 2BDNL 1II4E 1NAMA 1VFUA 2F9BT 2J5LB 2DM2A 5CBAB 3RA7H 2CRZA 3DX6B 3FJTA 3O6FD 4G3YH 3BP5B 2FCBA 4R90L 1UJ3C 2GW5A 3H9ZA 5IQ9A 5JHLH 1KTDA 1QLFA 1QHPA 3BYYA 2WP3T 5I1GL 1J9CT 4JFFD 4OM1L 4Y0GA 1FV1B 2VLJE 1YDPA 1T21B 5B39A 2G60H 4FQJH 3IAPA 2R56H 4W4NA 1M7IA 5ICZA 4LCIH 1B0RA 1EHAA 5JA8B 3B6SB 3ET9F 4WGVB 1DEDA 2PYEA 4PV8B 3RZCC 2PTUA 4J1UB 4C56D 1GVIA 2J8HA 5TQ0L 4NUGH 4F8TA 1OSPH 1GZQB 4JFEB 5I1LB 2XN9B 5E00B 3RJQB 1G7QB 4X6FA 3KPSD 1ZAGA 1VSCA 2CXGA 4FP8L 4JCMA 4ONFH 3VU2A 3VG0L 3TLRA 5AAWA 2WBKA 3CNKA 4RFNC 4BUHA 5SWQB 4XMKL 1CLOH 4ZPVA 3QWOB 2VZVA 5INDB 4NZRH 3HG1A 5DFTA 3RWEA 2OTWA 5DT1H 3EGSA 1S7TA 1AIFA 5DLML 3GJEB 1VADB 3H0TA 5MERB 4S0SD 3GIVA 4DGIL 4ISVA 4YGVB 4RGNB 3QIUA 4KKCC 3W2DH 4JN1H 5BZWA 1N3NA 5K9QG 4P5KB 4FOMA 3DURA 3QAZB 1A8JH 3QUXB 2PN5A 4TVSa 1YC8A 4WUKH 5ACZB 2IG2H 3VXRA 2P5WD 1NDGB 1FIEA 1PX4A 3HZMA 3NVQA 3KPNA 4F15C 5ERWB 3JWOC 4QOKE 5I74B 5B39G 3RX8A 5FEBA 4IS6B 3WL9A 1F3RB 2NXYD 3LKSA 3MV9E 4X4XB 3GMMB 1A6VL 1A6AB 3BP6B 1MAMH 1NCCL 4PJFA 3RGVD 2XTJE 3RY6C 4HKJB 1ZOXA 3E2HC 4OM0L 2IAMB 3GKWL 1HEZA 4XP6H 3RWFB 4KMQA 3L3HB 3TV3L 3PXJA 4C56E 1DDHB 4JREB 1MQKH 3BDYH 5I71C 1F3JA 5I66B 5L2KB 4KTDH 1G6RB 3B8SA 3WHE1 5IFAH 3TJEH 2QSCH 1LDPH 5C0BE 2VLKE 3CXHK 4HEPG 4OFIA 4CUCA 1FFRA 3DIFA 2NMSA 2R0ZH 1TPXB 4PV9B 4UIMB 2K9UA 3G5XA 1JHKL 5LAXB 4YC2B 1A9EA 3D39B 1C7SA 3RUGF 1IFHL 1E4KC 3EYQD 4LPUA 2NY3B 2ADFL 1S3KL 3LSOB 4OCSL 3ZDZF 4MAYB 1J1PH 4KRMB 4KKLD 1BPVA 1KCUL 2FWOB 1N2RA 1A7QH 3D3VE 3QXAA 3H7BB 2AJVH 2EDOA 3ARUA 2XZZA 4OZIF 2VXTH 2Z35A 4X9IA 2V17H 2NY0C 1RJZA 3T2NL 3P4NB 3AB0C 3S7GA 2OXHA 1F4WH 4X6BA 4HLZH 1FNFA 1G7MA 4HFWA 3IDGA 1NCAH 2FX8L 2E9JA 4M00A 2VLJD 1QACA 1JP5A 2AXJA 3VDCA 4ODTH 4R97B 3IVKA 15C8L 3LMJL 4P2QA 4NCC2 1I1FA 4M7ZC 3T2PA 3TO2A 1E6JL 1B4JH 2PW2B 4RQQB 4JZJA 3E3QE 5FM5O 3WN5C 4JRYB 5MEOA 4GRLB 4WW1B 4PJFB 2G5RA 3BEVA 3HNVH 4Z78B 3PGDB 1D6EA 4JJHA 2EC8A 4LLWB 2AI0L 3UO1H 1P7KB 3TFKC 1A6PA 4PY7B 3VXUA 5J0BA 1GZPB 2QSVA 4IOFD 1AGCA 2O93L 4UDTB 3FN0L 5CJXC 3JV5A 1IGCL 4TUKL 5BS0E 5C0AA 5E8OB 1IBGH 4HV8A 5AD0A 4JHZA 4G9FE 3O2WL 4MD5A 3CU7A 4JDVA 1AQKL 3U7WH 1X4XA 1MHHB 3AM8A 5KSBA 3IDIA 3MJ9H 3MV7A 4EVNB 4D0CB 1TZHA 4K23H 4Y16D 1HNGA 4JE4B 4K2UH 5IB4A 3DX9B 3LKQB 3U0WL 4AG4L 4G43A 1QNZL 7FABH 4L4TD 4QXGL 2JELL 4PR5A 5ANMB 5IVXB 2C1PB 4PJ8D 1JWMB 1DLHA 4KKBC 2WUCL 2W9EH 1JYXA 2XWTA 2GEEA 3WS3B 2F54A 4ODWB 3HUJA 2I9TB 4XP9L 1M4KA 5EBLA 2QQQA 4ELMF 1YQVH 2B4CL 5AG9A 3QAZC 4NKQB 3EOBA 4QHKJ 5DHVA 4Z7NF 3LN5B 1K2DA 35C8L 1CXEA 2H1PL 3MNWB 1RZIB 3N85L 1FZMA 4JFDA 4KDWA 2X4UA 1HZHL 5CZXC 2XWJB 3KYNB 5I1HH 5KVEH 4M5YH 4LNRA 5AZEH 3U4BL 1F6FB 2Y07L 4F9LC 4G8GA 4BK5A 4MLIA 2NY2B 2W60A 4RISL 1UCBL 1EERB 1YEJL 3OJMB 4XWGL 5FGCE 4TOYH 1I3GL 3BH9B 4X6DA 1CBVH 5LKNA 2NLJB 3TIDA 3O3UN 2FIRT 4MX7A 4O4YL 2IH3B 5F9DC 5I17A 2D0GA 3QFDA 4M9PA 1BAFL 3RZCB 4KAQL 3ZKXC 2APTA 2FHBA 4M8QA 3SY0A 3NCCB 4LPXA 1X5LA 3VFUA 2FGWH 3EYUH 4MWFB 3UPCA 3O8XB 1BJ1J 4HKBB 5DUMH 3O3DB 1KJMB 1G9EA 3FB6B 3DV4B 4WFHE 3FCTA 1VPOH 3ZHKA 4ONGH 3OKEA 2IFFL 1MAKA 4D0CA 4AYFA 1TETH 2IPTL 1AO7E 1T22A 1FVCA 2GTWB 3G6JE 4MAUL 4NZRL 2PO6A 2F8OA 5CUSL 4KKNA 5E94A 3BWAB 4R7DA 5FO7A 1FYHB 1J0KA 2NY6C 4QHLA 1F42A 1A6WH 1P7QB 3NFNB 35C8H 4N0UE 5CZVL 1Z6JT 4YR6B 2ZUTA 3WFBL 5EO0B 2WK2A 3QG7H 5EC2B 3CFEB 4U6XB 4R8WH 5HGHA 3MUY1 5HHPB 5GIRA 4ODSH 1A3RH 2R0LL 2R2CA 2HAZA 4PJAB 4OZIA 3MR9B 4ISVB 4NKMB 1RZ7L 2EO1A 5JIKA 3QUMA 2VITB 1QHOA 2ZKHL 4OZHB 5IMOA 1U8HB 4OD1H 1F02I 2ED8A 1I1CA 3JWOH 2VLRE 4OQTL 2X6MA 1KB5L 3MBXH 4HCRH 5LG1A 4DGVH 4NHUB 5EBWB 1BEYH 1FL5A 2IAND 3RUGA 4NZJA 5A40E 1K4DB 5JPNA 4HS6B 3FFCA 4K9EC 4PJCF 2JIXB 3L3KB 3V5KB 1GYAA 1UACL 3F6LA 2PW2A 3T8XA 3QDAA 5FV2A 5MP6L 4PRIE 5HYFA 3QB7C 1T83C 5A2JH 2DAVA 3KNBA 2UWEE 2X10A 3RIFK 3IXTA 2ITCA 3G9VA 3K74B 3SCMC 2WBWB 4UB0L 5JW4N 5IB5A 3BP7B 4NQEA 4NIKB 3MRJB 5FCUL 3S3PA 3OMZA 1D5BB 1M05A 4Y5VB 1KB9K 3VFNA 4IDJH 4R90H 1VKXB 5JTWA 4JY6B 4RA3A 3G5ZA 4Z7UA 4JR9L 1NLBL 5FOBB 1MQ8A 3L9RB 1IAKB 5FYKU 1V8HA 4LIQH 5HYJA 2XZAL 3S5LA 2Q76A 2FJHA 5F8QC 5FO8A 1A6VH 4I5BA 2ZOKB 3D2UD 1DBJL 3BN9C 3MV9B 1TZIA 5CJQL 2FB4H 5JORA 3O2VH 1NUNB 4M48H 5DMGC 2BC4A 3T0EC 1DLHB 3WUWG 1WT5A 1D5XA 2P1YA 3DRQB 5GGVL 4KI5E 4NRZA 3GRWL 5MI0B 3V0WL 2QADD 4KTDL 3MREB 4WI3A 4HF5L 3SKJL 1AGBA 2EICA 2OK0L 2ESVD 5BV7C 2P45B 4BSJA 5C0FA 3ZKXB 5DURB 4F7MB 2O61B 3RTQD 4X5XB 4QRRA 1U3YA 5GJTL 1W0WB 4PRHB 4M02A 4OIBA 3DX6A 4ZNEE 1D5IL 4Y4FD 3VRIB 5DXWA 4CVXA 1RJLB 2YR3A 3VH8G 1FV1A 3MMEA 3HFML 5TF0A 5LXGH 3BEWA 3MV11 4Z78A 1H5BC 3NCYS 3PGDA 4XNZB 5F6HJ 4DOHE 4NO0D 5K93A 1Y18B 3G6JB 4HWUA 4XVSH 4OZFA 3N1GC 3BRFA 5IVZB 5C0CA 1BJ8A 4KRPC 1I9IL 1JV5B 1FFQA 2AV1B 4NQSB 4P3WA 4KMTH 3HRPA 4NKDA 3HC4H 3SGDI 1CFTA 1L4IA 2NY6D 2BNRD 2Y9RT 5DS8B 4HT1H 1PAMA 5L2KD 3MJ7A 4PJEB 4YZFE 1KJMA 1IKNC 4EN3A 4TSBL 1UXSA 3N0PB 2BNQE 4UNUA 1XF4B 3DYOA 1F11B 1OT1A 1PJ9A 3BKYH 4E41D 2HWZH 4IDLA 4XCYB 3KYKH 3QUYC 2WSKA 3RGVA 1CVSC 4M7LT 3ZL4H 4F33B 1OVZA 4LAJH 1FSKC 1YEIL 3BAEH 32C2A 5F9JB 5DD3H 4XNUH 4Y5YB 4KXZH 1MCRA 5DJ6B 4CVUA 1XIWC 1YEKH 5C09D 2HMID 1XGUA 2DYPB 4JKPH 4F3FB 4OGXH 5LQBH 3PXHA 1UZ6F 5I15H 4HWEL 3DO3A 1FVDB 2R0WL 2AJSH 1LEIA 3NPSB 1HH6A 4JFDE 3G5VB 3NIFF 4NM4L 2R1YB 2R15A 4YBLB 3UROR 4O00A 5J9PB 1V7NH 2XACC 4DZ8A 1AQKH 3U7WL 5BXFA 5I19L 1PGRB 3K8KA 4J8RA 1X9QA 4M61A 1W0YT 4LNRB 5E1HB 1UB6B 2VSDA 2FRGP 3OKLA 2Y4SA 3T0ED 5IB2B 2HFEA 3BZ4B 2JB5L 1HHJB 1IM3B 3GSNA 1Z9MA 4LLMA 1WGOA 1KB5H 2G5BB 2R2EB 3RWFA 1H3VA 2QR0B 3LS4L 4QYOB 5D7JA 3TZVC 4JO1L 2HTKD 1PG7H 3IFPB 4JM4H 5A2FA 3QIUD 2MWCA 2B4CH 1H15A 3EYUL 3SCMA 1Z9LA 2EXWD 3UJIH 1SY6H 1ZSDB 3LMJH 3RVVC 1H8OA 4CMMA 1KCRL 1I7RB 2PCPB 2OYPA 4QXTB 5C0BA 2E6PA 3FQNA 1IAIH 1GIGL 1RK1B 1BFVL 3N1PC 5DD5H 3EYVB 3SEPA 1MCBA 4AL8L 3B5HA 1KFAL 3HR6A 2X4PA 5DMKA 3F62A 3O2DA 1YMMA 5LBSH 5GGRB 3DHMA 3PABA 1BBJA 3HE7D 3G5ZB 1YEKL 3T0VA 4QHNA 3ES6A 3GMLA 2RR3A 3FQTA 3MNZA 1EAPB 1X5KA 3WFBH 4DW2L 3IAGC 2DKUA 1IAMA 2VC2L 3BWAA 5FO7B 3VXOA 1P4BH 3LRHA 3QCUH 1S5HA 4MSWB 4BKLA 4AMKL 1WBZA 4LSDA 4JZOA 4HWBH 3VFRB 3FHAA 4NQDA 2H3NB 1KB9J 2DTML 4CL7A 1RVFL 4M6ML 5ENWA 4JPIA 1H9VA 3AVEA 5E6IC 1QFUL 5EWIL 2Y6SC 2OJZL 5DO2D 1LEIB 1KJ2B 4LCYB 1BQHA 3QIWA 3IS0X 1Y6MR 5DJZB 3WXWL 5ID0A 1U8HA 3H9YA 4H1LG 4RIRB 5AZ2L 1E28B 3UAJC 4EI5A 4JVWA 1QR1A 3PL6A 4NKIH 2NNAB 3VCLA 5GGSY 2OZ4A 1UB6A 5IB2A 3D3VA 1LD9B 5ACLA 5C71A 3C6LA 5C86A 5CEXA 4PJ8A 5JXAH 5E8EA 3FMGL 5FYJL 3C60C 5ALCH 2B0SH 3IKKA 4BZ2L 3DLQR 3RI5K 1H3WM 4GG6A 1H0DB 1P6FA 1PYWB 1HIML 4NQVB 5GJSL 1IM9A 3SJVE 2IF7A 2BJMH 4X80L 4ZUWB 5BRZD 1TVHB 3RY6A 4FQ1H 3CX5K 4LKXA 4PLJC 3Q3GB 3HE7C 2IADA 2PYEE 3JWOL 3FL7A 4UI2A 4LRNH 4FXKB 4TNWK 4LSQL 2BVPB 3MO1B 1JWUB 1JPTL 5DK2B 2HMIC 4OF3A 3ARGB 4YHOH 5T3XD 2F54B 3PHQB 4WCYH 1W72A 2YD9A 3VFTA 2QL1A 4LHUD 4ONHB 1IQWL 4G6KL 5L88L 2VDLH 1MJUL 3EGSB 3MV9A 1Q94B 4TSCL 1MEXH 2C3WA 3ME0A 5F9JA 4GAGH 3CIQA 1I7ZB 1EHNA 4OBRA 5JOPD 1CGUA 5EZIH 1TENA 4OLUL 4F7PA 1E27B 4LSTH 3KPLA 3WFEL 2X9XA 4JO4H 1H3PH 1C5DB 4P2OC 3CDYA 3ZKND 3ARGD 4QRQB 4Y16A 1UVQB 3MLRH 3WKML 4NWTL 3TJHD 4PJ7F 2AABL 5F93C 2VISB 4I77L 5K9QI 5D2NA 1NGZB 2BJML 3B9VA 3UTSB 1EGJA 2N7AA 1QQDB 1ZLWK 3HPJA 1I4FB 1OL0A 3SE4A 5IMMB 5GS1C 4TULL 4NN5C 4HUWB 1KLFA 4OZIE 5CEZL 5MHSE 1HSBB 3L3HA 5A2KH 3FKUS 3BQUC 3FFDA 3O3EB 4CRPA 3GJFA 5GRVK 1KJ2H 1MI5A 4YHIB 4HMDA 3B9KD 2FEEI 4MJIE 1BBDH 4KK9D 2CQVA 4D0DA 4H0HB 4EVNA 2JTDA 1RAMA 4KVNL 4CADA 4CVZB 3MLPA 1RK1A 4WW2C 3BZEB 2N1KA 3RDTB 3VI4F 1VFBB 5CILL 4Z7OE 1YNTB 3BIBX 2VLLA 1FYTB 4W68A 3BD5A 3ROOB 1ITCA 1ND0A 4WJ5B 4JLRB 1MVUB 3WJLC 2H32A 4JFOB 5HHPA 4Q9RL 2NXZB 4XZUB 2A9MH 5KVGH 4PJFF 4NO3B 1RJYA 3GI8L 3WJJC 3GIVB 3QUZC 3B9KB 3TBSB 4ERSL 2R0WH 2Y5EA 4IOIB 2GJZB 5BRZA 3REWB 3PHOB 3FT3A 5I1CL 4NN7B 4JFQA 4MXVE 4LVNC 1IJ9A 5ELIA 2JB5H 4EBQL 3ARED 4XPGH 2FH8A 4PJDB 4Y1AE 1INDL 5C07E 3AFLA 4P4RB 1E6JH 3KYMB 2NXYC 3T0BA 1D3CA 3OHXA 3HI5H 1JF6A 4LF3B 3FO9B 1YECL 2BHYA 3DX8B 3UYPA 1T1YB 1AD9B 5JW3H 4K7FA 3SKOB 3LB6C 3QI9A 1T6WA 3MC0A 2IANB 2YC1A 4MX7B 5D7JB 4IRSA 1D6EB 3EYOA 3DVFA 2YKLH 3DGGB 4XC1L 5E99H 1NL0H 3PQYB 5EUOF 1CLYH 2HLAB 5GRVL 5DLMH 1R3KB 1FORL 1PEWA 5TF1L 3SDAC 1N5YH 3VFNB 1RIHL 4L9LA 3E6FB 3SHSA 4BSWA 3DVIA 2BVOB 4X6EB 1F58L 3VWJC 3EYVA 2X42A 5KAQG 5HHXL 3S8WA 5L0QC 3BKCH 3ZDYF 4F7CA 3OKDA 1FC2D 2FLBT 3D0VB 1P4BL 2FEDC 2HVJA 1AC0A 1CT8B 1NKOA 2F5BH 2AXFA 2CKBA 5A43C 2A0LC 1ZA6B 2PW1A 4LIQE 2H45A 4UMGA 1D5MA 2Q3AA 5FIEA 2MPAL 4WU7A 2RGSA 4XNXH 4BKLB 4BZ1H 4YX2H 1RZKH 2HG5A 1HK6A 1YPZB 4MB4A 5EU7E 3ZT7A 4HGWA 3TT1H 4AM0B 1DZBA 2HWZL 4QRRB 4X5XA 4FZEL 1MY5A 1UWXH 3QXTA 5BJTB 3CVHH 1MCPH 2C26A 1W0VA 2WBJB 3VWKC 2YS4A 5JOPE 1N3NB 2XA8H 2LU4A 2EXWC 4F57H 5F44A 3QUXA 3JV4A 1FLTX 5JNYA 3MRHB 5IIEB 2LABA 4LU5H 2AJZB 4Y8DC 4GT7A 2B1HH 4HH9A 1A0QH 3DPBA 1X5AA 5GQBA 3T3ME 1T04B 4JFPB 3GHBH 1RY7B 3W82A 1NEZB 3GIZL 4MVBC 3MGOB 3V6FA 4NQCD 3Q0HA 3DX7A 1OM3H 5D5MA 2FR4A 5F96H 2ZSWB 2AI0H 5H35B 4JRYE 4FQXA 2CDEA 4X99A 2E9WA 2WIMA 1JCKA 1KIUA 3I3DA 1UJ3B 3I50H 3ARFD 3FN0H 25C8H 4JM2F 4Y5VA 4MDIB 4X9FA 3C9NA 3O3DA 4JHAH 3MA9H 1O0VA 4PJDF 3FT4B 1NMBH 2J4WL 3MCLL 3VXSA 4XCFH 1U8IA 2D03H 2Q86A 3AMKA 2AV7A 5KVFH 1HQ4A 4ZFGH 5TE4H 2EDXA 5T5FL 1DQJB 4PR5B 3R06A 4V1DD 5ANMA 2P8LB 3WKNA 5EZJA 1CGWA 5C1MB 4NBZB 4YXHL 1NBYA 3CFEA 3VGHA 2VDNL 2HT2C 4MNQA 4NO0A 1I9EA 1QPPA 5EH1A 2BRRH 3S3JA 1NAMB 2KL6A 1HYSC 5E2VH 5HVFB 3PWLA 4PJAA 4OZIB 4UBDD 2VUYA 3B9EA 3R1GL 5I16A 3T08A 1WAAF 3IJSA 2GSGA 3GMNA 4YPGA 1VESA 5KVGL 1JNLL 2Y1VA 1RZGA 5DUPH 4APQB 1JNNL 2UZIH 4EIGB 1JPFA 1A7PH 1OP9A 5IHZB 3QCUL 1KJVB 2BERA 3PJSA 1BEYL 4BYHA 2NY4D 5I1HL 2VLRD 5IEHA 5KVEL 1P1ZB 2ILLA 5D1XD 4M7LL 2X4NA 3QQ4A 1A6ZB 2XG4A 3OGCA 2QKIB 1FO0L 3QEQA 3T4AB 2VISA 5JPNB 4LSUL 1P53A 2ENSA 1T04A 4PD4K 3FQRB 5C07D 5GRXG 3BKML 2VDLL 3S3SA 1S7UB 4I0PC 4PJHB 3V95A 4JREC 3OKNB 3QUKB 5I73B 1EXUB 4PJ9C 5GRUH 3MLSH 4RAUA 1HHHB 1L0XA 4ZFFA 2ERJC 4U1GC 4XAWL 1DBKH 4OCYL 2V2XB 3LKNA 1KF9B 5D1ZC 2YKLL 5DHYA 4WGWB 3S35H 5E8NB 5DT1L 3DV4A 4UIKH 2A73B 1D5BA 4Z7UB 1F8TL 4P4KB 4H88L 1NLBH 3I3BA 5TDPB 3VD7A 5TF1H 1DSFL 1JHTB 1IC4L 1BWWA 3UEZA 2YZ1A 4JN1L 5IW1B 2X09A 2EXYC 3WNPA 1UWGL 3QISA 5D9SB 1JGDB 3FB7A 3RKDC 4ODHL 4JDTL 1I85C 1LK2B 1J1PL 4NO0B 3MV8E 2WQ8A 5KN5A 3AS0A 4MJ4A 3ULUD 5IQ7H 4XCCL 3E6HA 4XH2A 4LRIA 4PJCA 1YYLH 2NCMA 4OKDA 5D7IE 3MXWH 4Z7WA 4Q2ZA 1E6OH 5F1NB 4E9LA 3IJHA 5I73C 4MJID 3U46A 2ORBH 3X3GL 4XB8A 4XCEB 4HF5H 3SKJH 5BMFL 5C0EB 3L3DB 2K1MA 3QHTC 2XWTB 3U30B 1C7TA 4FG6D 5JO5B 4KHXH 1AI1H 2C1OA 3PG2A 3EDDA 3L95A 5C7XL 3HS0A 2R9HD 4LEOB 2VQ1A 4PB9L 4EDXB 2QHRH 4P5TA 2JJTC 4PY8I 4LASH 2X4NB 3QQ4B 4WW2F 5J3HC 3PE9A 3VXMD 5LVEA 3LEYL 4OTXH 3QRFM 1BVLB 1YY8B 1ZT4A 4KQ4H 3L3JB 4MHHG 1GZPA 1DEEA 1IGYA 4U2YA 4ZTPL 1T3FB 1RZKC 3CUPB 4U6HB 3WS6C 4MNQD 4CVXB 4LCCA 4PRNB 1RJLA 1I3UA 3S97C 1EEUA 5C0AB 5D7LB 5J6HA 1FVEA 3DUHA 3HCVB 3T0WA 3CXDH 3IRZA 3MRPA 2CUMA 1KENH 2YRLA 2XN9A 3QG7L 4K9EL 4RWYH 3BP7A 1JGLL 3H3PH 3D18A 4J2XA 1S7VA 4PP1D 4K7PL 5D6DC 4JAMB 4P2RB 2YD5A 2X1XR 5GSRB 4CN6A 5H37G 4U3HA 2IBGA 4K23L 1FCCA 4OFPA 3VI3E 1WFNA 1F3JB 3SGKC 2CK0H 4PJXF 5IGXL 3ORJA 2ADIA 1YYML 4QF1B 2EDFA 5EBLB 3RJDA 4OCWL 1AR1C 1FHGA 2NR6C 2VWEE 4A6YB 2P47B 1NFDA 4CW1B 3JWNC 4JFEE 2AKRA 4JFHE 3MQIA 1CGSH 1MY7A 3RIAK 2X1OA 1FGVL 4RFOH 4NPYA 3ZDYE 1AD0B 2CDFA 3RWJA 3MA7A 4Y5YC 5HGBB 4UT6H 1F6AB 4JKLA 1QBLL 1J1XH 1LQSR 3BGAA 3C09B 4N8PA 2OP4L 3HZVA 4OZHE 3UZEA 5GGVH 3HZMB 5F1OB 4GRLD 3GMPB 3LSOA 4Y7MA 1CL7L 5JLZA 2ICES 4X6CF 4LCWA 2A2QT 3QPQC 3QUMH 2VNCA 2W9DL 5C8JB 1BQHG 3D85B 3KPRE 5CGYD 3Q1SL 4CN1A 4NDMA 1PZ5B 3KPPB 1CLZL 5FXCH 4PRAB 4GRWF 4GRWH 2DN7A 1U6AH 4HUUA 3E3QC 1R3JB 4JY4B 3VGAB 4MA7H 1K3ZA 3WFDH 1MCFA 1T2QH 1BX2B 4RFNB 2J12B 1VFMA 4LVHB 4GKNA 3GMQA 4HZLA 4P2QB 5EIIA 3H3KA 3AROA 4P2YA 1UJTA 3NIGE 4XHJC 5SV4A 3RU8L 4EJ1C 5DD0H 1CFBA 4WI7A 5F7HA 2X1WL 3MLSL 4D3CH 3GK8H 4P2QD 3ROLB 1RMFL 1JYNA 3T2OA 1J88A 1GOGA 5TDOB 1RSFA 4OLUH 1AXSB 3V5DB 3KPRA 5ETUB 1NGYB 1ZLSL 2COQA 5LJYH 3CDFA 4M5ZH 4MXWH 2NR6D 3LQAH 4ZQKB 4NO3A 1ORSB 2FX7H 2JJSA 3GSQB 1F13A 1QKZL 1BD2D 1DSFH 2N4IA 5FUOL 4K3HA 4TNWF 12E8L 2Y07H 3P11L 4F7TB 1LMKA 5DJ6A 4JZOB 3VFRA 3HMXH 3U7AA 3BYTA 4ODBD 4YUEL 4HIIA 1S7XA 3FOMB 4TVPL 4U1KB 4JG1H 1JWMA 4P2RD 2I9LA 4JKPL 25C8L 2GSGB 3B83A 3GMNB 5CJOL 3R8BB 4HPOH 1KELL 4HUVB 1BM3L 1EJOH 1J8KA 2B7DT 2O5ZH 1NCTA 4KMTL 3WHE0 1LILA 2DJ4A 2DBLH 3ULUL 1MCJA 1T1YA 4X7SH 3WFDL 4YBQD 3TNMA 2AK1H 5FKPB 2HTLD 5JW4R 1QSFB 1N7MH 4IRJB 3IDJB 4ALAL 1FFNB 5HGGS 4WHYH 3RWIA 1NUGA 3QNXA 1B3JA 4GW1A 5B38G 4OBSA 5IMMA 3MCKA 3BHBB 1IT9H 2JJWA 4MCZA 3PQYA 5HPMB 5J3HD 1P69B 3G6AA 3WD5L 5DD0L 3BISA 3GMRB 4QGTA 3VGBA 3JVGA 43CAB 2J88H 2A83B 2A9NH 3IFLL 3UMTA 2V7HB 3O4LD 1NDMB 5E7FA 1N6QL 3E6FA 1VGKB 2YMXH 4Y1AA 3STZA 3T65A 2YN3A 1W72L 5DVMA 1UM4H 4KI1A 4J3XA 1U8JB 3EDJA 4QRUA 5CZVH 2GITB 2OR8A 1WC7A 5TH2B 3PGFH 5IR1A 3FZUD 3MJ8B 4XC3H 1CDCA 4NC2B 2R69H 3QDJE 2EIZA 1ZA6A 1ZTXL 4NM8H 3PIQB 4HK0A 5F3BB 1Q9OB 4Z7VE 2FB4L 4N8VB 3GSQA 3U7YL 3MV8D 5C2BL 1RIVH 5GSVB 3UZQA 3DV6B 2AAVA 4IOSD 2PYED 5GRJL 3M8OL 4OM1H 4O2CA 3SE3A 2D03L 4H25A 1F4YL 3AS3A 3VFOB 5J8OA 1LEKB 4YDLC 3CGTA 2BFVH 2I5YH 3CDCA 3VI4E 4ALAH 3SE4C 4HAGA 2AJUL 3GHEH 2VLKB 5KANI 1F2XK 3FOLB 3L3OB 4Q6IA 4HH9B 4NWTH 3EJZD 3L95B 1T89A 5KW9L 3G08A 3K2UH 1IC4H 5DYOB 4ZUTB 2R2BA 3V6BR 5JMRA 4BFEA 4LFHG 2MCPL 5H8DA 1OAUH 4G6FB 3HMWH 4PS4H 2CMRH 4IJ3B 4M4RA 5KG9A 5KZCD 1X5ZA 3HC3H 2J8UB 1BVLA 3DVNB 3MGOA 3V6FB 1EH9A 4NWUL 4E5XA 4TOYL 3NCMA 4PGCB 4ZXBC 2UUDH 4HUWA 4DCQB 4K3DH 4OF8A 3U36B 4L4TE 1NC2B 3EJZC 3H9HA 1SBSL 3GI9L 3RPIA 3ARVA 5GISL 2BVUA 3FFCB 2CIKA 3T65B 1FFOB 4FQLH 1U8IB 3QWRD 4KROC 1RZKL 5F7LB 5J12C 4C56B 5F88B 4FRWA 5HYSG 4P3DA 2X44D 5HHMB 1T03L 3UZVB 1BQLL 2W65B 3FFCD 1RHFA 4TUOA 1T7VA 3EFDH 4QHLB 5FKAA 5JIPA 4QXTA 5F7EL 5C0BB 32C2B 3W0WE 3CX5J 1ZHKB 3JTTA 4O9HH 4M1DH 2HJKB 1DVFB 2F8XC 4Q9RH 4L3CA 2A6JA 2FBOJ 1XGQA 3L3IA 4MD0A 4UT7H 1D5MB 1NAMH 3OKMA 3QEHA 5T33L 4UTAL 4EDWL 4EIZC 4Q97A 3DV6A 5FB8B 4KZDL 1JI1A 2NW3B 2W0FA 3N1MC 4PRBB 4S1QL 2ED9A 4YHZL 1QLFB 4YDKH 1BBJB 1G7LB 1KC5H 1R5IB 4ELMB 5HPOA 4BQCA 3KPSA 4KDVA 4AK1A 3MLWH 3C8KB 3V4VL 1EHXA 4U1HA 5IVOA 1JGLH 3U6RA 4GKZA 1U2HA 1FFPB 3GBLA 3HE6B 3MJ9L 4DQOL 4MSWA 1W0VB 5SWZE 1P1ZA 3RNQA 2BCKB 1FL5B 3UBXB 4OD3L 3QEUA 5L7XL 5I2IA 1TTFA 2VZTA 4MA8L 4NYLB 4U4BA 1JF5A 3WFEH 3U9PL 3G08B 1ZHLB 2HT4D 1D9KD 3FQRA 3WO4C 1BQHB 2J4WH 1W8NA 1HH9B 4JFZH 1KN2L 4N8VG 4FFVC 3ULUH 4OFVA 2YPLD 1YMHB 3K4DA 3NZHH 1UACH 1TIUA 4S1DC 2YK1H 5A2IH 3QEGL 1FNAA 2DQJH 4PPTA 4P3CH 3OXRB 5E8DL 4B41A 2X4SB 3BKYL 4XNZC 4ZOCA 3UTTD 3RU8H 2XPGB 3HB3D 5MENA 2A73A 1A1MB 4OGYH 1KLUB 3ECBA 1INQB 2V7NB 3GBMH 2Z93B 1OAYH 4UOW0 3FO0L 5DJ8B 2CKBL 3R1GH 1HH6B 2Q86B 1IAIM 3WNKA 1U95A 2W9DH 2YD4A 4Y4HA 4YBQC 4UTAH 1C1EH 3GUTA 5GGVY 1FRGH 4H0GA 4ZUSA 2VLLB 1K3IA 1H3PL 1UZ8B 1U92A 3A67H 4NQSA 2R0KL 4BQBA 1KENL 3BZ4A 3DTXA 3D69B 4FXLA 1I7TB 2HJKA 5ICYA 1V3JA 3MYJA 3ARZA 5EUKA 2A77L 3QO1A 3QFJA 5C0CD 1DL7H 1QFWH 2UWEB 2XICA 3NH7L 4HDIA 2HVKA 4M6AA 5EC1B 1DBJH 2Q6WA 1RULH 2Q8BH 1IVLA 3EO0B 4K94L 1CR9L 1HQRB 3Q5YA 4D9LL 5DJXB 3BPLC 1D5ZB 1ORQB 4ESKA 5C2BH 3QIBC 4OD2A 5J1AB 1NAKH 4RAVA 2CPCA 3RNQB 3UBXA 1DQTA 5D7KE 1NGWA 5IVXF 2G9HA 4MA1C 2J3SA 3OZ9H 4U6YA 5IBTH 2DQGL 3IFOA 2L7JA 3DYMA 1YNLH 1N0XL 4GW4A 5TE6L 2DQFA 1AO7B 2YK1L 3QHZL 2JELH 3G9AB 3IDJA 1MELA 1F3DJ 4NRYB 5CFHA 2QQKL 2W60B 5BXFB 3GBML 3WDHA 1CQKA 3ZYIA 2B4CC 5IKCA 3P11H 4QT5B 3GJFH 2DQEH 3ZHLA 1RZFH 2X41A 5BZDA 1WIUA 3INUL 3GSNH 1ZEAL 4NQDB 4F58L 1KLUA 2YD2A 3ECBB 3RGHA 1OP3H 1HNFA 1QRNE 3PWVA 1JHKH 5IF0B 4FQPA 3PDGA 2QQNL 1KJ2A 4LCYA 1RIHH 4PG2A 4S1RH 5GS0D 4WO4A 2AEPH 1UWXK 4L4VD 4X0KA 1VENA 4RIRA 1RVFH 4M6MH 3W0WD 1FL3A 1BP3B 1R5VB 4RX4A 1ACYH 4RMWA 4WIQA 1HKLL 3D0VA 4MNGA 4QCIB 4OZFH 4N0YL 4PJ8B 1L7TH 5T3XH 4PV9A 4QXUL 3V0AC 5CP7B 1UYWH 3K4AA 1R5WB 2F8VA 2ZG2A 1F4YH 3GSXB 5AWNH 2XZQL 1KSRA 1D6VL 1VB9A 4WEUD 4UT9H 3UYOD 1J5OH 2H32B 2NY1D 3SDCA 4C83A 4DKEH 2KQMA 2VIRB 4YX2L 4KKLC 4FQIL 4E41E 5IWLA 1WK0A 4APQA 1RUAL 4F8QA 5E0QA 2X4UB 3ETBF 5FUZH 4LP4A 1U3HB 4TTDD 4U1NB 4W6XB 1V7NL 1A6ZA 3OGCB 1QFWI 5GGQL 5DGRA 1JRHL 4HUUB 5IW6B 5CSBA 3F8UB 4WFGD 1MFCL 1PZUB 2BNRE 4YUEH 4LSPH 3PGCB 4KJQD 3ZTNH 3MFGB 2EDTA 5GZNC 3VA6A 2E7MA 4PGJA 3ULUF 2D9CA 3MLTA 4UUJB 1FL6A 1WBXB 3I02A 3MOBH 4E42A 1X7QA 3ALXA 3QUYD 4JM2C 5DD6B 3VFUB 3CMOL 2OK0H 1A6TB 4P2RA 4LCWD 3RTQB 2BY2A 3MNWA 4LQFL 2BSSA 3GSVB 4I4WB 4YHNA 4WUUB 2VDPL 5EO9B 1FC1A 4X8XA 4JRXA 2YRZA 3ARQA 2J88L 4M6OL 1D9KC 3K2UL 5KOMC 3BMVA 2D3VA 2ZOLA 3MLZH 1Y6NR 2J5LC 2QSQA 1YQVL 4C57C 4WW2B 4KJQC 2A9ML 3MRRB 5HGDB 3CFJA 4LRIC 3DTXB 3RWGA 1FP5A 4U6VL 5HYJB 3ULVL 1I9IH 4Q2ZB 2KH2B 3DX9A 3LKQA 3MLWL 5H2BA 4GXUN 3C5JB 5BRZE 2BY3A 4DAGL 2DKMA 2Q6WB 4O58H 4HWBL 1UFUA 3G6DL 2EDQA 1KPRA 2YEZA 4R96B 2GAZB 3DBXA 2VUOA 2VAJA 4L4TB 2PYFA 1FYTD 5F71A 2FDBP 4NHUA 5E4EB 1T4KB 5EUOE 3BHBA 4BH7B 1Z0NA 2J1KA 1KPUB 3U2SB 3DGGA 1A4JA 2NZ9D 1FH5H 3PV6A 4F7MA 4MNHA 1YY8A 5DJCB 3L3JA 5F7DB 3MV8A 4NQVA 2A6KB 4S2SA 2O5XH 1T7YA 1RJCA 2AXGB 5EOTA 1WEJH 5DA4A 2JK5B 5DJ2A 5J06A 5HI5C 2UZYB 4M4PA 1P9MC 3B9AA 3JV0A 4DUVA 4OLVL 1B4RA 1QRND 4X6CE 3W9EB 4HXBH 4L1DA 4X6EA 1WZ1H 5IM7B 4M43H 4K3EH 3ULUE 5ESVA 2CD0A 4WDIA 4LQ1A 5I1AB 3GDBA 5I1IH 3W5NA 1X6LA 3S88H 3PHOA 1DLFL 1PSKL 5D5MB 2IG2L 5D7IB 5IF0A 2YA1A 3T4YB 1CFNA 4UIKL 4RGNE 5CBEA 4J3SA 4JM2D 4XP5H 2R0KH 2CR6A 2QSTA 3V5HB 3O8XA 4HKBA 2ZJSL 3CU1A 5SX5H 2O5ZL 2Z8RA 5B3NA 1KYOJ 1UEMA 3SGDH 4G6JH 1BZ9B 3FT4A 3MRRA 4OCNC 3OKEB 2YPLB 3OPZL 3TYFA 2AGJH 5E9DB 3DGCR 4PJ9A 5K9KB 5FO9B 5DQJA 2M2DA 4UT6L 3WJLA 2IH1A 1NQBA 4LVHC 1A5FL 5IVNA 2VXTL 4M1GH 1KPRB 4MNQB 5GRUL 1JL8A 4AL8H 2VXSH 2EEDA 2QV2A 1MH5A 4UDUB 2C1OB 3C08H 1U9KA 2FJFB 3HZKB 1WEJL 1T4KA 1C1EL 3AUVA 5I75B 1CG9A 1HOCA 3TO4A 2B1HL 4K94C 4PRAA 1I8KB 1F8TH 1Z9OA 2H2SC 2P8PB 1TQCB 2XY2A 1IFHH 5C0RH 2BY0A 4BJLA 4I77H 3OKDB 4XPBH 2HLFD 5EOTB 3ELAT 4UB0H 1RZFL 4X6DE 1FDLH 1ZTXH 5ID1B 3MX0A 3NCFB 2J7LA 4U3CA 5D7JC 2EE3A 5I1DB 2QR0A 2VZSA 4UTBL 2O5YL 2IPUK 5HHVH 4N0RA 3W9DB 3E2HB 3OHXB 3K7UA 5D2NC 5DWUH 3K2MC 2V17L 3WNOA 1DQJA 4KPHH 3DJ9A 3D9AL 3OAUL 3UTPD 3V5DA 3UYRL 4D9QD 3AXLB 5GHWL 3OZ9L 2FECL 1SY6A 4NNPH 4JO3H 4U1SA 1KPVB 3FQXA 5D93C 1OTSD 4F15B 3DOSA 1AXIB 4PBVC 3QXDB 4YDJA 5C2UB 2A0LD 4G6FD 5KS9E 1XF2A 1ADQL 1J8HA 2MNUA 4RMTA 3CVIH 3WEXB 2F54E 2YPLA 4IMKA 1LO0H 2AKRB 3IJSB 4GRMB 5E9DA 1C12B 2GJ6B 1Q0YL 4JFPA 4JPWH 2VLKD 3VFOA 4WUKL 5DF0A 4EQ2A 1DQDL 3X12A 5LAXA 5EU6B 3D39A 3BPLB 3BJ91 4YNYB 4F58H 4EN3D 3PJSB 1U8MB 4ZUUA 4NYLA 1T83A 3D25B 2V5YA 3KLSA 3NCJH 1R24A 1I8LA 1P6AB 1XT5A 4CNIB 4FS0A 1HINL 5SWSE 5HI5D 3MRCA 4HKXA 4NT6B 4WCYL 3TN0B 1OP3K 3L3DA 2ZCLL 3OXSA 4JFED 4URTB 1WCQA 4M93C 4KJYA 1WICA 4R2GC 5I74C 3ZT6A 1IT9L 4Z7VF 3CVHA 5GS2H 5DEZA 3I6LD 3IRPX 2EDLA 2HT3C 5IB3B 4GLRH 4Y4KC 4P5TB 4X6BB 3ARBC 1VEOA 1XGPB 4JPKL 1BAFH 2HFFA 2WLYA 2A83A 2VXUH 2YXMA 4FTVD 4X7TB 2AQ3A 1L9MA 4J3VA 3OJDB 2GSIA 1OGAB 1X7QB 4WWKD 3DUUA 3QNYA 3AY4C 3O41B 4YHZH 1FVDA 4ENEC 2EKSB 2APFA 3K46A 2VXVH 4P3DB 4HJJH 3EYQC 4PRPB 1OAQH 4XNQB 4YHMH 1AJ7H 4E0RA 4HUXB 2XA3A 4ZUWA 3V6ZA 4ONFL 2GY7B 3OG6B 4HBCL 4ZNEA 1LK2A 4HQQL 4XC3L 4WFGE 2CDEB 5EUKB 2HH0H 3OF6A 2Y5TB 4I3GA 3HRZB 5DRWB 4GRWB 4ODVH 1I3VA 2HJFA 1V3LA 3EYFB 3MJGX 4LLUA 2WANA 4D9RE 3QDJB 1EFXB 4LLQA 1RFDH 3LN4A 4JKWA 5A2LH 2BRQA 3WNLA 4AJ0A 3ARSA 1UKSA 5KBNC 1AC6A 2R1WA 4I2XA 3ARBA 4N90E 4ELMA 3O4OB 2DQDH 3DXAE 4YIQA 5ALBL 3RWGB 4MJ5B 2BMKB 1DN0B 5JO5A 1GH7A 3C6LD 1JGUL 1MREH 4GKZB 4JGUA 3KLHD 1TVDA 1JZ3A 1LP9B 2GK2A 1AI1L 4PRID 1HDMA 4P23B 1NBYB 4ODTL 3FOLA 3L3OA 8FABB 3VXTB 4QTIL 5E95B 5JIIA 2VDKH 4O2FA 1LO4L 3PWPD 4RGNC 1LO5A 3BD3A 1SHMA 4XNMA 5CIPH 5IG7B 3H42L 4Q9CA 2VSCA 2C3VA 4BSVB 5GRZA 5I16B 1S9KC 4GS7C 4BH7A 3SO3C 1IGFL 4X7SL 4PJIF 3KPTA 2D31B 5FFLA 1OW0C 1RUQL 3CVHB 4WVRA 1RIUH 3MNZB 4FFWD 1FZMB 1P2CA 1YA5A 1KTKE 4Z8FH 4X9HA 4G6KH 1J18A 3SDDC 5B3JF 4UNVA 1NC2A 4K3DL 2BSTB 2EDNA 4XPHL 1XF3B 2MJWA 5DSCA 3UTSA 1MCSA 5GSRA 4X6DF 3GGWB 3OR6B 5IBUB 2V7NA 2VLME 4LKXB 2C3GA 2IALB 1UT9A 5JUEL 4HUNB 5EZIL 2Q8BL 4YO0B 5ESVB 4PD4J 1RV6X 1ZA3A 4HIEB 1T03H 2O26U 3BI9X 4IDJL 1J0ZA 1O7SA 4ZUSB 3NPSC 1G9NL 5JHDE 4R4BA 5EZJB 3T09A 2EDBA 3MRKA 1EJOL 4M8QB 1AH1A 2EE2A 4GMSH 4UT7L 1S7RB 2J6EL 2AEIT 3A0OA 3ILQD 3PV7A 5CJQH 1YNTA 4XC1H 4WNQB 5BO1H 3BX7C 2EH8L 1BGXL 4QHMB 4LBEB 2FJGB 4JRYD 4PP2A 4YQXH 5F9OL 3ES6B 4PJBB 1FFPA 3HE6A 3PNWB 1RHHA 1G0DA 1KJ3L 2CDGB 1MRDH 2NYYC 5D2LA 1MWAH 2JCCA 4P5KA 4RISH 3INUH 4LARH 2QLVB 2D0HA 4XH2B 1RIUL 1ZHLA 3ULVH 5T3ZL 5BW7C 5FYJH 3QDGA 3PGCA 3MO1A 3H6JA 3K8LA 3UXFA 1S7XB 3FOMA 2RFXB 3S37H 3MOAH 1ZHNB 3CJJA 1GGBH 2FZ3B 1N6VA 2YUXA 3DMMA 1E28A 4YBLC 4EI5B 1QR1B 4HX1B 4TPRH 3VGAC 4OV5A 3OPZH 1T0NB 4IRZL 1SEQL 1S9XB 3S6CA 1CFQA 2VAAA 2OMBA 3J7HA 4WEBH 4AIZA 3TESA 1T0PB 5K9OB 2NY1C 4JFFE 2CK0L 4MZ2A 2VZ1A 1YQ2A 1G9NH 3F7VA 3VE0A 5FYLD 3WXWH 1OAXL 2NY1B 2XPGA 1I85A 3BN3B 3H3BC 4PRIA 1E4WH 3BW9A 3QDGE 4WHYG 4LCCB 4KPHL 4CADB 5I1CH 4Y4FA 1T22B 2GTWA 1LO2L 2EDEA 5DC4B 3P9WB 3VJ6A 3QH3A 2D4DA 1XFPA 4OIIH 3THMH 3RDTD 4M5ZL 5IFHH 3WLBA 4PRDA 5JXEA 1JPSL 2GT9A 4IRSD 2EYRA 3BSZH 3GM8A 4JFOA 4KTYA 3TA3B 2XWBA 5D1ZA 3BRGC 3E1F1 2LTQB 1QQDA 4W4OA 1WBYB 1KXTB 5DK2A 5DD3L 3HI6L 2F53D 5SWQA 5K9JL 1VCAA 2ZKHH 1CFVL 1I1AB 3CAFA 4KRPB 1M7IB 5IJVA 4MDJA 3KYAA 5FOBA 1AFVH 3EYSH 1IRAY 1F4XH 3LCYA 1XGRB 4UQ3A 1FORH 4NO5B 2AS5M 4HULB 4JG0H 4Q6YA 5EULV 4DKFH 1AGEA 4F7EA 5CP3A 5I19H 2ADFH 5KTEL 1FIGL 2GY5A 4PRPE 1T5XA 1H3TA 1FJ1B 3G6AB 1P5UA 3VFSA 4LQFH 3OX8B 3DX8A 2DQFB 3SE8H 2C3VB 1AO7A 1FGNL 1I3GH 1CBVL 5I0ZA 2QBWA 4HLJA 1NDGA 1RU9H 3P4OA 3H8NA 1CDJA 3QO0A 1K8DA 1KJ2L 1CGXA 3MLTB 1CE6B 4IIQA 3HNTL 2DQEL 4EKXA 5E4IA 2AP2A 2Z4QB 5I8KL 1KT2A 3EJJX 5DC9B 2V2WA 3VWKA 2XYCA 4LOUD 4PJEE 3GEWB 4WHCA 1Q9LB 4DGIH 4N5UA 2R4SL 2EIZB 1SQ2N 4JFQB 4XMPH 12E8H 5ICZB 1OD9A 2OMNA 4NBYB 1GGYA 2WM0A 2Y72A 3QI9D 1MI5B 1XH3A 2WIIA 3D48R 1AGFB 1QSFD 3WLBB 5L9DH 4TULH 4P9MH 3OKOB 1HI6A 1ZS8B 4A2LA 1XCQB 3IYLW 3MLUH 1L9NA 4YHLL 4PJ8C 2CXKA 3W11C 3MCKB 3V8OA 3WFHB 2CO6B 4OQ1A 2EYTB 1S9YB 1XIWD 1CGSL 4W81A 4OT1L 3GMRA 3TNNA 5ITFB 3KS0J 4ZAKB 2E8YA 5C0DA 3RVUC 3TBWA 3LQMA 4JANB 4XCYA 3HUJE 2ATKA 4ZS6C 3KPQA 4YXLL 3O3BB 3IETB 5FHBL 4PUBL 3DO7B 5E6IA 5L8LB 4N1EA 3C5SB 4LKCA 4P46C 1Z5LB 5IW6A 5GGQH 5GGSA 2R23A 5C0GA 4PBXA 5FGSA 2H6PB 1BWMA 3FT3B 5KANG 3LS5H 2R0ZL 5ADPH 3QWQB 5EG6C 4BZ2H 1Y0LB 2OXGA 2IMMA 3MRMA 2OQJB 4NO2A 4X4ZA 2F53A 3N1FC 4ZPTA 1P2CB 3MOQA 4KDTA 5CP3H 4RRPG 2OR9L 1ULVA 4GW5A 1X4YA 3MXVL 4PJIE 3SDYH 1ERNA 2H9GA 2Z4QA 1QTYT 1S3KH 1FAIH 4WDIB 2GTZA 4JM2B 4M62L 5DSCB 4N0FA 1XIWB 4UAOB 3U9UB 3ROLA 4RMUA 2Y7QA 3O6FB 3KG5A 4QYOA 3EOAA 1EEZB 2HRPL 1UXSB 4X8JA 5GS0L 3IDXH 4Y4FC 4HIEA 3QEQD 5KSAC 4N1HB 1A6UH 4Y4FB 3P0VH 2Y23A 4JPKH 5AG8A 1H15B 2RB8A 3IB4A 4FFWC 3KLAA 5DVLA 4HWBA 4K3JL 3TP4A 4OM0H 3BT2L 1YY9D 4AENB 4FQ2H 2FGWL 1W8OA 1ITBB 3KPSB 4IMKC 1W2KT 1ETZB 4WTXA 1G9NC 3QQNA 3WUWA 1DFBL 4XPTH 1B0GA 5C0RL 4UIMA 1B0WA 4G43B 1PKOA 1B6UA 1HXMA 3R0MA 4G7YH 3NFNA 1P7QA 4U1LA 5FUOH 1GOFA 4GH7B 4K7PH 2P5WE 2YEZB 4LMQE 4FQCH 1MJ8L 3QEUB 2G2RB 3MYJB 5MENE 3CZJA 3H9HB 5KZCB 4J3TA 2MCG1 1EDQA 4X98A 3GO1L 2ARJQ 3BXNB 3MGTA 1CXHA 1K9TA 3SQOH 4NGHL 4S0TD 5HI3C 1U8KA 1HCVA 2KPNA 3GBNH 1OARH 2NY4B 1VEPA 4K07A 4TVPD 1D5IH 5I8CA 5M7QA 1T1WB 3OAZK 3LEXB 5D1QA 1PG7L 1J8HD 3B3IA 1B2WH 5KTEH 1FIGH 1EX0A 4KUZL 2Z91B 2DLHA 1JMXA 2V2TA 2VLKA 1F4AA 1IQDB 3GMOA 3LV3B 5FYJE 1ACZA 4P3CL 2HN7B 2PNDA 2XXCB 5C0IA 4OFKA 4P49A 3T8XB 3TPUB 4DGVL 4P59L 4AIZB 1QLEL 1KB5A 6CGTA 2VLJA 2WUCH 1MCWW 1NFDF 1BOYA 5KG9B 4RSVA 3RAJH 1BF2A 4YBHA 3TH4T 2WBJC 2BOCA 5D1XA 5IB5B 2IBZX 3LKOB 3FONB 4LNVA 3FO1A 1UB5B 3Q1SH 4WI4A 2YHGA 4MB3A 3U36A 4OFDA 1JPSH 5FYLE 1JVKA 3FQTB 1EO7A 2UWEA 3IT8D 3MACL 4HDIB 4CJ1A 3B43A 1UA6L 5F6IC 4M6OH 1NANI 2DM7A 1IZJA 4BZYA 2R69L 4JDVB 1XGTA 3ARFB 2AGJL 2GJ6A 2BXYA 3EDKA 5IVXE 1YNKH 5KSAA 1BIIA 3FQWA 1QRKA 4HMCA 4QF1A 2VDOH 1U8LA 1SYSA 2ITDB 3QIWC 3C09C 2H8PA 2E7HA 4G8EA 3VXMA 4Q58C 3SN6N 3LQAC 3ZE0E 5C0ND 4RWYL 3S96B 5EOQL 3IXAB 3NIDE 1DBML 4L4TA 3GSOB 1UG9A 4TUJB 3QBTB 3L7FB 3NBNA 2NY5C 2Z93A 3PP3K 4M6NH 1WQVT 3RQ3A 4JKMA 3LH2H 4OIIL 3HAEH 4M8VA 3I2CL 5DHVB 4WHTA 1BHGA 5F7NC 4PUBH 4AIOA 4Z5RB 2VDRH 3TBYB 2EYSA 4P9HL 1WITA 3O2DH 1AR2A 2XWJA 4P4KD 2Z8SA 2KDGA 5T1MB 3EZ8A 5DJDB 3ZTJH 3OR6A 2LVEA 4YWGH 4LDLB 1OGTA 1NL0L 5KSBF 3CMGA 1SY6L 4R4FH 3KGRA 3TPUA 4P0DA 1JNLH 3VMOA 1MIEH 4LSVL 2EDYA 3WCYA 4XBPB 4KV5E 3T0EB 2BOBB 1VERA 2VLRB 1P84K 3KPSE 1FG9C 3NABH 5LWYH 2PETA 2PYEB 5D1XB 5D8JH 1ADQA 2IAMD 5T1KA 3NFPB 1E4JA 4IBLT 4NKDB 4E42B 4NQEB 4XRCB 1CQYA 4GUPB 5D70H 4ZFFB 5F1IA 1NCNA 3WHXB 5L88H 4MWFA 1A1MA 1R5WA 4QXWA 3VA2C 3IDXL 1IC7L 4PRBA 3UJTH 3QQ3A 3IAQA 2H2SD 1T3FA 3CUPA 4U6HA 3PUCA 2BSRA 1MCOH 1JF1A 3TYGH 5J13B 3DUSB 1Q0YH 1IAII 2D7QA 2MPAH 3I6KB 3S34H 2VE6A 2APVA 4YDVB 3FB5A 4UAOC 4NUGL 2XTJC 4PJBF 3O9WD 4FA8A 2BNUB 4LLDB 4GG8B 3D6GA 4G8GE 3WLWC 3RHWF 5MI0C 5JW5A 4LLVA 2W9LA 2C3HA 5ISZB 3Q6GH 4UQ2B 1JZ7A 4H26A 1Z0MA 3E6HB 3UPRB 3PWVB 1RUKL 4YK4B 3AM8C 5CKAA 4BFGA 1M1SA 4OLWH 5F1NA 4M03A 3AC0A 4LLYA 3O8XC 3VDBA 1YDPB 1EHLL 4LLAA 2NTFA 5HHOA 5IEKA 1I8KA 1WLHA 1I9RL 1U41A 1QEWA 1HHJA 1AE6H 1YN6A 3C5ZC 2ZUSA 3TEUA 3RUGB 1JGVL 5TFSL 1BX2A 2PR4H 2Z91A 3WS6A 4X7TA 2FD6L 1MFDH 3FHQA 3MROB 3BW9B 2HFFB 3PL6D 1U3HD 3U1SL 4MCZB 4KHXL 1IGYB 4PYHA 5SWSD 4WUUA 5EO9A 2BOBA 5IROA 5I1EL 1AD9A 4JQXA 3P4MB 3RWEB 1FVEB 2Y7QB 3O6FA 2XXMB 4G9FA 1JPGB 3LS4H 4F2MB 3MLVL 3MUGA 4X8JB 3EYOB 1AR1D 3B2VH 3HAEB 3U30C 1J0HA 4N9OB 3MRJA 5DQ9B 4I3SL 3V2AR 4W6YB 3V79C 3RTQC 5TDNA 4Y2DB 5T5FH 3RPKA 1FNEB 2VO5A 1OY3B 3O3AA 3QDJA 1FG2A 1FRGL 4HC1H 1I8LC 4O02H 1XF2B 3WNMA 2DQUL 4XP6L 1WV7T 3L9RA 3F7PC 3LB6D 1EFXA 4LLQB 3ZE1F 1VKXA 5BCAA 3KPNB 5F72S 3DROB 4YDLB 4MNGE 1G0XA 4Y5XC 4ZO9A 5KSVA 2RAMA 1JNJA 4LCCC 1A1NB 4I9WE 2VJXA 3QUZB 5C08A 3QA3B 5CINL 4IOFC 1ZV5A 4L4VA 4X5LA 2DM4A 2A6IB 2MKWA 4C4KT 1Z3GH 3VXTA 2ZG1A 4RNRA 1LWRA 3O4LA 5IOPA 1QSFA 1HWHB 2DTMH 4YFLF 5DMIL 1SEBA 1QBAA 4PRHE 3O6LH 1SJXA 4IRSB 3C2SA 5D1QB 1CZ8H 5CAYB 3B4NA 5IHBA 1KCUH 3CK0H 1XCTB 1ZXQA 4LGRB 1CG9B 1HHGB 3KPOA 2QQKH 1BOGA 3L6FA 5CBAA 2EXYD 2BXZA 1MIML 2GFBB 2JB6B 1E4XH 3RAJL 1MJJB 4P99A 4NRXB 4XMKH 1FZOB 2OZ4L 1YY9C 3MRIB 4ZAKD 3WIHH 3E8UL 4LEXH 5J9PA 2KQNA 4HLZG 4NQCE 3S35L 2DJUA 4XBPA 4MA8H 3MPCA 3GKZA 5F7MC 1JV5A 2FHCA 4M7JH 4MD5B 5GJTH 4KK9C 2DQUH 3GSRB 5C92A 2ZG3A 3Q3GA 4JFEA 2IADB 5I1LA 5F1SA 3QCTH 4JB9H 1RPQA 5FK9B 5TQ2H 1K5NA 4MYWB 4ZYKB 3TYFB 4QRSA 4Y19E 4ODXB 2XTJD 1AHWA 3TT3L 2A74A 2YD8A 3ILPA 4QOKD 4PTTA 4Y4KA 1XR8A 1YNKL 3V4PH 5FKAB 2VXQL 4QRPD 3QQ3B 4UNTA 3FQXB 1N4XH 5L2KA 2CGRL 1DQQB 1KTLA 1VPOL 4XI5D 1SBSH 3GI9H 4HIJA 5FDWB 5B8CC 2XN9E 2D4FA 4DK6A 1X5IA 4YDVA 3NCYP 1DBKL 4K3JH 4G42A 4OCYH 5FYKH 4F7EB 1FQ9C 4HC1A 1LO3H 4N9GB 1T20A 4JFDB 1DFBH 3PWUA 4XPTL 1HSAB 4P46D 4H88H 3VMNA 3UPAA 4PJXA 1JIBA 1Y0LA 4R8WL 5JR1L 3HI5L 1YECH 3OJ2C 4UBDC 1LEGA 4K7PY 1J0IA 2J8UA 1DANT 1GGTA 4ZS6D 4MAYA 2MQ0A 5J13C 3PF2A 4Q9QH 2DI8A 4MJ6B 4RGMC 1PG7W 3AU1B 1BZ9A 1AGDA 4CU7A 1BOGB 3L6FB 4JO4L 4TRPH 4D9RD 3GSWB 1CWVA 4JG1L 1FN4B 5A16A 3S35X 3MXWL 4XGZB 2H1PH 1NKRA 4JFHD 4WTWA 2Z8WC 3MODL 1QA9A 1FSKB 4M5YL 3JXAA 3DRTB 5J11C 4OB5L 2DL2A 4U7SA 4AMKH 3MV8B 3GJFB 5CEZE 1G0YR 2SEBB 2XY1A 4PLKD 3VJ6B 43CAA 5D7JD 5M95B 1MCDA 5D70L 4BA8A 3TO2B 1EGJL 4EUPB 2FNBA 4PJHA 4H8WC 4N90D 1A7QL 4CVZA 3BZEA 3SGEH 3WIIL 3CFJB 3I9GL 2ICEB 2FO1A 5LGJA 5HYIA 1JPST 4NZUL 4M7ZB 1NGXB 3MRNA 4P9HH 1MF2H 3VG0H 1U95B 4P2CG 1P7KA 2OL3H 5EUOB 1U3ZA 4ZD3H 1BLNA 2FATH 4YEEA 1EEQA 4J4PA 1PKQB 3GJFK 1FAKT 4N5EC 1W72H 1O7VA 1Q1JL 5FM8A 4CBPA 5EB9A 4MDJB 3OWEA 4Y2OA 1YMMD 1A3LH 3WIFB 4AH2B 3MR9A 5C0JA 4CVWA 3L5JA 2DLTA 1HIMH 4KZEH 1T5XB 4NP4L 3QUZA 5C08B 2FL5A 1DN2A 3QZWA 4NNXB 4MAUH 1FE8L 3REWA 1ZLVK 2PKDA 3RWHA 1FO0H 2IQAA 2Y6SD 2OM5A 3DVGA 5E8PB 5EIQA 1CD1B 3OR7B 2R4RH 2CR3A 2W92A 2N56A 2J8OA 5GS3A 1EBAA 5IMLA 8FABA 2HN7A 4QXUH 4UV4L 5EOQH 5TFSH 1DVFA 1T2XA 1VFOA 4L3CB 1TJGH 3TN0C 4LCIL 3LDBC 3QO0B 4GRLA 4BSVA 5L2KE 2ARWA 1CU4H 4TPRL 3SKUD 3GFUA 2IJ0C 3V7AG 4MQ7B 3Q48A 4MMXC 3KXFB 1LVEA 1WFOA 5CJXA 1MHCB 3Q6FA 1QBBA 1OOAA 4OQTH 1RZJH 1J7VR 1PW3A 4FN0A 2V2WB 1UH2A 3IDYC 5E2TL 1BIHA 1ADQH 3LIZH 1A7RL 4YDIL 5DEGB 5DRWA 5HYSA 4N68A 5CWSB 5FM4A 5BV7H 1NMAL 5F89B 1HN1A 1WUNT 4MNQE 4DUWA 3C6SB 1MRDL 4JHWL 4MS8C 4YHPA 3PP3H 2AQ2A 4NQCA 3TVMB 3TCLB 1RK0A 2NY7L 5ICYB 4U7MA 4M7JL 4P2OA 5DMJB 2NZ9C 2BNRB 3HPJB 4XWOD 2FBJH 1T5WA 1KIQB 1X3DA 3N85H 3D3VD 2HFGH 3FAWA 5D2LF 5T3XE 3EKCA 5MEND 4JN2B 4PP1C 1R5VA 2B1AL 2R8SH 5F7UA 1JMZA 2DBJA 4ZFOB 3SDXE 1GGIH 4X6CB 2UV3A 4LVOB 4K71C 4OZFG 3EZJB 1LO5B 3VFGL 3T3PE 2R4RL 2UYLB 3TBWB 1MCLA 1AXTH 5D5ME 1RJYB 2UZIL 1QR4A 3QNYB 3T04D 1S7WA 1T80A 4RX4D 3O4LE 3RDTA 4LHUA 1AQDB 5C0FB 4JY5H 4ZTPH 2DQHL 4UINL 3C5SA 4OUUB 5D1ZD 4JLRA 1Q9KA 1S9WA 5I1JH 1X5GA 2R9HC 5HYEA 4XMLH 1E0OB 3OG4B 4S1DD 1AKJA 2GJ6D 5HHNA 1CS6A 1FNLA 1TXKA 3Q6GL 1OAQL 1NGPL 4LLUB 1A7RH 2IALA 3U48A 3MRCB 4HKXB 5BV7L 1KFAH 5D7SL 4OLWL 1S9VA 5BRZB 1S7VB 5F70A 4UT9L 1IGMH 2E27H 2GTZB 5E2UH 1AY1L 3ULUC 3MV9D 3QDMD 4OD2B 3LKOA 5GXBB 2FIKB 4PJAE 4ERSH 4HG4K 1TMCB 4LCWE 4X4MA 4NQXB 3QJFA 3OXRA 3B9KC 3TWCH 5C07B 3ZKMC 2R4SH 4PV8A 5GZND 3IFOB 4YHPB 1NCDH 3FN9A 4HPYL 4GSDL 4LPYA 2UY6A 1RD6A 2VXQH 4WUUE 1NPUA 1VACA 4IIQC 1INDH 3NMEA 4GMTH 5E2WH 2VR4A 1S9YA 5GGRY 3DSNA 4ZOBA 2A1WL 4KI5F 4Q0XH 3BQUD 4H5SB 2BZDA 4KHTL 1NANH 3QRGH 1KIRA 4WO4D 5ITFA 3NZ8A 2EC9U 1L0QA 5BS0B 1OTTC 5I1JL 4L3EB 5H2BB 2PF6A 5CJBA 2FZ3A 3H9SE 1DQML 5T3ZH 1QSFE 5A1AA 1U3HC 5IMOB 4QEGA 2JF1A 3B9KA 1CDGA 5KW9H 4M61B 5IVZA 3J8F7 2WW8A 3VFWB 1OF2A 3RWCA 2WWMC 3PDOB 2WBJA 2CRYA 3L5XL 3ARTA 2IAMC 4J7RA 5CEYB 1WZLA 3C60A 4WFHD 3DUUB 4NZTL 1NFIB 5AZ2H 1AGDB 5GRJH 2P24B 3KWWB 4QHMA 2YC1B 1XF4A 1KV3A 3GK8L 2OR9H 4I0PB 2XZAH 3GZKA 5EBGA 1E4WL 4IRJA 4N0FB 3SCMB 3NFPA 4XBEH 3RGVB 5E6ID 3HTLX 5I1KH 2OS7A 2YSSA 1FO0A 3PWNA 1X6NA 2ENYA 2LAGB 4PY8J 2OL3B 1FNSH 4KY1L 5DEGA 4WV1B 3BP4B 2R29H 3MLXL 1UJ3A 4R9HA 5I6XB 4YDIH 3HNSH 3MJ7B 1VGKA 1A4KA 4YHYC 4YIQB 3HMXL 1GC1L 1IGTA 2VRAA 2ZPKL 3VDAA 5D9SA 4DZ8B 1TJHL 2VB5A 4F7CB 2LQRA 2MTPA 4FQ2L 1NEZG 5IV2B 1HXMB 3QWRA 3BZDA 3D87B 4RGOH 4H1LB 1A0QL 4JN2A 3PWJA 3OV6A 1OPGL 1FZJA 1HDMB 4L4VB 1G7PA 2NY3C 1BFVH 1ZS8A 4TTDC 3RVTC 2DQIH 2DI9A 4BELD 5J57B 4JPIB 5DMYA 2DWDA 1IEAA 4LPTA 1DCLA 5E6ZA 1I8MB 3ULVD 3SKNB 2D7PA 2XNAB 3S4SB 3GSOA 1BD2B 5C0JB 3V4PL 1ZVSA 3K1DA 2FL5B 2YXFA 3RL2A 1S7WB 1BQLH 4MS8D 4GKSB 2GHWB 2G75A 3SE8L 3GNMH 4R97C 2O61A 2PO6C 3VFPB 5J89A 3LRSA 2Y06L 1NCUA 2E7LC 2NY3D 4B53A 5F7DA 3FQUA 3TA3D 5T1MA 4U3XA 4BH8A 4QRPA 3V52H 4N5ED 3WV0A 1JN6A 3LHPL 4Z76B 1YEEH 4HK3J 1B6DA 3TZVA 2X4OA 2X4TB 3QULB 3RFZC 5I30H 4K71B 5IVXA 1JHLH 3T0EA 2GJ6E 3QEQE 1YUHB 2RFXA 1CXIA 1P5VA 2R29L 2DLFL 3MLXH 1S9VB 2Z8VC 1LNUB 1OAYL 2GAZA 3DBXB 5KOVC 5TH2A 5CGYC 1CFQB 3RVWD 3D18B 3TVMC 4DN3H 1M7DA 3TC9A 5F3HB 1HE7A 1NH6A 5BVJB 4HV8B 1CE1H 3ZZ1A 2G5BA 3QYCA 5AYUL 4PJ7A 5AEAA 3FMGH 3V6OA 2IGFH 1I9JL 2WMPA 4ORZC 4HWEH 2E7BA 4J3UA 2E7LA 4POZD 1RK0B 1DUZB 1EZVY 3LZFH 3WDIA 1DUYA 5FUCC 1H3GA 3ARFA 1KPVA 4QY8A 4GKOA 4ZO6A 1MAML 3CMOH 1LEKA 4PREB 3RNKB 2NNAA 1OW0A 2W65A 3VCLB 4EBQH 1HHHA 4LMQI 4S10A 4GBXB 3U0PA 2VH5H 3RWJB 1WT5C 2Z9TA 43C9B 3F6IA 4EEEA 3WDJA 5E2TH 3FT2A 1LP9F 4Q6IB 1N59A 4U1MA 2FJFA 4L8SC 1YMMB 4A6YL 4FQXD 4HAFA 4TYUA 4PJ5B 3OB0H 1T66C 3WMSA 3HZYB 3IJHB 3D2UB 3IFNH 4JM4L 3UYRH 3WIHL 3WO3B 3QFJD 4NO2B 5ECJE 4XB7A 4WTZA 4WHTB 5D2NE 3VXOB 3IJYB 4KJPC 3VXSD 3G5YB 3U4EB 4LEOA 4EDXA 5KSAD 4G80B 3O6ML 4X7CC 2P43B 1K85A 1NGZA 2VERN 4P4KC 2P5WA 3EDEA 4PJXE 3BPNC 4ZUVB 5AZEL 1CN4A 5JHDA 3MROA 2WWKT 3CZFB 1EJ6A 4MQXD 3LEXA 3LKPB 2X9YA 3U46B 1XGYH 2XTLA 3P73A 1XZ0A 4WEBL 4YR6A 3WBDA 2D7OA 5AAMA 2DM3A 2JK5A 2ATPA 1PDKA 2HKHH 4NQDE 4JANA 5F7EH 4CMMB 5L2JA 1DBAH 1YMHA 4HJ0D 4UOJA 2X4RA 4U1SB 4NKMA 4GAJL 5D1ZB 3UBXI 1BVKA 5TE6H 5FYLH 3TFKD 3FB6A 2P8PA 4YDKL 1ZGLA 4ETQA 1LK3H 1BD2E 3VW3H 3RIFF 1NGPH 4Z95H 2X4QA 1U3JA 4YE4H 1K4DA 2PO6B 4GRWE 5E6YA 3EYFA 4OV6F 3P3YA 4OF0A 5ID1A 4CJ0A 3BESR 5AUMB 5FDYA 4OD3H 4M93B 1H8NA 3LN4B 3S34L 4BFBD 5T1KD 1YEHL 1A64A 3NFSH 1A6WL 4FXKA 4DGYL 4U6XA 4L29B 2BMKA 4DEPB 5HGHB 5KN5B 4XXDA 3F7QA 2AJSL 5FGRA 3MGAA 5DI8A 3FO2A 1Z9SA 2ERJB 4U1GB 4K3GA 4F7PB 3IU3A 1RUKH 4G6JL 2ICCA 1E4KA 3RX7A 4I48A 1NLDH 1MH5B 4Z7NE 3U4EA 4NJ9H 1IE5A 1P4IL 2QADB 4QXGH 1Q94A 1FGNH 1NBQA 5CEXB 2EDKA 1JK8A 3BGFB 4B50A 1YYMH 3O9WA 4OLZL 5LCVH 1FZOA 4R4NC 2DQHH 2WQRA 4TNVF 4UINH 1HXYB 3V5KA 1SJHB 2BX5A 1BFOA 5BOZG 2OSLA 2CLVB 2X89A 1IEBB 3GMPA 4I0PA 5IBLD 1WWCA 4G9DA 3PHSA 4LHQB 1CD9B 2PXYC 1XF3A 3MRMB 4K8RD 4KY1H 3VXPB 1LE9B 4GKNB 4EUPA 4HD9A 5FM5M 3TCLA 3E0GA 4EZMA 1FO0B 5DK3A 1HZHH 2B2XH 3MBEA 1CK0H 3HRZA 4GFTB 3QUMB 4PTTB 4L5FH 1JZ8A 3QQ9C 3QUYA 4WWKB 1DQLH 1BFTA 4JY6A 1PLGH 1YMME 3LPWA 1MRFL 5E03A 2HTLC 3TVMD 5ETUA 5EA0L 1JFQL 5CD3B 1EMTH 2NY6B 1NAKL 5SWSA 3SGEI 2QJDA 4HG4J 1A14L 5MEPB 1WWBX 2GCYB 4KVCL 4CDHA 1DR9A 2C7UB 4QWWC 3G6DH 4GAFB 1R3HB 4HS8H 3ALPA 4H25B 4ZFGL 4D8PB 1JWSB 2V6HA 2DIBA 2G9HB 1TCRB 3LH2L 4PJBA 1CDHA 1AD0A 2CDFB 5FHBH 3V6ZB 4G7VH 2DQCH 3LOWA 3LY6A 2E9IA 1RUPH 1T1ZB 4KKCD 4XPFH 5IHUL 5SX4H 1NMAH 1ZHBA 3QRGL 4W4OC 2L0DA 5BW7A 3EO1B 5IESL 5JZ7C 4XHQA 4NOFA 2KUTA 2ZWLT 5LGHH 4CNIA 3HKFA 1A6AA 1CXLA 1NCAL 4L3AA 1BECA 3QI9C 5DURD 1CICD 3HLAA 5IT2L 4GBXC 1IAKA 2JJUA 1S7SA 5TGBA 1MHCA 3Q6FB 4OCXH 5T5NG 5JPMB 4NUJA 1C16A 4LGSB 3SPVB 3EOTL 1QKZH 1MIMH 1IEBA 2AERT 5FAAA 3W2DL 1VFAB 3LPFA 1KJ3H 2ESVB 3QIUB 2P5EA 2XA8L 3U83A 5HDQH 3VFGH 3QSKB 2XRAH 3MBXL 4HCRL 4AENA 3NTCL 1Q0XL 2HKHL 1NCWH 1U8OB 1VFBA 5DRZA 5HYJE 2YPVH 4OFYD 2G60L 1JPTH 4PJEA 4JFXB 3ILPB 1Z2KA 1PKQA 3BPOB 3TT3H 1WCBA 2BNQA 4FZ8L 2VXUL 1BLNB 1F11A 1MCIA 3BOVA 3MRLA 3QPQD 2JLLA 2R2EA 2AXFB 1NBVL 2CKBB 4QWWD 1KCRH 1KGCD 1BREA 4X4YA 1GJIA 4Q7DA 1FLRL 2EDJA 3QXAB 2DLFH 1PFCA 4XPFL 5IHUH 4KQ4L 2JCCB 3ESUF 4MA3A 2NTFB 3VGDA 1GHFH 1TCRA 1NUDA 4S1SL 2Z31B 1GL4B 4DN3L 4HS3A 1EHLH 5C0CB 5JXAL 1ZT1A 5IQ7L 3SQOL 4G8EB 1OD7A 1QLRA 5IMLB 3FO2B 3NOIA 5D2LE 5SX5K 4YXHH 2AEWA 4QO1A 1MI5E 4GUPA 4G3YL 1H3XA 1BJ1H 5I18H 4PJDA 3VWJA 4WHDA 4LPCA 2YBRA 3IJYA 3O45A 3CH1B 3S36L 2NPLX 4GG6E 3JV4B 5DUBA 3AU1A 1KB5B 4QRRE 2YUZA 3SDXF 2ZUYA 4MCYB 3ZLQC 2BSRB 2YA2A 2IANA 1IC5L 5EWIH 3VE0B 2OJZH 3OKNA 3QUKA 5D5MF 5L6YH 3QUXD 1A5FH 3I75A 4EOWH 2ZNWA 4ZXBA 3T1FB 1TZGH 2DB8A 1DDHA 5DJCA 5EU7C 1BFOB 1NFKA 2F19L 4NKIL 4P46A 3TBTA 4ZS7H 3C6SA 4PJDE 2XKNA 5E8NA 1XF5A 4YXKH 4I18A 1WWAX 4LCUA 4ZUTA 1IM9D 2GKIA 5CIPB 5DTFB 3BUYB 1U8OA 2EH8H 3VW3L 1J10A 3KR3H 2QADC 1U8JA 5GGTH 1MCKA 1D9KB 4OZGB 4K55A 4E5XB 1RZGB 2RQ8A 3G04B 3UTSE 1LGVA 5E1AA 4FXGA 5DHXB 3MXVH 1H3UA 4TSAL 3MJ8A 3SDYL 3QXUA 3JV6A 3LD8C 4FNLL 4XRCA 2DWDB 3JTTB 5DC0A 1G7JA 4I1NB 4R96A 5DJYA 1ES0B 1SYVA 4KQ3L 3WFZA 3F7VB 3SDAB 1RUAH 4AH2A 5FUCE 2D7TL 5FB8A 1PQZA 1HQRA 2B8OT 2DICA 1PKQE 3A67L 1QZ1A 4TUKH 4NQED 3LN5A 3PP4L 3X3FH 1C5BH 4Y89A 1SEBB 2P44B 3KXFD 4MHHI 4KZEL 2A38A 4GMSL 2H41A 3KDMA 4KK8C 3MRFA 1JN6B 3MV01 2I25N 5IJKA 2EDRA 3FQNB 3P2TA 1X5YA 3SJVA 4D9LH 2CH8A 1JUFB 3MRHA 2IPUG 2ICWB 1TZGL 3RI5F 4WI5A 4NZUH 4KWUA 4PRPD 4L8BB 1OAKL 3MRIA 3ARGA 4JRXE 1F2QA 4ELME 4I2XE 4LVNB 4DUXA 2VLRA 4Z9KB 2VQTA 3B5GA 5HDOA 1YNLL 3BH8A 1UKQA 3ZMRA 4WEMB 4PGCA 2AJUH 1MCEA 4HGKC 2F74A 4HK3N 1RZ8A 4X99B 1CLYL 3KJ6H 2EE9A 1WZKA 4UU9A 3MLRL 2RHEA 3DETC 4X7EC 3WKMH 3F12A 1NCBH 3ABZA 4JJ5B 5EU6E 4HQQH 5AYQA 1OAZH 1I8IB 4DQOH 1FVCB 3BKJL 4G8FB 1FNGA 1VGEL 5FV1L 4YEFA 1ZEAH 2BNRA 5BV7B 1MFNA 3P4MA 4LFHD 3SGKA 3EOYG 5E94B 3P4OB 3OB8A 1IC7H 3X13A 5IV2A 1Z3GL 5DK0A 1N64L 1QLEH 2P8LA 4GG8A 1U92B 3ULVE 2RCSL 5GISH 1GCFA 3RKPA 4XX1G 3UJJL 2V9RA 4Y2DA 5BS0A 4FFYH 3MFFB 1G9ML 1I8MA 6FABH 4QHKI 1LO3L 1E4XI 1XEDA 1R5IA 3VXUE 3TT1L 4F37F 7FABL 2VXVL 3LKRB 4C59B 5H37H 1MJUH 2VDKL 3EO0A 1MQKL 5DZLA 3BMWA 2G75B 1IZKA 3BSZL 3BPCB 4ZDHB 1UYWL 3HE6C 3M1BA 2B2XL 1E4XL 4OUUA 5GPRA 4O9HL 3ARBD 3OKYA 1TVHA 3ZYOA 3D69A 4JQIH 3TBVB 4G8GB 4KJPD 4QRSB 5JW4M 4KDTC 5EO1A 3BD4A 4FQIH 4XBGB 5CEYA 1XCQA 2MHAB 2ICWJ 1I9RH 1XZ0B 1FYTA 5FHAL 1QBLH 4RZCB 2FSEB 5CHNA 4NN6B 1U93B 2DBLL 4NN6C 4ODSL 1A3RL 2R0LH 1C16B 2P42B 3SDCC 3SPVA 4Z6AT 5GS1B 1HCFX 5TQ0H 4U6TA 2ATKB 3HMXA 4NJ9L 2X4SA 4ORGA 3ZTNL 4ZSOB 2BY1A 1FNEA 1S7QA 5DFWH 4GW4B 5CMAA 3DO7A 1UM5H 3LQZB 3ARDD 4G8GD 1DE4A 4ZFZB 1J87A 4WU5A 1A4KB 1OCWH 2H6PA 1KN2H 1MWAA 4KAQH 2NW2B 1GAFL 1BZ7B 1CICC 3UTSD 5CWSA 4YPJA 2Q76B 4YWGL 4FFYL 4D9QE 4W70A 1CICB 3MNVA 2X40A 4TSBH 1U8QA 1LDSA 5E99L 3RVUD 4Z8FL 1BJMA 4N1CA 3L5WA 2ZP0T 4GBXA 3U0PB 3FO9A 3O81A 4CGTA 1A3LL 5EBMB 1JE6A 3OAYH 5J1TC 3WN5A 5GZOC 2Y25A 3KYKL 1G6RL 3B8YA 4JGMA 3CH8A 4YC2C 5C0AE 4E41B 1OAUL 1TJIH 1CD1A 3OR7A 5DJYB 1CIUA 1MNUL 3O4LB 1DQLL 4LSSH 1QA9B 5IOPB 5HDQL 4X0KB 4I2XB 5IP4A 2ADIB 3QIBB 3CX2A 4XWGH 4PJFE 4NQEE 2FX7L 5DHVH 1AIFB 1GZQA 2JKXA 1ED3A 4K9EH 1YN7A 4FQQB 3TBVA 2FLRT 1X5XA 4J6RH 4U49A 2HJLB 4XTRC 3V52L 3A6CH 4NPYB 3BO8B 1Q9WB 4N8CL 2EECA 1HXYA 3BZFA 5FYLL 4MXVF 3VXRE 4K94H 4O2FB 5GGSB 1YUHA 5SX4I 1B0GB 2FSEA 4G9DB 3P4LA 2EKSA 5BS0D 5GZOD 3MA9L 5T3XL 4V2CB 4NC1E 1TNMA 3I75B 3V0WH 1IC1A 5JIHA 4QHUA 4KJWD 1PBYA 1DBMH 1OLZA 4FMKA 4WFFD 3D9AH 1DTUA 4PLOB 4DKEL 1WISA 4ZTOL 3CDGB 1A7OH 3SOBH 1PZ5A 1IILE 4AY0A 3RA7L 1WC7B 3VRJB 1KC5L 2JJTA 2WBJD 4OCXL 4OGZA 1HEZB 2Q1EA 3CD4A 4Z18A 4M1CC 2VDQH 3KLDA 3B3IB 4PGBA 5BQ7B 1YEGH 2AVGA 2FD6H 3KPRB 3UTTB 1MJ8H 5F3BA 1KXVC 5CZKA 4FTVB 3VRIA 3LKSB 4F33A 3GJEA 5EZLB 1Q8MA 3PWJB 3WIHA 1P4IH 3JUYA 4HXAH 5L6YL 3QG6B 4DKDC 4V1DA 3EHBD 2IH1B 5DZNA 4MNGB 3G6JA 5B22A 1U2CA 4GW1B 2Q87A 3T2NH 4PJ5A 4J3WA 1BD2A 2ZUVA 4XCNA 2OTUB 1TFHA 3MREA 2E6QA 1J12A 3MBED 5I66A 4O51B 4XNXL 4BZ1L 4NN7C 3RVVD 4M3JA 4H26B 2FO4A 2HKFH 4HUVA 1KLGB 3VFPA 1ED3B 3EAKA 1REIA 2N7BA 3NCBB 2LAAA 4PIRF 2BSED 3VXRD 4XPHH 2VDPH 3IKCA 3BP6A 3TVMA 1FBIL 4WRLA 3V4VH 5HJ3B 5EN2A 1Q9WA 3W0WA 1TZHB 3FO0H 5DZOA 1GHFL 3LKPA 4UOW1 5F6HI 2ARJB 4YJZL 3PV6B 1J86A 3MRBA 1XGYL 1CFVH 3ZSTA 5FCUH 2BP3A 3MMEB 3QDGB 1Q72L 4ZTOH 3EBAA 4KQ3H 1OSZB 3CFDA 4XVJH 3RUGE 4N0CD 5ALCL 4PLNC 4HK0B 1G6VK 2F74B 4HX1A 4OV5B 4NSKA 3TWCL 4JFZL 1C5CH 3L7FA 4HBCH 1A6TA 4HMEA 3RL1A 1GGIL 3HPLA 4JFXA 4MQTB 2YWZA 4AG4H 4Z0BL 4XCCH 4GXVH 4Y1AD 2VDOL 2O5YH 5AYUH 1DE4B 3HN3A 4ZFZA 1AXTL 4LRNL 2J2ZA 5L0QB 5JHLL 3FO1B 3NACL 3NZ8B 3OSKA 3RBSA 4ZQKA 4YHYB 5TDNB 5HVHB 2PUQT 5J56B 3LRGA 1JGVH 1QFHA 5DJDA 1RI8A 5D7LE 5IESH 1SM3H 3PNWA 4OCLC 5EOCJ 1UQSA 3NA9L 1JTOA 1RHHB 2D7MA 2ZOLB 4PGDB 4GRMA 4ZXBD 4LEXL 4PJBE 5GSVA 4X4XA 1K6QL 3JWDL 4ZAKC 1JHLL 4O2CB 3I2CH 2DLIA 3D1MC 5HVWA 1MLBB 4BQ9A 1QUNA 1AGCB 3LEVH 4JFYA 1EO8L 1U8MA 4ZUUB 4JQVC 2OTPA 3H42H 1MLCA 1G6RH 4MXQD 3CCHB 2ZSWA 5F7FA 3L1OL 1CL7I 2V9TA 1O5DT 5DR5H 4NQXA 2MFNA 3ZSSA 4GAYA 4FABH 1RUMH 5HDLA 1KEGL 1YN6B 1VGEH 4M7KH 3IKCB 2AEQH 1N4XL 3PABB 1IM3A 3RL2B 1S7SB 5D4QA 1N8ZB 3GMLB 3QEQB 3T4AA 5HHQA 2ORBL 5BMFH 1PY9A 4ENED 3QDJD 3ZTJG 3SDDD 2DMKA 1MUJB 1XF5B 3RGVC 5BOPA 5DJAB 2V7HA 3SE3C 2A6DA 3VFMA 5ISZA 1INQA 1TTUA 4PG9B 3MUGB 2DD8L 3BUYA 1LHZA 2GYSA 3N9GH 3O41A 3W9DA 3CVHL 4WV1C 4ZSOA 3MSPA 1NGQL 2A1WH 4Q0XL 1JWUA 3D85D 2ZUQB 1NJ9A 3C8HA 4GAJH 3UO1L 2H26B 1RJZB 1QRNA 3UDWC 1U8NB 4WFEE 3F7YB 3BIKA 3CK0L 2L7UA 1ES0A 3LQAL 5DVKA 1GIGH 5FUZL 1ZANH 3ALWA 4PJ7B 1UH4A 4Y5VC 2NZIA 3SKNA 4YHML 3H7LA 1ZVSB 5LWYL 3L3KA 4XPBL 1TJIL 2NXZC 1VDGA 3L1OH 3KJ4B 1ONQA 5F6IB 4LSSL 2Z31A 1JTTA 1OGAD 5D6CA 1QD0A 1B88A 3RVXD 4Z7WB 4AEIL 3KS0H 1ZT1B 4OLYH 4N0YH 2IEPA 3OX8A 1I1AD 3QIWB 4L8SB 1G7HA