1PLCA

Accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accuracy and precision in protein structure analysis: restrained least-squares refinement of the structure of poplar plastocyanin at 1.33 A resolution.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1992-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plcA00
3QJRB 1AG0A 2JKWA 2WO2B 4DP7X 2PPCA 2YAFA 4L0PB 3SBRA 3WIAA 1GR7A 5AKRA 5I6LA 3OMIB 3ABKB 3FSVA 1BQKA 3EH3B 3FQ1A 3UACA 5D4JA 5I6NA 3NJGA 1TEFA 2XV2A 3IN0A 1UATA 4YSDA 4A2FA 1KCWA 3IBOA 3V9CA 2VMJA 5B1KA 3ZIYA 1AS6A 1L9RA 3C75A 2H47C 1GYCA 2BP8B 2RACA 1L9OA 2BW5A 1BQ5A 1MZYA 2GSMB 5D4IA 1IBYA 1BXVA 4EF3A 1AG6A 1HFUA 1PCSA 3ABGA 1XB3A 3UADA 1PAZA 3PAZA 3H4HA 1GS7A 2E86A 2OV0A 4F2FA 1J9RA 3NJKA 4GP5B 4A2EA 1NWPA 1SFHA 2DWTA 5TK4A 3NJMA 3X1GA 2FT6A 3KW8A 1OCZB 2UXVA 3N55A 3CZUB 4JHVA 4NERA 4AZUA 2QDVA 2X88A 3SBQA 2EIKB 1MZZA 4A67A 2FQEA 2XYBA 2ZOOA 2FQFA 4DP6X 2HLEB 4FA7B 1OE3A 2IDUA 1NIAA 2IDSA 1WA1X 1PNDA 4UAHA 3NJFA 1OCCB 5B7EA 1HAUA 3NSDA 1JXFA 4E9SA 1ILUA 2PP8A 3NSYA 1A3ZA 2XXGA 2AFNA 2YAMA 2XU9A 1MG2C 5E9NA 4BWTA 5I5MA 1SF3A 4HHWA 3SBPA 3X1NA 3T6ZA 1JZEA 5D4HA 5A7EA 5B1BB 4HHGA 3BQVA 4KNUA 3QJQB 2CBPA 4Q8BA 3RYMA 3AG2B 2BP0A 2XUWA 3TU6A 4DPCX 3G5WA 3NP3A 4G72B 4KO5A 3CVCA 2YQBA 4N8UA 9PCYA 3X1BA 3MX0B 4KO6A 4YSUA 4G70B 2B08A 4ENZA 1A4AA 1FA4A 4AKQA 1JXGA 2FNWA 2IH8A 2AVFA 4QKTA 4BWWA 3OMAB 1R1CA 2YAEA 3OQRA 4BWUA 1GY2A 1OE2A 2FTAA 1W8EA 1BEXA 1BYPA 4GY4A 5LDUA 3FU9A 1AQ8A 1AR1B 2FT7A 1NTDA 3WI9A 1WS8A 1E30A 4M3HA 2J5WA 4YL4A 2YXVA 1NZRA 3QJSB 1A65A 3ASNB 5I5JA 3EH4B 4A68A 5I5IA 3UABA 1NIBA 3D12B 6PCYA 3T6XA 4GP8B 4YSAA 2AZUA 2BWIA 2HZHA 2I7OA 4HALA 3ZBMA 2R7EA 1GSKA 3FQYA 4E9YA 3WG7B 1N68A 2J56A 1PLCA 1JZGA 1PLBA 3UGEA 3H56A 3OMNB 1CUOA 1ET7A 1TKWA 4G7RB 1V54B 3CVBA 4KOBA 3ERXA 1A8ZA 3PCYA 1M57B 3S3DB 1E5YA 2XXFA 4WKXA 4A2DA 3ASOB 1PLAA 1AOZA 3ABMB 1J9SA 1L9TA 1FFTB 2Y69B 7PCYA 3ABLB 5ANHA 2ZONA 1PZCA 3NT0A 4FAAB 4F2EA 1QHQA 1SNRA 3NJIA 1PF3A 2R7EB 4DP8X 3NSCA 1J5CA 3HEIB 3DKHA 4ZK8A 4YSPA 1ADWA 4HIPA 5B3SB 3SQRA 1A4BA 2BP0B 1ETJA 1L9SA 4HCFA 3TA4D 2CCWA 1ASQA 1MG3C 1AAJA 1NDTA 3DTUB 2OCCB 1PZBA 2GHZA 3NJNA 2CAKA 1AZCA 3EH5B 1W6WA 1X9UA 2ZXWB 2NRDA 4Q89A 4KNTA 2FT8A 1JXDA 1SDDA 7PAZA 5B1AB 4AX3A 2DYRB 2Q9OA 1KV7A 1CURA 1NPJA 4TXVB 1KCBA 2W8CA 3FSAA 3FYIB 1I53A 1TU2A 3FSZA 1OOWA 1RZQA 1XB6A 2ZWNA 2UXTA 1AZUA 5F7AA 5I28A 1IC0A 1V10A 4K9JA 2BHFA 4CSZA 3FU7B 1URIA 4HZ1A 1GW0A 2IAAC 3ZDWA 4AKOA 2DYSB 1AS8A 1HAWA 1ZDQA 2XWZA 4GXFA 3FS9A 3NSFA 3GYRA 2P80A 3S8FB 1E65A 1AZNA 2GC4C 4JHUA 2HX9A 1M9WA 2HXAA 3CVDA 1SJMA 3TBBA 3GDCA 4YSTA 1GS8A 1QNIA 2UXFA 1BAWA 3CDZA 3FU7A 1JZHA 3PPSA 4A2HA 3JTBA 4N4YB 4HCIA 1NICA 5B1JA 1PY0A 3NJLA 2WO3B 1SHXA 2HRHA 1ZIBA 2Q5BA 1ILSA 2GIMA 2GC7C 3TASA 1SDDB 3X2QB 3H4FA 1JOIA 2XV3A 2A3TA 3QJUB 2PLTA 3N2JA 4E9RA 2J57A 2I85A 6PAZA 2XX1A 2H5UA 2DY2A 2PP9A 1JZIA 1CC3A 3GXUB 3AY2A 2QPEB 1IBZA 3PLYA 2JXMA 3NJHA 1VLXA 1DYZA 2EIJB 4PAZA 5AZUA 2HX7A 4NAJA 2OJ1A 2QPDB 3NJJA 4YVUA 4KNSA 1KBVA 3FPYA 2BWDA 1ZV2A 1BXUA 1NPNA 4KO7A 4G71B 8PAZA 2X87A 1T5KA 2YAPA 2Y1AA 1NIFA 3DIVA 4X4KA 4E9VA 1BYOA 1XMEB 2CALA 4E9TA 2VM3A 4A66A 1GS6X 3NP4A 1ASOA 1QLEB 3AG1B 5AFAA 4DP4X 1AS7A 1OF0A 4UF7C 2BW4A 1KDJA 2JFCA 1DZ0A 2FQGA 3EF4A 5B1JC 4DP1X 2VW7A 3QJTB 3UAEA 2HRGA 4F7KA 3MBWB 2WSDA 4QLWA 4NB7A 2PCFA 2IWFA 3S3CB 4CSPA 1WAEA 4P5SA 5B7MA 3CDZB 3V9EA 1RZPA 5I6KA 2PPAA 1L9QA 3BVDB 1SF5A 2YXWA 1WA2X 3S3BB 1M56B 1NWOA 3CG8A 3HB3B 2VW4A 2IWEA 3JT2A 4PCYA 1CYXA 1JVOA 1OV8A 3UAAA 2IH9A 1JZJA 4MFHA 4YSRA 3TBCA 1L9PA 1EHKB 3FSWA 4DPAX 1WA0X 2H3XC 4G7SB 1PNCA 4HAKA 5PAZA 1YLBB 3IEAA 3NYKA 1AZBA 2QT6A 3FYEB 4BXVA 4YSQA 3ZX1A 2MTAA 4BDVA 2TSBA 3KW7A 1RCYA 1KDIA 3WNJA 5I6MA 2VN3A 2PPEA 3OM3B 1GY1A 2PCYA 4E9QA 2XV0A 3T71A 4W1TA 1XB8A 2AZAA 2FJSA 2TSAA 4KO9A 4DPBX 2IDTA 3AW5A 4E9WA 1KGYE 2PP7A 2YAOA 3QPKA 2UXGA 2EILB 1MDAA 3QQXA 1KYAA 2EINB 4GYBA 2GI0A 3T6WA 5I6OA 1BQRA 1ET8A 1W6LA 4DP2X 1OCRB 2N0MA 3IE9A 2DV6A 1KBWA 2P80D 1IKOP 3IN2A 3WKQA 4AI7A 1J5DA 3FT0A 1IUZA 2BZ7A 4A2GA 2FWLB 2I7SA 3OD3A 2VSKB 3PAUA 2VM4A 2YARA 3QJVB 2B3IA 3T6VA 2DWSA 2GBAA 4HCGA 1B3IA 1V55B 1PMYA 1J9TA 1PZAA 1OCOB 1TEGA 4P5RA 4BK5C 1RKRA 4BXSV 4YSCA 1ASPA 5I6PA 2XLLA 3X1EA 3S8GB 1AANA 3FU8A 4GP4B 1NIDA 1NIEA 4AKPA 1AACA 1SHWA 1ZPUA 1EZLA 3U25A 4BDVB 2UX7A 1J9QA 1A4CA 4KOCA 3WKPA 1ID2A 2J55A 1ET5A 4E9XA 2CUAA 2VW6A 1X9RA 2IDQA 1AIZA 4W9ZA 2GB2A 1JVLA 4JKNA 5F7BA 3PXLA 5I26A 3L45A 2BP8A 4DP0X 1CYWA 5B7FA 4RH4A 5PCYA 3T9WA 4YSOA 4YSEA 2LLNA 2QDWA 5EHFA 2AANA 2YAHA 4YSSA 2BO0A 1WS7A 2MRYA 1JZFA 2EIMB 5IY5B 1JERA 1E67A 5FC9A 2BZCA 1ZDSA 1SFDA 2UX6A 3AZUA 3EHBB 2XVBA 1BXAA 3AG4B 1F56A 3AG3B 4WTQA 4UANA 1AZRA 4YVNA 2XX0A 3FQ2A 3FPXA 1ZIAA 3WNIA 2CJ3A 2PPFA 1E5ZA 4M4RB 1OE1A 1FWXA 1NINA 2IWKA 2W88A 3PAVA 5TK2A 2IDFA 1N70A 2HX8A 2VSMB 2YAQA 3X1FA 2PPDA 2FQDA 4DP9X 4G7QB 4DP5X
chains in the Genus database with same CATH superfamily
2C7FA 1H3WM 4ZPVA 3C09B 5DHVA 5ABZA 3B7SA 2WO2B 4JREC 2YAFA 4XOBA 4YX2H 4L8SC 1KPRB 4KUZL 1CT8B 3FSVA 4QHKI 3R1GH 3V5DB 1IZJA 1LYQA 1TPXC 4E42A 1INQA 5FW8A 2DBLL 3UACA 1I8KA 1FYTE 4PVBA 4OGXL 2WCPA 4H25A 5L2JB 2P4AB 3SDAA 3AB0C 1AS6A 3MJ6A 4PRPA 1N59A 2GAZB 4KZCA 4P2RB 4UV4L 1LP9B 1JVKA 2X6MA 2DQDH 1ZVHA 4P59H 4Z0BL 1T5WA 1JGLL 2WTRB 2ZG2A 3S2AA 1SBBA 1CDYA 3HC4H 1OTSD 1QRNE 2AI0H 5IT2L 5IBUG 3WIFB 5B3NA 3N1MC 3U9WA 1IBYA 2VR8A 4I85A 4BHUA 4ADJA 4PY8J 3TO4D 3GJFB 4N87A 4MDJB 4BFGA 5ID1A 3HLAB 5IMOB 3WIHA 5DUPL 3BVUA 3WFBH 4FP8H 5CAYB 2FWOB 2NNAA 4FJZA 5CJOL 4DQOL 4FXLA 2OL3H 1RVFL 4FFYL 3VI4A 5DJ0A 3IXAA 1NUDA 1Q94B 3TX4A 1QTYT 5DFTA 5HGHA 2UVFA 2HG5A 2FT6A 5IWLA 3NCEB 2D8KA 3KXFA 2CO4A 2DLIA 3N55A 2HUHA 4M1GH 5DJXB 4X99A 1TJIH 3HBGA 4RBPH 4ONOA 4B9PA 3IK2A 3FSOA 1I3UA 1TJGH 1KXHA 4A67A 1J7VR 3QQ9C 2AQNA 4HCRL 2VDQH 1G7LA 1RJYA 3NABH 4LBEA 2O6DA 1J5HA 4OZIA 2FE0A 4P5TA 1IL1B 1FIGL 4Q7DA 2CJUL 1MJ8H 1TO4A 3MGTA 4AITA 3UEQA 3UGUA 3LNEA 4XXDB 4HPYH 1F1AA 2UWEE 4TLSA 4DN3H 3EJZD 5IVXB 1F6FB 4C8XA 2D7MA 4OAWB 1T03L 1FYTD 4UDUA 5HI3D 1ZANH 2VN6A 4KNUA 2HTLD 2OK0H 2CBPA 3HCVB 1MFEH 1HJBC 1QFUL 2WN2A 5E4EB 1OXYA 4PWIA 4NP9A 5FV1L 3SE3A 3EGXB 2OMVB 5IUSA 1GGCH 1QASA 2VNCA 5C0AA 3W9EB 4KK6C 5E00B 1FP5A 5FA4A 4PS4L 5IJCC 1IIIA 1U4FA 2ICCA 3CSPA 4LLUB 4O2EA 4YR6B 1QI4A 5FYLD 4UTBA 4ZPVB 2X1PA 4G70B 4UT7L 2PABA 3PYCA 1XZ0B 3O2DA 4MMXA 5E6UB 3H53A 4AK1A 2G5BB 2IADB 1YN6B 4PJDE 2VSCA 1KGCE 3OMAB 4YXKL 1NBQA 4PJ6A 1JPTL 3AS2A 5DGQA 4HUVA 3HI1A 2ADIB 2ZOLB 4GAGH 1UXSA 3O2DH 1CE6B 4HH9A 4Z3HA 1W0WB 3QRGL 4KK5C 4GINA 2JELL 4L1HA 3G9VA 4YC2B 5I5JA 5JLZA 1MJJA 1RIUH 2VH5L 1FNEA 3CLFL 1XZ0A 1L0PA 1OAQH 3KGTA 1O7DC 1U6AH 4FQCH 3CFDB 2X6VA 3D08A 2FLBT 4XVUD 3MLZH 3TTSA 1PPIA 3EFOA 3ZIMA 1T0NB 4MXWL 2XQBH 1A7NH 2W60A 1R5IA 4IS6B 3FUHA 1F86A 1N19A 4RDBA 1U30A 5G5DA 4K3EH 2N4IA 1CT8A 1KTKE 3GFUA 4X8JB 3FT3B 1OP5H 1YMME 1HH6A 1YAIA 3BQUA 4KVCH 4HUUB 3KBHE 5E95B 3VGEA 4HOXA 4OZHF 3BAEH 5DHVB 1E5YA 1HILB 2ZCLH 2OMVA 3LRLA 4QHMB 3DYMA 1Q0XL 2QHRH 2ADJA 1TETL 2ZKHL 3ABLB 5TGBA 1FZOB 2LTQB 4MVBC 2CJTA 1TCMA 2H3NA 2Q7YA 5E5RB 4E41D 3WLBB 5ECJE 1PF3A 43C9A 4AMKL 1EGJH 2CUHA 3GMLB 3NSCA 1HIMH 1XT5A 3CC5A 5DUMH 3UAJC 2ICEC 3QAZC 2FBOJ 5BXFB 4PUBL 1MHPL 4XNZC 2WKOA 2DMCA 2OJZH 3TV8A 3Q2CA 5I17A 1VCAA 1BD2D 4JG1L 1MG3C 1AAJA 3DNKA 5GZOA 4N2OA 3LSOA 4H5SB 1JD7A 4KX7A 4WFFD 4XGZA 4CVXB 2WY3B 3QUYC 5EZIH 5EBMA 3SPJA 1IJNA 3M46A 1U8LA 4XTRC 2FT8A 2H32B 3I85A 3TF4A 4LCYA 2K7PA 5GGVH 4GRWH 4D3CH 2DYRB 3WNNA 4H7VA 5J11B 2YOCA 3WNKA 3C6LB 1Z5LA 3V4PH 3DVIA 5GZNC 3M7FB 4RRPM 2TAAA 1IGFL 4CMMA 2KZKA 3ZKXB 1DBAL 1PJ9A 3MRNA 4NN5C 2AERT 3DRTB 4BQ9A 1IC0A 3MV9B 2AJSL 3PJSA 3QDJB 2BHFA 4HEPA 5FDYA 4FL4C 4BFKA 4L8DB 5EU5B 3NPZB 4AKOA 2PCPB 3BSZA 1PS3A 4UZGA 4GXFA 3SEPA 3QPQD 5JYMA 1CFNA 2KDGA 4PG9B 3TF7C 3GYRA 2DQDL 2BNUB 1PD1A 3KEDA 5C08D 1IARB 2GC4C 4UTBL 1NCUA 3QAQA 2F7RA 3AJ7A 4LL1A 4JRYD 4NM8L 1MRFH 3QEQD 4U3SA 1QNIA 1D6VL 2BRQA 5J1AB 3MJ7A 2OMYA 1CDBA 1UH3A 4XP9L 3TP4A 4BM7A 3STLB 5HYQB 1P5UA 2LVEA 1VERA 3KYAA 3SE6A 1EIBA 3DTDA 4GMSL 3V4UL 3HG0A 3KXFD 5IQ7H 1NGPL 1OD9A 3EDJA 2FECL 1MFBL 2Z7WA 2OMZA 2NX5D 5C2BL 3VCLA 2J72A 5C0IA 4MSWB 4E42B 1A25A 1DQKA 1HH9A 4PJHE 3MRQB 4GJTB 4EVNA 3CUPA 1SYSA 1IBBA 4P46B 3WFHB 2YQ2A 3DJRA 3FQ4A 1MAKA 1P9MA 4P3DA 3F6LA 4L3CB 4K5MA 3MRGA 4UM9A 4M56A 3GLDA 4DERA 1M7XA 2NT1A 3KL5A 3LMJH 1DYZA 4WW2B 3AXIA 1BZ7B 2YKKA 4UT7H 3ULVL 5GIRA 1N4XL 3HE6C 4KITB 2EVIA 5F1SA 2Q2EB 3VD0A 2GJZB 1FNSL 1Z0NA 2BSTA 2JB6B 5F1NB 3P3YA 3MKKA 1XF3A 1ZV2A 3C6EA 2X87A 1W8NA 4JM2C 3WKYA 3CZKA 4NUJA 4PJBF 1NIFA 4CVZB 5J13C 1YEFH 4DSYA 2DMGA 4A66A 1SBSH 4FZ8L 5C71A 2GFBA 2R4SL 4Z7OB 4XR8C 5DRNA 1OF0A 4V1DE 3D85A 3WUWB 4LSQL 3AABA 4CC1A 1CVSC 5EEZA 4XP1L 1SEBA 4TVPH 4QRTB 1E90A 3FKUS 5IVZB 1JK9A 5DMGD 4JRYE 4OVUA 4J3OF 5HGDA 2Q6WB 1QBLH 3I9GH 3A6CH 3K5SA 2ICWJ 3QWOA 3WFCH 1YDPB 2CA4A 1N67A 3LEVL 4UQ2A 4PJIB 2A6JA 4ZPTB 5CJ8A 3VVWA 4M7ZC 4LP5A 3GSQB 2X4PA 1RXLA 4JB9H 3KPSA 1CYXA 2W65B 3OAYK 5DYOB 3NN8A 4P2RE 3TT3H 2WBJA 2AGJL 2WZPD 4Y4KB 1YZZA 1FL6A 3GNML 1ZT7B 3HHSB 4Z7VF 2XKNB 2X1QA 5JZ7C 1WA0X 2BK8A 2Q0ZX 3EYFA 3GSWB 2Y9RT 3U48A 4Q9QL 4XPAH 4IRSA 1G1OA 5IOKA 4OCMC 1H5BC 2H1PL 1JCKA 1KMGA 1IGYA 3H42L 2D7PA 3ECQA 3DV4B 4I1NB 1UUSA 3OKKA 3MA9L 3T71A 2X3BA 5DC0A 3MJ9L 1G7QB 1MW3A 3UZQB 5I8OH 1FPTL 4X5RA 1IRAY 5J9PB 2W65A 5DYOA 5DUBB 4GW4A 2QBWA 3DK2A 5HTSA 4MTMA 5KN5A 1N64L 1ZD6A 4O02B 5A2KH 3HVNA 3S0PA 4MS6A 5FLUA 3VVVA 2B16A 5D96B 3OAUL 5DEFA 3WTUA 4Y1AB 1CXLA 1AGEA 2FGWL 3BP5A 4TVPE 3T0XA 5HGDB 4PYGA 2Q6WA 5C0GB 3LYRA 4TLUA 4PW4A 3IN2A 3GEFA 2YBRB 4XNQA 2O6CA 1TLMA 3CHOA 4Q9CA 1XIWA 1RU9H 3RQ3A 3NCBB 1CDUA 3O2VH 3Q5OA 2AABH 2FWLB 4JPKL 4WUUB 2I7SA 4QRTA 4UTAH 5DWPA 5HHOB 1A7PL 1RJZA 2MCPH 2DWSA 2HPTA 2MFNA 1CGUA 3CVHB 3DPBB 3HE7D 4KVNL 4LFHD 1VHPA 4GBXB 4N5ED 1OCOB 4OJFH 4M6ML 5D7IB 1JTOA 3BPCA 5AZEH 3V0EA 2BSSA 3WEOA 1ASPA 3FONB 5E8PA 1MCLA 3VD2A 3ZQWA 1JMXA 2DMBA 4OI8A 2DQUL 3DETC 2KQMA 3W37A 1SHWA 1NCIA 2G5RA 2XT1B 3OWRA 3B9VA 4WI0B 3DVNB 2BIQA 4KUCD 4OCYL 3ORJA 3RGVB 3ARUA 4X6BB 1JJUA 3WKPA 1YMMA 4I9WE 1ECYA 2GABA 1B0IA 1GGBH 4XN5A 2A99A 2HH0H 1CLCA 4PHZA 4YN3A 2R1YA 4JFDA 4XO4A 4ZMQA 3BW9A 2XBDA 3UYPA 4RDQG 5FW6A 2AJYH 1YEIH 5D1QB 1RP9A 4HULB 3ZDZF 3MRQA 4JG0L 1J86A 1YSOA 2K45A 3EZ8A 3I6LE 3MDJA 4HP5A 3ARPA 3VXRB 1ZLWK 3VDAA 1AXTL 3QEQA 2KERA 3FB8A 4LLVB 3OKYA 4QRSB 2AXGB 2XVBA 4RRPA 1DQTA 1G7QA 4WFEE 1TENA 5E4OA 1KBGL 3MV9D 4Y4FC 2ZOKA 2O5XL 1ZIAA 3OF6A 1T2QL 4APQB 5I24A 3HPJB 4LGPB 1P5UB 2OR8A 3IDGB 1S46A 4FQXB 3IB4A 5HGAA 3G7TA 3FDWA 2Q3ZA 1S7TA 1Q90A 4MCZA 3LNFA 2IPTL 3SJVE 3NEXA 3ZGIA 4BUGA 3C6LD 4EDWH 4MA1C 4BA8A 1QFWI 4PRIA 3ABKB 3ZHDA 1SEQL 3FRUA 5EB9A 5H94B 1HWWA 4LLQB 1VENA 4JM4L 3G5ZA 4PJGE 4WI5A 4B41A 3TC9A 2WJ5A 3U1SH 5SV3A 2EDDA 4AUJA 3F5WB 1SN0A 4HAFA 1R3IL 4X4MA 1HX0A 4UIKH 1L9RA 1KN4L 3GSXB 3HNTL 2JKIS 2R2CA 1B9ZA 5K1JA 1EAOA 2PCPA 4JE4B 3CSTA 5KN5B 3QEGL 2LU3A 4X6CE 1KTLA 4IIQC 1OP3K 2D3NA 2NY1D 4MMXC 4ANKA 5A3IC 3W11C 3GBMH 2Z92B 5EN2A 5BOPA 4DGWC 3GI8H 4OIBA 1NGWA 1XCTB 4NPKA 4Z7VB 4WI9A 2ZX7A 1PCSA 4NN6C 2Z8SA 4M9OA 4UQDA 3UADA 5HD8D 1J8SA 5T3ZH 2H32A 4M61B 3CBRA 4M00A 4NO0B 3RJOA 3NCYP 3OAWA 4NP4H 1EDYA 4NO5B 1NM4A 1NJ9A 2AEQH 1QBML 1N3NB 5E0QA 3WN6A 5JORB 4FMVA 3CZUB 4P4RB 2R0WL 4MNHB 1GJIA 5TFSL 3FUJA 3P2TA 1OGAE 3EDEA 4H2CA 4PVNA 2R29L 3AAZA 4XC1H 4XH2A 3GBDA 1EK3A 2BMKA 2H0PA 3RUGF 4E9LA 4ZW3A 1BVNT 3S5LG 3PQYE 1FVCA 2A1WL 4JFHD 2QADD 4H0HB 2AC0A 2A6JB 1UASA 3R1GL 3L3GB 3QR2A 4GS7B 3WEXB 1Y6MR 5K1VA 1S3KL 4LPXA 2PETA 3PNWB 4LE8A 5DGRA 5IK3A 1HEZA 2B9BA 2F18A 5KAQG 2QEJA 1IQWH 1YNTF 1HH6B 1ILUA 3HC3L 3RWGB 1MF2H 1CB4A 4FLQA 1DCEA 4OCXH 4UB0L 4ETQB 3VACA 15C8L 3T2LA 5E9NA 2EUXA 1FVEB 1HT6A 3WUWA 4HHWA 4MYWB 3IDJB 3IFNH 3DO7B 4NFCA 4NKMB 1DQVA 5IWLC 2I26N 1P2CB 3TNMB 4Q8BA 2J73A 4IYKA 4LMQE 2CO2A 5EO0B 1HL8A 3SKJL 5GRWA 5GGRY 2E27H 5BQDA 1CS6A 3BWSA 4P9ML 4PTUA 1A6TB 2W07A 1KGJA 4Y9CA 2ZCZA 4FABH 3GI9L 2NSXA 4HS3B 4XXCC 4HUVB 4NO3A 2PUQT 5MENA 2APFA 3O2WH 4YNYB 5B4MD 1H9DA 1W0WA 2NW2B 2DI9A 5DRWA 1GOFA 4KO6A 4B60A 5I15H 1AQMA 5TH2A 4KJPD 3I2CL 5GIRB 1YY9D 1AHWA 1CGSH 4MJJA 3QCTL 4P3DB 3HE6D 4NZFA 1QFUH 2D7NA 1FZKB 5EC2B 3GMPB 1DQQB 1JZ8A 2D31A 3QJFA 2YAEA 1BA9A 4F7TA 3MLSH 4O4YL 4XWGL 5E00A 4Z3TA 5J7CC 5EIIB 4MAUH 3KYKL 5IESL 2A9NH 3Q2LA 5LJYH 1E30A 4BSWB 3WTYA 3I50L 3MNWB 1NZRA 3E9UA 4GSQA 4LO9A 1MIMH 3FO1A 3WDIA 1RIVL 3HZYB 4BKTC 1A4KA 4HALA 1ZMYA 3MREB 2YGPA 4MA3B 3RY6C 5EEWA 1NGYB 3Q0HA 3VWKD 5EIVA 1OWWA 2R1WB 5I1GH 2WBJD 2XCMC 3GLAA 4KHTL 5J6HA 3CVBA 4KOBA 5LCVL 5IESH 4XNYH 3NK4A 1KJMB 2XXMB 4L4TA 3SPVA 4JFFA 3BKML 3MSPA 5H4ZA 2A7BA 2K3TA 2O5YH 4HHAB 5BS0E 3OZ9H 4GPVA 4ZUVA 3UTSB 3D05A 4LF3A 3FH5A 5TPWH 4FADA 1WWCA 5BUPA 2XFGB 4EXKA 4X4YB 2YO3A 2XZCL 3DKHA 4KU1A 1KT2A 3OXRB 2A77L 3OR6B 1SRDA 5HHXL 3TBSA 1MLCB 3NIDE 2DLGA 2L3BA 2V5MA 1KN4H 3ARYA 4N1CA 2X70B 1FFNB 4L4JA 3RFZA 5JA8B 1W2KT 1E9QB 1MY5A 3Q8FA 1AZCA 3W57A 2K7QA 5DQ9B 5L0QB 1ZJAA 1UM4H 1HDMA 5CMAB 3VE0B 2NY4C 2CBMA 5CILL 5D5ME 4BCYA 1OAUL 4ZODA 1JF6A 3QH3B 4XPTL 3UPRA 4F15B 1KT2B 1QEWA 2DTMH 3OXRA 1NPJA 4NQEA 4P57A 4X6DE 1FCGA 5AVWB 4JG1H 3WTVA 1FRGH 3TH4T 3ZL1A 2J88L 4JRXE 2K6ZA 1ITCA 2NR6D 5FLVA 1I9EA 2B8OT 4WTWA 2BX5A 2X4RB 3K80A 3NIFF 3IFOA 3V4PA 1E7VA 2BDNL 1LO4H 2XWRA 4ZT1A 4PPTA 3RURA 1NC4D 5KYXA 2N01B 5GGVL 1T04B 4FNPA 2W9EH 4JKMA 5T5FL 3DMMD 1T20B 2W95A 3ZKND 5AB0A 3EBGA 4JFPA 4JFVA 3IJSB 4LLUA 1H5BB 1I3VA 4JK0D 4LNVA 4WSJA 2OZ4A 3DYPA 5ITFA 1CTMA 3SPGA 3MV01 5AW5B 4H25B 2JB5L 5L2JA 4M93B 1T80A 2Z8RA 3TZVA 2VDKH 3BQUB 4PB0H 2F8OA 3Q05A 1TQSA 3VD5A 2EC8A 4UUJB 3S8WA 3LKOB 3OPUA 1JZHA 4EZKA 4RWYL 4HFWA 1J05B 2UWEF 5I8CB 3JTBA 1YA5A 5B1JA 1NCWH 2FEEI 4FTDA 1CXIA 1N9PA 4Z95L 5FUOH 3RWEA 5BMFH 1WC7B 2BSRA 1ZIBA 3QJXA 4HPOH 4OGYL 1KYOJ 5C08A 4DUWA 2P45B 2XN9A 2EDOA 5A6LA 2DBLH 3MOAL 4KDTA 4X42A 2X4TB 5DRZA 2X9YA 1JOIA 3BUPA 2VZUA 1M6OA 3N2JA 2NW2A 2YJLA 4L1SA 4P5TD 1QO3B 4APXA 3DGDA 3EYUH 4P2OB 4Z7QB 1TVBB 2HVBA 1ZSHA 2VISB 2W0FB 3U9UB 1A5FL 3VXUD 1YJDC 2DWDB 4QRPB 3CDYA 4U6XA 5B38A 1X5YA 4UV4H 3ILEA 4W70A 5CMAA 2G5BA 1GHFH 2F1BA 3FU6A 4IRJD 5DWUH 5BQ7B 1JN6B 4OI9A 5AZUA 3QQDA 4I0KA 1NL0H 4IBSA 4IGBA 1IBGL 2H2SD 4XNUH 1ZA3B 3QDJD 4Z7NB 1NAML 3FPYA 2WKGA 5SX5K 1G7HA 3V7MA 5CD5C 4D9RD 1S7XA 4U6VL 4LASH 4W9JC 1ZHLB 1H3XA 1T4KB 2AXFA 3L3OC 4JCWA 3DX9B 5EOCL 3ARQA 1AKPA 5HSFA 1BYOA 1C08B 3APMA 4XMPL 1Q72H 3KPTA 3C87A 4H0GA 2OMTB 1PD0A 1QLEB 3NP4A 3UGXA 5ADPL 4HS8H 3MN8A 2XWDA 1UWEL 1AS7A 2D2CC 5ESVB 2WLLA 4NNXA 4OAWA 4WNQB 3O3DB 4G6KL 2WUCH 1Q9KA 1RZGB 2B1OA 4FQIL 2BCKA 3GF8A 5TDPB 3BO8B 4EIBA 3X12B 1ZLSL 3ULVD 5F0LB 1IGJB 1Q9LB 1WAAF 4J12A 1YPZB 2HT4C 4P04A 3W39A 5J6HB 1JGIA 2XVGA 2KS0A 3ME0A 5JA9A 3MBEB 1L9QA 4OT1H 4JUTA 1DUYA 4OZHE 5D7SL 1S5IL 3NIGF 3OXSA 1LLAA 4NQDA 3PWPE 2WVUA 2DQFA 4K8RL 3UYRH 4BRVA 4C83B 2RQEA 3RZCD 1U8IA 3WUWG 5C08E 1AC0A 2PYEA 5IFJA 2A9NL 1EHKB 1XGPB 1THCA 3PIQA 3UOAB 3LKRA 4OLWH 3GMPA 4XCCL 5IBUB 4WU7B 1RUKH 2FJHA 5KVDE 4YSQA 4F7TB 2HMIC 1U93B 4F93B 1U58B 5JXEC 4NZ8A 2W9DL 3KCWA 4I77L 5HDRA 4IBUA 1UA6L 4AT6A 1AY1H 2IH1A 3IXTA 4ELDA 2VDML 2VITB 1ZEAH 4NKIL 5FFGA 1QACA 2WZ6A 1U3YA 3BDXA 1KPUA 2TSAA 4CKVX 3HMWH 4LRNL 5HJ3B 5EOQH 5ERWB 2MHAA 2YAOA 1JGDA 2CNYA 3L6FB 1H3VA 1L3WA 4I3GA 5CR1A 2XWBA 3QUZB 4ZO9A 5I5RA 2MKWA 2QQKH 4PJBA 3BKJL 4Z8FH 4GYBA 1IBFA 3HB3D 3NOIA 4KDWA 4DVBB 1FVDA 4JM2A 4G8GA 1E9OA 3IJHB 5A6MA 5DFAA 4FYSA 1A1NB 2HJFA 4WI8A 4XO9A 4WVRA 4MB3A 3DURB 1S9YA 1SOXA 3HE6A 3L3OB 3CXDH 3GJEA 3Q2WA 4GRMA 3SDXB 4ECNA 5EUOB 4FJ6A 3EHBD 5GS1C 5D5MA 2B77A 4LLDB 2MPVA 1G43A 4IJ3C 3WLWD 4PJAB 1M7IB 4PLKC 2KH2B 4XPGH 4CDGC 1PU0A 4HUWA 2XOTA 3HI5H 1NIEA 2A0LC 5IB1A 1OZTG 4R7XA 2B15A 1P84J 2IANA 3IMTA 2ATAA 1NC4A 2WNGA 4L8SB 1INDH 2FX7H 3ZYIA 3MLXH 2HFEA 4QO1A 1MWAB 3FO0H 1GSMA 1IBDA 4N9OB 2CLRA 4NO0A 5E94B 5GHWH 1XEUA 1ZHNA 5E2JA 3DSFH 1RZ8A 2DEYX 4OFQA 3V6OC 1WS7A 4LCCC 3WS3B 3JWNG 1OAZL 1EQWA 3JQOB 1N64H 1J18A 4QRQA 2Q8AL 1SJHA 4YX2L 4OB5L 5CLYA 5L6YH 5AKVA 4L5FL 4LVEA 3CFKB 2NY7H 3FQ2A 2CJ3A 5AB1A 1I1FB 4Y5VB 5IF0A 1N70A 1YEIL 3BH9B 2VTFA 5AALA 1XGTA 2VSMB 3NSXA 3OB0H 4HKJA 2FQDA 2JLPA 1QLRA 2ERJB 3V52L 4WIQA 3C5ZB 2NPLX 3OMIB 1DBAH 1GKOA 1OSZA 6TAAA 1A47A 3QQ4A 1RIHL 2WLZA 2EKSB 1UZ6E 1UWXH 1BJ1J 3FCBA 2ZOUA 2F53A 2XV6B 4NSKA 1TZIB 3U0PB 1R3JB 1NDGB 3U4KA 1OT2A 4PRBA 3FAWA 1I8UA 2F74B 4U1SB 2DH2A 3EJYC 1SLWA 1RPKA 2BM3A 3AMKA 5CEZE 3UZVB 5LHDA 1JYWA 1KV3A 2JK5A 4YDVA 2NSQA 2DJ4A 5JR1H 1WZAA 5E2WL 1ZLEA 4N28A 3I3BA 5J56B 1KJ3H 4WFED 5C8JA 2HJKA 2AVGA 3MRKA 4RNRB 1ZE3C 4N86A 3TFKD 4Q97A 1AHKA 1KB5H 5HDWA 3VU1A 3UYRL 3ABGA 1KUMA 3TN0D 3FB8B 5I30L 4XMZA 2PO6A 3N3EA 1W8OA 2C9QA 5H35B 2NSMA 1A7RH 2WN3A 3WJLC 3GHPA 2VJ8A 4F2FA 3DVFA 1TNNA 3KPMB 3CUPB 2F54E 5HHQB 4U31A 4YDZA 2VN7A 3SDXA 4PJDB 2DIEA 1DLHA 4JDZA 2WXJA 4PRHD 4KKCD 4OF0A 1E42A 3CX5J 2HJKB 3EYSL 1KB5L 1BYNA 4Z7WF 3S88L 1LK3L 1AGFB 2R0KL 5DLML 5E8PB 2XDHA 2GBVA 4ODSH 4FTVE 1EO5A 1CICC 3VXUA 3IDNB 3D85B 4OLYH 4PR5A 1Z7JA 1FNAA 1C1EL 5AOZA 3T1WA 3QUXD 1XF5B 1RIUL 5F44A 1TZIA 5IMLA 4U3HA 3ASWA 3MJ7B 1QLFB 3LZOA 4NJAL 4HWBL 4N2NA 4F15C 3NSDA 5C0NC 4PJAF 3VFMA 3HAEH 5EEXA 4NN5B 4OFDA 4XC1L 4QYAA 4EI5B 1SY6H 2BS71 2J21A 1A02N 1SF3A 4G9FB 3I84A 3O11B 1TQVA 3DOHA 4WWKD 5CS7A 2A6KA 5B1BB 1ITBB 4F7EB 5I1AA 2SEBB 4JY5H 4PRDA 1IM3B 3D2UB 4MA7H 2KZBA 5DJ6A 1YC7A 2FUQA 2EDLA 2WVVB 2CHWA 3AXLA 5C3LD 5C92A 4XOAA 2YQBA 1I9IH 4YDMA 3VFNB 3IGKA 4IKIA 3LVEA 1EEUA 2FJHB 2JKTM 3CMGA 4P06A 1EAPA 1NLDH 1FC2D 1RERA 4M93C 3O81A 5DU7A 4YSUA 3G6AA 3ETBJ 4XHJD 2OJZL 3PL6C 5BV7L 2CLZA 1T66D 4XMVA 2DYPA 3UAFA 5D9SA 4DUVA 4RMUA 3SKJH 2DQEL 3JWNC 4R84A 1TITA 2X12A 1QR1B 4WFGE 3SDCC 3VQ1C 1R1CA 1QWNA 3QJZA 1OAJA 4FNQA 2VKWA 4QO1B 5AAPA 4W6WB 3SKOA 4CW1A 5LGHL 1LP9F 1VGKA 1G4RA 5I0XA 4NWUH 1QWHA 1TZOA 2JSFA 1S7RA 2OP4H 4NZTL 1G7PB 5GRXG 2X1WL 5J06A 1MCHA 4R3SA 4QXUL 3SB3A 4UQIM 4DZBB 4ZS7L 1OB1B 2X2UA 4MZ3A 4UQAA 2BWIA 2HZHA 5DK2A 4LLDA 4NKQB 2IG2H 2DQTH 4PRHB 4B9YA 1WJ3A 1CFNB 3QQ3A 1YMMD 4NZRH 1A1OB 4AQ1B 5JO5A 3O8XC 2ZAHA 3JWNE 3MV7E 4S0SD 1JZGA 3BPLB 4A7SA 3HE6B 4Y5VA 5DT1H 3WN5A 4Q2ZB 4TUUA 1RZJC 3PCYA 1NEUA 5DS8B 1HKLH 3QNZA 4YHKL 3MUZ1 3BUBA 1L9TA 1NGXA 3OKOA 1P7KB 4HJJH 3CZSA 5HY9B 5EO9A 3ZLQC 5F70A 5TF1L 3HZVB 4UCFA 5INDA 4ZK8A 4N2BA 4NQXA 3SDCD 2AK1L 3JVFC 4M7LH 2XYCA 4XN1A 2O6EA 2EYTA 3MRHA 3SQRA 3BUTA 4HCFA 4B5ZA 5IQ7L 4OZHB 5KVFH 2GK2A 2M2DA 4BZYA 5FO8A 5GRUH 1TVBA 4MXVE 1Z32X 2FJGA 1ZWIA 1A1MB 2G4EA 2P44B 2J6EL 5DQJB 5FW7A 1DVFA 5B8CB 4UM9B 3WIIH 3G08A 2EECA 1RZJH 4S1SH 5C08B 4AK2A 1LWRA 2Q9OA 1KV7A 3F12B 4GO9A 1NMAL 5K39A 4BE6A 2FIKA 3RRQA 1TU2A 5FF6B 1KLFA 1SYSB 1MHEB 4LSTL 2KYIA 2DAVA 4FFZL 4NYLA 4HIIB 4B0MB 2DL9A 2QLVB 5K9QG 5EUKA 3E2HB 3QFJA 3RVTC 2NLJA 4GI9A 3FT3A 2P28B 1M42A 4JM0A 2BOCB 4H8VA 2HVKB 4GIOA 5C0BB 4DGUA 1TJGL 2R2HA 3NABL 4JFDD 4QOKE 1E65A 4U4IA 5DD1L 2HX9A 2DKMA 2RMNA 4QRUB 1ZXKA 3TBBA 4R5XA 3IFOB 5SWSA 2XZCH 4F27A 4R8WL 4XAKD 3SDDD 4EDXB 4XP1H 1QTSA 2WLLB 3OGOE 4NNXB 4WCYH 3C08L 4F1SA 2VXQA 4B27A 4JFEB 5KWYC 1U8NA 4DVRL 4TYUA 2JB5H 1YEHL 2FATH 1KC5L 1SDAB 3HAEG 3DV6A 3TASA 5E1HB 1SJEB 4MQ7B 5C0DA 5J1SC 3DXAE 3DX3A 3L5XH 3H6JA 3QWQB 2FAUA 4O2EB 3C6LA 3LRMA 1S7XB 4UZSA 4XPTH 4YXHL 1EHXA 4A7VA 1RSFA 5LWYH 2P5PA 5EOCJ 5E2TL 1E28A 4H8WH 4JY6A 1U9KA 1IBZA 4P2RD 1ZT1A 4KJWC 5F93C 5F0MB 3TBTB 1BLNA 2FWOA 2EJ1A 4MMYB 4ZUVB 5I76A 2OQJB 3QO0A 2YN5A 4XMUA 2RQ8A 2A74C 4AV0A 5DRZB 3O6LL 3O45B 5DURD 1QO3A 4APXB 5TDOA 3LRGA 3D2TA 3RVWD 4WUUE 4R0LA 3ESMA 1UD3A 2DJMA 4PWKA 3ULSB 2XQYK 5AOIA 3TWYA 4URKA 2APSA 2CIIB 3VXRD 1FGVH 2C9SA 5LBSA 5GGTH 3U4AA 1M7UA 1R0AL 5G4MA 4Y19D 2J6WA 4TQ8A 1B4TA 1NCBL 3LQMA 4X9IA 4QRPD 4DW2L 1NCGA 4X5XA 4IJTA 4TQEL 1O0VA 3ZJAA 1DZ0A 2R0WH 2FGWH 3C8KA 2YD6A 1KELL 4DH2A 2FYVA 2KZ1B 2EDMA 1IAIM 1Q0YH 2X7LA 2WYHA 3QUMA 3ZTNL 3MBWB 4GUQA 4PI0A 2F54A 2MCAA 2E3VA 4JNXA 4YPGA 2FIKB 5JW4M 3OKEB 4Y9BA 3BZEB 3SO3C 4BELD 3H0TB 2CUIA 3IBEA 5K9OB 3W81A 1B0RB 1IGIH 5JDSB 43CAB 2YEQA 3RDTA 3QYNA 1MFNA 2XWXA 4GG6E 1IT9H 4WI2A 5CEXA 5FKPA 4EXPX 1AHWB 2GY5A 3EJUA 3T2PA 4RVBA 5DJAA 2LU4A 4MDJA 1A21A 1T1XA 1TZAA 3MRHB 4LGRB 3NYKA 5MENB 5AUMA 4WQOA 4PJ9D 1F3JA 4MYPA 5K9OA 1IQDB 2ZSVA 2TSBA 3ETTA 3L4YA 2Z4TA 5DD0H 3QPXH 2XWJB 1DJZA 4XPHH 3GUTB 5TDNB 1GGCL 4PW9A 4G5ZL 3LDBC 3LPPA 4GRLC 1I8MB 2O30A 2YGOA 5CN2A 2FJSA 4JANA 5I15L 4WU5A 4DF9A 1NUNB 2W0LA 5I73B 1IB5A 5F9AC 1SUJA 1EFQA 1PZ5B 3C8KB 4R2GD 3H2QA 4AEIH 2CIIA 1LQSR 1CR9L 3GZQA 4JFPB 1NC2B 3HB3C 5EMYA 5KVEH 3BDYL 1NKOA 2N0MA 4YDIH 1KBWA 2O6PA 3WJJA 3OKLA 3BD3A 3S96B 1DSWA 2IOOA 4XN7A 3RAJH 3EJPA 3FFCA 4PY8I 1U3JA 5SWZD 1SMDA 2BZ7A 5EOQL 2A4CA 3U2SA 5J0BA 1P4BH 2J2ZB 4IKKA 5EBLA 5GRUL 4H8UA 2B3IA 3D25A 1N7MH 5D7HA 5FGBC 4ZMVA 1RIVH 1KJMA 3FBKA 1F41A 2R0LH 3S4SB 5GQBA 5TE4L 4E68A 1A4KB 1H0DA 2ZOWA 3KPPA 2CBOA 2FCBA 4HLZG 3D2UD 5ESQB 1LE5A 1Z0MA 1DBJH 5I0VA 1OIOA 1XIWD 1JMZA 4JREB 4JQIA 5T3XD 3MRJA 3U25A 1JDCA 4HWZA 1WAAE 2UX7A 1NMBL 1AE6H 4HIIA 2VUKA 1R33A 4TNFA 3TO2A 1HVXA 4A1RA 1C12A 3KHOA 4N3UA 1T2JA 1KC5H 4NHUB 2F58H 4JZJA 4YDLB 2NY0D 4NXSA 4RH4A 2F2HA 4PWEA 2VDRB 3MLVL 3VMPA 1ESOA 4PLKD 4TOYL 1EO7A 4YSSA 2AANA 2X1OA 1U8KB 3I6SA 2MRYA 1U3HD 5B38G 3KVDD 1JZFA 1DQQA 5I1DA 3NJXA 2FX9L 1DVFB 5B8CA 1EHAA 3BI9X 3RVVC 2EIZA 4FMFA 3K4AA 1ZDSA 1SFDA 1IE4A 2NNAB 1A6WL 1S7VB 4B50A 2YPKA 4WHDA 5LAXA 4UANA 5I19L 2JXMB 1DJWA 2XX0A 1GPOL 3F8UB 5SX4I 3QHZL 2W88A 5GZOD 4HS3A 5CEXB 5KS9F 2E7CA 1J0KA 3B2DC 4RGNC 2DLTA 3KPLB 4Y2DA 5GS2D 1F02I 3CZGA 3ZKSD 2Y06H 3NFPB 5MERA 3SDXF 2X9WA 4FI7A 5I8EA 5AKRA 5DTFA 1DL7L 5D8JL 4PJ8A 3QA3A 3QEHA 3TN0B 1U41A 4MJ5B 4JM2F 1V27A 4OKVB 3RUGA 1KBBA 2G9HA 3PFQA 3ZTJG 1RZKH 1TEFA 4FXKC 1HEZB 3L5WA 2LABA 5T5FH 3WS6A 3MLYH 2OMUA 3N50A 5INCA 3RZWA 3N85L 5IQ9B 5EC1A 4XX1G 4U1KA 4IDLA 3C5SA 4B7LA 2ZZUT 1BQ5A 3LIUA 2AEQL 3FOMA 5DMIH 5E23A 2B20A 3RZCB 1MRFL 5FYKE 5TDOB 4ZFGH 5IROA 4AOFA 1HHKB 3B9AA 2CUMA 1AGCA 2BJMH 3NACH 4KROB 2V6HA 1FV1B 1A6VL 3B56A 1FF5A 3D39D 3L1FA 4AL8L 2V2TB 1FBIH 2X2IA 3GHBH 4OGZA 1OT1A 1RJZB 3KW8A 3PABB 3L9BA 3PHQB 5BVPH 5HY9A 4M3KB 4XCNA 2D4FA 5IVXE 3DDFA 1NA8A 1OSEA 4AM0B 1DBBL 3H42H 1H15A 2BC4A 2EIKB 4MJ6B 4RMBA 5IROC 2WQVA 4NQVB 3V7AG 3ILQC 1L9NA 4FCAA 2XYBA 4QHLA 2YPLD 3NEOA 2FQFA 5SX4H 2WZPA 4LQFH 1FO0L 1HSBA 5MP6L 2D7TH 5IJBC 4H44C 4BH8B 5I0YA 4J3OD 1BZ9A 1OALA 3KPNB 1NFDE 4R3SB 2OMXB 3HG5A 4X7DC 1EMTH 4EDXA 3F65A 3NIDB 2PP8A 2YD5A 1XSOA 3UTQA 4FG6D 1KXTB 5D1ZB 5ALCH 2JCCF 3AAZB 4XH2B 3O6FA 1HHIA 1P6WA 2YGQA 2QR0A 1CDCA 2XU9A 4H26B 4QOKB 3HG1D 1U2YA 4BWTA 5I5MA 4AGNA 2J8UF 3X1NA 1ULVA 5F3BB 1JZEA 4L4VD 5D4HA 2NXZC 4W9HC 3X17A 2R8SL 1E3FA 1F4HA 5I1KL 3BQVA 2CRZA 3REVA 3LQZA 3QJQB 3HS9A 4ELKA 4UTAL 2UY6B 1UWYA 1M3IA 3AG2B 4Y19A 1OAYH 2V2WA 4HF5L 4GUPB 3VG9B 3PGCA 2QMJA 1UCBL 3PXJA 1PZSA 2V5RA 1MFUA 3PGFH 3QUXB 4R9HA 4Y2DC 5CSZA 2JMRA 9PCYA 3N9GH 2X1XR 2WOYA 3MVSA 4XMTA 4XHJC 1FI8C 1M2OA 1AI1H 2HPOA 3US0A 4AG4L 2BNRD 1JXGA 2IAMD 3J2PA 3LN5A 1OD7A 2CR3A 1ACZA 2EE0A 3L2LA 5L88L 2HSIA 3V4VL 3GSUB 4HK0B 3CN4A 4ZS6C 3OKMA 4GY4A 3A23A 4W9DC 3F6JA 4XMLH 1ZOXA 3DURA 1KIQB 1OARH 4UNIA 5JHMA 3NPSB 2OMWB 4LPYA 2H26B 4JMXA 5D6CA 1KZYA 4BINA 5I5IA 4YDVB 3C8HA 4XPAL 1FVDB 3F64A 5L8KB 3UXFA 3CX5K 5D7IA 1YEGL 4PRAB 4X0KA 3T5WA 1BZ8A 1LEIA 3VA6A 4D8PA 5F6HJ 4ABUA 4FZEL 4Z7OF 4CJ1A 5INDB 2VRAA 1W72A 3CVIL 3MJ9H 3VWKC 3NFNB 1TZ8A 5IJKC 2J1KA 2QQLH 1CUOA 1IEAA 2BNRB 4LP8A 3ERXA 4NRZB 3BP6A 4MDIA 4GXUM 1ECZA 3GSOA 4LRIC 4X9HA 1U8CA 1AIFA 3VD4A 1IGCL 3UTTD 4J3OC 4BH7A 4YQXH 4JB9L 2BOBB 1TTBA 1I7UB 2VDKL 4RMWA 4F9LA 1BX2A 4HUMB 4WGWB 4F37F 5C2UB 4PS4H 1A1OA 1GH7A 1SVBA 1VGEL 3C5SB 1F00I 1TR7A 4ZD3H 4GQ9L 5BJTA 4LL4A 3LD8B 1FDLL 1DSFH 3LZFL 5BRZD 4NM4L 4KJPC 1ZHKB 1XGZA 2VQUA 3B2MA 5CBAA 1KN2L 2AQRA 4Z7UE 4K0OA 2CAKA 2EH7H 3KEHA 4MNQB 1DVXA 2CE6A 3HVDA 5DO8A 1EGJL 5I1EL 3FTSA 3KNBB 7PAZA 4LSRH 1CGTA 1J0IA 3CZEA 3L2NA 4MBRA 4DPRA 5I8EB 3W39B 4XZUA 1QFWM 5GJTL 2AK4D 5FFOA 2Q7NA 2GTWA 2JTDA 2DQTL 2V7HB 4Z7NE 4XI5D 2FR4A 4HGWA 1LO0H 1M2VA 5T1MB 1WE5A 4LEOA 1CG9A 3QXUA 3BGFB 3ES6B 1EBPA 4GW1A 4PGBA 5LXGL 1DANT 2ZIDA 4S1DC 3TT1L 4CSZA 4HT1H 4E5XG 2EE6A 2YFNA 2DKSA 1EXHA 3ZDWA 1N0XL 3Q3GA 1EEYB 4FYRA 3BHBB 1H9VA 4HCRH 3EADA 2EEAA 2CR0A 3QW9A 4LSTH 1G6RB 3ALPA 4YBLB 3V0GA 1RSYA 4R7LA 2X2YA 4KJQD 4FQHB 4S0HA 2MQCA 2N3JA 4UQEA 5FO7A 3UG4A 1CGYA 5IGXL 3ULUC 2APTA 5KZCD 4CU7A 4EUPB 5J9PA 4WW1B 4FQIH 1HZHL 3UTZA 1IC4L 3GLZA 1KXQA 2B39A 2MCMA 3TO2B 1BOGB 3Q1SH 4JRLA 4GQRA 3EOTL 2WO3B 2DH3A 1RPUA 2E56A 1XMWA 2FSEB 1DEDA 1CFMA 4U4BA 3IJEB 3G5YB 4Z77B 5IMKB 4P3CH 1VAHA 5DJ2A 3QIUD 3H9SB 4B53A 2N0KA 1MCCA 4U1NA 4G80A 3LKPA 5HHMD 3D07A 1BLIA 1OM3H 1F8TL 1I75A 2DY2A 2E9BA 2G5UA 3BAIA 3P0VL 4H1LA 3NFSH 4QI3A 3P4OA 3VH8A 1JZIA 3HG2A 2Z91A 3BN9D 4KI5F 5AYTA 2O4EA 3QCUH 4KKNA 3W9DA 5JHDD 4I0PA 1MW2A 5T33H 1T0PB 2F5AH 5ADPH 5FPIA 2AJ3A 5EA0L 5H35A 4TNWF 3LS5H 4JS7A 3MRBB 4I18C 1WZLA 4P9HL 5KS9A 4HFUL 1ZAGA 2XPYA 3NZHH 2IPTH 3BJ91 4Q4IA 2W38A 1NLBH 2Y1AA 3NTCL 3INUH 2P8MB 3ZN6A 1GIGH 3H7BB 4JJ5A 4E9TA 1BZEA 2F19L 3TN0A 4ELKB 1WLHA 4W6YB 2DIJA 3SCMB 5KANI 4HG4K 2F5AL 2C9UA 5FOBB 2YD3A 4WSGA 2R9HC 35C8H 3QDGB 5C86A 4PJFE 4ADGA 2WLIB 3PL6A 3GMOA 4GKNA 4Z8FL 4GRWF 4UQ3A 1O7SA 1TO5A 3W2DH 4DKEL 1T1XB 4DNLA 5KBLA 3APNA 3QUKA 2LLLA 4J8RB 2BPBA 4GKZB 3I02A 1NGZB 1ZLUH 4LESA 3OGCB 5KG9A 1R0AH 1U0QA 1QUPA 1L3NA 5LGYA 3OZ9L 3N43B 1S7UB 1Y18B 2NTSP 4N2MA 1SY6A 4L3CA 1NCAH 1B0GB 1D9KB 4HIXL 4V11A 4CAGA 1QA9A 1RUQH 1PKQB 2EO9A 3VFVB 2YZ1A 4Y1AD 4F8LA 2BVOB 4WAFA 2ZCHH 5DRXB 5CJ5A 5HHME 5CSBA 3ULUF 3KPQA 4POUB 1UWGH 3AFLA 3FFDB 4DETA 3LB6C 4CU8A 4K8RC 3LEVH 1FV1A 3AU1A 1TSHA 1RCYA 3O4LA 3QUYD 2PPEA 1VADB 1C9SA 4M4PA 2XICA 1GY1A 4ZFZA 3ML8A 1KNOB 3UIYA 4HLEA 4W1TA 1DQDL 1GGYA 3P73B 4O51B 5FXCH 3T3PF 4HJSA 1LTXA 2C1OB 4HJTA 2X09A 3I9AA 3N6YA 4IMLA 4KNQA 1P4UA 4NHCL 2VDLB 4O2CA 3FMGH 5EU6B 5HI4D 2XPZA 2DB8A 2CKBA 3QPKA 5K9KA 2XY1A 4L37B 3BWAA 1BG9A 5TDPA 1PY4A 6FABL 1M71B 1X5FA 4XP4L 1LM8V 5BXFA 2R69L 2VMFA 2ITCB 1LO3L 2OM5A 3FO1B 4PJ7A 3AQYA 4U0QB 5BRZA 2GUYA 1J11A 3IWVA 5D7JB 1GZHA 1ROCA 4NHCH 2ADJB 4PD4J 3RUGB 4JG9A 1WWBX 1WZKA 4K2UL 5T1LA 1LEKB 1VCBC 1MFDL 2YARA 2HG5B 1MRCH 3ARDA 2DQGH 4MXQD 4F8TA 3FF8A 5DJXA 3I6LD 5BUAA 1TEGA 4FABL 5C6WH 2ZKYA 4W4NA 1JL8A 1XZWA 4AW7A 3APDA 3K6IA 3KPRA 3AXHA 1ND0B 1T0NA 5I6PA 1UUNA 1GAFL 4BZ2L 4G8IB 4GP4B 5T1KA 5JW3H 2VUOA 2I60L 2G2PA 1G9EA 3QG7L 5KYNA 1JNNL 4I87A 4LPUA 4AWJC 3OX8A 1N6QL 1A4CA 1ID2A 4FQ2L 3EBAA 5JZ7D 2I9TA 4KK9C 5E7BA 4O5LL 2NY7L 1OP3H 3MV8D 4ZW8A 3A0OA 4YHNA 5C2BH 1MFMA 5L9DH 2CBTA 5KBMA 4YS4A 3L3KB 2N7AA 3MNDA 2EIMB 2WVSA 4ZXBC 4BZ2H 1INEL 5I75B 4MXQC 4WFHE 3N06B 1ZS8A 2F54B 3CV5A 5F6IB 3CWGA 3SDCA 3CN1A 4FFZA 1L6ZA 3BZEA 3DVGA 2X70A 3K8KA 3UX9B 2CD0A 1I8KB 2X40A 4XNUL 4PJCF 4FFWD 1NINA 5E8NB 4G9FE 5DZVA 5GISH 3KLLA 3TS8A 5EDXA 3NCJL 1BVZA 2NYKA 1LWHA 2CO6A 2EDTA 4JGJA 4LLYA 3IRZA 4ODWA 2G3NA 2EDFA 4G7QB 2WYTA 2QSCH 4AMWA 3VG0H 3WIAA 1ZK5A 3F12A 3ULSA 4G7YL 3NRFA 3D5OF 2LFGA 1T20A 1E50A 2QTEA 4NZUH 1SOSA 1XGRB 1GGIL 3VB9A 4EIUA 5GS0H 4L0YA 2IJ0C 1X44A 4JFFB 1JK8A 2IBBA 4FHBD 3C60C 1KB5A 4LLWA 4OZFG 1UWEH 3FOLB 2NXYD 3TFBA 4BQBA 4D94A 4RFOL 2AK4E 1F8TH 3O3DA 2M26A 2VMJA 4OV6F 2A6DB 3LN4B 2H47C 3RHWK 3VG0L 3JWOL 3JV5A 5AW7B 1PG7L 4WHYH 4YZWA 3V79C 1L9OA 4LNRA 2RFXA 2DM3A 3OLEA 3VWKB 4RSVA 3F05A 3FUNA 4YK4C 4I3RL 1ZHLA 2AXFB 3L9RB 4R2GB 2NY4D 3VI3F 3RGHA 4AYEC 5L7XL 2EO7A 1OL0A 4U3CA 1XWVA 3DV6B 1DTUA 4P2QB 4QDGA 4KQ4L 1TTUA 3IVKB 4JPQA 4HWNA 4OQTH 1NCWL 1A6WH 2ZSVB 3VFVA 4PRHE 4TPRH 4G59C 5F71A 2ATPA 3BESR 3BGMA 5EZOL 4OKDA 1JG9A 2O61A 5BV7H 3LH8A 1KJVB 3MV7B 1LO4L 5CWSA 1GXEA 4GW1B 4PGBB 5F2FA 1Y6NR 2H1XA 4JO8A 4JHVA 4F8OA 5IB2A 3ZKMD 4WK2B 3BPOB 3WJLA 4JHAL 4ES9A 2VSDA 4K55A 3VGGA 5IVXA 1ZKAA 3QUKB 4PRIB 3LJ3A 4YDJA 1HL4A 2WNWA 4TUJA 5MEOA 4FDWA 4TPRL 4DGYL 1AH1A 4IRJB 1SEQH 1FBIL 3QSKB 1JPFA 4BZ2A 3H7LA 4JFED 4N8CL 3KAAA 2EUZA 3GRBA 3LPGA 1LHZA 3RA7L 1RZFL 1OPGH 5CN3A 3WUZA 1Q9OA 3O3UN 4HLJA 5DQDH 4LHUA 4BFIA 3TO4B 4MMZB 1I1RA 4QWWD 3SKNA 4JKPL 4N2FA 2NZ1A 4TN9A 1B2WH 4IBZA 2IXQB 3SBPA 1T1ZB 4KTEL 2Y2YA 5F9OH 5MP6H 2P47B 1RUML 1ZTXH 4Q6KA 1I8LA 1QA9B 2DZEA 2ZUQB 4YHKH 3RYMA 1NEPA 1KEML 2UVEA 4LVHC 2HKFH 3UC0L 3T2NL 5AW2B 1IM9D 2ED9A 3B9KA 1LMIA 2B1AH 3MLTA 4DESA 3X3FH 1WZ1H 1BD2E 3EIFA 4G6AD 4YBLC 3FF7A 1PD6A 4EOWL 4NQCB 4U1LB 3LKPB 1J10A 3O6FD 3DX1A 4K7FB 3A22A 2AEPL 3ARTA 2IPUG 2V9QA 5IHLB 3BUYA 3CD4A 3WHXB 4ZUUB 5E08L 1OHZA 2XZAH 2ZCKL 5HHNA 4A55A 3ARBA 1ZT1B 5IREA 2M1KA 1WK0A 2VR3A 2HH0L 1AXSB 4HXAH 2EADA 1OE2A 1QUNA 3A6BH 1LO3H 2ZSWB 4RGMB 5EU3B 3MQIA 2DJSA 4MVBD 1AQ8A 1V05A 5EF3A 1NMCB 1WS8A 1HESA 5KBKA 5JIPA 4YAQA 2BSED 2CM6A 3ARDB 3BEVB 3EH4B 2ARJB 2ENQA 3RU8L 2BVQB 5AWNH 4YSAA 3FQXA 5J3HD 2R7EA 3BHBA 4JFYB 4KFMA 1VEOA 4LU5H 2JCCB 4G5ZH 4ANUA 1JYVA 3LNHA 4JFEE 2ZUSA 1BBJB 1ZY9A 3D39E 1LK2A 4Y1AA 3ZXAC 3IJYB 4B9GA 1CG9B 1BFVL 3EYVB 3LIZH 5IVNA 2P48B 1IC5L 2B7DT 4OT1L 3CZFB 5EEVA 1E5BA 1G4MA 1S78D 3ASOB 3BSZL 1ETA1 3AACA 4P9MH 3QUXA 1A6AA 2HFFA 5DVLA 4FAAB 3ENEA 1VF5C 4P5MA 3WFDH 2JQZA 2FL5A 4XMKL 2R1WA 4AQ8A 2QQLL 4YSPA 3PV6A 5LBSL 1IE5A 2IEPA 4MJID 3WJMA 1EJ6A 3ZHFA 4LDLB 1G7MB 3DJZA 3WAJA 2QGBA 2G60H 3TA4D 2UWEB 4DAGH 1QX1A 1P4BL 5IJVB 1IAMA 1NDTA 4BQCA 5F7FA 1ZA6A 5L2KB 3KPQB 2AJXH 4X5QA 3SZ6A 3EH5B 1W6WA 4ZNEE 3UJTL 1CTNA 3A4FA 3KYOA 1EA9C 4Y9FA 2Z93B 2HRLA 3FQRA 2SODB 4FEMA 2J1YA 3VA2C 3NCJH 5B1AB 1QABA 1X4ZA 3HIZA 2R56L 3MTRA 4R0LC 4DQAA 1X5AA 5HYSB 5FDWB 5KJ7E 1AE6L 3CIAA 2VDOH 3HRPA 4K94C 1EJ8A 1S9XA 3GO1L 3BH9A 3GS4A 4YPJA 3SE8L 2A74A 5JW4N 3BSGA 1ZLUK 4L9LA 3WGUB 5CEYA 1QBMH 2A73B 2IAND 4IKLA 2GVYA 4NRZA 4NJ9H 2VC2L 3CVHH 4OM1L 2ISDA 4A6YL 2WWNA 1U8QA 4AEEA 5IHUL 5C3IA 3HRZB 5T3ZE 4OLXL 5T1KD 1EFXB 2EYRA 3VTMA 3ZL2A 2KQNA 5FO9A 3O3AB 4XN2A 4IM8A 1YN7B 3MV11 3IDIB 4N3TA 3RNKB 4F24A 3HPJA 5IUCA 3VB8A 1PX3A 5D2NB 4F7CA 2YPVH 4K3HA 3ZL4L 1MI5A 4TNGA 1CTOA 3IETB 2QPFA 5HJBA 3GI8L 1T1WA 1ED3A 2VQTA 1NFDF 1G1YA 5TJWK 1BAWA 4WFHD 5E2VL 4YXHH 5CM1A 2VQ4A 4KZ0A 3RUGE 2AKRA 3FK3A 4J3BA 4DCQB 2VXSL 3KWUA 1VZGA 3BT0A 2CGRH 2VDLL 5HVHC 3EJSA 1PY0A 3GRWH 2H41A 3EW3B 1CD9B 5ANME 1RULH 4IOSD 5E5MB 3NCWA 2Z93A 3RVXC 3UYPB 4ZOCA 2Y25A 1UM6H 4X6BA 1MDTA 5GS0C 4PBXA 3OG6B 4KK6D 1BAFH 5C6TH 1ED3B 1X7SA 2J4WL 4M5ZH 2X05A 3L54A 5K59E 4RZCA 1WZ1L 3OV6A 1A8JH 5CJQL 3LV3B 5DFVD 1NLDL 4TNWK 2VR7A 4P5KA 1HHGB 4U6YA 1VLXA 5ESAB 3RY6A 4X6DA 5EF0A 4M61A 1QATA 4N8VG 3BIAX 1XD0A 2WLYA 5IV2B 1MW1A 3O6FB 1V7NL 4NQED 5JOFA 2KUTA 1WV7T 4NC1E 1WD9A 2IPUK 3HS8A 2VQ1A 4E9VA 3CNKA 1XMEB 1QW9A 1YHPA 4KUZH 3QCUL 4PW3A 1K85A 1WAAA 2FUTA 1N10A 4N2DA 3MYZA 5C0GA 2R23A 1DVFC 4HIHA 1P1VA 4ZUWA 4Y8AA 3OAUH 4Z7NF 3LQAL 1ZT4B 3FQXB 4XP5L 3D0LB 1V3MA 5DJZA 1SXZA 5B1JC 2AQSA 5F6IC 2V2XB 4YO0A 2A5UA 3D30A 2C1PA 3UAEA 2CRIA 3TEUA 2X6CA 3O6MH 4XXCA 4PREA 3DX7B 4JFFE 4P5SA 3WV0A 1FO0B 4PR5B 3MMEA 4L4VB 5BOJA 1EDQA 2DM7A 4RMRA 2W92A 5FOJA 4PP1D 3QRLA 2JKRM 5SWSE 3BUYB 3D4ZA 4OD3H 1Y1UA 4TRPL 1MJUH 3WN5C 1HCZA 5LBSH 3FHEA 4IEFB 5EIIG 1WEJL 5E9DA 4QOKA 3CN2A 4KH2A 1E2WA 1NL0L 3QDHA 1MIML 2QT6A 4QXGH 1D5IH 2OTUA 2MTAA 4ZRGA 4LARL 1CDHA 1TJIL 3D34A 3MRGB 3QVAA 5FECA 2P5WB 2Y7QA 2C9AA 2UZIH 5E6IC 3QBTB 4BFJA 2P5EB 4OLYL 1EEZB 2G2RB 3FQUA 3NBNA 3IDYC 1J8KA 1KGYE 2A4EA 2PP7A 4HS8L 1FZMA 4MCNA 3Q8CA 3FU3A 5F3HA 3QXDB 2X2JA 1IAKA 2XRAL 3P11H 3RFZC 5DMKA 1WCBB 1XH3A 5C07D 4ZQTA 3MJ8A 1FCCA 1YN7A 2OAAA 4YXKH 3T6WA 1KTCA 2GSGB 4ERSL 3NRPA 4KI5C 1EO8L 5D93B 3ZE2E 3NRQA 3ULVC 1JPSL 1WISA 2WWOA 3P02A 1EHLH 2V8MA 3V6OE 1DFXA 3FC8A 1TQWA 2VSKB 2UZXA 3RL1B 2VLKA 4W9IC 1BZ7A 4JCLA 1BVNP 1ES0B 1XGUB 3S36H 1UVQB 4GXUN 4ISVB 4IIQA 5I0DA 1R9FA 1S4IA 1Z9LA 2HJLA 1HNYA 1P1ZB 2HWZH 2XLLA 3D69B 2NY0C 5FDWA 5DZNA 5C7XL 2ZWSA 2IO5A 4RBPK 3VFPA 2ZXQA 3LN5B 1NAKH 1J9QA 4OSUH 1PDKA 4UYQA 1GRWA 3LZQA 4HSAC 3MLUH 2CUAA 3B83A 2HG0A 3ULVF 4AEFA 2IC2A 4WEMB 2CGZA 2JJSC 4UBDC 3ESVF 4TLKA 3EOAB 5A2IH 2OMZB 4TSAL 4JO2H 5JDJA 4NQCE 1BAFL 4DOHB 3DMMB 1CICA 2FL5B 3SO3B 4C59B 5IY5B 3CMOH 1BQHA 5JUEH 3QDAA 3NFPA 3VG9C 3BE1L 2E9IA 4PIRF 2BJML 3A4DA 3NACL 5A2AA 3ULUE 4E41E 2QKIC 4KI5E 1OAQL 4FG4A 3ZE1E 1MCRA 3U6XS 2D2OA 1K6QL 1KXQE 1AHWC 2YMTA 3P4MB 3K1KC 1J1PH 4Y4FA 3AGWA 3SD2A 4M4RB 1CDGA 1FWXA 1OE1A 3G5XB 4PG9A 2X89D 3VFOB 4BV1A 5LQBL 4OFVA 1UH2A 3VW3L 3GM0A 2Z4QA 3VXMA 3LN9A 2ED7A 3T3PE 1UB5A 3CTTA 2X28A 1HKLL 1MCJA 3RY4A 4JKKA 5A43C 1YECH 1BQKA 3H9YA 3QHTC 4XBPB 4HUUA 1SQMA 1TYJA 3HG1B 4HWEL 4JQIH 5GGSB 1J1PL 2Y6SD 4S1DD 3L9RA 4Y16A 4ZUTB 3ZT7A 1HEJC 2AJSH 4P4KA 1IQWL 3QC5X 4S2SA 1EMTL 5JIMA 1N6UA 3GMQB 4PD4K 2PXYC 1H3GA 3U1QA 5KYWA 1FFNA 4FLSA 4OBSA 4Q56A 4OVVA 4UWQB 5JIHA 3IXAB 3MO1B 3TVMD 4AV5A 4QD2E 1QKZL 3OPZL 2RALA 1FNEB 2GSMB 2GSIA 2QV2A 1TQBB 4ABQA 4K5PA 4YHLH 2CA3A 4QRPA 4EF3A 5B38B 2W5PA 2Y36L 3FULA 3GKZA 4NPJA 3QUZD 5HHOE 1CXFA 1IX2A 2NYZA 3PAZA 5FYKD 4GQPH 4U1HA 1FFQA 2UZPA 1S9VA 3REWA 5BV7C 3SGEH 3FFCB 4IK7A 4PRPB 1FO0H 1QHPA 2WVTA 4ZMPA 3P9MA 2ZP0T 1OP5K 2DWTA 5GGSY 3FT9A 3RWEB 1YRKA 3V95A 1N12A 4PBVC 1ORQA 4U7MA 1RUAH 4HA1A 3GJFH 4I3RH 4RFNB 4QCIA 5IMMB 2ZWYA 4KPHL 5TE6H 2G0LA 5F97E 4HVBA 4OQTL 4HKBA 2ZOOA 3RNQB 3V6OA 1DUYB 1F2XK 5D7KE 5DD1H 1NIAA 2WOBA 4GO8A 5LAPA 4EE2A 2W60B 3QWRA 4KJYA 3BJLA 5FYLL 1H5BA 4H1LG 3BP4A 4LL9A 4IGBD 2XRAH 4E9SA 4YHNB 5JW4R 3F58L 3NEEA 2X4NA 2ICWI 1D5BA 4WCYL 5JHDA 5ES4B 3HNTH 5F7KC 3O45A 3UC2A 5D2NE 2X4UB 4ENEC 4OU3A 2R2BA 1CFVL 2XNAA 2WIIA 4P49A 4Y2DD 5LGJA 5JR1L 1YUHB 2QVMA 3GIVB 2P8LA 4I5BA 4NQXB 3T4AC 3LEYL 3Q9PA 1LMKA 2R1XA 5L7XH 1E3XA 3IMWA 3ARGB 4KKBD 1VFUA 4G8IA 5T1KB 2R0LL 3NK3A 2QMKA 5GGVY 3ZE0E 3NIGB 4M7JL 1A22B 2I5YL 4OUUA 4I88A 4W6XB 3O0RH 5ICUA 2F8XC 2DQCH 3B9DA 1EH9A 3NMEA 1O75A 3FQWB 3CFBA 5FAAA 5AVTB 2Q8BH 4ENZA 1FA4A 5DJYA 4G83A 3IDUA 2E4TA 1CLYH 1KXVA 4KRLB 4ZI8A 4HBCH 4M5YH 2AV7B 2FTAA 3L4TA 2DQHH 1W8EA 4OJAA 4YHZH 1SDYA 2WBWB 3L3GA 3PUCA 3WEXA 1J5OH 2V7NB 4Z7VE 5IROD 2VO5A 2JVUA 3UCRA 3B9EA 2NDFA 4KVCL 3N42B 2X9ZA 2HLAB 1QSEA 3P4MA 1A65A 3ASNB 4MLSA 3FU0A 5BO0D 4ZW7A 2JJTA 2C1OA 1E7UA 1W0VA 1ICTA 2N56A 1T3FA 4O2CB 1K6QH 5AW0B 3JZYA 4KROC 5I66B 1N68A 3L4UA 3TBWA 3IMUA 2ZXCA 3LXUX 4XPGL 3VXQB 2IPKA 3A6OA 2NTFA 4BGDA 1VACA 1GOHA 3MUUA 1A8ZA 4ZUSB 4NWUL 2XY2A 3KDPB 1FFOA 3Q6GL 2X3CA 1DHKA 5DI8A 3ZDXB 3O4LD 5K33A 3LNIA 4HW6A 2HT2D 1SM3H 5G4OA 4J7RA 2VL5B 3TVMC 3BCFA 2APXA 4C4BA 1R3LA 3EOAA 3PXHA 2DL2A 1E4XI 1CFSA 5E6SB 3LB6D 4K7PH 4AGMA 4OZ4B 2Q86A 3B6SA 4L3EB 4DK3A 4HWEH 1L9MA 1IC7H 1J5CA 1CL7H 1N8OE 2HA1A 3N1GC 4G6FD 4Q52A 3BVTA 4V1DA 1IM3A 1VZHA 3RWJB 2PTTA 2COVD 3E7JA 4MKMA 1BZDA 5K39B 3AROA 4E5XA 2Z31B 4K3JH 4MAYB 3QI9B 3U2IA 3MRFA 1G87A 4PU2A 3QCTH 2VWEE 3GS0A 2A9DA 2Z0BA 1QPXA 1MFDH 2OXHB 2YMOA 4QHUA 4K71C 2DW5A 5FHBH 2MCPL 2OMBA 2GHZA 3IDXL 2YEZB 1Z9OA 4XMKH 2DI8A 1XCQA 1JNJA 1XGQB 1TEYA 4TXVB 1JNLH 2IADA 4LCCA 1J8HA 4K94H 3GK8H 4UINL 3ULUL 1IGMH 4YXLH 1OOWA 3H3PH 4Y16D 3H0TA 4J8QA 5CCGE 4Y4HD 5JXAL 2HP4A 2F8VA 4IRSC 4Y16B 4ZUTA 1MN4A 2Z3FA 2AJXL 1AJ7H 2YBGA 1EANA 1VRSA 5AVRB 5I1HL 3PHAA 4NN6B 2P8MA 3DHMA 4JEGB 2BFGA 4P9HC 3WEMA 4PJGF 3TVMA 2NZIA 4OGXH 3LS5L 2ZG3A 5E4IA 4YL9A 1HU8A 5D7IF 1BQHG 4P2YA 3S88H 5I0ZA 3MRBA 3ESUF 2WNXA 1MI5E 3FS9A 4IK6A 4M5TA 4KXAA 3SD5A 2VDQL 2Y7MA 2VDOB 4HXBL 4Q74A 2AHIA 4K23L 4Q9BA 2B5IC 1CZ8L 2OYPA 3LY6A 2L7UA 3HN5A 1K5NA 2WQUA 4OFYA 4RLDA 3ZUNC 3AS3A 2JJTC 3KBPA 1D3CA 1DBKH 4QAMB 3T8XB 1REIA 3QGVA 2HT3C 3EXJA 5B4MC 5ALCL 3KCPB 1JSYA 2AQQA 2GK0B 3JBG7 4JZNA 4WUKH 2CKNA 2K1MA 4GS7C 5I2IA 2Q5BA 2YD4A 1EVTC 1RZKC 4PFEA 4L5FE 4UT9H 4Z7WA 1CZ8H 4G8FA 3UBHA 2GUOB 4S1QL 3AB0B 3B37A 3MRRB 2IQAB 3HMXH 3OC5A 5D1ZD 2W94A 2D73A 2FJFB 3GMRB 2H2PC 1JP5A 3U9PH 1H8OA 2XX1A 3F3HA 4P9HH 1SVCP 2JKSA 4J2QA 2R0KH 4W9GC 5HHMB 4AQZA 3MKGA 3GXUB 3ZTDC 5J1TC 2FZ3B 2J1XA 5AVYB 2VAAB 5L4MA 1DEEA 3KYNA 5ETUA 5TH2B 4NAJA 3WMPA 2QPDB 3VRLF 2DS4A 2CGYA 5HGBB 1UQSB 1CLYL 3T4AA 2H6PB 3ZYZA 3Q3GB 2W9EL 1DVZA 2LU7A 1BPLB 25C8L 5E8EA 3M8OH 3GJFA 1JI1A 2GT9B 3O11A 2YAPA 4DZBA 4EDWL 3VFOA 3CZJA 1M2VB 5T1MA 2CO3A 4Y8DC 4FA8A 4ZW6A 4YC2C 1YY8A 2E4FA 2XTJD 1JGEA 1L6PA 1CVRA 3FRUB 4W9KC 1OQXA 1I4FA 3E6HB 3FFOA 4KRPD 3SN6N 3II2A 3KM2A 2J20A 3ZYJA 1CMOA 1UXLA 1FNGB 3ESPA 4DEPC 4X6DB 2L4OA 1YAZA 3MRIA 4AYID 1HTYA 4X83A 3VXUB 5E2VH 3UO1L 2EDQA 4JHAH 5BZZA 3TH3T 2E7LA 4XP4H 2ADGA 3X13B 5GJSL 1L0XA 5KS9B 3MI6A 3PDOA 4HLZH 1P4IL 3O9WA 4MD0B 3T0ED 3KZ8A 4Z95H 5HD8C 2O26U 5AENA 4PG2C 3SDAD 3BX7C 4OGYH 1S7QA 3MRLA 2EDKA 4Z7AA 3O3EB 4Q9QH 1M3JA 1SF5A 2OSYA 4HUWB 3VFNA 5CGMA 3IAPA 3EJCA 1UT9A 3CCHB 3S3BB 3VX1A 4AEHH 3HB3B 3LQAH 4XWOC 2ALAA 2E9WA 3VH8B 3QUGA 3GBNH 3ETBF 1QZ1A 3GGWB 2BXYA 2ICES 1XDTT 3W9DB 2D0FA 3STBA 1QQDB 2Z0UA 3UMNA 4KXDA 4EN3B 4ISVA 1IILE 4QR7A 3SOBH 4DT2A 1KIRA 3U36A 4G80B 1FHGA 2HUEA 1HQRA 3QDGD 5DWUL 4QRFA 3WE1A 1PEWA 4M7KL 4R96A 4Y4HB 3IEAA 1TZHA 2VH5H 4OFPA 3FYEB 1WCQA 1K4CA 5CUSH 1MJ7H 3IGUA 4FQ2H 3TOPA 2WXIA 5HDQL 5I1CL 4X98A 3SPIA 2CSPA 3T2NH 3MLZL 3MMEB 3OVUB 4L4VA 5E99H 4KV5E 3SBWA 4BFEA 5LKNA 4KMTL 4NQTA 5DDHA 2HN7A 3AADB 3W5MA 1TFPA 3D8MA 4Z5RA 3V7AE 3B5GA 3MACL 3E6HA 1LO2L 3MLPA 1D5XB 2VGLM 5DR5H 1UT2A 1A6PA 2VXTH 1U8PB 2IDTA 4K94L 3QYCA 3AW5A 4JPKH 3RIFF 2WBXA 4HJEA 2FEJA 2EILB 3H3PL 4LSPH 4P4KC 2YKLL 4QXGL 5DJZB 4HQQL 5CU5A 3DUUA 4YIQB 1R75A 2OMWA 4AY0A 3IYLW 2YJQA 5CP7A 2ATKB 4U0RC 1S8DB 3UERA 2IALA 3V4VH 4C57C 5I6OA 1Q0YL 4NQDE 2P80D 3ZHLA 2V17H 2WGNB 2D3JA 2ICEA 5BO1L 3K6SB 4JFXB 3LZNA 3IJ8A 4NGHH 4TS6A 1XGTB 3CCHA 4MB4A 2OK0L 1HZKA 2C4XA 3LHAA 4FQLH 4OF7A 5EZJA 1BBDH 3QJVB 4Z78B 1N5AB 3BZDA 3CDCA 4O5LH 3M1OA 4MA8L 1PZAA 5JYLA 3GSVB 4KY2A 1Z3RA 3EO1A 3BQUC 1K2DB 2JE8A 3CVIH 4AVJA 2QKIA 5HPMA 5B22A 1KCUL 3CN3A 5DHEA 1AACA 4Z7WB 1U2HA 2IGFH 4D9QD 2XVKA 4LB8A 1TYRA 1RURL 2WTOA 2VL4A 3G6JE 4XRCA 2CWRA 5CP3H 3VD9A 4N5EC 2PW2A 3QPXL 3H2WA 4YHPB 1YPZE 1JVLA 4GRWB 1ZT7A 4XBGA 5B7FA 3IDMA 4WY7H 4DWHA 1WGVA 5IB4B 2VXVL 4NAMA 1IBHA 2NCEA 3ZT5A 1WBZB 5JIIA 4B9JA 3QUYB 1GTNA 1SJVA 3BDBA 3V6ZA 3MXVL 3STZB 2Y07L 1ZVYA 2SEBA 4J1UA 5MI0B 2IALB 2VOTA 3MV8A 4NN7C 2J5LB 3WNIA 1CR9H 1DVUA 2G9HB 3KWXA 4A6YA 4IHBA 3B7RL 4QHLB 3UJTH 4YK4B 3HFMH 3SDDB 5I1EH 1IEAB 2BNRA 1KJ2B 4JFQA 2ZUUA 3W0WD 5KOVC 4G6JL 1HNGA 2B2XL 1A3QA 2Y6TE 1NFIB 4PV8B 3LXBA 3V5KB 1AO7D 2FX8H 2AXJA 4NO2A 3KS0H 2YOAA 5BVJB 4UOW1 3B2XA 4DVBA 4G8FB 1HCFX 4BIKA 5IIEB 1MAML 3SODB 3DO4A 2JJWA 1BD2B 1CE1L 4RISH 1W80A 3O4OB 4BE5A 2AQ1A 1J0HA 1FAIH 5I6NA 2A74B 4JZNB 5LO7A 1PZDA 2XV2A 2BFVL 3RA7H 1T21A 1NEZA 3OKMB 3X14A 2I07B 5IOPA 5J6GB 4LEXL 5F3FA 1YQ2A 4H8WL 5I0WA 3IKCB 3Q44A 1R4XA 1J8RA 2F15A 4QHUB 3L95B 1NQBA 3QXVA 2G75A 2Q10A 4WJKB 4AYMC 4CRPA 3ZKQD 3KYOB 1GL4B 4PMFA 2QLYA 1YEKL 1V3KA 1ZA6B 3F04A 5D1ZC 4ADIA 3PHSA 4ODTL 3C2AL 3D0AA 2K6WA 3LH9A 4MSWA 5CR8A 32C2A 2AEWA 5IBLC 1YNLL 4JRXA 4OR1A 1J12A 1KACB 1XR9B 1P7BA 4X7SL 3TLRA 3MRIB 4HPOL 2FD6H 4M1CD 3PQYA 3HC2A 3LZRA 3T09A 1YEJL 4WO0A 1CF1A 4FA6A 3AQDA 3Q5YA 3KPLA 1DQIA 4Y2DB 5FS5A 4BRJA 1CWVA 1QFPA 3TIDB 1I4FB 3HC0B 3K8LA 1YPZA 3JTSB 3PWVA 3K6FA 4FHJA 3BYTA 2BNUA 4XWGH 3QT2A 2OZ4L 5FGRA 2E7DA 3QDMB 3QQ4B 2ZJSL 1UGKA 4EI6A 4EMZA 1Q9KB 1J9CT 3L4WA 4YEEA 4BZ1A 1RZKL 1T0MA 2OTPA 1RUAL 5AQ0A 2W9LA 6FABH 2V4LA 3B3BA 3VFRB 3W0WB 5LN4A 4RWYH 4LDCA 1H15B 4QXTB 3WIHL 2RH0A 2C9VA 1TTGA 4WU7A 4JE0A 4LPCA 2BHYA 3V0DA 3BT2L 3DX9A 3JTTB 1MCNA 2NY1B 4KKRA 3CFBB 1RU9L 2BY1A 2YWYA 4HHGA 4F58L 4R4BA 1I85C 5CUSL 5E8OB 5HYJA 4R90L 1CXKA 1R5VA 3GMRA 4NQSB 35C8L 5I18H 3GUTA 3FAXA 3SBWC 1X5IA 4LKXA 2C7UB 4DPCX 3EYUL 4G72B 4JFHE 1OM3L 3TJHC 4LFHG 5M95B 1NPUA 3APCA 4LF3B 4U33A 4H5SA 5FCUH 1XIWC 1FLTX 1DJHA 4G43B 4MAUL 5KVGE 2R2EA 4P5MB 5A40E 2VXTL 3BT2H 3PL6D 4LSDA 1B4JL 1IGJA 2B08A 4UT6H 5FKPB 5L2KE 2UV3A 1RK1A 1A4AA 1W0VB 2G0KA 4AKQA 1KFAL 3U0WL 3ISWA 3KWWB 5HDBE 2FNWA 3TYGL 1NAMA 1D7BA 1JK8B 1NGYA 3B2VL 2F58L 4BWUA 3EYQC 2L04A 1KB9J 1G9MH 2NUTB 3TCLA 2IQ9L 3BZ4B 4XN9A 2FBRA 3LHPL 1E3ZA 1QSFA 4PG2A 5ELIA 3WXWL 1GC1C 1D5ZB 2FT7A 4YL4A 3D7PA 4LCUA 4RRPG 5DJCB 2FX9H 4KBPA 3WKML 3O9WC 1B4JH 2EDRA 4HJUA 4A68A 4DZ8B 3ZRFC 3CHQA 3Q48A 2VUYA 2VYRE 1AFVH 4HYTB 2VJ0A 3L4XA 4XI5C 3L1GA 1GSKA 3FQYA 1UA6H 4KROD 1X7QA 1JPFB 1LVEA 4PJFA 4XNAA 2A9ML 5ANMB 4G7RB 3HR6A 3EJZC 1MCPH 4ZDHA 2BSEA 4KKLC 3ZO9A 3EYOA 4ZZKA 5KVEE 1B6UA 1MJJB 4O00A 3QNXA 5I16A 3ECUA 3OJDA 1XF4A 3MU3A 4FTVB 5T5FA 5JMOC 2OTWA 4HOWA 3S3JA 5KS9E 3EJRA 1X4XA 4FYTA 1QSVA 2Y5TA 5C0BD 4BSJA 3D0VA 1G0XA 5EO0A 5B3JF 3MTXA 3CHPA 1OGTB 3MFGB 4L4TD 5CBEB 1I1AD 3BVNA 4HG4J 2GSIB 4JZJB 3K2IA 3VXMD 2APBA 3WSQH 5D2NC 5FA4B 5C7ZA 2P26A 1DQLH 2DQGL 1CGVA 1LEKA 3LKRB 3CLWA 5D7LE 4HWZB 5IM7B 2FEEL 2E7BA 1AKJB 3DRQB 4ZMTA 1RK7A 1EV2E 5KJRL 2C3VA 1G1KA 3TNNB 3ROOB 2W8CA 2FX8L 3U82B 1R24A 2PMZA 4R4ND 1ORQB