1PLCA

Accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Accuracy and precision in protein structure analysis: restrained least-squares refinement of the structure of poplar plastocyanin at 1.33 A resolution.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1992-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plcA00
3V9CA 1ET5A 2FWLB 4EF3A 1RCYA 3HB3B 1L9TA 4WKXA 5D4JA 2R7EB 1KDIA 2UXGA 1W6LA 3SBRA 1NIDA 2CALA 4YSQA 2BHFA 2EIKB 1NWOA 1OF0A 2OV0A 1HAWA 1KCWA 2XYBA 1JOIA 2IWKA 2PPAA 2QDVA 2QPEB 2WO2B 2UXTA 5B7FA 1PAZA 1SDDB 5I6LA 1FA4A 1CYWA 3FYEB 1JVOA 2AZAA 5AFAA 1KYAA 1SNRA 4WTQA 4FAAB 1QNIA 4E9TA 4DP8X 1GS8A 1PLCA 2GB2A 2CCWA 2XVBA 2ZWNA 2DWTA 1KV7A 4A2EA 3T71A 1B3IA 1OE1A 3D12B 3S8FB 1JZEA 2WSDA 3L45A 2I7SA 3IEAA 3TBCA 1RZQA 1ZV2A 1M56B 1WS7A 3EH5B 3FU7B 4P5SA 4BXVA 6PCYA 3EH4B 3PAUA 4Q89A 1NINA 1ZIAA 3S3BB 4YSUA 3RYMA 1E65A 3ABKB 3BQVA 4A2HA 3GYRA 7PCYA 3ABGA 1MZYA 3EH3B 4GP4B 4AKPA 2LLNA 1BYPA 1PLAA 3ABMB 2IDQA 1BAWA 2AANA 4G7RB 3QJTB 1NPJA 2DWSA 4N8UA 3N2JA 2BP0B 3WI9A 1PCSA 4GYBA 2J55A 1OCZB 2DYRB 3EF4A 2PPEA 3NSYA 3CZUB 3S3DB 3IN2A 4YSPA 4E9XA 3G5WA 1BQKA 2NRDA 2UXVA 3OD3A 2GC4C 1JXGA 2IDUA 3V9EA 2IDSA 3NJNA 1ZIBA 3AW5A 1TEFA 1M9WA 3AG3B 1NIFA 3NJIA 2I85A 4BWWA 4DP6X 3DIVA 4JHVA 4AKQA 5I5MA 4GXFA 2FQDA 5D4HA 3OM3B 2FJSA 1L9PA 1ZDSA 1XMEB 1RZPA 2IH9A 3FPYA 2CAKA 1AACA 2VM4A 3T6VA 3ZIYA 3NSCA 2VSKB 1NIBA 5I26A 4X4KA 5I5IA 4DPCX 1GYCA 3QJUB 1IC0A 3PLYA 1GS6X 4UAHA 1ET7A 4PAZA 4AI7A 5I6MA 3AG2B 4YL4A 1X9RA 2IWEA 1ASPA 1PLBA 5B1JC 4YSAA 1PZBA 1NDTA 2IH8A 1KBWA 1PNDA 2YAOA 2IDTA 5FC9A 2YXWA 4HCIA 3WG7B 2AVFA 1SF5A 4DP5X 1FFTB 5E9NA 3X1NA 3IBOA 4G71B 5F7AA 5B1BB 3BVDB 3NJFA 4YSEA 2QDWA 3FU9A 1JERA 1SFDA 2HXAA 3MX0B 4AKOA 4BDVA 4FA7B 4DP7X 4F2EA 1W8EA 4KO7A 2DYSB 1A4BA 4K9JA 1OCRB 1AS8A 2EINB 2HX7A 2BP8B 3C75A 3U25A 1JVLA 1AIZA 3UACA 4W1TA 2YQBA 3NSFA 2H3XC 1CC3A 3NT0A 2AZUA 3DKHA 4HIPA 1XB3A 4NAJA 2XXFA 2BW4A 1ZDQA 1PZCA 1BXAA 4DP1X 2PP7A 2DV6A 5B1KA 1ET8A 2XV2A 1J5CA 4L0PB 3QJQB 3QQXA 1W6WA 1NIAA 4HCGA 4KO5A 4TXVB 1RKRA 4A2DA 1PF3A 3NSDA 3S8GB 1KDJA 2PPCA 1WA2X 3CDZA 4P5RA 4AZUA 3TU6A 1MG3C 4YSCA 2QT6A 1SJMA 4UANA 1TU2A 3GXUB 3PCYA 2EIJB 5LDUA 4E9RA 8PAZA 2R7EA 1DZ0A 3X1GA 4DPAX 3UABA 3UAAA 1NTDA 2E86A 2EIMB 5TK2A 5TK4A 3WIAA 1GY2A 4E9WA 2OCCB 1SFHA 2TSAA 3QJRB 4DPBX 3NJMA 1GS7A 2VMJA 2J56A 2YAHA 3PXLA 1YLBB 3OMAB 1HAUA 2A3TA 1L9OA 1BYOA 2IAAC 1XB6A 4BK5C 1IUZA 3JT2A 2UXFA 3NYKA 4JHUA 1ILUA 4ENZA 2FQGA 1IKOP 1NICA 2PP8A 2GHZA 2J57A 2XU9A 3IN0A 1QHQA 2UX7A 3WKPA 3X1FA 4M4RB 4CSPA 4QLWA 1M57B 4KOBA 2I7OA 4DP4X 1J5DA 1AR1B 2BWIA 1BEXA 2YAMA 3ZBMA 1TEGA 2XX0A 2BO0A 1MDAA 2TSBA 4G70B 4E9YA 2FT7A 3NJLA 3PAZA 6PAZA 1JXFA 1KGYE 1HFUA 3KW7A 1QLEB 2X87A 5AKRA 1URIA 2JXMA 4E9VA 5AZUA 2MTAA 4YSOA 5F7BA 2Q9OA 3FSZA 2PPFA 3UADA 1FWXA 3FYIB 3CVCA 3SBPA 2XUWA 1L9SA 2W8CA 2H5UA 4E9QA 3H4HA 5I28A 3PPSA 2AFNA 2HRHA 1CYXA 1WAEA 3H56A 1AZCA 2ZXWB 2FQFA 4BDVB 3NJKA 2GI0A 3IE9A 2YAFA 1R1CA 1AS7A 4HCFA 4JKNA 3T6XA 1V54B 5I6PA 5B3SB 3HEIB 5B1JA 5A7EA 2P80A 2XWZA 1KBVA 4HHWA 2IWFA 1J9QA 2ZOOA 4W9ZA 3TASA 1AZBA 5I6OA 2YAEA 2YARA 4NERA 1J9SA 9PCYA 1L9QA 3NJHA 3WNIA 3ZX1A 3CVBA 2VW6A 3AG1B 3FU8A 1NIEA 1L9RA 4NB7A 2YAPA 1AS6A 4GP8B 2GC7C 4DP0X 1ETJA 1A4AA 1E67A 1GSKA 1OE2A 3FPXA 3FSAA 2PCFA 2JFCA 3X1EA 2FT6A 1A4CA 1WA0X 1N68A 3FQYA 4YSDA 2XV3A 5I5JA 1AANA 2Q5BA 1ADWA 5I6KA 2FT8A 3NJGA 4DP9X 5B1AB 1BXUA 2CBPA 2YXVA 4YSSA 1NPNA 3PAVA 1ASQA 1JZGA 2CUAA 4HZ1A 3ERXA 2HLEB 2VW4A 3FSWA 3OMNB 2WO3B 1AG0A 2FQEA 2P80D 3EHBB 1AOZA 1WA1X 3SBQA 4QKTA 4F7KA 2RACA 3ASOB 3T6WA 2B08A 4YSRA 3UAEA 1KCBA 1E5YA 2B3IA 5EHFA 1A65A 1OCOB 1UATA 1EHKB 2VM3A 1VLXA 2J5WA 1ILSA 2HX9A 1ID2A 3T9WA 1A3ZA 2QPDB 4A2FA 5IY5B 4BXSV 3FSVA 3NP4A 3T6ZA 2ZONA 3QJVB 2Y1AA 4ZK8A 5I6NA 3FS9A 3ABLB 1ASOA 2BP8A 1CURA 2VSMB 4G7QB 1PMYA 4DP2X 2BZ7A 2EILB 4KNUA 2HZHA 2BW5A 3QJSB 2W88A 1TKWA 3ASNB 3ZDWA 1GY1A 2GIMA 1SDDA 1IBYA 1XB8A 1OE3A 1AZNA 2N0MA 4HHGA 4A68A 4Q8BA 3CG8A 1AZUA 3QPKA 7PAZA 4KNTA 1N70A 1I53A 1F56A 2PCYA 2VN3A 2XLLA 1JZIA 4HALA 4N4YB 5D4IA 4YVUA 3TBBA 1GR7A 1V10A 2PLTA 3WNJA 1SF3A 1JZHA 2VW7A 2YAQA 2IDFA 3FU7A 1BQRA 1E5ZA 1J9RA 1T5KA 3SQRA 2MRYA 3OQRA 1NZRA 4HAKA 3GDCA 1A8ZA 5ANHA 3N55A 1JXDA 2XV0A 1PZAA 3X2QB 4G7SB 2GBAA 3CVDA 2H47C 4G72B 4AX3A 2BWDA 3MBWB 1ZPUA 2XXGA 1X9UA 3FQ1A 4KO9A 4BWTA 2BP0A 1WS8A 2BZCA 4BWUA 1AG6A 2XX1A 5B7MA 1PNCA 4MFHA 1OV8A 2Y69B 1JZFA 2HRGA 1OOWA 4A2GA 3UGEA 1OCCB 1BQ5A 3AY2A 1AQ8A 4A66A 1IBZA 3FQ2A 3OMIB 1AZRA 3S3CB 4M3HA 2JKWA 4KOCA 3NJJA 1NWPA 1JZJA 5PAZA 1J9TA 1MZZA 3TA4D 3AG4B 1CUOA 5B7EA 4F2FA 2CJ3A 4E9SA 2FTAA 1GW0A 3JTBA 5PCYA 3AZUA 2FNWA 4RH4A 4YSTA 1V55B 2HX8A 2UX6A 2PPDA 1SHXA 4YVNA 1DYZA 3FT0A 4UF7C 3X1BA 4A67A 3KW8A 3DTUB 1BXVA 1E30A 1EZLA 1SHWA 1MG2C 4KNSA 2PP9A 1AAJA 4GP5B 4GY4A 2X88A 4PCYA 4CSZA 3WKQA 3CDZB 3H4FA 4KO6A 2OJ1A 2GSMB 3NP3A 2DY2A 1PY0A
chains in the Genus database with same CATH superfamily
3VQMA 4BQ6A 1C5BH 3JWDC 2VXUH 1KIQA 3BH4A 1ZGLA 1HXYA 4PWEA 5IQ7H 2UXGA 2MWCA 4I7ZC 4FHKA 5FUCE 1DO5A 2BVOA 3HG1D 1KCVL 3V4VB 2VQ1A 3CMGA 4Q2ZB 5IB2B 2QJDA 4LSRL 1A47A 3V6ZB 1E4XI 4KI1A 3WIHA 2WO2B 4ZW6A 1U3HB 4MJ5B 3QEQE 3MA9H 4PJIA 5EZLA 4FHBD 2EDJA 3BDYH 1TZ8A 3EUUA 4OFDA 5EZJA 4HJTA 4ATTA 1GYVA 1QNIA 2DLTA 5TFSL 2E7LA 4JGMA 5AW2B 2NT0A 2WVVB 3LN5B 4KJQC 2DWTA 5KSUB 3GMRB 3L5HA 1CDCA 5CWSA 1TYRA 3UZVB 2D73A 1CDIA 5E6ZA 5FCUH 2OTWA 3TCXA 1ZV2A 2GITA 3EH5B 3MACH 4HOXA 2CDGB 4ZNEA 1W72B 2JI2A 3MGAA 4F1ZA 4YLCA 1K2DA 5EUOB 3GSOA 2JXMB 3D4CA 4L29A 3PP3K 1QSEA 2E7CA 4PRPA 4GP4B 5TH2B 3IDNB 25C8L 3IS1X 4JLRA 4W9IC 1ORQB 5CBAB 3JWOL 3IVKA 1CLYH 1PLAA 2ZUQB 4P4KB 4OM1L 3QJTB 1DVFA 1U8HA 2GW5A 1NFDF 3MYJB 1QTYT 4HCRH 2UZYB 3AGWA 1SPDA 1E9PB 1H3WM 1NCWL 3MCKA 2W59A 3OZ9L 2FNBA 3PU7A 4NUJA 4C4KT 2OYPA 2XWJA 3MROB 5ICZB 3NK4A 2H1PL 2ITFA 1LEGB 3BMVA 2QSCL 4JO1H 5F6HJ 1SXAA 5B22A 4MA3A 5CN1A 3TS8A 2XTJC 3I2CH 1YY9D 3DO7A 2APSA 3MO1A 4O00A 4OZFA 1GAFL 4PLKC 4JO8A 4HGKC 2BNQA 2OMZA 2X53A 4IKIA 5CJXA 2IDSA 4MB1A 3C8KB 4UZSA 1KLGA 3DIVA 4LIQH 2D03L 2E4TA 3CZSA 2VKXA 3ARFA 2D2CC 3RURA 3B2DC 4HS6A 2N7BA 4ENED 2VSKB 3NPSB 4O02A 4X4KA 5I5IA 1G87A 1JWUA 1OQOA 3ZKNC 2JJTC 1ONQB 4WWPA 2FB4H 1UA7A 2FWSA 1KG0B 1Z9SA 3GSRA 3PLYA 3QNXB 3MV8E 2WAQA 3I6KA 1H9VA 3NFPA 1BF8A 1XIWD 2O5ZL 2Q20A 4YSAA 1LDSA 1TVHB 2EUXA 1S5IH 4LKXB 2DWYA 5I1KL 1XH3B 2JQAA 1R5IA 2W0PA 4GAAA 2LTQC 3D3VD 5BVJA 1FFTB 5SX5K 3PV6A 4RESB 2BXZA 4F15C 3BWAB 4OLYH 4DESA 5B1BB 5L8KB 5D1ZI 4YSEA 4YOKA 2C3GA 3BPNB 4HWBA 2X3BA 2LAAA 4P59H 4S1DC 5EZPA 2XRAL 4JHAL 5AB9A 4NKMA 1S4IA 3OBAA 4FTVE 1OT2A 2PO6B 2DMKA 3DHMA 1QFWI 3CX5K 2EDOA 5ECGA 2J8UB 4L3AA 4R8WL 5HGBA 4I8DA 1LEIA 3P9LB 4OF5A 1U2CA 2COQA 3CAFA 2FGWH 2W81C 4R4NC 4Y2DD 5AVUB 3HPJA 4U2YA 4XPGL 3LH2L 4QUOA 5H94B 1ADQA 3WENA 2VMCA 2XFGB 3M6DA 4XNQB 3ALWA 2ZCHH 3G5YA 2ENPA 2J71A 3LX9A 4FQ2L 1KLFA 3VXUE 4XH2A 2F7PA 4I18B 1IAII 2G0KA 3Q8BA 3IFNH 1RJCA 1E3FA 3B1TA 3LNEA 3T4AC 1H3GA 5L8LB 4JJOA 4R83A 3SKMA 1PZ2A 1T3FA 3NZ8B 4GT0A 3BXNB 3VAEA 4HZAA 4WDIA 2WXGA 3CVIH 4LVOC 4I3SH 2HRPL 4HUVA 1MPAH 3L4WA 3FZUD 4XPBH 1BEYH 2A5UA 4YZFF 2YBGA 3WELA 4WWKD 4OW6A 4DIXA 1HWHB 4UIMA 1UURA 1AO7A 1NGPL 2BSED 2FLBT 3MYZA 4UANA 3HG4A 3ET9F 3PJNA 2WAHA 3CXHJ 2G60H 1RUMH 4X4YB 5IFHH 3KCPB 3EGDB 4BZYA 4LGRB 3T65A 1KTDB 4M00A 2VXQL 3N44F 1DJWA 3RFRA 3QWNA 1CFMA 2IH1A 3GK8H 4PJFA 4L3FA 1AIFA 5AD0B 1DEDA 2SEBB 5D7LD 2P43B 2WXQA 4MNQE 4NZUH 3ZZSA 4HU8A 2YUWA 5TK4A 4X5WB 2RA1A 3UPCA 1RZGB 5GSRB 1ZS8A 1S8DA 3SE4A 3QCTH 3JV5A 4FFVD 5IHWA 1YLBB 1HAUA 5DJ2A 1TDQA 3LB6D 4GLRH 5DRXA 4DO6A 3O8XB 3VD7A 4WUUD 4S0SD 4U6YB 1R46A 3T0AA 3TBWB 3LAFA 3D0VA 3IN0A 1NDGB 4GAGH 4PN6A 2ETWA 3CC5B 4PJDA 1YMME 2I7OA 4HJGB 4JVUA 1UXMA 3MFGB 1T0MB 3X13A 5JZ7D 3VFRA 1WRFA 2K9UA 3ISYA 4XNYL 1GH7A 1KULA 4TNVK 1BZ7B 3EOYG 4K23L 4NM8L 4OLVH 2WW8A 4OSUH 2OFQA 3OJDB 2YA1A 4UBDD 2G75B 1MIMH 1R3IL 4R0LA 1IGTA 2W80C 3O2VL 4ZOAA 3UADA 5KUKA 2H2SD 3DOIA 1NCUA 2UWEB 5IIEA 3IFPA 4MXVE 1EAQA 3T1WA 4LSUH 2OSWA 1L5GA 2WLYA 2IAMA 1JTPA 3WDJA 2HRHA 4P2RE 2W0KA 2PWEA 5EWIL 4HBQA 1LEKA 3WTYA 2L04A 3BRFA 3GIZH 4JFEB 2GSIB 4F5CA 1IFGA 2W65B 4YPGB 2XETA 2Z93A 3UBXB 3MLVL 4NGHL 3I75B 1UD3A 2VNCA 1OAZH 2IIJA 5GIRA 4TULH 1X7SA 3HAEH 1GTNA 5HYJE 2NY6B 1EAJA 1L9RA 1XGPA 2ZP9A 3F58H 2YKKA 4UQ9A 2AEIT 2CZNA 1A4AA 3V4PB 2X0VA 1E67A 3SZ6A 3DVNB 2G5UA 3NRFA 1HEJC 4O58L 1FNAA 2E6QA 1A4CA 2FJHB 2CDEB 3T3PF 1EJ6A 1ADWA 3GMQB 4LCWE 3L08A 5CF3A 1K9TA 2W9DH 2ZWLT 3HZMB 4U1GC 1ASQA 5D1XE 2PN5A 1IBDA 1QBML 5IJKC 3RBGA 2ED7A 4OJFL 3VG9C 3DSNA 1CGWA 2H45A 5MERB 5J1AB 1R5VB 3I9GH 1IGIH 3LXBA 4JBSA 4QKTA 2C4FU 2H1XA 4PW4A 4N3TA 1R9FA 2VDRH 1GGCL 1A2YA 2XWRA 2ODHA 1PD6A 1MAMH 2K7PA 3B9AA 3MZTA 4TM9A 4WSKA 4F9LC 2A6IA 1NDMB 1U8MB 3MRGA 3MLXL 3NMEA 4JDTH 1AY1L 5GZND 4OQTH 3LS5H 1VFAB 1ZV9A 3Q6GH 2D0GA 4LP8A 2CKBB 3QXAA 5IQ9A 2VM3A 4Z78A 3Q8AA 1G9NH 3GXMA 5EO1A 2YLKA 1HHGB 3RE0A 4PRNB 1TQVA 3RDTA 1NGWA 3FO2B 2R0KH 4HIQA 4WJKB 1DBAH 5GRYA 5BOPA 4YXLL 4JM2B 2FD6L 1SLXA 4K94C 3EG9A 3WIIH 2DLGA 4DP2X 4I2XE 5L2JB 5E94A 5I75B 4I0PA 1ES0A 3OHXC 1KXQA 1JV5A 5T3XL 3OR6A 2P7TA 2OW6A 3I6GB 1CI5A 4L5FH 4NDMA 3TIEB 5DJ6A 5DFTA 2CNYA 2CJSA 1FNSH 4F37F 1OM3L 4C4BA 4CJ0A 3CDGB 4JFYB 4Z23A 1EDYA 4WV1B 3ZKXB 1YMHB 1I7RB 4PJ8D 2YO3A 1KXTB 2DQFB 3B2VH 2FHBA 3C5SB 5I66A 5IJVA 1J8KA 3OX8A 1EHAA 1KGCE 1NC2A 3Q48A 2AXJA 4C56B 3TNNA 2KDGA 3TV3H 1AZZC 4F7EA 1CLOH 2V2WA 4ZUSB 4ZMVA 4P5MA 1FO0A 1U8LA 2WGXA 2K7QA 4F1SA 3GSXB 2X6UA 4CKQA 1XIWC 4R4BA 1F4AA 2VDLB 3SQRA 1TTAA 5D5MA 5E8OB 2X4OB 3KYMB 2YEZB 5FK9A 5HHOD 1CE1H 3GB7B 4NQCA 1YEDA 5HGGS 2MCG1 2YMTA 1SQMA 2C34A 2WQUA 3BSZA 2AMGA 1Q9LA 4QNPE 5IF0B 1H8OA 4K7PX 5DWUL 3DOSA 4M8RA 1UA3A 1QZ1A 2K4WA 4H26A 5SV4A 5ABZA 4BWTA 5J1SC 3D4YA 4L4JA 1XHHA 3VYPA 4HJSA 1MCCA 4IRZA 2V5SA 4EE2A 1M2OA 2BVEA 4G5ZL 4HLJA 1UJ3C 4DWHA 4N2DA 1TJHL 3OG4B 2JLLA 4JRXA 3SOBH 1BQ5A 3AY2A 2WLLB 4X4XA 2RMNA 4BSWA 1XF2B 1KJMB 4LSPH 4UTBH 5CINL 2P5WB 4KPHL 5C07E 4Y2DC 1F4WL 4DN3H 1VB9A 3JSSA 2IPTH 4LIQE 5IEHB 1U8IB 2UZPA 1ORSA 5F88B 4NN6B 1RVFH 4HIJA 5AAWA 3OAZH 4CADB 2GBTA 5PCYA 1YY8A 4ZS7L 4KKRA 4TF4A 1FG2B 3QQ9D 1YJDL 2OZ4H 1U8CB 3KPRD 4UDTB 2CK0H 1DSFL 5KJRL 4IU3A 2I07B 4YO0A 1HIMH 1ED3A 5LLIC 1BXVA 3S36L 4AQ8C 1P7HL 4KNSA 2F8VA 4IYKA 1JNHB 3OB0K 4HJUA 2X88A 2R1XA 1YO4A 2D3JA 1BVNT 2Z1PA 3CDZB 3FZUC 2BMKB 4R5TA 2OXGA 4C83A 1PQZB 5E5MA 1PYWB 4KH2A 2UY7B 2G9KA 1IBGH 3IS0X 1KN2L 1U8NA 2O6PA 4W9JC 1MCJA 2PKDA 3HI1A 5CJQH 3W2DL 2QVIA 4G1MA 3WHE0 3GMMA 2VDKB 3AT9A 1TNMA 2VIRA 4YIQB 1IJNA 3TA3C 3H54A 5GJSH 2EIKB 4OB5L 5GISH 4FNLL 4M3JA 4APQD 3DSFH 2QDVA 4X7FC 2BFVL 1SY6A 3RWHB 4EBQL 5AW1B 5B7FA 5BQ7B 4I3RH 1WZLA 2GUYA 4XGZB 2L7EA 1JWSB 3RWFA 4HUUB 2QHRH 4FFVC 4JFOB 2VDPH 5D2LF 1FIGL 1L9MA 2Y3NA 2EC9T 4P2QB 3BFOA 5I2IA 1TQCC 3LB6C 5MEQA 1PG7L 1HN1A 1S9YB 2VN4A 5D6CA 4Y1AE 3RILA 3T0EB 4OCWH 5K59E 1BQHA 4TSCL 4XCNB 3UBXG 2RHEA 1GGIH 4G59C 4A2EA 3NFSH 1QZNA 3W39A 1QW9A 3IMWA 1B3IA 4N90E 4ZAKD 4M7LL 4QGTA 1GOHA 1OQXA 5JZ7C 4JPVH 3IEAA 4QRRB 1N7ML 1RIHH 4M6NH 5IUCA 2OMYB 1BVOA 1J0KA 1Q9WA 2Y72A 2BRRH 3DARA 4PRIA 1RZKL 3OVUB 1DBJL 4GKOA 4CSSA 5ISZD 2G5RA 4Q89A 4YDMA 2VLKE 1BJMA 4B95C 4HLEA 4UBDC 5DHYB 5FYLE 2EUVA 4HIXL 2D7QA 3BQVA 1F6AA 4TPRL 2AGJL 2HKHL 2H2SC 5DMGD 1C12A 2MPAH 2AJZA 2R4RH 3O3UN 4K3EL 3VWKD 4FXLA 4AEIL 3C12A 4GSXA 4NQXA 3W56A 2NX5A 1NFIA 5ITBL 2ZOLA 1KXVC 3BZ4B 3WI9A 3TJHD 1BIIA 4H20L 3ARDA 2Y5QA 5DK2A 5AWNH 1UHVA 2VLJA 1EXUB 4QOKD 3AUWB 2Y5EA 1PLGL 3DX2A 4WEBH 4ZBJA 5SWZB 4G8EB 4GEIA 3UZQB 3NCJL 3BQUA 5C9JB 2MOVA 4OFIA 3OAUH 2NUPA 4BUGA 3NOIA 1KEML 1KTLB 1MNNA 3F7PC 3QCUL 1V3KA 1MH5B 3AW5A 3R4DA 1RIUH 1TEFA 4FFYL 5F8QC 2EDFA 1NIFA 3I84A 3APFA 1BECA 4QTHB 5GGSA 2NLJB 2X4TB 1UVQB 1A8JH 3X11B 3BPLB 5KSBF 3N85L 3D39B 5G2NA 1AHWB 1ZDSA 3CLEL 1AGCB 1FNGA 1R3JA 3ES6B 4FX5A 4U6HB 2ZOUA 4CC0A 3EGXB 2BIOA 1EJ8A 1JTOA 4HPOL 5I1DB 2HT4D 3F8UB 1YEGH 3FSOA 6FABL 4X83A 2DI9A 3EYSL 3AG2B 3LPOA 4XMKH 4R5XA 2BDNH 3H9SE 4OR1A 3TT3L 2XKNA 1H5BA 2DOCA 5BXFB 1KB5L 3FHEA 3I3BA 1P5UB 1EHXA 4WTZA 4HCIA 3ZE2F 4PB9H 2AVFA 1N19A 4DP5X 4KMTH 2RQ8A 2WBJA 2Z3FA 3RZCA 4L3EB 2J6WA 2X09A 4KXDA 4ZQKA 3X1NA 2ZKHL 3FFDB 4HWZA 2ZOKA 5GZNC 1RJZA 1CU4L 1IGML 2GAZB 4WI5A 3BVDB 3ROLA 1BF5A 4AYGA 1MWAB 3P9WB 4H8PA 4P9HL 5CUSH 3U4BH 4L4VD 3WO4C 3KHQA 4YHPA 1HSBA 3BP5A 1D6EA 2IOOA 4KO7A 3FO9A 4K9JA 2EEXA 3FCTB 3FT3B 3QFJB 3QUML 3WL9B 3VFSA 1F02I 3CFKB 1SN0A 3D85D 3OXRB 5JMRA 3DXAD 3KNBA 3U0WL 5AB0A 4DVRL 4NPJA 1N5AA 3FTYA 3HN5A 1VGEL 3QEQA 4HT1L 4K7PY 1SMDA 3EOBA 5AL8A 3DX1A 2OYMA 5EEZA 4LK4A 4P9MH 3ETSA 1VA9A 3SDCB 3Q9PA 5D70L 3QIBB 3CZJA 1TJXA 4K5MA 4ODVL 5CSZB 2F5BH 3H53A 4PJ8C 5GS2D 4HYTB 1CLVA 1T0OA 2VUKA 4TQ8A 1PJWA 1QFHA 4KKQA 2X38A 2IFGA 2C4XA 4OD1H 4DO5A 1YSOA 3M07A 3MJ9H 2ZAHA 1LDPL 4YSCA 2CA3A 4ZUUB 4DEWA 4EQ2A 4POZD 5J13C 1FDLH 3JTTB 1QRND 4IU2B 4ZPVB 5FXCH 2Q0ZX 3PCYA 4MSWB 3G6JF 1CFQB 2HFFA 4HJJH 1EEYA 1G9NC 2GY5A 1HZHH 4DK5A 5L4FA 3L4XA 4F7TB 4PS4H 2HH0L 4QRQA 4J3SA 3QPQD 5KUMA 4GFTB 2LU4A 3O2DA 1A9EB 1SBBA 2H8PA 3WUWB 4K7FA 4OBRA 2VR9A 4YHIB 1CICD 4UOZA 4HH9B 3QUKA 1R75A 5L9DL 4G8GA 3ARED 4R2GD 1MHPH 1IUZA 2A6DB 1KY7A 4BK5C 3VDBA 1ILUA 2Q2LA 2JJUA 2WXNA 1ZT1B 3H8NA 4QO1A 5DFVD 1VDGA 5AKTA 5IVZB 3S4SA 3Q8EA 3K2IA 3SGEI 3JV4A 4L5FE 4PJGE 1G0DA 1JZ6A 1M57B 5CILL 1AR1B 4YX2H 3CMOL 4BH8B 4J3VA 3AB0C 4LLUB 4NPYB 4O51B 3JQOB 3BH8A 4HWUA 4JY6A 3VXNA 4UQ2A 1MCHA 2Q7YB 1AI1L 3B6SB 4UAOB 4CVZA 1BG9A 4FI6A 4PGDA 5HVGB 5J1TC 3KYOB 1KCSL 2AJUH 35C8H 2NY0B 3QQ9C 3AS1A 4AQEB 2ERJB 3KAAA 1OARL 4M62L 2V5TA 4DEPC 4QXUL 1BJ8A 2Q3ZA 1F3JA 1X5ZA 1UKSA 4GQ9L 2AFNA 3CUPA 4FJYA 4WO4B 4JG0H 2AK4E 3QNYA 2AXFB 1RK1A 5DK0B 4WSJA 4HUCA 2CK2A 5I1CH 5F7KC 3ULVL 3WTVA 3HMXA 2F7OA 1D5MB 1KJ2B 4UQ3B 2A4EA 2NY1B 2YD2A 3MLTA 4Q74A 1EK3A 2PYED 3QHFH 2GJJA 2PR9A 2RJMA 5ABAA 3DTXB 2ZCKH 3E38A 3MRHA 4DUXA 3L3OC 4P5KA 5C08E 3BP4B 3W38A 4PVNA 3IDMA 3ME0B 4JQVC 4JZOA 1OXYA 1UEYA 2YN5A 4Y2NA 3V4UL 4G11A 2ADGB 4Z7WB 5IJBC 4APQC 4LSTL 1B2WH 1NCTA 5KOMC 2FX8H 4X4ZA 5D2NA 3CXHK 2Z0BA 5E2TL 1NBZA 1UM6L 1T03L 2MJWA 2EZ0D 4BQ9A 5EPMA 4MVBD 3MV7B 4EN3D 3RWJA 4EKJA 5J7CC 3WN5C 1CFTA 3PWPB 2AJ3A 4F58H 1AGFB 5DT1H 3ZE0B 4KI5E 1Y07A 3L5WA 4XVOA 3DDFA 5FLVA 5CEZL 5F3BA 4BK4A 3ARVA 4ZAKC 4JO4L 3TYGL 4BZ1H 5FYJE 1WLHA 1FL6B 1ZY9A 3DX6A 3QQ3B 2BZDA 4P05A 2VW4A 2CA4A 3VSVA 1UWGH 3L2LA 1C1EH 4N9GA 4U31A 4ELMF 2V7HA 1A4KA 3QXWA 4XBEH 1A6WL 4P2OB 4MAYB 4P04A 3J07A 3T4AA 1YYCA 5DMGC 4I85A 4G43B 5F7DA 1P6WA 2ZSVA 4RRPA 3U7WL 4HUXA 3VWKC 2E56A 4NAMA 4K73A 2W1NA 2YD7A 5ADPL 4XMLH 3SDXF 4R97B 5B3JE 4PJ9D 3UO8B 1VGKB 3TJHC 2BLFA 2ED6A 2PWFA 3IE4A 1G7LA 4WJ5A 5ESAA 3VCLB 5LN8A 3HUJE 4LBAA 2WNXA 1JJUA 1MFDL 2ZONA 4I13B 1SDAB 4DZBB 2YUVA 5IFJA 3Q5TA 1DDTA 5E99L 4AUUA 3KR3L 1JS4A 3BESR 2J5LB 2UZXB 2V9TA 4HA1A 1Z6JT 4NC1C 5F9DC 4MNQA 4J1UA 1N8OE 1BM3L 4G6MH 4MDJA 4WHDA 2BW5A 1JNJA 3RRQA 3GSUB 3ZDWA 4PR5A 2YRZA 1QOKA 5IGXH 4A6YH 2OR9L 4X99B 1YC8A 1TOXA 2VXVL 4E41A 1XB8A 2R29A 1SXSA 2GY7B 1IQDB 2W5PA 1T1YB 4XPAH 5F9OL 3MGTB 4F57H 3RNKA 3VXPB 1NBCA 2PCYA 4QRSB 2IV9A 2LGNA 4Z1PA 1ZHBB 3I50L 4GXVL 2HT4C 1PJ9A 5I71B 3EYFB 1TFHA 2NXZB 4E0RB 5G5DB 5KN5A 4RAVA 5DS2A 1XR8A 2O5YH 3BWUC 2YPLD 5D72L 5KVDE 1VESA 4Z0BL 4G6KH 5LGJA 1X3DA 5L4IA 5A2LH 4YDVA 3WE6B 3QULB 1H8SA 1OT4A 5MENB 1RERA 4MZ2A 3MLZH 2AV1A 3ZMRA 1BAFH 3QWOA 4JN1L 4G72B 3IDJB 3QDMB 3K74B 2UUDK 3H85A 3M8OL 3W0WB 4NKOB 1ECZA 1INEL 5JOPE 3UCRA 3KEDA 2BZCA 1YN6B 1AG6A 2DEYX 1JF6A 3CFEA 2DJSA 5IQMA 3WFDL 3LNFA 3RP1A 5EUOE 2QQKL 1CFVL 5HXMA 3VSUA 1U6AL 3L48A 3T5WA 1UKQA 2NR6A 3WTTA 3MRRB 2DQDL 3R7RA 5A6IA 3A6CH 1U0QA 4B0MB 4DJMA 3T3MB 3ARSA 1Z3GH 3TIDA 2O26U 2XWBB 1ZLSH 3KGSA 4EEEA 1IKFL 3CSBA 4H0HB 3TA4D 2F8IA 4ZTEA 2ICEA 1NAML 1CPUA 1MVUA 1I1AB 4YSTA 4Z7NF 4J3WA 1UT1A 3Q44A 5C0BD 1T7XA 3IXAA 5HGDA 4BQBA 4IHBA 5IWLC 4JK0D 3IJ8A 4AL8H 3GHBH 1V3LA 3Q3GB 4BZ2H 5MEOA 2A9NH 3U30C 3BDBA 4U1NB 5I8CA 4NNPL 1FH2A 1LQBC 3EFOA 4NUPA 2CGRL 2I27N 4YHNB 4PJEA 2VISB 2BJML 4HPYH 4U6VH 1WBYB 2OJ1A 4O02L 1Z0MA 5IJKA 8FABB 1GKOA 2XWTB 3B3IA 3NK3A 3APMA 3CZNA 4POZC 1W80A 1CDYA 4RFEA 5E2UL 2VCOA 1ET5A 1QI3A 4U1MB 3V6FB 1RCYA 4PJ7B 4B5EA 1GOGA 3V0VB 3IDYB 5KYYB 1FFOA 1JRHL 1U41A 2BOBB 3I6SA 1A0QH 4CRPA 2HCZX 2FO8A 3VFNB 3HVNA 1T2QH 4F9LA 4R9HA 4X6FA 1T89C 3BCFA 1XF3A 5BW7A 5FS5A 3BAKA 1IFHL 3QPQC 4MQSB 4FLRA 1AQKL 1XFPA 3KYKH 4KY1L 3ZRCC 4U0QB 1DVXA 2A9DA 4LVEA 2GUOB 1CICC 1B6DA 2DWDA 5FGBA 3GBNH 3CH1B 4RFOH 1KCKA 3AREC 4R2GC 3W81A 1R33A 5LXGH 1R3LA 2O4EA 4HWBL 5DFVC 2JQMA 4HUWA 5HDWA 2YLHA 4B3EA 1A14H 5DJ8B 3ZDXF 3MUUA 2JELH 4GAJL 4QRAA 3D12B 3KPSA 4N5EC 1G7QA 1MJ7L 2H2PD 1O7DE 4POUB 2LQRA 2I7SA 5GRXG 1FZOB 3OHXA 5H8DA 1ZVNA 4LAJH 1HKLL 3QT2A 1UOVA 3EYVA 1OAQL 5C09B 2ICWJ 2MNWA 3EOAB 1ADQL 4ODHL 3RJOA 4HSQA 1TTRA 1YG9A 1HEHC 1ZGLP 4OTXL 3IGAA 4AGLA 2RQEA 2RFXB 5EF3A 2H26A 5H35B 1ODUA 4QPEA 4LT7A 3ABMB 4PV8A 1E4XL 2J8UE 4B9ZA 3WMPA 4EAEA 4PJHA 5IK3B 5GS0H 3VI4B 1CG9B 4WEEA 3L9RA 4OCRL 4L1HA 2FIRT 2ZWKA 2NDGA 3W9EA 3MV9B 3WFCH 3T4YA 3DX8B 3IXTA 4JKKA 4UT6H 1R0AH 4F8PA 2HVKB 4NHCL 5LGHL 3KDPB 4HCRA 3HRZC 1GPOL 1HKFA 1YUHB 3VFUB 3G6AB 1XCTB 2B77A 3D3VA 5DRWA 3VXRA 2XIBA 4W93A 3QEHB 3N0AA 3B7RL 1E4WH 3DVGA 3IPBA 1RHHB 1VEMA 4GAFB 4G9FD 3BAIA 2B0SH 1OLZA 4F8OA 1QSFE 4OM0H 5BUAA 5AZ2L 4X8CA 2ATKB 1TETL 2AJXH 1L9NA 2ICWB 4EN3C 3GZPA 2RALA 4GUQA 3VFTB 1R3HA 4PTTB 5KYXA 2VR6A 4Y5VB 5HDOA 2CPCA 2MFNA 1YNLL 5C07A 2EH7H 3DA0A 4E36A 1ZVSA 4WEMB 2EDHA 4GW5A 4HEPA 4Y2DA 3BIKB 3C6EA 4F33B 3ZMNA 1MHHA 2J2ZB 4OD3L 4KHTH 3QC6X 4KFZC 4R26H 5GS0D 2APVA 3QG6B 1MJUH 3OB8A 5BO1L 1EAPA 3EBHA 4N2AA 5C0JA 1CD1A 4BSVA 4GRLB 5EBMA 4TOYH 1D6VL 5ITFA 3EO0B 3K6SA 3MV01 4WHYH 1DLHB 4HF5L 5I16B 1F3RB 4DHLA 2F53B 4XNZB 2OMXA 4AEHH 3VGBA 4AQ8A 1W9XA 4J3XA 5C0CD 4PJ9C 3F12B 4AVHA 3G6DH 5CBEA 4KVCH 3L17A 1W8EA 1L0QA 2H0PA 5F1SA 1I3GL 1N26A 4U6TA 4AYFB 4YNYA 4U1KB 3RTLA 3RY4A 3DJTA 4XO5A 2B15A 3GRWH 3T77B 3LHAA 3ZO0A 4V2BA 1MQKH 1D5RA 1A7NL 5IV2A 5AOJA 4Q14A 3COOA 3TA3A 5K9OA 4LLWA 4U1HA 1BLNA 5DO2C 4WFGD 1B2YA 2OX5A 3CSTA 3QO0B 1FVDA 4FTDA 4J23A 3S37X 3WFZA 4MASA 4NXKA 4XN1A 5DYOA 1ZDQA 3CHXA 3ULAB 1J86A 5EN2A 3WKMH 5CR1A 2YJQA 4ATWA 2DV6A 2VH5L 3FCUB 3TLRA 3RFZA 1DQQA 1M3JA 1I9IL 8CGTA 4A7TA 4JFEE 1CL7L 4UQCA 5B38A 4JKWA 5IHZA 1FNFA 3LD8B 5ICYB 2H9GA 5D96B 1IQWL 3QJQB 1VFBB 3ULUL 1X5LA 1KGWA 1GA2A 3D4GA 3M1OA 2V2XA 3OKNB 2PWGA 3U2IA 4JY5H 3VXUD 4XCFL 2KKQA 4L18A 4FQLH 1DQLL 3W3BA 3LDBC 2GTZB 2HYMA 3KM2A 4AXWA 1B6UA 1LO2L 4JKPH 1QFWL 1F1GA 1RMFL 3L3GA 4XNMB 3EF7A 1XGQB 4HIIA 4GQPH 4FD0A 3O9WB 4JPSA 1CF8L 3H7BA 5IBUG 1J0JA 5AYQA 2JCWA 3B8SA 1OL0A 4YHLH 4L8BB 1DUYB 3BHBB 3TZVB 3K0YA 3SYQA 1WITA 2BSTA 3CBKB 3FQXA 1WFMA 4KAQH 2OMWA 1KXVA 3KWWA 3NH7H 4YXKH 2Y2TA 1HNGA 3D09A 1RK0B 1KT2A 1JWMA 3QAZB 4U1SA 4N1HB 5ALBH 1D7DA 5EZOH 5JXED 2WXHA 1T1XA 1BYOA 1XB6A 2YS4A 4R7NA 3FXIC 1EWHA 4BFEA 1SUHA 2DIBA 4DQOL 4MNGA 5HY9A 1WCBB 4FNTA 3L4TA 4K0OA 5AW8B 4G3YH 1KPRB 4GSDH 1KYOJ 3Q06A 2CR0A 3EGSB 3DK0A 3HJEA 1JK9B 3ZZ1A 4ANKA 4KGLA 1H19A 3QJHA 3PWLB 3M46A 2Y7SA 4KROD 1JNLH 4BKLA 4EZMA 1U8QB 2L7QA 4HDIA 1HCVA 1I8AA 1IIKA 2Q9OA 3A6BH 5CN2A 5E1IA 1FWXA 3FYIB 4QEGA 3TL5A 4TTDD 3WGVB 5EC1B 5KYWB 4U05A 2V6HA 2W8CA 2CD0A 2BERA 5FIEA 3IJSB 4ODBD 3REVB 3QH3B 1BYNA 2ZWYA 3ZT7A 1H15A 1R1CA 1PSKL 2A6JB 1M2VA 1YRKA 3WDIA 2CO7A 4ZMYA 1OGAA 1N59B 4ZO8A 5B3SB 1SM3L 2L8AA 1TPXC 3MNZA 4G7YH 4H13C 1FO0L 3NN8B 3EYQD 3WTXA 3KD4A 3MXWL 4N2FA 5INCA 1QP1A 3NSXA 5I6OA 1F3DJ 4X6CA 1MW1A 5TE6H 5A2KH 5JIKA 1IGYA 3AG1B 2BVQA 2D31B 3L5JA 4CU6A 5CLYA 3C6LB 1AS6A 4C56E 3HCVB 1YA5A 2V2TA 1P4BL 3F7QA 5EOCL 1EFXD 2I32A 3IJYA 2PTTA 1IGCH 4IRJD 3FPXA 3L7FB 1T5WA 3T09A 3HAEA 1HOCB 4KH9A 4KJPD 1A4JB 3QGVA 5GGQL 4HULB 2J1WA 5FUCC 5I9QB 1F11A 5GHWH 4MGXA 1U3NA 2FGZA 5JW4M 2G3NA 2K3HA 3HNSH 3O4LA 4XRCB 3MVSA 2EO9A 2YSSB 3QBTB 4YSSA 2JKLA 4AQZA 4MS8D 2H2PC 1A5FL 1CK0H 5FO2A 3VTAA 4CJ1A 1LO5B 2N1TE 4LPWA 4MA1B 4XBPA 3FBQA 3V5KB 1DFBH 4X6EA 4S11A 3RL1B 5ID1B 1JPSH 4BFFA 1BLIA 4LVNC 1RFDL 1BX2B 4XC3H 5HHXH 5E4EB 1FH5H 4KRPB 3F3HA 3U0TA 4F7KA 2WLZA 1L7IL 4PY8J 4ZS6D 5C1MB 1EPFA 4PJ8A 2NYYC 1G1YA 4G8FA 4HGMA 3SKOA 3WY4A 2B3IA 3RU8H 1CIUA 3CFCH 3FT4B 2O61A 3IRZA 4YQXH 2B5IB 3UAJA 1M1SA 2P5WE 3B56A 3L4CA 3LEYH 5ES4B 2EO1A 5J6GB 2X89D 4N28A 1EUTA 3DBXB 1MKFA 2NQDA 4AYID 3DC0A 1H0DB 5T1DH 1E6JL 4D7PA 3FSVA 3PABA 4LLDB 1RUPH 1QFUL 3IMVA 3IF1B 4JPWH 2EEFA 1C16A 1DTUA 1QLFA 1QTPA 1VEPA 2IV8A 2O5XL 2Y1AA 1S7WB 3MOQA 2I9TB 3FS9A 4WGWB 4FYTA 1FZMA 5DURB 3VDAA 1M7IA 5IW1A 3MJ7A 1I4FA 3LS4L 4OKVA 5FHAH 5A3ID 4L1LA 1BFSA 1M7UA 1I7TA 3KJ6H 1F1DA 4WWNA 1OWRM 1QR1B 3JWNG 3LKNA 1F8TL 2J6EH 4MXWH 5JOFB 1VPOL 3VW3L 1B0GA 1F1AA 1OB1A 4ZQTA 2XIDA 1SY6L 3GS7A 4GKNB 3T2QA 3WEOA 5C7XL 4BK5A 5CGYD 4WKZA 4V2CB 3VXMB 1N70A 1S7RA 4PBVC 3LQZA 4M6OH 1FPTH 2X5PA 3A0OA 4ZUTA 4Z7QB 1H6FA 3EBAA 4PB0L 1BQRA 2MRYA 3FL7A 1E4JA 4M1DH 1C5CH 1WC7A 4ZTOH 2BY2A 4FXGB 2MCPL 5GS0C 2YRPA 2JCCF 4R3SB 5E0QA 1I7ZA 1KGCD 1Q0YH 4N0FA 3P3YA 4H88L 4OLUL 4PJBF 3UTTB 1E5BA 4EVNA 3BD4A 1SYSB 1X4ZA 2R51A 3CHQA 3OSKA 4JG1L 3T0EE 3W37A 1RPUA 3BUPA 3HKZA 1XL4A 3UX9B 2R15A 4HXBL 4G7SB 3U4EA 1L0XA 4LAQH 2AK4A 4ZOBA 3L3DA 5FB8B 4OGYH 4DCQB 4FERA 1MLCA 4QRRE 2QTEA 1NUFA 2Z7UA 1A6PA 1N5YH 5K9JL 4FL4B 1P84J 5IMOB 1CJYA 5SX5H 2LR4A 3BJ91 3MA7A 4BFIB 2V0AA 5C0AD 4MAUL 2RCSH 3R18A 3SBWA 1YYLL 2CCLA 3L3OA 4D8PA 1DDHA 4RAUB 5JA9A 4LZKA 2OJEA 4NQSA 2FUTA 4JQVA 5E6RB 4PP2B 2APXA 1EVTC 4AZ8B 1NFDA 2QKIB 3HIZA 3TN0B 1KCVH 2DH3A 3B9KC 3CQQA 4NZRL 1BGXL 1DVSA 4CMMB 1D5IH 5PAZA 1J9TA 1QEWB 4PCTA 1MZZA 3FB7B 3PIQB 5HBBA 2VWEE 4ISVB 2DKUA 4PREB 3RAJL 3GSNB 3JTBA 4GS7B 2H3NA 4Q52A 1JGUH 4UTBA 4FQQA 2F7IA 3L1GA 2X4QB 1OAJA 2XCMC 1LVEA 1IM3B 1INDH 1Z9MA 3AMKA 5TFSH 5I18H 2ZPKL 1UWXK 3C2SA 3WN5A 3TNMA 3TXAA 1XGYL 4YPJA 3GS4A 2LLLA 4N86A 4HBCL 5DUML 4L9DA 4WI6A 1J0HA 4PY7A 4TLKA 2PP9A 2OZ4A 3LKRA 1ND0A 2NY7L 5TQ0H 3NP3A 3LRGA 4TVUA 3QI9D 3NGBC 4QHUB 4ZO9A 4IS6A 3VYOA 3O11B 4UINL 4AK1A 2FWLB 2Z6FA 1O7SA 2DTMH 3ZE1F 1B4JH 5ISZA 3L2NA 1BZ9A 1CDGA 3ZTJH 2GSGB 25C8H 3D39E 1PZ5B 2BHFA 2WY3B 3ARXA 3I6LD 4AE0A 3GXNA 4B9FA 5EF1A 1I8MA 2W07A 3O6FD 2GPZA 3IK2A 2A74B 3VWKA 1TITA 3EJPA 2PPAA 3QNZA 3MRLA 4HEME 2Y4SA 4QGYA 3HW7A 5E1QA 1JPGB 4JGJA 1T0NB 2HFGL 1D9KD 1NOLA 4KUCF 4MJIA 3LKOB 3M86A 4RLDA 1GW6A 3TCTA 2WKLA 3PNWA 1GSMA 1CYWA 3HLKA 3OZ9H 4Q9CA 4PRDA 5EEVA 5JXEC 4HJIA 2QSCH 4L4TB 1DEEB 1PX8A 5HYFA 5FX3A 2YR3A 3V6OE 1PZUB 1U2YA 3IWUA 4LHUB 4QOKA 4HGWA 1KB5B 3PHOA 1GAFH 4L3EE 2ID5A 3L3KA 4NNYB 4JRYA 3JWDL 4TVPE 2BVPA 5M95B 5CAYB 3GIVB 2F0CA 3BKMH 3DGGA 2EXYD 2WLMA 3LZLA 5EIIG 1FRGL 1AD0B 2ORBL 3G5ZB 2MQCA 4KROC 2Z34A 1U92A 1GCFA 3MNWB 3TM6A 2D03H 5LBSA 3R1GL 3TO2A 1CO1A 2XG5A 3HMWH 1IAKA 4OZHB 1E6OH 3LIUA 1OOAA 1AFVL 5H4YA 2FATL 4TTDC 5DJCB 4JDZB 5C8JA 4QCIA 2EE9A 5EU6B 3QFJE 5D7KD 2CE6A 4F8QA 5BS0B 3AROA 4LCUB 3QARA 4H44C 3BP7A 3OC5A 3K1DA 1DBMH 4J3BA 1FN4A 3C5ZA 3QUMB 3MRCB 4MA7L 2VN5A 2X1WL 3O41B 2O5ZH 1CFSB 3LZQA 5FYLD 1VFOA 2Z31A 4H7VA 3AITA 3VXOB 5FF6B 4M5SA 5DQ9B 5JDJA 3L9EA 4HLZH 2P5EB 4Z3FA 2CXGA 4EI6A 4I3GA 5EOQH 4P5TB 2FYYB 2WGNB 4UV7H 5JHDD 3SQBA 2B2XL 3RPKA 3E8VA 1MRFH 3ZPDA 3ECBA 4E42A 3BLKA 1EBAA 3C09B 4N9OB 4LOEA 5DRNB 4IRJC 3PGFL 4DP6X 3E2HC 4L4VA 4G6FB 5A2BA 4KJPC 5F1IB 3QXTA 5C0GB 1E9OB 2XZCH 3O2DL 3MNVB 1SVCP 3NVQA 1I9JH 4L2LA 5T3ZL 1SOSA 2IH9A 3QA3B 4DW2L 4ZX6A 1G1OA 3QXDA 5L2KD 2EUWA 1OF2A 1BWWA 1RIVL 4I5BA 5AZEL 3KDMB 3ARUA 4D2NA 3TT1L 3ATBA 4XPGH 3D85A 3LH2H 5I6MA 1CYGA 1JGLL 5DUBB 4FQ2H 4I1PA 5I73B 3TBYB 2A38A 2OMUB 3HG0A 4PJXE 1ZCRA 2EECA 4AQAB 3OPZH 4IBZA 1L6ZA 3L2MA 3O3AB 1L7TL 3EDEA 2W60B 2R0ZL 4JB9L 5H2BA 4J8RA 4ZS6C 12E8L 2X0UA 5I0DA 5IWLA 2DQGH 1KBGL 5E95B 1F2XK 3DMMD 4IHOA 3E6HB 2XPZA 2YGVA 4KZDH 1R47A 4TQEL 2WP3O 5CKGA 2EIDA 4ZSOA 1UD2A 4J4PD 1KJVB 1RZFH 3VD2A 2APTA 3NCXA 2GT9A 3A21A 1J8HB 3NESA 5BVPL 3HHRB 1LE9A 3K8LA 3L3HB 3N5AA 1NPUA 1E5AA 5FYKD 2P8LA 1EGJL 3HMXL 3SHSA 1K4CA 4R96A 3SGJA 3P30H 1AIZA 2VXQH 5IJCC 2XVLA 3LN4A 2VR4A 5A3IC 1CIDA 2JB6B 1ACXA 3FQWA 4FQHB 4JFFA 1T89A 4JCWA 5IW6B 1F18A 1V5JA 2FCBA 3RWGA 3RA7L 3HZYB 2WXIA 3MBEB 3P11L 3PP4L 3RIKA 5JHBA 2C1PA 3IJEA 5GQBA 1CICA 4ZFOB 3KPMA 1GMEA 2DQIH 1IAOB 4FOMA 5HHNA 4CSTA 3AREA 3JVGA 3A4FA 5FAAA 1DQVA 2Q8AL 5CGYC 2XPGA 4RAHA 4GG8A 4MZRA 4TLUA 1XZWA 1KZYA 4O2FB 1PF3A 4F2MB 1J5HA 4Z7WE 1KDJA 1QVOA 3FUMA 2PPCA 3MNMA 3ZU8A 3ESNA 4Z3EA 4XP1L 3HOGA 3TU6A 1IU1A 1MG3C 4N24A 2TRHA 2BSCA 3FUHA 3H9HA 1SJMA 5CCKL 3CQFA 4K23H 2ZYHA 4NM8H 2P1YA 5FV1L 1TU2A 2GTQA 1BWMA 4ABWA 2WO4A 2R1WA 4DPRA 2K1MA 3O2VH 3MJ9A 1TJMA 3EFDL 3EJZD 3PWPE 2GEEA 2WVUA 3P3RA 1HVXA 1N0LB 5I17A 2EVFA 1QBBA 3ZE0E 3WHXB 4AJYV 2E8YA 3L95B 5IOPA 1COBA 1L0PA 4L2YA 4XMPL 5TK2A 3O3BA 4E9WA 3V5HB 5DVNA 3FTVA 2PCPB 2NY2D 4MXQD 4FZ8H 3FOMB 3IGKA 2AEQH 2FVNA 5E5LA 4EXKA 3KLDA 4WI9A 3MRIB 4NGHH 1R34A 3FT2A 4X5XB 1T5XB 3T0BA 3RWIA 3HRZA 1E27A 1H3XA 1R24B 1J8SA 3EXLA 4PS3A 3KLKA 3W5MA 2XPYA 4KJWD 4P23D 2YAMA 4KZEL 3K1KC 4LLQA 5D6DC 5CD3A 1X5MA 3CV5A 2R56L 5DA0B 3IKCB 5JIQA 3T2NH 1VZHA 3UZEC 4Z3HA 5HP5A 4HK3J 3QORB 3P9MA 4NO0A 1H8LA 4LARH 4O58H 4K9EH 1E9QB 2RGSA 1AJ7L 2DEXX 1T7VA 4MQ7B 3ZKMD 3QRBA 4JG9A 4TYUA 2Y0SA 3FRPA 3P2TA 4E9QA 2JIXB 2NZ9C 3HG3A 1G6RH 1NGXB 1GTFA 4LHUG 4TQIA 3NZUA 4H5SA 1QBMH 4BDVB 4XZ4A 1VZGA 4HCFA 1MDTA 4P57A 5ALCH 3QI9C 1LO0L 5BV7H 1KIQB 3CLWA 1RPKA 1JPEA 4YR6A 2D4FA 1ZGLB 1HXYB 3ZJAA 2ZOOA 4PLJD 4X9FA 2YAEA 4YH6A 4NERA 1YEFH 3UGXA 1QFWM 4CC1A 1KB3A 1E7VA 1YZZA 3K2MC 2BVOB 4KUZL 1AY1H 1T80A 4A1RA 5TDPA 3KWXA 3IDIA 3O6FC 3E6FA 3AC0A 3DV6A 2XACC 5EZLB 4UM8A 3HZKA 1OZUA 4JRLA 5EZJB 2QGBA 1YC7A 3WLWD 4BFKA 2XA3A 5FPIA 3FQTB 1DLFH 5ESQB 4YXLH 2FD6H 2KLSA 4IEFA 3F6JA 1KCUH 3UROR 5MENE 5B1AB 2BY3A 2OTWB 1I9RL 2BSBA 2EXYC 2QLVB 3P4OA 3ERXA 2HLEB 5DMYA 1K2DB 3MRFA 3W0WE 3GSOB 2R8SL 5BNXD 4L29B 5TQ2L 1OM3H 2WCSA 5BRPA 2WN2A 1QSEB 4PRPB 4KI5D 5F9WB 4BZ1A 1KYOK 3VNYA 2B08A 3PFQA 3IVKB 4HKZA 4TTGA 1E5YA 5FYJD 1DVFB 1U8HB 5IVXF 1P7KA 3IPFA 2OYKA 5MP6L 3MCKB 3T3ME 4IGBC 4NUJB 2XWJB 2QPDB 1WT5A 4HWEL 4S1SL 1LLAA 1X5KA 2E6JA 3GMPA 4ZMNA 3CLFH 1TZGL 2YPLA 1ITCA 4MA3B 3UJTL 4YHOH 3SKNA 3DO7B 3MO1B 5T33L 4OZFB 3ABLB 1YEWA 2AKRA 5KEZA 2IH3A 4GO6B 2VJ0A 2OMZB 3MI6A 3KXFA 2P48B 4N0YL 3K8KA 2XIIA 1OHZA 2E5EA 5DWUH 4YFEA 1UZ8A 2LE9A 2QZQA 2K8QA 1CQYA 4IKLA 1KLGB 1GZPA 1F3DH 2H32A 2YEVB 3GZQA 2LT9A 4WNQA 1IBYA 5DMKB 2VXUL 1UWEL 3PGCA 4G5ZH 4G83A 4XHQA 3TEWA 1OTUD 1ZA3B 1O7VA 2C7FA 4HS6B 4L1DA 3UTQA 4PRHB 1FZKB 2K0RA 4O02B 4RWYH 1JWUB 4A6YA 2E46A 3ARGA 4KPHH 1RSFA 1Q72L 4XHJD 1JZIA 4N8PA 4N4YB 3SPGA 1F4WH 4FQCL 3N42B 2WBWB 4WO0A 5K39A 3CIQA 1JZHA 3NFPB 3VVVA 2X7LA 3RTQA 2YAQA 5D2LA 1Q9KA 2H6UA 3ZUCA 4DOHE 4K94L 3T0VA 3AT8A 4JANB 4ZS7H 1I8KA 1WP6A 1KV3A 1KFGA 1R5IB 1AMXA 5BVJB 1CR9H 4DGIL 3FUFA 1DSFH 5KJRH 3GLAA 5C0BA 3S35X 2QHLA 3NZHH 4NKDA 3QFDA 4NX0A 1HXMA 3CVDA 1N0XL 3S36H 2DLIA 5FCUL 1FG9C 1U3HD 4EIBA 3D2UA 1QYGL 4Y5YA 2NUTA 4J4PC 1KN2H 1FZJA 1JZFA 3IMRA 2BY0A 2MEJB 3IJ9A 2M83A 3VSQA 5C09E 1OCCB 2VZOA 3MC0A 5BZDA 1LEIB 5HGBB 1KGUA 3MKKA 2YMOA 3FQ2A 4OB5H 5C3TA 1CLYL 2DQEH 1B0WA 3HPJB 4K71C 4M4RA 4WFFE 1M6OA 1UGKA 1H9DA 4IM8A 1EEZA 1NGYA 3V7MA 5CD5D 2BFVH 3RVWD 1KLFB 4EBQH 1T22A 4XH2B 3VI4E 4N22A 4N2NA 4RFNC 4ZFFA 4N8VA 1B9ZA 2J20A 4H1LB 4O2CA 1E50A 4XPHL 1X5YA 4HW6A 5JIIA 5D4QA 4JO1L 3MV9E 1PG7H 1RU9H 4HAGA 5T1LD 3SKMB 1T3FB 4OZIF 4P2CG 3A22A 4A67A 1BBJA 4LRIA 4P4KD 4WDIB 4HC1A 3MRPA 3II3A 1GCYA 3GBMH 4HUVB 2EE0A 1Y0LB 2F2HA 5CZKA 3UXFA 2G3MA 1I1YA 3VFPA 1N7MH 1U8OA 2PXYD 2VDNB 4MNHA 1AO7B 1A7QH 1PY0A 2BSDA 3R06A 1EXHA 5CJOL 4NZTH 4BZ2A 1RZKH 5KSBA 3B43A 2F1EA 4PJ5A 3QQDB 3BEVA 5AB1A 2XYCA 4UYPA 3KCWA 3SYPA 3TVMD 1EJFA 4J3OG 3NEEA 3CJJA 1HHIA 3EJZC 5I0ZA 5DMIL 4V33A 2IH1B 1JL8A 1MCDA 1A6TA 4E5XG 4AEIH 4I48A 1F58H 4JREB 4AMKH 4EZLA 3QZPA 1ZS8B 1S8DB 2EE3A 3N91A 4MXQC 4CW1A 4PGCB 5DRXB 4ORGA 4E9TA 4FNQA 1MRDL 3D0VB 1RV6X 4KX7A 1KENH 1PLGH 4ZUVA 4PJDB 4BGDA 3NCJH 3AFLA 3BPCA 5KSAA 4XXCA 3DPDA 3A5VA 3NSJA 1KEMH 4OLYL 5CU9A 3X13B 3VFRB 4KJWC 3QCUH 3U9UA 4P23C 3JWNE 3PY9A 2ARJA 1K8IA 1JP5A 2F53E 3VWJB 3EH4B 3FQRA 4G9FA 5DGRA 4CVXA 4P59L 3D30A 4JFTA 4BFNA 3RYMA 1A3RH 1U93B 5DQJA 1ZHKA 4FRWA 3IFPB 1TZIB 4L3CA 2FX7L 4FGMA 2EADA 1WHPA 2D0HA 3IRPX 1L5GB 3ZKMC 2A1WH 2IAMB 1Z66A 1UH4A 3CPLA 2XZQL 4FG2A 1MVFA 1NM4A 3LZPA 3M1BA 4FQPA 3TBVB 5GZOC 1FNHA 3EYSH 2WLJA 4TL4A 2ZCHL 3TPKA 3OAYH 2GJ6B 3RX8A 2VC2L 5E6ID 1ODAA 4GYBA 2Z93B 1DE4A 4N87A 1IVTA 4ADJA 1HXKA 4Y4KD 4NENA 3K72A 2PO6D 1QO3A 5GIRB 2PPEA 2CHNA 4PLJC 1BBDH 1TQUA 1S7XA 4D9RD 1BJ1H 2GCYA 2NY5H 1AZVA 3VA2C 2UXVA 3DUHA 2DW5A 1ZT7B 2ZKHH 1JXGA 1TTUA 2HA1A 4UT6A 1CU4H 4KK8C 4XPBL 4JGNA 4XMWA 4N2KA 3BWZA 5C0CA 2H1LM 3NQKA 5J11B 3R8BB 2AQNA 3G6JA 4URTB 5IHHA 3AU0A 4PI0A 2G60L 1DN0B 3OM3B 5E8PA 3NCMA 1LP9B 2R4SH 2WOBA 3RJQB 3SYAA 4MD4A 4Q97A 4LGPB 1NIBA 1NM9A 3VTMA 3CFMA 3CIAA 3NJVA 5EBLA 2K6YA 4K9EC 4NZUL 4PAZA 4OZFG 2VUOA 1KPVA 3B9KA 3JTSA 1VKXB 3W5NA 1GGBH 3DSNB 4JPKH 1XDTT 5HDBB 3KJ4B 1YNKL 1PZBA 4F24A 3RL2A 2X6AA 5D70H 1NMBL 1A2YB 4ODVH 4KI5C 3LKPB 2A6IB 4OI9A 2BP5M 2X2HA 2NPLX 4PM1A 3MRGB 4GAGL 4TRPL 4W9HC 2XOTA 5BV7C 1PY4A 4P3WA 3F7VA 3L1FA 1LGVA 1ZSDB 2DJUA 3WMQA 3QXAB 1NANH 5IQ9B 2QDWA 4Z78B 2C9QA 3IWVA 1LDPH 5EO1B 1EFQA 4ACPA 1E40A 3EJTA 4EQ3A 1NGWB 4FG6D 4OSUL 3EUDA 3O8XD 3OF6D 3GINA 5EOCJ 1ZS2A 4Z77A 3EG9B 4H40A 2ZX9A 3TV8A 4LSUL 4A2LA 1CVSC 2ZSWA 2DBJA 5E94B 5L6YL 4I0PB 1ES0B 3SO5A 2HH0H 1IBBA 1JV5B 2E7BA 4HEMA 3WY1A 1U8KB 2P7TB 3OR6B 3V95A 3II1A 4NDMB 4RMRA 5BRZB 5DJ6B 1E2VA 4Z7UF 2O6CA 3GIZL 3LHPH 1F97A 4NCC2 5IB4A 2WBXA 4M7LT 1QRKA 1ZOXA 5FGRA 3IU3A 2IG2H 3V6OA 5JXEA 1LK2A 5I66B 5IJVB 1WJ3A 1OTUC 4L0PB 5D9SA 1HC1A 3OX8B 2E59A 4Z3IA 5T3XE 1NC2B 3KL3A 3TNNB 3QQXA 4XHJC 4F7EB 3BD3A 2V2WB 4LCYA 4A2DA 1NL0H 3F58L 4QWWD 3OKDA 1FO0B 1M53A 1U8LB 5EB9A 3NSDA 4XX1E 2C9AA 3KGRA 1F00I 4R4BB 2QGDA 4WRLA 5D5MB 1J5OL 1AI1H 1MF2H 4JMXA 4XBMA 5E0FA 2EDNA 1TMQA 2COVD 1GIGL 4YS4A 5EA0L 4NQCB 2R0WH 3HFFA 3IKKA 2QVKA 3FRUA 4JNXA 4E9RA 1OARH 4H1LG 3GO1L 3IGUA 4KHXL 4M62H 5EU7C 2ADFL 1Q9LB 3KPQA 2NY6D 3Q2NA 3DX0A 4QXUH 3KVPA 2FLMA 3FO1A 1LMKA 3UAAA 3WSQH 4KMQA 3F2LA 3T8VA 4XN5A 3L5XH 3FJTA 1U3HC 4K7PH 4ELMA 3ULVH 2VDML 2XA8H 1G7HA 2ZKXA 4EI5D 3I9GL 1IGIL 2Z91B 1Q0EA 2VDRL 4QHKJ 4Q6IC 3NYKA 3VGEA 5E6YA 4X4XB 5DD5H 4BSWB 4ENZA 1VAHA 1IKOP 4UCFA 3GJEA 2A9MH 5KG9B 2GHZA 4LMQI 1QHQA 2WTRB 4XT1C 2XVKA 4JDTL 2W94A 1E28A 3SDXA 5CSBA 3GZKA 1J5DA 4F3FA 3LS5L 1ICTA 1ORSB 1AHMA 4S2SA 4GJTB 4LSTH 1E8XA 2XHNA 1ML0A 4HIJB 5CD5C 3QUYA 3RVWC 1NLDH 3UMTA 2YWYA 1IT9H 5KVEL 5E2TH 1G9NL 1UM6H 1T03H 1E0OB 1KGYE 1YY8B 1EFXA 2GG1A 1HZKA 3RPIA 2VZVA 4OLXH 4ZMWA 1A7BA 2YPVH 3Q43A 1DBAL 4IU3B 4YO0B 1ED3B 5K93A 4EIUA 3R4RA 4K5NA 4PJCF 4XOBA 2ZUQC 1CD0A 1OALA 1Z32X 1IBFA 2MQGA 4UT9A 3VH8A 1NCIA 5KW9H 4JO4H 4C83B 2OXGB 1OP5H 5E5MB 3L3IA 3KZ8A 3NJKA 3IE9A 2D3LA 3VFGH 2PXYC 1DQJA 3Q8CA 3BZEA 4XWGL 3N1FC 1FNSL 4JDEA 2FBOJ 2LU7A 4UB0L 4G1MB 3GMMB 3NIFB 1A6WH 4FLOA 2VIRB 2E9BA 5LO7A 3TVMC 4P0DA 1NQBA 2E7HA 1T04A 3MJ8B 4CNIA 3AXHA 4FDWA 3UPRA 3G7TA 4PJAF 3TV3L 3FB6A 3VXME 1CLOL 2IEPA 1G4RA 3VA6A 3RWFB 3HZVA 2Z92A 5IROD 2X89A 1S5HA 2BSRA 3DK2A 4D0CB 4N0UA 4Z7QE 5I2IB 4HS3A 1IM9A 2CH8A 3DROA 3O4OB 4PEEA 5D6CB 2VLRE 1CE1L 1P0SE 5E9DD 1OY3B 2X4SB 2WP3T 4JQIA 2ZP8A 1BQHB 4Y9GA 3C8HA 3OSVA 5E99H 3KR3H 3HC0A 3UTTE 4C56D 3W39B 2YFNA 2CBPA 2I24N 2IGTA 2EICA 5EN3A 4A55A 4Z7VA 1Q9WB 2PR4L 4EDWH 1C8PA 2Q6WB 2VXVH 1EVUA 2P80D 1AOZA 3B7SA 4UZGA 4XN9A 5FGCB 3QDGB 3BEWA 4F8TA 2DQUH 1F6AB 1HSAA 4OFYD 2DWEA 1C12B 4IMLB 2AJZB 4YSRA 3UTOA 4LSPL 4UTBL 2DQTH 4NQXB 5JIDA 5EHFA 2NX5B 2ZOLB 1T0PB 2XN9E 5HD8D 1A6UH 3BPNC 2NY4B 3PFUA 1BIIB 1RVFL 2DBLH 1NBQA 3ARDB 4AYEC 4OF6A 3D51A 2J5WA 5E6IC 5DK2B 4BH7A 4A2FA 2VLJB 5D72H 4AMWA 4Y4KC 4DERA 1U3ZA 2OZ4L 3VJ6A 4U6XA 3IU4H 2PO6C 4HUMB 1S7SA 2FH8A 3GXIA 4LRNL 4NT6A 5I6NA 3BQUB 3BMWA 5J6SA 1D7BA 1HIML 2HUEA 1F42A 2NUPB 3Q9QA 5C70A 4OV5A 1SMAA 4JN1H 2LV4A 2F5AL 2WN3A 3Q1SL 5LN4A 1A6AA 5FOBB 1I3UA 1TKWA 2YD5A 1INEH 5CGTA 5GGSB 1IBGL 2GIMA 1GOFA 4I18C 4JKLA 5IQLA 1Z1WA 3MLUL 4WU7A 3M7FB 4ICXA 1MCSA 2QQKH 2JV6A 3QQNA 4O5LL 1CFVH 1FNGB 1R3JB 1LMIA 1U6AH 1VF5C 4GLRI 4PSPA 2OQJB 2VDOL 3U48A 5GJSL 5C0AA 5GISL 3VRJA 2J6EA 3FTXA 4Y9BA 1HK6A 2A0LD 5TGBB 3S7GA 3ZTDC 1OAXL 4Y1SA 1IKFH 2A99A 3GDBA 2XKNB 1H5BB 5D6DA 4BE6A 1NAMH 4W9LC 2QHRL 3V0WL 1ZTXH 4Z6AT 2P26A 5AVQB 2VDPL 1NZRA 3K5SA 3UZEA 1T83A 3X12B 3FBKA 2Q7AA 2WZ5A 3RVVC 3ZR6A 2WBJB 4OCWL 3RZCB 1N4XH 4L4TE 4ZQKB 1MFVA 2XV0A 4Z7OB 4HWZB 2ZOKB 3X2QB 1GGIL 3NFSL 5LBSL 5DZJA 3QUZC 3ROLB 4NNPH 3TF7C 3F6IA 4X0KA 5IMLA 2CGRH 2CCVA 2Z4TA 4JPVL 2BJMH 1F4YH 3ZYJA 1RIHL 4M6NL 2NY5C 4XTRD 4YHPB 4AITA 1HSBB 3BP5B 1D6EB 2BRRL 4XB3A 2R2CA 4AJWA 2GK0A 1B4LA 4P2QD 5E2UH 3QI9A 2HRGA 1I8LA 3FO9B 4FG6C 3UIYA 1OOWA 3O8XC 3PDGA 5KVGL 2EDRA 3DHPA 2V3EA 4JX0A 3VFSB 4OZHE 3MOAL 2R4RL 4MX7A 3TYFA 2HMIC 3ZDYB 1XF4A 5DWPA 4WQOA 4UNTA 5I0VA 2UZIH 1N5AB 5AL0A 4QRRD 5BS0E 3O6FA 3QEQB 3EOBB 3V7AG 1AQKH 1J0ZA 4KY1H 4E9SA 3K5RA 5KYUA 4G82A 4FN0A 4RGNE 2EKSA 3EJSA 4M48H 5AWNL 32C2A 2HX8A 4B3VA 4WI4A 5IG7A 5IR1A 1AYOA 1DYZA 1MCOL 6CGTA 4Z18A 2P5EE 3ZN6A 4PJ7F 4PGZA 4NCDA 4G7VL 4GAJH 1L6PA 5AVRB 4QWWC 4GY4A 1MJ7H 4CSZA 1MSPA 2X1OA 4JFHD 3D18B 4NS0A 1CXIA 1UENA 3LPGA 1HKLH 3IB4A 2Z4QA 1OAQH 4FEMA 4LOUC 1KCRL 2JSFA 1ADQH 4ODHH 4EPSA 2HFFB 5SWZD 1EEYB 4NHUB 3MR9A 2G4GA 3VFVA 4LU5H 4PGJA 3HE7B 3CFBA 5IVNA 4GW4A 2NY6C 4QRQB 4GH7B 1E4XH 3NCBB 3QZNA 1KCWA 2IWKA 3LV3A 2H8PB 4K7FB 4XMKL 1D7CA 3FN9A 5I76A 5GS1C 1LWHA 3VRLF 3QUKB 1JK8A 1NGZA 1VACB 1SJEA 3EO9H 4IGBA 4EI5C 4G8GB 1N64L 1F6LL 3CVHL 4NFCA 4QO1B 2L7JA 4KMTL 5AUMA 3S4SB 5HHQA 4QRUA 2NSQA 3JV4B 2DIEA 3S0PA 3CZEA 5HGAA 1X4XA 5F7HA 3P1VA 3WY2A 5JOEA 3MODL 5EEWA 1G7IA 4JY6B 3BH8B 3RX7A 3VI3F 3VXNB 2IMNA 2CSPA 2WNWA 3QJFA 3FU7B 1BQUA 4CVZB 3TBSA 4PGDB 1FORL 4W6YB 3ETTA 3G3LA 3PAUA 4RSVA 4NIYE 5L4MA 1I31A 1J8HE 4OF7A 4L3ED 5IKCA 4P3CH 1F3JB 2XBDA 2LLNA 1SXCA 2ZF8A 5L2KA 2ADYA 3CUPB 3QNYB 4ZUWB 1RK1B 6TAAA 1BQHG 3ECUA 4Y19E 3BDXA 3RKDD 3NJXA 3MLTB 4OD3H 2EXSA 1HH9A 4P9ML 1DANT 3MRHB 4Y9CA 4P5KB 3FTUA 1QAWA 3QFJD 4JZOB 1CDUA 4JY4A 2P49B 4ODXA 4AV5A 1QD0A 4KK9D 3VRIA 1D6VH 1S9VA 3C8DA 4I1RA 5EO9A 4H8WC 2ZNXA 4DKAA 3ULVE 3UTZA 3VXSA 4NOBA 2G5BA 2MKWA 4HF5H 3ZQWA 2IWGA 1DL7L 3MJ9L 3QHTC 5D2NB 2R2EA 1D3CA 1NBZB 4NJ9L 5HI4D 4F2ME 5IROC 1T1ZA 2BP3A 3ILDA 3SDCD 3QIBD 5D55A 1U30A 5EPMB 4GXFA 1FDLL 2HJLA 1TTBA 4WU5A 3RWJB 3CXFA 4P2AA 2AJ3B 1ROWA 3QVAA 4YDZA 5J89A 1XMEB 1SJHA 1PDKB 2VM4A 4HJJL 3WNLA 2FEJA 2XC8A 3DGDA 3KLQA 3L5WB 5FO9B 3ZIMA 2VERN 5F3BB 2P9RA 2D9CA 3ZDZB 3VD4A 1WD9A 1T7WA 3TO4A 4M9PA 3DX6B 1XQ4A 5DEJA 2XV6B 4L8SA 2E9GA 3OZLA 3JV6B 1IJ9A 2GKIA 5BUGA 4N9GB 5DTFA 3HS0B 2V7HB 1A4KB 2Y24A 4FYQA 1I9IH 5EBWA 4RMUA 1PNDA 1R4XA 1MHPL 3UDWC 5CEZE 4GFXA 3TJPA 3T4AB 5F7DB 1MI5D 5HDQL 4HUXB 3F5WA 3ULUH 2V3DA 1UXLA 4LVOB 1L4IA 4XCFH 2ZG1A 5B8CB 5HD8C 4NP4L 3NJFA 1OP3H 1CMOA 3P0VH 2GVYA 4EUPH 2VTFA 4JO2H 1G7LB 5HTSA 4WJ5B 5ESAB 1CD9B 1XWVA 1WZAA 1QFWH 2AJUL 1I85C 35C8L 3QZLA 3WTSA 5IFJB 2VDQB 2A2QT 3BP6B 4JAMB 4OZGF 2HX7A 1CF8H 1UACH 3UACA 4TMPA 2H3XC 4MNQB 1CC3A 4ERSH 2XI9A 4J1UB 4JFZL 4MDJB 4N0CD 4QI3A 4LP5A 4NN6C 4PR5B 1JV2A 4WCYH 2CLVA 4E41B 1UCBL 3CNKA 4J28A 4LL4A 5G4OA 2QSQA 2G0LA 2TRYA 2NY0D 1UXWA 3RNKB 3GTTA 5IREA 5F7YC 4JPIA 3MRNA 1ZLVH 1G9MC 4WO4D 1XX9C 3CWGA 2A0LC 5GRVK 1EBPA 5C0FA 1B2WL 4DT2A 1WFUA 5GGRA 5KN5B 3GBLA 4RAVB 3SN6N 4N2GA 1XR8B 4P23A 3VXQB 2NY1D 5D1ZD 4ZOCA 3N0PB 4H8UA 4PJIE 5LGJB 2MCMA 5GGUA 2XJKA 4YDVB 3GD1C 1T7ZA 2QPSA 4F58L 5I82A 5DT1L 3N1GC 5HI5D 3S3JA 3QWOB 4RX4D 4ZTPL 2HAZA 4P2RB 1KC5H 4YK4B 3QDJE 1H8NA 1TNNA 2L7UA 2NNAA 2IFFH 4Y4HA 1IEHA 2D0FA 3NIGB 5GZOA 2W38A 1PSKH 4XTRC 3CFEB 5K9QG 4TNWK 4ZNEE 1C1EL 2J56A 2YAHA 3LY6A 3MV7D 4NCC1 3CCHA 1SM3H 5FFOA 2IAAC 1YHPA 4XBEL 1TZAA 3MSPA 2JJVA 4C58B 4CA4A 4IBTA 5IESL 2V3FA 3WDHA 1FYTE 1QSEE 4GW1A 4PRPE 1N10A 4WFHD 2I25N 4UOQA 4DGYL 3INOA 2ITDA 4LEOA 3WXVL 3RGBA 4OCNC 3TIDB 5JW4R 5D93C 4RNRA 2ICEB 1AR2A 1T4WA 5EOCH 3QWQB 2CRZA 4HOWA 1MVUB 1SEQL 3LTVA 1XGTA 2ZXAA 1HFUA 2Q3XA 4N5UA 5AW3B 4P2OD 3C08L 3IXAB 3CXDL 3T08A 3ZRSA 4WY7L 4D3CL 2BCKA 5MEOB 3DYOA 4AIXA 5I8CB 5HHVH 5D1XB 3EFOB 2J72A 3S4SG 2M26A 1AQDA 4PJEB 1BZQK 4G6ML 2BNQE 1A5FH 1CVRA 5IGXL 4A6YL 5J06A 2MNJB 3VG9B 4RFEB 5E6UB 1RFDH 3NBNA 3V55A 4XPAL 3G9VA 3H9YA 4X9GA 1G6RA 5EUKA 4F57L 1FFOB 3UP1A 1L7IH 5C0DA 1ZJBA 2GJZA 3TASA 1DJSA 2VITB 1TEYA 3AQZA 1OP4A 3NJHA 3C2AH 4X6FB 1OIOA 4GMTH 4XP5H 1XF3B 1FFPA 2DEWX 3B2PA 1D5XA 4JO5A 4R7DA 5F7EH 4JFWA 4OCYL 3TBTA 3SSGA 3D4ZA 2WVTA 3ZQ9A 1J10A 2YQGA 2DWDB 3ZSSA 3GM0A 5DD6B 3ARTA 2JCCA 1E6JH 2PCFA 1TUPA 1XTMA 1HEZA 4G6KL 4PJBA 3N9GH 4OJDH 4XCCH 1AHWC 1ZLWH 3ZOAA 3ATFA 4PSRA 4PD4K 5CIPH 4HUWB 2O5XH 1QBLH 3PWUA 3N50A 5AVVB 1CWVA 2WQVA 4K8RD 3VGDA 3MLZL 4AGOA 3LS4H 3KPSB 4MRBA 1CLCA 1G7QB 1EV2E 1RJYA 3TWYA 2IALB 4GXUM 4DH2A 2CUMA 2NXZD 3OHXB 5AVSB 7CGTA 1W0WA 5BQDA 4EZJA 5C86A 3EYVB 5F6HI 1IMHC 1F8TH 2BPBA 1VPOH 4HJ1A 2CHXA 3P77A 2VR8A 4X8JA 3QHZL 4F20A 1MUJA 1Z5LA 1SY6H 4K55A 2RACA 3IGAB 4JZJB 4LCCA 2H26B 1ACCA 3RGVD 1OPGH 3FHAA 1PIFA 3JXAA 3LIZH 1NLBL 1F45A 4PMFA 3A6CL 4QXGH 3QDMD 2K9FB 4RQQA 4KV5F 4IRSC 3UMNA 3UYOD 3L9RB 1EHKB 5D7IF 4A38A 5I6XC 3IAPA 1VLXA 2FO1A 4X7SL 2E7DA 5LNEA 1NCOA 2HX9A 4HC1L 3IXTB 3KYNB 4BXSV 2AQRA 3GHPA 3NP4A 2MCPH 4FE9A 1H6UA 5D71L 2IMMA 5LXVA 3FU6A 1ZLUH 3GJFK 3H2QA 1P2CB 4JG1H 3WS3A 4KK9C 3GHBL 2Y7QA 3RHWF 5DRWB 3VXRB 5E8EA 5HGHB 3VD1A 1XAKA 5ESVA 2LU5A 2BZ7A 2CLRA 3DVGB 3P4NA 4GMSH 4HV8A 4KNUA 4NUGL 4K3DL 4RRPG 2GEQA 4U6VL 5HI4C 2P24A 3IRCA 1FHGA 4JUSA 2BOCB 3CTTA 4KZCA 5BOJA 1U3HA 1I1AD 3ZKQD 3SDCC 3QIBC 4GRMA 1R3HB 5KYXB 4Q6IA 2P8PA 1QEXA 4MAUH 1A0QL 3Q01A 1YYLH 4KK5D 5C07B 4HZLA 4ZW3A 1VSCA 1KF9B 2F7QA 1ZVSB 1V10A 4PGBA 4PJFE 4BELD 1JF1A 3DJZA 4QIRA 4Z7UE 1QA9B 3F7KA 3KYKL 1MHHB 2Q86B 2Y36H 1MFCH 3RAJH 3UTPE 3UJJL 2C7UA 3OQRA 3GBNL 4RFOL 1EAPB 5LHDA 4EZKA 1SUJA 5C0JB 4BSVB 3ARQA 1KGJA 4BV1A 2ZPKH 4AQ1B 5ITFB 2X6MA 1FGNH 1RXLA 5T1LA 5TH2A 3K6SB 3VD3A 1A14L 4AIEA 5TD4A 4TN9A 5DUMH 4HBCH 2GBAA 3RX9A 1HE8A 3TEZA 1BCIA 4B7LA 3IYLW 3DIFB 4F9PC 2F74A 5L0QB 5CBEB 4JDVA 4JS7A 2PNDA 1UASA 1TZOA 2PXYA 5FKAA 3GPSA 1PNCA 2N56A 3CD4A 4UINH 5ICZA 5LAXA 5FLUA 5JO5A 1BHGA 1J1OH 3TA3B 2X70A 5K9OB 5F1OB 3TVMA 4U1HB 1BLNB 4A66A 2OX5B 3F85A 3EKCA 1FVDB 4N0CC 4R84A 1EUUA 5GS0L 5CFHA 5DYOB 5KS9F 2A73A 2JTYA 4KITB 5EN2B 1FAIL 3S37H 4Y8DC 2BRQA 5KAQF 3MOBH 4UAOC 4AGQA 4GBXA 1KNOB 3TURA 4EI0A 4AIZA 1YPZF 5C09D 4F5CE 5IHZB 4UT6L 2NY0C 2H9GB 1TQCB 1RULH 1SHXA 2ERJC 1ZPLA 1MJ8L 2V2XB 3SPJA 3WOVA 5FW6A 3TH4T 1EZLA 2Z64C 4WO4C 3WJLC 2Q3AA 15C8H 4HSCX 4YBLC 3UBXI 2NY1C 2GQHA 2IXQA 2VLKB 4FJZA 4Y2OA 5D1ZC 4AXWB 1ZXQA 2XZAH 2BK8A 3L3GB 3ULUE 2AJXL 1HCYA 4EF3A 1AXTH 1DQTA 4XPTH 1QHPA 3ZXAC 3QIUA 2FSDA 3QO1B 3EDKA 4KQ4H 5DZVA 1AFVH 1XH3A 2FATH 1FFNA 1W6LA 5CJ8A 5HI5C 1IRAY 2JJSC 3O45A 5LNDA 2XN9A 3HPLA 2BSTB 3BLPX 1JOIA 3FQXB 1ZA6A 3GBDA 1EIBA 2OMWB 4JM4L 3KWWB 4KU1A 1LL1A 5I74C 3CSYA 4L0ZA 2QV4A 5MHSE 1LTXA 4FQXD 1KT2B 1JWMB 4U1SB 4KHTL 4I9WE 3B83A 5BJTB 4R26L 4R7NB 5E6IA 3BC9A 1EANA 2YXMA 2XQ0A 4Y4KA 5HY9B 1KB9K 2ZWNA 1NC4A 3QQ4A 1YDPA 1KV7A 3EO1A 5K9KA 3POCA 2B2XH 3U1QA 5BOZG 3QJHB 2EP6A 5EORL 5J6HA 3G6DL 4P5SA 4BKLB 2R39A 2BOLA 3PGFH 4HDIB 3Q6FA 4XP4L 1CTMA 2Z35A 4I18A 2ARWA 5JPNB 3S3BB 3NFNA 4P2OC 1WYJA 4XC1H 1P69B 4GRLD 1VJSA 1MQKL 4I77H 4DW2H 2B1AL 1WG3A 2WIMA 1RURH 4HIHA 2BSSA 3NZ8A 5AZEH 1HL9A 2ZJSH 2IDQA 2ZXEB 4GIOA 2OM5A 4N8UA 4ZZKA 3D1MC 3H9SB 2WSKA 4U0RC 1H15B 1KXQE 4NI3A 1VFUA 2I60L 1PCSA 2CO7B 3WKML 3QXVA 1OGAB 2PUQT 4PTUB 3MNZB 1NGQH 1NSNH 1OCZB 5KYNA 2BH0A 3CZLA 5SV3A 5I1LB 3BD5A 5INCB 3QSKB 5BZZA 2R0ZH 1RZ8A 3IN2A 12E8H 5F7FA 1IGYB 4M5ZL 1UB5B 2BVQB 1VADA 1U4EA 3MLSL 1LE5A 3MRDA 4JY5L 1MHCA 1WTGT 5ACMA 4FQLL 1S7VB 3QUZA 3APCA 5EF0A 3AM8C 3IJYB 4ZMXA 1PKQA 2ZTBA 3HNTH 3K2KA 3VO0A 1T5WB 2OK0H 3HAEB 3WO4B 4BWWA 5ADOL 5GSRA 1DJHA 5DU7A 4PYHA 4X7CC 1JAEA 3VD0A 5D5ME 5AYTA 3L3JA 2MMXA 3LMJH 2V7NA 5KWYC 1EGJH 4NQCE 3OF6A 3UYRH 4K8RC 3O4LB 1FFRA 1C8QA 1I8IA 2IJ0C 2AQ3A 3V7AE 1C5DA 4PHXA 4ELKA 4FYSA 3US9A 4C55A 1WZKA 4XBPB 2IF7A 2RBLA 4X6EB 2KS0A 4X42A 3NH7L 4CBZA 1ZKAA 5B1JC 3C5JB 3P11H 1GHFH 3PP4H 1OTTD 3U0TB 4RMSA 5DLLA 4TUKL 1SZNA 5T1MA 4PG2A 1THAA 3O9WD 4DN4L 1T20A 4JRXE 4PJ8B 4G8FB 3RGVC 1SOXA 2HVBA 5E9NA 2Y7LA 2O61B 3NA9L 4G3YL 3DV4A 2CKNA 3TZVD 3N1MC 2VDRB 2TAAA 1U2HA 1MREH 5AKVA 2WINA 3FU9A 4JMNA 1SFDA 1JNLL 5F3FA 4WZ9A 4HEPG 1CXEA 3PABB 4UT9L 1LJMA 1BZEA 3WFEH 1OK0A 1RUQH 2YKLL 2ZKYA 3HVDA 1C16B 3A6BL 1QLFB 2R23A 1OKEA 2IGFL 4YEEA 1FZMB 3I75A 3C75A 3EFDH 3GXPA 4GKSA 4IIZA 1M7IB 4JEGB 5IW1B 2YD0A 1G5GA 1I4FB 3MJ7