1PLCA

Accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Accuracy and precision in protein structure analysis: restrained least-squares refinement of the structure of poplar plastocyanin at 1.33 A resolution.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1992-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plcA00
3EH4B 2HX7A 1HAWA 3WG7B 1OE3A 3AY2A 2BWIA 1ZPUA 2UXGA 1JXFA 1MZZA 1ZV2A 3IE9A 1AQ8A 1PCSA 3NJHA 4UAHA 3L45A 3BVDB 2XVBA 4AI7A 4ENZA 1WS8A 3DKHA 3QJRB 1KBVA 3RYMA 2QT6A 2FTAA 1N70A 1BEXA 3CDZB 1E67A 1NIDA 3ABGA 5I6OA 5LDUA 4FA7B 2IDTA 4YSTA 4PCYA 1ID2A 3EH3B 2QDVA 4A68A 4HZ1A 1IC0A 2IWEA 1J9RA 2EINB 3S3BB 1JERA 2FWLB 2ZWNA 3UAAA 1AIZA 1DYZA 3T6VA 3NT0A 2FT7A 1ET8A 3D12B 2HRHA 2IDFA 3ABKB 3FSWA 1V54B 2JFCA 4DP2X 4EF3A 4F7KA 1ETJA 2XUWA 1BYOA 2GC4C 1V10A 1J5DA 2VSMB 4BDVA 1CYXA 2WO3B 3FU8A 2GSMB 1FA4A 1ASQA 2XX1A 2J56A 1NWPA 4A2GA 5B1BB 3WKPA 4BWWA 4HCGA 1J9SA 4DP8X 3ASNB 4G7SB 3FQYA 3FS9A 2VSKB 2P80D 1BXUA 1L9SA 1L9TA 2FJSA 2UXTA 2XLLA 1F56A 2W88A 2YARA 4WKXA 4JKNA 1PLAA 4A67A 2Q9OA 2IWKA 4DPCX 2BW4A 3OMAB 2IWFA 4E9TA 2CBPA 2H47C 4UF7C 5B3SB 3AG1B 4CSPA 1E30A 2UX6A 1SHWA 1NPNA 2PP8A 1I53A 3FQ2A 5A7EA 2YQBA 4G7QB 1KGYE 1SHXA 4A66A 3ABLB 1T5KA 1AZRA 1FWXA 5AKRA 1A4CA 1JVOA 1KDIA 2PPAA 4KOBA 4W9ZA 1TEFA 2YAEA 3QJQB 2BP8B 2Y69B 3ZBMA 3IBOA 1SFDA 2UXVA 1SDDB 3PAZA 1YLBB 3AW5A 2PP9A 1ILUA 1PZAA 1AZUA 7PAZA 4HCFA 1RZQA 1TKWA 3UACA 1GS8A 4BK5C 1QLEB 3AG3B 3G5WA 3T9WA 1CURA 4A2DA 5AZUA 1GR7A 1WA0X 1E5ZA 1MG3C 8PAZA 3FT0A 5I6NA 1A65A 1GY2A 1OCCB 3OD3A 3OQRA 1ET5A 2EIMB 3JT2A 1AS6A 2W8CA 2BHFA 4YSAA 1AOZA 2PPEA 3H4FA 5D4IA 3CDZA 1IBZA 2XYBA 1NZRA 2AZAA 2BZ7A 2XV3A 3TBBA 3NP3A 1JZJA 3WIAA 1A4AA 1PNCA 4KNUA 4YSEA 3SQRA 1M57B 3UADA 2PPDA 4KO5A 2J5WA 2VW4A 2NRDA 2OJ1A 1CYWA 3V9EA 2MTAA 1NIFA 4DPAX 1SF5A 4YSCA 2EIJB 2WSDA 3QQXA 3X2QB 3NSCA 4YSQA 3X1GA 4CSZA 4BXSV 2VMJA 4E9QA 5FC9A 2AANA 2HZHA 1OCRB 3WNIA 1OV8A 3BQVA 4HCIA 1R1CA 4W1TA 5B1KA 1WAEA 5I5JA 2FNWA 3OM3B 2DWSA 2PPCA 3CVCA 4YSDA 2DYRB 2HXAA 1KCWA 2HRGA 2IDUA 1KYAA 3OMIB 1OCOB 1ZIAA 3T71A 4KNSA 4HIPA 5IY5B 1XB3A 2EILB 3DTUB 2OCCB 5B7EA 1TEGA 4DPBX 1JZIA 2GB2A 4E9YA 3WNJA 3FSZA 4HALA 4KOCA 4E9SA 5F7AA 2PCYA 2B08A 3QJVB 2PCFA 4DP7X 1XB8A 5D4JA 1EHKB 2H5UA 3IEAA 4DP6X 1A3ZA 4F2FA 2TSAA 3NP4A 1ASOA 2QPEB 1KV7A 4PAZA 5AFAA 1GYCA 1BYPA 3NSFA 2BP8A 2FT8A 4E9RA 2GC7C 4KO6A 3KW8A 3TU6A 2YAMA 4WTQA 1SDDA 1ILSA 1AACA 2HX8A 1PZCA 1NTDA 1XB6A 1BQKA 2DYSB 3FQ1A 2YAPA 2FQEA 1ZDQA 3NYKA 1AG6A 1L9RA 4N8UA 1URIA 3H4HA 1RZPA 1AR1B 2FQFA 3TA4D 2Y1AA 2DY2A 4GP5B 2ZXWB 1JOIA 4AX3A 4E9WA 1ZIBA 4MFHA 3UGEA 4AKQA 1SNRA 4M3HA 1CC3A 1NICA 2DV6A 2IH9A 3JTBA 5B7FA 1FFTB 1SJMA 1IKOP 1GS6X 3CVDA 4JHVA 1ADWA 2P80A 5PAZA 3WKQA 1PLCA 1W8EA 2VM3A 3MBWB 2IDQA 4YSOA 5B1JA 3EHBB 4A2EA 3AZUA 1GY1A 5ANHA 5I26A 3S8GB 1JXDA 4YSUA 2OV0A 1KCBA 2GI0A 3ERXA 4YSPA 3CG8A 3S8FB 4TXVB 3DIVA 2GIMA 1MDAA 1WS7A 5I6MA 1SFHA 1GS7A 2H3XC 3KW7A 4GYBA 3H56A 2YAQA 1GSKA 4Q89A 1HFUA 2BP0B 1E5YA 2HX9A 4YVNA 2AFNA 3X1NA 2XX0A 3PAVA 4DP5X 4YSSA 2QPDB 3AG4B 2YAHA 3S3CB 1M9WA 1OF0A 5I6LA 3T6ZA 2IAAC 2YXWA 4BXVA 3NSYA 1AAJA 1BQRA 2FQGA 1NIAA 2XXGA 3ZIYA 1MZYA 2ZONA 3EF4A 4QLWA 5I28A 2Q5BA 2XV2A 2R7EB 3N2JA 2CUAA 1JZFA 2HLEB 1PLBA 2BO0A 2JKWA 3NJKA 4KNTA 3PXLA 2AZUA 2I7OA 2VM4A 3GDCA 1CUOA 2FQDA 3AG2B 1AZNA 5B1JC 1EZLA 1OCZB 3FSVA 4AKOA 3TASA 1L9OA 4G72B 4M4RB 1HAUA 3NJNA 4E9VA 2XV0A 5I6KA 4GP4B 3FPYA 3HEIB 4DP9X 1PF3A 3FU7B 4AKPA 2TSBA 3FYIB 3GXUB 3WI9A 1IBYA 1X9RA 2WO2B 4ZK8A 2PLTA 1MG2C 2QDWA 4E9XA 4BWUA 2FT6A 3IN0A 2LLNA 1TU2A 1A8ZA 1L9PA 1NDTA 1J9QA 5E9NA 4A2HA 4FAAB 3SBQA 1NIEA 3NJLA 2RACA 1PY0A 1KBWA 4X4KA 4GXFA 1ET7A 3GYRA 4K9JA 4AZUA 1AANA 2A3TA 3NJGA 2EIKB 4G71B 3ASOB 3ZX1A 2AVFA 1V55B 4NB7A 1OE1A 1PZBA 1PAZA 2VW6A 3MX0B 3ZDWA 2PP7A 1AS8A 4QKTA 3HB3B 1OOWA 1KDJA 2JXMA 3C75A 2CJ3A 2GHZA 2VN3A 4HHGA 3EH5B 2CCWA 1PNDA 3FPXA 3OMNB 2PPFA 3T6XA 1OE2A 1JZEA 4Q8BA 3X1FA 1E65A 2J57A 3PLYA 2IDSA 1WA1X 3SBPA 1JXGA 5I5MA 2MRYA 2X88A 3NJMA 1DZ0A 4RH4A 5I5IA 2J55A 3NSDA 3UAEA 4KO7A 3V9CA 4L0PB 1J5CA 1BXAA 2IH8A 6PAZA 4YSRA 2VW7A 1M56B 4YVUA 5TK2A 4KO9A 5EHFA 2I7SA 2BP0A 1NWOA 3ABMB 2YAOA 3NJFA 7PCYA 2ZOOA 2B3IA 4G7RB 1AS7A 1B3IA 1UATA 4YL4A 1NPJA 3X1BA 2DWTA 4DP4X 4DP1X 4BDVB 1PMYA 3TBCA 2CALA 3N55A 1GW0A 3QJUB 4F2EA 5PCYA 2UXFA 4HHWA 1IUZA 4JHUA 2BWDA 1L9QA 1JZHA 1BAWA 1JZGA 3SBRA 6PCYA 1RCYA 2UX7A 2XWZA 2R7EA 2E86A 2I85A 3FU9A 5D4HA 1NIBA 1W6WA 3QJTB 5TK4A 1QHQA 1AZBA 4DP0X 5B1AB 3U25A 4G70B 2BZCA 3IN2A 1VLXA 1NINA 3T6WA 3S3DB 1JVLA 3X1EA 3QJSB 3FSAA 1QNIA 2XXFA 1RKRA 4BWTA 3FU7A 5B7MA 1N68A 3CVBA 4GP8B 5I6PA 4NERA 1J9TA 1AG0A 1BXVA 3QPKA 5F7BA 3PCYA 1WA2X 2BW5A 3PPSA 1XMEB 2GBAA 1X9UA 4N4YB 3UABA 1AZCA 2XU9A 1W6LA 1ZDSA 2YAFA 4UANA 9PCYA 4NAJA 3NJIA 1BQ5A 3CZUB 4GY4A 2N0MA 4HAKA 3NJJA 1SF3A 3PAUA 3FYEB 1ASPA 4A2FA 2YXVA 2X87A 2CAKA 4P5RA 4P5SA 1A4BA
chains in the Genus database with same CATH superfamily
1GYVA 5J6GB 2GJ6B 3Q8BA 4KFMA 4PGBA 2JJVA 2ZKYA 4IGBA 3VGDA 4UQ3B 2LE9A 1B4LA 3INUL 4M6ML 5DC4B 5JA9A 1AQ8A 3TEWA 3BHBB 4UAHA 5BXFA 5I24A 1A3RL 5I73C 2CM5A 3GJFA 4ORZC 3Q1SL 5LG6A 1OTTC 1IIKA 3PGFL 2RFXA 1J18A 3IFNL 4WWNA 2ZX5A 1JPFA 3ZDZB 4QHKI 1CBJA 2N01B 4RSYA 1NOAA 3HPJA 3VFPB 3MNVA 5HD8D 1RUKL 5KSUA 2X4QA 4DGWC 3L3JA 4MMZB 3WTWA 2YUXA 3DXAA 1IC0A 1P9MA 2X53A 2FNBA 2P5WA 5B39B 1DANT 4G9DB 4I3RH 1L3NA 5BO0D 4HUVB 1S9WA 1T7XA 2G30A 2HRHA 1CR9H 3ABKB 5ICXB 3VXUE 1U2CA 3QIBC 5JW4M 5D7SL 3ES6B 4KVPA 2A9AA 3LV3B 1OAUL 5CF3A 5IR1B 3KH4A 4L18A 3TBVA 3ZW3A 2V9UA 4NN6B 2CMRH 4H8WC 3HR5B 3TWCL 4NUGH 1ZD6A 3II1A 3L3KB 3NFSL 5DD0H 3KXFA 5DJXB 5KS9A 1KJMB 1T89A 5I6XB 3MCYA 2PKDA 5A1AA 3DK2A 5EA0H 3ZKSD 4GW1A 2J7LA 2XLLA 3MLRL 1VACB 2H32A 4ACTA 4U3HA 3P2BA 3D25A 3ATFA 3HZVB 3WFBL 1JZ2A 3VTTA 3MLXH 3AXIA 5BQDA 4ZNCD 4XMTA 4MJ5B 2HFFB 4OAWB 4YHIA 4LEOA 3GMQA 1SGKA 2CO1A 2UX6A 5EOTA 1ZT7A 1PIGA 3BH4A 1NPNA 4MVBC 3MV7E 3VSVA 5T3ZH 5J57B 4WJKB 4HK0B 4OCNC 2BVTA 2P24B 4FP8L 4WIQA 3BPCB 5CILH 5EDSA 1B0RB 4N8CL 4ZMQA 4UQ9A 1SHXA 4G8FA 1HIMH 1S9VB 3W11D 3DYPA 1JVOA 1CBVL 3ZRCC 1QVOA 3P9MA 3BE1L 4YXHL 2MNWA 2JQMA 2VRQA 3CNKA 4UV4L 3AABA 2NYYC 4JL1A 1YLBB 1H8LA 2MCMA 2YD4A 3NGBB 5T3XL 5FECA 3VH8B 4BZ2A 2X0UA 3U4EA 5IG7A 1XXDC 3G5WA 5JDSB 4ES9A 3BKMH 1YSOA 4G1EB 5D7JC 1E0OB 3D0AA 1FH5L 5A3ID 3ZKXC 1XCTB 1MVUA 8PAZA 1EVTC 5IB3B 3GQFA 1CICC 4DGIL 1T0MB 5MENE 1EZVX 1EANA 3P0YH 3MRDB 5K59E 1G94A 3DX4A 1MCRA 2XWCA 8FABA 2WINB 5FFLA 3H4FA 3VYNA 1SN2A 5C0FB 5GGSY 3FB6A 4DGYH 3RWCB 1IAOA 2FSEA 2IWGA 2XG5B 2R15A 4PJIA 3GPEA 4GIAA 3KGRA 2EXYD 2CCVA 4I3GA 3QEQA 1IGTB 4UIMA 5AZ2H 4Y2OB 4CSSA 1BQUA 3FN3A 3TA3A 1WF5A 3HS0B 3QPXH 4LKCA 4D94A 5FUCC 5MEND 3FMGH 3B7SA 3QDJB 5IKCB 4TTDC 1E90A 3TEXA 3S97C 3PHQB 4H8WH 4XHQA 1IFHL 1M7UA 3BXNB 4OLXH 4PJ8A 4N2HA 4BZ1A 3LSOB 3L7FA 3CXFA 4U6TA 2AANA 3ESNA 3SKMB 2GITA 4RETB 5ADPL 4HCIA 5CGBA 3VD5A 5DI8B 3UC2A 2IFFL 3VSQA 1TQUA 3DX9B 4XPGL 4X7DC 2NSQA 1RQ5A 4OFYA 2J88L 4YSDA 3WNKA 5MERB 1D2OA 1DJZA 5C0BD 3EHBD 1PBYA 2AXFB 3QXAA 1KY6A 5IVOA 3D8MA 4JDTH 4GXVH 4PJHE 2OM5A 4FQHA 4GAGL 2YA0A 3D09A 3RVXC 3VU1A 4PGJA 2W9DL 2F2HA 1KACB 1PIFA 4RAUA 4M1GH 2F53A 3HE6B 1P4LB 1YQ2A 5BRZA 4AQ8A 1QZNA 3SCMD 3DX2A 5AOMA 2O93L 2G0LA 1VEPA 3UROR 4IRSD 2QLVB 2IV8A 3C5ZC 3VNYA 4TLTA 4XR8C 1HL5A 1CS6A 3QDME 1XH3B 4F2FA 2TSAA 1FNHA 3KYOB 3LDBB 2X38A 4GSRA 3C6LC 3HFFA 3AREA 3TPUA 1BP3B 4PAZA 4LPUA 4WCYH 5D2LA 5HSFA 4Y19B 5DJAA 5EZOL 5AFAA 1Y0LA 1BYPA 1QA9B 5E7FA 4DPRA 5K59F 1CD9B 5KYUA 1WPCA 4FQ2H 5J5EA 4Y9CA 3FJTA 3S5YA 5EB9A 4ZMOA 4ZD3H 3BVUA 1SDDA 3D48R 4KXBA 4V11A 5IUSA 4E68A 4UT6L 1ND0B 1XR8B 4ICXA 3TOPA 2D7TL 4XC1H 2Z4QA 5SWZD 3GIVB 2HN7A 3KLHC 3QIUD 4XN8A 1S8DA 1JXKA 2OTWA 4OD1H 2ZOTA 2EC9U 4WEBH 1XX9C 2Y1AA 2DY2A 2Z34A 4GP5B 5AOKA 4HV8B 4UIKH 3V6FA 5IEHB 1FZMB 3BESR 1JOIA 4H8HA 1UFGA 2DOCA 4MFHA 2ICEB 5D5MB 2H1LM 4B27A 1ZVSB 3LEXB 1KCSL 4M5ZH 1FE8L 1L7IH 3ZRSA 4M00A 1IGML 2B4CL 3DI3B 2VT0A 5FM4A 3TIDB 3GSNB 4JFVA 3SKJL 3U7YH 3HCVA 1UA3A 1L6PA 2JXMB 4GJTB 2NXYC 3AACA 1KCKA 1CE1L 1RUMH 3AT0A 3P30H 1JCVA 3NTCL 3PWUA 1WSST 4TLKA 4ZUTB 1EEZA 3FOLB 1PKQB 4FKKA 4MBRA 4R90L 4X9GA 4NQCD 2VDRL 3B37A 3IJ7A 3WELA 2DIEA 4HA1A 1T5XB 2R56L 3IF1B 4WDIA 2KDGA 2VLKD 2CM6A 2VYRE 2WSKA 3MJ9H 3N6YA 2KLSA 3VRIB 1XEDA 3WFHB 3QXUA 2YOAA 1I1AB 4L8SA 2CDFB 3B2VL 2BP0B 1NGPL 4BA0A 2X7LA 3QORA 3QWNA 3L3OA 4KV5E 3SKOB 2WM0A 1YEEH 1EAJA 1LYQA 4QHUA 4N3TA 2Q87A 1OQXA 3TV3L 4LEEA 3T6ZA 2YXWA 3NSYA 1AAJA 4OF0A 5C0CB 5K69A 4LOUC 3NESA 5DWPA 4NQSA 4AJWA 3Q9QA 1OPGH 2ATKA 2FHCA 2O6FA 2OMUB 2ZONA 3ZZSA 2AJZB 2XVLA 1CXHA 4OGXL 2CG9X 1GJIA 2AKRB 3ZDYE 5CSGA 2EVJA 2C4XA 3ISRA 2XZQH 4LVHC 3KWWA 4M5TA 5CJ8A 3LEVL 1K4CA 4JX0A 2ZSWA 3MPCA 1OT2A 2G5BB 2VR3A 3H9YA 2XNAB 4N8VA 5C3LD 4CADB 2VDQB 3DUUB 4ZAKB 1RZJL 1KLFB 3HEIB 5F0PB 1PF3A 3EYOA 2NR6D 4KKCD 3FU7B 1IARB 2QQNL 3QHZL 4LPWA 5IM7B 4PGEA 2XFXA 4NJ9H 5T1KD 3WTUA 2O4EA 1FCCA 4LU5H 1F3JB 1MG2C 1U8NB 4ZYKB 5C08A 3WFZA 5E6IB 1TQVA 2R2CA 3B5HA 4ZW7A 5CAYB 1FBIL 2EVHA 1AGEA 1QSEE 2DQGL 5GS0D 3TT1L 4QHLB 3UBFA 5JO5B 1E4WL 3R0NA 2WO4A 3LS5L 1U8CB 4QXUH 1A3LH 1JNHA 2H45A 4XNYL 5ID0A 4JO8A 5T3XE 4N90E 4RWHA 3U9PL 2IGFH 3LN4B 2HG5A 3GMNB 4YGVB 5J06A 2DTSA 3BKCL 1F1GA 3LY6A 5I19L 4BYHA 1PAZA 4WY7L 4F7CA 4G8GB 5LUMA 4YDLC 5MEQB 5F93C 1MJ7H 4R8WH 4KV5F 1QO3A 2QKIC 1QSED 1U91A 1KB5L 2DI7A 1YCSA 5SX5H 3VGEA 4L8BA 4GKSA 3IJEB 5DS1A 4Z3EA 3WS6C 2X2UA 1HHGB 3V4VH 2YRPA 3NA4A 2DQFB 4EI5D 1WA1X 5ACZB 1T66D 3KS0H 4QOKB 3C6SA 3P0VL 5EEZA 1SY6A 3BIAX 3BQUB 1FNEB 5I8OL 1MRFL 1N8ZB 1DVFC 3S4SB 3MLVH 3ZDYF 3WY1A 5ETUB 2AJSH 2YAOA 3P3UA 1NBQA 4QXTA 3TBYA 4U0QB 5A2BA 3IJ9A 3O41B 3JTTA 4P57A 5D1ZB 3LZPA 2R0ZL 4PJ7F 5JHAA 1PMYA 1UJTA 2PR4L 1KGXA 3KLSA 1P4IL 3TBCA 1S9KC 2AV7A 4JHUA 1DBBL 2BWDA 1QQDA 2IAMC 3TX4A 1T7WA 3SBWC 2R0KH 3OKNB 5GZNA 5I1DA 2YQ3A 2PO6B 4LLUB 2OTUB 4Y2DB 3L1OH 1BAFH 2IH3B 4FFVC 4PJFF 4U1JB 3REWA 2H41A 4G82A 1ED3A 2JIXD 2P8LA 4W9LC 1SXCA 5BV7L 4OY9A 2PXYA 4HJIA 2CXKA 3DVGA 4RQQA 1WUZA 1TT6A 1ZTXL 4JPIB 3MBEA 5TTRA 1C5DB 1KFGA 2QQKH 1EEUA 3QUZD 3IDMB 3E1F1 3LKQA 4HSCX 2DD8L 2W80C 5EIVA 4Y5XB 1JNNH 1U4EA 1YEIH 1JVLA 5DRZA 3QJSB 4L1HA 4HVBA 5AVZB 4YXLH 1IO4C 4NRYA 3NFNA 4OF7A 2P48B 3NN8B 3O6FA 4LLQA 1B4RA 1YEGL 4JFFB 3FFCE 4W93A 1IC5L 4B5ZA 4P2OB 4X6BB 1RMFL 3Q6FA 3OF6D 3IS0X 3VXMA 3QPKA 1A6UL 2ED8A 2EKSA 3IT8D 4A04A 1OP5K 1OB1A 4FXGB 1Q1PA 4R9HA 3VRJA 5DJ6B 2HFGH 3A3YB 2XPGB 5IK3A 3T2OA 5E2WL 1ZSDA 1J48A 3GSXB 3UOAB 2N0MA 2JQAA 4G42A 3N42B 5E94B 1ZHBB 3PAUA 5D2NC 1XF4B 3DSFL 1JDCA 4GLRI 3T0XA 4NIYE 5KG9A 4JZJC 5I66A 3UG4A 3T08A 3ZSSA 2Q8AH 3PHOA 4L3AA 2NY6B 4XH2B 4XO3A 4P2RD 5FO9B 3MU3A 2R4RH 4L4JA 5GGQH 3MV9A 4NM8L 4PVNA 4L1SA 3V0EA 1NCWL 2VR7A 4J6RL 5JUEH 4A55A 1EEYB 4XP4L 2K6WA 3BVDB 1OZTG 5TE4H 1Q72H 3EFFA 4GEIA 3P4NB 3PV6B 1TTGA 3INOA 3D4GA 2NX5A 4AQOA 1XF3A 2X4UA 1MDTA 3FZUC 2VL5A 3B7TA 4EDWH 2H0PA 2NLJA 4PWGA 1E4XL 3LJ3A 5F1NB 2VGLM 1I1RA 4XHJD 1UOLA 2ZNWA 2FJHA 3OJVC 5IBUG 3RTLA 15C8L 1CQYA 1M42A 5LDUA 1H8OA 1Q9LB 3UIYA 1ID2A 2F61A 2DEYX 2DQTL 1RIVL 5D1XD 2IWEA 2OR9H 1S9XA 5L2KE 3ALWA 3WL9A 3F7QA 4C55A 2R2BB 4FX5A 3NT0A 2VXSL 1OTSC 1RLBA 3FSWA 1KGUA 1V54B 3D2UA 4FQXC 1BWMA 2P49B 5G4MA 3ZZQA 2DLFH 2VSMB 3EOTL 3L5WA 4BK8A 1IGJA 5H94A 3VFRB 4ZTOL 2VUKA 1U3YA 1AY1H 1N12A 5CSZA 1SJVA 4CC4A 4DZBB 1J9SA 3FB8B 5F96L 3QHFL 5ABAA 3IGKA 3MR9A 3ME0B 1A7OL 4ILDA 4MNGE 5DMIH 3BO8B 4QGTA 3UYPA 4CVZB 1PZUB 1BXUA 1DN2A 4MA3A 1M53A 1UH3A 2F1BA 3GSOA 4E5XG 4IEFB 1H3XA 3US1A 1N6QH 1YYCA 4JKNA 1KTLB 4YO0A 4X6DB 2HRLA 3T4AB 1EMTL 2IWKA 5C07B 4JVWA 2APFA 1DLFL 2UZXB 5EC1B 4AIXA 4E9TA 4F24A 4Z5RB 3F64A 4LSQH 2OZ4L 4Z7UE 5A2CA 5EC2A 2PW2A 1OWRM 4Z3TA 4Z3HA 2XIIA 1T20A 4XMVA 3FQ2A 2XQYG 4M8QA 1HZLA 5AAWA 2X6BA 3W0WD 3GMPA 3S3SA 1OM9A 3VI3A 4JZOA 5FW6A 1A4CA 1Q9WB 1SOXA 4RAHA 1UURA 2PPAA 4M8VA 4NZUL 5T33H 3V4UL 1EBPA 4CC1A 4IOIB 1XHHA 2C5DC 4JMNA 4EQ2A 1T21A 2XN9A 4Z7QE 1U6AL 5FYJL 4WI0B 4ZBJA 3UEZA 2XIDA 4UOZA 1ILUA 2BVYA 1OSZA 2G3MA 3HMXA 4PGZA 4MQTB 4EUPG 1HESA 3LNHA 1AHKA 4AEHH 3QFJE 1F02I 2Q76B 5F7FA 4D9QD 2F0CA 5I6NA 4QTIH 3D9AH 1BQLL 1WJ3A 1RUAH 2HRPH 4N87A 4Y9BA 2ZYIA 1ID5I 3B9AA 2V7NA 5B1CA 1I8AA 3VXSB 3H6AA 2DQDL 3GHEL 4B96A 1D5IL 1ZS8B 5FM8A 1HDMB 3W9DB 1RJLA 5LHDA 1TQWA 3BRDA 2A6IB 2ZWLT 4NQXB 3IRCA 3NP3A 4AM0A 5JOFA 4G8IA 2V2XA 4KNUA 4OLUH 1HTYA 1MRDH 3QQDA 3VXTA 1WC7B 1UWYA 5F21B 3VFUB 4PGCB 1YNTB 4ZSOA 2PNDA 5HHNA 3RLSA 3O3DB 1RJYA 2GIYA 4OBSA 1HCYA 1U8KB 3ALXA 3RHWK 4LSUH 5CKGA 4Z7UF 1QR1A 5F6IC 3PIQA 4JB9L 5TPWL 2HZHA 2QV4A 2P8PA 4JPVH 4L9LA 2AXGA 1CWVA 4XRCB 1A1OA 2BS71 5D93B 1T2JA 1E27A 2VOTA 3A4FA 3K5SA 4MSWB 4QRQA 2PPCA 3UTZA 1E7VA 1LP9A 3KPLB 2C7UA 3V7AG 3Q8AA 1KYAA 4JRXD 4XNQB 5KSAC 4PWHA 4Z7QF 2YPKA 1FZKB 5J11B 1XB3A 3IFLL 1KXQA 2EILB 3ZDXF 5LLIC 5DXWA 4F20A 4KJQC 2WN2A 3VFTA 2COVD 2O5NA 4Y16B 5FYKU 4D9LH 3CK0L 2Q86A 3A6BH 5CUSL 3GSNL 1ZTXE 2MNUA 1ZLVK 1R3LB 3H7BA 1IAMA 4MCYB 1ZAGA 4P06A 2QMKA 3BDBA 4EN3C 1YO4A 2O6DA 1LTXA 5B4MC 1YNKL 5IB2A 4MNQA 4MCZB 1RSYA 2P26A 3C5SA 1J05A 5EU6A 3X12B 3F7YB 3LZLA 4WHTA 3T3PF 5IB5B 5C6TL 1FNGB 3O6MH 3B2UD 1KEML 4LLMA 1BQSA 2I60H 2L04A 4NZDA 3N9GH 5J12C 1XF5B 3AU1A 5GXBB 4KTEL 5IBLD 1WIOA 3ZDZE 2NZ9D 3GNMH 3LH2H 3VSTA 2HH0L 3RBGA 4LVNB 4WJ5B 5KTEH 4ZT1A 3OPZL 1QEWA 4WO4B 3K80A 4FFYA 3ARTA 4N0UE 4D0DA 4DEPC 2J8UB 3V52L 12E8L 3H4HA 3U2SA 2FQFA 4NGHL 4FLSA 3TT3L 4AXWA 2RJMA 5JW5A 2PWFA 2EIZB 1L6ZA 3H42H 1QLFB 1G6RB 1MXGA 1AKPA 1MCKA 1FH2A 2WLIA 3QI9C 4JDZA 4K7PH 5BRQA 4Z8FH 3KJ4B 2BJML 3T0EE 4X9BA 2YD3A 3OZLA 3PWPA 4HFUL 2VLME 3CVDA 3Q8CA 3DPBB 5E8EB 4PY7A 2OR8A 5J56B 3MXVL 1PLCA 1NGXB 3RTQC 3HUJB 3VMOA 2BFGA 5C0BB 2OL3H 4HS6A 2HT4D 3EHBB 5E6UB 1D5XB 1CD1B 1I7UB 4BFNA 4ODTH 1FLTX 4FLRA 4FFZA 2OV0A 1FL5A 2NSMA 4G6FB 4BK4A 4UOW1 1VPOL 1X7QB 3BEWB 2VDQL 4PRNA 2VR6A 4EZKA 5JR1H 1GS7A 1NCCL 2WQVA 1NAKH 2YAQA 1FNLA 4KK5D 3IJHB 5E08L 2VLMD 4AOFA 4PJ5A 1EO8L 2X1QA 1LE9A 3O3BA 4TVPD 1NEPA 4PVLA 5FLUA 4LFHD 2QPDB 2Q6WA 3UYRL 1M9WA 3FC8A 2EO1A 2OJEB 4NRZA 4XTRC 2VDML 3A6CL 1MN4A 2EP6A 4RDBA 1MFAH 4X98A 4F15B 2ARJQ 5JXED 1KB9J 4N0CC 2FLBT 1NFKA 1S78D 4OZIE 3UDWC 1FV1A 3PQYD 3Q0HA 1AJ7L 5IQOA 4X6CA 2B77A 3X11B 3BVWA 5SWZB 3FXIC 3OGOE 1GKEA 4GS7C 2D7MA 2FWOB 4DWHA 5EOQH 1IT9H 3O8XB 4EVNA 5JYMA 4F58L 2X0WA 3IKKA 1SN5A 3QIBA 2EEXA 1AD0B 1L9OA 4TSAL 1U8QA 1BZQK 4LPVA 5FM5M 3O4LB 5BZWA 2X4TB 3RBSA 2LAGB 2NY0D 1GAFL 3WI9A 3H8NA 1IBYA 1HKLH 4ZS6D 1JPEA 2QELA 4Y5YC 3DMMB 4GAJH 4ZX4A 1OWWA 3H85A 1YECH 2VZUA 5EF0A 3O45A 2V7HA 3Q05A 3LHPH 1U92A 3UAJD 5FLVA 1JGUL 3CFTA 4MJ6B 1J9QA 4A2HA 2EZ0D 4LPXA 2Q2LA 3UTTA 4FAAB 1BGXH 2JTYA 5FKPA 3OSKA 5IWLC 3OB0K 5FYJE 2CDGA 5C7XH 5A2JH 3K71B 4HC1H 2C9XA 3LNGA 3D3VA 3V0GA 1YJDH 4AJYV 2B9BA 1MIEH 3QDJE 1KPRA 4KRPC 4GSQA 4XCNA 5D72H 1LWJA 2QSCL 4PG9B 3TNNA 2JKSA 3L54A 4NO5B 4XCFL 2DM7A 1LNUB 1PZBA 2WBJC 2BK8A 4X6FB 1O5DT 1DUYB 5D8JL 3MGTA 4NOBA 4OT1H 4F2MB 3CMOL 1KN2H 4BRVA 3KHOA 5EIQA 3QJOA 4I9WD 2JCWA 2KDYA 3CFBA 5CEYA 3N44F 4KKAC 1TCMA 4HDIB 4R4ND 4U6XA 2HP4A 4MA8H 1P7BA 3QCVH 3PUCA 4ODHH 4OIBA 4HBCH 4Q7DA 3VDBA 3VACA 3WMQA 4OZIF 2HJLB 2MQGA 1FVCA 1KLGB 4RH4A 3V5KA 3UAEA 4K94L 3ARDD 4B0MB 3V9CA 3IETA 1MCQA 3DGCR 3IU3A 1WIPA 4WTZG 2VW7A 1M56B 4KH9A 5AKSA 1NOFA 3CVHA 4F7TA 3NJFA 1DQDL 1N59A 2HKHH 3FCSA 4Q9RL 5JNYB 2F19L 4G7RB 4ABVA 2VLJD 3EJYC 1NSNH 3CBRA 3FQRA 1TTFA 2AW2A 4U3XA 4W6YB 5AG8A 3RDTB 4P5KA 2YGQA 2HMID 3RJQB 4E41E 1NLBH 3BUTA 5GS1A 4GSDL 2BOCA 5AB0A 2E76C 1F45A 1EGJL 3KPPB 3PL6B 2C9PA 4GG6F 4OLVH 2DWEB 2H2SC 3QUXD 4X0KB 2FGWL 2WBKA 3GKWL 4FQQB 1GGUA 1NUNB 4UMSA 1D6EB 5EFIA 3LMJL 5I8CB 3I02A 4PJ7B 2EDTA 3QZLA 1OAYH 3BAIA 1KGJA 3D05A 4JFZL 3L2NA 1AE6H 5D5ME 4WEEA 3WUZA 1BW8A 4ZMPA 5GJTL 5FA4B 1EHNA 4BQ9A 5DMYA 1MJ8L 4JQIH 4WWKC 4AEIL 1MW2A 1RUPH 2E9GA 3QWOA 4OVUA 4XVUC 5ISZA 2NW2B 4PJBE 1N68A 3CVBA 5FW8A 4BHUI 3E2HC 5D7LE 1L7TH 5E1IA 5IBUB 1AG0A 2O30A 4FNRA 4PLKC 3UZVA 1CFMA 1ES0B 3PPSA 3MJ8A 3EJTA 5HHOB 1DJGA 4PP2B 1W6LA 4IMLB 4EI5B 3RWDB 3F62A 3VD1A 4U1MA 3PABA 4PV9A 2EYRB 3F83A 3FYEB 4A2FA 1TKWB 4YK4B 5HDLA 1HT6A 2VDLB 4QYOA 2WWKT 3GRWH 3DGDA 1KF9B 2CLVB 1FG2B 3TBSA 1AGBB 1UB5A 5FUZH 2AQPA 4JM2C 4WFHD 3CFMA 1X5AA 1PTZA 3DURB 4RZKA 4UMGA 1NCIA 3QZPA 1JXFA 3OLGA 2C3HA 3HIZA 3US9A 1P5VA 3INUH 4E5XB 5CJXA 5C0CE 4HUMB 4WUUE 4JCMA 1A3RH 4S1DC 2J6EA 3Q1SH 5AW3B 1KBVA 3HG1A 4JK0D 4WI4A 3QP3A 5I1LA 2VUYA 4QHKJ 3PGFH 2ESVE 2FEEI 4OFDA 2AV1B 1H3WM 1N70A 2HTKD 3IFNH 4LSTL 3VTMA 3CFKA 4ZX6A 4KXAA 2H8PA 5D7IA 1VDGA 2ITCB 2NNCA 4U6VL 3H9HB 4BUHA 1RUKH 4P4KB 3KPQB 3D18B 4EAEA 3HTLX 3GZQA 3LKRB 3GLAA 5EU5B 5DJDA 3T6VA 1U8LA 4BHUA 4WUUD 3ARFD 4F7KA 4GOSA 2X0VA 2VDPB 5G2NA 2PETA 4PRPD 5D7SH 1K5NB 3RB5A 5CJ5A 1EHAA 1WCBA 1OAUH 4A6YB 3DETC 4CA4A 4PJBF 2NCMA 4YH6A 1JWMA 2DWDA 2FO4B 3ASNB 4QHMB 5E1QA 1UC6A 3TWCH 1WBXA 2YMOA 1USZA 4EUPB 3NFSH 3FRUA 1FZOB 1ZA3A 1B4JL 2X05A 3FH7A 4YEEA 4OM0L 3QDGA 4OQTL 3KPOB 5JPNC 1J5IA 2I07B 2QL1A 4X9HA 1KGCE 3E8VA 3MLRH 5F72S 1VRSA 2Q9OA 3CLFL 4IRZL 2X2HA 2NTFB 5F7DB 2DQEL 3BH9B 2NY3D 4J3UA 1IILE 1NGWA 3MRFA 2ITEA 4FNSA 2C1OA 1ERNA 2X4SA 2Y5EA 1WEJL 3EYFA 5AVXB 4F7PA 3LKNB 4CU8A 1TETL 4BA8A 4G8GE 2PP8A 2LR4A 4L2YA 5TH2B 3HNVH 4I48A 4MMYA 2AJ3B 3FONA 4FP8H 2AQQA 4N8CH 2IALA 2PYEA 4G1MA 3BUYA 5DMGC 3WE6B 2IPKB 2WWNA 4HFWA 3QQ4B 1CBVH 2YPLD 4GIOA 3EH2A 3AGVA 4JLRA 3BE1H 5F7LB 1N18A 1IM3B 4YXHH 1KNOA 1M1SA 4PPTA 4UV4H 5B3NA 4HCFA 1DJXA 4Y89A 1GS8A 5F97E 5T3XH 1A1MB 4BFBD 5DUML 4YZFE 3SDCC 3DRTA 3GD1C 4YPJA 4HLEA 2ZUSA 1U9KA 5IROC 4W9FC 1FH5H 3VJ6B 1ZA6A 1JGIA 4K8RD 1E28A 2OZNA 4JHBA 2FJUB 4YBLB 4JQXC 4Q58C 2XETA 3IMUA 4U05A 4DGIH 1ET5A 3VWJC 5EIIG 4GXUN 5KN5A 1KN4L 4G9FE 1NMCC 2R1XA 5BQ7B 5DK0A 1XR9B 3OJ2C 5L0QC 3F6LA 2B4CC 4CU7A 3WDHA 2WQ8A 3BT0A 1YMMD 4ANUA 2WLLA 3CVIL 4D9RD 4Q9BA 1M3IA 1WP6A 4WWID 1A4AA 2E9BA 4KJWD 2R2EA 3EJCA 3IJYA 3BWZA 1D3CA 4ZMNA 3FUFA 3IXAB 1KY7A 2CUIA 5F71A 4LPTA 1CTMA 4HMDA 5HXMA 4J8QA 4ZZFA 4XPBL 3NDZE 3F5WB 2Y7OA 5DRNB 4BD4A 4Z76B 4Z7VA 4HH9A 1IFHH 5I15L 4WI2A 3M8OL 4YN3A 1H5BA 2OMZB 4L9DA 4PIRF 4MMXC 3WS6A 3UAFA 5ADPH 3ATBA 2JJUA 1I1FB 4XPGH 3GPSA 4IBLT 4X4ZA 4J3OC 3RPKA 4CNIA 3VD4A 3D0LB 5E5LA 2IDUA 3PJSB 1A4KB 2J88H 3DHJA 4U4BA 2G75A 1JGEA 4NEHB 2HLFD 3PNWA 1C16A 3HBPA 1DO5A 4BH8B 5JQIB 1NA8A 5LJYH 1SUHA 3N91A 4J28A 5C09E 1OW0C 4WV1A 2QKSA 4NQDE 5AUMB 1G6RL 5F9JB 1NUFA 4AT6B 5B7EA 2HPTA 1K2DA 2CO4A 5HPOA 2W9DH 3IJSA 4GBXB 4XMKL 2CKBL 2P47B 5IB1A 1BFSA 4YZFF 4NN7B 3CN4A 4MS6A 5IREA 4IW4C 2HVBA 4M1DL 1NBCA 4I87A 4KI5D 5D4JA 2K0RA 1G7MA 2NNAB 2JI3A 2JJSC 5F7HA 5GIRA 2IAMA 4WRLA 3SBWA 3F58L 2NY1D 2E74C 3TO4C 5EZOH 4NBZB 3TF4A 4MD0B 3G04B 2OMWB 5C09D 3GMMA 4HS3A 1XCQB 1RZJC 4P3DA 1NCNA 4TUOA 2WKLA 2HX8A 4NCC1 3HZYA 4LB8A 3GJFB 1UASA 4UT6H 5D6CB 2D7TH 1M4KA 3WIFB 3TGXA 2WMPB 2RFXB 3Q06A 3NEOA 4GW4B 1I31A 4QAMB 5D96B 1J8RA 3DOHA 3BWSA 1JMZA 1I7TB 2QADB 4P3WA 4JRFA 3T2NL 3D85D 3MNVB 3CN0A 4EQ3A 5I8EA 3BGFB 3OKOA 1BMGA 3RUGA 3UGEA 3I75B 4FMVA 4OZFA 5C0IB 5D71L 2LFGA 4IOFD 5LCVL 1BXXA 3WV0A 1KCSH 1FE8H 4I18C 4EI6A 2A6DA 3WLWD 1NICA 5HPMB 1IGMH 4ZOBA 5HHPB 2DV6A 4PM1A 4WI9A 1KIPA 4RMBA 5JIKA 5IVXE 3GMOB 4G6ML 2YZ1A 1FFTB 1F6LL 1SJMA 3FF8A 1JV5B 2BY1A 1DDHA 3MHZA 3MAWA 5T1MB 2WNKA 1J0IA 4R7DB 2YZ8A 2W0FA 1BD2D 1CE1H 4S0TD 3NTCH 1OP5H 1U3JA 4WHYH 2Z64C 3TBVB 4LNRA 4KI5F 1NGYB 4R90H 3EBHA 2VDRH 4GG8B 3WKMH 3S8GB 3U0PA 4GT0A 2R56H 4X6DE 2GJRA 5DEFB 3QVAA 4XODA 5C3IA 1JXJA 3WS3B 1ZT1A 1I3RA 5GGUA 5I6MA 1TVDA 1TFPA 4L8DA 1Q0XL 2P3YA 1GSKA 3FU6A 5EN3A 1T22A 2MEJB 4D8PA 3B2VH 4LKXB 4FA8A 1N6VA 4HLJA 1NGPH 1J0YA 3TM6A 4BH7A 3PAVA 1IC4L 2MQ0A 4DP5X 1KBKA 3DOSB 4J3OH 5EO0B 2Z8WC 1XL6A 2V5SA 1R17A 3V4PL 1ZT7B 4YS4A 5DDHB 3GB7A 3TV3H 5ERWA 3V8OA 2BVQA 1KG0A 5T5NF 1PLGL 2QVTA 3I50L 4U1NA 5AYTA 3R7RA 2YHGA 4L3ED 5IJVB 2F18A 5I82A 2PCXA 1BZOA 3GJEA 4ZFFB 5JMOC 4FQLL 5D9SB 1UOVA 4OGXH 5HDBE 2OMYB 3WD5L 3T6QC 3ECQA 1J8HB 3X1BA 1OCZB 4RX4A 3W39A 1RIHL 5E2UL 3LEVH 2L0DA 3UTSE 1AKJD 1IGFL 2TRYA 4U6YA 3C12A 4N26A 5DD3L 5IG7B 3FOMA 4L0YA 3HG0A 3V6ZA 1RZJH 1K85A 1MVUB 3M7OA 3QHZH 1FC2D 3TN0D 2QQLL 2A9DA 3K1KC 1IAKA 2QDWA 3FQNB 3W81A 5IVXF 1QUPA 3D34A 1DQLH 5DA0B 1O6VA 2WB7A 3V4LA 5E00B 4NQTA 2AC0A 1FBIH 2F5AL 4KXCA 2VR5A 2DQGH 3TT1H 3LRMA 4POYA 3F84A 2WW8A 3NJLA 5TDNA 2IOMA 3UTSD 3FB6B 1E4WH 3LS5H 3KWTA 4HUNB 4KY1L 1BJ1J 4XNYH 1U33A 4MMZC 1UT2A 4UIMB 3QEQB 2AITA 3D4ZA 3U9PH 5FXCH 3II2A 4LKCB 3LKSA 2IG2L 2VLLA 3BKCH 1RV6X 2R29A 4NPJA 4FQJL 3S6CA 5I19H 3GS7A 3LZOA 5I2IB 4WY7H 1CT8B 4MBOA 3UPAA 1TEYA 3ARSA 2GJZB 4HS8L 3SGJA 2F54E 3CCHA 1KLUB 4NNYA 2VR8A 1KB5H 3T0EC 3T6XA 3KAAA 4KK5C 5FO2A 3VFNA 4A7GA 2UV3A 2GITB 3VE0A 4K5MA 4HEME 4RMUA 3GSWA 1MREL 1ZHNB 1QLEL 2BCKB 2YEVB 3P0VH 5AWNL 2CA3A 3U48A 4Z23A 3D69B 1THAA 1I8IA 3KBEA 4D0CB 1MRFH 1QPXA 4TV3A 5HDBF 4HWBL 4JFWA 5LNGA 4FQHB 2K1MA 4UTBL 2F54D 5ACLA 3BJ91 1SPDA 2C3VA 3WEAA 4RZCA 2GTQA 4UQEA 1O9VA 3GZKA 2NY0B 2WWMD 2YIHA 4TQIA 3U6XA 2R0ZH 1LK3L 3C8HA 3L6FB 1NC4A 3SPVB 2PR4H 1P4IH 5JTWA 3DPDA 1BAWA 1J7VR 5DFVC 1DBBH 3AUVA 3C60D 3BOVA 3DROA 5FGBA 1D9KC 4P23D 5DC0A 4QRUB 1JMXA 2W81C 3B2DC 2VXUL 3UP1A 3FU9A 3HN3A 1BV8A 3KWVA 5BV7H 4Q9CA 3NGBC 3CDCA 1UKSA 3MSPA 1ZTXH 1Q0YL 3MCKA 3V0JA 2I26N 5I16B 1LWRA 1W80A 2GJPA 3GXIA 4ONFL 1IFRA 1FGNL 1PZ2A 2DD8H 1S8DB 5ICUA 3X14A 4DK5A 4GG6B 3OMZA 2QSQA 2WQSA 2QPFA 1WD8A 1FFNA 1E40A 2G9HA 1ORQB 5G4NA 3OLIA 3VXRD 3UCRA 1BIIB 1YEGH 3CLEL 3MGAA 4LP4A 1IC5H 1RMFH 1T2QH 5H35B 1AO7A 4MKMA 3K1DA 2WWKO 4NFCA 4I1NB 1A6UH 5EOCL 1ZOXA 3HUJE 4DGUA 5JXAL 4RA0C 4PREA 1Z5HA 5DJZA 1U8PA 4IBTA 3HCVB 4PYGA 4X83A 1N67A 1VFOA 3IPFA 5E2WH 5DJ2B 1EXUA 3AADB 3ARDB 3PF2A 3TFBA 2F7PA 3DSFH 3HS8A 2VDOB 1AQHA 3HOGA 3HS0C 2V37A 1XGTB 2OYKA 4GINA 3P54A 5IW6B 4FHBD 5HGAA 2TRHA 1ZRUA 1NJ9A 1FN4A 4JRYD 4CJ1A 4NM8H 1CGTA 1MCOL 1TVBA 1TZIB 1ZPUA 1ZLVH 1NCWH 4NUMA 4AW7A 4J6RH 1EDYA 4LQ1A 3WE1A 3NJHA 2F74A 2XOTA 2XVBA 4XP4H 4X4XA 4JY4A 4TRPL 1ZVNA 4HWUA 1LO5A 4NHUA 2YLKA 2Q0ZX 2OCFD 2O6CA 1JTOA 3MRKB 2QVKA 5KEZA 1DQQA 3FF7A 4AGLA 4G80B 5FGCB 2W92A 1E4XH 2VZOA 4JUSA 4CKQA 2WCGA 2YD2A 2WC7A 5I76B 3TCLA 15C8H 4NWUL 3V0FA 2ENPA 4KROD 2VXVL 2DQTH 1RIVH 1J9RA 4EKXA 5JMRA 1AYRA 1AIZA 1E3XA 3HE6C 2UWEE 3QI9A 4HU2A 5KAQF 4UUJA 3LPFA 2VXSH 5MI0B 1BYOA 1GA2A 3O4LE 4P9HL 4PJXE 3SE4A 4JGMA 4H8VA 5KSVA 1IEBA 2H2PD 3EOTH 4PRDB 1ESOA 1HZKA 1NWPA 5LN8A 3SDXE 4ZTOH 4TN9A 1PYWB 5DUPL 5H8DA 5JW4N 1LQSR 1UTDA 4GRLD 3WTSA 4LVOC 3IKCA 1IJ9A 3JV6B 3GS0A 1OK8A 1COBA 3QHFH 1WBZA 3P11L 9CGTA 1A7OH 1TJXA 3APCA 3EYOB 4O2CA 2BC4B 3FCTA 3OX8A 2UXTA 5LBVA 1BLNB 3L5JA 5SX4H 1HX0A 5DEGB 1PAMA 3EDFA 1L5GB 1KTDB 4UYPA 5JIDA 4DPCX 2BW4A 5EIIB 1EMTH 4JFQA 5DRXA 1LILA 5KVFL 4GKLA 1CE6B 1MJUL 2OW7A 1DLFH 2YUWA 3QQ9C 3EGSA 3MC0A 1P7QA 1A6ZA 2OZ4H 1YPZA 5BS0E 1I3UA 1ORSA 3KBFA 4ZPVA 2BSEA 5ID0B 1JNHB 1JTTA 1U3NA 3CIAA 4FULA 1FL3A 4LBEB 4LHUA 4QNPE 2X4RA 2XXCB 1Z0MA 3HBZA 4P5TD 2HT2D 3G5XB 4JO4L 2UY6A 4ENED 3MLZL 3UDWA 3V4UH 4NZUH 3SSGA 3T0BA 1T1ZB 1J87A 3DV4A 4S1RL 1UXSB 2D7PA 3I9GL 2IPTL 3RAJL 1BBJB 2ILLA 4Y1AA 1YEKL 5JA8B 1QO3B 2M2DA 4WKZA 3F04A 4AQEB 1L9MA 1U6AH 1QRNE 2FUQA 5FYJH 3TIEA 3JBG7 2XI9A 3M17B 3RZCD 2CPUA 4Q2ZA 2B1HL 2SEBB 5BS0D 2EE6A 2Z0UA 3AG3B 5DVNA 3QWRA 4QRPA 3T9WA 1YEJL 4YDJA 3RFZB 3L3DA 3APNA 1GZQA 1I1AC 1MFBL 3KYNB 3GINA 3ARFB 4JFEA 1A6TB 1MHPL 3B7RL 2QFPA 1BQHA 1RUQL 3CFCL 2UWEF 4C56E 1DJHA 3QQ3B 1BQLH 4KWUA 1DFXA 4KVCL 4Y5YA 1AS6A 5DMKB 1QRND 3GSQB 5AYQA 1BVOA 4IHOB 4U33A 1A7RL 1WD9A 3H54A 3CUPB 3JTTB 1AOZA 3HRPA 2AGJL 4Z0BL 4N8PA 2DQDH 3SDXF 3GHEH 4G43B 3DSNB 4R5VA 4EIGB 4KQ0A 4AK2A 4N22A 1D5IH 1EPFA 1C12B 2A99A 5JHDA 2EDLA 4P46D 1HSBA 1P5UB 3DTDA 5E2VL 4NDMB 1PFOA 4RA3A 5D7KD 2C3XA 1PNCA 1OHQA 4ISVB 5FB8A 1RIUL 1ICTA 4FZ8L 1IC1A 3BPNC 1KCUL 4AGNA 2Y7SA 4GUPB 2MSPA 4Q4EA 1YMHA 2WBJA 1EBAA 1YYLL 4J4PC 4X8GA 2CBTA 3J07A 3UX9B 3MBEB 1M2OA 2DQJL 2AJYL 2FEJA 1DQML 4UNIA 3UBXG 2CCLA 4OH2A 3DIFB 4IU3A 2J3SA 5AW7B 1QYGL 1Z0NA 3FSOA 4GPVA 3CZEA 4ZAKC 1LEGA 5TPWH 5EU3B 4QNPF 3KPSA 4I0PD 1R1CA 5JQ6L 4LCYA 1IKNA 2BHZA 2YPLB 3NABL 4DUWA 4LRIC 1XEUA 1TQBB 4W9JC 1WGOA 4WK0B 1VFBB 3KPNB 3E6FB 4J5VA 2EKSB 1EAPA 4JFUA 4M7LL 2N4IA 2ZWSA 4LPCA 3MRIA 5C9JA 3DTUB 5IK3B 5AOLA 5HJGA 2NOYA 1XAUA 3RVTC 2H3NB 3SOTA 5F7AA 3NOIA 5CUSH 3GSNH 2ZWKA 3THML 3ATAA 3CFDA 2H5UA 5FFOA 3DYMA 1W72B 4OZ4B 3VFWB 1YNKH 4OF6A 1K4DB 3ZT7A 1I82A 4TULL 5KZCB 4JNXA 4LOEA 1GYCA 1T7VA 5INCB 4XCEA 3RGHA 2ARWA 5C6TH 4BKTC 3T3ME 1KEMH 2JSFA 3TU6A 5EZLA 4I7ZC 4NKOA 3M1BB 1YMMB 3R18A 4HAFA 1AACA 1QR4A 1PZSA 4KTEH 3ZGHA 2HH0H 4TNEA 3FQ1A 2YAPA 4WW2B 4ELMA 5CD3A 2NX5B 3OPZH 3MNWA 1TENA 3BQUC 4RGOL 3V52H 4WF7A 5KYYA 3TA4D 2LLGA 4LLDA 1TO5A 4WWKA 4DOHB 3QXDB 4JJ5B 4Y1TA 4NGHH 1FNSL 2W91A 3F6IA 1VA9A 3L5HA 3TT3H 5M95B 3MNDA 1Z9SA 1BX2B 5IHBA 5EF1A 2BVPA 5D1QE 3WL9B 3X3GL 3SGDH 2BINA 1NCTA 1KB9K 4PH8A 4PJ9D 5D1ZC 3N3EA 2XG4A 5AW4B 1NFDE 5DURD 3D2UB 1WZLA 2BJMH 2VJ0A 2XTJD 1Z6JT 2GT9A 4HFUH 4HIEB 1P1ZB 3X13A 2BOBA 3L5WB 4IKNA 3MXVH 4X4ME 2R23A 2WUBL 3MRNA 5MEPB 3BN9D 4X9FA 3TPKA 3H9SB 5BVJB 4IOSA 2MCAA 3LD8B 3ZL1A 3IDGA 3LTVA 5IHLB 5F7EL 3H2PA 1EA9C 1VPOH 2WSPA 3A4DA 4MA3B 4NCC2 4XAKD 1GZPA 1EFXB 2VDQH 2H3XC 2JB6B 2WKOF 2XVKA 2JH2A 3KW7A 4E36A 1D7BA 4ZXBA 2VCOA 1NCCH 3DUHA 3QIWD 4Y5XC 5E08H 3HPLB 3AMLA 4K94C 2KC0A 4PY8I 2LABA 2A9BA 3D39D 2H6PA 3LB6C 1EO8H 1HVXA 3WKYA 3L3GA 1HYSC 1FP5A 1G7IA 2W07B 4LDOB 1GRWA 4PJCE 2NY1B 1QHPA 1UVQA 2VE6A 4LASL 4R4BA 5EC2B 3RVUC 3S3CB 4XNMA 3UYRH 3AQDA 2VDMH 3A6CH 2X2IA 2Y6SC 3FAWA 4GRWE 2BH0A 4N2NA 4QCIB 3UTPE 2EDOA 4FXGC 4FZEL 1EHXA 5DZ9A 2VAAB 3QZNA 3ECBB 2AQSA 4NRXB 2WQWA 4P0DA 3KL5A 4WQOA 3T3MF 1AJ7H 3D06A 2Z92A 3D4CA 4AZ8B 3II3A 3U36B 5E56A 4JKKA 3AQXA 3O11B 3FO1A 1RZKL 1TCRA 3K4ZA 1BLIA 1JPSL 1RSFA 1EZLA 3D85B 4D2NA 1X5ZA 4F58H 2LU4A 5CGMA 2NY6C 3MGOB 1OVZA 2R0WL 2YMXL 3V7AE 4FTDA 5KVFE 2CWRA 3UTPD 4AMWA 3SPGA 5DTFB 4TSAH 5GS3A 4BZ1L 1QKZL 2AEPL 4NZJA 2OKMA 5LAXA 4MWFA 5SWSE 2WXGA 2AS5M 3MACL 5C8JA 3LPWA 4IBQA 1FGVL 1BD2B 5LG1A 1G0DA 1YNLL 2BSTA 2FT6A 1YEFL 1Z1WA 2Z91A 1ZY9A 1MCJA 1AR2A 2P28B 2IEPA 3GXNA 5CP3H 4DH2A 1M7IB 5E9NA 2HTLC 1GGCL 1JGUH 2EE2A 3CU7A 1UXMA 3UPRB 1ZWIB 5IHZA 3JVGC 1KBWA 3DIDA 2OYPA 5IOPA 1U8HB 2XWRA 2EO7A 2YJQA 4MS8D 1F1AA 2VXQA 3D5OF 1PX4A 1FVEA 2WLYA 3V6OA 1JV2B 4AM0B 2WP3T 2GTZA 1DL7L 3ZTJH 2PF6A 1SZNA 1WFMA 4MB4A 2QSCH 4NPYA 2W9LA 4XCFH 5LNEA 2KQNA 4ZSOB 1AS8A 3A4EA 3FFCA 4QKTA 5D8JH 2Y5TB 2XZAL 1TJHL 1TZHB 3CMOH 1S9YB 1CI3M 2XSKA 2J5LB 1AOHA 1B88A 1OGPA 2N1KA 3GXFA 3POCA 4Y4FC 3CHSA 5GZOA 5EBGA 4MDJA 5JHLA 3LVTA 1JTPA 3PIQB 5ANME 1Y6MR 5DUJA 4L3EB 2P8PB 1JWUA 2NUTA 43CAA 2GUOA 1GOFA 1KXVC 2AXGB 3B3IB 5K39A 3VXOA 1XGYL 1UM6L 3BN3B 2UZYB 5I5IA 1W0VA 3CSPA 4K94H 5IROA 2C4FU 2WQXA 2W60A 1DE4A 1UQSB 5E7BA 4H0LC 1BVLA 4WFED 1R46A 3CXDL 3AXLA 1AKJB 4F8TA 3GRGA 1DQDH 1B3IA 1S3KL 4Q9RH 2F19H 1AR1C 3ZYIA 1R3KA 3SQBA 4DTGL 4I4WA 3U2JA 3JTSA 4KI1A 4OR1A 3BUDA 3TN0B 4H1LA 4HHWA 4KMTL 4UBDD 1L9QA 1ZXQA 2VIRB 3JWDL 3QW9A 4QEGA 2BDNL 1F58L 4I2XA 4GSDH 3TFKD 2WTRA 2NXZC 1WICA 3AM8C 4MNQB 2BNUA 3C5SB 4ECNA 1LEIB 1EGJH 3MMEB 2R7EA 2HFEB 4FGMA 3TNMA 2FGWH 4MJ4A 3GKWH 3QJTB 5FYKD 4PBDA 3AU1B 3LMJH 3S37X 3FH8A 2QLYA 2YUVA 4JFZH 1VLXA 4FG4A 2WJ7A 4JDEB 3SDAB 4V1DD 4NO3A 1BG1A 3DXAE 4IGBD 4YLQT 5GJTH 2Y1YA 1UD3A 1MJ8H 2D2OA 2P5WE 4GKZA 4N20A 4AEIH 3FO9A 3HLAB 6FABL 2EYTB 4V2CB 1H6TA 4AXWB 5E03A 5JW5B 3OPUA 4NERA 4QJ3B 2IANA 2OAAA 5IZ7A 3BZFA 1A9EA 1JFQL 2BW5A 1T83A 3T4YB 2F58L 4N4YB 4MNGA 4QAWA 1ZDSA 3DRQA 3VFSA 3G5VA 4WO0A 3POHA 3MYJA 3EUDA 4LOFA 5F44A 4M6NL 1OW0A 5JPMA 1MSPA 2NPLX 2G3ZA 2BERA 2IF7A 3KXFE 4ZMVA 5KS9E 5CO1A 2DB8A 3DXAD 4YBQC 3SDDB 2ZAIA 2P5WD 3P02A 4HS6B 2WZPA 3KS0J 2XVGA 4WEMB 4UDUA 3AS3A 1CK0L 2G4EA 3DTXA 4HIHB 3EYVB 1T3FA 3KE0A 4X4YA 3A21A 3SJVA 4PRNB 2D7QA 2QSVA 2F8IA 4KK6C 1CD0A 3OAYK 3N1PC 1G6VK 5KVGL 1NANH 1V8HA 2FJFA 5EMYA 1AHWC 3UO8B 1WS8A 5IFJB 2J43A 2V3EA 2DEWX 3C60B 3NH7L 3GTTA 1J0ZA 2MTPA 3MV01 3RY4A 1IL1A 5J7CC 1B0IA 3SODB 3WFCL 2E9JA 3MJ7A 2NUPB 1I9IL 4J23A 3ABGA 5L4JA 2Y23A 4HF5L 3UJJL 1T0PB 4OZFG 5IJKC 1N26A 4R84A 3ULVL 2ZD0A 4U6VH 4X7SL 3FT2B 4N6RA 4NT6B 3PE9A 2AAAA 1YN6A 4B0MM 3WJJC 4JPWL 2YN5A 1V5JA 2A0LD 3VFOB 3UAAA 4Y16C 5EBLA 1Y7VA 3D12B 5E95B 3S0PA 4EF3A 5L4FA 1ACXA 3QUYD 4XBPA 1VKXB 4ETQA 3VXRB 3FT3B 2F08A 1AIFB 2WO3B 4NJAL 2J56A 1HI6A 3WKPA 4PRHB 4HULB 3LQAL 4OZGA 3CDGA 5E9DD 5FV1L 3PPEA 4GW5A 4TYUA 1OTUC 4U6HA 5HHMD 3FKUS 2IIJA 2VSKB 3QYMA 2CO2A 3L7EA 1KB5A 1Q38A 1B4JH 5C0DA 4LVNC 3ILPA 2JV6A 1G1KA 2XA3A 4OM0H 4OQTH 1SY6L 3S35L 4JFYB 3W1ZA 1MCBA 4WO4C 4PJIE 1RU9H 3K6SA 2R1WA 3CLFH 4IRZH 3ZZ1A 2OSYA 1M7XA 2B0SL 2JTDA 2WXLA 3QEQE 3QNZA 3UBHA 2DQEH 5BJTB 4WSJA 2F6AA 3UTTB 5DS2A 5IFAL 4J3BA 4JG5A 4JRYB 1WEJH 1FQ9C 1OAQL 1HWHB 1X44A 4OLYL 1TETH 2Z93B 4M9PA 4QO1A 4OJAA 4PJAB 4KKBD 2YQBA 1KGYE 1JZ6A 4WU5A 4ICWA 3VXQB 3TURA 3MGTB 4KJYB 5AD0B 1RK0B 1HHJA 5KYWA 4XZ4A 5CFHA 3R06A 5DO2C 5HTSA 4DSYA 3TA3D 2CIKB 4I3SL 3MRHA 2GEEA 4U6XB 1JPST 4H5SA 3UBXB 4PW9A 3CD4A 3S8WA 2GSIB 1AGDB 3H6JA 1P7KB 3NZ8B 2OBGA 3B9KC 3FW6A 1QW8A 5DUMH 4KBPA 1SYVA 3AB0B 1E5ZA 5EN2A 5C6PB 5J6GA 3BDXA 2GJ6A 1E4XI 3FT0A 4OV6F 2WLHA 2A7BA 5BUPA 2F53E 3ILEA 4UQ3A 3PXHA 3HZMB 3CTTA 3KZ8A 3BHBA 4AJVA 4F7TB 4KJPC 3WEMA 3QARA 5FHAL 3FCSB 1KN4H 2XHNA 2IVFC 2GIXA 3FQRB 3TC9A 3F3HA 2FLRT 5D2LE 3J27A 3S35X 1A4JB 1IBZA 5GRXG 1NZRA 3KPTA 3VFPA 4F91B 4TPRL 4LCWB 4F7EB 1QSZA 3CVIH 4R5XA 1JZ7A 4DVBB 5F0JB 2K3TA 2BY2A 1OLZA 2W5PA 4MMZA 4KO5A 3PDOB 2F53D 5BRZD 2VLRB 2CE6A 2GQHA 5B39A 1W72L 4PJIF 4HUVA 4DPAX 5ICXA 5SX4I 3BPOB 4XPBH 3ES6A 4YSQA 3ARED 3CLWA 5C2UB 5IR1A 4P5TB 3B43A 3O3UN 3NPSB 4N2EA 5I15H 5CKAA 4FHKA 3M8OH 3HR5A 4IK6A 1OV8A 3ARGD 3CC5A 5B1KA 2EADA 4DVRL 3L3KA 4G83A 2EACA 5DJXA 3HVNA 4C4KT 1KJMA 3DMMC 3I9IA 3Q13A 2R1YB 2EDKA 1VACA 4JL2A 4HHAB 3PWNB 4OFPA 1XSJA 3HZVA 4L1LA 2AXWA 1C5CL 1G6RH 3DHPA 4MJ5A 2HFFA 1I8UA 3ZE1F 2PCYA 4XMKH 2CKBH 3WOVA 3BGAA 2YOCA 2P24A 2E7MA 2R9HC 3BPCA 3IEAA 3WXVL 1BOGB 5BRPA 1A3ZA 4NQVB 4M1DH 3SGKC 1R3HA 1PL3A 2CLZA 3F58H 3K72B 2EH8L 1HZHL 4X5WB 3O9WD 1BFOB 5C0AA 4ZO7A 3CU1A 2Z31D 4P46B 1E5BA 5FGCE 1DJWA 1FDLL 1TU2B 4UQ2A 5D2LF 3VH8A 4WFFE 4LCUB 1ODAA 5HI5C 2J8HA 4GQRA 3KPMB 4BFOA 3FUJA 1L9RA 3V0WL 5I1LB 3U0WL 3M88A 4G1EA 1U4FA 3MTRA 3CFKB 2YA1A 1XCTA 3QORD 1ZIBA 5IB3A 3I9PA 3T2NH 1UGNA 2XKUA 3UG5A 4LLVA 5MHSE 4X8XA 5D71H 3MRDA 1LE5B 4L1DA 4M3HA 5LCVH 4R4FL 2CSPA 4Y5VA 3RDTC 5IUCA 1EZUA 2IH9A 4RDQG 2WINA 5C0FA 1P53A 4G6MH 1ADWA 3K2UH 3S2AA 4QRSB 5KVGE 3RWCA 1OCWL 2XG5A 1MCCA 3VRLE 1W8EA 3N41F 4N5ED 4YSOA 4A2EA 5B1JA 3PL6C 4OI9A 1QMUA 4U4IA 5C08E 3D33A 1IGTA 4P04A 2JCCB 4R2GD 1JWMB 1D7CA 1WBXB 1KJVB 1KCBA 5MHSD 3HMXL 3FRUB 1X6LA 4CRPA 3GS4A 1XGPA 1S5HB 3RX5A 5IKCA 3FTVA 3R4DA 4POUB 4FQPA 2GCYB 3PHQA 5D7HA 2HX9A 4AVKA 1KOAA 4HJ1A 3ZVVA 3BXNA 3FHQA 4KRLB 2AFNA 2XX0A 3KCWA 2M1KA 4G59C 3WHXB 3UERA 3SKMA 2DZEA 1IC4H 1YG9A 2VTFA 4UOW0 5DI8A 3VWKB 3SDYH 3DX9A 4AY0A 3L4ZA 4MJIA 5KYXA 3V4PH 1T0OA 4MMYB 5MERA 2APVA 1Q1JL 1EUUA 1F13A 3FN9A 1GHFL 2ZOUA 5AW6B 3I50H 2PWHA 3G08A 4KTDL 2AXFA 4G1MB 3BUYB 2WNGA 1IJNA 1VGEL 1UA6L 3OVUB 4IRJD 5LAPA 1UZ6E 4M56A 5GGRB 1CFTB 2Q7YB 2E7CA 3IBEA 1NQBA 4FQLH 2KPWA 3MUHL 3MNZB 4Y4HC 1S7RB 4YK4C 1P4LA 5FK9A 2ZICA 3WD5H 1A47A 1AZNA 4ODVL 4XOAA 4RISH 4F8NA 4G72B 4M4RB 3RILA 4Z7OE 1RIHH 5E2UH 3TYFB 1XH3A 3BAYA 3NJNA 3CN2A 4GRMA 2X09A 1IGFH 3KYOA 1MH5B 4LL9A 5DD3H 4NI3A 1VESA 4CDHA 1LWHA 2NNRA 4Y19A 1QA9A 5BMFL 2XTJB 1N5AB 2E6PA 4Y4KB 2BY3A 2PLTA 1FFOA 2QQLH 1YY8A 1NL0L 4PRIB 4L0ZA 5KN5B 4Q6IB 5DVKA 1ND0A 4GQQA 3SGDI 3X3FL 3N0PB 2BCMA 3HI1B 2GW5A 3GIVA 4N2IA 2EJ1A 1PX8A 3VRLF 5DK0B 4FYRA 2F5AH 2FECL 5F0MB 4OCMC 2AXJA 5IEHA 4WGVB 4HV8A 4DKTA 1IZJA 1NCGA 1FZMA 2WLLB 4P4KC 4OGAC 5B22A 5D5MA 2ICEA 4KY1H 5J4MA 2ROYA 1ZVSA 3QIWB 4ZOAA 2B16A 3LEXA 4DIXA 3ASOB 5E1AB 1OZUA 2DQ6A 3TIDA 3UH8A 2IG2H 5A2IH 2DMKA 3IWVA 2D73A 3GSNA 1LLAA 1FYHB 3UYOD 4FQJH 5JDJA 3H55A 4BE5A 2C7FA 4L4VD 2JXMA 2VN3A 4S1SL 5D1QC 3UP6A 2CCWA 4ZUTA 3SYQA 5EEXA 4HH9B 1PKQA 4L48A 3VXME 3PLYA 4MQXC 3AJ7A 3TVMB 2D8KA 1PD0A 1T5XA 4YFLF 3QG7L 3ESPA 1U3HA 5JZ7C 1KCRL 4FE9A 1PG7L 2QEJA 3BSHA 4FFYL 5HDQL 4UQCA 1MREH 2YD8A 1QLEH 2BNRD 5AWNH 3VRIA 3WFHA 5A6MA 1YYML 2XTSA 4HJTA 2G75B 1MY7A 1OALA 1Q9KB 4JFDD 3NACL 1PZ3A 1XQ4A 2BP0A 4RCAA 4HWBH 3ZGIA 4WUKL 3GXTA 3NSXA 4UTBH 3SKOA 3GM8A 4X0NA 4PLJD 1DSFL 1NPJA 2AABL 4CW1B 5E5MA 2YO3A 4KQ4L 2EDNA 3KPRA 3TL5A 3EFOB 3C08L 1DBAL 3MV9E 4OJCA 3VGBA 4IMKA 2GAZB 4XPHL 3T1FB 5T1LB 1JF1B 1LK3H 2UXFA 2VZTA 5C0CA 3H2WA 3AC0A 5CJQL 3MRLB 1G7MB 4P9HC 1KIUB 2OMUA 1IMHC 3A23A 4JG1L 2AJZA 3F7VA 4AK1A 3U1QA 2AKRA 2NX5E 2VXUH 4FFZL 5DYOB 4CN4A 3DI2B 2L7QA 4WI5A 4DOHE 3BMWA 3GDBA 3MREA 2FH6A 4HG4K 1P84J 1Q0YH 3VM5A 3DVNB 1NINA 2G5BA 1GCYA 2XNAA 5C97A 1FGNH 1HCZA 3CQFA 1X7TA 3DUUA 4CADA 3ARZA 4ZAKA 4U49A 1KLFA 5JIQA 3D08A 3P4LA 4BFIB 4BWTA 3FU7A 4YBLC 5B8CB 5IM7A 3RIFK 2ZNXA 3TZVD 4QRRD 4OFKA 5D1ZI 4LRIA 4OZFB 3QJHB 2ADYA 1F3JA 3PCYA 1U8NA 4ZYKA 4P07A 1JNJA 2AJVL 5E6IA 2H1XA 2A6DB 2X40A 5EOCH 5TF1L 5JXAH 3IMBA 2A73B 5F7YC 2OSLB 1O0VA 1KIQB 4QHLA 2NY4D 5JO5A 2Q7AA 1DDHB 3NJJA 2VSDA 4HXBL 5IGXH 3JV5A 1U8CA 1TQSA 5DHVH 1E9PB 3RGVC 1GXEA 3SB3A 5J13C 3LN4A 3U0PB 4N0FB 4QXVA 2YGVA 2CAKA 4A1RA 2O6EA 4PU2A 3WFEH 5F8QC 4BV1A 3DO4A 4LGSB 1HAWA 1OO2A 2X42A 4G8GA 5FPIA 3AY2A 3K2MC 1TYRA 5MEQA 3VU2A 3HAEG 1MCOH 1VSCA 4OM1L 1PCSA 2WGNB 5CD5D 4R26L 4UQAA 2JB5L 1RK7A 4AITA 4EUPH 3OHXA 1X4YA 3IJEA 3QNYB 4TRPH 1HHGA 4JG0L 3MOAL 3VI3E 2YRBA 2DQFA 5D70L 5CEZL 5ACZA 1FAKT 4UB0L 4QOKA 2FIKA 5CBEB 1NIDA 1AGCB 3BQUA 5A2FA 1JD9A 1FNEA 2XN9E 2IDTA 4BSVB 1UJ3B 1N8ZA 5LGHL 3H3BC 4NWUH 1T1YB 5DRWB 3S4SA 3Q5TA 3B7UX 5ETUA 2VXVH 3I6LD 3ZR6A 4V1DB 2DQCL 1VADB 2ZAGA 3EFDH 3RI5F 4NN7C 4DP2X 1S7XA 2VQ1A 2D31B 4HUCA 5D1ZA 2XUWA 2ALAA 3G6DL 4P9HH 3HI6L 1TLKA 4GRWH 2VJ8A 5B1BB 2VH5L 4L5FL 3OKNA 5IB5A 1N9PA 1E9QB 3U79A 4RGMB 4JFPB 2PO6A 4LLUA 2OTUA 4Y2DA 4GI8A 3FOMB 3BAJA 3AGWA 2IH3A 4U1JA 5IHWA 1GJUA 3P11H 1IBHA 5C0ND 4J7RA 1Q9OB 1WFJA 4HPYL 3SHSA 4PJGF 2EXTA 3FUNA 2DL2A 2WXKA 5AALA 5CNHA 4A67A 1C5DA 1NAMB 2Q10A 2H1PL 3BZ4B 4Y5XA 2IWFA 5D96C 3CVHL 2H47C 1ROWA 5KVFH 1MJUH 2QADC 3QWQB 5TDNB 3BGFC 1W9XA 2ZYRA 5EV7A 3NN8A 1KWKA 4JFFA 4ZSOE 1N5YL 1KGIA 1G1CA 4P2OA 4X6BA 2MWCA 1KSRA 2IOOA 4YEFA 1AZRA 4WGKA 2AP2A 1JG9A 3MRPB 4FXGA 4JO4H 4L37B 4KQ3L 3ARBB 5DJ6A 2GBUA 2XPGA 3MLZH 4RMTA 1URLA 1SQMA 4W9ZA 2CHNA 5KWYC 1A64A 2BP8B 1DVUA 1KENL 4S1RH 4OTXL 3I9GH 2IPTH 3RAJH 1NANI 1YEKH 3Q6GL 3RIFF 4NNYB 1ZHBA 2Q8BL 1XF4A 1PZAA 1LP9E 3Q8EA 4APXB 4HKZA 2B1HH 4I5BB 1FORH 2LT9A 5BZDA 4XH2A 2WZAA 1T89C 1UKTA 3JZYA 4M7JL 5FO9A 1YEJH 1NCAL 3JWNG 1MLBB 1KXQE 2V9RA 3GSWB 4GB9A 1MFBH 2ZXDA 3QUYB 1ZMYA 2NT0A 2WNWA 4IBZA 1MHPH 1QBBA 2WD0A 4FTVD 1MCFA 1EEYA 1RUQH 3CFCH 4FG6D 4KVCH 3OKYA 5F6HI 2C3VB 5E9DB 4YSAA 1F4AA 3P4NA 4RZCB 3PV6A 4MNQE 1D6VL 1A7RH 1XGUB 5EU6E 4GQZA 2AGJH 4Z0BH 1TTAA 3GUTA 4G11A 3L95B 1A25A 1RHFA 3QZOA 5F1NA 1F4HA 3TTSA 4LLAA 1Q9LA 2XY2A 1NBZA 4Y8DC 4JO2L 2K9UA 5E2VH 5KBNC 1EH9A 2YBGA 4GAFB 5K9QI 4AV5A 3IAPA 3P9LB 1RIUH 2NRDA 5AW1B 4E9LA 5FR3A 4FZ8H 4IJ3C 4OGZA 4K5PA 1KCUH 1X5KA 5ENWB 2R2BA 4KKLC 5JIHA 4Z6AT 2MTAA 3EIFA 1GOGA 1YYLH 3NMEA 1OHZA 1U8JB 1RULL 5EU6D 2DQJH 3VFRA 2AJYH 3D30A 1DQMH 2EXSA 1E5CA 4XNDA 4NQQA 2AQRA 4ZUWA 1F6AB 1QYGH 1PD6A 1BZ7B 2IQ9L 1EHLL 4AGMA 2WKGA 3ME0A 4Y9EA 2J6EL 3GJFH 3PUUA 5JQ6H 3EOAB 4CVZA 3FQXA 1CJYA 3BD5A 3NABH 2X6UA 1H3GA 3PWPE 1QSFB 2CBQA 3U6RB 4TQPA 2ICWA 5JLZA 4XP5L 4IEFA 4KKBC 1T1XB 2DF3A 1KTLA 4UTAL 4X6DA 2WV3A 3T4AA 2J1ZA 5C07A 1JGDB 3G9VA 1TEGA 1LP9F 2UZXA 2Y36L 3I3EA 3GT6A 5EC1A 4Z5RA 3VGGA 1NUGA 5DK2B 1WWCA 4K9EL 4X5QA 2ENYA 2G2RB 1Y18A 4H1LG 2B08A 4AIEA 4OI7A 3PWVB 4AC4A 3B56A 3THMH 1YEHL 3VQLA 5I75C 4U1HB 5DSCB 2CQVA 1F11B 1RVFL 4HUWB 4CMHC 1RZKC 3BIKA 3L9EA 2VISA 1Q9WA 2OPCA 3T2PA 2QPEB 4M43L 4PJ5E 3V5HB 2DWYA 3B5GA 4XPAL 1MAML 4KXDA 3FO0L 4TULH 2ZUQB 3F7PC 4PJ8C 3Q5YA 4HJGB 1CLOL 3L4VA 1PZCA 5K93A 3ULUL 4FNQA 4J3XA 3UIZA 3ARVA 1ECZA 1NBYB 3GXMA 3QISA 1AG6A 4JREB 4X6CE 3EBGA 1EJFA 5B3JE 1WZ1L 1MFCL 1VF5C 4RGOH 2GFBB 5CN3A 2ZOLB 2Q76A 2GABA 4HEPG 1VZIA 1FNSH 2A1WL 4Q4IA 1GZHC 3UTOA 1DP0A 2ZX9A 4PRHE 5CBAB 3MLTB 3X3GH 4AQ8C 3VXSA 1XBRA 2WBWB 1GS6X 1JYXA 5LGKA 1ZS8A 3QAZB 1HDMA 5ITFB 2C1PB 3W9DA 4YIQB 2A6IA 4NQXA 4ZQKA 2EDDA 1NMBH 4GIPD 2WUBH 1GY1A 1OF2A 2XZZA 4XP6L 1JXDA 5CEZE 1WC7A 4AWJC 2VABB 1Z9PA 4IQHA 3CG8A 1A6PA 3TESA 2HCZX 4O2CB 4WENB 4PGCA 5A7BA 3QIBD 1YNTA 3EOBA 5F7EH 3UTTE 3O6KL 4B9YA 3L3HA 4UZGA 2OMXB 3O3DA 4PY8J 1FC1A 1U8KA 1K5WA 3D3VE 2ZJSL 3MRMB 4K5NA 3HE7B 4JFQB 3GSVB 3ARPA 5CLTA 1D5ZB 3N43B 1P7QB 4WK4B 1I7RB 1A6ZB 4XRCA 3SKNB 3OAYH 4LASH 4MSWA 3NCEB 3AS1A 3RVVC 3KPLA 1TTRA 4JFOB 4WFGE 4YHZL 3AT8A 4XNQA 4FZEH 4L5FE 4N2AA 1P7HL 4WAFA 4JG9A 2FLMA 4AYGA 2W65B 1FZKA 1QOKA 1AI1L 4YGAB 4YPGB 4ZX5A 2CBMA 3IMSA 3JWDC 3D3VD 4H20L 3WJJA 4Y1AB 2IMNA 5HI3C 4MVBD 7FABL 3G6JB 3UZQB 3FBKA 1B9KA 1RZKH 2Y25A 4X6CF 4YZWA 1R3LA 5CCHE 1JPSH 5B3JF 4FXLA 3LRLA 3RP1A 2R0WH 4LNVA 4YHNB 2YMXH 4MCZA 4YDJB 1UWEL 3F7YA 1EJOL 3LZNA 4GT7A 1K8DB 4BZ1H 1CU4L 1QKZH 1WQVT 2AEPH 3QNXB 1FNGA 2A74B 4G5AA 4OCSL 4ZW6A 5AG9A 2NYYD 2QVIA 4HIJB 4IU2B 3VD9A 3K6DA 3MACH 5DHYA 1XF5A 3E6HB 3JV4A 5LGJB 3L3OC 1FGVH 4FJYA 1YNLH 4A7QA 1YEFH 2ZAHA 3N0AA 4WJ5A 1L9PA 1NDTA 4OFIA 4RGNB 3VA6A 4WO4A 5D7JD 4OCWL 3QZMA 2J8UA 1J86A 3LH8A 3VFMA 1GGCH 2VLRE 2XJLA 4OJFL 3ZE0B 4X4KA 2C9QA 1NC2D 4GXFA 1CICD 4Q14A 2EIZA 4OF3A 2E59A 1YEDB 1QLFA 3HZKB 1DL7H 2C3WA 1UUSA 4NB7A 1VAHA 2VN6A 4AENB 5HYSG 3OHMB 5C7ZA 3ZDWA 1HOEA 2Y22A 1JI2A 5EBWB 4EOWL 5J0BA 3DPBA 2WZ6A 5ISZE 5E8EA 3EH5B 2XZAH 1TJHH 1QTSA 1S5IH 3HRZB 1HH6B 3N1MC 3OKDB 1NGXA 4P49A 5C0BA 4PV8B 5L8LB 2J73A 4M9OA 1CD1A 1I7UA 3C2SA 1WWAX 3K2IA 3EBIA 1JXGA 4IRJB 2WTPA 4LAJH 3ILQC 1RHHB 3GHPA 2J55A 3NSDA 1X7QA 2D0HA 1NEZG 1UM6H 3BEWA 4TTDD 2DTML 6PAZA 5TK2A 4ONGL 2CH8A 1CGYA 3IJHA 5GSRB 2QVMA 1SOSA 5C9JB 4MA1B 2Y7LA 3OXSB 2C9SA 1M05A 3CXDH 2GBTA 2E8ZA 3VD0A 4F37F 3ULVC 5ALCL 1S3KH 3FNKA 3CGTA 2EDYA 5BOPA 1CGSL 2G2PA 4DTGH 2OJEA 3L8QA 4AC2A 1B3JA 5EH1A 5LCVA 1IUZA 5L2JB 4KMTH 1NEUA 1YC8A 3JWDH 2BDNH 1F58H 5B39G 1PZ5A 3X11A 5SWZA 2O1AA 3RVXD 2WTOA 4YDMA 3R8QA 3HG1E 3LQAC 3JWOL 3C5JA 4ODUB 3O8XA 3CH8A 3ESVF 5B1AB 2K70A 3HAEB 3U25A 2X3CA 3C5ZD 5D7IE 3V2AR 1NFIA 2AQ2A 3T6WA 3DJTA 3RFZC 5EUOF 3TJHC 3C6LD 1GGIL 4ELMB 1WFTA 3MNWB 4OZHF 2XXFA 3O4LA 3PV7A 4DKEL 1XIWB 2X4TA 1A7NL 1YC7A 3CZNA 2WWOA 3RGBA 5F7BA 1G7PB 3DMMA 3HG1D 1T6BX 1JFQH 2EO9A 4KKRA 3KLHD 3CQPA 2F58H 4NQCA 1FYTD 4MJ6A 1V3KA 5TQ0L 4FA6A 4ZTPL 4HAKA 4DN3L 3CHQA 2AK4D 3CZLA 3LXBA 4M6NH 3WO4B 2L7UA 2BOBB 2WPGA 1P5UC 2BNRB 4N85A 1C08A 4K2UL 3K71A 4LCVA 3SY0B 5GZNC 3HC4L 5FYJU 2HKFL 3LH9A 3ULUE 1NKRA 4JFDB 1IBDA 4OW6A 1MCIA 3OKLB 1KC5L 1MELA 4NO5A 1LNUA 1CK0H 3OL2A 2PXYC 4X6FA 4DNLA 1DUYA 5LXGL 2B2XL 2NXYD 4DO4A 4F2MA 1ETB1 1MFUA 3MBEC 4AYSA 1TQCB 1ZV2A 2ZIDA 3IE9A 3IRPX 1OQOA 4X6EB 1CDHA 4JDVB 1J5OL 5KVGH 4APQB 4W9EC 4HDIA 1U95B 4LSVL 3L3GB 3PGCB 4MJJA 4Y7MA 4NXKA 4ZFQA 2PYEE 3O6FC 3QDGD 1TQBC 3NH7H 4EE2A 4Z7NB 4R4BB 1UVQB 4HU8A 2Y7MA 5I0DA 2YD9A 3WFCH 4H8PA 1KLGA 5DLML 5A6LA 4QYAA 1I9IH 3K3QA 3PWLA 3RQ3A 3UJJH 4HF5H 4D7PA 2DW5A 1KTKE 4KDVA 3CAFA 4H8UA 3WCYA 1A2YA 3ULVH 4ZQTA 4X7SH 3DV6B 1C8QA 3S3BB 5KVEL 4FXKB 3WHE1 2FWLB 2ZWNA 4JPWH 3AFLA 5JNYA 2FT7A 5D7IF 4RVBA 2EXWC 1U2YA 3CPLA 3RDTA 1I9RL 2R29L 1V10A 3FO1B 1VZGA 2NQ3A 2VDKB 4LOUD 3TZVB 1FA4A 4QRRB 3LX9A 4A2GA 4A7VA 4NJAH 5TQ2L 5DU7A 4PRIE 3LQAH 3SO5A 3ZIMA 3KPPA 3PL6A 4MXQC 3H0TB 1C8PA 2DWEA 2P80D 5H37G 3HB3C 4X0KA 4LHJB 5LAXB 3VFGL 3A47A 2N7AA 4FQQA 1D6EA 1GYWA 1OP3H 5EG6C 5I8CA 3VD7A 4PJ7A 4BBWA 4ZFZB 4WKXA 5GRUH 4PP1C 1QPPA 1SY6H 3S35H 4WW2C 1IQWL 2IH1B 3L16A 4MJHA 4OCYL 5BUGA 2V4LA 3DGGB 3PP4L 2B0SH 5FA4A 2EVIA 2CJSA 4PJFA 4DUXA 3ULUF 5I18L 1RJZB 5IFAH 3OAZK 2P43B 1YZZA 1JF6A 2NW2A 1OAQH 3WFDL 4HWBA 4OLYH 5HVWA 4JY6B 5C2BL 4Z7VE 3R1GL 1KDIA 1QI5A 4MQ7B 4HOZA 2IC2A 5HHOA 2MPVA 3O3AB 4CUCA 4PP2A 4O5LL 4IMLA 1MNNA 4A7TA 4EI5A 3RWDA 4QGYA 4OUUB 4G6KL 2FO8A 2UXVA 3NCXA 1OAZL 2LVCA 1P0SE 3QR1A 1TKWA 4I3SH 5ESVB 3UACA 1JI1A 1FNAA 4X5LA 1A3QA 3NIGF 4JCWA 1C7SA 5MEOA 2K45A 4LQFL 2JNZA 4LARL 2CLVA 3LN5B 4A2DA 3QQNA 1J8KA 2ATAA 1AGBA 5T5FA 3VXOB 3LNFA 3L17A 4O2FB 3B5TA 3DX6A 1CD8A 4KHTL 2BIOA 3DURA 2DICA 2HUEA 5IIEA 1MFVA 3E8UL 4LLYB 4E5XA 1BVLB 3NFPB 3ISYA 3S36L 4GH7B 4N0RA 5FHAH 2D3LA 3T5WA 4I4WB 4DQOL 4F9PA 2AV1A 1QFWL 1QFOA 5AAWC 1L3WA 1CXFA 2C4FT 1INDL 4G8EB 4H1LB 4X80H 2KMWA 1DVFD 2WXIA 2ITCA 4TQEL 4TPRH 3V10A 2FX7L 2XQYA 3H9HA 5A2LH 2EDEA 2J4WL 4P4KA 5ESQB 3EBAA 3ZO9A 1I8MB 1X5FA 1A7QL 3KPQA 3D18A 2R8SL 4CU6A 3IGUA 4PFEA 3EYUH 3LKRA 5EU5A 4QLRA 1W72H 2WJ5A 3BD4A 4OJYA 1KYDA 4CSZA 1X5XA 5E5RB 2IAMD 1OL0A 3RWEB 4BXSV 4OLEA