1PLCA

Accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title Accuracy and precision in protein structure analysis: restrained least-squares refinement of the structure of poplar plastocyanin at 1.33 A resolution.
pubmed doi rcsb
source organism Populus nigra
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1992-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plcA00
2BZ7A 2PLTA 4BXVA 4P5RA 3ZX1A 4QLWA 4Q8BA 5PCYA 2ZWNA 1JXGA 2XUWA 4DP7X 1F56A 4DP5X 1MDAA 5LDUA 1ET5A 2BHFA 1X9RA 3RYMA 3QJUB 2I7OA 3OM3B 1KCBA 2AANA 1OCZB 1ZV2A 2GC4C 1A3ZA 3AZUA 2UXVA 1JZEA 4M4RB 3UABA 2PP8A 2XXGA 3FU9A 5ANHA 1GS6X 2HX9A 2R7EB 4YL4A 1RCYA 4FA7B 3C75A 4N4YB 5B1KA 2FT8A 3KW7A 4YVNA 2MTAA 3CDZB 3PCYA 4KNUA 1FFTB 2R7EA 1OE3A 1V10A 3X1FA 2ZXWB 5B7FA 3WKQA 4GXFA 1ZDQA 2JXMA 3CDZA 3SQRA 3T71A 1AS6A 4BDVB 2CALA 2XV3A 2E86A 1SHXA 2BP0B 3CG8A 2ZOOA 1A4CA 3ABKB 1ETJA 1M9WA 1W8EA 2VM3A 1DZ0A 3ABGA 4BDVA 3FS9A 2IWKA 3ASNB 3CVDA 3AG1B 3TA4D 3FSAA 5I5IA 2BP0A 1J9RA 3GXUB 1DYZA 4KO9A 3ERXA 8PAZA 1ILSA 1NDTA 2AZAA 2GSMB 1JZJA 3CVBA 4KNTA 2J56A 1QNIA 1J9QA 1NTDA 3UGEA 3FYEB 3QJQB 1FWXA 3FQ2A 1W6WA 4AKPA 2UXFA 3GDCA 1L9OA 3OMAB 1AACA 1RZPA 2DWTA 3HB3B 3TBCA 2IAAC 1J9TA 1A65A 2DY2A 4DP0X 1FA4A 4A2GA 3SBRA 1KBWA 1RZQA 2HLEB 4YSTA 4E9RA 4WKXA 4RH4A 1J5CA 3NP3A 2JKWA 3QPKA 2GI0A 2DYSB 1MZYA 4JHVA 5A7EA 1JZIA 2TSBA 1BEXA 1KDJA 4HALA 1E65A 4X4KA 2OV0A 1AG6A 4AZUA 1ZIBA 4W9ZA 1HAWA 1PAZA 3H4HA 2Q5BA 3T9WA 3ZIYA 2DYRB 1VLXA 3UADA 4KNSA 1SFDA 1GY1A 4A67A 4E9QA 2HRHA 4GP8B 4KOCA 3EF4A 4YSOA 2IWEA 4F2EA 4JHUA 4UF7C 1NPJA 2P80D 2J55A 2XVBA 3NT0A 3FQ1A 3H4FA 2XV2A 4HAKA 3X1GA 1BQ5A 1KCWA 2FNWA 2YXVA 1AIZA 5I6LA 1PZAA 3EH4B 2CJ3A 5I26A 3S3BB 3CZUB 3GYRA 3ZDWA 4F2FA 2N0MA 2YAEA 3IE9A 1AZCA 1ET7A 2I7SA 2IDUA 1ZIAA 1OV8A 4HIPA 3ZBMA 4DP8X 1L9TA 4EF3A 1PLCA 5I6OA 4DPBX 2YAOA 3H56A 5I28A 5B7EA 2VM4A 2IH9A 1YLBB 2B3IA 3AG2B 2LLNA 3TASA 1QHQA 1IBZA 3V9CA 4DP2X 2IDTA 3D12B 1N70A 4G71B 1URIA 3FSZA 5I5JA 1UATA 2CAKA 3ABMB 2IH8A 1MZZA 1TU2A 4A66A 3JTBA 2J5WA 2FTAA 2GIMA 1NIBA 1PZBA 2PPEA 1BQRA 4L0PB 1WA0X 2B08A 2PP9A 3N55A 2BO0A 1OOWA 4GP4B 4DP6X 3N2JA 3NSDA 4G72B 4QKTA 4HCFA 3FU7B 1OCCB 3NJKA 1AS8A 2WSDA 4YSUA 3QJRB 2FQGA 3AW5A 1NIFA 3FU7A 1NWOA 1GW0A 2HX7A 2QDWA 1BYOA 1TEGA 3IBOA 1XB6A 2GC7C 2VW7A 4N8UA 1NZRA 2PPCA 2EINB 4NERA 3AG4B 2H47C 3CVCA 3PAZA 1M56B 2VN3A 3FPYA 1IC0A 3V9EA 1GS8A 2WO2B 4WTQA 3S3DB 1A4AA 2BP8B 1OF0A 1L9QA 2GB2A 4AKQA 4E9TA 1SF5A 3PAUA 2QPEB 3WNJA 1KBVA 1XB8A 2BP8A 2BW5A 3EH3B 1PNCA 3T6ZA 1GR7A 2XWZA 4PAZA 4KO7A 3FQYA 4YSDA 4E9XA 1PF3A 1TKWA 2J57A 1AOZA 4Q89A 2TSAA 2FQFA 4BXSV 1HFUA 5B7MA 3EH5B 1OE1A 3NJLA 1SDDB 1XMEB 2EIMB 1EHKB 2AVFA 3NJMA 3DIVA 9PCYA 5AKRA 1OE2A 5B1JC 3WNIA 4BWUA 3BVDB 3PLYA 2IWFA 1SDDA 4YSAA 1WA1X 3DKHA 1JXFA 2I85A 1ID2A 1KDIA 4KOBA 1SF3A 3FPXA 4DP9X 2EIJB 2QDVA 2DWSA 4YSRA 1JOIA 2H3XC 1MG3C 2PCFA 2VW4A 2IDFA 2X87A 3PAVA 3WIAA 4HCIA 1NIAA 1E30A 1WA2X 2GHZA 3EHBB 4DPAX 1ADWA 3S8GB 1AZUA 1GYCA 3DTUB 4BWWA 5EHFA 2RACA 3NJFA 2AFNA 3NP4A 4G7SB 1SHWA 2ZONA 4AKOA 1BXAA 2UXGA 3AY2A 3T6VA 1ET8A 2XLLA 4YVUA 4KO5A 1ZDSA 2XYBA 2OCCB 3FT0A 5B1BB 2XX1A 2WO3B 2QT6A 2XV0A 2PPDA 1AZBA 2CUAA 3NJGA 2OJ1A 2QPDB 4A2HA 4E9VA 5I6MA 2FQEA 1AG0A 2YAFA 1AR1B 2UX6A 4BWTA 1WS7A 3OQRA 2NRDA 1L9PA 4DP1X 3X1EA 4F7KA 1WS8A 1JXDA 1PZCA 2XU9A 3UAAA 6PAZA 1OCRB 1WAEA 2YQBA 1ASPA 3NJJA 1J9SA 2HXAA 3WI9A 1E5ZA 2XXFA 3NSFA 4UANA 7PAZA 1JVOA 1NWPA 2PPAA 3X2QB 4DP4X 4JKNA 1NICA 4YSPA 2A3TA 5I5MA 1KYAA 2MRYA 3NSCA 2HX8A 1SNRA 5I6PA 2FT7A 4CSZA 4W1TA 1CYXA 3TBBA 2BZCA 3IN2A 3SBQA 3PPSA 5D4IA 4BK5C 3NSYA 1ILUA 1EZLA 1OCOB 1N68A 3FU8A 4G7RB 4YSQA 4AX3A 5FC9A 5B1JA 3X1BA 4ZK8A 1T5KA 2UXTA 3QJTB 1ASQA 3MBWB 2VW6A 5B1AB 5AFAA 1PLAA 4PCYA 1AZRA 4G7QB 1IUZA 1R1CA 1B3IA 2YXWA 1JZGA 2CCWA 1E67A 2PP7A 2AZUA 3MX0B 3T6WA 7PCYA 4A68A 3S3CB 2DV6A 1JVLA 1BXUA 3AG3B 1JERA 4ENZA 3L45A 1M57B 1NIEA 2YAPA 3IEAA 4HHWA 5I6NA 1I53A 2Y69B 1KGYE 2W88A 1HAUA 4HCGA 3SBPA 1AS7A 1CUOA 1L9RA 3QJSB 2VSKB 3NJNA 2UX7A 1CC3A 1IBYA 2XX0A 3KW8A 1BYPA 2IDQA 1MG2C 3QQXA 1IKOP 1NINA 2BWDA 5F7BA 1NPNA 2W8CA 5AZUA 3NYKA 2BW4A 3OMNB 4NB7A 5F7AA 3WG7B 3OD3A 2CBPA 4FAAB 2YAHA 4A2EA 1GSKA 2VSMB 1CYWA 1E5YA 2H5UA 2HZHA 4K9JA 2VMJA 3TU6A 3QJVB 3IN0A 2IDSA 4M3HA 5PAZA 3WKPA 3FYIB 1TEFA 2EILB 1ASOA 1JZHA 2JFCA 6PCYA 4GP5B 5B3SB 2YAMA 1BQKA 3G5WA 4KO6A 3UAEA 4CSPA 4DPCX 2FQDA 4E9WA 1QLEB 4HHGA 4AI7A 3U25A 1A4BA 1X9UA 1ZPUA 4YSSA 1BXVA 1L9SA 4MFHA 3PXLA 1SFHA 3T6XA 1W6LA 1CURA 1AAJA 3UACA 1JZFA 2FJSA 4G70B 2PCYA 5IY5B 4E9YA 3OMIB 1V54B 4UAHA 3FSWA 4GYBA 5D4HA 4A2FA 2FWLB 5E9NA 1GY2A 4YSEA 4A2DA 1PCSA 5TK4A 1J5DA 1KV7A 1PY0A 1SJMA 1PLBA 2FT6A 3ABLB 1PNDA 2GBAA 1RKRA 4P5SA 3ASOB 1AZNA 4TXVB 3X1NA 4E9SA 3FSVA 1NIDA 2PPFA 4GY4A 3S8FB 1XB3A 2BWIA 2YARA 5I6KA 5D4JA 2Y1AA 3NJIA 2HRGA 2X88A 1PMYA 2YAQA 5TK2A 1GS7A 2EIKB 3HEIB 2Q9OA 1AANA 2P80A 3BQVA 4HZ1A 1A8ZA 3JT2A 4YSCA 3NJHA 4NAJA 1V55B 1BAWA 1AQ8A
chains in the Genus database with same CATH superfamily
4KJYB 3L1EA 3TV8A 4I0PB 2GTQA 3AT0A 5T1JA 3VYNA 1JPSL 4HKJA 3C08H 4QWWD 2OS7A 4DP7X 1F56A 5IMLA 1SN5A 3BH9A 4LSVL 2AEQL 3N91A 2FLBT 4HYTB 4LCWA 2EEFA 1MHCA 3KJ6L 4Y19B 4Y89A 1T7YA 3OX8B 4CNIA 3ALWA 4YHML 1ZLDA 2P8LB 2EIEA 4GKOA 1OCZB 5IQMA 1QNZH 2CGYA 1VPOH 4L4VD 2FBJL 3IDNA 2Z6FA 4ZPVA 2B14A 4BFOA 5B3JE 4IOIB 2VR8A 3CFTA 4Z7UF 3UTTD 2EDXA 2R7EB 5AW9B 1FLRH 4ZAKA 2X9XA 3R0MA 5GS3A 3KYKH 3ULVF 2LLLA 3NTCH 3X11A 4XNUL 2IGFH 4NNPH 1A6WL 3DROA 4L0YA 1DVFB 4I5BB 4MAYD 5B7FA 2O6FA 1Y1UA 4TLUA 3A5VA 4M7ZB 3BP5A 3BP7B 4E9LA 4M5ZL 4PVBA 4GQ9L 4PJCB 5IR1A 1BV8A 5EDSA 3HJ0A 1ETJA 1M9WA 2EC8A 2FGWL 1UXWB 3QNYA 2EUWA 2GTWA 4JS7A 4RSVA 1ONQA 1I1AA 4HK0B 2I9LB 1KGWA 1HHJB 3CU1A 4TSCL 4PGDB 4M6OL 4YWGL 1KEGL 3VD7A 4PRIA 4HUWA 3C60D 3WY1A 4MDJB 3L3HB 3IGKA 2FLRT 3CVIL 1X5XA 3CVBA 4JFZL 1RK1A 4LESA 2FR4B 2PWGA 3UGEA 4OUUB 2YEQA 4JO3H 1U8PB 4C58B 1JCVA 3QR2A 5I0WA 3HRPA 3STBA 4Z0XA 4G1EA 3CN4A 4P46D 2DM2A 4FFYA 3HBZA 3HB3B 5DC0A 4NQCD 1R3KA 3DURA 4DP0X 3MLSH 2HLEB 3STLB 2MKLC 1JGVH 1L6ZA 2IV9A 4OZ4A 4DKAA 1AHMA 3EJQA 2V3EA 3FCSA 5HVHC 3JWNH 4G83A 3HN8A 3DJZA 3RNKA 4PJIE 4PRPE 2ZXQA 5CJXC 3RPBA 1X4YA 3QXDA 4B5ZA 4N0CC 1MZYA 5I8OL 4Z3HA 2UUDH 1CLYH 4B5EA 4XVOA 5JPNA 3AT8A 4HALA 3KPTA 3QXAB 2OV0A 4J3OH 5B3NA 1T1ZA 1UEYA 3FQUA 4ZS6D 4HJGB 2P5WD 2CUHA 1DVYA 3N50A 1X5YA 1S7QA 2K4AA 3IBEA 3O4OB 4KBPA 4PJIA 4PRPA 1QSEB 2XWTB 1ID5I 2N0KA 5DJCB 3CIQA 4LSSL 3F7VB 1LILA 2OMYB 3WEXA 2QFRA 4A67A 5AVYB 3FTUA 1A1NB 1BDYA 3NCYP 4YSOA 3FO9A 3NRQA 4DWHA 3K4ZA 3VMPA 5F6HI 4HJJH 1UCBH 1NPJA 3ZE2E 1VERA 2CQVA 4GRLC 3IU3A 3FQ1A 4O2EB 3MQIA 1G4MA 3GJFB 4HIQA 1HI6B 3TYFB 3KM2A 4DKDC 3PWPE 4GAJL 2BNUB 2CSPA 2DQGH 2VDRH 5BPPA 2CJ3A 5J9PA 3RL2A 3L5JA 1UD5A 3A0OA 4EF3A 3P2DA 1XX9C 3P9MA 5CD5C 4XT1C 1LHZA 1MXDA 2NTFB 1H0DB 4IKNA 4APQD 3L54A 2G5UA 1VFOA 1XCTB 4ZMWA 2GYSA 1JBJA 4G71B 4J3OD 3QORD 3WELA 5JW4Q 4PJEB 3HTLX 2GAZA 3DRTB 4KH9A 1CZ8L 1CTMA 2PW1A 3VQMA 3JTTA 4K23L 3DPBA 4OLVL 2PO6A 5EU7E 5HYJD 5MEQA 1JTPA 1R24A 2PPEA 1T3FB 4X0KA 4AEHL 1PKQE 4NZTH 1ZXKA 1V7NH 4P4RA 1THAA 3BKMH 2WMPA 5D7LB 3R7QA 4I1RA 4CBPA 4K9EH 1D5BB 5FV2A 3W9DB 1IKFL 1FBIL 3DOSB 2YFOA 1BAFL 4RFOL 2H3KA 4K3EL 2CUMA 4NBZB 1CE1H 1BFOA 1H3PH 3OV6A 3CFDA 4HZAA 2DAVA 3AW5A 2AABL 7CGTA 1KJMA 1RUML 4V1DE 2OJZL 3RWGA 3UTZB 4JFVA 5I19H 3TEWA 3KD4A 3OZ9L 3TV3L 2ZXGA 2WVTA 2YSSB 1LVEA 1ORSB 2H47C 3BE1H 1M56B 1DEEB 1FFQA 3OF6D 3SPHA 1IC0A 2CWRA 3GI8L 3KHOA 3ORJA 5F7DA 2BP8B 5LXVA 2X4SB 5D1ZA 4ETQB 5D9SB 4QRQA 1I75A 4DZBA 4V1DA 2QPEB 1KBVA 2IXQB 4N85A 1CXLA 2LR4A 4Z76B 5GZOC 3F7YA 3V0HA 2BW5A 2E6JA 4LMQI 5TE6H 3WUWG 2J6EL 1PNCA 2LQRA 2JTDA 5JORA 2P4AB 5TH2B 2NCEA 2CK0H 1NDGA 2I26N 4OZGB 1BMWA 1FNSL 3MNZA 5LG6A 4DGWC 2V9UA 2JJTA 4I3SH 1AO7B 3GIZH 4XOCA 5K39B 2NX5B 3SCMA 4Z8FL 3MV7B 3VXRB 3VXMB 1XMEB 2R1WA 4Y4KA 4XNYL 5IUCA 1OARH 1PDKB 4DZ8A 2VXSH 5FIEA 3BZEB 2ZP9A 4NZUH 2W9EL 4W70A 3ULVH 1UXLA 2WW8A 1CDGA 1G7JB 1KCLA 4B95C 3DKHA 5AB2A 4C4BA 3JZYA 2A74C 1WFJA 4LARH 5F9AC 2FBRA 1KB3A 4P4KD 5JUEL 1RZKH 3SE6A 1XSIA 2AV7B 3IRPX 5HYFA 3UZVB 1MG3C 1UWFA 2PCFA 4G6FB 5FCUH 3KZ8A 4BSWA 1G7LB 2IDFA 3PAVA 3U46A 5C07A 5KBKA 3WJJA 3DTUB 4IJ3C 1KNOA 5EHFA 2QLVB 1VRSA 2DYPB 3LDBB 4HGMA 3CFEA 1BD2D 3G9AB 4TVUA 3RFRA 2G0LA 3TZVB 4JHZA 2UV3A 1DBMH 3CFKA 4F7TB 4KITB 1SMOA 4JDTH 2NUPA 4R7NB 4UU9B 5GRXG 4JM4L 1JGEB 2J88L 1BFVL 2HYMA 1UZ8A 3RIFF 2W0FA 1FYTD 4U2ZA 2GY7B 1BVZA 2MMXA 3BCDA 1JZ6A 3QDMB 4P5KB 1JUFB 2W65B 4ZD3H 3VFTA 1JXDA 4HJTA 1U8OB 1C16B 4HEPG 4FADA 3TFKD 5E8EB 2YQBA 2GJZA 2HFEA 5KN5B 2B9BA 5D2LF 3G5VB 3ULVD 2CRIA 5A2IH 5CCGE 2YD1A 5HXMA 1HIML 4F9PA 2KHAA 3RU8H 1OAXH 1IC1A 3I6KB 1T0MA 2X53A 4X5QA 5FYKU 3S3PA 5IT2H 1GGUA 1XQ4A 1FZMB 3GO1L 4HHAB 5L4JA 4G6JL 4YLCA 3I9GL 3LHAA 1P4IL 4BZ2A 2A83A 3B9KA 4GKLA 2Y7QB 2ZUTA 5BRQA 4EN3C 3SBQA 3GMPB 4FDWA 1KENL 1XSOA 2LU7A 4NYLB 4B6ZA 3ARBB 5GS1A 3GBML 3FUJA 5CU9A 4JL2A 4X8JB 4A63A 3BVWA 4NQXB 3IDUA 4L1TA 4QMEA 2VW6A 2YEZB 1A21A 5AFAA 4PYGA 4G7QB 1A9EB 3H42L 3OB8A 4K5PA 1XIWD 4K3JL 1FFPB 2A6JA 1C9SA 5BS0E 4NQEB 2OJEA 2BY3A 3D06A 3W11C 1NCCH 5TQ0H 4YZFE 2X4TB 4NC0B 1BXUA 1SN0A 4PR5B 3IM1A 4JQVC 4NQDB 3QUZC 2VOTA 4HCGA 3SBPA 1AS7A 1CUOA 1LO3H 2V2WA 4RGNB 3BJLA 3S3JA 4YHOL 4M1CC 3NJNA 2YXMA 1MLBA 2VR7A 4U0RB 1RUPL 1RUKH 4MB4A 3DXAB 1Z9SA 1IKOP 1IC7H 2YGVA 4QT5B 3IAGC 3JYBA 1WAAE 2JKRM 1JZ5A 4XPAH 1IGML 1RQ5A 5EPMA 2EDTA 2B39A 3PJSA 3U4AA 1YC7A 3INOA 1F3JB 1I1FA 1CYWA 1U2CA 2CDEA 2HZHA 4XNQA 5D6CA 4GAYB 4HMDA 4RAHA 2K8QA 1C08B 1VDGA 3BDYL 1E5CA 3EDFA 3D4CA 1SPDA 4RISH 2CDGB 4ELDA 4BKLA 1NFDA 4BGLA 1M1SA 4X6CB 4B9YA 2VDQH 2VR4A 4PIBA 5IEHB 1H15A 4ODTL 2APXA 5H4ZA 5HGHB 2Z0BA 5BVJA 4DJMA 4AOFA 1WAAA 1EZUA 2ZKHH 3ROOB 1GC1C 3A4FA 5E8OB 5ILTL 1LWJA 3SDDB 4YX2L 3QUYA 3P2BA 1ZA3A 3L3GA 4W9DC 4FQJL 4CRPA 3C12A 3GSNH 3L81A 5SWZB 5TQ2L 1CURA 3J8F7 4R84A 1KFAH 1U8MB 3K6SB 4FCHA 1RZIA 2D0HA 5IY5B 1CBVL 2VLJB 3OMIB 3FH7A 3WUZA 1KN2H 1DJSA 1G7PA 3KWWA 5GGQL 3AGVA 3FHEA 3UTSB 4W4OC 1U8HB 3LD8C 5AG9A 4NP4L 5AAWA 1XO8A 1YEIL 4LL1A 3UAJC 3QVAA 3MA9H 1AE6L 2ZQKA 2VMFA 2RQ8A 4UIMA 4MB1A 2FT6A 1KIQA 3QH3A 1I1AC 2CO2A 4N0YH 1TZHA 2PN5A 4JJOA 5CJOL 1C1EL 3SOTA 3AUWB 3L4XA 3D0LA 4F8LA 3GJEB 4XVTH 4GFXA 1P4LA 4WTZA 4YLBA 2HRGA 5GGUA 1MFVA 1VFAB 5HVFB 1DLHB 3FRUA 3GGWA 3X14A 3RLSA 5C0JB 1RZJL 3TA3A 4ZOCA 3OLDA 2IQAA 4XP5L 3ZXAC 3PQYE 4DGYH 1FFOB 3AU0A 3ECBB 5FB8A 4JQIL 3SPCA 2XNAA 3PU7A 3IFPB 1G7MA 3A6OA 5D70H 4PJAF 3OKEB 3TCTA 5PCYA 2L0DA 4LIQH 2A73A 3SN6N 3ZGHA 2EDHA 1FAIH 2H4EA 4KROD 2JKJA 4V2BA 2Y9RT 4JBSA 5E5MA 3I6GB 4PJFE 2V9QA 3QDGB 1P1VA 5FDWA 4QHKI 5CZKA 2VRKA 2X2JA 3VVVA 3AZUA 4HLZG 1U2HA 5HVHB 5IQ7H 5CD3A 1KXVC 3FU5A 1GZHA 3QZNA 3MRGA 3SSGA 1ZGLA 3BW9B 4H20H 1G6VK 3VA2C 3LXUX 2IQ9H 5KJ7E 2A9AA 1A47A 2EDBA 2KYIA 2FEEL 3KW7A 3ZIMA 3P3UA 1V7MH 3BD4A 1MIEL 2SEBA 3Q9QA 1P6FA 4U3SA 3VB8A 5BV7C 3V5KB 5DVOA 4JZJA 1BQLL 4PJFA 2WSPA 4XCYA 1NAKH 4KJWC 4YHKH 1GAFH 1YECH 3KDPB 5IP4A 2IAND 5DUPH 4AT6A 3QRGH 3CDZA 4MXQC 3LHPH 3LIZH 3T71A 1BJ1H 2XV3A 3IRZA 4XOBA 3QZWA 3VH8B 1RFDL 5ALBL 1K8DB 1YZZA 4PWEA 5AUMB 5SX5H 1DLFL 1QYGH 2YHGA 1J12A 1QKZH 3L5HA 1QLFB 3OJ2C 2C3XA 1SJHA 3RI5K 1HX0A 5IW6A 3QJFA 3IKCA 3ZQWA 2PETA 4FEMA 5JQHC 4ANKA 5E6IC 4IK7A 4LPVA 4N2NA 3QZOA 2JCCA 5J56B 2EXWC 2WBJD 4IM8A 4WO0A 5AAMA 3BQUB 3CVHA 1UA3A 4PJCF 1NTDA 3FONA 3EGXA 5JHLH 4GQRA 4ZZKA 9CGTA 2JK5B 4NKMA 3U36A 1UQSB 3F05A 3D9AL 4K73A 5FXCH 3WTTA 1NCBH 5DTFA 1SM3H 1D5ZB 4PFEA 1EEZB 5LHDA 3ECQA 3V0GA 5E08L 3QQ4A 4XO4A 1S5IH 4KY1H 2EEBA 4YSTA 3JWOC 3VA6A 3PGDA 3ZTEA 4IBWA 3EYSL 5DRNB 5C0GB 2HB0A 3QDJD 1YMHA 4RDQG 3U0TA 4QRBA 5E4OA 4Z3IA 2J1ZA 3L7FA 1FZJB 5HJBA 5HVGB 3SJVD 3ZQ9A 2V5RA 1CLOL 3P3YA 3CC5A 4E41A 1IB5A 2R69L 2KQMA 5IHBA 1X9LA 4XXWA 2R39A 4NQVA 2Z1PA 5JNYB 3GWJA 2QR0B 3GRGA 3S4SA 1QR4A 3TWCH 1P2CB 2YPLB 4FD0A 4U1LB 2EYSB 2ITCA 3O3AA 4S1SH 4AZUA 3OKLB 2ICES 1HAWA 1ETZB 1HCFX 1X6LA 2BOCA 4AMWA 2ZOWA 2F54A 2OMWB 1DCLA 2BNRD 1BVLA 3NACH 5D8JL 4OSUL 4ZFGL 1G0XA 1QI5A 4JRYE 3VGHA 3S88H 2XWEA 1K6QH 1E4JA 2XG5B 2O61B 2EH8H 5I8KL 4S0TD 3RY6A 5JW5B 5C92A 1A64A 5ESQB 4C55A 3ROLB 3EW3B 3LKRA 4TTDC 1JPSH 1WFTA 4NO3B 5I30H 1QMUA 1KC5H 3PABB 4UF7C 2AEQH 4ZFFA 3KJ6H 4WENB 1CVSC 4JPSA 2YPKB 5GJSL 3FZUC 4R4NC 4YHMH 1Z3GL 4F7PA 1XTLA 5LWYL 1MQ8A 2Q76A 2BCKB 4BA8A 2FBJH 1M7DA 1NCTA 1PZUB 4TRPL 1L9TA 4X8GA 4XC3L 5I6OA 5F1NA 5L2JA 2VWEC 2H9GA 3MGOB 2JJTC 3TESA 1SQ2N 1KGIA 5B7EA 5KSBA 1LYQA 2ZSVA 4QYOB 3MRPA 4UUJA 5E6SB 2IH9A 4XNUH 4DP2X 2I32A 1QHQA 1A6WH 2C3WA 4JFHE 1URIA 2DQIL 3FSZA 1GKEA 4CVZA 4FQXA 1XGRA 2VABA 2OL3A 1OTTD 1PD0A 5ISZE 3ALXA 5F3HA 5H94A 2O30A 4M5ZH 4GQ9H 3TN0C 3ULSA 1NEZA 3UX9B 5CP7A 1FVDB 1PZBA 1M6UA 3FO0L 3IXTA 4YLQT 1WT5A 1IL1B 4KGLA 2RGSA 2X28A 2W1NA 4AM0B 3N55A 2V8LA 32C2B 3VXSB 2PWEA 3FFCA 1ZLVH 3EYFA 1HCYA 1KEGH 4TSCH 2XWJA 4M6OH 4YWGH 2E9WA 3NJKA 3MJ6A 4PJEF 4Z23A 2MOGA 3HZKA 4QAWA 3PS6A 5E6UB 4JFZH 5E1IA 3D3VA 5EV7A 3GKZA 2IBBA 3GUTA 4GBXC 4XXDA 4BUQA 4N8PA 4JQXA 5I0XA 1T66C 2O26U 2XSKA 4HPYL 3VQLA 1FQ9C 5DJDB 1COBA 3MRQA 3H9SA 1MJ8L 3DMMA 2BNQA 4L3AA 3V5HB 1WBZA 3TIEB 4JFOA 2NY4D 5LXGL 5K9OB 2BVEA 2P5EB 4IBSA 1T22A 4HH8A 1UKTA 5DEZA 2OSLB 2KZWA 3EJZC 3EGDB 4MX7B 2Z9TA 3L4TA 3IDJA 3X13A 5F1IA 2XN9B 2DQJL 5DC2A 5DUBA 5HHVH 2YFNA 5T3XL 2XZQL 3VFWA 1CK0L 3VWKA 3WY3A 3FQYA 3D34A 4MNHB 4FYRA 2FWOA 5JLZB 3H2WA 3REVA 1UJTA 4JFFE 5IHUL 5KVGL 1NGYA 2VDOL 3B9KC 3WDJA 2VC2B 4NDMA 5I1JH 5C3IA 3S35X 1XD0A 3SBWA 1HSAA 1R5VA 2FO4B 3RUGB 3S96B 2Q1EA 3RKDC 1EHKB 1MW3A 1NC2B 1WBXA 1MFUA 4LT7A 4L48A 3B4NA 1JPEA 4LSSH 3VXUE 4YDMA 5KVDE 4JFQB 5DLLA 1FNLA 3VI3B 4BFEA 3F65A 1OK8A 2RQEA 3CBRA 3GT6A 4OZGF 3OTTA 4UAOC 5IFJB 3WJMA 4EOWL 3BLBA 3GC3A 5FM5O 4HSQA 4KKRA 4OFKA 2ZOKB 2HAZA 2XVLA 4YHZL 4NRXB 1CMOA 3W1ZA 5E95B 1OSEA 1JOIA 4GAJH 3TF4A 1R3JB 3KVDD 4XMTA 3RVUD 3MFFB 1KZYA 3US9A 3VXUA 4P2RB 3S8GB 3LN4A 4OQ1A 1MPAL 4IRJD 3R19A 4XHJD 3MCKA 2YBGA 3NP4A 2HMIC 1H19A 4XP9L 1TF4A 3FT3A 4PJGB 1B2WL 4O51A 4OQTL 4U1GB 4XVSL 2IADA 1T1WA 2ZX6A 2PMZA 5D1ZI 1PFOA 3TNMA 4L2YA 2QPDB 4RA3A 5HHNB 4E9VA 3I6LE 2YAFA 2YO3A 5HHME 3UBHA 1NBZB 3HHSA 1B9ZA 1DUYA 2FD6L 2QHLA 3FH5A 3PV6A 4G9DB 4K23H 3SDXB 3VFUA 4OLVH 2E0PA 2Y4SA 4DP1X 3X1EA 1JWUB 2XU9A 3CZFB 3S2AA 2OSYA 4I0PD 5AB0A 4LCUA 2IF7A 2DJ4A 3ZZQA 4L8CB 3OPUA 1RZ8A 1AZZC 5ITBH 3NSFA 4F7EA 2H2PC 3B9VA 4NO0B 1T83A 2V5MA 1EXUA 3CSGA 4Y19D 1IKFH 1FBIH 5AOMA 1BAFH 4DPRA 3HG0A 3O9WA 4RFOH 4K3EH 4AWJC 1F3DJ 4FERA 4D0CB 1N0LB 3SKUD 5AW0B 3NESA 1W72A 4YNYA 1F4WH 3VM5A 3I3DA 4NGHL 5F7FA 1RUMH 4NO2B 4HMCA 5DMKB 2OJZH 1R34A 5LVEA 1JYVA 4M6ML 4M9PA 2AERT 3HZMA 3L2LA 1BAGA 4XMKH 5DZOA 3TV3H 3AJ7A 1EZLA 2C3VB 5F7WC 4XPFH 3GM8A 1WAPA 5KSVA 3GI8H 1G9EA 1SMDA 3V95A 4ZMNA 1DVFD 5LGKA 4LOVA 1CXIA 3ARZA 5DD5H 4X9BA 3UXFA 3WNOA 2ZCHL 3NA9L 5AAWC 4NQSB 1DBAL 1MLCA 4LSDA 2WWOA 3WNLA 2LU3A 4WJKB 1ZTMA 1ROCA 2E7HA 2VC2L 2IAMA 2ZZUT 3AG3B 3BEVA 1FNGA 5I6NA 4H8HA 3TJHC 3I50L 3L4UA 1FVCA 1MJ7L 1NM9A 4QXUH 1BMGA 3B9AA 1UT2A 3COOA 1F90L 4EDWL 3DX7A 5LB1A 5D6DC 2B1OA 5HJ3A 1SJEB 4YXLH 4BV1A 4QF1A 2EYTB 3DX9A 3EJYC 3MRKB 1LDPH 1KYUA 1EZVY 4ONOA 3UYOD 4AIOA 3HMXL 1QLEL 4YHYC 3O2DL 1RVFL 2W9EH 1IC5L 2JJSA 3HB3D 4PGJA 4XCNB 2C9AA 2D3LA 3GJFH 4BE5A 2R2HA 3KG5A 3MRIA 2BSSA 5B21A 3WY4A 5IOPB 1WUNT 2ZXAA 3PDGA 4RAUA 5JUEH 4QUOA 1Y6MR 1DFBH 2OCJA 4KDTA 3VGBA 4OZIB 4OFIA 5A2LH 4JM2A 1WFNA 4WI3A 3HJEA 2Q86B 3J07A 5A2FA 3UAEA 4OB5L 1OT2A 3FQWA 1QQDB 3RNQA 3QNFA 4MJIE 1GZHC 4IMKA 4PW3A 2A2QT 3WKYA 5EOCH 4HWUA 1XBDA 1HK6A 1SOSA 2DLGA 3QP3A 3IXAB 3OKKA 1NA8A 4MFHA 2EC9T 3FCGA 5DD0L 2UY7B 3OKDA 1M7IB 4XPHH 2YQ3A 4WI0B 1KCKA 1J10A 4EE2A 5BO0D 4JZJC 2FB4L 2H1PL 4JM4H 5DVNA 4X6CF 5EC1A 1BFVH 3T0BA 2CKBB 5DK2A 2VLKB 3W3BA 4Z77B 3GBNH 3BMWA 2Z31A 1TYRA 3CSFA 5SWSE 1MCLA 3B8YA 5BV7B 4A2DA 2V2XA 2PW2A 2W60A 1BOYA 2DEWX 2FJHB 3JTSA 1HILA 2FNBA 4L5FL 5IGXL 1HIMH 1QTSA 4Z9KB 3TBTA 4NQQA 1FNEA 1FV1A 3ASOB 3CDGA 3NN8B 4W9CC 1NIDA 5J13B 1ZT7B 4LLQA 1U58B 1SHMA 5AAMC 4HWBA 4G6JH 3I9GH 3KM1A 1D6EA 1P4IH 5IB4A 1ADQL 4UBDC 1HCZA 1E3XA 3WN5A 4JG1L 4CBZA 2Q9OA 1AANA 1KENH 5C8JA 3ARGA 4HLZH 4NUGH 5E6IB 2H26B 3H3BC 3GBMH 4HZ1A 2VDLB 4PGZA 4Y88A 3B2UD 3GMNA 4PG2C 2A9DA 1V55B 3DX1A 4OFQA 4Z7VE 3UFIA 1MCBA 1CFTA 1E9QA 4EUPB 1T4KB 5DU7A 1IM3A 1XCWA 2ENYA 1JXGA 3H42H 4K07A 4OZHE 4LVHC 1NMAL 1PZ3A 1P1ZB 5FW8A 3ZHKA 2VZOA 2JB5H 4K3JH 4QJ3B 5HY9A 2WINB 3P73A 3MRLA 5HGBB 1H8NA 2XN2A 2ESVE 4M7LL 3VFRA 4P2QB 3OM3B 2OXGB 1N3NA 1WTGT 5GIRA 4AQ8C 3O6FC 1LE9B 5DMGC 1GA2A 1LEKA 1CU4L 5LG1A 4F2MB 1MFCH 5ANMA 1GGYA 4YHOH 5DFWH 1T2XA 4OZHA 3Q5TA 3OHMB 3WV0A 1U41A 3H9YA 3KPSA 3RIAF 3ESVF 3QWOA 4BYHA 4FA7B 2VN6A 4GRMB 4PGCA 3KPPB 1OWRM 4U1NA 1IKNC 2EYRB 2E47A 2X12A 2X4PA 5EWIL 3WFEL 5IQ9A 1FE8H 2F5BL 2K4WA 4KI5F 3FUNA 1KPVB 4KK6C 1FI8C 1T5WB 5CEXB 3ARYA 3LVEA 4UQAA 2WWNA 4NT6B 3IDGB 4WWKA 5E0QA 3L1OL 1WZMA 5ENWB 4AG4H 4XAKE 3MUY1 3HG1B 2OAAA 5C2BL 3PPEA 4ORGA 1T89A 4HWEL 2OX5B 2D31B 4X5PA 2VCOA 3O41B 2GEQA 2JI3A 2CBOA 1VFBB 2DJMA 3M1BB 3K8LA 5GSRB 3MZTA 1KG0B 4X99B 3SE9L 1D7DA 3ASNB 4JY5L 4OTXL 3TA4D 4WFGD 2AQ1A 2CHZA 1JV2B 2ENJA 2O5NA 2PYEE 2VQ1B 3P4NB 2B2XL 3Q0HA 1WD8A 5KZCB 4QDGA 2Y24A 3VXNA 1FFNB 3AQYA 2QV2A 4FQJH 4NM4L 4UZSA 4E5XG 3WGVB 1AO7D 4QRRB 4OJEH 2CHXA 2NX5D 4I18B 3FSOA 2JVUA 3MV7D 4DEPB 4HQQL 4X9HA 1HHGA 2Z8WC 1RZPA 2ZT9C 3DARA 3VXMD 1LO5B 1J9TA 3N0PB 4YPGA 1OLZA 2BERA 3SQOH 2XBDA 5BV7L 5J57B 5TDNA 1CBVH 5GGQH 3FXIC 1E3FA 4WFFD 1WP6A 4FLSA 4DSYA 1WT5C 2DLTA 1YEIH 1QD0A 4D7PA 1AE6H 1P9MA 2VDML 2VIRA 2FYVA 3MRDA 3NP3A 3F85A 4DH2A 5EN2A 5T1LB 2V37A 5JA9A 2VXTH 4IHOA 3HZVB 3IYLW 1YAIA 4AH2A 5MENA 4G6FD 5CJOH 3TN0B 4FKHA 2TAAA 3ME0B 3ARFB 3D0VA 4X4XA 4EXPX 1E65A 4HS6B 4KJPC 4N20A 4YFDB 2Y5TB 1AG6A 4AYGA 3RWCA 3QI9C 1IX2A 5A2KH 5C1MB 1QUNB 1RZJH 3SPVB 3G08A 3TZVD 4JQXC 1WE5A 1VKXB 3A4DA 3UH8A 4LCIL 5I1HL 2R1YB 2J5LB 5C0CE 3U79A 2J73A 1KYDA 2AK1L 2Q3XA 3ABZA 5INCA 5CEYB 4GBXB 2HRHA 3VNYA 1V27A 5I16A 3EF4A 4R2GC 3JWOL 2MHAA 3VXPA 5B39A 4HF5L 2XV2A 4HAKA 4IOFC 1E5UI 2FNWA 3H3PL 5E2WL 1PZAA 2QSVA 3TBYA 1LEGA 5C0CA 2I7SA 1BLIA 3RWIA 3FBKA 5A16A 1NDMA 2BOBA 3LRSA 5FECB 4PJHE 4OKDA 1Q9KB 4DERA 2WYHA 3E2HB 3H56A 1E27B 3EO0B 3MLWL 1MFAH 3PF2A 1UUSA 1UD6A 3SBWC 1WWWX 3IJHA 1A7PL 5TGBB 3UOAB 3ARWA 2Q8BH 1FG2A 3E1F1 1YLBB 4CSSA 2B3IA 1MIEH 3LN9A 4U1SA 4HXAH 1BQLH 3STZB 2IWGA 4L3FA 3OAYH 4WQOA 2P43B 2Z91B 2CAKA 3ABMB 4WGKA 2J25A 3MJGX 1JWMA 3RJQB 3RPKA 1DSYA 4H26B 2ZP0T 5GSVA 3WL9A 1GZQB 4P06A 3GLZA 5ALBH 3QYNA 1AIFA 3BGAA 4GW4A 1DLFH 4Q9BA 4Z78B 4HCFA 4UAOB 3FB6B 4NQED 3M88A 2VKXA 2IV8A 3AROA 3NZ8A 1S7XA 1Y18B 3T8XA 4B41A 2K6ZA 2EDRA 4PS7A 1DBJL 1KB5B 2DEXX 3QCUH 5FGBA 1YEGL 3D87B 2AQTA 2ENPA 2Q2EB 3LRHA 4RGND 3IBOA 3QEQB 4K3HA 2VW7A 2N4IA 4NZ8A 4NN5C 4K7FA 3M1CA 3DXAD 2J7LA 3CVCA 3L3DB 2NNXA 1EXGA 5E08H 2VKWA 4X9IA 4PJXB 4PWHA 2WB7A 3EYSH 1EK3A 1L5GB 4F3FB 2P44B 4AKQA 3FAWA 2CBMA 3U4BH 3N0AA 3WNJA 1SMAA 1CLOH 1T83C 1R5IB 4HETA 3V5DA 2R69H 5GGTA 1A9VA 4DKFL 5DEJA 1ZVNA 3T6ZA 3SDYL 3O9WC 2YC1A 5AW6B 3TT3L 2EKSA 4NC1C 2GFBA 1PG7X 3BC9A 1RP9A 2ED7A 4LLWA 1C5BL 3X12A 4MVBC 2FSEB 5E6YA 2E76C 3KGTA 4HUXA 4OJFH 1T7XA 4YO0A 5H4YA 2P1YA 1QVOA 3VDCA 1HXYB 4RNRA 4G9FE 1GZPA 5SWZD 2C1OB 3FT9A 5D8JH 3OAZH 4OSUH 4ZFGH 1RK0B 2NY7L 4PBDA 1VZGA 4JKWA 1AKJB 2GSIA 5I8KH 3BVDB 4OU3A 4EI0A 5F6HJ 5JO5B 5KANG 5F3BB 5ID1A 3K6FA 3M45A 2VLJD 3UJTL 1ID2A 1KGXA 2CO7A 3NSXA 2H8PB 1D3CA 4N5EC 5H37H 1ECYA 3UTSD 4RGMB 3GHEL 5E8PB 1XF3A 3V6OA 3KMDA 2NW2B 4G80B 5GJSH 4BKSC 3RZCA 3RUGF 1Z3GH 1BG1A 2F7PA 4P2OA 4Q6YA 1NIAA 3POCA 5LWYH 1T6BX 4PJ7E 3TIDA 3NCWA 2BVOB 1XF2A 4TRPH 1HL4A 4NHUB 4XC3H 4ZUVB 4EUPG 4IK6A 5DEGB 3P11L 3RHWK 1QFWL 1WFOA 5AW7B 5C08A 4PI2A 3C2SA 3VSQA 4JY6A 1ZHLA 4FNTA 4BZ2L 3KPQA 1NJ9A 1XCQA 1ZT4A 4WU7A 1TO4A 5KS9A 1UENA 4GKZA 4GAGL 1EDHA 3FO0H 1HZLA 5HDWA 1ODUA 3C87A 2WWKT 2IH1A 3QG6B 4PJGF 4KDTC 4UV7L 4YDVA 1WDAA 2F7OA 3WS6C 5IUSA 2ZWLT 5C0AA 5DO2C 1AGEB 1ZXQA 2P26A 3LYRA 4ANXA 4UANA 4KFMA 1MHPL 1KB5L 2Y36L 1U9KA 4FZ8L 4RRPM 5AL8A 4IMKC 3QDGD 1A14L 1U4FA 1T2JA 4WFEE 3SDXF 5JHDB 5LQBL 2W0PA 4Y2DB 5JIMA 1S78C 3EKCA 3PP3K 1A6PA 4H1LA 1SNRA 1CGYA 3M17A 5DQJA 3EYUL 4KK5C 3QNZA 2DQHL 4HFWA 5HGDA 5EZJA 4AC4A 1RIUL 3VJ6A 4HPYH 5KYYB 2AJVH 4QJ4B 3QRFM 1RD6A 4QHMA 1IM9B 2WK2A 4HZLA 1UB5B 1NMCC 1RZ7L 4PHXA 5BRZA 3T8MA 1HDMB 1HH9A 2Z31C 2UXTA 5GPRA 1QATA 3I2CL 4NJ9L 5LXGH 3SYPA 4AQEA 4X4YB 4PS3A 1Z9LA 1JI2A 2XN1A 4JFDB 4ZTEA 5HDBF 3SQBA 3QO1B 4F7CA 5D7IB 4W9JC 2DQJH 1VCAA 3D69A 1CK0H 1T21A 4HIIB 4HJ0C 1I53A 4ZZFA 2GCYB 2X0WA 4JL1A 4GRLD 3H1ZA 2VSKB 4PV8B 1SJHB 3WN5C 2XFXA 5AW1B 1NFIB 1A4KB 1BF2A 3O3BB 3S97C 4GXVH 3GSQB 4ZODA 4NB7A 4ZTPL 2GSGB 2MOQA 1AHWC 3MLYL 2A9ML 2X6CA 5F7AA 4XZUB 5FKAA 3QIUB 3C2AL 3QFGA 2HLAB 4PRBA 5EZOL 4ZDHB 5CD5D 4QO1B 2VMJA 1QRNA 3W0WB 3BDBA 3L3KA 4YHZH 4HIEB 3Q2LA 4N6RB 5PAZA 3WKPA 5DZVA 3F7KA 5TE4H 5T5FA 4O02B 4GP5B 4ZMXA 3CLEL 3F7QA 3IDIA 3BPCB 1MPAH 4GSRA 4AYEC 4EI5B 4LVHB 3ASWA 4XP9H 1H3TA 2ICCA 4OCWL 4R4BA 2QHRL 1WBYA 2N01B 4GG8B 3DVNA 3FTVA 4FG6C 1B2WH 4GKNA 1CFNB 4ZPTB 4OQTH 1WWAX 1UHVA 1KGCE 4XVSH 5DO8A 3IDXL 3GB7A 1J88A 4OZIF 5CKAA 3DSNA 3O6FB 2ODHA 2AXHA 2B5IB 4I4WA 2CJUL 3RWFB 2V7NB 5ACZB 5KG9A 1HSBA 2FD6H 1SYSA 4OCLC 4WWKC 3TPUA 5I8CA 2CPUA 5C0IB 4FXKB 5ESAB 3VI4B 4X7TB 3C6EA 3CZEA 4CMMB 1A0QL 3B1UA 4MCYA 1SJXA 1H3XA 3OGCB 4XNAA 1H5BA 4WI7A 3C9NA 3FQXA 3HBPA 3CHSA 4WNQA 2CHDA 1O5PA 3MOBL 3OJDB 4P5SA 4TXVB 1I8MB 4WJG3 4G42A 2BWIA 1SRDA 4OIIL 5D7KE 4F80A 1JN6B 1UFGA 5CBEB 4J28A 1MW1A 4P5TA 2YGNA 3BGMA 1E40A 4UYQA 1PQZB 4LKXB 2LAGB 4XE0A 2R4RL 1HKLH 1EAPB 3QEGH 1FN4A 1GGIL 1GS7A 3D25B 3HCVB 5GZOD 5J06A 1QR1A 4XMWA 1S7WA 5AOKA 5ITFA 3UBXA 3WXWH 1PSKL 2H9GB 2IOIA 3LS5L 2PTTB 3LKQB 4OCRL 3U83A 4JB9L 1CE6A 2WTOA 3L95A 3PL6A 5JOPD 1N4XL 2C4FT 1GGTA 3OJMB 1E5BA 1AP2A 1DVTA 5AYTA 3ZX1A 2FDBP 4JY4A 1J18A 3NA9H 1DBAH 4DKEH 1UWXK 4HPOL 2X3BA 4MS8C 1ZVYA 3UTPE 1PG7W 2NZ9C 1Z2KA 4HJSA 15C8H 1IBDA 3IJ7A 1S8DA 3VXQA 2H7WA 3EXJA 2VC2H 4O9HL 1Q94B 3VXSD 2A77L 1JDDA 5F89B 3LXAA 2Y1ZA 1MJ7H 2E9IA 3L9RB 3TH4T 3VE0A 4C4KO 1TZGL 5CILL 3QQDA 4EDWH 2X5PA 3ARVA 4HJEA 3FCBA 3FFCB 3MRBA 3CVHL 2WLLB 5I74C 4GQPH 1M05B 3O2WL 4UT9A 5HHOB 2FT8A 2P5PA 4YVNA 2MTAA 1XF4A 1LP9A 3HMXH 4MMXA 3FRPA 1PZ5B 2PABA 3O2DH 2HKAA 2ZXWB 3BYYA 3QI9B 4FFWC 5SWQA 1EMTL 3UTQA 3N1FC 4MMZA 1H3UA 4O02L 1U21A 1K5NA 3NCFB 3WIFB 4U1HB 2E86A 1EEYB 1SHXA 2DMGA 4F9LC 4YK4C 3QSKB 4ICXA 2VXQL 3BKYL 4NZDA 4IBVA 4BDVA 5EO0B 3CXDL 1F86A 3CVDA 4LCCC 2JB6B 4JFOB 2BP0A 3BT0A 4JUTA 2J8UB 5D7EA 3FU0A 5I8EB 2XN9D 2AZAA 4YBHA 1CIUA 3MODL 1U6AL 3BYTA 4PRHB 5ADPL 3AAZA 2FECI 4R7DA 1TVHB 2J21A 5DD0H 3IGLA 1OIOA 4GG6B 2FB4H 2ZX9A 3T3PB 5FK9A 4YFEA 4IBLT 2BY1A 5IVZB 4KDVA 4XTRC 2C3HA 4N68A 4PWJA 2MPAL 3V0WH 3VFPA 1DVZA 3DBXB 3MCLL 4OGQC 2OLDA 1IGCL 5E2UL 2WZ0A 5KVFE 3KGSA 2C9SA 3ULUF 2LU4A 2GIYA 3K2KA 4WTZG 4L5FH 1MAKA 5IGXH 3EF7A 4FHKA 2RCSL 2DYSB 4M62L 3QCVL 3T2QA 1KXHA 1P7BA 1H6TA 1BQHA 4YGAB 4KXZI 4AW4A 1R9FA 1PW3A 1INQB 4P2RD 5EO1A 3DHJA 1RJYB 2YD3A 3QHZL 3LZFH 5FGBC 1ADQH 1Q9OB 3KL0A 1ZIBA 4PV9B 1GC1H 3PDOA 2HVKB 1EZSA 1VIWA 1BMZA 4X5RA 2QVKA 5KYWB 2NUTA 4X4ME 3W11D 3GMRB 4HH9A 5EZLB 3TC9A 2WIMA 4JDEB 2CM6A 2QVTA 5HGAA 1IAMA 1ZJAA 2ZG3A 3FT2A 3T3ME 2UZIL 3QUZD 3QWNA 1Q0XL 4XMLL 3OKMA 4X7EC 1YA5A 3HAEA 4NSKA 2JMRA 5F88B 3PHOB 3E38A 4M1CD 1BIIA 1NMAH 5DWUL 1YCSA 2J55A 2F7QA 1HINL 1LNUB 1RUAL 5KYXB 1BQ5A 3K3QA 4YBLC 4X4MA 1TQUA 2DWXA 3RURA 1AIZA 5F7MC 4QHKJ 2ZPKL 3EH4B 3QT2A 4L1SA 3EYVB 1T5XB 5JMRA 5C0DA 4DETA 2GUOB 4NO0D 3IE9A 1MFEL 2IDUA 1N59B 5HI5C 1ZK9A 3MAWA 3L6FA 4KTDH 5C0BE 3GXIA 3GXFA 4XC1H 3B56A 3NIDE 4RIRA 2ITDA 1A7NL 1O7VA 1U93A 4A7VA 4RZCB 2DM3A 4LSPL 5ES4B 3SKJL 5EWIH 1URLA 3WFEH 3H85A 3D12B 1N70A 4XO9A 3DI3B 5ID0A 3BI9X 1A9BB 1XF5B 4F91B 5I1LB 3CPUA 1T7ZA 1F1AA 3QZWG 4NI6A 4O58L 5FHAH 4EAEA 4ZMQA 1MZZA 3JTBA 3FFDB 2XWCA 4NAMA 2E3VA 5C2BH 4L4VE 4U33A 5JMOC 5EC2A 2I25N 4HWEH 1O7SA 1FDLL 3W81A 2CRZA 3ISWA 3V6OC 2X1OA 3V0IA 3T4AA 5C9JB 3Q06A 1HOEA 3MRMA 1X7QA 2BO0A 5D55A 5DJZA 2V3DA 4JY5H 4P2OC 1GRWA 4G5AA 4LEXL 2IFFL 1BOGA 1EAQA 1AD0B 2BM3A 1QEWB 5D1XC 5L8KB 3U2SB 2B2XH 5I15L 1MUJA 1S7UB 2XKNB 5GHWH 3WEBA 4NRYB 1A6AA 3UAJD 4CC4A 5HDLA 4NM4H 4JPKH 4KDWA 5IB5B 1E4WL 1TEGA 1I1AD 3UTTA 5A2CA 1FVCB 1ACYL 2A6KA 5EULV 5EBLB 2VN3A 1Z32X 5BV7H 3ZDXE 4QRPB 4QRUA 3KPLB 1NCWL 3FQTB 1A6ZB 3Q1SL 4MAYA 4JRXB 5ADOL 4CGUB 5DUML 5DF0A 4X6FA 3RBGA 4IMLA 4HOXA 1OCWL 1XB8A 4QLRA 4G3YL 1EFQA 1N2RB 3KXFB 1QI3A 1WD9A 1RZGA 2IPTL 4QTFA 3MLZL 5A7BA 1H3WM 1DCEA 2FEJA 5I5RA 2X4UB 1VGKA 3DRQA 3ZYZA 4NQCE 3UPRA 2D0GA 1LWRA 2VR6A 3KPNA 4PJXF 1JRHI 1JNHB 2FYYA 3C60A 1OTSC 4GEIA 3ZUNC 3RY5A 5CP3H 4DQOL 2UWEB 1KTLA 2J8HA 2WNGA 2Z64C 1TQCB 1JGUL 3D39E 1E4XI 2V6HA 1P5UA 4IBQA 5AW8B 3P40A 1SLVA 2XICA 4ERSH 4EUPH 4A7GF 1UOKA 4LCIH 4KHXH 4PJDA 4Z7WB 1S3KL 5I1HH 3ZT7A 1ZEAL 4P46A 3T2OA 1GH7A 3PLYA 2EE2A 3RPIB 1SDDA 3GMOB 1YY8B 4NQCA 1MAJA 3FTZA 2VLKD 2XQYG 5IROC 1KN4L 3JWOH 5F21B 2ZSWB 4ZOBA 3KCPA 4YSRA 4EI6B 3H3PH 5E2WH 1B9KA 2P5WE 4HX1A 4KJWD 5BQDA 1AZUA 1SHSA 5T33H 4MJ5A 1IAKB 2NXZC 1ML0A 1CGTA 1I7RA 3LNDA 3VXTB 4K5NA 1MREL 5EIVA 3MLWH 3O3UN 2JKTM 1W72L 4LU5L 3GHPA 4CKQA 1A7PH 3ES6B 5B1BB 3FT0A 1FIEA 2PPDA 2XV0A 4PCKA 1AZBA 1U91B 2FO1A 2DTSA 1M53A 1NEZG 2P5WA 1JPFA 2VISB 4PJBA 4YR6B 1AG0A 1PCXA 2JLLA 5E6ID 3UG4A 2EXWD 4J1UB 2GJ6B 2R1XA 1LD9B 1TIUA 2G5RA 2ENSA 1MFBL 3OQRA 3EDKA 3JWNE 4LRNL 1PZCA 3LXCA 1CDUA 2Y5EA 3WFCL 2XV6B 2Z4TA 3NVQA 1AHWB 1MW0A 2WLKA 4XMUA 4AYFB 1U8LB 1MCPL 4P2YA 5DFVC 5GGRY 4AENB 4NFDA 1MIML 1O75A 3LKNB 3ULUH 4ODVH 1RI8A 4PTTA 4PTUA 4XBPA 4UT7L 1DBJH 3IS0X 4MXWL 5DA0B 2QVFB 5E99L 1P5VB 1YEGH 1UT1A 3OXSA 2WXIA 2HUEA 1SOQA 2J71A 2R29L 3TO4C 3M46A 2ADIA 4FEIA 1C8PA 3TYGL 1MCWW 3BUYA 2XTJE 3TBBA 1RPKA 4JM0A 4WFHE 1NKGA 5DJ0A 5EOTB 4APQA 4PLKC 4HUUA 4HIJA 3MLVL 2DDQL 3SGJA 2K8MA 2AJZA 3ZKMC 2RIKA 5GZNC 1XT5A 5DJ6A 2ZCKL 1J11A 5FOJA 1H5BC 3HG1D 2CLRA 4GXUN 3MZGB 4XXCA 5E9DB 3KJ4C 5HYJA 1D5XA 4KX8A 5IK3B 3SDYH 4A68A 2DV6A 5BW7A 1ZY9A 3QZLA 4XNMB 3TT3H 1A2YA 5F8RC 3T0EB 3GTTA 1C5BH 3BCFA 4TTDD 1UZ6E 3MX0A 4P5TC 1ZVHA 3RTLA 5F9DC 4TNWF 2B15A 3RL1B 3L08A 3WXVL 1NANI 3I9AA 2B9AA 5KZCD 2PKDA 3K1DA 4R4ND 3KW8A 2JI1A 5DRXA 3ULUD 1TZAA 4KJQC 1C12B 3KEHA 3QQXA 4OCYL 3NJVA 4QRRD 5D7IF 4Q97A 3A6BL 3HPLB 1CFVL 4AEEA 3PL6C 1KCSL 3T2LA 1I3GL 2BVTA 4U6HB 5FGCB 3LH8A 1B4RA 3OF6A 3CLFH 4ZFOA 2FJUB 4UQEA 4HW6A 4N2LA 4EKXA 3GHEH 4BSVA 4JKMA 4BH8B 2XPZA 5E2JA 4M29A 3WHXA 1EAOA 4ZTOL 4D9QE 1VAHA 3TH2T 4KRNA 5DQDL 3EFFB 4F8TA 2BMKA 3TN0D 3DO7A 4L3EA 2W5PA 3ARFD 1QFWH 3QFJE 4HWBL 4MNGA 2BY0A 1XGPB 4OZFB 3EJCA 1CT8B 1S4IA 3PNWA 3QHFL 3TNNB 3ZGIA 5BQ7B 2H3NB 4U1MB 2W07B 4FQCL 4IYKA 1IAII 1VFUA 3BZ5A 1F6LL 4JCLA 4R96B 1MJUL 5IM7B 5BJTB 4H8VA 4Y5VC 2HJFA 3C5JB 4MMZC 5ERWA 5I74B 5CHNA 3FQNB 4JANB 1XD1A 4FFVC 1A66A 4GBXD 4AY0A 1BD2E 1F11B 4YSEA 4ZW3A 4BFGA 4MJJA 3WO3B 4UI2A 5FOBB 2DD8H 4YC2C 4ODXB 1PNDA 4P4KA 1KB5H 1N18A 3E6FA 3LPFA 4FZ8H 1YAZA 1J0JA 1A1OB 4P3DB 4LQFL 4NPJA 2CGRH 1A14H 1XB3A 2QKIC 2LOEA 3QISA 1FYTE 4YK4B 2COQA 2QPSA 5LQBH 1TPXC 3VI4F 4KQ4L 4WUUB 4XH2A 5FUOL 4LCCB 2EIKB 3GTVA 2ZX8A 1ECZA 2DQHH 3EJZD 2P7TA 4LCVA 5K1NA 4BCYA 3U0PA 3ZMEA 4Z7UE 3SY0A 1IBGL 2QMKA 5DCCA 4TOYH 3H8NA 2AJXL 3ULVE 3PWUB 1RZ7H 1UXSB 2B59B 4UOQA 1RLWA 1NL0H 3B9KD 3I2CH 5T3ZL 1FYTA 2Y07L 3HS0A 4MKMA 4FQHB 4BH7A 4UCFA 2E6QA 1G7IB 2IALA 3KYOA 3RKDD 3MU3A 2OXHB 1A8JH 3VCLA 1MJJA 4W9IC 4Z7UA 5H35B 1ZMYA 1HQRA 4LVOC 1SYVB 2UXVA 2WYZA 2EE3A 4P99A 1Y0LB 4OLYL 2PP8A 1Q9LA 4JZOA 1N6UA 4N3UA 4QGTA 5SX4I 1E6JL 2H0PA 2AK4E 4WW2B 5T1DL 2HPOA 3ZSSA 2QVIA 2WXPA 2A6DA 1CXKA 4N2EA 4XMPH 2I07B 2AEIT 3BPNC 3LKPB 4H4NA 4JFPA 4MASA 5AOIA 3QEQD 1WHOA 4ZTPH 3K6DA 4CW1B 4UMGA 5IG7B 2A9MH 5HPMB 5A3IC 4EMZA 2HMID 3C2AH 2ZKMX 1ZDQA 1AS6A 1E28B 2IOOA 4Z3TA 2YPVL 1KJ3L 5CEZE 4DEUA 4GSXA 3KPRA 1JK8A 1NCDH 2Y6TE 2MNJB 3VFMA 2HVJB 4XVUC 5DEFA 4OV5A 4UOW0 2RD0A 4BFIB 3L2MA 1XIWA 3CLEH 5IZ7A 1J9RA 3GXUB 4C83B 3PE9A 1KCUL 1I8IB 4KO9A 5JW3L 1NBVL 2XZAH 5LUMA 3UBXI 2YKLH 2QHRH 4J3VA 3QWQB 2JSFA 5D5ME 1I1RA 5L6YH 4TVPH 1QNIA 2ENQA 2EIZA 4YBLB 4ZJ9A 1J9QA 3S35L 3SKMA 4Z7QE 1DHKA 3PWVB 5FYLE 4EZKA 2H2PD 1FWXA 4OCXL 4JFEB 4B9GA 2CJUH 4OLUL 4IOSD 4HUXB 2D3NA 3UZEA 4PG9B 4U3CA 1ZK5A 2J8UF 2J1YA 4DUXA 1DJHA 5L7XL 1WF5A 1A0QH 1IIIA 2HFFA 4ELME 4QWWC 5IMOB 2ICWI 4LDCA 3QJXA 3SE3C 1I9EA 3AU1A 3T3PF 1T20B 2YLKA 4UDTA 3DIFB 4LRIA 2RTTA 3M1OA 4OIIH 1U3HC 1F13A 5FKPB 1BEXA 2P8MA 3BISA 1YSOA 4HAGA 3GSUB 4JAMA 3O6KH 1ETA1 5DJ2A 2R4RH 4Y8AA 4OGXL 1GGIH 3H4HA 2Q5BA 1UVQA 3IDMB 1OP5K 1A7BA 4Z1PA 1ZTXH 5D1XB 1UWGH 1PSKH 2A6IA 3LS5H 1OVZA 2QVMA 2X6AA 3NIFB 4HV8B 5IVXB 3TJHD 2XTLA 5I0ZA 4TVPD 4YIQA 4JGUA 1JRHL 2XG4B 5AZEL 1BBDH 4YGVA 1N4XH 3FB5A 4AZ8A 2EH7L 1S2EA 3TPKA 3Q6FA 5AYQA 3ARUA 4HPOH 2VLRB 4IBUA 2XVBA 3ZY7A 4M7KH 3P3TA 2VZ3A 4BBWA 4JDVA 1QWUA 2J43A 3GSOB 3GSXA 2PXYB 1CGUA 1BCIA 5I26A 1FYHB 4O9HH 3GYRA 4LBAA 1LJMA 1QHPA 2A77H 3QJHB 4XMXA 1ANUA 5AQ0A 1TZGH 3M6DA 5JIPA 3Q5OA 5FFOA 4GRWB 3RFZC 4R26L 5JHDD 4S1DD 5FV1L 1IMHC 4Y2DD 4WDIA 1L7TL 3O2WH 3EBHA 1SN2A 3E0GA 4MMYA 3S7GA 4K3DL 5ICYA 4HIHA 2F5AL 1Z5YD 1KLFB 1RV6X 2E9JA 1PLGL 5FAAA 1DEDA 2X3CA 1EMTH 2G2PA 1D5RA 3MGTA 1KGUA 1IM9D 4O02H 4I0CC 4ORZC 1YPZE 5LNDA 4X5LA 1Q0EA 1E2ZA 1FZKA 1ZA6A 1CG9B 3GMMB 3GSNA 2VXQH 3BKYH 3MBEB 4QXTB 3CXDH 2OMZA 1YYLL 3MBXL 3GUFA 1E0OB 4JFDD 4PRNB 1PZ2A 2AQNA 5JQ6L 2V9TA 4YQXL 2WSDA 1T03L 1R3HB 2PCPB 3MR9B 4AUJA 5KUKA 3MODH 2WIIB 5I75C 1U6AH 3FOMA 3EHBC 4C56E 3B2PA 1DVQA 1WC7A 1NIFA 4V2CB 4Y4HB 3U6RB 2G4EA 2YUVA 5DZ9A 4ZS6C 1KPUB 2E27L 4N0FB 1SGKA 2X1XR 1YEKL 4FXLA 4Y4FB 2NXZB 3P77B 3VWJC 4F1ZA 5A6MA 4A37A 2MPAH 1WHPA 2VDPL 3H53A 3WFBH 4PMEA 5FO9B 1SEBA 4M6NL 1D7BA 1TJGL 4UBDD 1J48A 4FI8A 2XY2A 4HJ1A 3QIUD 1IGCH 2IANA 4KHTL 4BQCA 5J1SC 4RQQA 2YRPA 3NK4A 1ITBB 1XGUB 2HA1A 1CWVA 1REIA 2OM5A 3QUXB 3W0WD 3GXNA 2HKFL 1PD6A 1IGFL 5EUOB 4KWUA 2CA4A 4LGSB 3GFUA 2ZOLB 3BFOA 4G6ML 4M62H 3QCVH 3N9GL 2BFVL 1X5JA 3APNA 4UNUA 4J6IA 3PYCA 4KO7A 3PUUA 4LSRL 4NENA 4Q9RL 3T0XA 3RVTC 4OD1L 3NZHL 3TLRA 1M1XB 5B7MA 3TP4A 4E41D 2V5TA 4H0GA 3GINA 3QDJE 5AWNH 4ZUTA 4QRFA 1DQDL 2GIXA 1F4YL 4X6DE 3O6FD 2ZKXA 3VQ1C 2NDGA 3JWDC 5DMGD 3MNVB 2Z35B 1Q0XH 4XMLH 5B39G 3ZTJH 1FRGL 4S2SA 3TO4B 1F6AB 1UACL 2I85A 4O2CB 4PP2B 4XXCC 5DSCA 5DWUH 1VGEH 1HINH 1D5MA 1RUAH 2DN7A 2QDVA 5DR5L 2UWEF 4EO5A 4URTB 4BFBD 2X4OB 3NGBC 3ZJAA 4JE0A 2ZPKH 2DQDL 3IT8D 3QAQA 3V0JA 5BW7C 4KK6D 4YDZA 4HCIA 1CPUA 1WA2X 2GHZA 1ZLUH 3SJVA 4AW7A 4Z7WF 1MFEH 2BNRE 3FCUB 1KJVA 4BWWA 2ED8A 5EBMA 3LIZA 2O5XH 5ACMA 3KJ4B 4WU5A 4ZMZA 3CSPA 4LCYB 2JQZA 1U8QB 2RAMA 1FL3A 2OCCB 4IU2B 1KELH 2QT6A 4LSPH 1W8OA 3GD1C 1TTAA 4MSWB 3QW9A 4MJ2A 4FNRA 1M3JA 3ILPA 3IMBA 1AZVA 3ZE2B 2KZ1B 4O58H 4NNXB 5D2LA 2ITEA 2Y5QA 5GJTL 3D18B 3PWPB 3CSTA 3B3BA 4GMSL 4IGBA 1FDLH 1YQVL 5JHLA 3Q8AA 4V33A 4P3CL 3RIKA 4NO5A 1WWBX 4P23B 4UDUB 1YMME 1H6UA 3QULA 1OF2A 2IFFH 4LEXH 4BZ1H 1C5CL 1QWHA 3OR7A 3OB0H 4FMKA 1EO7A 1YEJL 3QAZC 3CV5A 1A6TA 5MI0B 3JSSA 5I15H 3W5MA 5HHPA 4RFEB 3T0AA 3GEFA 3NA4A 4XNBA 5E03A 3FU3A 3BO8B 2Y7MA 4GLRH 1PY9A 2H6PB 1EEUA 1E4WH 3FFCD 4KKLC 2WLHA 4J4PD 1UUNA 2ERJC 4P2AA 4Y1AE 2BLFA 1V05A 5HHOD 1KBPA 1MQKL 2AITA 4R0LA 3C5ZB 4L18A 3B1TA 1OAYL 1ZE3C 3EOAA 4UIKH 2WD0A 4G7RB 3N85L 5FC9A 4KJPD 1BIHA 3OBAA 4LEOA 1PKQB 3D3VD 1NCWH 1KCVL 1YN7B 3HE6B 5FR3A 2ALAA 3Q1SH 3QI9D 3QJTB 4LGPB 4XRCA 5AEAA 4L8DB 5DUMH 5ADOH 3QYMA 1KULA 1MCKA 3L5XL 3CN3A 4NZFA 4M8QB 4LO9A 1OCWH 3G6JE 4K5MA 3QDHA 4G3YH 1B3IA 1EHXA 1KV3A 1XH3B 3JV6A 2IPTH 4Y5VB 3MLZH 1UFUA 2BINA 3HR5B 4HWZA 4AQAB 5DYOA 1I9RL 1U2YA 4JFSA 4ZQKA 3BZ4B 3C8KB 2BJML 5CSZB 1TVBB 5JXEC 3S5LB 3CUPB 4HHWA 5J3HC 3FN3A 1QPXA 1DANT 1AR1C 3F12B 2F61A 2P28B 3KYAA 5MEPB 4PREA 4YC2B 4WHDA 4IOFD 4DQOH 4PRHD 1JGUH 4KK9C 4HS8L 3G6JA 1N9PA 1OAUL 1EBPA 3ZDYF 2OR9L 1GTNA 1AXSB 2EO1A 2X4NA 2XVKA 4NC2B 4CU7A 1S3KH 1QLRA 2QKIB 4WJ5B 3NFPB 3AAZB 3IF1A 3LH2L 3VSVA 4LNVA 5FO8B 3G7TA 3QFDB 3T1FB 3QNXB 4ZX6A 1BLNB 1KN4H 2CE6A 2BVQA 1E5YA 1H6FA 3BUQA 2LHAA 1DE4B 2ARJB 4M3HA 4E0RA 2ATKB 3TFKC 4M5YH 4R97C 3WTXA 4L9LC 2HT4C 2DWEB 3MPCA 4APXB 2D03H 4GJTB 2CH8A 2YIHA 2A1WL 3I02A 1BQKA 4PRDA 4JZNA 1YEFL 1NGXB 1A4BA 1K4DB 1MREH 4HFUL 4MS6A 3OVUB 1WV7T 4LU5H 4R5XA 4LVOB 3TEZA 5DRZB 4P57B 4M43L 1R3LB 3G5XA 4MA7L 4ZXBB 3U2IA 1YUHA 3EOYG 2CDFA 3IPFA 4ZUWA 1QSFA 1IGIL 2ZAIA 4QXVA 3MLUL 3NFNA 4HK3J 4DCQB 2A4ZA 4NKDB 4MQXC 4LRNH 5I1AB 1AQHA 3S34L 3WFCH 1IVTA 5E9NA 4YDLC 1TQTA 3OAUH 4MCZA 1E9PB 1B4JH 5HGGS 1BZQK 1XIWC 2IDCA 1S9WA 4DAGH 3VRJB 1HE8A 1MF2L 1MIMH 4W9KC 1GGCH 1G87A 3GXPA 4I77L 1J5IA 4H1LG 4K7PL 5K69A 1OAKH 4UT7H 4JCMA 3VG9B 4MXWH 1HHHA 1QBML 4IRJA 3K4DA 4TYUA 2R29H 3A4EA 3NCCB 1TTGA 5JIIA 4GW1A 4D0BA 2DJUA 4PJAA 4N0RA 2P80A 4ENEC 2UZXB 3O9WD 4XWGL 5TDPB 2FJGA 5GGSA 3OC5A 1A8ZA 3MLVH 2DDQH 3Q6GL 5ELIA 2HJKA 3PHQA 3QCTL 2OZ4L 4K5OA 3LVTA 2UUDK 4MVBD 4X5WA 5GGVY 1HEJC 3KBEA 4G8EB 5FA3B 2FATH 3BAJA 1ND0B 3FTXA 2ZCKH 2ZWNA 2B0SL 4QNPF 1T1XB 5IIEB 4KJYA 4LSUL 4I0PA 5JDSB 4XNXH 2ZOTA 4MXVF 3RYMA 3VGAC 3BAYA 4CVUA 1KCBA 4NQTA 4Y19A 3G04B 1JS4A 4OGYL 3UABA 3OX8A 4ONHB 4JFYB 2ZOUA 4NLAA 2P8LA 3P2TA 3WXVH 1QABA 4MAZA 1DN2A 1E90A 1R5WB 3D07A 1G94A 1ESOA 8CGTA 4OCYH 4IOIA 5FO7B 1U3HB 5I1EL 3DHMA 2R7EA 4AJVA 2VXUL 1KCSH 1BX2B 4WWPA 3MACL 5BOZG 1L0XA 4CILA 2G5BB 5CAYB 4R90L 5BS0B 4QRPD 3WLWC 4N2MA 2CLZB 2HWZL 3V2AR 1DVFA 4PGEB 4ZYKB 4I5BA 4JRXD 1QUPA 4WWOA 4WW2F 3WMPA 2ZOOA 5CS7A 3ZE1F 3P1VA 1OWWA 3FNKA 2Q0ZX 2FUQA 3BP7A 4WKZB 4YL9A 2PCXA 5IBUG 4OFYD 4PJCA 4ZTOH 4N8CH 3KXFD 1ZHNB 1UXWA 2WQUA 5DMIL 3DLQR 4HWBH 4HK0A 2I9LA 4AMKL 2G0KA 1HHJA 4KUZL 4P9HL 4PGDA 4QHNB 4RMSA 3QHFH 3BUTA 5DO2D 3ZQXA 4MDJA 1UGNA 3MREB 2F53E 5EUKB 4XN8A 1UWEL 4R3SB 1MRCL 3V4PB 2GKIA 4FQCH 4JPVL 4DEWA 2FR4A 1AGDB 1MJUH 1XEDA 4OUUA 2DY2A 2FX7L 2PR9A 1U8PA 2CM5A 3RFZB 4HU2A 5M94B 2YKKA 2C7FA 2DIJA 3CWGA 3RI5F 4CADB 1S78D 3V0FA 1VFMA 4KK5D 2AJSL 3B34A 3STLA 4S1QL 1D6VL 3KAAA 2YK1L 2XHNA 5E8NB 3Q7JA 5G4NA 1EO5A 2APBA 4KRLB 5K9JL 4JPWL 4H25B 4LLAA 3U4EB 4YDKL 5AAPA 4L8BB 3AITA 3UBXG 3QWRD 3RGHA 5BUPA 2DQEL 4KQ4H 2R0ZL 4F92B 4OVVA 5L4MA 5FUOH 1DDHB 4PN6A 1MFNA 3UCQA 3QXAA 4M5TA 1IBGH 2KZBA 5LCVA 3ZIYA 4H44C 2TRHA 3CZLA 2APSA 2AJXH 4K2UL 4YPJA 4HJGA 3SEPA 4KNSA 4A7SA 2X9ZA 1CGVA 1Q9WA 3QXTA 1WJ3A 1M6OB 1QSEA 4LOFA 1LGVA 2XWTA 2GJ6D 5B38B 3P0VL 5DJCA 5DHYB 1CF8L 1UD2A 3F7VA 1CD8A 2OMYA 3VWJB 3HRZC 1XEUA 5J6GB 1A1NA 1HT6A 2CO3A 3BKCL 3NIFF 1I9IH 4FNQA 4O2EA 2YAEA 2R9HC 1LTXA 2NNAB 3GJFA 4ZBJA 1HI6A 3GIVB 1IM3D 3TYFA 4OLYH 1S7SB 1MELA 2BNUA 3FRPG 1BXXA 1NCIA 3L9YA 1E6JH 1AMXA 3PQYB 1S9VB 2VR5A 5T1DH 1MCOL 1MCRA 4H8QA 3DYMA 3AWEA 3V9CA 2VZVA 2V4LA 2NY3C 4ABQA 1W0YT 2F0CA 5E2VL 2R0WH 1MY5A 2NTFA 2ZUWA 1X5LA 3S5LG 5F1SA 3VTTA 1H0DA 2G75B 1YEWA 1R3IL 3AREB 1XCTA 3BAIA 3WS3B 2YPVH 4FG6D 3RILA 3WJLA 2ZAGA 1WFIA 4GRWF 3JUYA 4PJEA 1NUDA 3E6HB 1K8IB 3BGFC 3DRTA 3DHPA 4G8FB 4DN4L 1QX1A 4G5ZL 2OYKA 2E7DA 2KDYA 4N2BA 4XNQB 5JW4M 1R17A 2R2BB 2HG5B 3K6NA 3BRFA 1T3FA 1KCUH 1ZKAA 2HRLA 3JVGA 5JW3H 4LPTA 3ATAA 4W68A 5D7LA 5IJBC 1H9VA 4EDXB 4DHLA 2FQGA 3T0ED 1D5BA 3W9DA 4FZEL 3DOSA 4U1JB 1MNUL 3C08L 3IJEB 3TOPA 5DHVB 1UJ3C 1E50A 4PWKA 4OCXH 5MEOB 4CL7A 1XVSA 3FTYA 4TSAL 4WGWB 3WSQH 4OLUH 2GBUA 3PAZA 4WWID 5JZ7D 3LRKA 2WSKA 1WZ1H 3UTZA 1F5WA 3PRZA 1QNZL 1B88A 1VPOL 4G7VL 4A2MA 4IGBC 5L7XH 2YSSA 3AS1A 1ORSA 4LVNC 1CFMA 1DEEA 1XZ0B 1HQ4B 1BQHG 2X7LB 2ZTBA 4JN2B 4YXKL 2EABA 5F0JB 5HTSA 2BP8A 4Z7NB 2X4SA 3D0AA 4ETQA 1MI5E 3ZYIA 1XXDC 3A4AA 5D9SA 4I9WD 4YXHL 1U8JB 2NX5E 4KZCA 5F7LB 1J7VR 1I7UB 3VXME 2IXQA 3CZGA 4Z76A 3S98A 2BIIA 4HULB 2BS9A 4KUCF 4MS8D 5AKTA 4PJ8B 2YMXH 5TH2A 4Y5XB 2NZ9D 4WFFE 4OZGA 1ES0B 2DI9A 2ED6A 2RHEA 3HAEG 3QAZB 5IKCB 2Z0UA 1H8SA 1AO7A 4B96A 4XN5A 5K39A 1VHPA 2NX5A 2YRLA 1B4LA 1Q90A 3AXIA 3DBSA 3MV7A 5AZEH 3NEOA 3VXRA 4D2NA 3VXMA 2EH7H 2WV3A 3T4YB 5DWPA 1PDKA 4I88A 1KDIA 3BZEA 2ERJB 1B0GB 3BT2L 4YZWA 3ZYJA 3QXVA 3PJNA 5JYMA 4G43B 1G7JA 2P9RA 4MNQE 2ZWKA 3BHBB 4NWTL 1IARB 3PREA 4ALAC 1NBYB 4Y16B 1KLUB 4G8IB 1ZHBB 4FFWD 3E80A 4M02A 1GYCA 3IGAB 5ALCL 1X5IA 2AV7A 3CCHB 3UZVA 3U48A 1RAMA 2Y7OA 4PJIF 1G7LA 4IRSC 2Q2LA 4AKOA 4HGWB 1W91A 4JVUA 3BVNB 4R26H 1L7TH 4JRYB 4KO5A 5E1QA 4WUUD 2DYPA 1JFQH 3VD4A 3L48A 5GISL 2ITFA 2ATAA 4OR1A 5BZZA 1F02I 3TZVA 4HD9A 4HD5A 3B37A 4XH2B 4F7TA 1AR1B 1KACB 2IPUK 4NLHA 4ZMAT 2CO6B 3D51A 3ESNA 3ZPDA 3CXHK 4KXAA 3SPJA 4R7NA 4UU9A 4EIUA 1ZLEA 1F00I 1JGEA 1Y6NR 4FJZA 4R8WH 2JKIS 2W94A 3V6ZA 1HXKA 2KPWA 1JZ2A 2JKLA 4RMQA 3APMA 1E5ZA 3QDMA 4K55A 4P5KA 1YYLH 3MBXH 2MCPL 3QJZA 1BZ9B 1JUFA 2W65A 2AS5M 7PAZA 4XTRD 1U8OA 1C16A 1B90A 5E8EA 1FJ1B 1UB6B 2WXQA 4JKNA 4ODBD 5KN5A 3ZE2F 1NICA 5FUCE 3UJJL 3RVXC 4MJ6B 3G5VA 3FB7B 4WWNA 4L9LB 4DO4A 1OT4A 1W0VB 3QS3A 2V17H 3SE4A 5IHHA 3I6KA 2VRAA 3NSCA 1UCBL 5I6PA 1RHHB 2FT7A 4YEFA 3VFNB 1FZMA 1YEKH 3DVFA 2F68X 4HHAA 3BWSA 5ISZB 1CDJA 4BK5C 5EF1A 4KKNA 4KVNL 3ZW3A 1S7RB 2VDPH 4LK4A 2DF3A 1JWSB 2XPGB 4FYTA 2Y7QA 5IMKB 3JVFC 4HDIB 4AEIH 1IGTB 4NQEE 4M6NH 4PLNC 3GMPA 5L8JB 3F7RA 3GBEA 3ARBA 4NYLA 3KH4A 3MDJA 2WHVA 3JXAA 4QKXB 4PCYA 3V10A 4XPTL 2BHYA 4X8JA 2HKFH 2K7QA 3QXWA 1IGFH 4NQXA 4D8PB 1EBAA 2YEZA 1CDHA 2AZUA 4G6MH 3N9GH 7PCYA 1A9EA 2BFVH 3MNDA 3MXVL 3RVUC 4LSRH 1FFPA 1H8LA 3ZZSA 4YDLB 4Q9RH 4NQEA 4IRJC 3GBDA 4QGYA 2V0AA 4OD1H 3IJ8A 1IBBA 3NZHH 2X4TA 4PR5A 5EU6E 4NQDA 2R0LL 4FFZL 3PFQA 4CU6A 1DQDH 5J12C 1F4YH 1AXIB 3HC0B 3N6YA 2X4RB 1OSZB 5E24E 1FRGH 4HWNA 3O6LL 3OD3A 1PBYA 5HI5D 3DXAA 4UOJA 5IHLB 1UACH 4OJAA 1H3PL 1NBCA 5I0DA 2H32B 4XO3A 4BELD 4QT5A 5DR5H 2GTZB 8FABB 1ASOA 2DQDH 2EO9A 2XWBB 1F3JA 2N7SA 3MNMA 4JFFB 4GAYA 2A5UA 2WM0A 1C08A 3QXUA 4M93C 3G5WA 2XIDA 2XI9A 5DUJA 1E8ZA 1LO2L 2CHWA 2O1AA 5SV4A 2CDGA 4POZC 4HHGA 1ZAGA 4X6CA 3QRBA 2QGBA 1QFUL 5IEHA 3L3OC 1GGBL 2EDOA 4P9ML 5HGHA 4Y8DC 2LAAA 1W6LA 2J72A 3B3IB 4H1LH 4OD2B 3CHXA 1BBJB 1TTCA 3OG4B 4R83A 3RB7A 3ROOA 3UTSE 2FRGP 3KLAB 4G59C 5E8OA 2GVYA 5SX5K 7FABH 5I2IB 3SDDA 1OAQL 3NPZB 2FJSA 2IIJA 5D1XD 4JGNA 2EUVA 5SWZA 5GJTH 3MSPA 1RPQA 1NCJA 4GMSH 4L05A 3O6MH 1U8MA 1YQVH 3SO5A 3K6SA 3G6DH 5D1QE 4I3SL 2AXGB 1RH8A 2VLJA 2AEPH 3EG9B 5IV2B 2VLRD 4OKVB 4JKLA 4BIKA 1CN4A 3UTSA 1C5CH 1U8HA 3LZOA 1OARL 1RKRA 1OKEA 2PXYD 1YEJH 1IRAY 1H9DA 2XWDA 4GY4A 3S8FB 2VXVH 3I85A 3KDMB 4JE4B 5DZLA 4LMQE 3MRRB 4LARL 5HHMB 2BIMA 1EGJH 3LNFA 3GJEA 2R69A 1B4TA 1VFAA 4JO2H 2ZYIA 1DLHA 5FCUL 3BH8B 4WI6A 3N85H 2VO5A 5C0JA 5I0VA 3CGTA 1KCVH 1CXEA 4JHWL 3UC0L 4ZMLA 4X42A 4HKXB 5FFGA 5KUMA 4QLWA 3PWJB 1HNYA 1NGZB 1FFOA 2E8YA 3ECBA 2F18A 3L5XH 2WANA 1QASA 1ICTA 3CXFA 1TENA 3IFPA 4HUMB 4MBOA 1JL8A 1DJYA 4FXTA 4N1HB 2VAAB 1TJIL 4ABUA 3OKEA 5JPMB 1I9RH 2I7OA 3S48A 4EIGB 1AMYA 2DBJA 2WQSA 3HZ3A 3QIBB 4YBQC 5EG6C 2OYPA 5F70A 5HI3C 5IROD 3T04D 4LPXA 2ETWA 3CK0L 3I6GA 1FHNA 3EH2A 4N28A 3Q1EA 5H37A 3QDGA 3TBWB 4HS8H 1II4E 4UQCA 4XNZC 1OAUH 1PX3A 3RX7A 5CO1A 1BZ7B 3TVMB 5I76B 1HU8A 4Y4HD 2JXMB 1YN6B 4IBTA 3BW9A 2UYLB 1XL4A 4MYWB 1FNFA 1KZQA 1ZOXA 4OLEA 3KLQA 3LH2H 4Y4FD 2NXZD 3O4OC 1I8LA 1G7QB 3LMJL 3JZ7A 1AYRA 1NCOA 1HCVA 4I2XE 3V5KA 4D94A 5KEZA 3HUJE 5HYSB 1BG9A 2AQRA 4N2AA 1IFGA 3IWUA 3ABGA 1DZ0A 1F8TH 5AW2B 3FS9A 4F5CE 3QUXD 4D0DB 4J3TA 2A1WH 3MKKA 4JNXA 3VH8A 3V7AG 1K8DA 5AUMA 3MV8B 3RRQA 3UTOA 4ATTA 1F2XK 1QLFA 3F84A 2EZ0C 3MUJA 3HRZB 1J8RA 2YRZA 5LGJB 2EUXA 1LE5B 3HHMA 1ZGLP 4YZFF 5TE7H 3BP6B 1NGPH 3FYEB 1EJOL 1W6WA 5DFVD 1KT2B 3BQUA 4MA7H 4OF3A 1L9OA 1IEAB 2VLLB 4WO4B 5DI8B 3BLKA 3OLIA 1ZLVK 1IGIH 4A2GA 2JK5A 4QOKE 3MLUH 3SGDH 1UQSA 1KY6A 5FM4A 3WJLC 4IBYA 4IDLA 4FXGC 3TO4D 3S34H 4W81A 3TTYA 3HZYB 2BXYA 1D5ZA 1MEXL 2X38A 3UYPB 2WNKA 3VX0A 1EEZA 4FNLH 2NY3B 4LHUB 4MJIB 1WAAF 3MA7B 1KSRA 1RUKL 5DRNA 5T3XE 2NR6C 3MRCB 1MF2H 3ZDZE 1TT6A 4PLKD 4I77H 5C0GA 1IC7L 2H41A 1UOVA 4XGZB 4K7PH 1XR8B 1JTOA 4B3VA 4PGBB 4HKZB 1EHLL 5KVGE 1FZJA 3ZKMD 2BVUA 5GZND 3G9VA 1FGVL 4ODHL 3BGFB 1QBMH 1WIOA 4LP5A 5ICZB 1O7DC 2V33A 1IAOB 2MQCA 5JNYA 4HGKC 2AF2A 2QR0A 5F96L 5L9DH 2FX8L 3HHRB 3T9WA 1P2CA 2YPLA 4LLVB 4U1LA 2EYSA 1CFQB 4RISL 1T2QL 2KERA 3OKLA 4Y9FA 2F58L 5G55A 1ETZA 5SWSB 4TULL 2GT9B 3Q6GH 2VJ0A 3RDJA 3QCTH 2OZ4H 3O4LB 4WIQA 1I8UA 2CO4A 2OMWA 2P52A 4RMWA 1G9NH 1UJ3B 4GP8B 3D4YA 2H45A 5J5EA 4F24A 2B0SH 1AGCB 3PWPD 5FUZL 2XG5A 3OZKA 3NT0A 4KJQD 3TO2B 2O61A 4LSUH 5JW5A 1J0HA 1MRDL 5ESQA 1HWGB 3ROLA 3GSNL 3HKZA 4NO3A 1MCFA 3PABA 5F8QC 3SO3C 3KLHC 1ZV9A 3PL6D 1KFAL 5F9WB 3ZDWA 4GW5B 1PFCA 3EJSA 1ITCA 4OGYH 2YPKA 5JOPE 5BOPA 3IFOB 2BCKA 4U1IB 4TVSa 2ZNWA 4Z7VB 4KXDA 3MA9L 3MGOA 3Q3GB 5B8CB 5I1EH 2HTLC 2C9RA 4QYOA 3MACH 1U3JA 2HFGL 4Z5RB 2ZX5A 5LO7A 2QQNL 4ZRGA 4UM9B 1HL9A 1U92B 2ESVB 2HWZH 3HE6D 3N43F 3HFFA 1HOCB 2EXSA 4YJZL 1S9KC 1CQYA 4G72B 5F6IC 1FVDA 5FW6A 4DGYL 4L1DA 2X2UA 1IL1A 1CF1A 7TAAA 4AM0A 4FFVD 32C2A 3VXSA 2FJFB 4AMKH 5D70L