1PLCA

Accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accuracy and precision in protein structure analysis: restrained least-squares refinement of the structure of poplar plastocyanin at 1.33 A resolution.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1992-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plcA00
3SBRA 1OE2A 2FQFA 1ILUA 2OJ1A 4A2EA 3FU9A 5I5JA 3BVDB 7PCYA 4YSTA 2GI0A 3NJHA 3QQXA 2Y1AA 4HALA 1TEGA 2VN3A 2BWIA 1NDTA 2I85A 3OMIB 1HFUA 2WO3B 2WO2B 3D12B 2XWZA 2IH9A 3H56A 3T6VA 4FA7B 9PCYA 1BQKA 1JZEA 2OV0A 4DPBX 1PF3A 4UAHA 3SQRA 3QJSB 1WS8A 1OF0A 1WS7A 1RZQA 3NJIA 4YSCA 2YAFA 2FJSA 1KGYE 1ZIAA 3FPYA 2ZONA 4KNTA 4BK5C 3QJUB 2P80A 2HXAA 2HRGA 4HHWA 3N55A 4E9QA 1BQ5A 2DYRB 2XLLA 3PAVA 5B1KA 3RYMA 3HB3B 2IDSA 4F2FA 4DP1X 1A65A 2J55A 5B1JC 5B7FA 2PLTA 1ZPUA 2JXMA 5F7AA 1NIAA 2R7EB 2I7SA 4HCGA 4KO9A 2FQGA 3NJNA 4BDVB 1M56B 3FT0A 4N4YB 4N8UA 4W9ZA 2VW6A 3EH3B 1AANA 1L9PA 1URIA 2YARA 1OCZB 2R7EA 1OOWA 1MG3C 1BAWA 5B3SB 2WSDA 1IKOP 3CVDA 4W1TA 2UX7A 1AIZA 5B1AB 2XYBA 3ASOB 1V55B 1QLEB 5I26A 2IDTA 5TK4A 3NSYA 1E5YA 1TU2A 5AZUA 1W6LA 1SJMA 4G71B 3ASNB 2DWSA 4GP8B 5I6NA 5AKRA 2X87A 4JHVA 4G7QB 4A2GA 3IEAA 2H47C 4YSUA 1QHQA 4G7SB 3JTBA 3N2JA 2FQDA 1KDJA 3CDZB 3FPXA 2YXWA 3ERXA 1JZIA 1IUZA 2DYSB 1SFHA 3FYIB 4M3HA 4PCYA 1A4CA 2HLEB 2J57A 3KW7A 2GHZA 3EH5B 1XB8A 3OQRA 3ZIYA 3AW5A 3FSZA 3QJTB 2MTAA 2UXFA 1CUOA 2J56A 1BXAA 1L9RA 3GXUB 1X9RA 4P5RA 2YAQA 2W8CA 4UF7C 3NJKA 1GYCA 4Q8BA 2IWEA 3NP3A 2VM3A 3FYEB 3T71A 1GR7A 4A68A 1JXFA 2CCWA 3IN0A 1NPJA 4KNSA 2XV2A 4GP5B 1ASQA 3AG2B 1SHWA 3L45A 1AS8A 4E9RA 1XMEB 5PAZA 2HX7A 2VSMB 3TBBA 3H4FA 3MX0B 1DZ0A 3NJGA 3UGEA 2HX9A 2CAKA 1PZAA 1XB6A 3MBWB 3OMNB 5I5MA 2VW7A 1WA0X 3S8GB 1J9RA 2VM4A 4NB7A 2XVBA 2QDVA 2ZOOA 4A2HA 1M9WA 1E5ZA 1SFDA 2FTAA 1KBVA 2BP0A 4EF3A 1OE1A 1A3ZA 4BDVA 3NYKA 1ZIBA 1PNCA 4DP6X 2AZUA 4KO5A 6PAZA 2YXVA 3QJRB 3S3CB 3NJJA 4DP5X 1MZZA 5B1JA 1SDDB 1AZCA 2IDUA 2BP0B 3QPKA 4CSZA 2N0MA 1JVOA 2OCCB 2AFNA 3S3BB 1AS7A 1RKRA 2EIKB 2B08A 4YSOA 3BQVA 4HAKA 3S3DB 3UAEA 3UAAA 3AG3B 3V9EA 2IDQA 1BXVA 2W88A 1KCBA 2FQEA 4YSDA 1JERA 2DWTA 1NINA 2MRYA 3ABKB 3TU6A 3PXLA 4BWWA 1AR1B 4F7KA 2XXFA 3FU8A 4MFHA 2GB2A 2GBAA 1NWOA 1ADWA 2AVFA 1X9UA 2B3IA 1GS6X 1AZBA 2VSKB 4YSPA 2BZCA 3OMAB 4YSRA 2VW4A 3WKPA 1IC0A 3WNJA 2X88A 1JZFA 1OCCB 3OM3B 5B7EA 3JT2A 1YLBB 1FA4A 2UXGA 4G70B 1TEFA 4A66A 4YSQA 3QJVB 2VMJA 2JKWA 2EILB 2UXTA 2RACA 2FT6A 3T6XA 5LDUA 4A2DA 2LLNA 1WA1X 2YAEA 3NT0A 1NIFA 2Q5BA 2CUAA 3CVCA 3EF4A 4E9TA 7PAZA 4NAJA 1FWXA 1TKWA 1OCRB 2ZXWB 4HIPA 2CBPA 2BHFA 3ZDWA 4E9WA 3CVBA 3AG4B 3GDCA 1M57B 2XU9A 2QPEB 2EIMB 2PPFA 3NP4A 1E30A 2XV3A 1ET8A 1JXDA 3TA4D 1EHKB 2XX1A 3AZUA 4BXVA 1E65A 1W8EA 1EZLA 5TK2A 1J9SA 2H3XC 1ASPA 1F56A 4DPCX 2JFCA 3H4HA 4HCIA 3X1BA 4A2FA 4KNUA 4Q89A 4DP0X 1ZDQA 1IBZA 5D4IA 3GYRA 3EHBB 3ZX1A 4AZUA 1L9OA 3WIAA 4DP4X 5I6MA 4GP4B 4E9VA 1JVLA 1KV7A 1L9TA 1QNIA 1SDDA 5I6OA 2FT8A 3HEIB 4GXFA 5I6PA 1W6WA 4GY4A 3NSCA 1J5DA 1HAWA 2FWLB 1CYXA 2PPAA 4KO7A 1R1CA 1GS7A 3OD3A 1E67A 2PP9A 4L0PB 3PLYA 2AZAA 1NZRA 1PLBA 2BW5A 3FS9A 1DYZA 3SBPA 3X1FA 1AAJA 1FFTB 1GW0A 2XX0A 4ZK8A 1BXUA 1NTDA 3G5WA 1GY1A 5A7EA 3NJMA 2HX8A 4YVNA 2NRDA 1B3IA 1PCSA 3TASA 5I28A 1AOZA 1JZJA 3DTUB 4F2EA 2YAPA 2P80D 1CYWA 2PCYA 3U25A 4A67A 4P5SA 1KBWA 2YAMA 5PCYA 1ZV2A 3T6ZA 2FNWA 4DP9X 1PMYA 1V54B 1ILSA 4DP7X 1ET5A 1OV8A 1MG2C 3FQ2A 3IE9A 1N70A 2PP7A 2GC7C 3S8FB 1T5KA 4KO6A 1OE3A 4CSPA 2DV6A 2TSBA 2GSMB 1BYOA 5ANHA 1AZNA 3CDZA 1JZGA 4WKXA 4K9JA 1AG6A 2PPCA 4DP8X 1N68A 3WNIA 2FT7A 4E9XA 5I6LA 3FSAA 2BP8B 1SF3A 2Y69B 2I7OA 2E86A 2PCFA 3WI9A 3PAZA 5EHFA 4YSAA 2TSAA 2QT6A 2AANA 3FQ1A 3ZBMA 3FU7A 4BWTA 5FC9A 1AS6A 1RCYA 2BP8A 1ET7A 2QDWA 3DIVA 3ABMB 2XV0A 1HAUA 4JHUA 5D4JA 1J5CA 4BWUA 1NIEA 1AZUA 4KOCA 5E9NA 4G72B 1MZYA 4QKTA 4AKPA 1NPNA 3UABA 3X1EA 2H5UA 2YQBA 2YAOA 3ABGA 4M4RB 1KYAA 1PLCA 2IDFA 3FSVA 3PPSA 3WKQA 1JOIA 6PCYA 5I5IA 1PZCA 3ABLB 2DY2A 4X4KA 3UACA 4RH4A 4WTQA 1AQ8A 5I6KA 3NSFA 4DP2X 3PAUA 1BYPA 1GS8A 1A4BA 1AACA 1ETJA 1JZHA 2EINB 1OCOB 3NJLA 1L9QA 2XXGA 3AY2A 3X1NA 1J9TA 1SHXA 5B7MA 4E9SA 1L9SA 1CC3A 4G7RB 2ZWNA 2IWFA 2IWKA 3CG8A 2EIJB 1PY0A 3TBCA 4DPAX 1NICA 3IBOA 2YAHA 4ENZA 1SNRA 3QJQB 1BQRA 1J9QA 2UX6A 1PNDA 1ZDSA 4YVUA 3SBQA 4E9YA 4YSEA 3T9WA 1WAEA 4AX3A 5AFAA 2QPDB 2CALA 2BWDA 3C75A 2GIMA 1SF5A 1UATA 1A4AA 2UXVA 4JKNA 2BW4A 1ASOA 3NJFA 3PCYA 2HRHA 4YL4A 4TXVB 2IAAC 3X1GA 3CZUB 1GSKA 1I53A 5IY5B 2J5WA 3EH4B 3FSWA 4YSSA 1PAZA 1AZRA 1NIBA 1RZPA 1AG0A 1JXGA 1VLXA 3FQYA 3T6WA 4HZ1A 1KDIA 1KCWA 4PAZA 8PAZA 1PLAA 1GY2A 3KW8A 2HZHA 4GYBA 4KOBA 4QLWA 2CJ3A 2GC4C 3UADA 2XUWA 1BEXA 4AKOA 5F7BA 3NSDA 3WG7B 2Q9OA 4AI7A 1A8ZA 2BO0A 3DKHA 2PPDA 3IN2A 3X2QB 4FAAB 4HHGA 1XB3A 4NERA 1IBYA 1MDAA 4AKQA 2PP8A 4HCFA 3AG1B 5D4HA 2A3TA 3V9CA 1V10A 1CURA 4UANA 1NWPA 5B1BB 1ID2A 1PZBA 1WA2X 2PPEA 4BXSV 2IH8A 2BZ7A 1NIDA 3FU7B
chains in the Genus database with same CATH superfamily
3KPSE 2R0ZL 3OG4B 4H7VA 3L6FB 2EECA 3QP3A 4PD4J 4QXVA 2XWTA 3LNFA 3PJSB 1NDTA 3T2PA 3D09A 1NANI 4CC0A 5DJAA 4C56E 2E76C 5E4EC 1MCFA 1H6UA 2H1PL 2WV3A 3D12B 3BUQA 3UG3A 5C6PB 5CM1A 3QAZC 5EEYA 4Z77B 3UPCA 1HQ4A 1GTFA 4J7RA 2JWYA 1SXCA 4XVUD 2H7WA 3LQAL 5DJAB 5EORH 4NM4L 4OKVA 4NN7B 4UTCA 3BVTA 1YQVH 5IQOA 3BKYH 4KJWD 4NOFA 1D2OA 4GUQA 3OAZH 3WKML 5FYLH 3D05A 1J5IA 5FFOA 2DQIH 1BF5A 3Q7JA 2W9EH 5ESVB 3K4AA 2VNCA 1DQMH 2VXVL 3F7VA 5C0GA 4P2AA 4TQ8A 3ZT6A 3VXMA 3QORA 4LLAA 1S9YB 4LIQH 1YYMH 1QSFD 4QHPA 1QFUH 2YXMA 3PP4H 2AABL 1I1FB 3OLEA 4UNUA 4ZTOH 5ABZA 3U0WH 3DPBA 3UGXA 2HFFA 1K8IA 2PLTA 4HYTB 1M1SA 4IW4C 3LSOA 5DMYA 1HWHB 1Q0YH 1ACZA 3ZDYE 3PYCA 3IDMA 5BMFH 2RH0A 1DVFC 3SDDD 5L88L 2OFQA 2R0LH 2BCMA 4MJID 4IJTA 1MEXH 1RUAH 2CU9A 5BJTB 3R7QA 5JMOC 4KVNH 5BRZE 1MWOA 4K94H 2CO6B 3B4NA 4UQ3A 3POHA 1MY7A 3ULUH 4C4KO 4WFEE 2CUHA 1RMFL 2WZ6A 4OCXH 4R4BA 4QKXB 5B38G 1SBBA 4Y2DB 4JCWA 2VQTA 4O51A 1FNAA 1N6VA 3NSXA 5SX5H 4DEPB 1WZAA 2ZPKH 4TNFA 2EDJA 4G71B 3O45A 2DEXX 2X87A 1FNEB 4I18A 1K5NB 2NNAB 3AQXA 1OSPH 3IVKA 5SWSD 3X3GL 1WCBA 2FIKB 1H3TA 4HC1L 4P23B 3W56A 1B4RA 1ZJAA 4OSUL 2JJTA 5ENWB 4A2LA 4NO0B 3O45B 4OF6A 4X6DF 1REIA 1MF2H 3FO1A 3K2MC 4I18B 3MA9L 3N9GH 4MQXD 3SDDC 2NNAA 3N43F 3ILQC 3JWNE 4OCRL 5FUCE 4TKWA 4L1BA 2ZQKA 5IVXF 3TT1H 3VGEA 3BPNC 3T3MB 3V4PB 3BAKA 5HHOA 4L8SA 4Q9QL 3MRDB 4LBAA 2HG5B 3FQUA 1NLDL 3NCYS 1KFAH 3K6SB 4KFZC 4L3ED 3WO4B 5C07B 3GMQB 4PRIB 3QULB 4NPYB 4PJFB 4UF7C 4HG4J 3NIDF 4IBZA 1K2DA 4K8RD 5AW0B 1WBYA 3EFDL 4Q7DA 5JHMA 3MLPA 1BPVA 2DOCA 4L8SB 4OLEA 4F57H 3CK0H 2Z93B 1EHLL 2BNUB 3FUJA 2YUZA 2CKBB 1P4IL 4BSVB 2HWZL 2JKLA 1NC2B 1EJOL 1P2CB 1ZVYA 1K2DB 1OAXL 3QUGA 3ZUCA 4U0QB 2JCCA 2WXLA 3BXNA 1R34A 2RQEA 3LEYL 3VRLF 1JZ8A 5DHXB 2P1YA 3WDJA 3P30L 5I18L 3S8GB 3CVHB 2XVBA 2YJLA 3HRPA 4NOBA 4U3SA 1RI8A 5F6IB 5D5MB 3BPOB 4GAAA 1KCSH 1AGDB 1A7RL 2BSCA 4JN1H 4EVNB 4IK6A 2YGVA 4HUXA 4LU5L 2OMZA 2Q8AH 3LKOA 4W4OC 5L2JB 3MQIA 1RL1A 2QKIC 5GGRY 4JUSA 4OU3A 3KYMA 4KO5A 5IVXA 3PIQA 3RDTC 1MFDH 1FO0A 1NBYA 4PB9L 3RHWK 2H3NA 1W80A 1AIFA 3S37X 1IFGA 1C08A 5EO1B 4L5FL 5AVVB 3ZJAA 2VMCA 3BQVA 4HAKA 1J0KA 1GJUA 3MRNB 1KC5H 2OM5A 4KKBC 4QNPF 5CD5C 2X4SA 1AGFB 3VFOB 1ZLSL 2YD2A 1TFHA 1ZEAH 4HT1H 4JVPA 1EUUA 1KN4L 3FBQA 5JPNC 1NDGA 4S2SB 3KWTA 4RWYH 1H6EA 2KHAA 3MRNA 4HLEA 4JGNA 3QNZA 2X4SB 3O3UN 1CLCA 4XX1G 4EQ3A 2YA2A 1R75A 1R47A 5IWLA 3EJZD 5D7KE 3CC5B 4IOSD 1FIGL 2GBAA 4MZIA 3DBSA 5E6IA 2CKNA 1D6EA 4XVJL 1QEWA 2AVFA 5TGBB 2W0KA 4NKMA 4PI2A 1G6RH 1J8HA 4I3SL 3AWFA 2NY4B 2K4AA 4FJ6A 1BD2B 5DZOA 4Q4IA 3KLSA 1JGVL 3LDBC 3H42L 5JDSB 1AJ7L 4ZFOB 2CKBL 3MZGB 1RURH 3VA6A 3CLEH 1R17A 1U3YA 4AIOA 2B4CH 5K9KB 2V5YA 2ITCB 4X6BA 5GGSB 4F7CB 3IGLA 1YPZF 2UY6B 1EGJH 3C9NB 4OLXH 3A4AA 2KPNA 1QQDA 5IF0A 1F4AA 4HXAH 4KROD 5B22A 3BAJA 3AMLA 4J23A 4PP1D 1IL1B 4Y2NA 4E5XA 1ZK9A 2R56H 3CVBA 4UQEA 3P9LB 4IBLT 4EJ1C 2KLSA 1QSZA 2L7QA 2FECL 3VXSB 5IGXH 3PWLB 5KSBF 1ET8A 1MWAA 1J5HA 4ONHA 2E74C 2G2NA 2FH6A 2LV4A 3EW3B 2RD0A 1OAUH 3HAEG 4LL4A 4XE5B 5DGRA 3SDXB 3V4VA 2AJXL 1XQ4A 4FE9A 5E1QA 3BD4A 2COQA 4A2FA 1FFNB 2CZNA 1GC1H 2Z6FA 3NESA 3S5LA 2AJVL 4OIIH 3T0XA 4TUOB 3KYAA 2A7BA 2JB5L 1HILB 1Q90A 3A24A 3FB6B 4TNEA 4A39A 4ZUSB 1JVLA 2EH8H 2XI9A 3FT4B 3L4ZA 4N0RA 4PSRA 1H8LA 1OZTG 3HEIB 1KPUB 4M56A 4Y4HD 3TH2T 3V7AE 1UCBL 3FF7A 2ALWA 1F2XK 1F4YL 2HTLD 5I1CL 3RY6C 3TBVB 1L5GA 4X9BA 5EU5A 1EZVX 4CSTA 4Y4FC 1ZE3H 1F58H 1FDLH 4GQQA 3ZPDA 1L3NA 4ZK8A 3GNMH 3GI9H 4L4VD 5CN1A 1FGVH 5C0AE 2DI7A 3P4OA 1THAA 3UBHA 1OHQA 4FI6A 1CLOL 3TBVA 5JW4N 1FUNA 3OPUA 2NY1B 2EIDA 2PCYA 4DK6A 1DVFD 3V52H 1O9ZA 3D39A 4FQCH 4LSUH 2OJZH 1WC7A 2ZKYA 4HIXH 1QZ1A 5DC9B 4KRNA 4L8CA 3RGBA 3DTXA 1N70A 4MHHI 2B2XL 2G3ZA 1J8HE 4M7LH 2W9DL 1G94A 4YN3A 5AOJA 1CGXA 1TSHA 4HUVA 1NEZB 1OARH 5DJ2B 4P3DB 2QTVA 1KJ2L 3UO1H 4L9DA 4MJ5A 1HKLH 1T20A 1SXNA 4OQTA 2HT2D 3P3SA 4G42B 4PJ7E 3UBXG 3W39B 3PGDB 2UZXB 5I16B 4JJ5B 2ZAHA 4PG9B 3HE7D 4GEIA 1BVKB 1MCLA 5I66B 3FU6A 1SYSB 4ZSOE 3PAZA 2EC9U 1N0LB 4WJ5B 4XVUC 5F9WB 2Q87A 3WEBA 5DVNA 3FQ1A 1JGUL 2B14A 3MLZH 3BD3A 3PWUB 4G42A 1JWSB 4WO4D 3W39A 1CI5A 3KEHA 1G9HA 1S78C 4BD4A 3MJ9A 1BOYA 1TJIL 2WD0A 2YGOA 2VYRE 4Z7OB 5KWYC 4FG0A 1JZ2A 1TQTA 3DIVA 2FE0A 4FNLH 1PW3A 2R1XA 1NAKL 3QQ3A 4TMPA 3GKZA 3RVXD 1HHGA 4U6HB 4AKPA 3TBSA 1WZ1H 3EYUH 1P5VA 3ABGA 2HFEB 2PTUA 3NFPA 3BRGC 1UXSA 1ZS8A 1N4XL 1FIGH 4N5EC 4U1NA 3F85A 1DBKL 1U93A 2N7AA 1XBRA 3VXSD 5HHQB 5GZOD 1HHGB 2VLME 4U6HA 5BVPL 1BDYA 1A2YB 1KBGL 2A0LC 2IIJA 3PP3K 4N8VB 2QGBA 3H9HA 1I1AD 4HWZA 4ZMQA 5F1IB 2D73A 2F53B 4GO9A 5FK9B 4CMHB 1KTCA 1P4IH 4XN8A 4Z6AT 4N90D 2EIZB 5J13B 5FYLL 1JYXA 2ENPA 2XICA 3NZUA 2WYHA 3L4VA 5D2NB 4N90E 3UTTD 3UYRL 3WIFB 3DBXB 1I9JL 1JF6A 1UJTA 3OKEA 4DUXA 4R9HA 3ZZLA 2EIJB 3M17B 3O4LB 1IGML 5E03A 4WEBL 5LB1A 3S7GA 4N3UA 4C4BA 1GOFA 4PW4A 2RFXB 4LPUA 4LCIL 2DQEH 2FGWL 3DBXA 5DEJA 4GAJH 4E9YA 1LEIA 5C0GB 3WYRA 4NGHL 4HG4K 3JUZA 4EBQH 3HC4H 3ATBA 1YMMD 2HUHA 4Z76A 5E8PB 2FDBP 4OF7A 1A3RH 4WENB 1BBJA 2EVJA 1S4IA 1WT5C 2VDPL 4JKNA 1IGYA 5T3ZH 1AGBA 4HJ1A 4JS7A 4QRSB 4ADGA 4BEIA 4HBCL 5IY5B 2B59A 1YSOA 4BCYA 5CWSA 3UEQA 5E5MA 2EEFA 1XH0A 3ARBC 4HZ1A 3Q3GA 5DJ0A 2IBZY 1AZZC 3DO3A 5MI0B 4NC1E 5DFWH 8PAZA 1FYTE 1Y6MR 6FABL 5F9OL 2UUDH 5HDQH 3ESNA 1H8NA 1N5AB 4LL1A 4C57C 3PXJA 35C8L 3NSDA 4JDEA 4LK4A 1QPKA 3CH1A 3IAGC 4QJ4B 4BZYA 4QRUA 1YO4A 2JB6A 2Q3AA 2RMNA 1JF1A 4P4RB 4U1MA 4H8WH 3TVMA 1ROWA 3P0YH 4P2RE 3WFBL 1MFAH 4E2OA 3IU4L 5D55A 2QSCH 3CZEA 1D5ZA 2OMWB 5D7LB 4LPWA 1ACCA 2P5EB 1J05A 4K55A 3GTTA 2EC9T 1MFBL 4HJ0D 1ETZB 2IH8A 3H3PL 4TNVF 2C9UA 1B0IA 1QPPA 2EADA 2ED6A 1CU4H 3GS7A 1AXIB 4Y4FD 4BZ2A 3JV6A 2YC1A 2QPFA 2O5YH 1C5BL 3ARBD 3L3JB 3VD5A 2P5EA 4MXQD 4CAGA 1KEGL 4PJHE 2I9LA 4DOHB 1HVXA 2QSVA 5DFAA 5GHWL 5DD1L 2BWIA 4PYGA 4Y4HC 5LNDA 1TT6A 5JPMA 1PD0A 5H94B 5TDOB 2C9AA 5C07A 4NQEB 5FYJE 1EHXA 3H56A 2FAUA 3EO1A 9PCYA 4ZQKA 4KHXH 2BS8A 2NW3A 1I7RA 2CBTA 4QRPE 1HL9A 5EC2A 3F84A 4FXGB 1WS7A 4B9FA 4NN6B 1MREH 5EZIH 5I73C 4YS4A 2ATKB 2MPAL 4WDIA 1X6LA 3IT8D 5FWRA 1Z5HA 1D5IL 4PWGA 3F7KA 1E9PA 2KKQA 4TPRL 5TE6H 1TG8A 4NZUL 5KSBE 4OJCA 3T0DA 5D1XB 4DTGL 1GC1L 2ATKA 2DQFB 4U3SB 5E8NB 4QRQA 5EOTB 3IDYB 1CXEA 1BECA 3S37L 2WQXA 1HH9B 4YDKL 4IQHA 1E9PB 2FLBT 1NBZB 1N8ZA 3IDNB 1EO5A 3GPSA 3HI6H 2VR4A 2I7SA 4ODWB 3BSZA 3IF1B 4MTMA 1Z5YD 4N4YB 3NIFB 3WFEH 3ZY7A 5L0QC 3O6FC 4XPHL 3PIQB 4Y5YB 4B0MM 4DUVA 1AANA 2O6FA 2ROXA 4Y19B 1RFDL 3FTXA 4DQOL 4WW1A 4XO8A 3ATFA 4Q6IC 2H3NB 3IDXH 1UFGA 3US9A 2OP4L 2OMTB 1XEUA 1HHIA 2P8LB 4LU5H 3KAAA 2F1AA 4QHNA 1QASA 32C2B 2ATPB 3K6IA 3G6AA 4ERSL 1OLLA 4ZUUA 3PQYA 3WTXA 1I9IH 3KPPB 1M05B 3QIBD 5ICXB 5IESL 2X4PA 3LHPL 3QNXB 2OSWA 4X5WB 4UTAA 3AY4C 2FO8A 4PG2C 2QKSA 1AHWC 1VIWA 2EDYA 1F6FB 2VJ0A 5HDBB 1SOQA 1UWXH 4FHJA 4F33B 3D39D 4GFTB 4LSRL 4PJEE 4L1LA 3LZQA 1TNNA 3KGTA 5IJVA 4U49A 1TTAA 1LILA 2B4CL 3CXHK 3MV7D 1I7TA 3VVVA 3M07A 1BMGA 2VLLB 4OTXH 1KLGA 4WIQA 4UMGA 5BZDB 3RZCB 3NQIA 1DSFL 2CR3A 3RWIA 5IFHH 3LKNA 4ZXBB 1XB8A 3FTYA 3CBRA 3GLZA 4PWIA 3NPSC 4IKNA 3NSJA 2CRMA 2ITCA 4MDIA 1PSKH 2VC2B 2W8CA 5FHAH 3I6SA 4Y89A 2DQGL 2B1AL 2F54D 1E7VA 2DMKA 5CJ5A 3CXFA 2D0FA 1NPJA 3MSPA 1Q9OA 2WQ8A 1BEYH 4OD1L 4HJGA 2DH2A 4MMXA 5FEBA 2XN0A 3ARXA 2W07B 3F05A 1BBDH 5HDRA 4FNQA 2QHRH 4F27A 3B2UD 2LU4A 1P5UB 4P2RB 2ORBL 2BX5A 4M4RA 3NGBC 2DI8A 1Q9OB 4CRPA 4LIQE 4NRYB 3PWLA 2VM4A 5ITBL 1IE5A 4RFEA 3OJVC 4EAEA 4CNIA 5IMMA 2HJLA 3BGFB 4S0HA 4IBWA 5IHLB 3V4VB 1E5ZA 4OZIA 2EVIA 3CHPA 3TL5A 2NDGA 2JF1A 1FFNA 3V0JA 3ECWA 4NRYA 2ZOLA 4AT6B 3ULAB 4JFYB 2HRLA 5T8IA 1AQDA 2QJDA 3OWEA 4LARH 3VXUE 4ZUSA 2O5YL 6PAZA 1GOHA 4I5BA 4KK6D 3TJHD 3VB8A 3RKPA 4WWKA 5LBGA 1JGUH 2ZOLB 3RIKA 4AT6A 5IMKA 4B9CA 2F18A 3C6LA 3MXWL 5CINL 1XZ0A 5I76B 3ZXAC 5DLML 3ZDXE 2IDQA 3DA0A 4TNWK 2JB5H 4IEFB 3ILPA 1S3KL 3OGCA 1IGCH 3Q9QA 1NOLA 3EYUL 3PY9A 4ICWA 4OJFL 4DHLA 1KCLA 2VDMH 2L0DA 5KS9F 1BVLB 1OF2B 3TEYA 3TBYB 2BSRA 2OCFD 3LCYA 1ZT7A 2FATL 3LS5L 2DTSA 2XKNB 4BFJA 5KN5B 1E40A 5KVFL 5F93C 4CU8A 3DUUB 5HY9A 4DGIL 2B39A 5CJXA 2WTPA 3IJEA 4FNPA 1DFBL 4PTTB 4G9DA 3OMAB 1T0NA 3WKPA 4PRBB 5CNHA 1CLOH 4J3OH 4N2FA 3CFUA 1RZKL 3OM3B 1NMBL 4OM0L 2VISA 2G4GA 1FH5L 2Y23A 5AAPA 3W57A 5E08L 3KPOA 1JFQH 1XF5A 3PGDA 3FQ4A 4N20A 1QHOA 2ERJB 1XF2A 5C2BL 4JFHD 1SYSA 3FKUS 2A99A 2OL3A 5JO5B 5LDUA 3RZCD 1OLZA 1ZGLP 4FNLL 1OKEA 1CXHA 4M7LL 3A0OA 1ZHLB 4DAGH 2CUAA 3DX7A 5MENB 2HKHL 1G1CA 4TTDD 1UQSA 3NA9L 1P7QB 4FN0A 1OCRB 1JXKA 2BHFA 3O9WC 4E9WA 1RHHA 2F54B 3I3BA 1MFBH 5I8KL 2DI9A 3LPWA 2V2WA 2QQLL 2NY2B 2Q0ZX 1R3HB 2QFPA 1N19A 4PBVC 1UXLA 2J7LA 1BVZA 3DC0A 1WWBX 5AVZB 4HKXA 2XWTB 5F21B 4UNVA 1Y18B 1WCQA 2R1WB 3IMRA 3P2BA 1A64A 3GYRA 5JUEL 2J44A 1E3FA 2XBTA 4PRPD 1L9OA 3V4PL 1L6ZA 4G9FE 5D1QE 2GPZA 1KV7A 5DZVA 4E9VA 1XGQB 2JIXD 1RPKA 2WZPD 2FT8A 3CN4A 4JFDA 4Q4EA 2WTRA 1QUNA 1RZ7H 3RNQB 1R1CA 2J1YA 5KVDL 3EHBD 8FABA 3IS1X 4J3VA 1VA9A 3V6BR 4BINA 2MPVA 3DO7B 4N8CL 3VI3F 2XTJB 1SLWA 3ARFC 3ZE1B 2XX0A 3WIFA 1A6TB 5ESVA 3ZQWA 5HHMB 4BFRA 1E7UA 3WU1A 3QZLA 3OKEB 3GBNL 2F1EA 3BT2L 5KVEE 3O4LA 1B3IA 2ZYIA 3MV9A 1EA9C 1ECZA 1SDYA 2ICEA 4Z7NF 5I28A 3HS0A 3IGFA 5DRZA 1ZT1B 4F7MB 1A6TA 4MNHA 1IC7H 3BKML 1U8IB 3BMWA 1TYEB 2EXYC 2R4RH 1MFNA 3P9WB 3Q6FB 5DT1L 4DESA 1BCIA 2VL4A 3VXNB 5KSAA 4KZDL 4ODVH 3F2LA 1ZT1A 4F7MA 3V7MA 1F3DH 4KO6A 4I0PB 5ETUA 1AGBB 1IQWH 5EDXA 1JZGA 4PFEA 2HUEA 3IJSB 5CLXA 3X11B 5KSAB 2I9TB 4E9XA 2J8OA 3PWVB 3SGDH 2YS4A 4JRYA 4N8PA 2BP8B 5MERB 2I7OA 3UP1A 3BPCA 4EQ2A 4M6OH 2WWOA 4DNLA 3FQRA 3TGXA 3BJLA 4EZKA 4XNDA 2XDHA 4GW4A 4KZ0A 4LSPL 4GG6A 2BP8A 1EHNA 1RULH 1UH3A 4NLHA 3HRZA 5DD0L 3UC0H 4NO0A 2QDWA 4P4RA 4MA8L 1LDPL 4ILDA 1NIEA 1XCTB 5D1QD 1C5BH 4HX1A 1MFCL 3SD5A 1XGPB 2VZVA 5JZ7D 1NPNA 3MRDA 4N0YL 15C8L 2A9BA 4UB0H 4M5YH 1YQVL 4JL1A 3HFML 2Y5QA 5A2AA 3RX8A 2OZNA 4G8FA 5EIIA 5LJYH 2IDFA 2ZXBA 3GJEB 4FQIL 3JBG7 5GIRB 2X4UB 4FFTA 4WFFD 1MN4A 1HL8A 1WPCA 3ZTEA 1PZCA 3QPQC 3P0YL 4LLUA 4HPYL 5DEZA 3VA2C 2IAMC 3DI3B 4LIQL 1QO3A 5MEQA 2AMGA 1MRCL 3D4GA 3X13A 1QLEH 3VFRB 1QP1A 4NZJA 3GJFH 1TQBC 3GSXA 3K8KA 1XGUA 4WNSA 1LO0L 1OCOB 1JHTB 2HT3C 4M9PA 5B8CC 2E56A 4ODTH 5HHVL 3BXNB 3VFVB 2VE6B 2MQGA 3CCHB 2M1KA 3HBZA 5ELIA 2BNQB 2EABA 3H2QA 4NUGL 1L9SA 1JPST 5I1GH 1CC3A 3VFSB 5JIIA 1G7LA 2K3TA 3CVHA 5DQ9B 4KTGA 3RGVB 3B2DC 2HLAB 3QI9A 4ZMWA 2ZUYA 5B39B 4OGQC 1ZWIA 1SNRA 4IYKA 4XNZB 4XMWA 4ENZA 4WFFE 4HJEA 4PVMA 5HPMB 2A74C 5I1IL 3OJMB 5LN8A 2F68X 1DSFH 3D0VA 1CI3M 2KBGA 5B39A 5CFHA 5CD3B 4M6NL 1S7QB 2ESVB 1HKFA 2C3XA 1NBZA 5BV7C 2R0WH 2ZYHA 1J18A 3RFZB 3ZUNC 4G3YH 1SY6L 1WIPA 3LAFA 1AIFB 5EUOA 2QSTA 4Y4HA 1YN6A 3HW7A 2G60H 4C54A 1CL7I 1P84K 2D7OA 3EOBA 1H19A 2EXSA 1I4FA 4WWKD 5BVJB 4C8XA 4FTDA 3WY4A 3EG9B 4I0PD 1I9IL 5IESH 2Z7WA 1HWWA 4PWKA 4ZMNA 3P30H 3CZFB 3E6FB 3R4DA 5L4FA 2NY6B 2CGYA 1ZS2A 1ZE3C 4O02H 3NCMA 1IX2A 1I4FB 4LVOB 4AKOA 5F9AC 2OSXA 2UUDK 3BPNB 3MODL 3QEGL 5A43C 2ZWLT 2DQTL 1T1XA 3CZFA 5EUKA 4XPFL 4NKMB 3QZMA 4XBMA 4FEMA 1CE6B 4WVRA 1ORSA 3KLQA 3EH2A 3LIZL 1SJHA 2HPTA 2V4LA 3UIZA 1KTKE 2BVQB 1CURA 1OQOA 1MRFL 4R7NB 1D9KB 3FU7B 2LE9A 4GAFB 3EGXB 4NO5A 1PZ5B 2ZTBA 4LSDA 1FQ9C 4XCNA 5D1QB 3KLHC 3UXFA 3KPNA 1OD7A 2VLRD 5KYUB 1F90L 3E38A 1CE1H 3GWJA 4YX2L 1S7SA 3E8UH 4S0TD 3O0RH 4UT7L 5AD0B 2WO3B 2G75B 2G9HA 5GRZA 5E2UL 2VDKH 1BLIA 4NO5B 2N7SA 4OLYL 3NK3A 5BZDA 4XCNB 1JPTH 2Q6WB 1MCIA 1UOVA 1CXKA 1ZA6B 4ALAC 3BMVA 1ZXKA 3AM8A 4GSRA 2GYSA 3T2OA 4GAGH 3E1F1 5T3XH 2SEBB 5G5DB 1MY5A 4X6DB 3SBWC 4DGVL 1E6JH 2P5WA 5I1DA 2YAFA 2FJSA 4IGBC 3WIHL 3QGVA 1JV5A 3SGDI 4CVZB 5JLZB 1ZA6A 2WMPB 4XTRC 2LAGB 1LP9B 3O6FB 4PRPE 4HUUA 3HBQA 3TX4A 4UI2A 2BVEA 3TEWA 4OJYA 2P5WB 3I3DA 4XCCH 5I1DB 3PAVA 4NNPL 1HILA 3UTTE 5B1KA 4CNIB 5GXBB 1F0LA 5IJBC 2UY7B 4F7TA 3FT4A 5J5EA 3NIDB 3NK4A 1FHNA 1QUPA 4Y16C 2H2PD 2JI1A 3EYSL 1ZPUA 2I25N 4HOWA 3M6DA 1O5DT 5JLZA 3ZOAA 2ZUSA 4YBQD 4EEEA 3V4LA 2XRAH 4WI0B 3V10A 5JPNB 4R90H 2W0LA 4MQSB 2VW6A 1QRND 3EH3B 1INQB 5ID1B 1M7IB 3NVQA 2AXGB 1OCZB 1B4LA 5FUOL 1G6RL 3QUML 2J12B 5K9JL 4WI0A 4OZFG 1XIWD 3RDTB 5JPNA 3QQ4B 4JPKL 4RGOH 3SKOB 2GVYA 5ACZA 2F58L 3HE6D 1KCRH 2Y07H 3F7QA 3K8LA 5D2LE 2D2CC 3G04A 1YEKH 3HG1D 3QWQB 3ILPB 1FAIH 4LCUB 1TTCA 4Z23A 5HYSB 3ILDA 4NNXB 2VRKA 3MRLA 2APVA 3MV9D 4Z1PA 4EI5C 3ZIMA 5KW9L 3SPVB 1I85C 3IFOA 4OUUB 1ZT7B 1HYSC 1NL0L 2AW2A 5AW2B 3WEAA 3E8VA 5DJ2A 4P4KC 1OGSA 2XCMC 2FUQA 4N25A 3Q2VA 2KMWA 4FI8A 1XVSA 4EIBA 3U82B 1K6QH 2IAND 5IHUL 3LV3A 3DWTA 3PG2A 5D70L 3WD5H 1IC1A 3QO1A 4GAYB 2MTAA 2Y4SA 2VIRB 2V3DA 5SX5K 3KPOB 4FJYA 3ZTNL 4UQAA 3F12A 4OCSL 1IBGH 2QR0A 3PDDA 5CLTA 2Z31B 4ECNA 3RUGF 4AYGA 5LGYA 1RJLA 3MRBA 4RESB 4GRMA 4ODXB 3AVEA 1I3UA 5MENA 5CP3A 3O2DH 3VFPB 2OYLA 1VJSA 2X6VA 2EDTA 3EYQC 2FEDC 4JFTA 3EJTA 3MRBB 1Z5LA 3IDUA 5HHQA 3MV8A 4QYAA 1NFIB 1G7HB 4PHXA 4X8CA 4Z5RA 2EZ0C 5FYKE 4LPXA 1J10A 2VXQH 3QFJD 3VFTB 3WAKA 5IFJA 1T1WA 2EIZA 2ZF9A 4QXUH 2X4TA 3B3BA 4GO8A 3GI8L 3DX1A 4GEJA 3ZDXF 5GZND 4U7KA 2QZQA 1XTMA 1JVOA 2N0MA 3FB7A 4V33A 5HJ3B 2QADC 4QTHB 3CLFH 4HH9A 3B9EA 5I17A 4W9HC 3EJRA 4TULL 5CJQH 1DSYA 3B5GA 4J3WA 2WLLA 4QY8A 1U3ZA 1FYTD 4ABWA 1OTTC 4K94C 2EACA 1N7MH 2FQEA 4L4VA 4QTHA 4RGND 4X6CA 2ICEB 2YSTA 4Z76B 3RDTD 5DRZB 4N26A 2EDBA 1YEGL 5MHSD 5BJTA 3A4DA 2F19L 4XH2A 3TPKA 2QVMA 3O2VL 2D3VA 3VI4E 1XSKA 1GS6X 4X6EB 2Z31C 2XETA 4YSPA 1CXIA 4ZAKD 3CGTA 4R5TA 1GAFH 3NIFE 3F6LA 3VGAC 4JZOB 3C5JA 2NY5L 1EMTH 4ONFH 4A63A 1DVXA 1N5AA 5TF1L 4L1HA 4ZAKC 1DJWA 3PWVA 2XPGB 3C5ZA 1C16A 1E8ZA 1L6PA 5G4NA 2EH7L 4FRWA 5JNYB 3ROLA 1BJ1J 4UINL 4HEMA 4WU7A 5KYNA 4JFVA 4KXAA 3FO1B 1NCAH 4YE4H 3BZFB 2YMTA 3EF4A 4GW4B 4J27A 2F58H 4MBOA 2ADFH 1CF8L 5FWQA 4IIQC 1W15A 3IPEA 43CAA 1UCBH 3QVAA 4WI3A 3GIZH 3B9KA 3BAEH 1E9QA 1S5IH 3JV4A 1IIKA 3G5YB 3OB0K 3BZFA 4IMLA 1FE8L 5IBTL 5AWNH 4K9EL 3JV6B 3MRCB 2LAAA 4FQQA 3MLZL 1G9MH 1N3NB 3ILQD 5JW4Q 5TK2A 3NAAH 5CLZA 3BESR 2AJUL 3NCYP 3TURA 1I1AB 5JPMB 3QEQA 1CLYL 1I82A 5L0QB 5TDOA 1ZDQA 3ZYJA 2ZICA 5CILL 4Z7WF 2LFGA 3ME0A 1XR9A 5EC2B 4GKLA 3DYPA 1EFXB 1I1AA 5I6OA 2DJ4A 3E0GA 3NSCA 5EA0H 3D9AH 2F53E 3MROB 2PP9A 3P73A 1WBZA 3S4SA 3PLYA 2YRPA 1BOGA 4OCSH 1ZANH 3SDCC 3FTGA 3MV9E 4KJQC 1LLAA 3N85L 1QSED 4IRSD 4JQVA 4AJWA 5L2JA 1GY1A 2DQFA 3RGVA 5EZJB 1MQKL 4X0NA 2CBOA 3HG1E 1F5WA 5AW8B 4CN6A 4GINA 1JD9A 1NCHA 3A67H 3MRMA 5BXFB 5HI3C 1CFTB 4G43B 4JFOB 2Q10A 4KY2A 2ZXDA 2TRYA 1IRAY 1KBWA 4PGBB 5EO1A 4NRZA 1GGIL 1K3ZA 1FYTB 3WEOA 5CF3A 1TJIH 2XQYA 4FQPA 1S2EA 2RJMA 4RMRA 3TA3B 3IKCB 2PR4L 2EO1A 4WEBH 4K23L 4ZXBC 1TSRA 1CFTA 4G43A 4JFOA 1VFBA 1SUHA 5TD4A 2APTA 2TSBA 5HGDA 5EUOB 4PGBA 4P5MB 3U48A 4BBWA 1L3WA 2NY5C 1HHIB 2P8LA 5D1XE 2WQVA 4DPRA 1IZKA 3VE0B 1BREA 1SXAA 4RZKA 3TA3A 3UTQA 2ITDB 1P7BA 1JN6B 4MDJA 32C2A 3S35X 3EIFA 2OX5A 3NFSH 4UTBL 4FL4B 2ZP9A 1RIHH 5LG6A 3BE1H 4FFWC 3BIKA 4M7LT 1XIWA 3U1QA 1SY6H 1J8HB 3AT0A 1WT5A 1ZK5A 3NH7H 4UDTA 2OX5B 5DJXB 4GQ9L 2NY3C 5C09B 1AO7E 4LDOB 4JZJB 1Z32X 2GAZB 4EKXA 3V52L 3FRPB 4LCCA 3NABH 5D2NE 3AWEA 1AZUA 3GLEA 4M02A 4QRRB 3TN0C 4X7CC 3S48A 3RWIB 4ODSH 2Z7UA 3LKNB 4ZXBA 3UBXI 3X1EA 4M29A 1K8DB 4RAVA 5JHLL 1D9KA 4YO0A 4GQZA 5JIQA 2DQHL 4XNBA 1BQHG 1MLBB 4IJ3C 3AFLA 4LKXB 3LEVL 1MAJA 5E7FA 1B9ZA 5GGRA 4RAVB 3BP5A 5I6KA 1RY7B 2AMUA 1G0XA 3NSFA 4HJGB 2ZT9C 3PAUA 1WD8A 1MWAH 1P7KB 3WOVA 3MRKA 3KWUA 3TCXA 4X5XA 4B9JA 4F1SA 3STZB 5E1HB 3HI6L 5E9DA 3BEVA 2WLNA 1DQVA 4XO3A 4PW9A 1SHXA 3I3EA 4NCDA 4BFEA 5KUMA 3QHZL 4ZNEA 3ESUF 4NC2B 3ZKSD 4X6DA 5E51A 3HUJA 5DFVD 4NNPH 4M43H 4X5XB 4KHTL 5IMMB 3IDXL 5AAWC 3WHE0 4YZFF 3GBEA 3IFNH 2ADFL 5ANMA 2PCPB 4I2XB 4P49A 2Q7NA 3OHXC 2EDEA 3OKKA 3OHMB 2LR4A 1JHLL 1MAKA 5KVEH 4KY1L 4AXWB 3QDMA 1KN2H 3BCFA 1PJWA 1KIUB 1DEEB 3PABA 3B5TA 2PCPA 4I2XA 3IJHB 1UYWH 4JM2C 5FPIA 2HTKD 4MS8D 3BDBA 4Z7IA 12E8L 1A0QH 2WCSA 4MVBD 5AVXB 4IKKA 4F58L 2EVFA 1LEGB 1XZ0B 5I76A 3ETBF 3KDPB 1Z0MA 2A77L 4XMKH 3X1GA 1GSKA 2J5WA 3EH4B 4GIOA 2XQYK 5JYMA 2QHRL 5E95B 5FM5M 2P5PA 4IEFA 3T6WA 1R3JA 3JWOC 5F7FA 2EAEA 4BFNA 3A22A 1F4WL 2R4SL 4UM8A 1OAZL 2RHEA 3HB3D 1L9NA 5J1AB 4FZEH 1OF2A 3F00A 3ULSA 1U58A 3PV6B 2O61A 4QCIB 5T33L 3V0GA 3WJJC 1OL0A 3R8QA 3PQYD 4DGWC 3REVB 1BWMA 3IN2A 3MRLB 5E56A 3V6FB 2NT0A 2IGFL 1GJWA 3U30B 5KEZA 4PJXF 1IBYA 3VI3A 1DVQA 1NGXA 1IAIL 3KLAB 3NN8A 3C08L 2A6DB 5JXEA 1WA2X 2VISB 5C9KA 4F3FB 1KENH 3GUFA 1IEBB 3KR3H 3KJ4C 1PD1A 3PWUA 2MJWA 3ZYIA 2BIOA 5ALCH 4ZTOL 5DHEA 3CPLA 5CBEB 2GI0A 1YNLH 4R3SA 4U1IA 2OL3B 4MYPA 1W72L 2VWEE 2AERT 1RZFH 5GZOC 4BKLB 4ZNEE 4PJEA 4UBDD 1RJZA 2G2RB 4F15B 1XL6A 5BMFL 1CL7H 4OTXL 2ZZUT 1LEKA 4LOFA 3CDYA 1I7UA 1LGVA 4NM8H 4CJ1A 4ZMYA 1TZHA 4LQFL 4KITB 1CXLA 4POUB 3HAEB 3OHXB 3FN0H 5DRWB 4LSVL 4W4NA 4GLRI 1ZIAA 4N8VA 5C7ZA 3H9ZA 5F1IA 1MHCB 1QVOA 4A2MA 1PZUB 4G6AC 4Y16B 3MLUL 2HXAA 5AVSB 2JQMA 3MU3A 2WK2A 5F7KC 1HZLA 3HHMA 3W1ZA 4PD4K 1ETA1 3IPBA 1IIIA 1K85A 1QSEE 4ERSH 3MV8B 4N2OA 5I8CB 2OQJA 3C5SA 4G1MB 5MI0C 4D3CL 4BZ1H 2D7TH 3EFFA 1RIVH 4AQ8A 5AZ2H 1GHFL 3I02A 3S88H 1SN5A 3G6DL 1NIAA 2WTRB 2R7EB 5E8EA 4GKOA 1T21A 3PFQA 1M56B 3FQTA 1DEDA 3K71B 1QG3A 3ECVA 2X4TB 1I3VA 1B0RA 2FWOB 2YUWA 3CZNA 3ZLQC 5DQJA 3IKKA 2IPKB 3U6RA 2OULB 2RFXA 2ZYSA 1HK6A 3KHOA 3MOQA 4XB8A 1OPOA 2E27L 2FUTA 1NLDH 5DZAA 4MCZB 3OB8A 3WXWH 5MEQB 4PB9H 5IFHL 2AEPL 3UROR 5DQJB 2Q86A 4OCMC 3P2DA 1AIZA 3B1UA 4KDVA 4UU9B 3U7AA 4B7LA 4WW2A 3SKNB 3NSYA 4UZSA 1NSNL 3QUYB 3CJJA 1JJUA 1GGIH 4TPRH 2YD3A 4G82A 5FUZH 3TNMA 1M9SA 3FB5A 1NEZG 1KXQE 3R1GH 3S8WA 1OAYL 2XC8A 2BCKB 3H1ZA 3Q3GB 4JHBA 5DJ0B 5T1DL 1KDJA 4NBXB 3EJPA 5ISZD 4ZOBA 4V1DA 4G5AA 4GKZA 3L3IA 4ONFL 1ZHNB 1IUZA 4X6EA 4YMPA 2Q2EB 2I9TA 1I8KB 1SFHA 2A9CA 1AXSA 2NZ9D 3FT2A 4QHKJ 4LCCC 4CGUB 1N10A 1KCUH 3WLWD 3LZLA 5MERA 1AYOA 2QQKL 4JZOA 3L3IB 3FSOA 2DMGA 1YY9D 4OZGB 4XB3A 4DH2A 5CCGE 3QAQA 3ASWA 5J56B 2CWRA 2AXFA 1CF8H 4MNGE 5J06A 3FB8A 1YPZE 5DK2A 4F8TA 1A47A 3MFGB 3DVFA 4A68A 3SPGA 4ELMB 3D25B 1VEOA 2E9WA 2ZP8A 4FZ8H 3DIFA 1YY8A 3KE0A 2ENQA 1A14H 1IKNC 1KCVL 3HA0A 3L3JA 3OKDB 4WU5B 3VVWA 1GCFA 4WO4B 4QGTA 1UD3A 3UJIL 1XSOA 1YYML 1QFWH 3PRZA 3TS8A 2M2DA 2DWXA 2WBJA 3N1MC 4KKAC 3WLWC 3OMNB 1VZHA 3BHBB 4HT1L 1NUDA 4MWFB 2P3YA 3LRSB 4H8VA 3O41A 2Y25A 3LEVH 3OAWA 2NT1A 4MB5A 3RL2A 1QWUA 2DL2A 2AAVA 2V7HB 1KT2B 3KCWA 3QEQB 5IHWA 2BY1A 3LRLA 1ZLVH 3GSXB 2A1WH 3MUGA 4DFIA 1XSIA 3FRPG 4JPIA 1J88A 1TJMA 4FMKA 4MMZC 2AJVH 4Z3HA 2BNQA 1L7IL 2XXMB 3NH7L 3ZTJH 1E4KA 4OCYH 4R2GD 4D2NA 4NS0A 3M8OH 4Q14A 5CSGA 2B08A 5C0NC 1FLTX 4I48A 4MZRA 3T0EB 2PXYA 3E80A 3E7JA 1J7VR 2HFTA 3GMNB 1QZNA 5TQ0L 1FH5H 1OHZA 1ZVNA 4NN5C 2BLFA 4J3OD 5I18H 3CFNA 4RDQG 1D9KC 1G87A 1PG7H 1KCBA 1N59A 3JTSA 4ODSL 5DURD 3T0EA 3Q8AA 4KH9A 4PLNC 1KCSL 3NDYE 4BFIA 5D96B 4HW6A 1AR1B 3GRWL 1G7PA 1H3UA 3DV4A 1ZSDA 5HYJD 4GT0A 4PJGE 2CDEA 2GB2A 2Y7NA 3L7FA 3QDMD 3E2HB 3QUXC 4F37K 3HNSH 2QGDA 4WV1B 3VRLE 2XHNA 5I1HH 2BSSB 4FXLA 2OZ4L 4I88A 2P45B 3EDKA 5CSZB 5ITFA 4MJ2A 1G7PB 3DV4B 4NFBA 4W6XB 1IAIM 1UB5B 4ZUUB 1LDPH 2PYFB 4OZ4B 3WNJA 3PDOB 2APWA 4OVUA 4OF8A 3QNXA 5HHME 3JT2A 4LSTH 5FGSA 1YLBB 4PU2A 3ZE2F 1JN6A 3HE6A 1G9NH 2W60B 1F6LL 1T0PB 2AJYH 4I77L 1G7QA 1FC1A 4F33A 5LHDA 4BCXA 1T1XB 2WXIA 2DDQH 4N86A 4ZFFA 2WXJA 2AK4B 1KEML 3E1ZA 4U1KB 1I7TB 1AO7A 4LEBA 5K39B 4MHHG 5I8OL 5DMJB 1SJHB 1ZOXA 3BWSA 5E99L 3SE4C 5DJXA 3VXTB 1BFVL 2AQQA 2DN7A 3ZW3A 3OLIA 1G0DA 1EXUA 1TCRA 3BGFC 4LGPB 3VJ6B 3DX9B 3LZNA 1S7WB 2GAZA 1NSNH 4MDIB 4U1HA 5IOPB 4I8DA 2X4OB 1BQHA 1Y6KR 1EHKB 4F58H 4QRRA 5D1QA 1JK8B 1E4HA 4KJPC 1EZLA 2M8XA 1MNUL 3GBDA 1MJUH 2E0PA 1F56A 4P9HL 4QHKI 3VJ6A 3VX0A 1OWWA 5DSCB 2DWDA 4N2LA 5I1JL 4FQCL 4LSUL 4MMXB 5D4IA 1YY9C 1MLBA 1IAII 3RTQC 4ZMPA 4KK6C 3TJHC 3ARBB 4RA0C 2WGXA 4U6YA 1TYJA 5KYYB 1QNIA 4ZTPH 1P4BL 3OX8A 1E5BA 2BZDA 2UZIL 2NZ9C 3D39E 3CFEB 4G5ZH 4M43L 5IMLA 1HINL 4RMTA 1E50A 3IRPX 3RZWA 3STZA 3BUDA 1JPSL 2E9IA 1NZRA 2A6KB 2M83A 3IM1A 5FA3B 3V55A 4GO6B 2NY7L 4AM0B 1WFUA 4KKRA 4AL8C 4Z7NE 2NNRA 3HNVH 5ADOL 5C0AA 3QORC 2GEEA 4DETA 1IAKB 2Z8RA 2UY7A 3QXAA 1LO3L 4LT7A 4F15C 4MD4B 5CJ8A 3U9PL 3WFZA 3UG5A 4Q52A 2DLFH 5LBVA 4W9FC 3WO4C 5HDOA 4JM2D 4BIKA 1ODUA 4G8GE 2X9WA 4HS6B 2A74B 4TVPD 3SQBB 3R19A 5BV7H 4MA8H 5F7MC 2V7NA 1OE3A 3WS3B 2GSMB 5ANHA 3CDZA 5D93C 1EAJA 2DLEA 2F5BH 4WI2A 2E7HA 2GABA 2A74A 3CXDL 3D3VD 4S0SD 4WLCA 2BSRB 3Q2NA 1ADQL 1YN7B 1KBGH 5HGGS 1R3JB 2W91A 2YO3A 3FSAA 5IQ9A 4Y5YC 4HV8A 4NN6C 5LKNA 4N2CA 5HYSG 4NKOB 4GIPD 1NCWH 5D6CB 1MJJA 2ZSVA 1BQLH 3DUUA 1YC8A 5HY9B 4PJAA 2Y7MA 4LVNC 4R7VA 5E0FA 3MYJA 1JPGA 4OV5A 4OLUL 2RB8A 4FTVE 4GRWH 2K3HA 4IBVA 1AD0A 4RAHA 5I71B 1BM3L 3TZVB 1PX8A 2QKIA 5EIQA 5AUMA 1A8JH 2OJZL 3ETTA 1HJCA 2FX8H 3ULUD 4PJAB 3ABMB 4P2QE 4ZW6A 2W5PA 3RIFK 1N18A 2CSPA 2OMUB 4DF9A 1H3PH 1AD0B 2WQAA 4A6YH 3MHZA 2Y1VA 4AITA 5DT1H 5CP3H 4NJ9L 5KZCB 5IQNA 1Z6JT 5E00B 3RWCB 3SSGA 2YMXH 4KZCA 3FTSA 1MFAL 2EYSA 2IVFC 3O3AA 4V1DD 3V7AG 3LD8B 1PQZA 3QO1B 3UYPA 1HN1A 5EU4A 4AYID 1MCQA 6PCYA 2XN9E 3RRQA 1P7QA 3SIKA 5BO1H 3DXAE 3VYOA 2F54A 3UACA 1VFAB 2IBGA 3L2NA 4H5SA 2HJFA 4QXTB 2GSIA 4EIGB 1R3HA 5KJ7E 3L8QA 2ZJSH 3QT2A 5C0RL 4XMLH 5KW9H 1VAHA 3RPIA 2OK0L 2WVSA 3FT3B 3FRUB 2XRAL 2Z7ZA 3DSFL 3LRMA 1ZLWH 4OV6F 3NCWA 4YHKH 1LE5B 2IWFA 2V5RA 4JY4B 1G7HA 4RRPM 2P5WD 5DZNA 4BCZA 4HUNB 3GMOB 2EICA 1MVUA 2DLIA 3I84A 3MRQA 1A7BA 4K5PA 4O58L 1EK3A 3QJQB 4D0BB 1LQSR 5CO1A 2UX6A 2EDDA 2XWRA 3ZHLA 2WP3O 4PJDE 4E36A 5G55A 3VMPA 1IAOA 1WAEA 4FQXC 4MAYA 4N0YH 5EBWA 4J2XA 2CR6A 1WAAE 3GGWB 3GMOA 4XWOC 6CGTA 3VO0A 4D0BA 5AZEH 4MJ6A 1QRNB 4FNSA 2IPUG 4F91B 2GITB 2BIPA 1H0DA 1T03H 3FQTB 4XHJD 5I1JH 4MAYB 4TXVB 3UBXA 4LASL 1INDH 3FNKA 5C0CB 3SGJC 4IDLA 5I17B 2CM6A 4JM2B 4N3TA 1ZV9A 1JXGA 2CGZA 4XWGH 5C0BE 4YH6A 4WNJA 1TIUA 2YHGA 3TEUA 2FJGA 4JHAL 4JE0A 4LL9A 5ID0B 4FFVD 4RIRB 2WO4A 4MCZA 1CMOA 1PG7L 1XF4A 4NQDB 1U3HA 4MRCA 3ZDZF 1FG9C 1IGFH 4JY6A 1BP3B 3GDBA 3WG7B 3U2IA 2NUPA 4AI7A 4YIQB 3W0WD 3ABZA 1LMKA 3T2LA 4WKZA 1R0AL 2LTQB 3FB5B 2EUWA 1HKLL 2DMHA 4FLSA 4UDUB 5F7DA 5J6GB 2AKRB 4L3CB 2NUPB 4XXWA 2WBWB 4F7PA 3BZEA 2ADYA 1NWPA 1H5BC 1UVQA 3C5JB 5CJXC 3SODB 1CFBA 4DFHA 4WHYH 1BW8A 3C5ZB 1NDMA 3PGFL 4N2HA 4NQVB 4OZHE 5CAYB 4GG6B 1T7VA 2VLMD 3FU9A 2X4RA 3ROLB 4YSTA 1ED3B 4HALA 4XPGH 1IM3B 3RGVC 1H15B 3OMIB 4KPHL 1E9OA 3P3TA 4HU2A 4X80H 4ZBJA 5F7EL 4PJGB 4BFFA 1WRFA 1BQKA 1HS6A 2JKIS 3BPOC 4UQCA 1ADQH 3QZPA 5F7NC 3CFJA 3GTVA 4GSDH 1IM3A 1E9QB 5F1SA 2F7QA 4FADA 3FN3A 3S6CA 3P3RA 5EMYA 1RVFH 4JQIL 5IB4A 4XNZC 1E2ZA 2Y36L 1Z3RA 4PJGA 1KGYE 5TE6L 4FQQB 3C87A 3QJHB 2RAMA 1AR1C 2BIQA 5MEND 4JNXA 4M1CD 4K3EH 2YSSB 3HNSL 1A25A 1UENA 2ESVE 2WBJB 4X7TA 3HZ3A 1OB1B 4JE4B 1ECYA 2XLLA 2EO7A 4M8RA 5DC4B 5FHBL 4POZC 5B4MD 3VSQA 2NX5D 1UUNA 5ICYB 2XZAL 1QBMH 5B8CB 2KS0A 3LRSA 4HEPG 4AE1A 1EVUA 4PJFF 5BZXA 2YSSA 5MEPA 1MOEA 3Q1EA 5KYXA 4NAQA 1FHGA 2IC2A 3EO0A 4FABL 5AG8A 3TTYA 3VFSA 5JHBA 3P4NB 4J8QA 1G7MA 2XG5A 3QEHB 1BFSA 5F9WC 3T4AA 4K7PH 4JRXB 5TE7L 3D85B 4ZX6A 1JNHA 1BOGB 2W0FA 2VDPB 4ANVA 4FTVA 2ZSWB 3MNWA 43C9B 4M8VA 1JPTL 3Q8CA 3L9YA 4O2CB 1F41A 5EZIL 3RNKB 1MCPL 1M1XA 1KTDB 5EZJA 1B0GB 1PL3A 5BQ7A 4JRXA 2CBQA 3GMRB 4XCYA 3FT9A 5CD3A 4U1LA 2GI7A 5GRUH 1MRDH 2NY0D 1CZ8L 1G9ML 3GRWH 3JWDL 2B1AH 3D06A 2OMVB 3KPLA 1TU2A 3GF8A 5DD5L 4PRDA 1HXMB 5I15H 3QXDA 1N59B 2EIEA 1SJMA 4P57A 5HHMD 3GMRA 2I5YL 4XCYB 3T65A 3HMXA 3HG4A 3IKCA 4KRPD 4I85A 2V3EA 4QRTA 1FNHA 1U8MA 1EGJA 4G7SB 4W81A 4ZUVB 2BFVL 2JK5B 1CU4L 5IQLA 3MRRA 2CDFB 1HXMA 4PQXA 4AV5A 3EYFA 2Z35A 3CN2A 2YXWA 3ERXA 4FP8L 1V3KA 3APMA 4Y0GA 4OD2A 4YWGH 1X5KA 3C12A 2PCXA 1FNGB 3KPSA 2VXTL 5C7XH 1WF5A 1ZANL 2QPSA 1WAAF 2PO6D 2GHZA 4M6MH 3IS0X 1XXDC 4Z9KB 1JRHH 3MJ8B 2WVVA 5I1KH 5A3IC 1KCKA 3RWEA 2Y6TE 3D3VA 4WFGE 1YA5A 4TSBL 5AL0A 4P5RA 3UG4A 2YAQA 1Q9LB 5IBUB 2WXPA 2VRQA 4O4YL 1IGIL 3IXAB 1I9EA 2GUOA 5TF0A 4KI5F 2XBDA 4M5TA 1KJ3L 2Q3XA 3OL2A 4FQ1H 4NO0D 4QIRA 4WHTB 3ARFA 3OZLA 3L45A 5FYLE 4AH2A 1DHKA 1T1YA 3GSQB 5PAZA 4KKCC 2X3AA 2NNCA 4NUJA 3LH8A 5F7WC 1JNLL 1UM5L 1GIGL 4EN3D 2ZD0A 1GH7A 1S7SB 3GRBA 1XB6A 3KMDA 4U1HB 2XZZA 1HESA 4L3EB 5FFLA 1OPGH 4LKXA 3MCYA 3T3PE 2N7BA 3DRQA 2D3LA 3G5ZA 4UM9D 3BSHA 4R4FL 1A9EA 4FG6D 5GGRB 4OGYL 2BP0A 4YDIH 1YZZA 4EF3A 4P9ML 2MTPA 1NEPA 3NYKA 1ZIBA 4FOMA 1PZDA 1JPEA 4FYRA 4UT9A 3N42F 5C08A 1JV5B 1PNCA 2XSKA 3L2MA 4F57L 1D5IH 3VD2A 3FTZA 4W9JC 5G2NA 1M7DA 2HKFL 1DJYA 1ZLVK 3S3CB 5KVDE 4AQ8C 1AZCA 2IDUA 3D69B 4I1RA 1WISA 5JW5A 3NTCL 2DKMA 3K4ZA 1XGTA 4P9HH 4IRSB 1RZKH 4U7SA 3WIIL 3QUHA 1GAFL 4YAQB 3AG3B 1UASA 4ZS6C 5LUMA 3D69A 5DK0A 3SDXF 2A9NL 2BVPB 2Z8WC 4OCWL 3LVTA 5F2FA 2OMXA 2W88A 1HT6A 3ARYA 4YBHA 4H44C 2OBGA 3E2HC 4UT6H 3QW9A 3NFSL 2C7FA 2FATH 5CCKL 4EOWL 1GZPA 2XFXB 3PXLA 1NCAL 4YE4L 3U6XA 1HSAA 2XXFA 4JPWH 2DQDL 3RDJA 3APFA 3P02A 5EORL 1OXYA 2EDQA 4DQAA 4HKBA 1L0XA 4JFPB 3OXSB 1AZBA 3WGVB 5C0EB 3HZYA 4FFZL 3ZSSA 4XNXL 1RZIA 1SEQH 4PP1C 5DVPA 3K8MA 3PHOA 4YXKL 1T2QH 4XTRD 2CH8A 1HHKB 4MA1B 3NCEB 1SOXA 4JGUA 4KROC 2O93L 3ULSB 1T5XB 1P1VA 1V27A 4LP8A 3LB6D 3TA3C 2FT6A 4HV8B 4OLZL 4RWYL 4P3CH 2GIYA 4NKQB 3KZ8A 3MJGX 1IGCL 2FBJL 3OWRA 3REVA 1U8OA 1BIIA 3FZUD 3QDGE 3GXDA 3N42B 1YDPA 2Q5BA 1MHHA 3LEXB 5C0BD 3O8XA 2WGNB 2X1QA 4L2YA 3TWYA 4A6YL 1X9LA 2AV7B 4YGAB 4Z7QF 1U8CB 1RUQL 4RSVA 2GQHA 3NEEA 3W0WA 1E6OL 3AG4B 4DN3H 1OGPA 5EUOF 3P3UA 4KRMB 3ULVL 4GAYA 8CGTA 4X9YA 1CFQB 3S3JA 2Y5EA 3LN5A 3F12B 3QPXL 4Z7UA 4YK4B 4YXHH 5JHDE 4H26B 1CD9B 3CH8A 2CLRA 4BJLA 1FNFA 1MQKH 4FKKA 4AUUA 3WS6C 4WW2F 3O3AB 1PQZB 2VSDA 1DCLA 1JWMA 1Q72L 2QVKA 5JIKA 3RVUD 4N0UE 1ND0A 4GBXD 2KLRA 2ZUWA 5I75B 1SBSH 2DWEA 2X7LA 1D9KD 3BWAB 4GRLC 1GCYA 3O2DA 4JGJA 3JUYA 3TT3L 4CC4C 2Y0SA 1O7DE 1LEKB 5G4OA 1RU9H 2V2TA 2OTPA 2IQAA 4NENB 1I7UB 3VFUA 4E41B 5I6PA 4H8WC 5E0QA 2QMKA 4BQBA 4HC1A 1YNKH 1MIML 3MJ7B 4KO7A 5BO1L 5LNEA 3LKPA 3THMH 3D6GA 5I1EL 4CN1A 2FLRT 3P0GB 4X4MA 2Q8AL 2ZCLL 3DVIA 4GI9A 3S5LG 4ANXA 3VFUB 3SBPA 2A77H 1S6NA 1FORL 2K6WA 4MMXC 4XMKL 2HN7B 2BERA 1P6FA 1NTDA 4B5EA 3UCRA 1T1WB 1KJ3H 3NJMA 4F24A 3V6OC 5CEZE 4TQEH 2GT9B 4RAUB 3OR6A 1JZJA 3EFDH 5M94B 3ARDA 2A5UA 5IBTH 5JIHA 1DQJB 2V8LA 3ULUC 2ZJSL 5DD3L 3PE9A 3MJ9H 4RZCB 5TFSL 4HCRL 1MFEH 3EDJA 3LQAC 4DVRL 2GT9A 3DSFH 4MJIE 5DLLA 3L4UA 4GG8A 4AQ1B 3LH2L 4Z7UF 1IEAB 3L3HB 3QQ9C 4CGTA 4R4ND 2WLLB 2AK1H 3ARWA 3IFPB 5FYJD 1K72A 4F20A 4P9MH 3NZ8B 1NGQL 5I6XC 4L4VB 4A7UA 3PQYE 1EJFA 4JDVA 5FAAA 3Q48A 3RX9A 3KYKH 1OGTA 4FTVD 5DC0A 3EBIA 1Q0XL 5L2KB 3SKNA 1TETH 1SF3A 1DVFB 1MHPL 1UEYA 3JV0A 4X7EC 2X38A 4KVNL 1MRCH 3AAZB 2VUYA 4AGPA 4XVTL 4YDVB 3OJ2C 2WLZA 2EDNA 4YE0A 4JY6B 2YEQA 2YOAA 3IAQA 4WHYG 3KWXA 4JB9L 2ZUTA 5INDB 4HSCX 4YIQA 2CK0L 3PL6C 3ATAA 5J3HC 1JP5A 4HWBL 4CVUA 2Y6SD 4J3UA 4L4TB 4EXKA 2NQDA 5DO2D 1AYRA 3BUYB 4IOIB 4A55A 2FD6L 4YHIA 4YHLH 3HE7B 2VERA 4JJOA 4XNQA 5A16A 1LHZA 3B7SA 4OZGA 2WP3T 2VLRE 2FO4A 1P69B 3PPSA 1JOIA 3KPSD 3FB8B 3EGDA 4PJ7A 3NIGF 3BUYA 1DQKA 4IOIA 5C6TL 2WY3B 2RQ8A 4ETYA 5JXAL 4OFIA 4DT2A 1AQ8A 3RB7A 4MXWH 2D7TL 1A3LL 3C6LC 1NFKA 1U36A 2AJXH 2Z91B 4Y4KD 2CG9X 1N3NA 1HE7A 4GQRA 3KXFD 3L3GB 3MLYL 1L9QA 4PJXB 1J9CT 2CJTA 2V9QA 5FFGA 4KMQA 4PRIE 5HSFA 3EUUA 3BH4A 3TO4D 4XBPA 2LABA 5JQHC 4HUWB 3QRFM 4RFOH 2EH8L 4QHUA 5IB2A 3HZMA 3AQYA 3NDZE 3MV8D 3O41B 3JT0A 4FS0A 4QNPE 1PX4A 4U3HA 1ZTXE 1OOAA 3TH4T 3MREA 2D03L 1OB1A 3F3HA 3QUXB 1V7MH 4JFQA 4FMFA 3L17A 1NUNB 1IT9L 3TIDB 2QPDB 2AVGA 3NCCB 1GGCL 1Z9OA 4K3DL 3US0A 4HJUA 2K8QA 1A4AA 4TSBH 2R2HB 3MNZB 4JFQB 3MTRA 1JGIA 2ZWKA 2IAAC 2LFEA 4GXUN 4ORZC 4KTDH 4HF5H 1A3QA 2Q7YA 3FQXA 1AZRA 4KNQA 4EXPX 3JWDH 1RU9L 1KENL 2B0SH 3GHBH 2XQBH 4PAZA 2VB5A 2X5PA 3HMWH 3RNKA 1SM3H 2EDKA 5C8JA 4N0UA 1WZKA 1FYTA 5DVMA 2MCMA 5I23A 4FI7A 2KH2B 5IUCA 4U1LB 2BSED 3L2LA 5KBKA 1H5BB 1S46A 2GC4C 5CCKH 3OC8A 1MJ8H 4Z7UE 4QHLA 5F7BA 4ADJA 1VDGA 5D7EA 1KJ2H 4LMQI 2CDEB 3ZDYB 1VFOA 2EJ1A 2DJSA 4CUCA 4A7VA 3FONB 3NPSB 4LF3B 3UP6A 4FAAB 4WV1A 5ISZB 1ZCRA 1GGBH 3C60A 1ZV5A 3FHEA 4HWEL 3FUDA 2VXTH 4ZUVA 5GPRA 4OZ4A 4YFEA 2X44D 3OXRB 5B1BB 1FZOA 2BZ7A 1ZD6A 3DO4A 4LGRB 1GYAA 2E7BA 1F1DA 5DQDH 2WVUA 1SXZA 7PCYA 4XR8C 2AK1L 2W9LA 1ZA3A 3I6LE 2WVVB 2JMRA 1FZOB 3LZOA 4PIRF 4J6IA 2L7UA 1HC1A 1EZVY 3E6HA 1TJHL 4P3WA 3MBXL 4DKEL 4P46D 3VGHA 5D7LD 1JZEA 4E42B 3BDYL 5D7IE 1E6JL 4N22A 4A37A 1KYFA 1OF0A 2WQRA 2WW8A 2PW1A 3FU0A 4JFFA 2X6MA 2E9JA 4APQA 3AT8A 3ULUF 1FG2B 1KYOJ 3GSQA 4X7FC 1Z3GL 4L8BA 1W8NA 2W1NA 4KQ3H 1UTDA 1UURA 2BSDA 4WFGD 4XCCL 4OQTL 2DWDB 4HHWA 4XP9H 4E9QA 3BP5B 3IMWA 4L4VE 3I50L 4CVXA 4XN7A 3O3EB 3IB4A 1UACL 1BFOA 4QT5B 3V4UL 4RMQA 2QLYA 1PFCA 3CSTA 5E9DB 4OFQA 4ZO9A 3GSWB 3EFOA 2JVUA 4XNAA 4UILL 3FBKA 1CGWA 3FFCE 3K72A 2FQGA 4LNRB 3AM8C 2DYPA 1TO5A 4R2GB 1VGKA 5BS0E 3SYQA 5L7XH 3C8HA 3DXAD 3AGWA 4TLKA 3IMSA 2WXFA 2UZYA 4PJXE 3ELAT 4IKLA 1JDDA 4EBQL 4FYSA 4L8DB 2OYPA 2X1XR 2G9KA 3ARGD 5KSBA 3MODH 4H13C 4WWPA 3BFQG 4MMZB 4YDIL 4PJCF 3VXQA 4W1TA 4W9IC 5FM8A 1PYWB 2WQSA 3IJHA 5JHDD 4WTXA 1EEUA 4MKMA 5CJBA 1Q8MA 2BVPA 3ASOB 3MV01 1UJ3A 3SCMA 3VG0L 1QSEB 4LZKA 5IB1B 3S9DB 3KPQA 3I85A 2PCFB 3MLUH 2GY5A 1T22A 2YGNA 3TM6A 3ESMA 3M86A 4ZI8A 3ARDD 4XP1L 4FFZH 5KOVC 2XG4B 4Y19D 2C1PB 2R51A 1HSAB 2RCSL 4LLMB 3GHEL 4J3XA 5TPWL 1A14L 4GMTL 3CDZB 1HHHB 2QELA 5GSVB 3U1SH 4QAMB 4TSAH 4BK8A 4OCWH 2EDWA 1CE1L 2WLIA 3RY5A 1U58B 3PV6A 4DEPC 1QRKA 2VDOB 4HU8A 4MX7B 4QCIA 5ESAB 5CGBA 1FL5A 1KJVA 5FGBA 1HEZB 1DDTA 2NTFA 2A4CA 4Z8FL 3F5WA 1PX3A 4FGMA 1WHOA 3FCTB 2L8AA 1MJJB 3ZIYA 1NMAL 1QYGL 2IAMA 1KJ2B 1KUMA 1U3HD 1NFDA 3MUUA 3MYJB 4XNYL 1S9XA 4G7YL 5F6HJ 1G9EA 2VRAA 3HPLA 4MX7A 5CKGA 5KG9A 1GYCA 4N0CC 3FYEB 4F8PA 4G8GD 1NQBA 5C9JA 1TUPA 1FGNL 1QW8A 2MOQA 2ZNXA 5FYJH 4GP5B 4X98A 4OGAD 4ZTEA 2C3VB 2IBZX 2QMJA 3VU2A 2JJVA 2HX7A 1MCRA 2VZTA 1QEXA 3OKMA 4LCVA 4YOKA 3TBBA 3H4FA 3J8F7 5E00A 2CLVA 3LNIA 3VFMB 2CAKA 2L04A 2LU5A 5GRVK 1S5HA 3HG5A 4HOMA 4H25A 2C3VA 1XXFC 1WA0X 4JFHE 2G2RA 2VAAA 5DA0B 1NA8A 4X8JB 3SKUD 5ADOH 3LQZB 1F02I 5HHXL 1T80A 1FE8H 3BO8B 1S5HB 4Y2DD 2F8XC 4OH2A 5I6XB 4DCQA 1U3HC 1A3ZA 2P8PB 2L3BA 5AB1A 5DR5L 1QX1A 1NGWA 2JKNA 4UIMB 3TNNB 5D1ZA 3WNLA 5FV1L 2W0PA 2W80C 3FT3A 3SKMB 4DUWA 4Y16A 3FRUA 4AIZB 1J11A 5I0DA 3LZRA 2WZAA 4HZAA 1S7XB 5SWSB 3SY0B 4XMTA 4P5TA 3MJ7A 3ZTJG 2XKSA 3QJFA 4XCEA 4BA0A 3SZ6A 3D30A 4EUPB 4G6FD 3VFWA 5AW9B 4DVBB 3RKDC 1MVUB 1BIHA 3MRQB 3EFFB 3SPHA 5LCVH 5LAXB 4PM1A 1YNTB 5DRNB 5AYUH 3VXME 2OMYB 4UBDC 3U9WA 2F5BL 4CJ0A 1NAML 4QXWA 4MA3A 4XCEB 1SHMA 1FL6A 3DJZA 3ARGB 2WXKA 3BGMB 3TN0B 4BYHA 5J9PA 2IPKA 3U6RB 3N0AA 4TVSa 1YNTA 1AY1H 2C7UA 5EG6C 4YGVB 1H0DB 2ZX6A 1NGQH 3HR5A 4Y8DC 4QRFA 5I0YA 2XWJB 1NLBL 4OIFA 4JM2A 3BOVA 2FNBA 3AY4A 4LOVA 4PG2A 3HB3C 4LHUD 4XN5A 3C5XA 3HC0B 4YGVA 2B9BA 2VQ1A 3CAFA 1IQDB 3QUYA 4RIRA 4C83A 1OGAD 2XY2A 2H8PA 4IU2B 5DD3H 1R5WB 5CUSH 4KKNA 3CHXA 2WKGA 5JR1H 2Y7QA 2FR4A 4IBSA 1AHWB 4FC3E 5F71A 3U0TA 2UXTA 1J8KA 5H37A 4OFVA 1YECH 5F0JB 4C83B 2VLJE 2XZQL 3FOMB 3IBEA 5B3JE 2EE3A 1XGZA 3NT0A 4R26H 2D03H 4R96B 3TPUA 3KDMA 4RMSA 2C3HA 5DMKA 1PZ3A 1PG7X 4L3CA 2ZXWB 3QUZC 1X7QB 5CEXA 3Q06A 4X5LA 3QFGA 3O6KL 2PPFA 3A6BL 4JFDE 4XZUB 3X12A 2XQYG 5F3HA 4NQVA 1FCCA 2QSCL 3CIAA 3Q9PA 4N9GB 2B1HL 4M93C 2F8IA 4WFED 5GRYA 1J9SA 4FF9A 2H6PA 2NR6D 4YHIB 4F8QA 2HJKA 2HPOA 1KTLA 3BN9C 2DQJL 3DDFA 3KLLA 4K2UH 2CO1A 1IBZA 3KH3A 5DEGA 2V33A 1DVSA 3MLWL 2JCCE 3CFJB 4IS6B 4L29A 4BSWB 3C8KA 3MV7E 1SDDA 1MXDA 4B3EA 5LBSL 4KK9C 1MCBA 3DRTB 1RUPL 4UYPA 1RZGB 1TCMA 1MCEA 4MWFA 3CFIC 5HHPA 3AB0B 1RMFH 4OCXL 2CK2A 5ESQB 4DK3A 3OSVA 3FS9A 4EN3A 2E6QA 4L1TA 3MRJB 4ACTA 2FLMA 2C34A 4ZS6D 3ZU8A 5J57B 2Z0UA 2VH5L 3I50H 4QYOB 2G3MA 3LY6A 4JAMB 1BXXA 5HHOE 2XJKA 3K74B 5JXAH 1VZGA 1KB9J 2J20A 4EI5A 4G6FB 2AC0A 3QUXA 4S1SL 5FKAA 4XCFH 2NYYD 3P4NA 4UILH 2VR3A 5F7EH 1U8QA 3Q2CA 3LEYH 4MAYD 4O5LL 4DZBA 4O02A 4Q97A 2ZSWA 1PZSA 2B0SL 3F6IA 3GHBL 3MNWB 3MNZA 1T7YA 3MBXH 4QEGA 1YMME 3ATDA 5TF1H 1R0AH 5B38A 1FJ1B 2DYPD 2HH0L 4ZMAT 1Z9MA 3KM2A 4X6FB 1LO4L 4QO1A 2G0LA 4UTBH 2PKDA 1DBMH 4NQDD 2FT7A 2X4NA 1MJ8L 2H6UA 2IQ9H 4GKNB 1R3KA 2C4FT 4WI8A 2V2XB 4U0RC 2O26U 1ZHKA 5HGHA 3O2VH 3HN8A 4KXZH 1T03L 3T65B 1TVHA 2Y24A 3K6OA 3M1BB 1W0VA 1AI1L 3QNYB 3U9UB 4AQEA 4DWHA 2A83A 4NKDB 3UGUA 1E8YA 5EEWA 1J86A 2OJEA 3TYFB 1OAXH 2YWYA 4GKNA 4NFDA 5F0LB 3ZRCC 5EIVA 2FEJA 1JAEA 1UB5A 1JS4A 4GB9A 5I0ZA 4HF5L 4M62H 3V8OA 1VPOL 3NABL 4EZJA 5DI8B 1XD1A 1LJMA 4NZFA 5ISZA 1USZA 1H3WM 3AWGA 3FUFA 3IXTA 2KZKA 3H9YA 3DHJA 2XWXA 4U6VL 4ALAH 5BO0D 4QOKD 3QUYC 1U8JB 3SKJH 5IHZA 2ZOUA 5K1NA 1R3LA 3L3OA 3AREA 3UABA 4ZFOL 2YQBA 4Y1AA 2LTQC 3RWEB 3US1A 5IB3B 2J21A 3ZE1E 2XTJE 3AQDA 3BYTA 4MA7L 3JWNH 5HDWA 2ZX9A 3IXAA 1TJGH 2QZ5A 2QADB 2YEZB 3B56A 2GFBA 4YDZA 4XI5D 2AQ1A 2OR7A 4KRPC 2XTJC 4TRPH 2QL1A 1DN0A 1GS8A 2EKSB 2D7MA 5KSUA 2DQIL 2ILLA 2EC8A 4Z0BH 4G9FB 2W94A 4APXB 5IT2H 5E2VH 4CBPA 4D8PA 5EBLB 3EO9L 2HVKB 4MAUL 3II3A 2PW1B 2MIZA 3AROA 2ICEC 4OGZA 1RD6A 4EI6A 4ZPVA 5EPMA 5JHAA 2J43A 1QW9A 2IWKA 1P9MA 2QVFB 2TAAA 3OTTA 3DECA 3S2AA 4P5TC 2NX5B 3GTNA 5EBLA 1S7TB 1W0WB 2H41A 3GHPA 4X0KA 2XNAA 3WN6A 1BWWA 2IF7A 3ELQA 2VDLH 2ZAIA 2E75C 4FNTA 3IGAB 5DJDA 1GGYA 1RUAL 3RVWD 2H4EA 3V95A 5DDHA 2YMXL 2FJHB 4D0CB 2Y06L 3UZVB 2H32B 4U0RB 3JWDC 1SLUA 2Z0BA 3CN3A 3Q5TA 2VDLB 5IIEB 3KPRA 4Y2DA 3BT2H 5JW5B 4PI0A 5DYOA 1CBJA 3DROA 1IAKA 1F8TL 3BZ5A 3PCYA 4IRJC 2CJUH 1R6VA 2FJHA 4D0CA 3HC3L 5K59E 1ZLWK 3QUZD 1R5VB 1B2WH 1RZPA 1T3FA 1KXQA 3KPRB 2I60H 4TLSA 3MXVL 1BF2A 3FQYA 2B2XH 3MGTA 5HI4D 4AEIH 3TBTA 4BH8A 3NEOA 3AXLA 4AVIA 1J87A 3MOAL 1MW2A 5C3TA 4AEFA 3IDIA 5EC1A 4YHZL 2JJUA 2CJ3A 1CVRA 3RWGB 3F04A 4JREC 4AQZA 1Q1JH 4HS6A 5D2LF 3MGOA 1BEXA 3PJLA 3TBWA 3S36X 3V4PA 4D9LH 4FFYH 4PJ8D 1QNZH 2YWZA 3CFBA 2MNJB 3CUPB 1CTMA 3RWGA 3S2CA 3OF6D 2ODHA 4JO1L 4PTUA 3HZYB 4HS3B 1KB3A 2VDOH 3MGOB 4X42A 4JY5H 2FBOJ 1KWGA 1TZIA 3U4BH 2X6BA 1JMZA 3GKWL 1CGSL 5IKCB 4UANA 3QYCA 1WHPA 2CKBA 4PJDA 1V3LA 2I5YH 1T5KA 4M03A 5A2BA 4JX0A 4OV5B 1NC2A 3SBRA 3ECQA 4QOKB 4X9HA 2WOBA 3MOBL 3AACA 2QQNH 5F7YC 1TEGA 3FCTA 5D7JC 4RGNC 1FNLA 2A0LD 2PO6A 3N04A 5T5FH 5JQ6H 3AGVA 1BIIB 2XZQH 4O2FB 5AVTB 1C9SA 1ZTMA 1NOAA 1G0YR 1QA9B 2WIIB 4LRIC 3VDAA 4Z3FA 1EDHA 3FO9A 2CQVA 5CIPH 3T2NL 5K93A 2IQ9L 3RKDD 3RWCA 4A7SA 3CMOL 4KHTH 4IKJA 2QADD 1JTOA 4JDZA 3UYPB 1A7QL 2AK4D 2BS71 1VRSA 2IXQA 3FPYA 1JV2B 3OKMB 2ZONA 4IOFC 4L48A 1DJZA 5GZNC 4UOW0 3ZKMC 1I1YB 1NC4B 1NLBH 5DTFA 3OKOA 1FO0B 3EGSA 2HRGA 1AD9B 4K4KA 1KB5A 2HJFB 2VO8A 2ZUXA 4QXTA 5I0VA 2QGCA 2X7LB 2CRYA 1YUHA 1S7UB 1IKFH 1U6AH 1NC4A 1CK0L 3OPZH 3VQMA 3EGSB 4XMZA 2B5IC 4DKAA 4UT6L 4WWID 4HQQL 3VXUB 2VDKL 3RP1A 4HCGA 5IUSA 4KO9A 1GZQA 3NJNA 5ISZE 4CSSA 3VG9B 4NCC2 1X5MA 1S7UA 3UTPE 4Y4KA 1NGWB 4UIMA 5E6YA 5CGYC 3TNNA 2CO7A 1X7SA 2R69A 4RISH 2PW2A 1MLCB 5C3LD 1IBBA 4AZ8B 5I1AA 3BVNA 1TJGL 4XMUA 4DIXA 2A38A 3G6JE 4FZEL 4RSYA 3HFMH 5MEOB 1GZQB 1OOWA 5EZPA 3CC5A 1T0MA 2VN5A 3DYOA 3K80A 4FQIH 4XAWH 1V05A 3O2WH 1J8SA 3N41B 4X4XA 5I1AB 1QI3A 1V55B 5DR5H 4GI6A 2FBRA 4R2GC 1HH6A 4JZNB 5TE4H 1W6LA 1JGLH 4P9HC 4TQHA 3ASNB 2DWSA 5FW8A 4EDWH 4JPVL 3WENA 1KB9K 3WUWA 4A2GA 4GUCA 1BLNB 3L3HA 1KY6A 5FYKU 4MNQE 5GGTA 3K0YA 3N2JA 1CICC 3HJ0A 2Y2WA 3MJWA 4LESA 3DOSB 1UWGL 4M61B 3T2QA 1MIEL 2EQDA 3V6OE 4DGYL 4PJ8B 1W8OA 3FJTA 2AI0H 3INUL 3VNYA 4ONGH 4JFEA 4MXVE 4DO4A 4Y5XB 4F8NA 4JPKH 1DFXA 3AW5A 1F8TH 1R5WA 2FJFB 5D1XD 3KGSA 4UDUA 4YHML 1BXAA 1NCUA 3QIUD 5D2NC 1AHWA 3WKYA 1I9RL 2IV9A 2IWEA 3T71A 3SBWA 1MRFH 1H8SA 5INDA 2W95A 4M9OA 5EEUA 5GRUL 3MJ9L 3HUJE 4N8VG 2YUVA 4TSCL 1TPXB 3MOAH 1BZQK 2CO4A 2ITEA 4S1SH 2F2HA 4K8RC 4M7JL 3KDMB 5I75C 2GTWA 1NL0H 2VR5A 2H0FA 1YEEL 1OAYH 1WWAX 3BFOA 2KERA 4KHXL 4LVNB 1ED3A 2DKUA 1T7XA 4TVUA 4AMKH 4LBEA 1LNUA 4OLYH 2DQEL 5AW5B 2DL9A 3JTTA 1RJYB 4H0LC 3ZMEA 3FHQA 5AZ2L 4OT1L 3VRJA 2BFVH 1I3RA 1EUTA 4F2MB 4JMNA 1GW6A 4GBXB 2QDVA 2R23A 4NXKA 3B83A 1YPZB 2NXZD 2E47A 3VH8G 1SFDA 2YK1H 4YEFA 4Y1AD 1PKOA 1WYJA 2R2EA 3M7FB 5KVGE 5D93B 2HT4D 4MB4A 1A7OL 3KL3A 4XO5A 2AJ3B 3WS6A 5JOFA