2JKNA

Drae adhesin in complex with chloramphenicol succinate (trigonal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A structural study of the interaction between the Dr haemagglutinin DraE and derivatives of chloramphenicol.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 28
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jknA00
1UT2A 1USZA 1USQA 1RXLA 2VERA 1UT1A 2W5PA 2JKNA 2BCMA 2IXQB 2JKLA 2JKJA
chains in the Genus database with same CATH superfamily
1JDAA 1AZVA 2VMDA 2QBWA 3P0GB 5GGTH 1ZT1B 3T0BA 3MRQB 4DQOL 2XBDA 3QDJB 1OAUL 4Y5XC 5HHPB 2DWEB 4M1CD 1I8MA 2V5RA 1U95B 5EBMB 1YHPA 4XMPL 2FX8L 3ZT7A 4Z3FA 1E4XH 4QRRA 2D3JA 2E7CA 4MKMA 2PPCA 1X5HA 4W4OA 1A6UH 1FIGL 1FZOA 1QSFA 3M8OL 1I8AA 3UTSA 2E86A 1AO7A 5EN2B 3TT3H 3EBGA 4OFKA 4IS6B 3UH8A 2RMNA 3LZNA 4HMDA 4XVTL 4YHPB 4IBTA 5E5LA 3RZCC 1A1NA 3WHXB 2NY6D 4IW4C 1XV8A 2WUBH 3TT1H 2GUYA 3BKML 4L8DB 3KPSB 3RB7A 4QRPE 4DK6A 1SOXA 3MBWB 3JV6A 4JPIB 4E36A 2NW3A 2QSCH 3L95A 3QUZB 2P5EB 1BZOA 3JVGA 3RIFK 4EZMA 4JZOA 5B7MA 5IESH 4ZXBB 1J0JA 1BQUA 1HE7A 3VXMD 3VA2C 4XPGL 5KVGH 1HJBC 3Q1EA 4JY6B 4E5XB 2QQLL 5C0DA 4OQ1A 1F3DH 1FN4B 1JV5A 1NCOA 1YC7A 4Z7VB 2VDPH 1MCLA 1P84J 3O3AA 3ARDB 4U3SA 3JTTA 3ZSSA 2GCYA 1RZGA 3QE5A 1BM3H 3DJSA 4Q6KA 1AFVL 1ZT4A 2D8KA 1LNUA 2K70A 1JBJA 1FL6B 3W82A 1F90H 2P28B 5I0VA 3I3DA 3DVGB 4BKSC 1UM5H 3CDZB 1KJMB 1XZ0A 5ECGA 1LO3H 4H20H 2VXTH 3UJJL 2DRUA 1G7HA 4N2AA 3Q05A 4NWUL 2ZTBA 1RZIB 3GSQA 1JD7A 4LF3A 4RFOL 3MV8D 3SB3A 3FSWA 3KYMB 1H15A 5J89A 5DZOA 4AJVA 1RCYA 4AVJA 1TU2B 3CXDH 3EO1B 2KDYA 2P5WE 3I9AA 4UQ3A 3TA3C 3IS1X 4JBSA 4M1GL 5TK2A 1LE9A 4CILA 3H3PH 2CNYA 4NQDE 2EKJA 12E8H 3KXFD 4QLWA 2AK1H 5HHVL 3F6IA 4X6FA 1O0VA 5AFAA 5FK9B 3TPUB 5G4MA 3WFHA 5ERWB 1NOFA 2NY6B 3RIAF 1KXQE 1KV7A 2CGRH 1IBBA 4QRBA 3TVMC 4TRPH 4D9QD 4ONHB 1F6AA 4MNHA 3RFRA 4IJTA 1QP1A 4L48A 5EWIH 1NAML 1DBBH 4OSUL 3DDGA 3FTZA 1BPLB 3JT0A 4JJ5A 4RZCA 5B1BB 4PBVC 3GSUB 5EEUA 3TCXA 1UB5B 1ZHBA 3DRTB 1IQDA 3VXMB 4P2OA 3UAAA 4JN2A 1A7NL 5JORA 2Q20A 1JHTB 1EHLL 2L0DA 3B3IA 3NGBB 4G8FA 2WOBA 4Q2ZB 4U6YA 5EG6C 3AY4A 4EF3A 4YHYC 1TFPA 2X89A 4H26B 4CSSA 5FYKL 4HLZG 5IIEB 3SJVD 3D4YA 1U8CA 5ESVB 2VM3A 3VRLE 1AYRA 1LK3L 4U1MA 3WFCH 4IBVA 3BPNC 5JHDA 3U6XS 3EYVA 5E7BA 4PBDA 4ZTOL 5E9DD 2VZOA 4MJIE 1BJ1J 4C55A 1SEBA 4KZ0A 3EZJB 3OPZL 1UXSA 1A7BA 3MV8B 2UZYA 2KI6A 2BJML 2ZQKA 4K7FA 2OK0L 4PJDA 3G6AB 4AQ1A 3UTZA 2HX8A 3U0TA 2WXQA 2D3LA 3CHOA 2A77H 4IDJL 5LN8A 2XUWA 1QRNE 4QNPE 1MRDL 3B2VL 3CZSA 3KXFB 4HXAH 5DK0B 1X44A 1RFDL 1UZ8A 2R2EB 4FQ1L 4G3YL 4NBXB 4P23A 4Q6YA 4D8OA 4OLUH 5CN2A 4J3VA 1FVDA 1A8ZA 1KYAA 1WS8A 2VE6B 4NFBA 3UMTA 3UG3A 5CD3B 5MEND 4PS8A 2PO6D 4R26L 3V9CA 1ESOA 2Q7YA 4I77H 4KQ0A 3IMRA 4L1LA 4XNQA 3CFBB 1KEMH 2OW6A 3OHXA 4NKIL 1B6DA 3OKKA 1MLCB 8PAZA 3FT3B 1TT6A 2AEQH 5HGDB 2QDVA 4IDLA 3WN5B 5LNDA 2Z7WA 4OCXL 4JZNB 4XTRD 3MUY1 4HPOL 4I1NB 4PWFA 3DWTA 3QUZC 4HIXH 5I6KA 5CGBA 2BZCA 4HWNA 1WAAE 4ZXBC 4XVJL 3ARBA 2Y23A 1ZS8A 4GRWF 3FTXA 1HDMB 4RESB 1ITBB 4XXWC 3MRFA 3U4BH 4Y1TA 3SJVB 3KBEA 4F37K 1LVEA 3ARDC 1T22B 5CAYB 1WZMA 1RU9L 1CG9A 5E9DB 1MI5B 2XTLA 4A63A 1A1OA 1BFSA 1S7TB 4K8RH 2JFCA 1EDHA 4YFDB 1A3QA 4Z1PA 2WQAA 4PB0L 1RPQA 1XGZA 5DTFB 2Z8RA 1IGMH 1BFTA 4WFED 4KMTH 1EZUA 2DQTH 4IK6A 5FCUL 3HVDA 5E6SB 2Q3AA 3S36L 1F02I 2XQYA 2IPTH 2DQEH 1QFOA 2KBGA 4DCQA 4O9HL 4YHKH 4M1CC 5T1KA 4J3OF 1A6ZB 1OPGH 3ALXA 4FQCH 2LAGB 3LDBB 3MX0A 3QWNA 3ZLQC 1PG7W 1J0YA 5BOZG 1W72B 2PR4H 4H8WL 3BZ5A 2CCLA 3HZMB 5HYEA 2LAAA 1MWAH 3D4CA 4G8IA 4EPSA 3GUTB 5MENB 4JHAL 5F2FA 3T0VA 1ID5I 3NJGA 4NBYB 4O58H 5ICUA 1EA9C 4IKIA 1FGVL 3BSHA 5C08A 1HHKB 2W81C 4PAZA 4L3CA 5MP6L 4L9LA 4UU9A 5C7XL 2NY6C 4QRQA 1IAKB 3EO0A 4PUBL 3EJUA 2HRGA 1OALA 2WLMA 2YAOA 3UC0L 4Z76B 1XAUA 5DJ6A 3FJTA 1P6AB 2HFFB 2IF7A 1ORSB 3VX0A 3IAPA 3N04A 5DS2A 4F7EA 1QFWH 4ANXA 4P48A 3B3BA 3BVWA 4ZQKB 1TVBA 3I9PA 1NCTA 2O4EA 1SJHA 2VERA 3FO9A 4MQ7A 2JKNA 4G43B 5I74B 3M7OA 3LMJL 3ULUD 1RLWA 5SWZE 3ZDYE 4F7TA 3QJZA 2B4CL 1MJUL 5CJXC 3VXPB 1I8LA 5HHOD 1MIMH 3IDYB 1OB1A 3BH9A 3O4LA 5DFWH 3RWCA 3DI3B 2Y5TA 4OTXL 1X5ZA 3TZVA 2NY4D 2A6DA 4X8JB 3MV01 4G72B 2GEEA 4JLRA 3QUKA 2Y36H 2F6AA 4E41D 4D0BB 2YXVA 1OP9A 4LBEB 2WXFA 1M1XB 1PYWA 3T3PE 2UXFA 4D8PB 2YRZA 5CWSB 1N4XH 5TDOA 3BOVA 4YHNB 1OWWA 2GPZA 3BFOA 3ARPA 1CZ8H 2ENSA 3CFIC 3A6CL 4X98A 2DKUA 5DD6B 2FX7H 5DMYA 5DJDA 4NZFA 1P4BL 4MKTA 1JZHA 2PWDA 4PGZA 5IVOA 4IK7A 1IT9H 2ENYA 3FQRB 1LP9F 5DLLA 3CUPA 3MVSA 4N28A 4ODTL 4CADA 4HEMA 1N2RB 2D7OA 4QKTA 5EZIH 5J6GB 4KTGA 2V17H 4P4KB 5IB5A 4LDEB 1MNUH 2XNAA 3QDGE 3WN5C 3T1WA 4RVBA 5JXAL 7TAAA 2C7UA 4R97B 2VAAA 2A73A 5FDWB 3SGDH 1JCKA 1QD0A 2XY1A 3F12B 3D2UA 5CINH 3HBQA 4M5SA 4K7PX 4JFEB 4WDIB 2HLFD 3NACH 4H1LA 2CJUL 1H3PL 2NY7H 3WO4B 2A0LD 5E6UB 5HHOB 3HZKB 1QKZH 4GRWE 5L2KE 2CG9X 2HRHA 1QNIA 4D3CH 2NY4B 4GSUA 4PJEE 2ZP8A 4BQ9A 2ESVD 3IJYA 4XH2A 1X3DA 3U7YH 1HT6A 3HZVA 4E41B 7PCYA 2EZ0D 3WDJA 1WO2A 4L0PB 3UAJA 4W4NA 4LO9A 4U6TA 1R33A 2GIXA 5BUPA 3V7MA 4WFFE 3P9MA 4MNGE 4FQHA 5B38A 4HJJL 5JLZA 3MUZ1 1L5GB 1S9VA 4HKXA 2M83A 1I53A 3WE6B 5DSCB 1BP3B 4NPKA 3QIBA 5CU5A 3PV7A 4MCZA 2I9TB 1W16A 3UROR 1GKEA 3E8VA 4G1EB 5EEXA 4MDIB 3P3SA 2JXMB 5I6XC 3BGMA 3J7HA 3MZTA 2AJVL 2Y2YA 3H0TB 1FO0H 4HJEA 3IMBA 4N2DA 4TNFA 4PS7A 1TQCB 4YLBA 2N7BA 2DDQL 3BZEB 3U2SA 5IB2B 1P6FA 3ETSA 2NY3D 1J05B 5E5MB 1EEYB 3VFWA 4AYID 3H9HB 4R96A 4TUOB 1G7QA 4XTRC 3DECA 3ATEA 2EVFA 1J86A 5A2CA 1VRSA 1FFPB 1VFBA 4HF5H 5IVXF 3AM8C 1QHPA 1UWXK 3HG4A 3IJHB 5DHYA 3FBQA 3SY0A 2VDQL 3GBEA 1ZSDA 5I1KH 4PV8B 1OVZA 3LPOA 4LAQL 5F72S 3ZQXA 1PZCA 4AM0B 2ICEA 1UD4A 5I74C 2WQUA 2GAZB 1JZGA 5HYQB 1M9SA 5E4EB 3W5MA 2ESVB 1HNGA 3IDYC 3I6KA 4OUUA 3IDJA 2B9BA 3JTSA 4OGXH 5I26A 4F2EA 5C0EA 1DSFL 1AD0B 5C09A 3REWA 5BRQA 2FJSA 3ZZ1A 4LSDA 3O45B 3K6OA 1WBXA 5AUMA 2F68X 3WG7B 1LWJA 4NQVA 1W2KT 2CK0L 1T03L 2RFXB 4NXKA 2CO6A 4KAQH 3ZBMA 1AG0A 2ZCKL 3BYYA 4FNUA 4EI6A 1SXCA 4R8WH 2X6UA 3BKYH 5C0IA 1WTLA 1I7TA 2J8UE 3ISWA 1NCWL 1YUHA 3RWIA 5HYJB 1E5BA 1IL1B 4UM8B 4TYUA 1KB9J 1AGEB 1T2QL 5JDSB 1TTUA 5DHVB 1Q72H 4A2LA 3ZT5A 5HGAA 2VXUL 3JWNC 3K91A 2DI7A 2NY3B 4MB1A 4XC1H 6FABH 5JIIA 4P4KC 4GQPH 4OGZA 2P8LA 1WFIA 1DVZA 4JFFE 5GS2H 5I6OA 3X14A 5J6SA 3OJDA 5J8OA 3H2WA 4R97C 5IWLC 2I60L 1CJYA 1U3HA 2W80C 1GGIH 4JMXA 3VI4A 1O9ZA 4GUCA 2XPGB 4N0YL 3ULUC 2CDGA 2R2HA 3KH3A 3SKNB 2HG5B 4KNTA 3C9NB 3WO4C 2XXFA 3C6LA 1KB5H 1D3CA 1IEAA 1G1YA 1RJZA 4PJBF 3V0WL 5CP3H 3BXNB 2Y5EA 3FYEB 4QXTB 1QVOB 3AC0A 2YWZA 3ZTCC 2NY4C 3FB7A 3V4VL 2R27A 3CZJA 5TDPA 4FS0A 1PEWA 1H5BA 4LLWB 4DHLA 1L9SA 4LARH 4HFUL 1WISA 3RUGE 4Z3IA 1S7SB 2X4NB 3L5IA 1F4WL 5C6WH 2CO7A 3BVDB 4FQIL 5ITBL 1UEMA 1BAFL 5IROD 1HHJA 2F18A 1SLWA 3QS3A 1CB4A 1DDTA 4IU2A 1CLOL 5HDBF 35C8L 3MBEA 1MN4A 1WWAX 3MO1B 4JRXE 1R46A 4YSUA 1NC4A 1BQHA 5L8LB 4BEIA 4LSSL 4K23L 4Z7UA 5KG9B 5GRVL 4HLJA 4ZSOA 5DJ0A 1FLRL 1M4KA 3N41B 5DS8A 2V2XA 1EFQA 1K4CB 4NLHA 5E8OB 1HL8A 1SPDA 1TQCC 4KVCL 1LO2L 4OU3A 3HAEG 2LABA 1NWOA 4KBPA 3SYCA 4NQXA 3KPLA 1BZ7A 2ZX5A 1R3LA 4FZEH 1AR2A 3BCFA 1OAZL 1MPAH 2OMUB 1Z9MA 1WDAA 4X5WA 4DW2L 4LSVH 1KB3A 3UBXB 4IBUA 1CD8A 3MUJA 4TQEL 1VACB 5F6HI 1G7JA 3D33A 3IF1A 1X7QB 2HLFC 1GY2A 3W9DA 2FJUB 1XH3B 1R9FA 3BVTA 5D1ZD 2L04A 5D7KE 1BLNB 2A0LC 1CD1A 4KQ3L 3EFDH 1R3HA 1UVQA 5BMFL 2BVYA 3RU8L 3MFGB 2JI3A 5SV3A 4NLAA 4DGVL 2OMWA 5E4EC 3GJFA 4AZ8B 1H6TA 4PJ9D 2OR9H 2HN7A 2YD3A 5EIIG 4PS3A 4OI7A 2EZ0C 3BWAB 3SDYH 1UEYA 5E08L 4PJCB 2FX9H 4K5LA 1WFJA 3PWLB 1SM3L 3CVHL 2JKSA 2F15A 1JTOA 5I0ZA 3HA0A 2H0PA 5KSBB 3GGWB 3GSOB 3AACA 3WIIL 1IBFA 1GTNA 1CDYA 1G87A 2HJKA 3MOAL 2X6VA 1SYSB 2A6KA 5F1NB 2PWFA 5L6YH 1NMBL 4UINL 2YGPA 4OCYL 3TV8A 1HWHB 1A9EB 5LXGH 4OJDH 3MRPB 3ULSB 4M03A 4ODVH 2ZD0A 3DGDA 3Q7JA 4OF5A 3APFA 3MXWL 1LK2A 2TSBA 4F2ME 3L4YA 4B9JA 2W65A 5ICZA 3WS3A 4FXKB 1I1YB 3IGAA 3OPUA 4PJIA 5DJ2A 5E99L 5EOCJ 3TWCL 4AEFA 1KEGL 1XHHA 5DDHA 1OE3A 2ILLA 3PPSA 3H3BC 3VD5A 3C2SA 1M7IA 1KBKA 5FGCE 3V6BR 3ZTEA 4WSJA 3UABA 3U4KA 1MCIA 2NY3C 2X4UA 5F7LB 3QPXL 5AEAA 4F3FB 2JKWA 1FHGA 1FL3B 4JG0H 2G75A 3IFPA 1MZZA 4TPRH 5J0BA 4QAWA 3UCRA 1QASA 4EI0A 3TPKA 3ULAB 2PCFB 5D1ZB 2WWOA 1EFXA 2VL5A 3S6CA 2DM7A 4RFEA 4A68A 2FYYB 1W0YT 1ILSA 3CH1B 4LLQA 3HUJA 1FYTE 1OM3H 4FNLH 4HIHB 4S1RL 4AITA 1QI5A 3NJKA 3RWGB 2VLRD 4PJ9B 2DQDL 4YQXL 2VLME 1ZHKA 5GJTL 1PQZB 2R2BB 4XCNB 5BS0A 5I6LA 2VXQH 5GZND 3FFDB 2BRRL 4I9WD 4LU5L 4PJBE 4AIOA 1DFBH 4KOCA 3VXTA 2RA1A 1IC7L 5KYXB 1TJXA 3G5YB 3S4SA 4BFOA 3VFVB 4PGDA 4FFVD 1S46A 4PRDB 1AR1D 4WWOA 3VTTA 3Q1SL 4ZMTA 2WQSA 3R06B 2WBJA 2E9GA 3NCJL 3L3JA 1RUQL 3KWWB 1U3JA 3DJ9A 2LW3A 3QDAA 4LVNB 4PJ5A 2DQUH 3QNYB 1QYGL 1G1CA 5JQ6H 2DLGA 4FJYA 1U8JB 4X6EA 4IRJD 1R24B 1X5AA 3H9ZA 5LBSL 4A7VA 4K55A 4OZHB 3M1BA 2FAUA 2XWXA 3C2AH 4B9YA 5DD5H 1NINA 2UVFA 3MLYH 4NC0B 4OAWB 5GGRA 5KN5A 2WO2B 3WFZA 3ZRSA 3QZLA 3WLBB 2VLLB 5CEXB 2O30A 1Z5LA 2OR8A 4A6YL 1P7BA 5E2UL 4FMFA 3B5GA 4HS3A 5I73B 3SGEI 1X6LA 3FSOA 5F88A 4YSPA 1MIEH 1PG7H 1ZV2A 1SVBA 1DQDH 2Y2WA 3ELQA 3GMLB 1UKTA 5BZZA 2EE0A 3P73A 2NZ9D 1EQWA 1KCLA 2XIDA 5BNXD 1NFIB 2X3AA 2Z1KA 4NO0A 1WAEA 4ODUA 1U8PA 4OFQA 1RJYB 2VLRB 1CXEA 2KPWA 4G6ML 4X80H 5CIPA 5F1IA 1KENH 4HWZA 1N64H 2VSKB 5GRXG 3L4XA 2EDOA 3GI8L 4FABL 4CGTA 1L3WA 3ESUF 3GMQB 3RPIB 5LO7A 1FBIL 2FGWH 5B1AB 4AW7A 2JF1A 4AQ8C 4HH8A 2YBRA 5DK3A 5L9DL 4RWYL 4KTDH 3SCMA 5DZ9A 4O02H 1MREL 1A0QL 2EIJB 4OZFH 1RZFL 5LBGA 1FZJB 2VMJA 1AR1B 3GBNH 2AV7B 3IN0A 4B27A 4A7GF 3P0YH 2ARWA 4A2DA 1FFTB 4XI5D 4TLTA 3L1GA 2VRKA 2APFA 1ZTXH 5I23A 3RGHA 2E9BA 1X7TA 3VSUA 2DQCL 5C0JB 3L3HA 2ZG2A 2GY7B 4IBYA 4X0KA 4BH8A 1NCAH 2WN2A 4IRJB 3FO0H 3VNYA 2XBZA 3ASNB 1LO0L 4FXKC 1YAIA 3O9WD 2VIRA 1HOCA 4J3TA 4PRNB 5KSVA 3VW3L 1I4FA 4HUNB 3L9RA 5A2BA 2BNRE 4PIBA 4Q7DA 4DKDC 4JKKA 2QDWA 3V4VA 4ANUA 3VFNB 4UOW1 5HDQL 5C07A 1F2QA 5FFLA 1WA0X 3G3LA 4L3FA 3RP1A 3RURA 5DUML 4AGOA 2J1WA 4XAWH 4JS7A 3EOBB 4UTBH 3NH7H 4BA0A 3ECVA 3TIEB 1A6PA 5D1ZC 1N0XH 1GGBH 2WLZA 4CN4A 3EADA 1G4MA 4PY8I 3MGTB 3Q43A 2FLBT 3E6HB 5C0CD 4XBEL 1FI8C 3DI2B 3FQNB 5E2VH 2OMBA 1SMOA 3HR6A 1TNMA 1UFUA 4PJ9C 2WWKT 3ZKMC 5BJTA 4AYMC 1LEGB 1GZHA 4PJGB 5DC2A 2NYKA 3L3GB 4XWGH 2DBLH 3VXRD 5T1MA 2ODIA 3NCFB 3KLAA 1TETL 4JFHE 4YWGL 3V6OE 4N0RA 4GXVH 3DVFA 4NFDA 3IMSA 1MFAH 1Z9SB 1M2VB 4YNYA 4LGRB 1WA2X 1IFHH 2ETWA 1R5VA 1JS4A 1CD0A 5D2LB 5EZLB 4TSCL 5H35B 3TH3T 3GC3A 5CILL 1OM9A 4F8PA 5HXMA 2CHNA 4JFOB 4LVNC 4P2QD 4UT6L 5C8JA 3VXNA 4UT9L 3F83A 1TFHA 2NYZA 3UBHA 3IDGA 4GFTB 5BV7L 4PJXA 3O9WB 4ZDHB 1UJ3A 1OD9A 4DPCX 2JQMA 3MRHB 2BS71 1S7VB 1OIOA 2IH3A 2VABA 4PWJA 3KPMB 2CKBL 2IH1B 1I3GL 1HSAA 1Y0LA 2YUXA 4MMYA 1VPOH 4CC4A 2Q8BL 1MY7A 1B2YA 2TRYA 3CFMA 3CVHA 4JQXA 4M8QA 2IADA 4M4RA 3VDAA 2XV3A 5I73C 2HWZL 1GYCA 3F58L 3AMKA 1OF0A 1QPXA 4HD9A 4HIPA 4L23A 4OM1L 5C0CB 4CU6A 4GG6E 2QV2A 4XBPB 5DD1H 3CVIL 2EDWA 2YS4A 3I50L 4PW3A 5BUGA 3DVNA 2A1WL 1SMDA 2Y07L 3D08A 4RX4D 4QKXB 5GZOA 3VCLA 1HQRB 4EI5A 1IAOB 5GZNC 3TO2B 3VGGA 1EHXA 4JHWH 3DHMA 3VXRB 5BZDA 1J5CA 5AAMA 5GISL 4E5XG 4J5VA 3MNWA 3NJFA 3CLFL 1NGPH 1U8MA 2H45A 4DGUA 5I0YA 5I30L 5ID1A 1OY3B 2CMRL 3W57A 4FFVC 1R5IB 1IGJA 2VDOH 4KHXL 1AR1C 2IAND 3RB5A 2BY2A 4P46A 3HFMH 1FCCA 1N10A 4P4RB 3FTYA 3SOTA 1YQVL 3MRCA 3V52L 3SKOA 2UXGA 4HK0B 3WOVA 3MRIA 2J4WH 4P2QB 4GRWH 5DZLA 3QEQE 3KBHE 2CK2A 4XNMB 2XN2A 1RZKC 4YDZA 4HIEB 1BIIA 4IRJC 4HK3J 3K7UA 3KLHD 3B9DA 4HWEL 4NIYE 1S8DA 2V2TB 1A5FL 3RVWD 4G42A 1FQ9C 3FT4A 2CCWA 2NCMA 2P48B 3LAFA 3NABH 3OAUL 4XP9H 3T71A 5I0WA 4W6WB 2YD2A 2X87A 1BMZA 3KDMA 4PJDF 5D7IE 3JWOH 1B88A 3OKMA 4CGUB 1UJTA 4J8QA 4FQLH 3CC1A 4L1HA 1URZA 4EZJA 1ICTA 2DMCA 1IVTA 1D5XA 4OCSL 1ZVSA 3IJ7A 2PW1B 3MLTB 4EIBA 4Z3GA 5HI4D 2H3NA 4NZTL 4XGZA 4J3OH 4I87A 4AGPA 1NIDA 2NZ9C 3GHEH 1VZGA 2D0FA 3SE3C 2XZZA 2F2HA 2FE0A 2B59B 3MLRH 3ZVVA 1AZZC 3CLWA 3CFQA 1BQRA 2O5NA 2Q87A 1QSFE 3N85L 4HEPG 2PYFA 3WE1A 1JZIA 4PRAB 3WJMB 2JE8A 1IEBB 1JFQL 3Q13A 1A47A 1WIUA 3KPPA 4LCYB 3T0AA 3TBSA 2E8YA 1XGYL 5LBSA 5IR1B 1E30A 2DWYA 2ZWNA 2YEQA 1UD5A 4M62H 4LPWA 5TFSL 3TONA 3O8XA 5C0RL 4JG9A 4WTXA 3OV6A 3GB7B 1AVAA 2BFGA 2D7MA 2ZSWA 2R23B 4CKVX 1ZVNA 3NJJA 4WI5A 4XI5C 3L3DB 4A6YA 1G7MB 1EEZB 3FZUD 1U8IB 3BPCB 3HG1A 7FABL 3RAJH 5DZJA 2PTVA 2J71A 5F9AC 5G5DB 1RULL 4N2LA 4XNXL 4CW1A 1YEEL 3H6JA 1B4JL 3FT9A 5AVTB 3K0YA 1I8IA 4M8VA 1S78D 1K4DA 1GYWA 2DQHH 3GMMA 3IGLA 3O9WC 1HVXA 5I75B 3GMRB 1MQKL 1NCHA 3TJEL 3V8CA 2YPLD 2HLAB 1C7SA 4DK5A 3A4EA 1F8TL 4LPTA 1F4AA 2IPUG 3DIDA 3AREA 3PJLA 2R56H 1HOEA 2EH7L 2FT6A 3CFDA 1A3RL 1OTTD 3NSXA 3VFRA 4PGBB 1QA9B 2IQ9H 4D7BA 4JANA 1S3RA 4MNQA 1H0DB 1I82A 4G70B 4WWKA 3C5JA 3FNKA 3V4PA 4E9TA 1YPZB 4NEHB 4GI8A 1OSZA 4JO8A 5CZVH 3K4ZA 1JHLH 3G9AB 5FKAA 3C8KA 1DN2A 2BP0B 3O4OB 2FEJA 2BNQD 3U9PL 1F3RB 2F53D 2HTLC 1INEH 3P69A 2EDYA 5C0AA 5KTEL 3D39D 5HDLA 4U3HA 5AD0B 3AXLB 4HZ1A 4QXVA 4PG9B 4QXWA 5SWSD 3MRDB 3OR6A 4P8QA 3C60D 4KO6A 4LLMB 5F7MC 5LGHH 2EE3A 4HOMA 1BQSA 9CGTA 3RA7H 2HVKA 4OGYL 3DETC 5AB9A 5C1MB 3MRJA 4NKDA 5IMMA 4WFGE 1NGZA 5KVDH 1PKQE 1DZBA 2YIHA 1TLKA 1HX0A 3HE6D 5EBLA 1T6BX 5CXPA 5AZEH 2YPLB 3H56A 2FBRA 4JO1L 4UM9A 1G6RH 3MAWA 4AEIH 1V3LA 2C5DC 1R4XA 4LIQE 1JZ3A 2EYTA 5HHMD 1JPGA 2Q1EA 5B1KA 3UPRB 4ZRGA 4KY1H 4L3EE 4GPVA 1GOFA 4LVHB 5K39A 5AZ2L 3VFMA 2ARJQ 4NNXA 5J9PA 1ZWIA 3PFUA 4JDVB 1TKWA 2NUTA 1HH9B 3B7SA 5CUSL 3UMNA 5CNHA 4AQOA 4QXGL 1OP4A 1XGQA 1ZAGA 3QUML 3MYJB 4R4BB 1TZAA 3FTSA 4J39A 2BNQB 2PWGA 1BCIA 3FXIC 2F53B 3ESOA 4OLYL 1UWEL 2PCXA 3P4NB 4UT6A 2E46A 3D39B 2WPGA 4UT9A 4X6CA 1LDPL 4RISH 4GKOA 4UCFA 1DQMH 1CICD 2H26B 3LXBA 3Q6FB 3QEHA 4JKPL 4N2HA 4M7LH 4RAVB 3FH7A 4PRHA 1FIEA 2R83A 4OF3A 3AU0A 3BEWA 1XF2B 1C8PA 4XP5H 2JKRM 3PFQA 1TZGH 3F65A 4PY7A 3CLEH 4LRNL 3MGOB 2CKBA 5GHWH 1T20A 3DA0A 3JUZA 4X9FA 5F9JA 3ZDXB 5DMJB 4YHZL 1G6VK 2ZOKA 2FJFA 3PAUA 3QISA 3IMVA 3HE6B 3BH8A 1HHHA 3PGCA 3SO5A 2KERA 4ALAL 5CEZE 2AXGB 3OR7B 4C56D 4YDIH 3OMNB 3S88L 1P7HL 1M9WA 1N5AB 3KLHC 1R3KB 5KWYC 1J1XH 3RVWC 3UFIA 1ZGLA 4HUUB 4G7VH 4HQQL 4LSPL 4NHCH 1V7NH 2ZPKL 1T0MB 3N1QC 5I75C 4YUEL 5T5FL 4CN1A 1PX4A 4IEFA 1KJ2L 5HHMB 3MV9E 1IM9B 2FIKA 4HKJB 4NB7A 3BWUC 3PABB 2F74A 2H9GB 2XT1B 5E23A 1J9QA 2VYRE 4HS8H 5GGVL 1IAIM 1MJ8L 3SQBB 3RTQA 3RIAK 1IE5A 2X42A 1NJ9A 3UZEC 3CX5J 3GXTA 3BZDA 5HI4C 5HYIA 5FYJU 3HC4L 3NCBB 3DUSB 3L45A 4NM4H 3JWNG 3PL6A 2CR6A 5D72L 5DJZB 3BZFA 4J8RB 4EIGB 3FUNA 3SZKC 2I27N 5DHDA 5F7BA 1HINL 3IMWA 3ZGHA 2ZICA 2F7PA 4FFWD 4U1LA 1ZK9A 2F8OA 2ZX6A 4LPVA 3O4OC 5I15L 1CICB 5I8KH 4BWTA 1J9RA 1FRGH 1S7RA 3CZFA 3ZXAC 4MD0B 1Q94B 1U93A 4WTQA 4K7PY 4YVUA 3SDCA 2CO2A 3ESNA 4G82A 3OZ9L 4OZ4A 2O26U 4AEHH 2OTUA 4F57L 3QARA 4ATTA 3U0PA 4I0PA 4W68A 3HOGA 3OJVC 4R0LB 4FTDA 4M6ML 1IBGH 2BS8A 4DQAA 1RPKA 2BX5A 4FXGB 4U6VL 3FZUC 3PWVB 1JPSH 1KTCA 3MODL 3P11H 4G7SB 5FO7B 2KUTA 3P9WB 3FB6A 3TX4A 2J43A 4C56B 4FZ8H 2X4SB 3QO1B 2H6PB 1J5IA 4Y19D 3EYUL 2DOCA 3S37L 1S78C 3OZKA 2RR3A 2V3FA 1Q4NX 2N1TE 2BY0A 1KTRL 2QHRL 4JRYD 2AMUA 1EJFA 4LLYA 5DRXA 4G1MB 1RZ7H 3D0LA 1NUDA 4Q56A 3AQZA 4E9RA 2CJ3A 4JK0D 3ABLB 1WLHA 3L7EA 3UIZA 3FTVA 1OTTC 1IQWH 3S5LG 1AQ8A 5B3JF 1FNGB 4LVHC 4YE4L 4JFQB 2Y06H 1AIFA 3G04A 1B90A 1MELA 1VIWA 4K94H 3HHMA 3KCWA 2CHWA 2L4OA 5FHBL 3KLDA 5I1IL 4NYLB 2H32A 3MUHL 3DBXA 4GG8B 1NEZB 2VO5A 4JZJB 2B1OA 4HT1H 1KBGH 5GRUH 2X7LA 3RWFA 2N4IA 5DXWA 2LT9A 2Y6TE 3PCYA 4HEME 4JY4B 1HCVA 1DJZA 3GSVA 3UO1L 2AEPH 3L8QA 1NMAH 2VC2B 1GZQB 3HE7A 2K9FB 3WIFB 4N6RB 3VI4F 5JIMA 2F7RA 1UA6H 4XXCA 5JPMB 2ORBL 5A3ID 3X3FL 4ZFFA 4NQQA 1BFOB 5AB0A 2WWNA 3ECBA 1TNNA 2W0LA 1XGUB 3W0WA 1B0RB 4AMKL 3HE6C 4Y19B 1MWAB 3LKRA 2W07A 4W6XB 4XXDA 2ATPA 1C16B 5ES4B 4JRYB 1DBAH 3WS6A 1R47A 2WXMA 3VXSA 3HG2A 4X2UA 2GEQA 5HI5D 4UNIA 1NIFA 3D50A 3OAYK 4L8BA 1ZLUH 2G5UA 3S8FB 4HJUA 4OJEH 2GJZA 1LE5A 4PPTA 1I3RA 3LPGA 3W39A 2JK5A 4GO6B 3ZQWA 4YK4B 4RAUB 5LLIC 3STZA 4AKQA 5IT2H 3ZR6A 4KHTL 4NBZB 2LU4A 4Q4IA 3ZTDC 3FQ2A 1I1AD 3G6JA 5BXFB 2F5AH 2UYLA 1MXGA 4Z7UF 4ENED 1AIZA 4PW4A 5E1GA 4BRVA 3MKKA 2Q5BA 5DD0H 5DI8B 4Y4HC 3N44F 3ZX1A 2FWLB 3LNHA 1ET5A 3NZSA 2D2CC 1WYJA 1JMXA 2J25A 5FR3A 1V54B 1CICC 4JFZH 3NMEA 4I5BB 2ZF8A 4P9ML 3VFGL 4CMHB 3UTPD 2EKSA 1KPUB 4TVPH 4F58L 1KBPA 2PTTB 1MFDL 1UENA 2BOCB 4R0LC 5DMKA 4B3VA 4OCRH 4ZUUA 3ARTA 4FXGC 1AP2B 2OMZA 3UCQA 4AQZA 5MERB 4AIZB 4HJGB 2QHLA 1TZHB 2ZXGA 5JW3L 2ZP0T 3OBAA 3U30C 4JFWA 4NNPL 5F96L 2OR7A 3M1CA 4KITB 3UTTE 2CDFB 2I9LB 3QUMA 1Z1WA 3VQ2C 1FVEB 2X5PA 2WP3T 1D5ZB 1M57B 3ETBF 5CSBA 4FA6A 1E5UI 1GHFH 1R3JA 1R17A 2Y69B 3D0AA 5EORH 1XH2A 5ILTL 3CHQA 2F7QA 3BQUD 4CN6A 5BQ7B 2GC4C 1KIPA 2ZX7A 4HW6A 3UPCA 2FJHA 4UWQB 1S7WA 3E2HB 2DJSA 4N25A 1IGFL 3TBWB 1BLIA 4RMWA 4M7KL 1Q9WB 4PJIF 3V0AC 4PS4L 4ZBJA 2C34A 5B3JE 1JK8B 1RMFH 3SIKA 2TAAA 5E6IA 2AV1A 1YEGL 2KT6A 4H88L 2WP3O 4KUCD 4WHDA 2YD0A 4RMQA 5J11B 1H3UA 1LWRA 2N1KA 3LN5B 4JZJC 2Q6WA 4J6RL 2VLKD 4OZIB 3UBXG 3GO1H 1PY0A 1FDLH 4PJHB 2FZ3B 3ES6B 2J8OA 2PR9A 4OVVA 3P4OB 4PRIE 1ZXKA 3GMOB 4PP2B 1DE4B 2NT1A 1I9RL 3GBML 4JO3H 2X2UA 5JPMC 4X7SL 2ZXDA 3BAYA 3HUJF 4Y1AE 3RWEB 1A6WH 5DJAA 5H4YA 5ISZD 1U91B 3VI4E 1TDQA 3ZT6A 2XXMB 5CCJA 5EOQL 3RGBA 3QNXA 3PXHA 4F9PC 2Z7UA 1GY1A 5T33L 1I1FB 5GGQH 1FO0B 4ES9A 4PLNC 1MFBL 3MUUA 4LCWE 5FLVA 5I1LA 1YY8B 3FFCD 2NTFA 2XTJE 3GI9H 3M1OA 1MUJB 3BQUB 3DOSA 1Q9KA 3QJHB 4PJ7A 4RMVA 4TSBH 3OX8B 1YN7B 1YDPA 2OL3B 3H9SA 3RFZB 2B2XH 2G4GA 3ETTA 4OZGA 2W9EH 4YK4C 4X5PA 5INCA 5ANMA 3J8F7 3NYKA 1ZS2A 3OJMB 3MU3A 5DZNA 1AGDB 1ZA3B 3V9EA 3RWHA 3T0XA 4XP6L 4M02A 43C9B 2DMHA 5AKVA 1YEWA 3ZDZB 1D6VH 5D1QB 1IGIH 2WM0A 3PNWB 4I2XE 4YDKH 5FO8B 1EAQA 3TCLB 3ULVE 4I8DA 2V2WB 1TJHH 2VLJD 2Y22A 2A4CA 1B4TA 1RUAL 2WXIA 1EANA 4HUVB 1AJ7H 5FFOA 1MH5A 3J27A 3K0WA 5D1XA 4DEPB 3L2LA 4K5MA 2HJFA 2YZ1A 5I8EB 4MA8L 1UG9A 4IRSD 4NNYA 1ET8A 4PWEA 1FWXA 5F8QC 1IBZA 5A3IC 1SOQA 4CMHC 1EJ6A 3QG7L 1FFNB 2QSTA 3PGDB 5HVGB 4C8XA 2XVLA 4LRIA 4BM7A 4DP6X 1UH3A 5ISZB 3EOAB 3RKPA 2YC1B 3QDME 3QCVH 3NJMA 5EBWB 1M6OB 1E6OL 1CC3A 2DYPD 4F15B 2OPCA 5KBKA 4QRUB 2ENJA 1RK0A 2XVGA 2F7IA 4DETA 1WA1X 3ESMA 2XXCB 4P99A 4NPYA 4BRJA 1UM4H 3H2QA 2NUPB 1E2VA 2IAMA 4U31A 4KJYA 5HI5C 3FFCB 4JN1H 5I1HL 2XWBB 3CXHJ 1RIVH 4AJ0A 4AX3A 1X6NA 1I7UA 4X6DA 4PD4K 5IV2B 4OFYA 5AOMA 3K1DA 4LLUB 4Z7WE 5IQ9A 4FQ2H 1HFUA 4ZW5A 1FG9C 1FFOA 1Z66A 3PQYA 2Z7YA 4AT6B 5DRNA 3NIDE 5FAAA 2CLZA 2BSEA 3QCTH 4P5TA 2V4LA 2O5ZH 1AXTH 4ELMA 3E2HC 4ENEC 4OIFA 1AD9A 4HUXB 2DLFL 4AQEA 1EO5A 2K8MA 3VQLA 3EFOB 2JKIS 4Y9GA 2RTTA 3BJ91 5JR1H 3OXRB 1BF8A 1F4YH 1UH2A 1PZBA 3L4WA 3TA4D 1GC1C 3QUHA 5FUOH 3V5DB 2VLJB 3WDHA 1G9MH 1KB5B 5C0GA 4JFXB 2BVTA 1PZAA 4PJIE 4QWWD 3X12B 2XI9A 2NR6A 1M2OA 4R2GD 5J11C 3ET9F 4MYWB 3Q9PA 3BAXA 4HGWB 1XSKA 4YL9A 5HGHA 4D9LL 5IEHA 2WANA 3TBVA 2UZPA 5D2NA 1CE1L 4GQ9L 4IRSB 4QRPD 4UDTA 4LLVB 3HS0B 4MXWL 3EGSB 4WFHE 4FI6A 1F58L 6TAAA 3GLDA 5AYUL 5ICYB 3VFPA 1EX0A 1USZA 4ONGL 4UT7H 5FDYA 1SXBA 4Q0XH 3NTCL 3S5ZA 1E8ZA 5IUCA 1PZ2A 3DRQB 3DVIA 3P1VA 1CI5A 3U46A 2CM5A 4LSRL 5FKPB 4NWTL 2XJKA 1UWGH 4WV1B 4DP9X 5A2IH 1VKXA 1SLUA 5H94B 3AUVA 2EYRB 1A7RL 1S9YA 2VM9A 1E40A 4YLCA 5C7ZA 4ZTPL 3AXIA 5H4ZA 2WWMD 2UWEE 1S9WB 2XFGB 3UJTH 1RK7A 1P1VA 2VDKL 4FTVE 3BQUC 3X11A 3P30H 4RGOH 1WK0A 4X4ME 2FD6L 3JZ7A 3RFZC 2XZQL 2YSSB 4I18A 4AIEA 4KX7A 3ZHNA 4ZQTA 1K8IA 3VD0A 1D6EB 4UOQA 4KRPD 3Q5YA 4NJ9H 4OD3H 4PJXF 4ZAKA 2RD0A 3VE0B 2FR4A 2EEBA 5CJQL 4FQJH 5DD3H 2HUHA 1UYWH 1FUNA 3T6QC 5D1QC 4R2GB 1NCNA 2DQGH 2Y72A 3ZE2E 4Z95H 3D85D 1P7KA 2ZYSA 3K6SB 2D3NA 3OTTA 1CDHA 1MHHB 2X10A 5FECA 4QRPB 2AJYH 2WBKA 5F7EH 3CMOL 4DEPC 2VQ1A 2CSPA 3PJNA 4X7TB 5GQBA 1M7DA 5JHLL 2ZOLB 4GSDH 5GSVA 2VRAA 1ODUA 3D2TA 2DQJH 1QFUH 3B2MA 5FGRA 2QV4A 3WSQL 2D4FA 4JL1A 1JTTA 4BZ1L 1ZLUK 4FDWA 1XSIA 5C70A 4AUYA 5F7YC 1NFDA 2A3TA 2Z64C 4TTGA 3GF8A 4CSTA 5LWYL 5CZRA 1J88A 5HJBA 3WIAA 5EIIA 1H8OA 2AJUL 2BC4B 2OTPA 1NEUA 4ISVA 4F15C 2JJVA 5ESQB 5BVPL 3SQOH 4JPWL 5GS1A 1L7IL 2AJZB 1DBJL 2DQFA 4P59L 3DUUA 4WI7A 2Q7AA 4ZS7H 1NGQH 4L1SA 3TN0D 3QQ4B 3MLZH 2IFFH 4MJID 5CSZA 1E9PA 2EDTA 5IHBA 1Z7JA 4WEUD 1OSPL 1N8ZB 1S5IH 3W37A 3PDOA 2ICWJ 3I6LE 2NQDA 5F3FA 3L4UA 4POYA 2J6EL 1XIWD 3IKCA 4LLDA 4HPHA 1WPCA 3QFDA 3AADB 4GKNB 3KGSA 1J0KA 3B7RL 1BEYH 4OD2B 1UZ6F 3QORA 4KRPB 4K2UH 2CGYA 1QRND 5CEZH 3BLPX 4JG1H 4R4FH 1KJVA 1QEXA 4XHQA 3UPAA 1JWUB 4NUJB 4GW1A 4KKPA 4XHJD 4GO9A 4QHKJ 1GYVA 2ZUXA 3GNML 2NNAB 2V3EA 1CE6A 3D85B 1DQJB 1LO4L 4PRPB 1DQLH 1AAJA 5E00B 5HP5A 5E8EB 5AW0B 1CBVH 3CPLB 4ZPTB 4XNYL 3TEUA 3VGBA 4HUCA 3HHSA 2H1PH 3MREB 4XNZB 3GLAA 3ZE0F 4PJFE 1QFPA 2VOTA 4IRSC 3HS0C 5T5NF 1ADQA 2WLNA 3HEIB 25C8L 4M29A 1K3ZA 5D70H 5C07E 2BIPA 4Z77B 5E7FA 3WELA 1W9XA 3QXUA 1RK1A 1J1OH 1FG2A 4G6AD 2MQCA 4KMLB 1MRFH 1E8WA 4ZMAT 1EZLA 3VXUA 3L9YA 4WV1C 6PAZA 3VGHA 1GTFA 1YEJL 2FECI 4NHUB 4NUMA 1GGCH 3P9LB 2CJTA 3C5XA 3E8UL 3TN0B 1QATA 3BPOB 5HJ3A 4WGVB 4FKKA 1HKFA 1THAA 3ECQA 3SZ6A 1PZ5A 4EOWL 3PXJA 1SF5A 5TE4L 1I8KB 2R4RH 1GGUA 4YHIB 1RIHH 1XIWB 1L0QA 5I9QB 5I1AA 3S3SA 2AJSL 2ZOUA 1HH6A 5LN4A 5EIVA 4DNLA 4Y88A 3PHQA 3MACH 4WW2F 4OQTL 1H6FA 3NA9L 3GXNA 2C9AA 2LGNA 2NLJA 3O6FA 4MBRA 4DQOH 1J8SA 2A6IB 3COOA 1CDCA 1QRNB 3SGEH 2YPKA 1OAUH 1Z0MA 1ND0B 4KTEL 3CDGB 4Y5XA 4UQAA 3OD3A 4JFYA 4XMPH 2FX8H 1ZSHA 1T04A 1PSKL 1AYOA 2X9YA 1WE5A 3FONB 3MJWA 2PCPB 3IGKA 4HG4K 1IILE 2C1OA 1FIGH 4MJ5A 4MQTB 4QWWC 5IG7B 3M8OH 4PJXE 1NSNL 4R2GC 4ZJ9A 3LEXA 4XN5A 3CJJA 5DYFA 1E67A 4XVTH 2ADIA 1BVNP 3DGCR 3RZCA 2FL5B 3BKMH 4TUUA 1TENA 1NH6A 2WXOA 2OMTA 2XA8L 5I66B 1EDQA 1F18A 2XWCA 2O6EA 5AL8A 2GTZB 4KJPD 3OKDB 3BUYB 1HL5A 2XWZA 4NKMA 4GXUN 4ODXB 3OKOA 1WT5C 1J7VR 4XPGH 1TQUA 2BNUB 5SWZD 2CBTA 5ABZA 2QQLH 4Z0XA 3ZYJA 3W9EA 5LDUA 4JCMA 2XV6B 1KT2A 5KYWA 3ZK0A 1T1WA 4AH2A 1F13A 1AFVH 3VWJD 5JMOC 2WWMC 3IDIB 4ODSL 5EUKB 4PTTA 3V2AR 3TH2T 3E3QE 4KO7A 1QLRB 4Q9CA 4H8PA 2ICWI 3UJJH 2B7DT 4JFDA 3LKNB 1HHGB 3KCPB 2GKIA 2TRHA 4NWUH 4ZW8A 3SDAD 4Y4FD 4TF4A 1RSYA 3O3EB 4L4JA 4RFOH 3UXFA 3C6SA 5D71L 2N7SA 4HWUA 1NQBA 4H1LH 4KRPC 5DUBB 1YY9C 3SBRA 3TBTB 1QEWB 1BMGA 3CSGA 3RIKA 4QHLB 3L6FB 1UT1A 2EIBA 3KW8A 4LSTL 4BZYA 1XH1A 2C9QA 4M1GH 3L16A 3BAEL 3Q8AA 4DAGL 3S96A 1FZKA 2IOMA 2K1MA 2FO1A 4KO9A 1SY6L 5HHVH 4MB3A 1GRWA 5HYSB 1YCSA 2FHBA 5DC4B 3CV5A 3EYFB 3D07A 3IJSA 3UX9B 1KGCE 2JB5L 3SBWC 2W0PA 3EYOB 4IOSA 3GS7A 4WLCA 4XNZC 3TVMA 5IJDC 3QDGD 1NAMH 4OSUH 3MRGB 3UEZA 2R8SL 3LEVL 1KMGA 4NQSB 4BKTC 3C5SB 2XG4B 5EU4B 3GSWB 1SHWA 2GTWA 1T4KB 1A7NH 3GMPA 1X5JA 4CRPA 2JCCB 3MJ7A 5SWZB 3ZDYB 2UXVA 4FQQA 4PR5A 1U6AL 4QRSB 3ZYOA 1EHLH 5DS1A 4NOBA 4M5YL 1QQDA 2AJ3A 4X6CF 5L2KD 1DBML 5FYKH 5CGMA 2PW2A 5IHWA 5I1DB 2ALWA 3VWJB 2CBQA 4CA4A 1CBJA 3LKSA 2UUDH 3E1ZA 4NT6A 3TN0C 3BPOC 1LK3H 2GTQA 4DEUA 3KR3L 1CMOA 4ZTOH 3B9AA 3QFJE 3T3PB 5I9QC 2XTSA 1XIWC 4WFFD 2DQMA 3SDAB 4O2EA 4Y4FB 2CRMA 1LQSR 1G7LA 1XGPA 3F7QA 4H8VA 3ASOB 3G5XB 3ZE1F 1IGCL 3OPZH 4FAAB 4JPQA 2BJMH 3RG1C 2YA0A 5E8DH 4YDMA 2VJXA 2OK0H 1ZT1A 3MRQA 3BW9B 3RWDB 3QDJA 1WAPA 4IDJH 4KKLD 5AYTA 5HHPA 3MR9B 4XHJC 2DWEA 1MRDH 3B2VH 3H42L 1A4KB 1U95A 1RFDH 4FQ1H 4PWGA 5EBMA 4G3YH 1CQKA 1O9VA 1QR4A 2EEFA 3GTTA 4ZO7A 1NPUA 4WHYG 2YKLL 3WXWL 3VD7A 5JO5A 1L3NA 4R26H 5K33A 4PM1A 5EN2A 4IS6A 2P7TB 4P5MA 3QDGB 5CHNB 4L1TA 4NKIH 3WHXA 2Q2EB 2VJ0A 2EXWD 2J6WA 4OCXH 2J6EA 1KY6A 2XZAL 3KPSA 1N59B 4HPOH 4L8DA 5T3ZE 2R1WB 1DJIA 3MBWA 4MNQE 4JPIA 4PGEB 3QUZA 4QHMB 2P5EA 4XVJH 3UERA 4ONOA 4ZXBA 3D0VB 5L2KB 4WNQB 4XXWA 5L4FA 4X5LA 5SWQB 4JY6A 4PJEB 4LSQL 4E5XA 3WFDL 1FN4A 4Z7VA 3WY3A 1EZSA 2ZUSA 3EH1A 5T3XL 4HPYL 3ARDA 1RU9H 2HKHL 4F7PB 1UASA 1GW0A 4PB0H 3I2CL 4MNGB 4YSTA 1FL6A 2JI1A 4Y9CA 2CUAA 3DVGA 4HJ1A 1GSKA 4OF6A 5FCUH 3HG0A 3TYFB 1UWYA 3S36H 3VQMA 3S34L 4RIRA 4CUCA 4L1BA 1RZIA 3O2WL 2K45A 4O9HH 3Q2VA 4A55A 3IETB 3KYMA 4Y5VB 4HUWB 4UOJA 4GSRA 1TU2A 1WWCA 3EO1A 4H8WH 1RH8A 1VCBC 1DDHB 5HDWA 4DESA 4F33B 1F00I 5C0ND 4JHAH 3T4AB 1DLFL 3U9WA 4G8AC 4Z8FL 5EO9B 2ZKYA 3EBIA 4TNGA 4W9JC 3T04D 4PCSA 1FGVH 3SYAA 1H3TA 1FNSL 1KF9B 3CXFA 5MP6H 5C7XH 1ZE3H 1AY1L 4QXUL 3O2DL 2CPUA 5FK9A 2JCWA 1KG0B 4PUBH 5ERWA 1M05B 2O6CA 2OAAA 3UC0H 3CQQA 3RBGA 1WEJL 5T1DL 3VDBA 4JFFD 4ONHA 1WF5A 5IUSA 4WF7A 4Y8DC 1JYVA 4KJPC 4OQTA 4HEPA 2VDMB 3GSUA 4Q4EA 1TTBA 1UB5A 3DRTA 3GPEA 2QQNL 4FEIA 1MAML 2BY1A 3CDFA 2I26N 2NPLX 2CLRB 3FOLB 2VXSL 4JM2D 3BP5B 3FN9A 3BRFA 2IGLA 3LMJH 4G9FE 5EV7A 4BXSV 1FVCB 2APBA 3VWJC 4ZMOA 2B4CH 1MJUH 4H26A 1KWGA 5IIEA 4FKEA 5CJXA 5ESVA 5CJ8A 3VMPA 2R29A 4X0NA 2XPZA 3QQDB 3GIZL 1F3DJ 4X6CE 4B9PA 4OTXH 3KLLA 3BKJL 3K4AA 4G7YL 4Z7QF 5BVJB 1P4IL 3SDAC 1D9KD 4Y4FC 2DQ6A 2DL2A 2DI8A 2VH5L 1HIML 3DJRA 1PJWA 3MV8A 2RACA 2J8UB 2XQYK 3L3OB 1QLEB 1YUKB 3CSBA 1BOGB 4O51A 3ZE1E 3V0EA 2XXGA 4JRXD 3Q2WA 4ZFOB 5BRZE 5BZXA 3GJEB 3A6CH 3LNIA 3OWEA 3IDNB 4OCWL 5GS3A 4LOFA 3KXFA 5DK0A 2K78A 4JGJA 2R2EA 1P4BH 4S1QL 2VE6A 3WY4A 4ODTH 5D7EA 5AKRA 3MV11 1OQXA 3NVQA 4JFFB 5DQJB 1D5IL 3B2PA 4WRLA 1JF1B 5FF6B 3CFBA 4G6JL 3G6JF 5EF0A 1CXIA 5SX4I 5HYFA 4X9YA 2OZNA 3ARZA 4N4YB 5JIKA 1MLCA 2FUTA 3FT3A 5HGDA 1KYFA 2WKOA 3WN5A 5JXAH 3ZTNL 2DLTA 4JZNA 4GKZA 5D4JA 5D7KD 2B20A 4M8UA 4P3DB 1OP3K 5IB4B 3P0VL 4JM2B 4Z7OB 4LESA 1FV1B 2CJUH 1HDMA 1H3PH 3PJSB 4L4TE 2BINA 5D7LE 2VUKA 1XXDC 4PQXA 1OAQL 1E3XA 1T22A 4TNVF 3KPQB 4HBQA 5E9DA 1MI5A 3NCWA 3RUGB 1S7TA 2XZCL 4HH9B 1D9KB 3MUGB 2HFGL 5DTFA 3VYOA 4U1NB 4LCIL 3TWYA 4BZ2L 4HJJH 3C5ZA 4FXLA 4HCGA 2X0WA 4P2RE 3DX0A 4MS6A 4JRXB 3NJNA 1IKOP 1BZ8A 4KKLC 4G8GE 4GYBA 1BIHA 3IDMB 4HC1L 4JHUA 1BGXL 1A6ZA 4Y5VC 3DARA 1YQ2A 3LHPL 3OGCB 3QS2A 3VMNA 2AQRA 1PLGL 3HZMA 3T4AC 3WAKA 4P5SA 3E9UA 2OLDA 1EERB 2IDFA 3GUTA 2AJVH 3QI9D 1I3VA 3KW7A 3R18A 2ROYA 1E4WL 1DVQA 3U6XA 1HHKA 2DDQH 2BK8A 1LM8V 2Q76B 1IAKA 1I85C 2EXWC 2FH6A 3AAZB 5HI3D 4Z76A 3RIFF 2QT6A 4A2HA 1M42A 2H7WA 2EDMA 2FLRT 2HFFA 3EFFB 4ZYKB 1TTCA 2RGSA 4QF1A 2VDQH 1KIUB 3TF7C 3AM8A 3RPBA 4B7IA 1FYTD 4ZQKA 3B1UA 3QNZB 4I88A 4D0DB 3NIGB 5IF0B 4QTHB 3VACA 4DFIA 2VLMD 4APXB 7PAZA 4G43A 3CZGA 4JO4L 1BBDL 4J2XA 4PTUB 3F7PC 1QWUA 3VXPA 2GY5A 2JMRA 2WO4A 2VZUA 5IB3B 1DSFH 4TVSa 1LXMA 3SKJL 1INDL 4ZK8A 4X8JA 1CXFA 4L8SB 3RBSA 1QBML 3IXAB 4D0BA 1JGEB 1ZLSL 43CAB 4LBEA 1M1XA 2CK0H 2FT8A 4J6IA 1QNZL 4D8PA 4F2MB 5L2JB 3S8GB 3L3OC 1T03H 5CWSA 2ZCKH 1IAIL 4CJ1A 4YHNA 5FO9B 3AUWB 2DWDB 4X5QA 3T6ZA 5C0NC 2J2ZB 1NCWH 3QI9B 4YGVB 5FGCB 5HD8D 2A9BA 5DD6A 4PJ7F 1C5BL 1WQVT 3N1MC 1IKNC 3U9UB 1HJCA 5TF0A 5TGBB 5IREA 1T2QH 4ZUVB 2EO7A 3GYRA 4PJ6A 2VXUH 2XJLA 4TOYL 4OZGF 1FP5A 4B6ZA 1U8QB 5I1JL 3SD5A 4ICWA 1N2RA 3GKZA 4U1JB 5E95B 1TYRA 3BP7B 2DMKA 4KFMA 5J6GA 4P4KA 4BWWA 4U7KA 1JZDC 1CIDA 3WTWA 1QUPA 1AXSB 2JTYA 2OTWB 1OAKL 1XSJA 3G6JE 1NA8A 1FYTB 2I60H 2JB6B 4N26A 3RLSA 4ZMZA 2VISB 5IWLA 2QVMA 2GJJA 2VN4A 5FDWA 4JM2C 4N0YH 3F12A 3GDBA 5E1AB 5CR1A 4BGDA 2R9HD 4JFEA 5IM7B 4WDIA 1BD2E 3NFPA 5ADPL 1QSEE 1EHNA 3AY2A 5HHOA 3EHBB 5AW5B 3HZKA 3V0WH 2IWKA 3ABKB 1E3FA 3IVKB 3V4VH 3PHOB 2FBJL 1D9KC 4HJTA 4E41A 3O2DA 5E0FA 2X12A 4HFUH 2WTRB 4IRZL 2HPOA 4AKOA 5FCSH 4MXVF 1ZVYA 2FHCA 1F4WH 1G84A 4FQIH 5ITBH 1L5GA 1BAFH 3NIFF 4Y2NA 3RDTC 4IBLT 2OJEB 3LRSB 5DSCA 3WE6A 2XA3A 2ZCHL 3LV3B 1P9MC 3SDDD 1CLOH 4OVUA 35C8H 1J5DA 3UZVB 2I9TA 4LSSH 4K23H 4X6DF 1BV8A 4G1EA 3S5LA 4MDIA 1FLRH 4OF0A 2JXMA 5KVEL 4F1SA 1PX8A 2BNRD 1CYXA 1VDGA 3H0TA 4ACTA 4ONFL 1S9XB 5JZ7D 4KVCH 4V1DE 1N12A 1LO2H 3GLZA 3IM1A 3SPIA 2AZUA 1YYML 4ELMF 4WKZB 3BRDA 3BZEA 2BDNL 5IB2A 5IK3B 1OAZH 1CGTA 1J05A 1T80A 1EEYA 3LZLA 5E5MA 4DW2H 3ECUA 4HJIA 3H9HA 3HN3A 4TUOA 5DR5L 3LOWA 1WFMA 1FYHB 3MXVL 4TQEH 5TE6L 3V5KB 1C5DB 2V2TA 1FFPA 3MJGX 3IJHA 3X13B 2ZXWB 4PV8A 4KQ3H 1OCRB 4KKRA 5DHEA 2QKSA 4B95C 5BMFH 3LPFA 3L1EA 4AM0A 4ZI8A 3RU8H 5AVZB 3WI9A 3MZGB 5HHXL 2GAZA 3FN0H 2BSTB 2Y4SA 4AUJA 4DGVH 5FB8B 5HYQA 4UANA 3FSZA 5HHNB 2XN9E 3ERXA 2FJGB 2HVBA 2AQ2A 1TYEB 2GJPA 2EVIA 1AQMA 2ESVA 2Z6FA 2E7LC 1KN4L 5E08H 2V33A 4JFHD 5CM1A 1SM3H 3CVHH 1VZIA 3TIDB 3T2OA 3INUL 4NKQB 1AD0A 1ROWA 4L8SC 5CZKA 3LXAA 1MCBA 3WIIH 1TTFA 3MOAH 4K73A 3ZTJG 3O45A 1NMBH 1QHQA 3LS5L 4UINH 5AB2A 4OCYH 1CO1A 3FRUB 3SDDB 1YJDL 2RFXA 2VN7A 1HXKA 3MXWH 3H53A 3LPWA 3QI9C 5IFJB 3Q3GB 4FHKA 4FCHA 2BNRB 5E99H 3TWCH 5HYJA 1KEGH 4Y16D 2VN6A 3IMTA 2F8VA 1IL1A 4UM8A 2FDBP 1JPFB 4JCLA 1OEZW 4MMXB 5DC0A 4KX9A 5JDSA 5DHVA 2B1AL 1S7XB 4HKZA 4ZNEA 1C9SA 5HI3C 5GXBB 1W80A 3QPXH 3H9SE 1BG9A 1MG3C 1JGDB 1UATA 1WVZA 1CT8B 4BSWB 4R7XA 3N40P 3ZL4L 3VMOA 4BZ2A 1OK0A 1HL4A 5MHSE 3BCDA 4TQ8A 1O75A 3F7LA 1MFCL 1KBWA 1IBHA 1NCIA 3DO4A 1RZKL 1R34A 3L3IB 1RQ5A 3FQUB 4PH8A 1ONQB 1QFWI 2X38A 1C08B 2NCEA 2XPGA 4HC1A 2QVIA 3SKNA 1F6LL 4S1RH 2HG5A 4XCFL 3C9NA 4L05A 2DQDH 4HUMB 3QJQB 4YQXH 3EHBC 1WD8A 3QZOA 5GJTH 5ACZB 4KGLA 3GJFK 2L3BA 5LNEA 2VDNB 3BXNA 4QXTA 2VZ1A 1QVOA 1ZTMA 1NFDF 5AWNL 2BRRH 4UQ2A 2I07B 2W60B 1WV7T 3X3GL 4LU5H 4LLWA 1IC7H 5F8RC 1XCXA 3A0OA 3QXAB 5KBNC 2J88L 3LZQA 3RJDA 1S7SA 2X4NA 3QEQD 3Q1SH 3Q44A 1Y6KR 3NCJH 3PREA 4MXVE 1RUQH 3VFSB 1XWVA 2EE2A 4IOFD 3B1TA 1MRCL 5HD8C 1QYGH 3B9KD 2X4OB 3K72B 3BSZL 4DWHA 3MO1A 4EVNB 1LMKA 5LBSH 1L9OA 3FYIB 4LHQB 5KG9A 2K3HA 1C7TA 1QPPA 4XNBA 4IJ3B 4YO0B 2YD9A 3MJ9L 5JXED 3PWJB 3CIQA 1K4CA 1NC2D 5E8OA 1D7FA 3KL3A 3L9BA 3J07A 2F54D 2W92A 1M71B 1SUHA 1VFAB 1YMHB 4A6YH 1ZVHA 5CBEB 3HW7A 5E2UH 3TBYB 4DN4L 4UYPA 3U1QA 2XKNB 5GSRB 3WEMA 2OMUA 4AVHA 4ELME 4GG6B 2R39A 3UBXA 3V4LA 1JPTL 2N56A 4V2CB 1VACA 2R9HC 1OF2B 1X7QA 2OCCB 3OB0K 4HXBL 1VJSA 2IO5A 2ZWSA 1BLNA 4G6MH 2YAEA 3TFKD 5GJSL 2XN0A 4M5ZL 3STLB 2OM5A 1NFAA 3GI8H 4FABH 1F6FB 3FU3A 5FX3A 1FBIH 4AZ8A 4QTFA 5L9DH 4RWYH 4FF9A 4AQ8A 2MFNA 2QR0B 3BWAA 3EDJA 1OGAD 3AQDA 5DF0A 1MREH 3V0FA 4PJCA 4I85A 3O81A 1A0QH 3PWLA 1RZFH 4KNQA 4R83A 3WMPA 5KSBA 3QEQB 3GGWA 5H2BB 3GSOA 3KGTA 5CFAA 1G0YR 3DHJA 1SYSA 5F1NA 1I31A 4DP7X 4GXFA 1BJMA 4GXUM 3DX7A 3SDDC 2K7PA 2DQCH 3B9KB 4KDVA 1A9EA 1EJOL 3MRPA 1WWBX 4GI6A 5GIRB 2LFEA 3IGUA 3IJEB 2XWTB 1JGVL 2YOAA 5EDSA 1LO0H 5D7IB 4HSAC 4IKJA 4FXKA 4H5SB 4BQ8A 1NC2B 4YSRA 5JZ7C 1NCDL 3GK8L 2JNZA 3VW3H 4MMXC 2F54B 4KKAD 4DGYL 1H9VA 5KS9E 3LTVA 1UD3A 2EDFA 5HDQH 4F3FA 3EJYD 2CO4A 3OGOE 5DUMH 1FL3A 2E7DA 3ENEA 4IRZA 4GUQA 2BLFA 3HN8A 2L7JA 2PP8A 3D30A 1D5BB 2R0LL 3SPJA 3G08B 3TLRA 2PCFA 5D1ZA 1NKRA 4TSAL 2N59A 4EEEA 4XBEH 2FYYA 3VG0L 3DX8B 5E9NA 2N0MA 1KLFB 4Q6IB 1QSZA 4HIHA 1D7CA 1O7VA 5TD4A 1K8DB 3RWGA 4KVPA 2IV9A 4PJ9A 3SY6A 2DIJA 5I16B 2JQAA 4H4NA 2NW3B 1OGAB 1NEPA 1PQZA 4M6AA 1B9ZA 32C2B 2R2BA 2LU7A 1XQ4A 2X1XR 4XCNA 5DYOB 4DZ8B 5SV4A 1D5RA 1HEZA 2R69L 1TETH 3FFDA 4I48B 4YWGH 3QRLA 3FUIA 4PGJA 2CDEA 2Z0BA 3CZKA 3LQAL 5KYXA 3G5YA 2FNWA 3VFVA 3BDBA 4TSCH 4PRDA 3TFBA 1GGTA 5CILH 3R06A 3K3QA 1BJ1H 4UT6H 4D9RE 1MFEL 3KWWA 4UT9H 2KZBA 2J1ZA 3B7YA 1QBLL 4EIZC 1DVSA 2ZX8A 4HDIB 4KVNL 1JXFA 1WGVA 1CLYL 1U8JA 1YEIL 2VZ3A 3HC0B 4F2FA 1R24A 4Z7AA 4IJ3C 4L3ED 2VDLB 2WTPA 4LF3B 4OZHA 1A64A 2ZKXA 2CKBH 4F8TA 5I8CA 15C8L 1I3GH 4OAWA 1E9QB 3FH8A 3HZYB 3O6FC 2Q8BH 3WLBA 5CEXA 5KVMC 1MSPA 1V3JA 3EGDB 4OFVA 1E50A 2HWZH 3RTLA 3F58H 3U6RB 4L0ZA 3EJQA 4PGCB 4LP4A 3T3MF 3KWVA 4LSUL 4RSYA 4UZUA 4BD4A 3QR2A 3L3KB 2DTSA 4OM1H 3EYQD 3GMLA 1LEKB 1TQVA 5AAWC 2SODB 3O0RH 3CVIH 4XN4A 4H0LC 2QMKA 2P3YA 3I50H 3O3DB 1NGWB 1NFIA 4GUPB 1AE6L 2A1WH 1FZMB 1RJYA 2VLRA 2Y07H 5LAXB 5IMOB 3UJIL 3QYNA 1QI3A 3FU6A 4EN2A 1F4XL 2AERT 3D34A 3GZQA 4HHGA 1LEIB 4IHOB 1DJYA 3GMQA 4NS0A 5GRVK 3RPIA 3SGJC 5GZNA 3SGKC 3UYRL 5JPNB 5GISH 1P2CB 3T65B 3CLFH 2BFVL 1PKQB 5I30H 3GSNB 2CMRH 3ARBD 4U6YB 4XWOD 1MVUB 4KHXH 1E2WA 1FZJA 3KEDA 5CEZD 4R7DB 3D9AL 1YQVH 1KPVB 2AV7A 3BUQA 3V52H 5AG9A 5F6IB 1X9LA 3A6OA 4F20A 4H44C 4IOFC 4U1MB 5IB1B 2MSPA 3GRWL 4FG0A 3GFUA 5HGGS 3B9KC 3MBXL 3OG6B 4NO3B 3EF4A 3NCMA 5C0JA 4LEXL 3KLQA 4ODWA 4YZFE 2XACC 4LASL 4RQQA 4HWEH 3MV9D 1Y07A 2XYCA 4IRJA 1A5FH 1U2YA 1JXGA 3F7KA 3KWTA 1N6QL 4L3EB 3OAUH 2YPVL 5JXEC 4HLZH 1CXKA 2NMSA 5T8IA 2WZPD 3I9IA 4UV7L 2EEAA 4PRNA 2GI0A 3A21A 1WZAA 5KBMA 4JQIL 1IIIA 4OCSH 1YNTB 3VFNA 3V0GA 1UZ8B 5HYSG 4BK8A 5IJKC 1IMHC 4NZTH 5LXVA 1TEGA 2HKFL 4W4OC 1A6TB 3TNNB 2VAJA 3EOBA 3TIEA 5DJYB 1J8HE 1W8NA 3SE3A 3CFUA 4GAAA 3N3EA 4XNQB 3TFKC 3MGTA 3N85H 1TZ8A 3P54A 1DQKA 4XZUB 3OHXB 4AZUA 1RERA 2ED9A 2FVNA 3OKKB 1QTSA 1JFQH 3HNSL 2V8LA 5EU6E 2BP8B 4IBWA 1ZDSA 4NZRL 4Q6IC 4QLRA 3FQNA 4AK2A 3EBHA 1XGYH 1LEGA 3NOIA 3V5HA 3K5SA 5TFSH 5C0RH 1F97A 3OL2A 3ARBB 4PJGA 4L37B 3L3GA 2KHAA 5BCAA 3MJ6A 3ZZSA 1ZA6B 1TVHB 1A66A 3FUEA 4Z7VF 5E03A 1Z9SA 1NICA 1M2VA 3AFLA 2Q8AL 7FABH 3MRLB 3KG5A 4L4VE 4M1DL 2X40A 4XE0A 3WKYA 5D2LA 5EZLA 5H35A 1DANT 4KRMB 4CVZB 1RULH 4OCLC 4XNXH 5HJDA 1BF5A 1YEEH 1B4JH 2GUOB 2ZAHA 4BUHA 3MV9B 4QO1B 4EUPB 4JFOA 1TYJA 2NNXA 4TN9A 5A43C 1EBAA 1KCBA 2Y1ZA 1XF4A 1MQKH 3TJEH 3O9WA 1A21A 5F7DB 3KAAA 4ZDHA 4JW3A 3HLKA 4UQEA 4MVBD 4G80A 1F8TH 4KKAC 3MRHA 2EDLA 1GR7A 1KC5L 1S7VA 2VSDA 4LL9A 2EH7H 2E9JA 1OGSA 2IDCA 3EJYC 3KPMA 1A3RH 4U2YA 1HXMB 3P2TA 2IH1A 4F7CB 4UNTA 4KFZC 3BQVA 3EJPA 2B1HL 1T1XB 4GRMB 4YAQB 1HZHL 1BREA 3QJRB 3WYRA 3RVUD 2I85A 4BE6A 5C0CA 1CFBA 3EO0B 4XBPA 1A6VL 1CXLA 3U9PH 4YIQB 5KTEH 5AQ0A 3GHPA 2WNWA 4EDXB 3D69B 3HPJA 5ENWB 5JHMA 4F7EB 1CR9L 2J8HA 3DPBB 1HQRA 1IAOA 3TM6A 3V7AE 3TO2A 5JPNC 3L7FB 2R0WL 4PWIA 3VXRA 2I5YL 3PP3K 5ITFB 3S35X 4OLEA 1MCPL 3MJ8B 4UIKL 1U4EA 3FO9B 1OZUA 2CXGA 4OD1L 4OGYH 4TV3A 3DV6B 4YSDA 3ATDA 1R5IA 5I8OL 1KGJA 2MOGA 4JPSA 2YMXL 3NSCA 4W9LC 5F6IC 3QHTC 2VZVA 4HK0A 3WL9B 4P2QA 3NRQA 1CFQB 1SXNA 1T5WB 2LVCA 3A24A 4N2MA 1BM7A 4XNMA 2DY2A 1QW8A 3NPZB 1CGUA 2GQHA 1G7IB 3QUKB 3D06A 3II3A 4JO1H 2QADD 2BIHA 4HIEA 4LKXB 4JPKL 5D6CB 5EUOE 3I74A 3GTNA 1I1CA 1E4KC 3ZO9A 3OF6D 3VVVA 4UAOB 1F5WA 1QMUA 1JVLA 5FC9A 1G9NC 3QHZL 2QGEA 4P9HL 1SDDB 3WHE1 5AZ2H 2AVGA 4X9HA 2R69A 3BUDA 1SXAA 1P84K 3QDJE 2HKAA 2PW1A 1U58B 3MLTA 4M6OL 4BFRA 2OSLB 5CUSH 2G9HB 4QDGA 3FL7A 3EYQC 4QXGH 1KDIA 1XTMA 3DYMA 3QUMH 1BZEA 4BELD 2X28A 1N68A 2IC2A 1JN6B 4CDGC 1UFGA 4NOFA 1IO4C 4QYOB 1QAWA 4OLYH 1UWEH 2B59A 1CVRA 4UQIM 1BXUA 3KJ6L 4H8UA 5CD5D 3OHXC 1Q38A 1LDPH 4RX4A 5IB5B 3R19A 1BVNT 5KSUA 4PRAA 5G4OA 4HCIA 3WJMA 1IEBA 4JKPH 3T77B 1TOXA 4BCZA 1FH2A 2DIAA 4P49A 2WKOF 1GCFA 2BW4A 4LCYA 3T08A 3WLWD 1OCWL 3J2PA 5I17B 1T7VA 2A73B 5CJ5A 4G83A 1INQB 5IR1A 1FJ1B 1IGTB 3ARBC 4XWOC 4LRNH 4LB8A 5EA0L 1OV8A 3KYNB 4PV9B 5JIQA 3CQFA 3NSDA 4YHZH 3GB7A 2R23A 1Q1JL 4S2SB 5B1JC 3L3DA 4FYTA 5C9KA 1G7MA 3PDGA 1EEZA 4ALAH 1U8IA 1YMME 3BPCA 5JMRA 3UTTD 1P4LA 2WKGA 3S88H 4X83A 4R9HA 4BH7B 5G5DA 2NSMA 5AVRB 3HZVB 2DM4A 2QADB 3BD4A 2BXZA 3BAKA 4LL1A 2JIXD 4LNRB 4HQQH 4LSPH 3VD4A 2ZPKH 5CLWA 4FFYL 1J87A 2EILB 4YUEH 5T5FH 2PMZA 4JVPA 1KJ2H 2H6UA 3GMRA 3N5AA 1C12B 5JLZB 1NAMB 4KI5E 1RUML 2HLAA 3KJ4B 2VC2L 5GGVH 1MJ8H 2DYSB 8FABA 4N8PA 4NQED 2HT2D 4MCZB 5B8CB 2B3RA 1BVLB 2PN5A 4NP4L 3X2QB 3IDUA 4PGBA 1QA9A 1U8KB 2Z92B 3UADA 2OS7A 3UZEA 3HC4H 3VU2A 2YFNA 1H0DA 1QBBA 4QPEA 4OF7A 5D72H 3JV4B 3GMNB 2EYSA 3D7PA 5FOJA 2X41A 2BW5A 2WOYA 1HINH 1E65A 1YPZA 3GT6A 2CUIA 3GRWA 1UADC 5E1HB 5I15H 3KGRA 5A2LH 3WJJA 2BP0A 3CK0L 5CGTA 4AUUA 2W1NA 3MGAA 3BVUA 2G9KA 4PRID 1KNOB 5LGJB 3OZ9H 3GM8A 2YPVA 4W9CC 1HI6B 3AXLA 2XG5B 4IKLA 4K7PL 3UYPB 2XYBA 4F57H 5AD0A 4XOEA 4PG9A 4I0CC 1CLZL 2EIKB 3BHBB 3L2MA 3CN3A 3MRDA 4WUUE 4Y1AD 4XMXA 5DT1L 5IQ7L 4M6MH 4LLMA 2SEBB 4DKFL 4U6VH 2ICEB 5DMIL 4P5KB 1OARL 3DHUA 3HJEA 3RL1B 1XR8B 2O5YL 3DIFB 4YSQA 3MODH 3UTTB 1ERNA 4A2EA 1SDAB 2XU9A 4PMEA 3DX1A 4N1EA 3EYUH 1JNHB 2OZ4L 4LCWD 3S37H 2JIXB 1GXEA 4TTDD 1NM4A 4PREB 5ELIA 1KY7A 2XTJD 2QHRH 4RWHA 5I19L 2FQFA 4MVBC 4IMLB 2YPLA 5CZXD 4O5LL 3MROB 1PY9A 4NRYB 5F89B 2KPNA 3EJZC 4PP1D 4UAOC 2IDSA 5KYUB 4N8UA 4NQEB 3DMMD 4WI8A 3UPRA 4LEBA 4EI6B 5J13B 1JGLL 1OT1A 3AQXA 1IFRA 4QHUA 5J6HB 2YBGA 4YE4H 3ARGD 1NCCL 5INDB 2ZYRA 5D1ZI 5KYYB 1PDKB 3X1GA 3RVUC 2E47A 4NJAL 4PFEA 3ULVD 2XFXB 4JDVA 5FHBH 3ZUNC 5I1IH 1HH9A 1DANU 5E5UB 2EO9A 1QFHA 3M07A 4GT7A 1IIKA 3MYJA 3K8MA 4HHWA 1FE8L 3T8XB 4AQAB 5JTWA 2BNQA 3U1SL 2F53A 5EBGA 4PRIB 3P4NA 5DURD 3D39A 2X0VA 4E42B 3ZUCA 3GUFA 5DVNA 4Q74A 3K8LA 4QY8B 2H26A 3HMWL 3Q6FA 4JL2A 4FX5A 3O6LL 3UO1H 4K3EL 4RAVA 3G9VA 2MWCA 4Y1AB 2WLIB 4RMTA 4BQ6A 5HDRA 5IBTL 3QDMD 3UBGA 3H1ZA 2ORBH 4OBRA 3X3FH 3KMDA 2J20A 3C08L 4B96A 3ULUF 3MGOA 3EJCA 3SPGA 4XMKL 4HP5A 5ACMA 3GSXB 1GC1L 4AMKH 1X9QA 2DKMA 4LCWB 4N2IA 3HE6A 2C8NA 3A6BL 5MEPB 3ABMB 5F3HB 5I5MA 2XTJB 5F0MB 4AE1A 3AWEA 2AXGA 1XX9C 4L2YA 3FAXA 3OR7A 2QADC 1J10A 1N5AA 4FHJA 4C4UA 1R3KA 1MCEA 5JIPA 1LTXA 2GJ6B 1T3FB 1WGOA 4HUUA 1MI5E 5DUPL 2VQUA 1G0XA 1T0MA 5I76B 2O6FA 5FM5O 3DMMB 1IM9A 2CO7B 3KJ4C 3PUUA 2NX5E 2WGXA 3BZ4B 3PABA 2H9GA 4HKJA 4B9ZA 4OJYA 5J4MA 3ARGB 3F8UB 3I6GB 5EEZA 3SQBA 4KHTH 3WNOA 1MY5A 2MEJB 3L4ZA 5B8CC 4O2FA 4I2XB 1RVFL 5K9KA 1DVYA 4L9DA 5K9QG 3DYPA 4HV8B 2PCYA 2WVSA 5DJ0B 3CVDA 1SJXA 3DUSA 4ODBD 2V5SA 2PWHA 1F45A 4Y4HA 5DJZA 4J8RA 2ICCA 5CD5C 3F64A 4WK0B 1HILB 5DURB 1C8QA 1BZ7B 1Y6NR 4B60A 3K6FA 3L4TA 1CICA 3FTWA 3PXLA 1TXKA 1BF2A 2UV3A 4FNRA 4H13C 4K9EL 1Q94A 2H2SD 3HLAB 4NCC1 3WLWC 3BFWA 2OA9A 2OL3L 3TV3L 4P9MH 3QDMB 3IF1B 3VFGH 5K9JL 4O2CB 5DVPA 4F58H 3DNKA 1MFDH 3F2LA 2FBOJ 2PYEE 3HAEH 4MZRA 1R3HB 4R0LA 4F7MB 2ICEC 3RY4A 5IBUB 1OE2A 4FXGA 2F8IA 1MCFA 1SQMA 4Y4KD 3PWVA 4N5UA 5JW3H 1NAKL 2BSSB 2WZ0A 2EUVA 5FO7A 4C56A 5F96H 1YNLL 1PMYA 2X4SA 3QO1A 1N3NB 4N0CD 3M6DA 1NDMB 4BV1A 4Z7WB 1B0IA 4FTVD 4JDTL 3Q2NA 2OYMA 3NIDB 2HJKB 3IRCA 4G1MA 4X7CC 5SX4H 5ILTH 3AWGA 3QWRA 4HOZA 2HT2C 3L1FA 2EXYD 5J13C 3PAZA 3THML 3R1GL 4G9DB 1IGFH 4PYGA 3REVB 5AB1A 4M7KH 1FNGA 4JFQA 2P1YA 4NFCA 1Y1DA 1Q0XL 4PS4H 4FQXD 1OD7A 2YXFA 1YEGH 1HZKA 4H88H 1B0WA 4RGMB 3ARSA 4NYLA 4MQXD 4YBLB 5C0FB 2NY2D 3I02B 4UNUA 4GG8A 4J6RH 1HCFX 5T3XE 3EXJA 1N8OE 4JZJA 3KD4A 3D6GA 3JWNE 5F9WB 3X17A 4FFYA 5DZPA 5KJRL 1EO8L 1X4XA 1T89C 3IFNL 3PWNB 5I1GL 1MEXL 4JY4A 4TNVK 3NQKA 3P3YA 2R7EB 4YSCA 1I9RH 3GBMH 4P57B 5B7EA 3WIFA 1GZQA 2J1KA 4N6RA 4X7SH 1MLBB 3K6DA 3FU7B 2MCPL 1XAKA 3BI9X 4Y4KB 4B97A 3S8WA 1V10A 4H8WC 1XGUA 1BVKB 1B0RA 4JFEE 4R90L 2UWEB 3LB6D 1MWAA 4TTDC 4Y19A 2YFOA 4OIIL 4QJ3B 2H8PA 3KHOA 4U6XA 2XTJC 5T33H 4XO8A 4UOW0 4F9PA 1MFBH 4FTVB 3NP4A 4WIQA 1C16A 3CHRA 3I6LD 3HBPA 4JRYA 5CZXC 1T0OA 2LVEA 1ZE3C 2FQDA 1XB6A 1AOHA 4WHCA 4PP1C 4HZLB 5G4NA 4BIKA 3QAZB 3CN4A 3DMMC 5DRWA 1GPOL 4E41E 4ZZFA 2ZWKA 2HLEB 1DVFA 2HX9A 2CHDA 4AGMA 1U3NA 1SFHA 3ARGC 4WEEA 1R0AL 3AU1B 4OI8A 4RAUA 2ZKMX 4J23A 4FQXB 1JZEA 3NESA 1GW6A 5BXFA 3ULVC 4X6EB 3ZE2B 1SOKA 1K85A 4XP6H 1MFUA 3CZEA 2Y7LA 5G55A 3HRPA 2WZ5A 2Y9RT 3M1BB 4FYRA 3N41F 3I75B 5DI8A 3FUJA 5FGSA 4AI7A 4PHXA 1RUAH 5E8NA 2F19L 2OZ4A 3CFEB 2XDHA 4Y5YB 2BPBA 4XVSL 1Z5LB 1TF4A 4LVOB 1XSOA 2WMPB 5F1OB 3SYOA 4MA8H 5C71A 3N9GL 4DJMA 5DVLA 4EKJA 1WC7B 1BYPA 5IMKB 2QKIB 3SD2A 2P8MB 3R4RA 4HOWA 3QG7H 1XD0A 2GHZA 1VGEL 1TZOA 2CIKA 2W88A 1J0IA 1UT9A 4FA8A 1KPUA 1J9CT 2PTTA 1UWXH 2BOCA 3RL2B 3CPUA 1E6OH 3AABA 4LKCB 1AP2A 5MERA 4AIZA 3HTLX 1KB9K 1H8NA 1U8OB 4HJGA 1C1EL 3SO3B 3QC5X 2WIIB 1PY4A 3MN8A 4CU8A 2DEXX 3KYOB 4ERSL 2IWGA 1KTDB 2BIOA 3G5VB 3K4DA 4B5EA 4PJCF 5I1HH 2CDFA 1JIBA 2I9LA 3PAVA 1OP5K 3D12B 4MZ3A 4ZODA 3T2LA 1FVEA 4HJ0D 5KSBF 2JLPA 3T4YB 1D5ZA 4L1DA 4Z9KB 4X5XB 3AT9A 1DJXA 3TTSA 3P4MB 1N0LA 1BXAA 3BKCL 1A3LL 5IMLB 1CQYA 3QEUB 4QHNB 3M86A 2DLFH 3A47A 3UZQB 2LU3A 3TBWA 2Y5QA 1Q9WA 2XPYA 2OXGB 3WFBL 3L5WB 1A2YB 4CC1A 4GAJL 1JK8A 4H40A 1WJ3A 1DTUA 2OJ1A 3GRGA 4M43L 4PJFB 5LHDA 4RGMC 4KI1A 4LMQI 5HYJE 2WGNB 3FSVA 4YBLC 4D9LH 3QRFM 3O6KL 4HS6A 1E27B 3LN5A 3VAEA 4XRCA 2EIZB 1CE1H 2H2SC 4GQ9H 4OZIA 1XCQA 3GPSA 3OAZH 1U42A 1KXVC 4MXWH 5F9WC 1F58H 3GZPA 5AYUH 1YN6B 4ONGH 4PJHA 2FZ3A 2ZIDA 3NTCH 3ILPA 3P4OA 4Q58C 4UAHA 4JM4L 3GMOA 4PP2A 4U1HB 2CRYA 1DE4A 4LSRH 5EFIB 5JQHC 2AEIT 3AGWA 3FQWB 2X4RB 4NWTH 4Y4KC 4N20A 1BWWA 1BXVA 1DCEA 1YLBB 2WINB 4XVUD 2NQCA 3RWEA 2B16A 4Q97A 4RH4A 4PMFA 1U91A 1E2ZA 1A7RH 4N0CC 3IJ9A 4HX1A 1K9TA 4OF8A 2OMYB 2VDRB 4C4BA 4WNSA 2VR7A 4YSEA 2NTSP 4ZTPH 3FUDA 1W15A 1I1FA 4YDNA 3ATFA 4ADJA 5DJCB 1DSWA 3DXAE 2VDKH 1X5XA 2O1AA 1NUGA 3QAZC 3JBG7 4N0UE 1MUJA 3BQUA 5BO1L 3QJHA 3AB0B 2FD6H 3OX8A 2WSKA 4N85A 2XZQH 1YO4A 2EXYC 4K3GA 2OL3A 3RFZA 5FV2A 3E80A 5AW8B 1E43A 4MRBA 3D3VA 1AZCA 3NN8B 4PU2A 1P69B 4TUJB 2YXWA 3UGUA 2Y24A 3RE0A 4GUOA 4PJXB 4FQXC 4ETYA 2E4FA 5CJQH 5FYJL 2XWEA 1AGDA 1ZA3A 4N2KA 1KGCD 4OZHF 4MBOA 5D1QA 3NK4A 3PNWA 5FO8A 3TCLA 5L88L 5JA9A 3S2CA 3VFTB 3H54A 1KFGA 4Y5YC 4HUVA 4C83B 3CMOH 1HYRC 1ZTXE 4OBSA 4LVOC 5JHLH 1AG6A 4KV5F 3K81A 4NO5B 5I8EA 2R0ZL 2WSPA 2QKIC 1H3VA 3WSQH 4OV6F 5CU9A 2AC0A 2DIBA 4BZ1H 3TO4D 2VZTA 1TJMA 2C7FA 4MJ2A 1P7QD 2VW4A 2ZNWA 5LWYH 1FFNA 3PGDA 4XPBL 4AGQA 4X8CA 2ZYHA 2CWRA 2AJUH 4MAUL 5ISZA 3EOAA 4DVBB 2YC1A 4UTCA 5EBWA 1M6OA 5BVPH 4JPWH 1KIRB 5D96B 3LB6C 5I71B 1L7IH 1KCUL 1DBJH 4P59H 4QRUA 2XN1A 5FGBC 5LVEA 3SO3C 3QFJD 3ZDWA 3OMZA 4N0FB 2NUPA 2ARJB 1YEKL 1OSPH 3FFCA 2FQEA 1ZDQA 5EB9A 2PO6B 2J6EH 1IGJB 2XWBA 4N5ED 1L9QA 2Y2TA 4Y9BA 3CFKB 5EIQA 1E8XA 2DM2A 2W91A 5IV2A 4PJCE 4GP5B 1VEOA 4LLUA 1R75A 4AT6A 2ZCLL 4YPGB 4LL4A