2JKNA

Drae adhesin in complex with chloramphenicol succinate (trigonal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural study of the interaction between the Dr haemagglutinin DraE and derivatives of chloramphenicol.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
total genus 28
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jknA00
2JKJA 2BCMA 1UT2A 2JKLA 1UT1A 1USQA 2JKNA 2W5PA 1RXLA 2VERA 2IXQB 1USZA
chains in the Genus database with same CATH superfamily
3FN3A 1URIA 4OB5H 3P3UA 3WFHB 5ANMB 3AB0C 5EOQH 5DQ9B 3U1PA 2VABA 3UJIH 4P4KA 1T6BX 3MRKA 5DTFB 5I75B 5BQ7B 5FF6B 2OYLA 4CN4A 4DGYL 4YL4A 1LTXA 4D0CB 2X38A 2AK1L 2HJLB 1AFVL 1CXKA 3O6KH 4XAKD 1HFUA 2A6JB 1IVTA 5ALCH 1ZSDA 4Y8AA 5CKGA 2BNQD 1S78C 3CFMA 4HEPG 1EZVX 4YFLF 4PJFB 2F7QA 3PAYA 3DJ9A 4G8FA 1FRGH 3QEQA 4L5FH 2C3VA 5E8PA 2D2CC 4KXBA 1RZKC 4K5OA 1A7OH 1YSOA 4XO4A 3BEVA 5ITBL 4IQHA 3OX8B 3ARFD 1UWXK 4FXKA 2YAPA 3CC5A 3P77B 1IAMA 4HXAL 2CO6A 3QG6A 1OSZB 2DLTA 4K3HA 5KVGH 4D0DB 3ZY7A 3X3FH 3QPQC 4WSJA 3NTCL 4F37F 3GXPA 2XETA 3SDYH 3WIFB 4V1DD 3V95A 3CTTA 1DL7H 3WUWA 1INEL 2P3YA 5BO1H 4PJ5B 3E80A 4OCRH 4M62H 5DK2B 3CX5K 4B6ZA 3IFPB 3UYOD 4P23C 2WINA 1N10A 4XP4L 4AM0Q 2EILB 1H3VA 1K4DA 1V05A 3HUJA 4XNUL 4E0RA 4N3UA 3DYOA 4GT7A 3HCVB 4X6CA 3TV8A 2QSCH 2ENSA 1DJZA 4EKJA 2PW1A 4LSRH 1R34A 1UXMA 2C7FA 3RTQC 3MGTB 4P59L 3COOA 2IAMB 1RXLA 2ESVE 2N1TE 4I9XA 4J7RA 3PWNB 1C5CH 4PWJA 4GSDH 3BWAA 4U1HB 1R5IA 1PCXA 2CDGA 2NZ9D 2VRAA 3G5XB 3NCYP 3QUMH 4S10A 3FQ1A 1I3UA 4ABVA 3ESNA 4FERA 2DM3A 1YC8A 5IBLC 1EWHA 4JO2L 5A16A 1YA5A 2YOCA 3HBGA 2EE9A 1SJEB 2YD8A 1H3UA 1Z5LB 1S7VA 2BVPA 1HNGA 5AB0A 4PRDA 1I3GL 5TE6L 2GJRA 1AXSB 2O5ZL 4RRPA 1XSIA 2YARA 1PNDA 1G7JA 2QZQA 1O7SA 4GKZA 1ORSA 5FAAA 3QNXB 1TTGA 2G9HA 1M6UA 2W9DL 4H0GA 5I16A 4PCTA 4X4YA 2J57A 1A5FH 1TEFA 4BRVA 3EGSA 3BPOC 4FZEH 2RMNA 3QJVB 2Q6WB 4ZS7L 1FV1B 4JDVB 1SLWA 2G0LA 2WOBA 5LKNA 5FM5M 3SE3C 4B97A 2IPUG 2E74C 4X4YB 4X7TA 3DURB 4MTMA 1CQKA 1FO0H 3QVAA 3ENEA 1DVTA 3VI4B 3ZL1A 4NGHH 3BT2H 4F7MA 3CN4A 5HGDA 3O4LE 2QGEA 2XWCA 1LQBC 2NXYC 3CG8A 3UJJL 3F7QA 4OCYL 4JN1H 3KYKH 4R3SA 4FFWC 3LQAC 2JJSC 4DKEL 5A16B 2ZUWA 3FFDA 2GT9B 2Y24A 1SXCA 3VSTA 4YSOA 4PRBA 2VW4A 5TGBA 3ZU8A 2Q7YA 1CDCA 3J27A 3NCXA 3UZVB 5IB4B 1TFPA 3JTTA 1H6EA 5BUAA 1OT1A 1R5IB 2PWHA 5H4ZA 5CD5D 3SSGA 3SE9H 3PIQA 3PS6A 1T0PB 5AG9A 2DOCA 4OGAD 3FYEB 3D51A 4W6YB 4TLTA 2GT9A 2K7QA 3PWJA 1WFNA 4OJYA 4QHMA 4MJ6A 3DETC 4KMTH 4UQDA 4K9EH 4PY8J 3GS7A 3O0LA 4GUCA 4ECNA 3DROA 1WBYA 1YJDC 4H26B 5DVLA 1IAII 3AMKA 3FQTB 1E5YA 1J8HB 2VZUA 5K59E 5MERA 3L2MA 4RZCA 4Z7WB 4BH8B 5JA8B 2H3KA 1FL3B 3P4LA 3CDYA 4KXZH 4R7DA 3KDMA 2ZOLB 1Z9NA 1D5ZB 1ZLSH 4JFFE 2RJMA 2QPDB 3DVGA 2WXIA 1ZHNB 1B4RA 3PF2A 3EO9L 2ZXDA 4X5RA 3N1MC 4JFOB 3DRTB 3KEHA 2ZOKB 1VACB 4Y5VA 3SOBL 5FLVA 1U8CB 3MUY1 1SZNA 4N90E 3W3BA 4JO1H 1CTOA 1JMXA 5HJDA 3V8OA 5AW6B 3HHRB 2EVFA 1LNUB 3Q5TA 5BJTA 4RAVB 1VGEH 3B8YA 3LZQA 3V4LA 3BVVA 3ZR6A 3HKFA 3LZRA 1UWYA 1KEGL 1JVOA 3GJFB 3W57A 1MLBB 3HVNA 3JWDH 5EC1B 1AO7A 2PW2A 5E6SB 4IBTA 3HPLA 5D6CA 2EIZB 5HBBA 1YEJL 4MWFA 5JMOC 1PF3A 4XXCA 1T1ZB 1D6EB 3VYPA 2DYPA 3IAPA 1RP8A 3D07A 4U1MA 4UTBH 3BGMB 1A3LL 4WI0A 3AGVA 2H1PL 1CFSA 4FLOA 4U1GC 3MSPA 4UQ9A 3MRJB 3OLDA 3KLLA 1XR9B 4YO0B 3VE0A 3RVVC 4R8WL 2C1OA 1MH5A 1IC4H 3N0PB 4F9LC 3GM0A 4H1LG 4WWKD 4CVZA 1YUHB 4WENB 3BKML 4JQVA 1BAFH 4K7PX 1BQHG 5F7NC 2YAQA 5TDNB 3CZFA 1XGUA 3GSUB 4FI8A 4PH8A 3KPRB 1IAIH 1TJXA 4LNVA 4I8DA 4YE0A 3LZOA 5EO9A 5ETUA 4AGOA 2YEZA 5EORL 3LD8C 3LEYL 3MBEC 4MA7L 1U41A 4G70B 4JPWL 1MW1A 5EEXA 3PV7A 3HE7A 4PRNB 4F58H 1LE9B 5G4NA 3C60A 1F6AB 2C9SA 3BW9A 3DJRA 4WW2B 2Z3FA 1QFWL 1WHPA 5IF0B 1GMEA 1YEHH 3J7HA 2MHAB 3MLVH 5I28A 1M42A 2JKSA 5TH2A 4EMZA 3EJSA 2PYFB 3OJ2C 2WZPA 2J25A 1UB6A 3O4OB 4P2RB 3L95A 3NJKA 4UT9L 1G6RL 1DSFH 1F4YL 4AENB 4YSPA 3V0FA 3B6SA 4PRHE 4BFEA 4PLKD 4LPWA 3DHJA 2BRRL 5MEOB 2CUAA 2XVKA 3I6GA 3UROR 4LIQH 4WWID 1I8LC 3RUGF 2EVHA 4Z7QE 3V6FA 4BCYA 4Z7AA 2GHWB 1G9MC 1ZPLA 3QR0A 1WWWX 1DFXA 1Q94B 1HYRC 1SBBA 3GIVA 4HH8A 3HAEH 2VDOB 5PCYA 1UOWA 2LOEA 1MCQA 2AERT 1AE6H 2I9LB 2YD4A 4YX2L 3MJWA 1WIOA 4HJ0D 5KVFL 2AF2A 3TWCH 2HRPH 4HS3B 2H0FA 3W11D 1O9WA 4J3VA 4ELDA 3T2QA 3QIBC 5BS0B 1U8MA 5EEWA 2JLLA 2FEEL 4HBCL 2A9NL 1RV6X 2F5BH 5H35B 2WWMC 1U4FA 2WVUA 2XQ0A 1L9NA 1NDMA 1BLNA 4WWOA 1BFOB 5C09B 4QTFA 4GPVA 1T6VN 1B4LA 1TPXB 4ELME 1HSAB 1MFUA 3ZE0E 4OSUH 2F53A 3C9NB 3NIFE 2BHFA 4TNGA 2P1YA 3EDEA 4G6ML 4GAGL 4ONOA 1EHXA 4HG4J 1N7ML 1PU0A 3QUXB 2CWRA 4DTGH 3IYLW 1S78D 3D33A 4NERA 5MHSD 5B3SB 5HHQA 1HWGB 2WB1A 5C0CB 2P45B 2DWSA 4E9TA 4FXGC 5BNXD 1IBBA 4NNYA 2OK0L 5B1KA 2DRUA 2UZYB 1W8EA 3TP4A 4QY8A 4NKIL 4QRPB 3SBPA 1RERA 4YN3A 1UKSA 2YN5A 1N9PA 2GI0A 3RWEB 4RLDA 1JK9A 5F6IB 3BZFB 4AKQA 5E9DD 3CX2A 3ZYZA 4HIEB 4LLDA 5IKCA 3GMPB 4NWTL 3GZOA 1WBZA 1UZ6F 2UZIH 4U3SB 2FK9A 3L3KB 4JREB 1WEJL 4H44C 4BUGA 4UQ3A 3QEQE 3DJSA 2EC9T 3ULVE 2P8LB 4AEFA 1FL5A 2XG5B 3DV4A 3LN9A 2DM2A 4EKXA 4KX8A 4W93A 2KH2B 3ZZLA 4K3JL 2UWEA 3FQ4A 1UC6A 4PRAB 1QFUL 5LWYH 3E3QE 1LMIA 2X09A 3DOHA 3L5WB 3QAZB 1EZSA 1UM4H 3GJEB 5DK3A 5E99L 4P5TC 5EC2B 2CBPA 2DMCA 5DWPA 3GMMA 4N2BA 3MRMA 2BHUA 4WTZA 1GGUA 3CFKB 4MJID 1A1OB 5GJSH 2E9GA 2RCSH 3RDTB 3JBG7 5FUOL 1IKOP 2MSPA 4Y4FC 3V2AR 5EEZA 3OV6A 5EU4B 1TQCB 3FFCE 3VD2A 4X5WB 4Z6AT 3AG2B 5CSBA 3GDCA 4HUNB 2VSMB 3RWEA 4ZTOH 1ADQA 5HHOA 4NQEE 5EO0B 5FUZL 1S8DA 3O3EA 1I85C 3CVHA 4FMKA 3WFEH 3KVQA 2RGSA 3X3GH 3GGWA 4QRFA 4LU5H 4YFLI 1S7TA 3L7EA 2CHDA 5GRZA 1O75A 2GKIA 4J3OG 4KNUA 1KC5L 1FNEA 3D25B 3NIGE 4KJPD 4U4BA 4OZIF 2AXHA 4YBQD 1QSEA 4MNGB 3UCRA 4J39A 3DX3A 3QISA 1OF0A 4M6NH 2IIJA 1WBXA 2P8LA 4XE5B 5F7MC 2QR0B 4ZSOB 4IBUA 1LO4H 1QW9A 2IWFA 2BVEA 1MCPL 1MH5B 2UXGA 1HAUA 4GS7C 1E4KA 1BOGA 2X2UA 1C8PA 4IRJB 4IRSA 1EXGA 4G7YH 2OL3B 4ZDHA 1DVYA 5J1TC 4NO0D 1X5GA 3SYPA 1F4HA 2B14A 5GIRB 3FOLA 2BJMH 2VLKB 4NP9A 3C5ZA 1YNKL 2CAKA 2EEXA 1VFOA 1G0DA 2FBRA 2N3JA 1CF8H 3GBMH 5DEGA 5E4EC 5IROA 3SCMD 1S7SA 4G2AA 3SPIA 1A7RH 3D69B 5AFAA 5I0VA 1GYVA 3L4YA 3CAFA 1MLBA 4GP4B 4NXSA 2A83B 1ACYH 4LEOA 2DQGH 4FHJA 5DJAB 3BT0A 4APQB 2J6WA 2VWEE 1L6XA 3CC1A 1CLOL 1NOLA 4ZTOL 4N2EA 3RWIA 3VFWB 1HOEA 1H9VA 3G5YA 2WW8A 2ED9A 2EIEA 2NY1C 4AQEB 3WMSA 5E9DE 1G7IB 5HYJE 5F7EL 1NIAA 4J3WA 3TBVB 1PX4A 2A9DA 2BNUA 1RY7B 3KYAA 4ADGA 3HRZB 3H42H 1RK1A 5E2UH 4XWGH 4X4XA 1CB4A 4LP4A 5AYQA 3VH8A 1KC5H 4LDOB 4P46A 4KKZA 3NSFA 4I18A 2AMUA 1AOZA 1EBAA 1QLRA 1RLWA 4OZ4B 2X1PA 5F93C 4UV4H 1LDPL 3KDMB 3NCFB 1U6AL 1MREH 2QKIA 5F7LB 4N5ED 3T1FB 1LE5A 4JGUA 3V4VH 2O4EA 4YDVA 5J06A 1U8NB 1NTDA 2ZKHL 4NYLA 4PW4A 5ETUB 2A6IA 1LXMA 2GK2A 3IKCB 4W9GC 3KGUA 1XGPA 1LEIA 1HAWA 3PDDA 4MZ3A 4QHMB 2A9MH 1JNHA 5EUOE 1MAJA 3HKZA 4YHLL 3D2TA 3IPFA 1OGTB 1YUHA 4Q0XL 3SGKC 1AP2B 3MA7B 4R6UA 2UZPA 4ZUUA 5GSRA 2EDEA 2G2RB 1I7TA 4ZFGL 4KHTL 2XACC 4HJGA 5KZCB 4QGTA 4E9RA 4ZTPL 2R2CA 1E9PB 3WU1A 2F54B 1WPCA 1VESA 4OLVL 1L9RA 1ZLDA 2VO5A 4IJTA 3KPOB 4LZKA 4AKPA 4U6YB 4EUPA 1MQ8A 5HP5A 5CIPA 3WXWL 1OE1A 2F8VA 4HBCH 3AQYA 3MODL 4FQQA 5JR1L 3VYNA 4C58B 1LE9A 1YHPA 4XI5D 2EIZA 4HLEA 1EO8H 4E5XG 3H9SB 1HCYA 5ESAA 1XGTA 3WTWA 3RG1C 3EHBD 4LHUD 5A3ID 4A7UA 3R1GH 5EBGA 3D39E 4X0KA 4A6YB 4NAMA 4YPJA 4RAVA 1DVFA 4N0UA 2F5AL 4PJAB 3V79C 3PWLB 5EUOB 1YNTA 4GSDL 5JXEA 4MS6A 3LNDA 3MV8B 2GB2A 1WFUA 4LE8A 1IRAY 5KBMA 5JUEL 5I1EL 3S0PA 1FA4A 3U9UA 2ITDB 3F05A 3ZKSD 5LGHH 3SYAA 3BP7A 2X89D 1JHKL 4PJ8A 3BFWA 2SEBB 5IV2B 4JRXD 4NAQA 1GOGA 4FQPA 4S2SA 2WBWB 3QWRD 5GGQH 5K9JL 4UT9H 2ZX7A 1QATA 3DJTA 5A7BA 4F5CA 4G5ZL 1ORSB 4WFGD 4QJ4B 3L3JB 3QDGB 1OW0A 3TL5A 3B9DA 4NUMA 4XBPA 3RYMA 3C09B 3BIKA 1KNOA 4B3VA 3T6ZA 2PMZA 4P5TB 4MSWB 1MIEL 2VXTL 4JO4H 4HJEA 4MCZA 3SBRA 1AZUA 2XVBA 3WY2A 2AJYL 5EEUA 3FL7A 1AIFB 3K46A 2Z7YA 1DVFD 2V3DA 2BCKB 4S2SB 3EZ8A 4BHUA 1AQHA 3OG4B 1DE4A 1YEKH 4UOZA 3WLWC 2BMKB 3QIBB 1URLA 2MCMA 4L4TE 1YVLA 2HRPL 4HPYL 4J4PA 2WZ0A 1NMCC 1YY9C 5D7EA 3KBPA 3LB6D 4ZYKA 3JT2A 3ZGIA 3PWLA 5EUOA 3U25A 3TBSB 1MJJA 4PBVC 4BK5C 4CADA 1A9EB 3MGAA 4UT7L 1D5ZA 3VXOB 4Y4HD 3I75B 3S4SA 2WSDA 3GMRA 5J6HB 3P73B 4ZXBA 3EIFA 3NCBB 1QPXA 4GIPD 2CCLA 5FKPB 1QSEE 1WRFA 4FFYH 4N8CL 3DROB 1TO5A 4YXKL 3MTRA 4NC1C 4PCKA 1FL6A 2PPAA 3VWJC 1A9EA 3W0WD 2IFFH 1Q0YL 3OGOE 3QNZA 3HB3B 2PWDA 2OSLA 4GUPA 4YHKL 5DC0A 3TBSA 4Z23A 3G5ZB 3D3VD 1ETB1 3Q44A 5HHOE 5I26A 2KPNA 4KV5F 4J4PC 5I17A 3ZMEA 3EGSB 2APSA 4XBEH 3T09A 2WMPA 5HYJA 4KV5E 3N1GC 1JZFA 4GXVL 3DVNA 3SPGA 1MFEL 3MXVL 1N67A 2X4RA 3OMZA 5DO2C 5E2VL 3LKPB 2HFEB 2AW2A 5F88A 2VZVA 3ZT6A 4GQRA 2DBLH 5MI0B 5EZJA 1TYJA 2BSTA 2DWTA 2KMWA 3NSCA 2APBA 1ORQA 5LAPA 5TK4A 2YD9A 3RPBA 1CT8A 3TV3H 3T1FA 3K6SB 4XNDA 4XVOA 3MCG1 1S7VB 2BVPB 2Y06H 1UKTA 1IFHH 3FCSB 3VTTA 4XB8A 1JGEA 5FHAH 1G4RA 1FYTB 5D7IB 3WY4A 4HKBB 3CSYB 5HVHC 4GH7B 5IV2A 2HFGL 1YY9D 5IB2A 1TT6A 4AVKA 2M83A 3HRZA 3LZNA 3QUZD 4M7KH 3B2VL 3RVVD 2DS4A 2XKNA 4RGNC 4U7MA 1JERA 3MV8A 2CMRL 3SJVE 3ULUL 4V33A 2JMRA 3UPRA 5HDQH 1KG0A 3KW7A 1J8RA 5I1JH 1EDQA 4M93C 5FM5O 5DYOA 5FA3B 2QV2A 4HLZH 3RB7A 1NAMB 3N41B 1TZIA 4GSXA 2N1KA 3BKJL 1A3ZA 1HXYA 4FFZL 4QT5A 3NJXA 4ANUA 2EYTA 3V7MA 2VN7A 4YR6B 4YDLB 2EYRA 1S3KH 4HP5A 3W82A 2J8UB 3MBEB 1SRDA 1VIWA 4U1KA 1FFNB 2GC7C 3QUZB 5C08B 5GZND 1JYWA 2HXAA 3IGAB 4HHAA 5HI5D 2MEJB 1ZV2A 4CSZA 3FB8A 4WO0A 5TE4H 4HT1H 1E9PA 1ZLSL 1I7RB 2Z9TA 4EZMA 5IEKA 1IGFH 2MFNA 4QRQA 4UQAA 1AANA 2FT8A 4MYWB 4U7SA 2ZUYA 2IGFL 1OTSD 1M7IB 1Q72L 1A9BA 2YAFA 5I15H 3ULVD 1CMOA 5E0FA 1EFXA 1DANU 1S5HB 3ZO9A 3K72A 1P7HL 1EFQA 1E0OB 2B4CC 4AYBA 1KYFA 5DVKA 2E27L 3FQWB 3M8OL 3OSKA 5SX4I 3MXWL 5T5NG 1XXDC 2OFQA 1TVHA 5CU5A 4EOWL 4J6IA 1TCRA 2DJ4A 3APNA 2ODHA 3OG6B 4K9EL 4NYLB 5AVUB 3AS1A 4FC3E 3D1MC 3QBTB 4DN4H 4YIQA 4AK2A 3O3EB 1BVZA 1QRNE 4PIRF 4MMZB 3A67H 4Q14A 5T3ZE 5HHOB 4LCWA 4TUKL 3GBLA 1RUPH 2F53E 1BQSA 4G6KL 4OUUA 3VH8B 2ROXA 4J6RL 4NENA 5E51A 4P46C 3BWUF 1PSKL 3GXNA 5D1ZC 2ADJB 3BD4A 2VC2L 2YZ1A 4K94L 1PCSA 4GSQA 2OMNA 1AY1L 2G60H 4PRHA 3TU6A 2WBJA 4FTVA 3ZTDC 4AYGA 3NEEA 1NKRA 3MUJA 4PJFA 5F1NA 3CFEA 1YAZA 2VQUA 5LDUA 3QZLA 4FG6C 1IV8A 1GC1L 1XEDA 3ULUF 1JPGB 3KWWB 3TH4T 2R1XB 4QXUH 2IGFH 4XXWC 1D3CA 3EAKA 1MZZA 3IXAB 4LSVL 1RZJL 1U8LB 3ULSA 3N9GH 1AHKA 1MXGA 3QB7C 3V0HA 4Q9RL 2HX9A 3MJGX 2WWOA 1ECZA 3CHPA 3TJPA 1JNJA 1AR1D 2QSQA 2BIHA 2BRQA 3S8FB 2ORBH 3ESOA 5ADOH 2XTLA 2R59A 5HVGB 4QRPA 1FSKC 3JTSA 4YNYA 1OLZA 1NDGA 1Q1JH 4CMHB 1KELL 3Q13A 4KY2A 2VUYA 5IVNA 4LLWB 3CVIL 3M86A 1CVRA 2YD7A 3JV6B 2FJHB 3OHXA 4M29A 4MAUH 2HUHA 4OF8A 4PJFE 1GJWA 2E9IA 4ORGB 2JB5L 3BT2L 5BPPA 5IZ7A 2AITA 2TSBA 5D8JH 3VXNB 5I9QC 4JQIA 3QAQA 5FYJE 3AU0A 2UXTA 5CMAA 1H5BC 3CQQA 2AJXH 2CJ3A 5L8JB 4YDKH 2GI7A 4QYOA 1ZHKA 3QUXA 3NACL 2VDQB 1QW8A 4WW1B 3QWRA 2ICWJ 3BZ5A 3MRDA 4KXDA 1JAEA 2JXMB 1BMGA 1U8OA 5CCKH 3HVDA 1J5CA 1WF5A 1TDQA 4U1JB 4PY8I 4W70A 2DKSA 5BRZA 4KQ0A 5DO2D 3BFOA 1M2VA 4PI0A 1LQSR 4JGMA 1WFIA 4GLRI 1CU4L 4NQCD 5FO7A 3EBGA 2CA3A 3X1EA 4Y4FA 3EADA 4YBLB 3WIIL 2CO2A 4G43A 3ULSB 5ACZA 3GUTA 4D7BA 5T33H 3NJGA 3IAGC 4JR9H 4PQXA 1VKXA 2NUPB 2YGPA 4WO4B 1Q94A 1IC0A 1BD2A 1IGTB 1G9MH 3AQZA 3GSNH 4N2HA 4F7TB 3NGBB 2QTEA 1OCZB 5T5FL 4MDJA 4ZFQA 1A4KB 3WXVL 1HZKA 3IGFA 3STBA 3HA0A 1AYOA 2COVD 1A6WL 1R3JA 4DERA 3CXHJ 3MNVA 5MEQB 1HX0A 4DEUA 3HB3D 1OW0C 5F21B 2DB8A 3N41F 4ONHA 4YSDA 3CPLB 3C5SB 5GZOD 1O6TA 1P7QD 3FK3A 2DLIA 2WNWA 3NH7L 4ONFL 3FTXA 4PJEB 4O02A 1GC1C 2NY2D 4P4KD 1KLFA 4BKSC 3UGXA 3MOQA 4GB9A 1FGNL 3S35X 1F42A 2ZIDA 4RFOL 4ZXBD 4NWUL 3M07A 4FE9A 2G5UA 3QIWC 5CLZA 1GW0A 3B2DC 2H1XA 5JHDD 4CC0A 1Z0NA 2P42B 4U6HB 4UV7L 3QUMA 5SV3A 5IW6A 5M95B 1JPFB 1T2XA 2E7LC 5C0AD 1NLDH 1NOAA 1MUJA 3IKKA 3FRUA 4U3HA 2OX5B 3E6HB 3BP6A 4FXGA 4P8QA 3RP1A 3DV6B 5I18H 3RNQB 3BPLB 2V9QA 1ANUA 1CG9B 5DRZA 1NGYB 3CZSA 2CK0H 1D2PA 3PDOB 2RB8A 2AQ2A 4QOKE 3R06B 3L5HA 2ZUSA 1SFDA 3GB7A 3UTOA 3QRGL 1T3FB 3WKNA 2F53B 3O0RL 5DJ8B 5L2JA 5B7MA 2I9TA 1KGJA 5DD6B 2K8QA 2V0AA 4QHPA 2NNCA 5EU3B 3L9EA 4FQXD 4LIQL 3UGEA 4KK6C 5IMLA 1MFDH 4P4RB 5JDSB 2Z8SA 2GG1A 1NBVL 2WNXA 5HHNB 1XD1A 1EJ6A 5CD5C 3CVBA 3UMTA 3WNKA 5J1AB 3EOBB 2WYZA 1PLGH 2VGLM 1OALA 4JPKH 3DETD 3HMWH 4OY9A 3MLSL 3CZJA 2WVSA 3WY3A 3T2PA 4KC3B 1ZLVK 4UIMB 5D2NC 4BELD 5DT1L 4Z7UB 2BP0B 5INDA 3MRIA 1BF5A 1TEYA 2V9TA 5F1KC 4WI7A 2J1XA 2ARJB 4IRZL 4PGBB 1WITA 3EYVB 4HSAC 4N20A 5JW5A 3RX7A 1IZKA 4KOCA 3AGWA 1X7QB 2GJ6A 3QZOA 4H2CA 4WTXA 1BQLH 1U95A 4KPHH 4HULB 5DVPA 3VSQA 2F8XC 4I18C 5DDHA 4ENEC 3GMOA 3ZHLA 3REVB 3VD3A 5F7HA 1BZ9B 5IESL 1H3TA 4FP8L 5FEBA 3FUMA 4UM9D 4KRPD 4EN3D 2KPWA 4ZOBA 4UBDC 1PDKA 2NYYD 4QHLA 1DBKL 4JHVA 4FZ8H 3O4LA 2IOMA 5IVXB 2HMID 2VDQH 2V5MA 4GAYB 1INDH 4M61B 5C07D 5F3HB 3DVIA 3OR7B 1XDTT 3FN0H 4Q89A 4QUOA 5JR1H 1JHLL 1FLTX 1OARH 3MKKA 4GG8B 3WEXB 2F9BT 5C0DB 3QXDA 4AUJA 1KIUA 5DJDA 4AGLA 3GHBL 4NQSB 1HHJA 1XD0A 4WY7H 4JEGB 5AVVB 4KX9A 1IGYB 4DGIL 2KDGA 3MLXH 3NVQA 5D7SL 4JZOB 3ETSA 3PWJB 4Z7VE 1HHKB 1EERB 4PREB 4UB0L 3VI4F 4PSRA 1SN0A 4OD1L 4JB9L 2VO8A 3VSVA 2CBOA 1DFBL 1CFQA 1EK3A 4NHUA 1NIBA 1J5OL 4F57L 1A7QH 4F80A 1E4KC 2WV3A 3PE9A 3EJRA 3ZDZE 3QNZB 3AG3B 3GLEA 4UZUA 5C7XL 2VISA 4NN7B 2A2QT 4MB3A 3D0AA 3Q1SH 2DD8L 3QNYB 4I3RL 3TCXA 5DJ6B 2NXYD 1J18A 3PNRB 2UY7B 1JPST 2C8NA 3SDXF 5I5MA 2DI9A 1CD0A 1ZVSA 3VXOA 2H9GA 5IVXA 1DVQA 1AZZC 2L4OA 4HIIB 2WTPA 1EAOA 1ID2A 1ZEAL 1LNUA 2P5EA 4ONGL 1XCTA 3ILEA 2ZT9C 4X4ME 1SMOA 2NW2A 5HJBA 1WD8A 5E9NA 5FUZH 3BO8B 5IW1B 3VNZA 4Z0BH 1ACZA 5E5UB 1GGTA 1KV7A 3HBQA 1RCYA 4GJTB 4L3ED 1QSFD 3DRTA 5I19L 5L7XH 5FGCB 1FFPB 1W72L 3U82B 1OKEA 1S9YB 4F93B 2J88H 4X9HA 3HZYB 1WAAF 4NRYA 1ICTA 1MCCA 3TBTA 1NL0L 1U3NA 4BK8A 3RILA 5CD3A 1ROWA 1I8MA 3ARED 2YSTA 4X0NA 5J6GB 1AXSA 3HG1E 1RIUL 4LDCA 2W9DH 4XR8C 3PL6D 3B83A 2VLKE 4PRDB 5IHWA 2XTJE 2XZAH 4B95C 1NFIB 1MCWW 1NMAL 3N5AA 1C1EL 4YDZA 2DIJA 1DN0A 2XZCL 1WDAA 3MJ8B 4MJ6B 1CO1A 4NQVA 5HGAA 3KGRA 2OYMA 3HC2A 3OLGA 4FMFA 5IBTL 1LDSA 2Y7NA 4MA1C 5EN3A 3UAJD 1YYCA 4BE6A 2P49B 1W0WB 3VYOA 5T3XE 2Y25A 4C54A 3MO1A 2V2TA 4PRBB 4P5MA 4LCVA 2ODIA 1IQDB 3C6LB 3OAZH 4IS6A 4PRIB 1E3XA 3SKOB 4X7SL 2WAQA 3LMJH 4Y4HA 3ZBMA 3RLSA 4DAGL 2ZWKA 4P99A 1GJIA 1DQJA 5DQDL 4MJ5B 4M9PA 1XF5A 4V1DB 3C2AH 2F54D 5K59F 4YX2H 1NFDE 1ADQH 1HESA 3CDGA 3OVUB 4F7MB 1N18A 2GIYA 4HX1B 4F2FA 4XCYB 2EUZA 5BOZG 5CP3H 4MAYC 5EU7E 2IG2L 3ULVH 1W91A 2F54A 1IC1A 1F18A 3EDJA 1AQMA 4P2QB 4L29B 3VSUA 4HV8B 4QWWD 5SX5H 3ZKNC 5I8OH 4JDVA 4KXZI 2XSKA 3QUYA 1H15B 2FQGA 3OGCA 2GSGB 4KJWC 5GGRB 3AC0A 2YSSB 4JO2H 2BVQB 5JUEH 3ULUE 1RZIB 4UQ2B 1OQXA 2QPFA 2GBAA 4X7CC 4N1HB 3CFCH 3RIKA 4AXWA 5GZOA 1BVLA 2V3FA 1A4KA 3HPJA 5HDBB 2O1AA 4HFUH 3EXLA 4PWHA 4OLZH 5F7DB 4ETYA 1FJ1A 5CLYA 1E7UA 3S7GA 5L88H 1KSRA 1ZA6A 1JPSL 5E9DA 4HUUA 4HS6A 2WSKA 2H26A 5IQ7L 1N5AA 3MUGA 1SOSA 2NW3A 1U3HD 4XPTH 4WEBL 4RA0C 2K9FB 5J8OA 4I18B 1O6SA 5F7AA 4HCRL 3UTQA 5B39G 5I66B 3FHQA 4JM4H 4L9LB 1Q9LB 1OP5H 3ZE1B 5LAXB 1N3NA 3N06B 4L3CB 3SDAC 2VIRA 1U8PA 4D0BA 3IDNA 2WB7A 3WKML 4ZG1A 4UQCA 2R7EA 5CP7B 1AMXA 1DJGA 1FPTH 1PNCA 4ABQA 4XCFH 3JV5A 1XBDA 2W07A 1XZ0A 2AV7A 4U3CA 3RNQA 4FYSA 2YS4A 2JIXA 4I77L 4ZJ9A 1DQML 2P5WA 4OJCA 3ESMA 3NIFB 5E1GA 2WTRA 4WK2B 3LRSA 3ZKMC 2R0LH 2XFXB 2GFBB 1S7UB 2P47B 1KACB 2NSMA 3KYOA 5AZUA 5KYUA 4Y5YA 5GGVL 4EVNA 2FNWA 1TZGL 2H3NB 1KFAL 1ZV9A 3FFCA 3KPSA 5LGHL 3G08A 5DFWH 3ZZQA 2R23A 3TWYA 4AT6A 2QVIA 3V4PB 1C9SA 2Z31B 5D7JD 4NI3A 3AB0B 1XH3B 4N9GB 2O61A 1OO2A 3V5KA 1CURA 3LEXA 1C08B 3QA3B 4HUVA 1T1XB 1BQ5A 5FIEA 2G0KA 3AG4B 3K5SA 4I3SL 1QBLL 5AYUH 3MCLH 3V9FA 3VTMA 4J3OC 2QR0A 2VOTA 2ZOOA 4HJSA 3UG5A 1PG7L 5KG9B 1B4JH 2BC4A 3TA3B 1MY7A 3MXWH 4Z7QB 1MLCA 2NR6A 1G1YA 4DQAA 1EZVY 3SCMC 4G9DA 1E43A 1HOCB 1A3LH 1PKQE 4NN7C 2YK1L 4WKXA 2WJ5A 5F96H 4F7PA 3IXTA 2BP8A 2BIQA 3WJLA 2F74A 5IWLC 3JV4A 4OZIA 1BYOA 4IU2B 2N0MA 2WZAA 1KB5L 5FF6A 1R5VA 3UFIA 2WQAA 3IN0A 5MEND 1O0VA 1RSFA 1RZGA 1PG7X 2V2XB 2ZNXA 2J55A 3KJ6L 3N40F 4PJ5D 3V0WL 3X13A 2XZQL 2OMVB 5EMYA 1G87A 1GYUA 4G7SB 2OMZA 4G8IB 4JN1L 2V2XA 4M9OA 2ALAA 5F96L 3I9IA 4U6VL 1YYML 4Z9KB 2WN2A 4OFQA 4B3EA 2YIHA 4EXPX 1IAKB 1MWAH 1VZHA 2DV6A 2QGDA 4IU2A 4QOKA 2GUYA 3IB4A 4UYPA 2H4EA 5D7JC 3S36X 4WWKB 1NEZB 4XB7A 3OC8A 5B39B 3BVTA 1TCRB 1FN4B 3RKPA 2BSDA 3S48A 1E6OH 2AXGB 5AW2B 3TEZA 4JZJC 2PP8A 1TQWA 4W4OA 3BH4A 3UAJC 4PJBF 4D9LH 3UACA 5CU9A 1XB3A 4HA1A 5AD0B 1J8SA 1IB5A 5KYYA 1NGXB 5DD5L 3PWUB 4LVEA 1BMWA 4MNQA 1RIVL 3VFMB 4AW7A 3QQDB 4YSUA 1D9KB 5C8JB 5IFJA 1E67A 4LEXH 1I75A 1K8IA 3OR6B 4NC0B 4OD2A 2G75A 1QZNA 3BQVA 1YEWA 2YFOA 4RSVA 5ANHA 1B0GA 4K3EL 1NCBL 5EHFA 3EGXB 1N19A 4LSTL 1QO3B 2AQTA 1QHPA 1L7TL 3H54A 4ATTA 4DGIH 2O61B 4ATWA 2IBZY 4OLWH 3RJDA 5E94A 1LM8V 3OPZH 2R23B 3ZL4H 1T2JA 5D93C 3RU8H 1E28A 1GGCL 1PSKH 2KQNA 3L3GA 1HI6A 4M4PA 4XPGL 3BQUC 2YBRB 4WK4B 1TQCC 4MMYA 4AC2A 5C0CA 1GSKA 3I9PA 1AZRA 4UDUA 5IUCA 1T03L 3MFFA 1MJUL 4QRTB 2FT6A 1CFBA 4ZUSA 1NINA 3P9LB 2EDYA 4M7KL 5DC9B 5DHYB 1BIIB 1SY6A 1KTRL 1NANI 2WLIA 4IIZA 1X9LA 2JQAA 4NO0A 1MPAL 3QJQB 3O8XB 3IU4H 2ZPKL 4LT7A 3TYGH 4JFFB 4LLMB 5IUSA 2OMVA 4NENB 4ZO7A 5BMFH 1LEGA 4AQAA 1O6SB 5DZAA 5KS9B 3BAIA 1A66A 1QACA 1QR4A 5C7ZA 5DFAA 3PFQA 4F2MB 1DTUA 1BM3H 1KCVL 1KPUB 1OVZA 2BP8B 3FXIC 4Y2OB 3EH5B 3T6XA 1DVUA 1TVHB 3KDPB 4OW6A 1P5UA 1NEPA 3SPVA 3H7BB 4NFBA 5IMKB 4N1CA 2VDPL 2ISDA 2WZ6A 3N44B 2X1XR 4NZTL 4GKLA 4KGJA 5KG9A 3MRCA 3SB3A 4GAAA 1F11A 1RLBA 1PZ2A 2WKGA 4JDZA 3ZE2F 3H9YA 3QG7H 5T1KD 4J3BA 1DZ0A 2Z1PA 3T0ED 4LSPH 5KOMC 5C0RL 1BVKB 4YGAB 3ARBC 3VFOB 3KWVA 3O11B 1J5HA 3CFDB 5D71H 5EU5A 4PVBA 4M5YH 1ETZB 1G94A 1UHVA 4FQIL 2DL2A 3BN9D 4NJAH 3GTTA 1OAUH 4TL5A 5K1VA 3H9HA 1FL6B 4XRCA 4AZ8A 1QFUH 1OWWA 4HIJB 1JZ7A 3IWUA 3MXVH 5E2VH 4IBQA 5DS2A 3KL0A 3LRSB 4R0LC 4D9RE 5BZDB 1JZ4A 4GY4A 2YQ3A 4KH2A 2QPUA 1EA9C 2XTSA 4KHXL 4C55A 5L8KB 3KPRA 3T8VA 3PWPB 1VPOL 3ARFB 2HJKA 2NUTB 2R29H 4CADB 4CVWA 4OZFB 1HHGB 4A2LA 4JFYB 4CVXB 3L5XH 5DT1H 3N40P 3IS0X 2JVUA 1UFUA 2Z31C 3C09C 4OI8A 1JGDA 2NY1B 4PGDB 4A2FA 2X0WA 4NKDA 5GISL 4KY1L 1H0DA 4BGLA 3EO1A 1MHPH 3VM5A 2LAGB 1A14L 1RZFH 4LGSB 4JFWA 1B9KA 1AGCA 2JFCA 2G5RA 4P5KB 5E8OA 2HRHA 3S35H 1UTDA 3MJ9H 1HZHH 3NJJA 1XGYH 3VD7A 3FF7A 2D73A 3EJJX 1HINL 4XVSL 4IDLA 2CJUL 3ZQWA 1SY6H 1CCZA 4Y5YC 4DHLA 3F01A 3DGDA 1RMFL 5A3IC 3DRQA 3I9GH 3PGFL 5JA9A 4MRCA 1QBBA 6TAAA 4X83A 3LKPA 5F88B 4J2QA 3TPUB 3HZYA 3L7FB 3G9AB 4G11A 5DS8B 4MDRA 5T5FH 1RSYA 2ORBL 1JZEA 4RQQB 5ADOL 1K2DB 3FUNA 5HHME 2BVQA 1UXWB 1UA6H 4TL4A 3MN8A 4QXWA 1X5XA 5JPMC 4TSBH 4K0OA 5I6KA 3OM3B 2Q20A 1YNTF 4TULH 2A9AA 1RJLB 4FG0A 3RGBA 3WELA 3VACA 1YN7B 2VLLB 1CICA 4A7VA 3P11H 3B7TA 2XBZA 5INCA 1S6NA 3WJJC 4KH9A 4XCYA 4HOWA 1RMFH 1BQUA 5CEZE 1DLHA 2H9GB 2B08A 4OQTL 5C07B 3CDGB 1D5XA 1FZOB 3T3MF 4XB3A 2WXKA 3WN6A 1YQVH 5FYKH 3H9SA 7PAZA 3DNKA 3GKZA 4HJIA 4KUCD 5J12B 5CKAA 2MPAH 7FABL 4YSRA 3HBZA 3FRPA 3QFJB 3WSQL 4FQQB 3DX9A 5FFOA 1X5JA 1F2QA 4EAEA 2H8PB 4PJ9A 1Y07A 4NHUB 2Q8BH 3ZMRA 4DGYH 5I73B 1NCCH 4E36A 4ONGH 4ILDA 1RUPL 1E4WH 3UTPD 1OE2A 5D4QA 4MGXA 1EO5A 2WXHA 2DQDL 4ZFOA 3CBRA 4F57H 4PREA 3QH3B 1V3JA 4RZKA 1QSVA 1ZS8B 4JPVH 4PJ9B 4JRFA 1BP3B 4F2EA 3CSGA 1UD4A 4N2FA 4QIRA 4PW3A 1L7TH 1E2ZA 3FH7A 3V4VB 4UIKH 4U0QB 3QXDB 2AK4B 1BWWA 1DQLL 2EXTA 3CLEL 2YWYA 4H8UA 4WJG3 3ABZA 1G5GA 3HS9A 4XPFH 3IF1A 2M2DA 4JCMA 3VDCA 5JHLH 1IGMH 3TBTB 1D9KD 1QLRB 4OZ4A 4KO5A 4WV1C 3O8XC 4FG2A 2CALA 2YPVA 3RURA 3KR3L 4JFVA 3V7AG 1R33A 3CMOH 4XMXA 5B38B 5JXAH 2A6KB 3NFPA 1I53A 1UJTA 4JRXB 2FCBA 4Y2DB 5C09E 2YUVA 3SE8H 4HVBA 4NPJA 3ILPA 3W9EA 5FV2A 1ZXKA 4Y2LA 2Q6WA 1FC1A 4HWBH 1MFAL 2JNZA 3AZUA 2C26A 4NZTH 4FLQA 5C6PB 1O7DE 1RULH 3FO9A 4D8PA 1FVCA 3B9VA 3KCPB 1V54B 1BXAA 3ZKQD 3DPBA 5E1AB 4G59C 1MREL 4DK5A 1AGDA 4AL8L 3SKMA 1P4IL 1Q38A 1XH2A 1TTFA 2PO6D 5L2KB 3DRQB 2J21A 2IQ9H 3IPBA 1IGIL 1T04A 4AIZB 4WGWB 3NT0A 3JYBA 3EYOB 4WW2C 2MIZA 1I3RB 5E6IB 5DEGB 4FG6D 4MCMA 3OKNB 1PLCA 4ELMF 4IU3B 5J1AA 1BXVA 1KDIA 3FOLB 5EOCL 4U6TA 3NFSH 3W1ZA 4WHYH 2J5WA 3GPEA 2Q3XA 1SVZA 3N1FC 3QUGA 1QP1A 3JXAA 5HPOA 1INQB 3K0WA 1JGLL 3OXSB 3KLSA 3O3AA 1I8AA 1L9MA 1AVAA 3P9MA 3VGHA 4B50A 2BWIA 2CXKA 2W65A 4P07A 1DQVA 4FG4A 5F1IB 1KN2L 3HUJB 1SDDB 5TDPA 3UDWC 4OV5A 4U1GB 5KBDA 5EU6B 4ERSL 5LLIC 4M7LH 3UPAA 3PGDA 1G7PB 4TOYL 1U91B 1CGVA 1PTZA 2R1YB 3D3VB 4HWBL 4GAJL 4NQCB 4WRLA 2BDNH 3HC3H 1TQVA 3WLBA 4LHQB 1AXTL 2YRBA 1P4LA 4MJ2A 1EUTA 3S37X 5I74C 4Z3GA 1MW2A 3F7PC 5A2BA 5IB1B 4P46B 4UNVA 2MCPH 1CXFA 1UD3A 3TN0C 2AQPA 4TVSa 2CKNA 3HAEB 1U95B 3ULVC 1X44A 4BFBD 2EEBA 3OX8A 3WS3B 2AQRA 3CFKA 2HX7A 3AVEA 5CBEB 3MNVB 5MEQA 4N0UE 1OCCB 5LWYL 3VFWA 5K69A 3V52L 5INDB 4IKLA 5D9SA 3TH3T 4LSRL 3UZEA 1RZPA 1F4WH 5DJZA 2LU5A 4UIMA 4LNRB 5CP3A 4EBQH 1UJ3B 4ZW7A 43CAB 1RIHL 1B0RA 3FTVA 3NSDA 5AL0A 4QAWA 4OJFL 2C3XA 3V4UH 5IQMA 3U2SB 1QUPA 4BSWA 4DQOH 4Q52A 4XMPH 3BDYH 1DQMH 3BYTA 4E9SA 2HLFD 1S5IL 2Y9RT 4PJ7E 3QZBA 1MCIA 1U3HB 4PSPA 2LU3A 4CU8A 4MD0A 1WTLA 3FFCD 4O2EB 3DXAB 2J3SA 5TFSL 4K73A 5I6PA 2N59A 4X4MA 1PZ3A 1K5NB 4G6AC 4HXAH 1V55B 1M6OB 3N44F 5KBLA 3ATAA 4FQHB 3VFMA 2VJ0A 4MMXB 4JFXB 2DZEA 4E41B 1B2YA 4ODSL 3R06A 4LARH 1E90A 2H0EA 1XF3B 3GIZH 1VFUA 3MFFB 5DU7A 3RFZB 4CC1A 2FLMA 4C4KO 2FEEI 3MLYH 4UUJB 1FPTL 3GXFA 5J1SC 2IV8A 2QV4A 3LPOA 1KLUA 4JCWA 1OXYA 4TQPA 3A22A 3GGWB 2Q10A 3ELAT 2FJHA 1JDDA 5KS9F 3ZDXE 5EBWB 4YPGA 4XP6L 1VADA 2EH8L 3NCEB 3FO1B 4ODVL 5GRUH 3CD4A 5A43C 5JQ6L 1FZKB 3RGVC 2ATPA 5A6IA 4P59H 5I24A 5TK2A 3LKQB 2B0SH 2H0JA 3Q3GA 4KKLC 5FYLD 1KB3A 4UAOB 3TS8A 3AXHA 4M1DL 1U3HA 3BUYA 3PV6A 4JHWL 5DCCA 2QLYA 3SDDD 5JQIB 2V4LA 5F0MB 1J05B 2NTFB 2GJZB 5GGSB 3X1FA 4GFXA 3SQBA 4HC1H 4OFPA 4AQOA 4H5SB 4FQJH 4DCQB 5DJZB 3WGUB 4PRAA 4FLHA 4G9DB 3W9DB 4BZ2A 5DUBB 3CFEB 2FSEB 3L5JA 3ABGA 4AJVA 1RP9A 2R15A 3HC4L 5HHXH 2X7LA 1KJ3L 2XG4B 1MCEA 1ZRUA 2LFEA 2X4PB 3RFRA 1BEXA 3RAJL 2Z93B 3HAEA 2F19L 1JPTL 2VR9A 2OLDA 3U2JA 3VGFA 4JKLA 3FS9A 5C08D 1PIGA 4MJJA 1JYVA 1JJUA 5HY9A 3CHSA 1L6PA 2Z31A 5F7UA 5DFVD 4KI5F 1FZKA 4Z0BL 4OD3H 3V6ZA 4G6FD 1RZGB 4QO1A 4UT6A 4IGBB 1W72H 4WW2A 1DQQB 1EO8L 3RWCB 5JYMA 2EKSB 4B9GA 1THCA 1EMTL 3SKUD 1XO8A 2F8IA 1ET5A 2P7TB 1KCUH 1A0QL 1VCAA 2YPVL 2NSXA 1AIZA 1QSFE 2MQGA 2P5WB 3CK0L 3HR6A 5TDPB 3IDXL 5DLML 3TVMC 5HHQB 4QRSA 1NFAA 3LS4H 1IGCL 1YMHA 3MV9B 4NQCE 2O6DA 4IJ3B 2QSVA 3CSPA 4JX0A 2NY3B 1IGJB 4ZFGH 3CFBB 2EDWA 2F2HA 4MZ2A 3QFGA 1QLEB 3OMIB 3FSOA 1U8PB 3B9KC 4FXTA 4GRWB 4LFHD 5FYJH 3DUUA 5LBSH 3NG5A 4EI5C 4H8PA 1U2CA 5IMOB 1WS7A 3QDGD 1V7MH 3ALPA 3VFNB 3M1OA 4F9PC 5KWYC 1HE8A 1G7HB 5AZEH 3ETBJ 5I19H 1FRGL 1M2OA 4LPYA 1I1RA 4OLWL 2VZTA 4Z7OF 2X70B 3AU1B 4R5VA 1PY4A 4I89A 3GI8H 1GHFH 4L8SB 3TT1L 3AW5A 2GFBA 4XMKH 2BS71 2NY6B 2NY7L 3P0VH 4PJCB 5DI8A 3Q7JA 4PJHB 4C56B 3LMJL 4DP4X 5CJOL 1CR9L 2G30A 1BM3L 2UY6B 3V0DA 3QUXC 4PV1C 1SLVA 4Q6IA 5KYNA 1AQDB 1G7LB 4U2YA 4ZUTA 43C9A 5HYSG 4MXWL 4AQZA 4UOW1 4XN4A 1Y18A 1KG0B 4OIAA 4DVRL 4JKWA 1ROCA 2IH8A 2FJGA 3GSQA 3HMXL 4XAWH 5EDSA 1UT9A 4PJ9C 4XPAL 5K1NA 2PP7A 1YEEH 5JOPD 4EDWL 2PYFA 2XPGB 4NM4H 5BV7L 2WXMA 4HKXA 5IVZB 1KPVB 4N2OA 3UBXG 2ICEA 2W0FB 4GI8A 5CEYA 3CHRA 3B9KD 3KZ8A 1YYLH 4HFWA 1TNNA 3HS0B 1I1CA 1G7MA 1NCDL 1UCBL 5L4MA 1UJ3C 2H26B 2CO7A 1CT8B 1PAZA 3K6SA 5IROD 1JZIA 2DLGA 1P2CB 5T1LB 2A3TA 4ELKA 4KRLB 4OV5B 1PFOA 2B20A 3G6JA 2J5LC 2CMRH 4G9FE 3MBXL 3BSHA 5T1DH 4ABWA 4EI5D 4Y2DD 1ZLWK 5A2LH 1UEMA 3DVNB 3QH3A 1S5HA 2Y7OA 3EFDH 2CIKA 1S7WA 3BKJH 3TTSA 1WCBB 1PZUB 4KX7A 3AXLA 4XMKL 1ZT4B 5C0GA 1QBLH 1E8WA 1NMCB 4ICXA 3MRJA 4MXQD 5B8CB 3VFRA 1YEDA 2J8OA 4PMFA 1OOWA 4CN1A 3VWKD 1Q4NX 3R19A 4GUPB 5ICZB 1LJMA 4HIXL 1G7QB 3GRGA 6PCYA 4XN5A 1UYWL 2CGRL 2GJJA 4POUB 4F33A 2AGJH 4LIQE 2APTA 4JL2A 2VAAB 4CSTA 3NAAL 1TG8A 3FQRB 3L45A 3K8KA 2CK0L 1DUYB 2VB5A 4PV9A 4KMLB 3SDXB 4FQXB 4N6RA 4PTTB 4PBXA 4YE4H 5C07A 3VTAA 2HMIC 5AG8A 5KVEH 4PRIA 3SKOA 2Q0ZX 3V0WH 4PS3A 4PJXB 2KDYA 5HYQA 5SWQA 1H6FA 2X6AA 5FV1L 4PS7A 4PJIB 1KJ2A 1SHSA 1N6QL 2B4CL 3C6SB 1BYNA 2HZHA 2GQHA 4WNJA 1MFEH 3VXUB 1K8DB 2GJ6D 5DUMH 1XL4A 4AV0A 5FB8B 2H32B 1T22A 3P4NB 4H1LB 4IRSD 4ACPA 2JCCE 1XCTB 2DJMA 3H9SD 1QRNA 3WJLC 5IWLA 2EO9A 4KJWD 4NOFA 3S97C 5G2NA 3E8UH 1NGPL 4LSDA 4P23A 4PCYA 2COQA 1ZIBA 2DQ6A 1JNNH 1UZ8A 2CJUH 1OM9A 1SMAA 5FFLA 1D6VH 3WHE0 3W38A 1C5DA 4PTUA 3BIKB 5CS7A 3UERA 5EZPA 1IO4C 2E46A 2H41A 3C2AL 3W0WA 2XU9A 1BQRA 3PP3K 4QDGA 3D34A 2W9LA 4H25B 3WUWG 2X4RB 3Q01A 4ZSOE 3C6LD 5GGRY 3IK2A 2V5TA 4YZFE 1EJOH 4LPCA 4ORZC 3BH8B 2VDLB 1A7BA 2P8MA 1EEYB 2EDMA 4JN2A 2UVEA 1B3IA 4F3FA 3WNNA 2A9CA 4LLVA 3KG5A 1BZ7B 5JXED 5I17B 2E76C 4TKWA 1AQ8A 2P8PA 1F8TL 3JTTB 1HIML 4UOW0 1A7NL 1WT5A 4PJIA 3P11L 1D5RA 3VJ6B 1IC5L 4FQXC 3KH4A 2DQDH 3K71B 1MHHB 1BHGA 1UFGA 1U8KA 4FTVE 2OXGA 1YY8A 4JHAH 3DX9B 4XHQA 3WDIA 4NQSA 2VDRH 4PP2A 4FS0A 3SZ6A 3F04A 2J8HA 1NA8A 5GS0C 2GCYA 3U79A 2WQVA 1XCQA 3T3ME 3QI9D 4MNQE 3L54A 2A1WH 2HG5A 4FULA 1BREA 3QNYA 3ROLB 2I7OA 4PJGF 1AD9B 2JI1A 3L9BA 1GKEA 1JGVH 1FZOA 3I75A 1AZBA 1YLBB 4GAYA 3S4SB 4K23H 2OXGB 2PUQT 3SDAA 3Q6FB 2BW4A 3LQZA 3FQNB 4KKBD 4CILA 1UGNA 3WL9A 3VFRB 2VMJA 5B3JE 3EOAB 2C3WA 2ZWNA 4OZIE 4PRPE 4X6BA 2BZ7A 2FYYA 1I7TB 4C8XA 1XL6A 4KKNA 1QAWA 2OMXA 3AADB 4KDVA 3QUXD 4F58L 3MLRH 4KO9A 2CPCA 4MQSB 4DO4A 2FBOJ 2JK5A 3QEQB 4P57B 1BOYA 5L0QC 4K94C 1QHQA 3QDJB 1BAFL 3S8WA 4J23A 3EBAA 2IWEA 3I2CL 1A1MB 2DAVA 3LRMA 3MV8E 4NKMA 4B9YA 2L7QA 2VR3A 4JFPA 4LLAA 4LSPL 4P23B 3MLYL 1CPUA 4JFDB 3FT4B 1P84K 4QHLB 3FH8A 4MASA 1SUHA 1TZ8A 2QADD 3NJIA 2QEJA 1K6QH 2RHEA 4KK8D 2H32A 3P4NA 2SEBA 4H1LA 1R47A 5D6DC 3VI4E 4APXA 4MAYA 4AWJC 5C0FA 1T66C 1HHIA 4HH9A 4JPWH 1TJGL 3TBVA 4IRZA 1NSNL 2AAVA 4TLKA 3U7YH 1A22B 5DMYA 1PYWA 2PPCA 3MRIB 1RIUH 4LP5A 4W4OC 3KPNB 5D7HA 4BQCA 4LVNB 3Q43A 3IN2A 4QR7A 1UM6L 2EUVA 4WI3A 2QELA 4Z7UA 5D2LF 4ZFOL 5BS0E 1H3GA 4P23D 1I1YA 1TR7A 5ESAB 1J9CT 1YMME 5T3ZL 2VAAA 4G7YL 5FOBB 3NZUA 5C2UB 5D1XB 2ICCA 3IDGA 2DI7A 3HG1B 5F7WC 2P43B 1UWFA 1VGKB 5DFTA 1ETZA 2ZF9A 5A7EA 3FTUA 1UB5B 2H45A 4H4NA 3C12A 5ILTL 3BP4A 3WYRA 1AZNA 3HJ0A 2D3LA 1S9VA 1GCYA 3BXNA 1IU1A 2VLJA 3EFFA 4P05A 3VQ1C 1N0XL 3LS5L 2F58H 1CDYA 1D9KA 1MOEA 4IOFC 4R96B 5C8JA 5IFJB 1GMIA 5D71L 3C8DA 4S1QL 3RDJA 1I1FB 1IC7L 2FJFB 4E41E 3WN5A 4EJ1C 1S9KC 5FO9B 5IG7B 3HC0B 3O2WL 4DW2H 3FPYA 1CF8L 1T66D 1OHQA 3Q8CA 4JPVL 3W39B 3KWTA 1JV5A 3G6DH 4N0FB 1E9OA 2ZSVB 3O9WB 3ZYIA 4HSQA 4N86A 1NIFA 3QJFA 3TNMB 4D0CA 2K9UA 2ZKMX 3DUSB 3D9AH 1BV8A 1NQBA 4FI6A 4M02A 4Y2NA 1S8DB 4JY6A 5CR8A 3K2IA 3VG9B 2ICEB 1IAOA 2ZSWB 4EN3A 3CFUA 1UVQA 4PM1A 5D7KD 5LGYA 1DBJL 1IC7H 2F6AA 4TS6A 4BSVB 2CR0A 4U1JA 1J7VR 2PKDA 1BXUA 3ECUA 4MKTA 5DHYA 2J4WL 2AABH 1SDYA 4ONHB 4UU9B 4RDQG 1AR1B 2QSTA 4IK6A 4LCUA 4ZUSB 1A47A 2ZUQB 4ZPTB 5ERWB 2OXHB 5KJ4A 5E1HB 3VVWA 1D5MB 3ZTNH 4X8JB 5E7BA 4B7IA 1TZAA 1VFBB 3GSNB 3SQOL 4LPUA 1MLCB 1MWOA 2JJVA 2PLTA 1OZUA 3BHBA 4MKMA 4X6EA 4HEME 1EEZB 2NUPA 4XOCA 4XMLL 5BVPH 3DV4B 4GIOA 1J0HA 1ONQA 1T03H 2E59A 1WGVA 4N2KA 3WE6B 3NJHA 4F7CB 5HHVH 3BJLA 1JXGA 2CLZA 1TQBC 2JB6A 3PNWB 4MLSA 4PJDB 4DP6X 2X70A 2UX7A 3HFML 3MNDA 4UCFA 4YC2B 3GSOA 5GSVA 1VHPA 1M2VB 4ENED 3F62A 2Q8AL 4WY7L 3ARVA 4IRSB 4AT6B 3EGXA 2FQEA 1FFQA 2Y0SA 3Q9QA 3UCQA 4NEHB 3B2MA 3L3DB 4RISH 4IRJD 2YA1A 2CLZB 3DHMA 4TQIA 3RUGA 3P2TA 2X9WA 1ES0A 4P3WA 1GZHC 1HZHL 1NFDA 2DMBA 1RURL 3R4DA 4HPHA 4POZC 3CDZA 3QHFH 3O2DA 3QIUB 1SPDA 4NZUH 4BZ1H 2BSSA 5GZOC 4NKOA 3L9RB 3ARFC 2I32A 3ZLQC 1NCJA 4Z77A 5EN2B 5CMAB 4BFNA 1A3QA 4PCSA 1YO4A 1R24B 1YQ2A 3CUPA 5CNHA 5I8EA 4FEIA 3WSQH 4ZXBC 1BQLL 1GZQA 4R7NB 4E41A 2FQFA 4L8BB 2VXVH 4AJWA 2VDRL 3QUYC 3WIAA 4E9LA 3GMLA 3Q5OA 2P5EE 4IGBA 1N3NB 4C4BA 1JL8A 4JHBA 4S1SH 3ZK0A 3H85A 3PXJA 1NDMB 4L9LA 4S1RL 5BW7A 2QSCL 4OM0L 2OP4L 2VQ1A 5JHDE 5JPNC 5HY9B 2AAAA 3OKMB 1H5BB 5AKRA 1JBJA 1KIQA 3HFFA 5TTRA 3RRQA 4M5TA 3S3SA 4ZS7H 4A2EA 4RIRA 3A21A 1RU9L 1WWCA 2G2NA 3L3OA 3IJEA 4Y0GA 1NLBL 2VXSH 2HN7B 1FJ1B 3L5WA 1X9RA 4M8RA 1MW0A 5LO7A 1KFAH 4X6FB 4DCQA 3LY6A 4TXVB 4GMTH 4Y9BA 5F1NB 3TVMA 3II2A 1DEEB 3BAXA 4TUJA 2X40A 3K72B 5EZIH 1WTGT 2ZYIA 3NJVA 2XX1A 4IMKC 5E8DL 1UACH 1P6WA 2Y7LA 3ASWA 5LNEA 3OGCB 1P4BH 4OGYH 2PXYD 5CZKA 4EI5B 4ZQKB 3UZQB 3B6SB 1KTJA 3GMPA 3V5KB 2A6DA 1I7RA 2K4AA 2PR9A 4ZMLA 3Q8EA 3FT9A 4TSAH 3V4PA 5C86A 5KSBB 3WTSA 3T6VA 1AGFB 2EDDA 3RWHB 1EANA 5AB9A 2YOAA 5M94B 4ODXB 2OCJA 2MKLC 5ADPL 4AMKH 3WLBB 3TURA 5GJTL 3JZ7A 3JVGA 4OJAA 1JGIA 3K1KC 4ZMTA 1VLXA 2EYRB 5LVEA 1M7XA 1C12A 4YHYC 3LDBB 1KCUL 2QFPA 1KLUB 3PU7A 4GXUM 4W1TA 5GS1C 1P9MC 3RL2B 3TA3C 4JFEA 4ALAH 3F5WA 3JT0A 2ZWYA 4GW4A 4X5PA 2ZCLH 4AQ8C 3OPUA 5I1KH 2FGWH 3QJXA 4XP1H 5E6RB 2X4SA 1J1PL 1W15A 4OCNC 3MROA 1L9OA 2Q9OA 1M6OA 4L3CA 3TZVA 1J0ZA 3VD9A 4YXHL 5I5JA 2OCFD 1NCHA 4D94A 1JG9A 1BZ8A 5A2JH 3ES6A 4MD0B 2QVFB 3FB8B 3TASA 4F8PA 3MJ8A 5BS0A 1BJ1J 5KSVB 4G6KH 3LPPA 4Z7VA 2FX8H 3E7JA 4WU5B 2YLHA 3M1BB 1QNIA 2QQKL 4Q9RH 2R2EA 2I9LA 5TQ2L 4HUUB 5CZRA 1EQWA 1IKFL 4UT7H 4PHXA 2B1AH 1T4WA 4KRNA 2YRLA 3B5HA 3HPJB 3TFKC 4N4YB 4PV8A 4HIHB 4ADJA 1SXAA 5EIIG 3NFNB 4Y1TA 5DYOB 5FA3A 1FVCB 3I6GB 4Y2DC 5CWSA 4MBOA 3KVPA 3JUZA 4UYQA 2NQDA 4PJIE 4B5EA 4HWUA 5HI3C 3MNWA 4N1EA 4OZGA 3S5ZA 4N68A 1YEEL 4LSVH 4WSKA 1E4HA 2Q76A 2CCWA 3SDCB 3KPPA 1HVXA 3FTGA 2C1PA 3S4SG 1XWVA 5TH2B 3P54A 1JGEB 2KLRA 3S6CA 3GF8A 4OCWL 1TKWA 1YNLH 1AJ7L 2HLAA 1OAXH 3A67L 2R56L 4FQ2L 4WHDA 3LN5B 3G6AB 1ADWA 1FF5A 1P53A 3Q48A 1UT1A 3CMGA 2V17H 4OFKA 4PG2A 3DPDA 2DICA 4JRXE 4M7LL 4I1NB 4OJFH 3K5RA 4GT0A 3F58H 3GSUA 5CJOH 4IS6B 3CCHB 1JXJA 3WEBA 4EUPG 8CGTA 1AGEA 2Z91A 2X87A 1YCSA 5IMMA 2Z35A 4FNTA 3RVWC 1K4CB 2W8CA 1ZGLP 3PPEA 4UAHA 5I1EH 1CLZL 1D5IH 3X11B 4FQ1L 4XZ4A 3MZGB 3BWUC 5F0PB 4YHML 2AQQA 2ZONA 3DX6B 2WUCL 3KM2A 1TVDA 4G8GB 4L0PB 4IRSC 3S96A 1CIUA 1RK7A 5D70L 2UZXB 4RMWA 5ILTH 1AAJA 4WEMB 1PMYA 5HI3D 4H25A 1ACXA 4WU7B 2D7MA 3UYPA 4Z76A 5LGJA 2HVBA 1HL8A 2DWEB 4RVBA 3QJRB 4N5EC 3L1EA 5JOFB 1EZLA 5D1XC 4ZXBB 2WBJC 4U6VH 5IBUB 4R4BA 2FRGP 4PWGA 4HDIA 4U6XA 1QABA 5D2NB 3MGOA 4E42B 1CR9H 1TOXA 2M1KA 4G71B 3FCUB 3FTGB 3KCPA 3BKYL 1IM9B 1O5PA 1OT2A 4HJUA 4OF3A 1NC4B 2C5DC 5B21A 1I85A 1XIWC 4K7FB 3N42B 4NPKA 4TUKH 3II1A 4KK9D 3A6CL 4QOKD 4U1LB 1AD0B 3JZYA 2WN3A 3IRCA 2EO7A 2BFVH 2Y36H 1S9XA 3FMGL 1WWAX 2G9HB 2X2JA 5PAZA 3AY4A 3INUL 3O9WC 4XCNB 4MCZB 1MNNA 2PO6A 3DI3B 3GLZA 4LSTH 2MPVA 2OJZL 1OAKL 3SDXA 3RHWK 3RWFB 4P5TA 1T5XA 1HQRA 4P06A 2EYSA 2J4WH 4XMTA 5JNYA 5KYXB 3FQRA 4X9FA 3BAEL 3LRLA 2BOCA 3DXAD 3KPMA 1HSBB 1LP9F 4GINA 3UYPB 4Z76B 3BP5A 4A7GA 4PLKC 2O26U 5C0JA 3UJJH 2FL5A 3VXSB 2AEQH 1IEBB 2PPEA 2ZG1A 3VI3A 2CG9X 3VFSB 2R29A 4NP4L 5T1JA 4FD0A 4M43H 2JH2A 2AJ3B 1H0DB 3QIBD 4QEGA 2ZP9A 5KUMA 1S7QB 4BXSV 2J6EL 2CIKB 4A7SA 1E8ZA 4FNLL 4N0YL 1SY6L 1DVFB 1TVBA 3T8MA 1XV8A 3S3JA 1LEIB 2RR3A 5ALBL 1KIUB 5DJDB 1F56A 2A6IB 4NPYA 4ZFFB 5E5RB 1SNRA 2UUDH 4GW1B 5HI4D 3JVGC 4QTHA 1MVUB 1T0NA 2X41A 1QEWB 3VD0A 1J1OH 5C07E 4DZ8B 1OD9A 2OMTA 1OOAA 1SEQH 5CLWA 4FNUA 5GRXG 3SDAD 4KKPA 1MSPA 3I3BA 3O9WD 5FYKD 4LASH 2ZAHA 4FABL 1OANA 3TESA 4UT6L 3NEXA 1IKFH 3G6JE 1MCWM 5D7LB 1LK2A 4Y19A 4KVCH 5LQBL 3O6FD 2Z65C 5JHLA 4MCNA 2FO4A 5LBSL 5BRZE 2XWTA 2B16A 4PVMA 1CTMA 4L1HA 1KGCE 3A4FA 5K93A 4TVUA 2XXMB 4PB9L 4QRRB 5FA4B 1WFOA 3UAEA 3L2LA 3MOAL 3D0VB 3DX7B 4WAFA 5EUOF 4DWHA 3LAFA 4O58H 3D4YA 2EC8A 2WUBL 3UH8A 2BSBA 5F3BB 2MCAA 5C0CE 3T65A 3QIUD 4DP7X 1PY0A 1MCFA 3JV0A 3OAUL 1DEEA 3ARDB 4YXHH 1ND0B 2BNQA 1XMEB 2L04A 2V5RA 1P5UB 2J8UE 2IMNA 2VYRE 3GEWB 5H2BA 3ZDXF 5JDJA 3HN8A 2KZKA 1HN1A 4HUXB 1QEXA 3DO7B 3GSXA 3PGFH 4G7RB 3TWCL 3MOAH 1S7SB 4HKJA 1KGYE 3GEFA 2K3TA 5ABZA 3CDFA 3PAVA 3DTUB 5K39B 4XT1C 5E0QA 1FO0B 2RH0A 1MCOH 2VT0A 3PP4L 4AGMA 2AHIA 2UVFA 4BSJA 5CCKL 4Y1AB 3ARYA 3FB5A 3EJZD 3WNPA 1OTUD 2PCPA 1OF2B 1A6VH 3O6MH 2D3NA 4YAQB 1O9ZA 4DKFH 2GSIB 2XFGB 3VWJA 1B6UA 4UM9B 4HK3J 1VEOA 1PQZA 2WY3B 1JGDB 1TJGH 3TFBA 1EDHA 1WBXB 3G5YB 2AVGA 4X5XB 4HKZA 1YQVL 5FYKL 3OHMB 4N8VB 3HHSB 5T33L 2GABA 3ARFA 3C60C 4KVCL 1ZE3C 3KPQA 3QRGH 4RAUA 4YGVB 4LEOB 4PWEA 5EU6E 3IFPA 2DH2A 3CFIC 4QHNA 3VQ2C 4IBVA 3FBKA 3IMUA 4RWHA 1Q1JL 3P3TA 2P7TA 3O6FB 3CVHB 5AWNH 1DBBL 3L3GB 4PUBL 4ZAKD 4LRIA 1KB9K 4MA7H 3F00A 3RWCA 3C5ZB 1JV2A 3AQDA 2J2ZB 2ZP8A 3H6JA 4GSRA 2LHAA 1KXHA 5EU5B 1CL7L 3KBFA 3FUEA 5DRXA 2WP3O 3GHPA 4Q2ZB 5KW9H 5KN5B 1RFDH 1JWUA 1XGQB 4IMLB 3VRLF 3LQAL 3MX0B 1PGRB 4U2ZA 3W11C 4EQ2A 1M1XA 3O6LL 3VXPA 3QQDA 5B8CC 2P46B 4F7CA 4RFOH 1TJIH 2NY6C 4AK1A 1T7YA 4XVUD 5EU6D 2PWEA 3G04B 1F6FB 3ML8A 1IBFA 4WI5A 2XQYK 5J89A 4JFUA 4ADIA 1QBML 2EDJA 4JANA 1FG2A 2AGJL 1VZGA 1KELH 1FYTE 2B9AA 5D7IE 4XXCC 3RY6C 1Q0EA 1S7TB 1NEZA 2ZTBA 2F7PA 2VJXA 2C7UA 5EA0H 1U8JA 2HKHL 2RACA 4YDLC 4Z7OB 1Z9SB 4DKTA 4X42A 1QRKA 2CKBH 5J4MA 5KSBF 1M1XB 3HZKA 3DGGA 2NYKA 4GFTB 2VABB 2EP6A 5C2BH 2RBLA 1W0VA 4IBYA 4I0PD 3IJHA 5DA4A 2AANA 2Y72A 1XFPA 1E5UI 1P5VB 5C3TA 1Z9OA 4K8RD 4PU2A 5HDWA 5CGBA 2XY2A 3HZKB 1IBZA 4TOYH 4JY6B 4B9IA 3L3HA 4BINA 4PJ7A 3WIHL 1W80A 4JO8A 2DW5A 4FJZA 1HWHB 2WCPA 1CDBA 4AYFB 1MCNA 1JXFA 2PPDA 1LO0H 3KPQB 1XH0A 4RAUB 4QRRD 1HOCA 4YGVA 4DPRA 3LKSB 5E00B 2BSSB 5BVJA 3HC0A 1IFGA 3QEUA 4F8LA 2V8LA 5K9KA 4WQOA 3P4OB 1EFXB 1JNLL 2H2SC 4R90H 5TPWH 4FHKA 3NSJA 3IDIA 3L3DA 2ESVA 5FGBA 1SXBA 3F7RA 4XX1G 1NL0H 2I27N 2KI6A 1FDLL 2BJML 2APFA 2M8XA 4N9GA 3BOVA 3O2DL 2VDMB 3CSTA 3TO4C 1VGKA 1B0GB 5DMGD 2LAAA 4KVNH 3DBSA 5DMIH 1JV2B 4AITA 5IHUL 2YC1B 2D7TH 3IDIB 2V8MA 1DLFL 4M43L 1NCCL 3FB6A 3CMOL 3GZPA 5JLZA 5JXAL 2VMEA 4AVHA 2XXFA 4QRBA 2OJEA 3RIFF 3BE1L 4GKNB 3LKNB 1GZPA 3L8QA 43CAA 2ZOTA 1UJ3A 1T2QH 1VRSA 3MRGB 3BVXA 2N4IA 5KSAC 1UM4L 2ATKB 4KU1A 2ETWA 1IBHA 4N8VA 2VN4A 3MNMA 3LN4B 2OXHA 2XTJD 4NQXB 3IDUA 4TVPH 5E95B 3C5JA 4MD5A 2BHZA 5IP4A 1PZCA 2VITB 3SIKA 5IOPB 2QADC 2HTLC 3BZEB 3CPUA 4FJ6A 2HT4D 5C0FB 2BVYA 3GZQA 1X6LA 3C5ZD 2XWTB 5T5NF 3UEZA 4Z95L 3KS0H 1GIGL 4PJDF 1G9NL 3OZ9H 4MQ7B 1KCKA 2ZSWA 1L7IH 3PHOA 3VG0L 3DMMC 5F89B 5IHZA 1D5IL 2VDOH 3A6BH 1N6VA 4Z7NE 1CK0L 2VZSA 3BVWA 2H0PA 3BKCL 5DC2A 2DBLL 4DKEH 5DHVA 2WK2A 3IXTB 3QJFB 3ARWA 4GBXA 3K2UH 4R2GB 1FLRH 1JUFB 2ADIB 2AXFA 1QI3A 1AZCA 2VLRE 1FG2B 1RULL 5E1QA 3WO3B 2EIDA 1HILA 2FB4L 3NCWA 4QMEA 2KQMA 2IQAA 3ARGA 5LCVL 2A73B 2C9UA 1GIGH 2FHFA 4I77H 3O0RH 5G5DA 1B4JL 4G80A 4P2QD 4YOKA 2YZ8A 3KWXA 1LO4L 2BO0A 2IAMD 2R9HC 3D0VA 3IWVA 1T1XA 1PJWA 4LCCB 3A3YB 4H8WH 4XCCL 4UMSA 3BP4B 5I1DB 2EXSA 3KM1A 1J8KA 2QL1A 4EI0A 3PYCA 2OSLB 1YEIL 4M3HA 2TAAA 4U1MB 3L3IA 3VD4A 2BP5M 2WTOA 5MENB 2B5IC 3GJFK 4PR5A 3B7SA 4LHUG 1UKQA 1MVUA 5GJTH 4B0MM 4EDXB 3SDDC 2WTRB 1MEXH 5FW8A 1WICA 3QZWA 3W56A 4P3CH 2R1WA 5EC1A 2D31B 4H8WC 5DD3H 1E3FA 3KEDA 5F7BA 1TYEB 1AXIB 4KKLD 2X4QA 5C0BE 1RQ5A 5T3ZH 3QQXA 5TDNA 2IDFA 3QCTL 2WQRA 1V7ML 2R7EB 4DESA 2EVIA 4ZOEA 3VRJB 1DL7L 1FNLA 4NZ8A 2DL9A 2YGQA 3IDNB 3VWJD 1ZWIB 2BINA 3C6EA 4OBRA 2QMKA 4QXVA 4Y5VB 1TFHA 2ENJA 5CF3A 4E5XA 5EZIL 2DQHL 2Y4SA 1USQA 4KZ0A 1D5BB 2NNAB 4YO0A 5KAQG 3GI8L 4N87A 1JZ6A 3WTTA 2OSWA 5I2IA 5ICYB 5DJ0B 4K71B 2HB0A 3CK0H 4JFDA 3D85A 4YHNB 3RIAK 4AV4A 1P0SE 1Z9PA 2A77L 1QQDB 2PR4L 3FSVA 3QCTH 5D2LB 5KVDL 1J8HA 2NY5L 2WLYA 1AO7B 2PF6A 2PW2B 4X8GA 3VFGL 1PLBA 3V4VA 2H32H 4H1LH 1JGVL 1BVLB 3KBEA 4N0RA 2F8OA 4K07A 4XNBA 3QDMA 1NM9A 2JK5B 1GGIH 5FC9A 4NJ9L 1AD0A 2IALB 4PVNA 3N85L 4GQPH 3U9UB 1YN6A 5CILL 4FRWA 4WZ9A 3EJPA 1KJ2B 1W2KT 4UWQB 2BY1A 1NMAH 3UC2A 1RAMA 2CKBL 3CJJA 1RPKA 2XTJB 2IBGA 3MLRL 1JWMA 2FWOB 4ELMB 4NLAA 1J5IA 4DK6A 1FIGL 3V6OA 3Q6FA 2VN3A 4L8DB 4U6XB 1RZKH 5DZNA 3G9VA 1DVZA 2UY7A 5CUSL 3V9EA 4KITB 1MCRA 3PAUA 4HZ1A 4J12A 3HE7D 4YXLH 1NBZA 3GMRB 1DVXA 4XVJH 1R1CA 1XIWA 1YY8B 1UURA 1U8IB 3QUYD 1MIEH 4JPIA 5CN2A 4YSQA 2UZXA 1RPQA 3K4AA 3S37H 2VXUL 2FECL 4X7SH 4G8GA 2GEEA 3CXDL 4NQDB 1PX3A 3QRLA 3QQ9D 4JBSA 5ACMA 1GPOH 2CLRA 2RIKA 1S7QA 4WEBH 3QIBA 3MNWB 4RRPG 1N0LB 3QJSB 4G8EB 5EBMB 3UBGA 3VFGH 4OZFG 3LNEA 1KLGB 1JHKH 2CUIA 3MRNB 1IEBA 3B56A 5JW3L 1SHWA 4YLQT 5IBTH 4HWNA 4MD4B 1C7SA 2GEQA 3WNJA 1TU2B 4N90D 4QCIA 3GRWA 4JRYB 4U0RB 4ELKB 1MN4A 3ZSTA 2AZUA 3C75A 25C8L 5IROC 5J6GA 3MJ9A 3C5ZC 2P26A 2IH1B 3M1BA 3PQYB 4FQIH 2CO4A 2PO6B 3QARA 4OUOA 1JF6A 3D85B 1R0AH 3ARUA 1JTOA 1SJEA 4MD4A 4NN6B 3VI4A 2X6VA 5D72L 4FHBD 3BE1H 1EH9A 2ZAIA 3ZN6A 3MAWA 5D96B 2K78A 5CBAB 4CUCA 5GS0D 1MWAL 1D7DA 4HK0B 4J3XA 2CGRH 1RUML 4G3YL 4O2FA 2AQNA 2ZX5A 4KKCD 4KKAD 4JFHD 3DMMB 1MHCA 4JAMB 2JV6A 3C6SA 4UOJA 3OB8A 1DP0A 4DUVA 1MNUL 3FDWA 4FNQA 4FA7B 4DZBA 2PW1B 4B9KC 1A6TB 5CLTA 5C1MB 2DWDB 2DQGL 3KLDA 3L2NA 4OFYA 1SQMA 4HIHA 2BP0A 5E08L 1MI5D 1VA9A 2WQXA 3GYRA 1COBA 4X98B 1E2VA 2XWXA 2WWKT 3U9PL 2UY6A 3IDYC 2EDLA 4GQ9H 1RZ7L 4IBWA 1YEIH 2AK4E 1ET8A 3CZEA 4PR5B 1N5YL 3SDCD 3A4AA 2JKNA 5BRQA 3BAEH 3OPZL 1KFGA 4XRCB 1AO7D 35C8H 4F9LA 2AEIT 4R5TA 3TLRA 4CRPA 1GYCA 5CO1A 2P80D 4F24A 1CGSH 2DLFL 4XC3H 4LEXL 4LLUA 4KK6D 1BM7A 4XI5C 4UV4L 2HT2C 3HW7A 3BEVB 3OLIA 1RUAL 2IAMA 3N43B 4M48L 4PJXF 3MRBA 4I3GA 3RVTC 4FNRA 3UTZB 4FQ1H 3BISA 4HMCA 1A5FL 1DJWA 5L6YH 4ZI8A 5C0ND 4JZOA 1SN5A 3QIUC 3H7BA 5ID1A 1MELA 1MHEB 3KHOA 3HMXH 3VXRA 2VKWA 3VA6A 1Q9WA 3S98A 2NOYA 2YGVA 4BFGA 4TRPH 4DN4L 2CBMA 4O9HH 4ABUA 3EYSL 3ZTJH 3FN9A 1GGBH 4L1SA 2CKBB 1DLFH 2X4NB 1F3DH 3HI5H 3RX9A 4WUKH 4LAJH 1QUNA 3C2SA 3EUUA 3QUMB 3TZVC 5CIPH 4NN5B 5IW6B 4YHOH 1G7MB 4PEEA 4P4KB 2YA0A 3OKDB 1B4TA 1TQSA 4QO1B 5IEHA 2M26A 3N04A 5CEYB 3OKMA 1UWEH 4YVUA 5HHMD 2Y1AA 4XP5L 5JORB 1KLFB 4AQ8A 3BJ91 4UINH 2JELL 1RK1B 2RALA 3O8XA 2NQCA 4Q7DA 2IFGA 4PP1C 2YXMA 4JKNA 2FJGB 2NYYC 1XHHA 3M7OA 5JW5B 2OTWA 1OCWH 3GWJA 5H4YA 3F7VB 4R7NA 2X2HA 4RMRA 4A04A 3TVMB 3OJVC 43C9B 4K3JH 1TXKA 2ATKA 2BPBA 4LVNC 1NEZG 5EPMA 4XP5H 3NJLA 1C16A 4F7TA 5DMIL 1EXUA 5AVWB 5C0IB 2ZYHA 3PP3H 3BEWA 4KMTL 3GXTA 3R8BB 2BOLA 4NBXB 2EE2A 5DRWA 3IMSA 3AG1B 1ES0B 1BGXH 5DYFA 1HYSD 2HSIA 3ARBD 2XN9B 3SBQA 4AJYV 2ZJSH 5GZNA 4K8RH 1PY9A 1FH2A 3EOBA 4CNIA 4XBGB 2K8MA 1ZHBB 5HDOA 2F7RA 5FYLE 6FABL 3MJ9L 1CWVA 4I0PA 3T4YA 4KZDH 1EAQA 3IGUA 1ZD6A 3F83A 3PL6B 4WI2A 3LV3B 4FP8H 2GBTA 4XXDB 3PNWA 1A4JA 1T3FA 2Z6FA 2NSQA 2MNUA 3I6LD 3EDKA 4WTWA 5T5FA 3RL1A 3ZYOA 1WFTA 5EO1A 5HYJD 4Z18A 1F1AA 2Y22A 5EH1A 1QMUA 2X6MA 1KN4L 2XWBA 3NQIA 3FN0L 2A74A 4MNHA 1LEKB 5IK3A 3D4GA 3MBWB 1IE4A 4UNIA 2E86A 3L08A 4R97B 3SYQA 1M56B 3VD5A 2P5WD 4YEFA 5AOZA 3HTLX 3QHTC 3RBGA 2V7HA 2MOVA 2YN3A 3MLSH 4PB0L 5HVFB 4Y4KD 4OBSA 2J72A 3AT0A 4JG9A 4HWZB 4E9YA 1GS7A 1NC2A 2YEQA 3FCTB 2O6PA 1BFOA 5E70A 4BA8A 1R3KA 3EXJA 1C5BH 3PABA 1NSNH 1E6JH 2WIIB 4TSAL 5SWSE 3KXFA 4PJEA 4JFQB 2GTWA 3K8MA 4EI6B 2MPAL 3SJVA 4K7PH 1BQHA 3I9GL 1JRHI 1JWSB 1UXLA 1TZHB 1TTCA 5DO8A 3ZW3A 2IDTA 4HUKB 4IBLT 2OR9H 1AGBA 5IJVB 2R69A 5DRNA 1UD5A 2VERN 1WC7B 4MDJB 4DVBB 1OB1B 1QFWI 5HYFA 2HN7A 2J56A 4K23L 4M1CD 5FO9A 2OJEB 2R2HA 2XY1A 4KHTH 4ZUWA 3Q2VA 5HHPB 3PAZA 4Z78B 1BQHB 4U3SA 1KT2A 4PGJA 5EZLB 3ECQA 3BD3A 2QVTA 2FHCA 3D05A 2NY5C 2VR8A 2VERA 3SZKC 3LKQA 4BFOA 4C57C 3U36A 4MA8L 4HC1A 2VDPH 1VEMA 2ZUTA 2CRIA 1F6AA 3BW9B 3PJSB 3TYGL 2H3NA 3WNLA 1CZ8H 4YIQB 4L8BA 5CILH 5G4MA 3VDAA 1T20B 3A24A 2D8KA 1SJMA 4L0ZA 3CV5A 4AEIH 1E9OB 2ZSVA 4N0FA 4ZS6D 3QDJD 5LXGL 3X3FL 4FDWA 1LD9B 4FCAA 1DJSA 3I50H 3NTCH 3PUCA 1XGUB 1NCUA 2FQDA 2VLRB 1OAUL 3BPNC 3QIUA 3QXAB 4WFED 4X5XA 5BRPA 1R17A 4LMQI 2IOIA 1JN6A 2DD8H 4JZNB 3OLEA 4NT6A 2F5BL 5ICXA 5AENA 4PB9H 1WUZA 2APWA 3NN8A 3ARBA 3C9NA 3T0EC 2NDFA 2YD6A 5KBNC 3U6XA 4ZX3A 3LV3A 3NMEA 5K9JH 3QJUB 4D9QD 1A4CA 2GUOB 4LLUB 3IETA 2CBTA 4XO9A 4DVRH 4G6MH 4K7PY 1CGTA 2FO8A 1T0MA 1Z9MA 2IPTH 3AREB 4P2RD 5KVDE 1QFOA 2AK4D 1XAUA 2OSYA 4IU3A 1ZANL 1M05A 2EXWD 4AVIA 4HS3A 4CNIB 3EBHA 4RRPM 1Q9KB 3L4XA 3RPIA 2GK0B 4QWWC 4E9VA 1KYAA 1MI5B 3GO1H 5I75C 5ECGA 5E9AA 3IJSA 1OWRM 3A6BL 4UNUA 4U7KA 3U2SA 3GSXB 1D9KC 5ALBH 1NGQL 3GJFA 4LNRA 4ZMQA 3NIDF 5EB9A 3SKMB 4JO1L 1LGVA 2EEFA 5AL8A 5KTEH 2I85A 2VDKL 4JUTA 1PYWB 2DKMA 3MYJB 1RZIA 6CGTA 3FU0A 4NM8H 4TNWF 5B38G 1WZAA 5HVHB 4UZGA 3KGTA 3WEOA 5IR1A 1IAIL 4QLRA 2OMXB 2NZ9C 1OEZW 3EJZC 4XOBA 2Z0BA 5FA4A 1A7QL 3VMPA 4BSVA 4PI2A 4AENA 1YEJH 4L29A 1L0YA 4MQXC 3V0VB 1XF4B 4HKBA 4WV1A 1Z2KA 5I1CL 2EINB 4XNMB 5DGQA 3CFJB 3ZUCA 1WCQA 1UUNA 2X6CA 4ZS6C 3NIFF 4Q0XH 4PJCE 4C56E 4OAWA 2P5ED 4Z7VF 3VU2A 3D2UD 2DQEL 4L8SC 4RZCB 4ZK8A 4QHNB 3SBWC 3WFBH 5F9JA 1I7UB 2EH7H 5BVPL 1SJVA 3VW3L 1DDHB 1OSPL 2G9KA 2EXWC 4R5XA 2C9PA 4ZAKC 5IY5B 1QASA 1XSOA 2PTVA 4ZD3H 3FO2A 3QO0A 5E6UB 4GQ9L 3O2WH 1M9WA 2EEDA 4UM9A 1IIKA 2OMUB 3SKNA 3US0A 4AUUA 1DQKA 5E5MA 1OSEA 4IHOA 5IB4A 5CJBA 1PD0A 4NQDD 3MUZ1 3U6RA 2E4FA 3D2UB 2NY6D 4C56D 3FQNA 1KJVA 2FL5B 3X14B 1PJ9A 2XWZA 2BSEA 4JZJA 2WLLA 4NM8L 1R9FA 3OAZK 1JDAA 5E6ID 3HPLB 2D7TL 3Q8FA 1X5ZA 3KLHD 3S2AA 1GRWA 4RWYH 4RETB 4W9KC 1LLAA 4LSQL 4GP5B 4V11A 2VDLH 4LKXB 3KPNA 2PP9A 1CICC 2VR6A 1KTDB 3U30B 3S36L 2NZIA 1XR8A 5TE4L 1A0QH 4PLOB 1PLGL 3ET9F 4OZHF 5TQ2H 3U0WL 1HK6A 4N24A 4PS4H 3VI3F 4BFIA 5IW1A 4X2UA 4JS7A 1ZMYA 4ODBD 5A2AA 5J3HC 2E6PA 1MFVA 4NUPA 3GBML 1J5DA 3UBXI 2P8MB 3QI9C 2NCEA 2VAJA 1LK2B 4FQLL 4Y19B 1M7DA 4LL1A 2WNKA