2JKNA

Drae adhesin in complex with chloramphenicol succinate (trigonal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A structural study of the interaction between the Dr haemagglutinin DraE and derivatives of chloramphenicol.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jknA00
2JKNA 1UT1A 1RXLA 2W5PA 2JKLA 1USZA 2VERA 2IXQB 1UT2A 2BCMA 1USQA 2JKJA
chains in the Genus database with same CATH superfamily
4R5XA 5C09E 1MF2L 5HVHC 3P4MA 1XF4A 4FFVC 3NOIA 4CADB 4FQ1L 3RVTD 3F00A 1WAPA 3KYKL 3QJFA 1DN0A 5IMLA 1J9SA 3MLSL 1A21A 2CLZA 4XHJC 4AE1A 1TNNA 3B2PA 4PWEA 2I9LA 4QI3A 4O4YL 5CMAA 2Y69B 3PHOB 4X6BB 1XZ0B 1CXEA 4J39A 4UTAA 1RVFL 5ANHA 2DDQL 4ENED 4HG4J 4O02B 4K7PL 1J5CA 2VLJE 4D0CB 3SD2A 2C4FU 2QPDB 3DBSA 1FBIL 3HC4L 1PEWA 2Q2EB 3V9EA 2H4EA 3QS2A 3N91A 2I5YL 2NYZA 1YEIL 3W82A 3MRBB 3DX7B 1XGPB 4F93B 1JNJA 3PWPB 4M8QB 1SOKA 4LLWA 4NRXB 1KNOA 3FH7A 4PJCF 3NJFA 1FVCA 2IPTH 5GRWA 5KBPA 1ROWA 1KZYA 1NKOA 5D4IA 5K93A 1YYML 5CU5A 4HUVA 2VCOA 5E1HB 4P5TB 1Z2KA 5A2IH 4PY8I 5I30H 2XX0A 4YXHH 1B4RA 4OZIA 3G9AB 4Y1AD 1KY7A 1NGWA 1UYWL 4OF7A 3MR9A 2LT9A 1T1XB 2ZOLA 3N1FC 3UAJA 5PAZA 3ZMRA 2CXKA 2EDBA 2OMBA 4ZUSB 5GS1C 2NY3C 1W72B 3DVGA 1VEMA 4H0LC 1WAAF 3CAFA 4JRYD 2EIMB 2XV0A 1QW9A 1TLMA 1G84A 3T0VA 2YD5A 3HRZC 2Y6SC 5I1AB 1PLGL 3TBYA 4NO0D 4MJIA 1KB9K 2DQUH 1XQ4A 2BVQB 2SEBA 3JVGA 3V7MA 2C1PB 3QNXB 4X4ZA 3UTPD 4YDVB 2HFTA 5F71A 5K59E 3P4OA 1Q9KB 2OJZH 1FLRL 5ABAA 5BCAA 4RMTA 3G5ZA 5KYXB 1MDAA 1R24A 3PGDB 4R26L 2VN6A 2ZP9A 4IYKA 4P3DB 3MRIA 1K4DA 1ZVHA 4KK9C 3MKKA 4ZUVB 2H5UA 1MCDA 4FQ2H 5TFSL 3VFSB 2D7OA 1DQLH 3DOIA 4KNSA 2GJ6A 3H56A 4NYLA 4TQIA 1JZDC 1Q94A 2RCSL 4GS7B 1R5WB 2QZ5A 3V4VA 3BLPX 4F8TA 3UG4A 2LHAA 2PCFA 1YEHH 4NZTH 4ONGL 1LO0L 2FX9H 2J56A 1QFWL 3P11H 4FQCL 4IQHA 4NGHL 2PO6D 3V0HA 2V9RA 4LF3B 5IUCA 1UEYA 1KG0A 4OLUL 4Y7OC 1A6VL 2K6ZA 3MRHA 3ZQ9A 4AYMC 1MJ7H 3EYFA 1CF1A 2PF6A 4MD5A 4P99A 4QHMA 4RNRB 2OMTA 1GY2A 1UM4H 1SZNA 6FABL 1NEZG 1AD0B 2FWOB 1BAFL 5HHQA 4OGAD 2W0FA 2HB0A 2A9CA 1TOXA 2XZQH 3S36X 1A14H 3US9A 5I15H 2O5NA 1VSCA 2MPVA 1NA8A 2PP8A 5CLTA 1DVZA 1UJ3B 1N7MH 4E5XG 1AY1H 2WHVA 1QABA 2EDYA 1HE7A 4GEJA 3CU7A 3RA7H 4DKDC 2ICEB 4G8IB 3OF6D 2A6KA 2I25N 3RWFA 2XUWA 4WWOA 3LKRB 1OLLA 5MP6H 1EXUB 2N56A 4NQDD 5FDYA 3EJUA 4GKLA 4Q6IB 3QHFL 3CVDA 4K55A 4QAWA 3CN3A 3QG6B 4FLHA 3VFVA 4PLKD 2PW1A 2EDMA 2B15A 2O5XL 4P57B 3RFRA 3OL2A 4WW1B 3P9LB 1AHMA 1NEUA 1FG2A 3SOBH 5IR1A 3UAEA 4OV5A 3AADB 3IDIA 2J57A 4EN3B 2AGJL 2OSXA 5HJ3B 3T6VA 3FQNB 4I9WE 4A2GA 4U1NA 1E4HA 1E8XA 2YPLA 3OKKA 2Z7YA 3Q0HA 4DKAA 3ETBF 1SMDA 3PG2A 2FAUA 4J3OG 3OB8A 4HEME 3DHUA 3MNDA 3VFOA 4UI2A 1U41A 1IGMH 2IBZY 4NKOB 3L3HA 4JFFD 4Z3GA 3EJZD 4FXGA 5CKGA 2AABH 3APDA 2QHLA 3OD3A 4LLVA 4NKDB 4X5QA 1EZUA 1XTLA 5J13C 4WY7H 1GOHA 5HBBA 4LOFA 1KXQA 1LTXA 4U2ZA 3PL6C 4GQQA 4UTBH 1V7MH 2VR5A 4KZ0A 5I1HH 3KPLA 1T1YB 3X14B 3U9UB 2XHNA 3EFOB 5INDB 1MHHB 3G5VB 1PVHA 4NX0A 1YJDH 3FCSB 5FGRA 1E2VA 3H2WA 1N4XL 3WNLA 2JKJA 4UDTA 4YEFA 2V3DA 3CQPA 3CG8A 1B9KA 2VRKA 3F7RA 4H8UA 2CR3A 2JK5B 4KK5D 5BJTA 2BNQA 4P3WA 3WSQL 4Q7DA 3Q01A 4HA1A 2IG2L 4WTWA 4LEBA 3GJEB 5D7EA 1OAQL 3N1GC 1GC1L 2ZAIA 2YLHA 3CXFA 4XNQA 3SPJA 1IGJA 1UTDA 3C8DA 3DMMB 3VD4A 5LO7A 1I1AC 4KX8A 1TYEB 1L3WA 4JAMA 5BZDB 1KFAL 2AK4B 1SBSH 3FSVA 5L2KB 3DROA 1S2EA 1WBXB 1J1PL 4N3TA 4OD3L 1CDJA 3AREA 5EC2B 3GSQA 3TT3L 1I8LC 3OHXA 4ABWA 2VMJA 4L5FH 3CIQA 1L9RA 4U3SB 4O51A 2NZIA 4K2UL 1ZLWK 5DWUL 1BZ9B 3DRTB 3ZDXF 1V10A 4JNXA 1NCBL 3ATEA 1U2YA 1FYTB 5SWZB 2HVBA 4JFVA 4KNQA 5E9DA 3PJNA 4JKNA 3TF7C 2DKMA 5F8QC 3VFTA 1JGIA 1QRNA 3VXSB 1D5IH 1P5UA 4XN8A 4WEBL 4E9LA 5B38A 1UWEH 1Z9SA 4OT1H 2PWDA 4YHIB 1E2ZA 2Z31B 3QXAA 3DJSA 5AVWB 4XCFH 2R0ZH 4KXAA 5BOZG 2VN5A 1ZT7B 1BQRA 5I5MA 2OYKA 1E27A 4ZO6A 1FL6B 3OGCB 1KXTA 3EO1B 3UJTH 1ZHLB 1QTYT 4FQXB 2IC2A 1L9PA 1LQSR 2XG4A 4CDHA 4EOWL 3KYNB 4RX4D 3SE4A 4PJIB 4D9QE 4JMXA 1KCUH 2Q87A 1ZV5A 2YEZB 4HZLA 1J8HD 2J6EH 4IGBA 1DCEA 5ISZD 1O9WA 1YNKH 2KS0A 3KWXA 3ZOAA 1H3XA 1K8DB 1EZLA 1Z3GL 4M7ZC 4P4KC 2XVKA 5DEJA 2PTTA 2X2IA 1CK0L 4Y9BA 4LOVA 1OF0A 1XF4B 3FAXA 1SHXA 3CU1A 3DPDA 3UDWA 3QJFB 1DN0B 2WBKA 1BV8A 2XQYA 4Y9GA 4S2SA 2CLZB 4NNPH 4N2MA 4AQ8C 2DL2A 2E75C 1SFDA 2I9LB 4JG0H 4JJ5A 1RZ8A 3O4LE 5CMAB 3F64A 3HUJA 4K4KA 4I88A 1ZT1A 2QSVA 3RVVC 2WINB 4J2QA 3IRPX 4A7SA 2WO2B 4IU2A 4AIEA 2AQQA 2HSIA 3R1GH 4L2LA 3FQ2A 2GVYA 2F1BA 2WMPA 3O8XA 4PJFE 2QTEA 4HBCH 5B8CC 1ZT4A 5AAWA 2YKLL 3LY6A 4IU3A 1KNOB 1XD1A 2BZCA 1FVCB 1NM9A 1AKJA 2N1KA 5E5RB 2IDSA 3BSZL 5HJDA 4WSKA 1AKPA 2JIXA 3OSKA 5JNYB 3DVIA 3X3FH 1U92A 2VDLH 5KANG 4OZIB 3V6OA 2NXYB 1MJ8L 2XWJB 3ECUA 3AS0A 3QUML 3ALWA 1OTUC 4WTZG 1NGWB 3AUVA 2B4CH 3MR9B 3ULAB 9PCYA 1OTSC 3CBJB 1RAMA 4LQ1A 3LRLA 4XWOC 5I30L 3DVGB 1ET5A 3ARWA 5GGUB 5GZNA 1UH3A 2DQIL 3BDYL 3TBYB 5FYKE 4NNYB 4MJIB 3L7EB 4MQ7A 5IB4A 5D96C 4ZTOL 4WNSA 2WYTA 3GI9H 1S7VB 2NPLX 3GZPA 3UL4A 2IANE 4J4PD 2EDXA 1MAKA 3P4OB 4JM2D 2E7BA 3U0TA 3G5ZB 4XVSL 3MPCA 4BK4A 1JCKA 4BE5A 3BYTA 4GLRH 3VXQA 1R24B 2IQ9H 4YSRA 5ETUB 4NXKA 3MRIB 1JTPA 3NJNA 2XQBH 3V52H 3HNTH 4TNWF 2OJZL 1CLOH 3PE9A 5IZ7A 3BPNB 3Q6GH 4U1HA 1A65A 1ASPA 1ZMYA 2GJ6B 4H2AA 4BV1A 1Q94B 3V4VB 2AXGB 4LU5H 3VI4E 3SE9H 4GPVA 2RTTA 5G2NA 1X5AA 4EKXA 4FQ2L 1QEWB 4WEEA 1FL5A 1SQ2N 3SE6A 1HINH 4D8OA 4KJPD 5GS2H 2AMUA 1A7RH 2HPOA 1G7IA 1KG0B 4F7KA 4UAOC 1T1ZA 2FR4A 4NZ8A 2UY7A 4EZMA 4LNRA 3EYFB 4NZTL 3SGEH 3P11L 4H1LG 4QHMB 5CZXD 1Q38A 3U1PA 2AXFA 4JDVA 2YD8A 3CSGA 4XP5L 5FO8A 5JW5B 2AQ1A 4MDJA 1MJUH 2G5BA 4E0RB 4GLRI 1CLCA 3MJWA 1G7QA 5EU7E 4DIXA 4CA4A 1MJ7L 2X6CA 3K7UA 2HLFC 3J8F7 3M8OH 4K8RD 3VFRA 4U1GB 5HHQB 2W0FB 5LAXA 3KPRE 1UM4L 5E51A 4P2RA 4GRLC 1MCNA 4LCWD 1SVZA 5AL8A 1JPEA 4PJ6A 5A40E 1J05B 4M7JH 1PY0A 4KROB 5AB2A 2M83A 3FT3A 2FBJH 1A14L 2DPKA 3RWFB 2A6KB 4G5AA 4PJEA 3LKPA 4C4KT 1CR9H 1HSBA 1AY1L 3PGCA 3I6LD 2A9BA 4Y0GA 3UGXA 1D5XA 4J3OF 1I1YB 2FQFA 5EF1A 2XCMC 3VFVB 2PW1B 2QVKA 1UATA 1CVSC 3IWVA 3M45A 5E4EC 3SGEI 1T20A 2J1XA 3NVQA 4PBXA 5CF3A 2ZX7A 3QJQB 5IR1B 4OV5B 5LG6A 4UT9L 3IDIB 1QNIA 1Q72H 4OH2A 2A4EA 3GIZL 4PJCE 2V5YA 4TPRH 4FABL 2YPLB 4YDKL 3CGTA 3OKKB 1R9FA 4N0UA 4G83A 1IX2A 4H0IA 3PWUA 3WIHH 1O5PA 3QJXA 4XX1G 5FYKL 1T7WA 3D3VA 4FJ6A 1I9RH 3ULUC 2DWEA 5B3SB 2JB6B 1EUUA 2DYSB 3ATAA 5FUCC 3VFOB 5ID0A 3GDBA 3L3HB 1JK9A 4FXGB 2PWHA 2QGCA 3COOA 1D5ZA 1N18A 4LLVB 3C5ZC 5HDBB 3QIUD 4P0DA 2KDGA 3D2UD 4P4RA 5D5MF 3CHXA 5AYUH 1WAAE 1RZQA 2NNRA 3CXDH 1IGML 5HDOA 4RA0C 4X9IA 1JBJA 3ELQA 4XNZC 3PXLA 4BK5A 1QUNA 1GYVA 2BVYA 2D3VA 4N20A 1DFBL 2Y07H 4ZFQA 2VC2H 4IRZH 4R4BA 2P44B 4K7PX 4Z3IA 4UDTB 3SKMB 2X3BA 3OMAB 1V7ML 5BJTB 2A5UA 2BNQB 2F54A 5LN8A 3WTYA 1YJDL 3BKYH 1QWUA 2GIXA 3QUYD 5LG1A 3TVMC 2W0KA 4XNQB 1KCVH 1IGJB 5KG9A 4CAGA 3KBEA 2OTUB 3GM8A 4JAMB 5CEYB 4WU5B 4P5SA 4Z78A 3B5GA 3QQ9D 1JPGB 2TSBA 3UTSA 2YUXA 3DROB 3SPIA 1SYSA 1KF9B 2XPZA 1E5CA 1INEH 1MVFA 3GSQB 1U58A 3ASNB 3ARTA 3OHXB 4H8WH 2Y24A 1B0IA 3ILEA 3PUCA 2VNCA 4QRRD 4QT5B 1FO0B 4O51B 2R69A 2ZCKL 1VESA 4GT7A 3P2TA 4DPAX 5EU3A 3CCHA 1CDYA 1VDGA 5CSBA 3V4UH 2BWDA 3D12B 1ODUA 3VWJC 5C07E 2KKQA 3D30A 3WD5L 1QAWA 3NJVA 4L5FL 4UILL 1WFTA 5E9DB 5AOZA 3CDGA 2XBTA 1B4LA 1EANA 3AROA 3VFTB 5A6LA 1WDAA 1HAWA 3ENEA 4I2XA 1XF3A 2DQHH 1JYXA 1W91A 2DEYX 2DQMA 3MJ9H 5B38B 2XC8A 2X38A 3O2DH 1Z9SB 1KCLA 5F7LB 1MRDH 3PWJA 2SODB 1LWHA 3QXAB 2EKSA 5C0FB 3KHOA 3D39A 2ATKB 2WP3T 1D5IL 1E27B 4GT0A 2WXKA 4HWEH 4PRAA 4WW2A 4OT1L 1KXTB 2R1XA 3RWGA 4DP1X 1NSNL 2XG4B 3U0PA 4DGWC 1LP9F 1IAMA 2WUCH 1ES0B 2R0ZL 4P46B 4ZFZA 4D94A 1AZVA 5CR8A 5MEQB 4UWQB 1JPTH 1OCWH 2EUZA 4RISH 2F8XC 1B9ZA 4IGBB 2CKBA 5BV7B 5IKCA 1QA9A 2PTTB 3RVTC 2GQHA 1KCUL 2IDQA 1WYJA 3KPOA 4UM9D 1AP2A 1ACYL 3L3JA 4N8VG 2HRHA 4PJBF 3TH4T 1PLBA 2Q0ZX 4S2SB 5SWQB 3JWOL 4UB0H 2A6JA 1BFVL 5JLZB 3CLFL 3N44F 3T3MF 1NGPH 2EINB 2ADIA 4JVPA 1ACXA 1RZ8B 2VR6A 4TOYL 1UUNA 3QIWB 1M4KA 2MOGA 4Y4FC 4ADJA 3RAJH 3HUJB 1KSRA 2NCEA 2XV2A 4KWUA 4LDEB 2EILB 4NNPL 4HKXB 2FT6A 4S1DD 4IU2B 5I24A 4JG0L 4BWWA 1CFTA 3HJ0A 3WIIH 2IH1A 1N5AB 2PCXA 3O8XB 2WMPB 1ZS8A 1S7WB 2LU5A 1RUAH 2H1XA 5E8EB 1N67A 3TT1H 5CJBA 1ZT4B 2W9DL 3FN0H 3C2SA 1BFTA 3QA3A 4IU3B 4NT6B 3BGFB 2ZXEB 4EXKA 1R5IA 4UF7C 1GGIH 2BVUA 1AKJB 4KY1H 2WLHA 2WTOA 1EA9C 1RUMH 4N2FA 1RZKL 1AIFA 1UGNA 4U1SA 5GS1A 4Q58C 2JIXB 1SMAA 1OGSA 1U92B 3OG4B 3DRQB 4EE2A 1CIUA 4MB1A 3V55A 4MD0B 3QEHA 3HRZA 1BMGA 4JFDD 1Q0YL 3GS7A 3I9AA 3JWNG 5CJOH 1CE6A 5FKAA 2F19L 4MDIB 3X17A 4FD0A 4M00A 4TN9A 2L8AA 4XB8A 3D0AA 2VZUA 4M48L 1GZHA 2BC4A 1ZIAA 5KVGH 4W93A 1M7IA 4B0MM 4EBQH 4ZFOA 4W6XB 5DHXB 5IB4B 4MQ7B 1IAKA 2PABA 2AAAA 4KKZA 3GPSA 2CALA 2JCCA 4A2EA 3HA0A 3BEVA 1TZOA 4W6YB 1KJ2B 1Q0EA 1CTNA 1CU4L 4Z95H 1PY4A 2WUBH 3WXVH 4BQ8A 3FOMA 3VXQB 4DEWA 1D2PA 3RUGF 5I71B 2C9VA 3GI9L 1ASQA 4AQEA 4KNUA 2NTSP 5LUMA 4M9OA 1PCXA 1MHEB 3S8GB 3BT0A 4RAHA 1JXJA 3KBPA 4U1HB 1W6WA 1XR9A 4P5RA 5FLUA 1BD2A 4UQBA 5FR3A 1E65A 2IQ9L 1F90H 3KW7A 1SHSA 2XN9D 2YR3A 1NC4B 3P0VH 4JG1L 4F92B 3QG7L 3V52L 2VW6A 1QTSA 1F1AA 2DQCL 3HNTL 3L2LA 1L6PA 3KVDD 1LDSA 2J2ZA 2PO6C 2ZUQC 3NZHL 1JSYA 1FL5B 3Q6GL 4OLVH 5JPMC 4ZQKA 4EXPX 2F7IA 3D48R 4LU5L 4F8OA 5EUKA 4YHZL 1G7IB 2PYFA 1T1ZB 2FR4B 5I6KA 2BNUB 2UY7B 3BO8A 4XAKD 4LNRB 3D50A 2M8XA 1HINL 1NLBH 3WMQA 4PJ9B 3VXMD 2RALA 5FO8B 3IDNA 1Y6KR 2QVMA 2VR3A 4MDJB 2G5BB 2QEJA 2BW5A 1UT9A 4OGAC 4PCKA 4AMWA 2I9TB 1PKQA 3VFRB 1F11A 2ENYA 5LAXB 4DK3A 3U6RA 5F6HI 2KZKA 4P2RB 4R4FH 1IJNA 3MLZL 3ZDYE 2X9ZA 3C8HA 3I50L 2PUQT 2PWEA 2ZWLT 4DEPB 5BW7C 5DQJA 5JIDA 4PJEB 3LKPB 3WE1A 4UT6A 1HSBB 1OSPH 4GFXA 1XXFC 3APCA 2NR6D 4M4RA 3RX5A 4DUWA 2BIOA 2ZYRA 2BHFA 3NH7H 1D5XB 4KDWA 4M7JL 4PLKC 4A7GA 1BXAA 2FBJL 2AFNA 1MHPL 2ZG3A 3S34H 5EHFA 3MREA 2L7EA 4PWIA 5JW4N 1T20B 3B83A 3LZFH 1CYXA 1E8ZA 3FRPA 2MCMA 4FMFA 5FM5M 3WAKA 4M7KL 2FQGA 2WKOA 3GM0A 5BOJA 4WLCA 3QZWG 5AENA 4K5MA 4KVCL 4OCSH 2V5SA 3QRFM 1ZAGA 4N0UB 1MREH 3PWUB 1Q72L 1JYNA 3D3VB 1IMHC 4NOBA 2D0HA 4U6YA 5DD0L 5DLLA 4ZODA 2QSTA 1U3HD 5DZOA 3PL6A 3VSVA 1JZ3A 3B7RL 4E9YA 4W1TA 3AXIA 1BVKA 3AXHA 1AC6A 4JFPA 1JK9B 4TM9A 5KVEH 1D5ZB 1I3VA 1EFQA 5KZCD 2P48B 3DO4A 1I9RL 4P4RB 1AJ7H 1CF8L 1H6UA 4H26A 4HIEA 4O5LL 4AKPA 4KDTC 1V55B 3H4FA 2KMWA 4ZI8A 1KTLA 4IRSD 4OFYA 3PP3K 3V4VH 3OKEA 3S3BB 3CZNA 3T0EB 1QUNB 1NMBH 1HKLL 2PPCA 4FFZA 4IBQA 1HXKA 3V4PL 4R4BB 4KK5C 5AYUL 4S0HA 1JPFB 3FB8A 4G8AC 2EC9T 1LDPH 1I1AA 2BSEA 1SJHB 1P7QD 1IARB 1KLUB 3EJJX 2F54B 1JG9A 3AUWB 3DIFB 2OI9C 3QFJD 4X6FB 5DR5L 1BM7A 1T4KA 4MNQD 3C60A 5KG9B 4E41E 3ZK0A 1M6OB 2UZIL 5C86A 4BSVA 2DD8H 4Z78B 1TCMA 3DHPA 4GXVH 5EBLA 3UTSB 2ZPKH 2BOLA 1UZ8B 2LAAA 3ZYZA 2G60H 4LPXA 5LDUA 2XA8H 4C4BA 3QRGL 1KCVL 2ARJA 1U58B 4OIAA 1WUZA 1MI5A 2R2HA 2V7HA 4FGMA 5I18L 4RESB 3QR1A 2ZP0T 2CZNA 1H8SA 3CCHB 2BWIA 4JHBA 1S3RA 3NSYA 1WISA 3TOPA 2L4OA 3MBWA 1HEZB 1D7FA 2YGVA 4JZJC 4Y88A 1JZ7A 3CDGB 3QT2A 1WC7A 3LOWA 2BK8A 4KFZC 1XF3B 3BMWA 3ZR5A 1Y6NR 4I85A 3AVEA 2I26N 1ZJBA 4AKQA 4MA3A 1JL8A 5G4MA 1FVDB 4EI5A 4Z7VF 1JYWA 3QDJA 3FUIA 3ZZLA 3OC8A 1JRHH 2EKSB 3A4EA 3EFFB 1SYVA 4G6AD 4KPHH 3DX3A 4M6AA 1KV7A 4FYRA 4PRAB 4WW2B 4FA7B 4R7XA 3AY4C 2A99A 4JO4H 2YGNA 1JOIA 4P4KA 4H13C 1N10A 3H9SA 2OFQA 4PRPE 4ZFZB 3K8LA 1VFBA 5TTRA 2KYIA 4R6UA 5CWSA 3T1FA 2DYRB 2OQJA 3VI3A 2NXZC 4Y19E 5HDQH 1AIZA 4AQ8A 2CKBB 4X6DB 4YN3A 4NQUA 4S1SL 1QA9B 5DUJA 4U3XA 3JV6B 3SCMC 1OCCB 3KPOB 4P2QA 1G7PA 1JPTL 1OCWL 1AP2B 3QR2A 4CNIB 4JN2A 4HJTA 4J7RA 4GG6F 3IVKA 2A6JB 1UASA 4R2GD 5AKVA 1BDYA 2FATH 3G5WA 4TKWA 4ANUA 5AD0A 1RHHA 3QQ3B 3V0GA 3LD8C 1JNNL 4JGMA 1P4BH 1JRHI 2MQ3A 2R1WA 4N90D 2F68X 2UV3A 3ECWA 4N2GA 4B9ZA 3NBNA 1NIBA 2P8MA 4LSRH 4U6HA 1YO4A 1TQBC 1CFTB 2Q7YA 2K9UA 2IH1B 2JTDA 5B3JF 2C5DC 2WQRA 1ET7A 2GABA 3SE8L 4QYAA 5D5ME 3TCLA 1UXWA 5A2CA 3MLVH 2OR7A 1R5IB 3CFKA 1E9OB 2DLHA 3SKJH 3WIIL 3Q5TA 3W2DL 3W5MA 5D4JA 4JHZA 3T4YA 1YEDA 1RUAL 4Z7UA 5L4MA 4EZJA 1Q1JH 1UA3A 4HXBH 5KAQF 4AEHH 4N2EA 2ICWA 2ROYA 1IU1A 1GGIL 4RGNB 2IFGA 3EKCA 5JW3H 1CE6B 3HW7A 1RUML 3WDHA 1F4WH 1WLHA 5TPWH 1CFQA 5K33A 4LSQH 2BC4B 4NCC1 1CQKA 5F7HA 1M7IB 1UB6A 3ARRA 4ZFOB 1EVTC 1CT8A 3H42H 4LVNB 5IEHB 3IRCA 5ANME 4BIKA 4YDLC 4J4PC 4L4TE 2JCCB 4JM2C 1ZLUK 2NY4D 1CBJA 3TA3A 2WXMA 4KO5A 4KKLD 5CXPA 1J0IA 1LK3H 3DOHA 3FOMB 4G6KL 5CKAA 1PX4A 1JZ4A 3EGXB 3HG0A 4Z7QB 4AQEB 4GAGH 2AV1A 2WAQA 1EUTA 3BZ5A 3Q7JA 4WFHE 4WKXA 5KVEE 1OAXL 1XCQB 2WUBL 1XR9B 2Q20A 3BUQA 4CMMA 1FP5A 4PBDA 3B6SA 4XXCC 4DOHE 1NUGA 2VXVH 3NIGB 3MKGA 1M71B 4HC1L 5GIRA 4ZXBA 1DDHB 4Z1PA 1XIWB 3T77A 5DMKA 5B21A 3W9DB 3QZNA 1TTUA 3AWFA 1V3KA 2V9QA 4ZQKB 5FGCE 1GVIA 4IHOA 3TZVD 3P0VL 1LWJA 3IJ7A 4IK6A 5CIPA 5F9OH 5EUKB 4FP8H 2HFEA 1IBZA 4XI5D 5CZXC 3BO8B 3TFKD 5DMJB 4IBUA 1D3CA 1N6VA 1DVFD 2LQRA 2VLME 5AVRB 3AQZA 3U1SH 4ZW6A 3IDNB 4K8RC 1UJTA 1PKQB 3BXNB 5FYJH 2AXJA 1F11B 3EUUA 3N1MC 5C0DA 4AY0A 1U6AH 2GW5A 3U6RB 2YD7A 4M1DH 4JVUA 4Z7WF 2DI9A 2XICA 4X4ME 1NFDF 4X5XA 4PJBE 1H0DA 3MLWH 3VXNB 1HIML 3VMNA 3QO1A 1CWVA 5DQJB 4RLDA 3JSSA 4TF4A 4WNJA 4ZPVA 3U7YH 2E7LA 4R4FL 2AVFA 1ZE3C 4GEIA 3DUUA 4M4RB 3KXFE 3LNFA 3GWJA 3HHRB 3UIYA 1NL0L 5D7JC 5IMKA 1TCRA 3MREB 1TZHA 4N86A 3U48A 5AUMA 2BHYA 5C09D 3VWKA 4N0CD 4H4NA 3FRPB 3NH7L 4K3JL 3VSUA 1M42A 4ZOAA 3GK8H 2UVEA 1JGUH 1DANT 3S34L 4Z3HA 2CGZA 3K2KA 1CTMA 2Z9TA 1A8JH 3O6FB 3P4NA 3LZFL 3KDMA 2TSAA 2CCVA 5GJSH 2WSDA 1HILA 3BAWA 2W07A 2VLRB 4U6YB 1A4AA 4KJQC 4OD1H 4NUGH 3FSZA 1JDCA 3K4AA 4LSTH 4UYQA 5AVZB 2VLJD 5ESAA 3ARBC 3K2IA 1WZ1H 1BVKB 3SKUD 2XACC 3QIUC 1XX9C 1MREL 4G7YH 4XO5A 4B5ZA 1RERA 4TS6A 5TK4A 2P52A 3CUPA 1F2QA 4V2BA 2OMNA 3JT0A 1DSWA 3DGDA 4HIEB 2VZ1A 2Z3FA 4ALAC 2G0LA 1S3KH 1KTLB 2OCJA 3AB0B 5KVEL 3OKEB 1NCAH 4JFQB 3FTGB 4FJZA 3LN9A 5EA0H 3ZMEA 2ADGA 5IFAH 3HG1A 4OFIA 4IMKC 4XOAA 3ZE0F 4I3SH 3LZRA 2XY2A 2X6VA 5DD6A 2K1MA 3D0LA 1H15B 3DTXA 3MNWB 4NJ9H 1NMBL 3H0TA 1BFSA 3L4TA 3RKDD 1MRFL 3RUGE 2PPAA 4LHQB 5A6IA 3C60B 3F7YB 5FX3A 3GJFK 4Z7NF 1UH4A 4DN4H 1LDPL 3HBGA 1M3JA 3QQ9C 4LLAA 1SLUA 5HPMA 4OIFA 3JV0A 5D93C 5EBLB 2YRBA 3L4WA 4WWKD 3TL5A 1G7LB 1KIUA 1HHJB 2ARJB 3ABZA 3V4LA 4Q0XL 2R2HB 2V7HB 2DD8L 1SGKA 2CCWA 5EV7A 1JZIA 2K6WA 2VAJA 4GXVL 2ZPKL 4MFHA 4HLEA 2G60L 1VAHA 3MJ7A 3MBWB 1IC1A 2BSTA 4XXDB 5DD1H 3MBED 4NUJA 3LX9A 2G3ZA 1I82A 4KK6D 2Y7NA 4ISVA 3TBBA 4FKKA 3UBHA 2GC4C 4NLAA 4HLZG 2NOYA 1JN6A 4QEGA 5EOQL 4MWFB 4XCEB 1AZCA 1BIIA 3O2WH 4MA3B 4Y9CA 4WI8A 4EI5B 3OZ9H 2CDEB 3EDDA 3QDJB 4FKHA 1TJMA 1UM5H 3NJGA 5EU6A 4B6ZA 3NJLA 1SYVB 1YQVL 3QWRD 3NRPA 4XO3A 1MVYA 4LE8A 4F37K 4WO4C 3HHSA 3MV8E 5DA4A 1XHHA 3LEXA 3VSTA 4P4KB 4MCYA 3QDHA 3H9SB 3SDDC 1JRHL 4HMEA 3RNKB 2KPNA 1VFBB 4KPHL 4YDNA 3AS2A 3THML 4DO5A 3T1FB 1KJ3H 2OQJB 1RJYA 2IPUK 3BD4A 4L9DA 4V33A 3VI3B 4XX1E 3N42F 3L95A 1SN0A 3FU0A 2Q8AH 4BSJA 4GP5B 3EZJB 3IETA 3AMKA 4JO2H 5CINH 4A6YH 1C8QA 2EABA 4JPIA 1G7PB 3PAZA 4P2QB 4JN2B 1RP8A 3A4DA 4QGYA 1IE4A 2DJ4A 4BFNA 3IVKB 3NJJA 5CBEB 3BI9X 2P46B 5DUMH 2AJXL 5DQ9A 3IMWA 2C4XA 2R1WB 4X7CC 1H5BC 2N7AA 5EC1A 3GRBA 4U0RB 2NY2B 3EOTL 2P8MB 2X2JA 4FLQA 4EUPA 4AZ8A 2VXSL 3DYPA 3MUGB 3S0PA 2FATL 2OBGA 3RIFF 2Q7YB 1EJ8A 5I1EH 4B7IA 4NM8L 1P4BL 5BUGA 5FWQA 2YXVA 4HUNB 3VFMA 4LSRL 4PHZA 4Y1AA 5K1NA 1UXWB 2XNAA 4I9WD 3CFKB 4KO9A 4YX2L 1ETZA 1S7TB 5DJAA 5T5FH 2OXGA 2ISDA 3GLDA 2J8HA 3VGHA 4AK1A 3T4YB 2AXWA 2WNXA 1YEDB 3L9EA 4JRYA 4MQTB 3V6ZA 3P0YH 4Z7UB 3VFPA 4GW1A 2EP6A 1MXDA 4HIXH 2UZXB 5D7IE 3MLVL 4RRPM 4NO0A 2ICWB 2Z1PA 3P3SA 5AYQA 3WTUA 2FD6H 1J10A 1SHWA 4E42A 1IGIH 4GXUM 1Q1JL 4RFEB 2WN2A 3ZKXB 4BK8A 1CFQB 4AEHL 2Y1ZA 1N59A 3ARGB 1UB6B 4KK8C 4X7DC 2X6MA 1X9LA 4UZSA 5JW3L 1SY6A 3WIFB 5CR1A 4PRHE 1TJHH 4E9VA 1F4WL 1SXAA 2YN5A 3F3HA 4AVHA 1BOGA 1ADWA 3TA3B 4A67A 4WV1A 4MJ2A 1IFHH 5EU4A 2VIRA 1LO4H 1NGQL 3CE1A 3U9WA 2FEDC 3NCCB 3SBWC 2AV1B 3R18A 4V1DB 1UOLA 1QSZA 1TQTA 4H8PA 2PO6A 4X5RA 5JPMA 1FQ9C 3NTCH 1LK3L 4GSXA 1K85A 3GHPA 4CMMB 4F9LC 3B6SB 4NC1E 4XVUD 2W91A 1NCDH 3L4ZA 1YNTF 5D70H 1R3IH 4GAGL 2CKBH 1C8PA 3V0WH 2P8PA 3BP7B 4ZXBB 3T77B 5DMKB 3NIFF 3KWUA 5I17A 3FFCE 3QEQE 5HJGA 4OZHF 4IHOB 4JANA 2EXWD 2AQNA 1C5BH 2ZUUA 1GGTA 1KB3A 2VXVL 2CRIA 2IAMD 5CIPB 4L0ZA 2HFEB 1ZCRA 5EZIL 5TJWK 1KTJA 3Q8CA 4JREB 4YSQA 2JMRA 2FX7H 1JZGA 5F9OL 4EDWL 4W9FC 3SY6A 4FZEL 3KNBA 3PV7A 4XPAH 3OF6A 1HHKA 3TP4A 5F21B 5BW7A 5E2VH 3M1OA 1IE5A 3M46A 4L8CA 1W9XA 4NQDA 3U1SL 5G5DA 2G30A 4J27A 3UBXB 3WL9B 4WHCA 3MI6A 1XGYH 4X5XB 5I1DA 2R4RH 4GG6E 5LGHL 5F6HJ 4GXFA 3D4CA 4C59B 1U6AL 3QO1B 1AZRA 4JB9L 4M1DL 4ZPVB 5I0ZA 3EYQD 1WSST 5I9QB 3CSPA 3DUUB 1NWPA 3OAWA 1LNUA 4D9QD 5DS2A 1HH6A 3MLWL 2BIPA 3UBGA 2BCKA 2CHXA 3EBGA 4A39A 1MFBH 1TCRB 4DP7X 1NDGA 3JWNE 5EO9A 5AUMB 4KRPC 4WHTA 3VWKB 2J21A 4TQEL 4GINA 5ACZA 2VN4A 1KMGA 1U91A 4JFFA 3VA6A 1V3MA 2HFGH 1CFNA 4KMTL 4B50A 3O45A 3L2NA 4M03A 3EAKA 3P4NB 3O4LD 3KDMB 1YVLA 3BQUC 1B4TA 1NFIA 2OXHA 1XTMA 3E2HB 3EF7A 3LKOA 4WFEE 1S7QA 5A2KH 3LH2H 2W07B 1AFVL 3GK8L 3GYRA 5DRNA 3SDXA 4KFMA 2KBGA 4CVWA 1G5AA 1WICA 4S11A 4I1NB 1MUJB 2A74A 4RCAA 3NGBC 1KCSL 3MCLH 4YHOH 1ULVA 4MMZB 1RJLA 3UZEC 2JB5H 3CUPB 2A6DA 3UH8A 4OD1L 3QC6X 3DPBA 4NUGL 5T5NG 3GFUA 4LSTL 4AL8L 5CD5D 4IRSC 5HYSA 4GQZA 3QDMB 5DFTA 4LCIH 1PZDA 2BSCA 5GJTH 4G7YL 3PFUA 2UXVA 5DZPA 2ADGB 3B3BA 4YDZA 3HG1B 5AVXB 4PGBA 3JXAA 2QL1A 1OLZA 3KR3H 1DDTA 4OM0H 5DD6B 3S8FB 1XSJA 3D0LB 3NN8A 3PHSA 3GHBH 1FNHA 4YSDA 3DTXB 1P6WA 2FIRT 4QJ3B 5IUSA 2IH9A 3D1MC 3V9CA 3MRQA 5IFAL 3BVWA 5LWYH 5D6DC 4I3SL 1NC2D 3F84A 1TT6A 1P2CA 1AGBA 3C6SA 4H88H 4HQQH 4W6WB 1HWGB 1KDIA 3L9RA 4YL4A 5HPMB 4PRIE 4PJXA 4NJ9L 3WFEH 1BVZA 3A6CH 4Q14A 1LEKA 5FYKD 1AHWC 4WCYH 4ZMNA 2VDRB 3OX8A 4R90H 3P9WB 4MNGB 3P3TA 1GGCL 2GK0A 3HC0A 4HKZA 4NQQA 1Z5YD 5D55A 1ONQA 3QC5X 5CO1A 1JNHA 2IAND 2PXYD 2I60L 5DZVA 4GY4A 2DM2A 1NTDA 4LSUL 5TGBA 4OCRL 1JUFB 1VGKA 4BUGA 4DKEH 2GHZA 5IB5A 1MPAH 1MW0A 1GZQA 2QZQA 2WC7A 4NUJB 4FC3E 3UCQA 2YJQA 4UT6H 3CLWA 1BF2A 4DGIH 1Z5HA 4PVLA 4ISVB 4NJAL 2XN1A 3EFDH 5E24E 4CMHC 1BIIB 4XP6L 4OGXH 4RX4A 3UXFA 4G1EA 5DD1L 3CSYA 3VXTA 5K9QG 5FO7A 2QVTA 5HYIA 4HIQA 4Z7WE 1U8HA 5EU6B 1J8HA 5ISZA 1NFDE 1SN2A 1YNLL 2VW4A 1CXFA 1BZEA 3O2WL 1H8OA 2CJTA 3DXAB 3HHSB 4XPHH 4ZD3L 1P5VB 5GS3A 1CGVA 3LEXB 4LEXL 4MCYB 2LLGA 3OVUB 3RJOA 1D7DA 3CFCH 5HD8D 5B1JC 3OPUA 2IH8A 1YLBB 3U30C 1RJYB 3QSKB 2YK1H 3L95B 1DBBH 3C6LD 4AC2A 2HVJB 2D4FA 2WVTA 3IETB 2CBMA 3B7TA 2BVEA 4QXUL 3HAEA 2LFEA 3G6DH 1RD6A 3KPRD 5E4AA 3BMVA 3VXUE 4JO1L 4FG4A 3H55A 2A1WL 1TETH 4R2GC 1AXSA 2FECI 1VJSA 2Q8AL 3DO7A 4P9MH 3IK2A 3B9KD 4I8DA 4JO2L 2CBOA 5CINL 4A6YL 3BDBA 1A7NH 5F1NA 5C70A 4FFZH 5DQ9B 1OAZL 1E40A 3SQRA 1RURH 5EC1B 2IBZX 4YLCA 4D7BA 5J89A 1LEGA 2F7QA 3IJSA 5DYOA 4EUPB 4FNQA 4AZ8B 4RMWA 2MPAH 1WG3A 2CUMA 3DDFA 2E0PA 5FUOL 1IM3D 1BREA 4AT6A 2YQ3A 4L9LA 2UXGA 1PSKH 5DC9B 4YDJB 1I8MA 2CJUH 3VW3L 2A4CA 3IBOA 5DJ6A 1PYWA 3VFMB 4Y1AB 3WTWA 4KVNH 2P7TA 2XNAB 2XX1A 5IVOA 3UAFA 1DJWA 4LVHB 3ULUF 4UQ3B 1F1GA 1XV8A 5DJAB 5T1LB 5I1EL 2OXGB 1TNMA 4AEIH 1TZ8A 4JRYB 4YHKL 4IKNA 3V6ZB 4Z8FL 5D2LA 3VFPB 2NQDA 4GW1B 4NQCE 4RMQA 5F9AC 3SYCA 3ZE0E 5LQBH 3EHBC 3RP1A 3ZZ1A 5B1AB 3VD7A 2J25A 4RRPA 4LP5A 2KI6A 5T5FL 3OAZH 3QPKA 1MVUA 3WEOA 3QI9A 4KUZL 2G4GA 4QHKJ 1HEHC 4J4PA 1OHQA 5I6XB 4JM2A 3JUYA 1SJEA 2BP5M 4HIXL 2BY2A 2YQBA 4Z7NE 1WFJA 2PCYA 1UD6A 2FD6L 2ODHA 3FT2A 4ICWA 4U33A 5LDSA 2ZXCA 1XB6A 43C9A 3D7PA 4GQ9H 2Q5BA 4C8XA 3FH5A 1IGIL 5IY5B 2VSKB 4N0YH 4ZSOA 1BOGB 1ZKAA 4MXVE 3AS1A 2XTJE 4WV1B 5I28A 1BBJA 5HHPA 3TM6A 2X05A 1IBHA 3VTTA 2E47A 5EU4B 4XXCA 3BP4A 3CXHJ 3MXWH 4ES9A 1TZAA 1RFDH 4J3WA 1MNUH 3WEAA 5JPMB 3NJXA 5TE7L 3AT8A 3CZJA 1ODAA 3OQRA 1D5MA 3VMPA 5L7XH 3B2UD 4APQD 4LRNH 1JHTB 3OAUH 3CH1A 5CLZA 2P8PB 5M7QA 1Z0NA 3IFOA 1E50A 1QYGH 1IAIL 1GYCA 2FDBP 5I17B 3UADA 3ZE1E 3TV3H 3VD5A 4JANB 2DRUA 2RFXA 4NBXB 1NCDL 5D70L 1R3IL 5CILH 3A67H 1RK0A 5CJXA 5ABZA 5I1KL 1DVFC 1E4WH 5C07D 5ABDE 4F8NA 5DVLA 3FCTA 4PD4K 2E9JA 4LCWA 1A4JB 5FLVA 4WK0B 5IB2A 4NKMA 2YFNA 3KNBB 1IM9D 2Q86A 1N0LA 4TVUA 3KLAA 3AT0A 3BPLB 4PRDA 4UMSA 4JDTH 2H0PA 4ZW3A 2GTWB 5A2JH 3MLRH 4L8CB 1BYNA 4NQDB 4H7VA 2AJ3A 2D9QB 4LLYA 3ZE2B 1C5CH 3RIAK 2FHFA 1FFPB 3INOA 1JNLH 5I1DB 4O2CA 3MNVA 4XPAL 1IGFH 4WI9A 1YMHB 1S9WA 2CE6A 5I73C 5E2VL 1U3JA 1A6UL 1AMXA 5SWSE 1CXLA 4HEPG 3QZLA 1XGYL 1LNUB 2HPTA 2CIKA 1E43A 2BCKB 4LPCA 2EDTA 4MMXC 5KS9F 3TYFB 3KHQA 3ECVA 4O00A 4N0CC 4BZYA 2EIBA 1JFQH 4ZO7A 1EO5A 3C08H 3FU8A 3ZN6A 4WGKA 5ACZB 2WNWA 4YGVA 3O6LH 5T5NF 1U91B 1MFBL 1CFNB 4G9FB 3O45B 1XBDA 4OF3A 3D2UA 5FUZL 4TNEA 2WZ5A 1NFIB 2OXHB 3LKOB 1S7QB 2F1AA 4MAYD 6PAZA 1OWRM 4DF9A 5DRNB 4RGOH 2XJLA 3TC9A 5I1JL 3SDXB 1E6JL 5GGVY 3OLGA 3KPPA 3EGDA 2A74B 2X88A 2MEJB 3FQTB 3MYJA 3CH8A 1T5WA 4POZD 1RJLB 2Y36L 2A6DB 2AI0H 3MNZA 3DPBB 4LBEB 5HYSB 1OGAB 5JHBA 3CHPA 2G3NA 3CFDA 1JF5A 3MCLL 1MW3A 3QUYA 5DQDL 4GI9A 4AYDC 1BAWA 2OI9B 4XMPH 1N64H 2D3JA 2CNYA 1FFOB 2ICES 5HHXH 1BGXH 4YDMA 4C58B 3EH5B 2YMXL 3JYCA 4XBMA 1WD9A 1OW0C 3NN8B 5FECB 2CWRA 5CIPH 5GJTL 1ZHBA 3SJVE 3S5LB 5DJXA 2NX5E 4WI6A 4QRRA 5BZZA 3KR3L 4F7CA 5F7EH 3LQMA 1NIDA 2IJ0C 3QUXD 2MMXA 3L9RB 4LHUD 4WWKC 3GHBL 4P5KA 4PJXB 1TO4A 3KCPA 4ZS7H 1LEKB 5LWYL 2YO3A 4MA8L 2AQRA 9CGTA 3OX8B 5IHBA 4XNXH 3WY2A 1T2QL 3X1NA 3HC0B 2GK0B 3IRZA 3IS0X 4HKZB 3BUYA 4H88L 4HQQL 1ONQB 1YC7A 4KX9A 2XQYG 5EN3A 2PPFA 1JNHB 3NP3A 4HJGB 1MH5B 4OZHE 5C7XH 4XNYL 1ZLDA 4WCYL 1CGWA 1M2OA 3MBEC 5TGBB 4AYID 1VGKB 4B9PA 4KK6C 4DZ8A 5IB5B 3VQMA 5A7EA 2DL9A 1GZQB 2BS9A 4FYSA 3RWJA 5E9NA 4WFGE 2B1OA 1NAML 2FQEA 4L8SC 3DVFA 3EO9L 5LN4A 4D3CH 2R59A 3HKZA 3HBQA 3QDGE 3FU6A 3D08A 1CGSH 4MB5A 3ERXA 4U4BA 4IBSA 3CSYB 3VXTB 5FO7B 4DGIL 1SF5A 1P6FA 1U8HB 3EFDL 4PJ7E 2IDFA 1OXYA 1DBAH 5ISZB 1E4KC 4NAJA 2WKGA 4F7EA 2FRGP 4N8CL 3ULUH 2ARJQ 5AW5B 3PPEA 2MSPA 1BW8A 1PZBA 1OALA 5FV2A 4UM9A 2JKRM 1IAOA 2DV6A 3RVXD 2FWLB 5E6ID 1NMCC 3L5XH 1SUJA 4FTDA 1I85A 3L8QA 2BXYA 3FL7A 3DJRA 3S6CA 1SJXA 2GSMB 3CFCL 1RP9A 4G8EA 3D34A 4AGPA 2YAFA 1QSFE 3HAEB 3LD8B 4H20H 1RZGB 1CDHA 4B41A 4DP4X 2UWEF 1AXSB 1PY9A 2Q8BH 2WBJC 4O9HL 4OD2A 5GZOD 5C6TH 1JZFA 5K9KB 1TQBB 2NQ3A 4HBQA 1QO3A 5LNDA 1UWXK 3H2QA 1TETL 4L3EE 4XPFL 2OMXB 4XWGH 4RMBA 4PP1D 1LEGB 3IJSB 5DYOB 4ZMYA 2OMVA 4TUKH 1NKGA 3ML8A 3GXIA 1A7NL 1TKWA 1T2JA 2VISB 3H9ZA 4FFZL 4NZFA 4AT6B 5FGSA 3NRQA 4L9LB 3HJEA 3SY0A 2HT4D 2CDFA 2CHZA 4BCZA 3C75A 3TLRA 1PYWB 2H47C 3ZPDA 1MELA 2MPAL 2P7TB 4ZUTB 2VDPH 3RWIA 4PGCA 2B16A 5EIIB 1E3XA 3EADA 3FK3A 2VDRH 3GS0A 4XN5A 1AQ8A 1VLXA 2CJUL 4AGQA 2IO5A 5D2LB 5E7BA 5C0JB 3MTXA 4GMSH 3UX9B 3L81A 1HJCA 4JPVH 3QUZD 1RCYA 5E1AA 4AEIL 4FE9A 3X11A 1MVUB 3D06A 2E8ZA 3QI9B 3SGKA 4YDLB 3WGUB 5LQBL 4FCHA 1SJEB 4Y89A 1A6PA 4LCUA 3D09A 5DZLA 2Y4SA 1SEQL 3NMEA 4HG4K 4PP2B 4EIZC 1KULA 3FT2B 5ICXB 1NIAA 1WV7T 4N87A 43C9B 5C0AE 1LQBC 3CFNA 4M8VA 4PR5A 1WZKA 3OKMA 1DSFH 5G4NA 2V2TA 3L4XA 4ZSOB 2JJTC 3K4DA 4Y5YC 1L7IH 2K3HA 5B1BB 1ITCA 3LB6D 3CVHA 2JNZA 2XN9A 3F7VB 1BBJB 3GSUB 5HHPB 4GQ9L 3BUPA 2VRQA 3V0JA 4F9LA 5E8PA 1JDAA 2AJYL 3BP4B 3JBG7 3H3BC 2X6AA 4G1MA 1MWAL 3L3OC 3FCUB 1M7UA 1A7OH 2VUKA 2XFXB 1YMME 4XVUC 4E41D 5A2AA 1NLDL 2ZUSA 4HJ1A 1KCRL 3B5HA 3DBXA 3PS6A 5DZ9A 5GPRA 3MLXL 2XU9A 1RFDL 4RMSA 1MNUL 3CH1B 3FO0L 3VXMA 3IFOB 2ZOTA 3BH4A 1EHNA 1HXYB 2EXWC 3VXPB 3WFCL 1NUFA 3I02A 2RFXB 5L7XL 4NWUH 2H2PD 3VB8A 5GRXG 4BKSC 1RK0B 1HZHH 3ISWA 1G7MB 1YDPA 1DQQA 1QYGL 1ZVSA 7PCYA 3FCTB 2X1OA 4LCWB 1F00I 4YJZL 2VE6A 2A77H 2E5EA 4QRTA 5IB2B 4EUPH 4UQCA 2Q86B 1AR2A 2PWFA 3KLAB 1OK8A 5E95B 2NR6A 4U05A 1YQ2A 3NT0A 4LLYB 4K23H 5C9JB 2OSLA 1QFWM 1NUNB 2X4NA 3MNVB 1YN6B 4LESA 4O2CB 1KELL 4DGUA 4JDTL 3EYQC 1ET8A 3L2MA 1MIEH 3LRSA 3NESA 2UXTA 3LXBA 1EAOA 1C5CL 1VZHA 1MW1A 5MEPA 1JNLL 2FJGA 4PRPD 4P07A 2BS71 2CIKB 4A7UA 3P77B 5CP3A 4N68A 4EIBA 2FJUB 4LMQE 1GIGH 3STBA 1BVLB 4Y19D 4K0OA 4J3OD 1KYOJ 1NZRA 2RMNA 3ZZQA 1SLVA 3SGDH 2LU3A 2C7UA 4NP4H 1UD5A 1Z32X 1BJMA 2QQLH 1U3HA 3VTMA 1K5NB 1S78D 3QRBA 2VJ8A 4GG8B 1CE1H 1XBRA 1SY6H 5GGQL 1E2WA 5H37A 3HNSH 1G7JA 4O02L 1GW6A 3D2UB 1L5GA 5FUCE 5TQ0H 3VD0A 4FQQA 1JFQL 3FO2A 3UZEA 3C08L 4FEIA 3O6LL 4RSYA 1C7SA 3BIKA 4IRSA 3O11A 3DLQR 2EO9A 3EDKA 3EGDB 4X4YA 3RTQD 3MYJB 2QT6A 3SPVA 3TCTA 5E2UL 3V10A 5DCCA 4EMZA 1T5WB 5CGMA 3DK0A 1A3QA 5CD5C 4RFNC 1EPFA 4RGOL 1BHGA 2A9DA 2CUIA 3D18A 4JR9H 5DVMA 1P7QA 1E5YA 1T5KA 3QFJA 3WJJA 5J11B 4Z3JA 3CFDB 5C0BE 1BXUA 1A9VA 4BKTC 4MNQA 3QUYB 4QRQA 4EZLA 3HZMA 5AW0B 3SGDI 4C83A 2X4SA 2CO6A 3QS3A 1U2CA 5AOKA 2AI0L 4MZRA 1Y07A 1KJMA 2OSYA 4OZGB 2DQGH 4S1QL 1JWSA 2Y06H 1PFCA 4U7SA 1ZHBB 2OJ1A 3QNYA 2DMCA 3RDJA 1GS6X 2EDQA 4NZUL 1YEWA 4MVBC 4AQ1B 5DJXB 2APXA 3LHPH 5IJDC 1WBYB 1KN2L 5CJ5A 3MLTB 1NKRA 3MV7B 3CNKA 2X28A 3WBDA 4XP4H 1EJOH 4JM2F 3VNZA 2EYSA 1UH2A 3VGBA 4BWUA 5AZUA 4PGEA 4PLJD 4ICXA 5DD5H 2FVNA 4L4TD 1SXSA 4CL7A 3BUYB 5I8KH 3OV6A 2V5TA 3QDAA 3WO4C 4QUOA 3MODH 4DVRH 3AGWA 1CURA 4MKMA 5HJBA 1BJ8A 3BAEH 5AG8A 4G5ZH 5GS0C 1DL7H 3C5JA 4XNXL 3CJJA 4DZ8B 1HXMA 4Y5VC 3EGSA 2L3BA 5JXEC 5HDLA 4WFHD 3RWJB 1CS6A 2V17H 4P5MB 2ZWZA 1G5GA 5C7XL 2AW2A 2HFFA 4L2YA 2CA3A 4Z7IA 4JFYA 4UQDA 3BC9A 2A38A 4HWNA 3V2AR 4WSGA 4JQIA 5I8OH 2Y9RT 2BJML 2VL5B 3PJLA 1TVHB 4DTGH 4CGTA 1MLCA 4LBAA 2M26A 1J18A 2EICA 1BA9A 5K9JH 2M2DA 4F7EB 3WHE1 4I3RH 3QHZL 2UZYA 2AK4E 1CGSL 3BT2H 3QIBB 4NDMA 5L2KE 1IFRA 5FB8A 5HD8C 2O5YH 5EO1A 4IBYA 5EG6C 4DK5A 4UM9B 4HULB 1IAOB 2GI0A 2IAAC 3V79C 5BRZB 2VLMD 3RFZB 1ZXQA 3C6LC 5EU7C 1WBZA 2Z64C 5J7CC 3FB6A 3IBEA 1M7XA 4AJWA 1F3DJ 3GZOA 2DTMH 2XIDA 2B8OT 3SGJC 3ZL4H 3AU1A 4N0FA 5KS9E 1WIOA 5SWZE 3VVWA 4G8EB 1KPVB 2AEIT 4YIQA 1Z9MA 4KRMB 4M4PA 4P23A 3GNMH 4Z7OB 1EQWA 2WYZA 4JUSA 3B9KC 1QI5A 1J5OH 2DQDH 4UQ2A 1TTGA 3GHEL 1CFVH 1QO3B 4H20L 2YLKA 1A6ZA 4J28A 2XXFA 4UDUA 1DBMH 3RVUD 3GMLB 1CJYA 4Q97A 3ASWA 5C6TL 2BS8A 3FT1A 3T8XA 5AB0A 2IV9A 1PX8A 4G9DA 2VMFA 1HE8A 3PUUA 4GFTB 4XMUA 3KEDA 1SRDA 4AMXA 2NLJA 4TUKL 2N7SA 1I4FA 1ZLWH 1RV6X 3RWIB 1INDH 2VDOH 4PGCB 4BH8A 2XA3A 3QULA 1OT1A 4IOFD 1J0YA 3JV5A 2EC9U 1A6TA 2GBAA 3HC3H 1SXZA 4YS4A 4YK4C 1LO2H 3HN5A 4YC2C 4B9YA 5EULV 4C56B 5E1AB 3X11B 1IQWH 4TSBH 4YFLF 3WKYA 5EEZA 1BEYL 1E6OH 1WFNA 2QQKL 2GSGA 5CNHA 4LCUB 2XWXA 4OQTL 5A2FA 1OVZA 1MEXH 1EVUA 5CCKH 4FULA 2WZ6A 1QP1A 4XBPB 2AZUA 4PR5B 5J1AA 3NCJH 1UD4A 5I5RA 2V2TB 5IOPB 4TL4A 1X5YA 3WN5B 4CSSA 4P3CH 3CVHB 4BINA 2XN9B 1OZUA 3GLAA 3L1GA 4FTVB 1YPZA 1DZBA 3SBQA 1SVBA 5DWPA 5TD4A 2GEQA 2CO3A 3SQBA 1L7IL 1AQDA 4MNHA 3WN6A 5B4MC 3TZVA 1RZKC 2J4WH 2P8LA 3ELAT 4YWGH 2WXJA 5BO1H 2DB8A 3RWHA 4APQC 4M3JA 3UTZA 3C2AL 3MA7B 3EOBA 1XSOA 3BKJH 5L2JA 5HSFA 1ZPUA 1QPXA 4ESKA 2R23A 1DVFA 1EO7A 3VXMB 3FRPG 3PXHA 4Z77A 1A7OL 2XIIA 3MC0A 4OQ1A 5GGVH 3I02B 2BP8A 3ZHLA 1JVKA 4AMKH 2P5PA 5KBDA 4Y4HD 4XOEA 4TTDD 4OFDA 2VDMB 1LE5A 2J1KA 1DQQB 1ZVSB 2OCFD 4UOW1 3VH8B 4MQXC 4CVZB 2VM3A 5DVOA 1F41A 2J7LA 2Z7UA 3POCA 2VE6B 5FF6A 5A16A 5L0QC 4JY5H 2X0UA 4QRTB 2F53B 1X5KA 4YEEA 4EIGB 5GHWH 1HZHL 4ZFGH 5DYFA 1G0YR 4IRJD 4N9OB 4WI0A 4X7SH 3U2IA 2EH7H 4CN4A 4ENZA 4UMGA 2FE0A 2A77L 3NACH 4MAUH 5IQ7H 3B1UA 2AANA 3K91A 2JTYA 2X4NB 3GGWB 3Q2CA 2UWEE 5LCVL 4HSQA 2GJ6E 2Y3NA 4W9IC 1M2VB 2R0WH 6CGTA 3WE6B 4MMXA 1HNGA 3LRSB 4L05A 3M88A 3MV8D 3Q8AA 5E99H 5C09A 3TNMA 4GUPA 4JL2A 2J8UA 1E28B 1WQVT 4K23L 4P2YA 4HCGA 3W0WB 2B5IC 3MRNB 1J87A 4UV7H 2YMTA 5KSVA 4PJ8D 1MG3C 3KVPA 1MIEL 2FJHB 4XCNB 3FQRA 5CFAA 1G87A 4OIIH 3ZO9A 3MJ8A 2N3JA 2C7UB 5D7SH 3BVDB 3T2NL 4ZW7A 1MG2C 2YPVL 1AH1A 3LS5L 4N85A 1U3HB 2VLJA 2CCLA 2CU9A 1QVOA 3ABLB 3RURA 4P2OA 1GIGL 2DLFH 1T04A 5KZCB 1G7JB 1OSYA 2ZXDA 3FUHA 4MAYC 1TEFA 4FQQB 2QQLL 3FO2B 3IDYC 4G3YH 4DGYH 3TBSA 3WXWH 2BSBA 3WJLC 4JO3H 2GC7C 1SBBA 3BIKB 3W11D 2EUXA 1F3JA 3O11B 1TQCB 5KBNC 3OZKA 1HDMA 5IMOB 2W0PA 3HNSL 4POZC 5EO0A 1OY3B 4X4YB 1QZ1A 1MZYA 3MSPA 5TQ0L 4X9BA 3SPVB 4BRVA 1ZANH 5T1KD 4J3XA 3QJZA 1XH3A 2VDNL 3D18B 4Y2NA 2EE9A 4FERA 1P7QB 2NYKA 2JQMA 4BKLA 3QFJB 4OVVA 5HYFA 4L29A 1S7RA 2F15A 2QFRA 4KZEL 4FHJA 1Y1UA 3IXTA 4MNQB 4QRQB 3JYBA 4X6DF 4X80L 3HZMB 5I16B 3D69A 2X4SB 2CO6B 1J1OH 4WKZA 2XZCH 4WK4B 2ICWJ 3U25A 4M7LH 4K9EC 1KJMB 3FFOA 2ZUXA 3BZFA 4JR9L 1U8LB 4YSEA 2E59A 3VFGH 3ZRCC 4I13B 1KTDA 4WWKA 4HUCA 1KBKA 4FQHB 4K8RH 4N1HB 4KTEL 3BEWA 1XD0A 1EJFA 1GY1A 3I9GH 3IKKA 2HJLA 4NWTL 3QXVA 1T22A 3KDPB 3A6BL 4DPRA 1GCFA 2Y06L 2EYSB 5DK3A 1WT5C 3STZA 2XBZA 4PGZA 1JGVH 3MBEA 4PGEB 4PRHD 3M86A 2H32A 2NUTA 3TNNB 4YHNB 3FUKA 3G6AA 4Y9EA 3T0DA 2WLJA 1MDTA 1QSEE 4YPGA 5IMMB 4P9HL 5F7WC 5IB3A 1EJOL 1MCPH 1NPNA 1KN4H 3ZHNA 1ZE3H 4J3BA 3CX5J 4N1CA 4L8SA 4HPHA 2KLTA 3VFWB 3KM2A 1J11A 4S0SD 3IEAA 3C5JB 3TYGH 1KPRA 3OSVA 4YDIL 3EGSB 5I8KL 1WA2X 2ERJC 2JSFA 3W37A 4WU7A 3QR0A 3QWRA 2WQSA 4DVRL 4AH2A 1E4KA 2EADA 2HFFB 3BAEL 4JN1H 4X9HA 4G5ZL 5AW9B 1DL7L 4JFYB 1BQUA 3Q9QA 3FFDA 3MFFA 3TU6A 2G9KA 1X4XA 1GYWA 2WLLA 1MQKL 2V17L 3KL3A 3ZR6A 4BFRA 3VRIA 1MLCB 3FFCD 3QEQD 3QUGA 3QZOA 5EWIH 4MJJA 5IT2H 4G7VH 2UZYB 3OBAA 4NDMB 2E9IA 3BZ4A 5I8OL 2TRYA 3RVXC 5E6IC 5K1JA 3MV01 3T6QC 2HG0A 2IPKA 5K9JL 4KXBA 4I3RL 4R2GB 1WBZB 3FUFA 3FB6B 2VXUH 3BT2L 4ALAH 4NUPA 1FV1A 1XO8A 4N0FB 2FJFA 4PV1C 5JOEA 4I89A 4FI7A 5GGRB 1AACA 4YIQB 3SBPA 3WHE0 3QW9A 5C0EA 4P23B 3MMEA 5GZOC 1QZNA 1DANU 1GTFA 2J5LC 3L08A 4YVNA 2DTML 3FYIB 1K4CB 3ZL4L 4Z23A 2CMRH 4ZYKA 4PIRF 1OV8A 3UJIL 3ZIYA 1SN5A 4UQ2B 3ML9A 4LDCA 2G2NA 1UFGA 4PP1C 3T0XA 2D31B 3UOAB 4UDUB 1OM9A 2EDRA 5KTEH 3B2DC 2O1AA 2DQDL 3QAQA 4PYHA 2EDWA 5F88A 4M6NH 4IJTA 2WKLA 5HHMB 5B7MA 3T8XB 1P6AB 2NY1D 3QEGH 3KLHD 2YQGA 1QHOA 2GJJA 3CDZA 2A9NH 4Y16D 1CPUA 1H3TA 3QXWA 4DGVH 1KXVA 2EZ0D 2BFVL 4FZ8H 5EIVA 1L9QA 4BH8B 4U6TA 3QULB 1T1WB 1RHFA 3NFNB 1ECYA 3GKZA 2CSPA 4WFED 5SX5H 1TTCA 5F9JA 3QUZC 4HKJA 4KTDH 3ZKMD 3KLQA 1FNEA 1INDL 2VDOL 5TE4H 3TEZA 4AITA 1F97A 1V3JA 2NY4B 4I0PB 2GSGB 2ZOWA 2JJTA 2BMKB 3HC3L 3HUJE 4N3UA 4Y5YA 2O72A 3L4UA 1EK3A 4FI8A 1LO2L 3US0A 3V0AC 4HX1A 3N41B 2GITA 4ZFFA 4Q4EA 2YD1A 1W15A 5LBSH 1IQWL 1Z5LA 2GFBA 4TSBL 5J1AB 2DIBA 4M3KB 2O61A 5MI0C 5DS8B 3UBXG 3LB6C 2W80C 3L3OA 3BSZA 2APBA 1MEXL 3KGUA 2EYTA 5HVGB 3PWVA 5I82A 3GSNH 3TJEH 3I2CH 3GTTA 2ZKWA 4L4JA 5F6IC 1VPOH 1YPZB 2HWZL 1P7KA 4GIOA 2XWBA 1CDGA 5D72H 3QUMA 4OB5H 2Z8SA 2MCPH 3SQBB 1AQDB 4MNHB 5FHAH 1X5JA 4U6VH 3TZVB 1MQ8A 3CFJA 5IM7A 2P8LB 2IAMA 4AK2A 1KFGA 3RWHB 2V5MA 1J1XH 1FAIH 2HKHH 1Q9LA 2F08A 3EO0A 3EOBB 4PRID 3UTZB 4DKFL 4L4VA 5GGSY 4LQFH 5L2JB 4GO8A 3LSOA 5E8DH 2EE6A 2R23B 1DVFB 3H2PA 4QTIL 5BRPA 3HE7D 2Z4QA 3GINA 1DQJA 5BO1L 4C47A 1FL3A 3D9AH 2H2PC 2W0LA 2PP9A 3VM7A 3KWVA 1MCBA 3H6JA 3VG0H 5LAPA 2XDHA 3KL5A 1BVNP 3OPZL 2HG5B 1AZNA 3KJ6H 1XGUA 5DXWA 5KYYA 1DR9A 3ESNA 3WJMB 2QKSA 5GGVL 5CM1A 3O0RH 5FF6B 2HXAA 4WTXA 3V9FA 5B39A 3ZYOA 2DIJA 1FRGH 1X5LA 2WPGA 3ILQC 4WI0B 5A1AA 3MRGA 4ABVA 3U4EA 3T8VA 1YSOA 3S3PA 2VOTA 4R0LB 4JY5L 3FZUC 3EUDA 1LXMA 3RY6C 3I9PA 4ZFGL 4UOW0 2Q76B 2B9AA 2EH7L 3FUMA 1COBA 5C09B 3TONA 4L1TA 4BQBA 4FYQA 3UTOA 4BFIB 2RAMA 2AEWA 3BKMH 2J8UB 4FMVA 4MAUL 5I1CL 4NRZB 4J3OC 2P42B 3S48A 5KSVB 5BVJA 5KSBB 1OP9A 1NAKH 3GRWL 3O4LA 4PJAB 1RI8A 1WD8A 2NCMA 3FQRB 4MLSA 1IIIA 2WIIA 5JQHC 5DUPL 3CVIH 2Q1EA 3GBNH 1G0DA 2VLJB 3KCWA 3O4OC 1QVOB 3HZ3A 3I84A 4P2OB 3VXUD 4U1LA 4Y2DC 2YOAA 4YSTA 1T04B 4OIIL 3NAAH 4Z0BH 4AQAA 4B3VA 3P40A 2DH2A 3O9WB 5LGYA 1JXFA 1DBKL 2HH0H 3HE6D 4PJFA 3MCYA 1E3FA 1JZ6A 1G9HA 1ZRUA 4HV8B 4P2RE 1N2RA 2DLFL 2H0JA 1F3JB 3RTQC 1HDMB 3RKPA 2OP4H 1AO7E 3LDBC 5EO0B 3HC2A 1EEYA 1BFOA 1QBLH 1XR8A 5EZOH 4DGYL 2WCPA 4EI6A 2XJKA 1XH3B 3WXWL 2VXTH 2ZICA 4PW3A 4JO3L 4BM7A 3VXOA 5EN2A 4BKLB 4BXSV 3RTLA 4UT9A 3IJYA 4M62L 4XOCA 4L29B 1S7RB 2XYCA 2UYLA 1R3HB 4JG9A 2X4RA 1JXGA 3V5DA 3IXTB 4J23A 1NC2A 2F61A 1ZANL 3GIVA 3D69B 1U3ZA 4N8PA 4W9EC 4WKZB 2DBLH 5I0YA 3RLSA 1OIOA 3E6HB 4P59H 4X8CA 5C08E 4NM4L 3BZFB 1A0QH 5BQDA 4NQCD 4ZOBA 5K69A 2NY3D 1FN4A 1FFNA 2K9FB 1QRKA 1P53A 1BQ5A 1QKZH 1JJUA 1FFQA 4M7LL 1J9RA 5EDXA 2RQ8A 1E9QB 2IANA 1T22B 2Y6SD 2PXYA 3F58H 4LARL 5FW6A 4K8RL 3STZB 2PETA 1K3IA 2X3AA 3LVTA 3W5NA 4PLJC 4F57H 2LLLA 4NN6B 2NUTB 2H32B 1KJ2L 2NQCA 3G6AB 3BH9B 1F4XL 2R0LL 5IB3B 1UOKA 1L9SA 5E2TH 4H5SB 4AV5A 2FJSA 1SHMA 1T0OA 2XTJD 4L8SB 5D1XB 3T65A 1JD7A 4YBLC 2FCBA 3VI4A 5MEOB 3GTNA 4PVBA 4ZJ9A 5AVUB 1DZ0A 4LLQA 2ARWA 3T0EE 1MCPL 1KN4L 3K3QA 2BRRL 4WU7B 1Z9OA 3WUWA 2D8KA 2O4EA 2B1HH 2MRYA 5K39A 5DDHA 4AH2B 2CRMA 5CP3H 3TEWA 1ZA3A 1IVLA 1PZCA 2QDWA 4FQIH 4WI7A 4ZK8A 1GR7A 1NH6A 5D6CA 3TBVA 4BHUA 1RPUA 1WP6A 1A4KA 1BQHA 4MBRA 1FGVH 3OKDA 1TPXB 1ITBB 2FL5A 3C6LA 3HOGA 2N0KA 4CBZA 1KTKE 4MHHG 1RIVL 1PF3A 2W9LA 4PS4L 3UYPB 2FBRA 3BZ4B 1FZJA 5H37H 2GTQA 3HBZA 3KPRA 1DQMH 4FXLA 5CGYD 2IPKB 5EWIL 5IT2L 1A5FH 3O3EA 4D0BA 3B9KA 3SDAD 4WF7A 1FV1B 4LOEA 1RU9H 1V7NH 2FJFB 2ZWNA 3PP3H 3ZTDC 7FABL 4HHWA 1CBVH 4YFDB 5HHNA 4W4NA 4XN9A 3SODB 2ZX6A 3MMEB 3UIZA 2QPSA 1M9WA 2VITA 2R2CA 1IM3A 2Y7LA 1BWWA 1N9PA 4YVUA 4N2DA 3II3A 2FSEB 4B53A 5SWSD 3VX0A 3DURB 3BUDA 3RL1B 3LQAL 2CMRL 4PJCA 1B4JH 3AXLA 4YQXL 5F88B 2FO8A 1NOFA 4ZMQA 2EXTA 4A37A 4OM1H 1LM8V 1I9JL 3T0BA 3U4BH 3CDZB 3Q8EA 1DVUA 1J0KA 2JKTM 3VFNA 3CN0A 1AG0A 1N6QH 2K8MA 4XNAA 4G6JL 35C8L 4IIQB 3LN4A 4M6NL 4LKXB 4IOFC 4HCRH 3LRKA 4CUCA 2XLLA 3QEGL 3UERA 1R75A 4TVPE 2OTWA 5A6MA 1H8LA 4X6DE 3AJ7A 5CHNA 4AE0A 5IFHL 3NCYP 2R56H 1HAUA 1WAAA 2OL3H 5GGTL 5CFHA 1J8KA 4DGVL 3RJDA 4HKJB 3P1VA 1FNEB 2FEEI 4OJCA 4L1BA 4AC4A 3EH1A 2R8SH 3SOTA 2Z91B 3RDTD 4IJ3B 5ADPH 4KTDL 4Y5YB 3CFEB 3P69A 5KVFL 4HX1B 4LXFA 4ZFFB 2DLGA 3CHRA 1Z3RA 2H6PA 1Z5LB 1O0VA 2GFBB 4IDJH 4JDZA 4A2FA 1G7HA 5IROC 3TO4D 4BWTA 2VO8A 3L3OB 2GTZA 1KEMH 2EYTB 4GKNA 3FQWA 3PWVB 3TJHC 1RLWA 1IC4L 5LBSL 4APQA 3VRJA 4PEEA 2XWBB 3SJVD 2OM5A 3RGVD 3QUMB 4BELD 2ALAA 2NX5D 4NN5B 3TJEL 3QXDA 3CFJB 2V9UA 3GSNL 5IM7B 3I2CL 2IAMB 4TXVB 1DQDH 1VPOL 3KYAA 3MGTB 5C07A 4OCWH 4L4VB 4ODVL 4RGNE 4OB5L 4LT7A 3ZHFA 2MCPL 3LSOB 1FHNA 2FQDA 3E7JA 2Z4QB 4B97A 1KLFB 1FL3B 3L17A 1XCTA 5F3BA 1IM9A 4JX0A 3Q2VA 4Y4HC 4RIRA 3IFNH 4TTDC 5BMFH 3GXDA 3V8OA 5E8DL 4HD5A 4YZWA 4XVTH 2L0DA 2VLKE 2XWCA 1GSMA 3EG9A 3FONA 3WFHA 5KYYB 2ATAA 1JDDA 3QJTB 1JGEA 3KJ4C 1RKRA 4WFGD 1P9MC 3DX8A 2ZSVA 4IRJC 5B39B 3T0WA 2WK2A 3VG0L 5KBKA 4XPGL 3N5AA 2OYPA 2AMGA 3QDGD 1Q8MA 3QB7C 1Y18A 3KJ6L 3MRGB 3J7HA 1RZIA 1I3GH 4F37F 2DIAA 3U4EB 4ZMWA 5HYSG 3MO1A 4JFUA 1JGLL 4ELDA 2GY7B 1TUPA 3KYKH 3BP6A 3NIGE 2X5PA 4LRIC 2C9AA 2Z0UA 3LHAA 1IBFA 3TESA 4TVPL 4X98A 1RVFH 5FM8A 1JS4A 4K7PH 4UCFA 3O4LB 3LNEA 2IADA 3S5LG 4KUCF 5CN3A 2WIIB 1J0HA 3BKML 4I87A 2IALA 1U3NA 2E7HA 4MAYA 2O6FA 5L4IA 1FBIH 3H85A 1QSFD 4JY4A 1AOHA 1ZLUH 4CC4A 4GSDH 5B1KA 1WJ3A 3C87A 3ROLA 1NAKL 3WJLA 4U1LB 2O6CA 2PYEE 3S5ZA 2CHNA 2ZT9C 1RULL 4AQAB 4N9GA 5C0CB 5D1QC 2AJUL 5HHOA 2YAHA 3CVIL 3GBNL 4PJFB 4UNTA 1CD0A 5I75C 1IGYA 3W11C 4J6IA 4RFNB 3I75B 1YYMH 1SF3A 2WD0A 3F7LA 2X70B 1N2RB 4L3ED 2CG9X 2WCSA 3CFIC 3RVWD 3NAAL 4Z0BL 1AQKH 3VG9C 4UANA 4NIYE 2HH0L 5FO9A 4DFHA 4UTCA 4JJOA 4FXKA 4XXWC 1XR8B 1K9TA 1C5DA 3NFPA 3DX1A 3IWUA 8PAZA 2ESVE 2HJFA 3FSOA 3VXOB 1L9NA 4OJYA 5EN2B 5HY9A 3IJYB 2UYLB 4KZDL 2X4RB 3V5DB 5IQOA 5EOTA 5HGDA 1NC2B 2WTPA 3IU4L 2N7BA 4MX7A 5EEVA 2BXZA 3IKCA 3QUXA 1O6TA 4LHUA 2WANA 1VCBC 1HHHA 4ODWA 2FGWH 4I5BA 1WT5A 3Q3GA 1CICC 1FN4B 1FLRH 3AY2A 4HGWA 4I18C 5IFJB 5FFOA 3W81A 3QGVA 4MS6A 3RU8L 2PXYB 2Y7SA 3IDMA 1ZWIA 4FNRA 4J8RB 5FGBC 4GUQA 2ADJA 2OA9A 4PJHF 2VLRE 1IEBA 1ZK9A 4LSPH 5HYJB 4PLOB 2R15A 4YHPA 5C0AD 4QD2E 2VXQH 1F6FB 1OT2A 3HAEG 5I8CB 4NUQA 4FNLL 5ENWA 3F58L 4RETB 3RWCA 4AZUA 2KZWA 4ODSL 1EHLL 2JKWA 4ZTPH 3V4PA 1WTGT 3HS0C 4QXTA 4JW3A 3CVBA 3T65B 1QFWH 4GIPD 4FQCH 4AL8C 4F57L 4NGHH 1ZLEA 3VI4B 3TJPA 5DLML 3ESOA 1W0VA 4JM4L 4OCYH 4MRBA 2HN7A 4PQXA 5I6NA 5EEUA 3B9AA 4OCNC 3GSWB 4WHYG 4AYFA 5I74C 2QVIA 5E2TL 2IV8A 3TIEA 2AQPA 3WUWB 1G1KA 5K39B 4P5TD 2AEOA 5DDHB 1YMMD 3CN1A 1ZA3B 2NT0A 1AVAA 2WCGA 4XH2B 2CO4A 2XIBA 4MA1C 4Y7MA 6FABH 5IJVA 4JKKA 3MV9E 5D6CB 5JIPA 1KY6A 1CDIA 1A4KB 1BQHB 3IXAA 5E6IA 5JHMA 1BAFH 2XWZA 3DYMA 1UD3A 2BIHA 3OKDB 3FT0A 4F7PA 2FL5B 2HJKA 4LGRB 3C6LB 5EIIG 4FQIL 2Z7ZA 4Z7AA 1GMIA 2MWCA 3FT4B 3SKNA 1F13A 3KPRB 3NQIA 5GRYA 1QW8A 2OZNA 4HXAL 5GZOA 4KHTH 1ZJAA 3I3DA 3O3EB 4D0BB 2ZXQA 4MGXA 1XF2A 2ADYA 3UTTB 1JYVA 3QHFH 3IMTA 4GRLD 2H3NA 1AR1C 4XB7A 2AJSH 2AQ3A 4H8VA 5HHNB 2O5XH 4ADIA 1A5FL 3GDCA 3OWRA 2P1YA 5FDWA 2VITB 1IM3B 1KBGH 3AT9A 1UT2A 3IAPA 1H9VA 5GRZA 4LCYA 1CBVL 4PI0A 4W70A 5JR1L 4E9RA 2WQXA 2L7QA 1NBVL 1R17A 2XTSA 2ODIA 1W8OA 4DPCX 3GJFH 4XN7A 4PJCB 2HX9A 3E3QE 2NY1C 3AW5A 3N55A 3QYMA 2FEEL 4JK0D 3JWNC 2DOCA 2QTVA 5IREA 5BXFA 3QWNA 4Y16C 3V0EA 3ZTEA 4FG0A 2E4TA 3E8VA 1Z9PA 4XRCA 2ZX5A 3D51A 4MLIA 1II4E 3R0MA 3IYLW 1B4JL 2P24B 3QUZA 1RSFA 4CN1A 3OR7A 4MXWH 3GSVA 3P73B 4URTB 2CR0A 4OM1L 4TUOB 5F9WC 1XGTA 1WS8A 1OANA 3U4BL 2FZ3A 2OTWB 2H32H 1X6NA 2K6YA 5CHNB 3ZKMC 2APSA 1H6EA 3QNZA 5T33H 4KKQA 4P2QE 3ZO0A 5IHUH 3PWNA 5E8NA 1N4XH 4HCRL 3C5ZD 3VGAC 2RHEA 1WE5A 5ECJE 1PZUB 3DV4B 4NSKA 3WSQH 5J0BA 2R27A 2XV6B 2R56L 1ZK5A 2OL3L 2IG2H 3E8UL 1XGQA 3TXAA 1OAQH 5E70A 1GC1H 3TTYA 2X1QA 2H3KA 3BN9D 1MY5A 1T89C 4YH6A 2ZKHL 2H6PB 5C0BD 1U8MA 4ZTEA 1KFAH 3K71A 5ADPL 4E41A 1KACB 3WMSA 2GTZB 3JWDL 4GKNB 5DC0A 3FQWB 5EBMA 3TT3H 1PX3A 4FNPA 3BPOC 3DI3B 4PVNA 3TVMD 5DFWH 1BG9A 3VRJB 4K2UH 5DMGC 4R5VA 2LTQC 3X1FA 3K8MA 2IXQA 2C9PA 4X0KA 4U31A 5CZRA 3LZQA 4XAWH 1RJZA 4XNBA 3TTSA 2ZG2A 1NCBH 4A66A 3MACH 2NW2A 1OD7A 3PDOA 4OKVA 4YBQD 1TSRA 2EYRA 1IKFL 1KEML 4XMKL 3QXDB 5DF0A 1LGVA 4M6OL 2VDLB 4E5XA 5GRUL 1BZ7B 3LQZA 3TBTA 4EKJA 3HE7C 1E7VA 4IK7A 4ONOA 4WEBH 2NSQA 4B9IA 3WNNA 3SIKA 1C16A 2NY0B 3FXIC 1DUZA 1FIEA 1XCTB 3DVNA 1IM9B 3T2LA 2VQUA 4RIRB 5JIMA 1L0YA 4N2IA 3AZUA 4Q74A 3RZWA 2WOYA 3BGMA 4A7QA 5AZ2H 3EG9B 3FONB 1GCYA 1UB5A 2ENJA 2H6OA 4W4OC 3WFHB 4N2OA 3LZPA 3IFNL 5DRWA 3DX8B 5BMFL 4L1DA 2ZSVB 3ESUF 3RY6A 1CC3A 4OJEH 2X4PA 2FT7A 4WAFA 4XVTL 3FH8A 2I07A 3U83A 2NYYD 4YR6A 1RZIB 4PRPA 2MJWA 4HC1A 4BA8A 4D9LL 1Z3GH 4V1DE 4D2NA 3MO1B 4BXVA 2CHDA 2B5IB 2IBBA 1CK0H 1X9RA 3ARDB 4Y19A 3SE3C 2O6DA 1FA4A 4GO9A 5KVDE 3WLBA 1S5HB 3BP6B 1AGFA 2AK4D 5L2KD 4A7TA 5DA0B 3QRLA 4FFYL 1JD9A 5KN5A 2CM5A 1ILSA 2HRPL 4XE5B 2BRQA 4J1UA 2UX7A 1PBYA 4YHMH 2IADB 4PM1A 3BSGA 4WIQA 5IBUB 2P9RA 3L3IA 1DLHA 1LLAA 2IALB 5SWZD 3RZCA 1Q0XH 3DHMA 2EIDA 2FX8L 2X2UA 4P06A 1EH9A 1BVNT 2VUYA 4IKLA 3SO5A 3ROLB 3VJ6A 4Y4FD 3FYEB 3MGOA 4GAYB 4O58H 1IBGL 3HE6C 3RTQA 4N9GB 4XMLH 2YKLH 3TPUA 3TFBA 1CLZL 3I3EA 4GP4B 5EBWA 5HHOB 5GQBA 2HVKA 1HL5A 1B3JA 3G6JB 3FRUA 1IGYB 4K5NA 5AW1B 1MFUA 2AQTA 4GSDL 5D5MA 3BSZH 3BAXA 1K6QH 1HQ4B 4ZAKC 1RUPH 1FFRA 5IHHA 3CTTA 5FO9B 1MJ8H 1OKEA 1G43A 4FXKB 4HUUA 3QUMH 4FQXD 2C3VA 1C5DB 3NFPB 3S37H 3K46A 4DNLA 4PB0H 3QYNA 2HJFB 1X5GA 3EIFA 1U8CA 3OHMB 1AQKL 5HY9B 1E5UI 1RXLA 3JTSA 1HL8A 2DQIH 3BDYH 3TASA 4X2UA 3IKCB 3QUXB 4LHUB 3GC3A 3BZEA 4ODWB 1HYSD 4OCXL 1FE8L 2XFGB 3EDEA 4I5BB 4MJ5A 4ANWA 3CDCA 3O41B 5ESQB 5ALBL 5ANMA 5F8RC 4XVSH 1SM3L 1GJUA 3DETD 4G7SB 4HGWB 3F7PC 4L4TA 4GAJL 4R7NA 3RYMA 3UEQA 2PTUA 1E30A 1A7PH 3PNRB 4JFTA 5E1IA 3IDMB 1BSIA 4QAMB 4QF1A 2FGWL 2EECA 3ILDA 1D9KD 3FQXB 1IRAY 1FORH 1X7SA 2ADJB 1IEBB 3F6LA 4RSVA 5CJQH 4BQ6A 3ZDXB 5CEZE 4YHPB 1QMUA 2WO3B 2X10A 3ARPA 3CZLA 2JXMA 1OD9A 5INCA 5DI8B 4DEUA 2XTJC 3TURA 3BH8B 4MJHA 3RWCB 3NA4A 5KYNA 4FJYA 2GJRA 4LSPL 2HRGA 4QXTB 4YE0A 3QDME 2VXQL 4X5LA 3I6SA 1JZJA 1OHZA 4KKPA 4RMRA 2OPCA 4YHYC 4G6FD 4AYFB 2NT1A 4OR1A 1MAMH 2VC2B 3NSCA 4ZTPL 3RI5K 4YPJA 2VUOA 5ERWA 3CZUB 2MTPA 1CI3M 2JQAA 3P4LA 1K2DA 3JTTA 4OCYL 4TNVK 4XP5H 2DBJA 1MNNA 4UAHA 1WA1X 5C0RH 1LP9A 1X5MA 4HOWA 3IXAB 4G71B 4KV5F 5D1ZC 2BH0A 1A3RL 4OZFH 3WG7B 4F7PB 5F89A 3VE0A 2HJKB 1V27A 3F5WA 2OMYA 2JKNA 4OBSA 3MX0A 1WWAX 4NO2A 5CGYC 3SKNB 2EIKB 4G8GD 4U7MA 4MNGE 3WKQA 1MOEA 2D9CA 4UBDD 4YZFF 3SDAC 3V5KA 1S9VA 4PJBA 1F4AA 4C55A 2J5LB 3M1BB 1XF2B 2BSRA 2IVFC 2HLAB 3RIAF 4RWHA 2H26A 1NFKA 5IHZB 1TR7A 3IE9A 5HI4C 1VGEL 4QXGH 3LPGA 5DU7A 4KHTL 1U8QB 2DQJH 1OGTA 4PI2A 4UT9H 2W65B 4ZMOA 5CZKA 5BS0B 2GJ6D 2FB4H 2OSWA 4M43H 3UABA 2AJSL 4WTZA 5IV2A 1KGCE 4OW6A 3ARZA 1GS7A 3GIZH 4FABH 2CJSA 3I9IA 5CN1A 3T4AC 2Z93B 4YDKH 1FZKA 5EU6E 4DP9X 3K6IA 3DX9A 4HJ0C 4P2CG 3VA2C 3NCEB 1KBGL 2BSDA 4BFOA 1XXDC 3EYVA 5FYKH 4HGMA 2NY5C 5CBAA 1VZIA 1JCVA 3FF7A 3MBXL 3AM8A 3CDYA 3DXAE 5BXFB 5AKTA 4L0PB 3FTXA 3P02A 4AWJC 5KBLA 4H40A 4XRCB 2MNWA 3AQYA 5CGTA 3APNA 2K7QA 3OR7B 3MLYH 1VENA 5E00A 1P4UA 5GS0H 3QAZC 2A6IB 3APMA 1IC7L 5CEZL 5J12C 3QNZB 4BUHA 3UP1A 1DFBH 4MXWL 4RDBA 3PWNB 5E8NB 2DYPD 3VYPA 2CQVA 4QOKE 1PD1A 3PQYE 4QYOA 3VH8G 1U33A 3RDTC 4B5EA 1AAJA 1NCOA 2D4DA 2R2BA 2N1TE 5T33L 1CFMA 4K94L 4NQVA 1XGQB 5IHUL 4NRYA 1CN4A 4PJHE 3MROA 3QORB 4A04A 3RUGA 1ZD6A 1U8MB 2K3TA 3QWQB 3TO4C 3K71B 1ZY9A 1FVEA 4ORGA 4ZX5A 2J1YA 2I27N 4AUJA 4OKDA 3NRFA 4H1LA 4XMXA 1WZAA 3HB3C 3QQ4A 5K9OA 4RGMB 5EBMB 4LNVA 5AKRA 5ACMA 2F5AL 3RGVC 1T66D 2ZCKH 4K5OA 2IXQB 4HUKB 2Y72A 1DVTA 4X0KB 5T1MA 1RJZB 2G3MA 3LIZA 2NW2B 3PDOB 1V54B 1XWVA 2RD0A 3HG3A 3WGVB 4MYPA 3WD5H