2JKNA

Drae adhesin in complex with chloramphenicol succinate (trigonal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural study of the interaction between the Dr haemagglutinin DraE and derivatives of chloramphenicol.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
total genus 28
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jknA00
2W5PA 1RXLA 2JKJA 1USQA 2JKLA 1UT2A 2BCMA 1UT1A 2IXQB 2JKNA 2VERA 1USZA
chains in the Genus database with same CATH superfamily
4IEFB 2A6KA 5KUKA 3LZRA 4IRSC 1ANUA 3TCLB 1NGYB 4Q14A 3QH3B 2NSXA 2OTWB 1SVBA 2YAMA 4ORGA 3RTQC 3D69A 1OZUA 4F9LA 3MNZA 3VD4A 2UZIL 3DO4A 4Z18A 3V6FB 4AZ8A 4DTGL 4EI5D 4F8TA 5D7KD 5GS0H 2B0SH 1FIGH 2BLFA 1IC5H 2XHNA 2NY3B 5KYWB 3CDGB 4N86A 2OMTB 3NSXA 2V2TB 1D5RA 4KJWD 3CPUA 4UQ2A 1WBYB 4ZXBC 4OCYL 2OLDA 4KI5F 2X9WA 1H8SA 3BUPA 3L48A 1N12A 2BVOA 2G5BA 2BSRA 5TJWK 4YBHA 1P1VA 2VXQH 4NI3A 3HHMA 3DK2A 5IEKB 3QQ4B 3V9EA 4PGCA 3S35L 5DUPL 1EVTC 5DJ0B 3VFGL 3FQ1A 5AZEH 5I1JL 3FCTB 3FQXB 4FQCL 3HZYB 2HFEB 3AT9A 3P2TA 3A6CL 4Y4KA 3CLFH 2A6IB 3DVGB 5EA0L 3CPLA 5BS0B 3CBRA 3HPJB 4J12A 4X98A 1CF1A 5A2CA 2C1PB 2VDKL 3NZ8A 2F7RA 1CFTA 1L3NA 1TEGA 1IM3A 2JCCA 2OMZA 3D18B 2CPUA 1R3LA 1P1ZB 4EZJA 2BHYA 4HPOH 3MRCB 4HPYL 1U3NA 1C16B 3OLGA 4M1DH 3UABA 1FYTB 2ZIDA 1YECH 3VI3A 3LEYH 3P4LA 1E5UI 2R29H 4IGBA 2CDEB 2EDXA 1CU4H 3H7BA 1FRGL 3WJLC 5FB8A 1HH9A 1ROWA 5FYLL 5FYKH 3SGDH 2KT6A 4LESA 2XTSA 4GI8A 4O9HL 1U21A 3FO1B 2BRRL 4O2FA 4HIQA 3P4OA 2A74A 1YEKH 3QPQD 4AQEB 5AB0A 5HI4C 1I8LA 1CN4A 3ZKSD 3FFDB 4W9LC 1MIEH 1XZWA 3GSNL 4G8EB 2J20A 2MWCA 5D5MA 2P7TB 3LN5A 3PNWA 4OTXH 2WVVB 2EKJA 2CHZA 3CFEB 4V33A 5IVXB 1TPXC 2C9UA 3KBPA 3NA9H 3W0WD 2ADYA 2OZNA 1QSEA 4PLOB 4NNXA 3GSNB 5KYUB 1ILSA 5B4MC 2P43B 2Q3AA 3IRPX 5DRZB 4NHCL 3TBYA 5HD8C 5EEXA 2EDYA 5MI0B 5IVXF 3BP7A 5AVRB 4XMPL 3F12B 3WHE0 4F8PA 4LASL 1J8RA 4N0FB 4WDIB 4Y8AA 3ARDB 5DDHA 4M56A 4AY0A 1FIEA 2D8KA 3N91A 1OIOA 1MELA 3KCPA 4UINH 3R4DA 5FUCE 3H9SB 1UOVA 4YS4A 4OCSH 3VA6A 1XGRA 3T0EA 5JA8B 2YS4A 4UTCA 4GAYA 1URZA 2HRPL 1NDTA 3ORJA 2J56A 2CWRA 4JQIL 5HHMB 3GHEH 3TA3B 1HL4A 3W0WE 3WE6A 2CQVA 5E99L 1LEIB 1JZIA 1IM9A 1LXMA 3LV3B 4HUXA 2VN4A 1MW2A 2YPVL 4Y4FA 4YGVB 5EF2A 2BX5A 1HJCA 1JRHH 1QUNB 1L6ZA 4B3VA 1KN2L 4E9RA 1F97A 2BNRE 3DVGA 4QRQB 4MJID 2DF3A 5T3ZL 3I9IA 3ILQC 4JM2B 3T1FA 1F1DA 2FEDC 5GSVA 3NJGA 5D4IA 4BKTC 4XN1A 3B7RL 3TIEB 1OK0A 4HJSA 4EUPH 1V10A 1YNKH 1NFIB 1ZSDA 4ELMF 3N1MC 1GC1L 3SDCC 5DR5L 5EBLA 1XIWB 4TQIA 2D7TH 1RUQH 5JO5A 2O6CA 3SDDA 2IH1A 3EG9A 1YZZA 3UYPA 3MCKB 4L4TD 1S78C 3WTTA 5F0JB 4OGZA 1LO0H 3BP6A 3BD5A 4QAWA 4ELMB 2CDEA 2DQUL 1LILA 2QL1A 3VSQA 4QT5A 3B9EA 4P2OD 4MCYA 4EN3A 5L7XL 3UTTB 3OR6A 5IQ9A 3PU7A 2WXQA 5T3XE 4GEJA 2WYTA 4B97A 2OXGB 2EYRA 4XX5A 4NRZA 3MFGB 3SDAA 3FS9A 1UEMA 5J9PA 2APFA 1DUYB 4XWOD 5B1KA 2VL4A 2WOYA 1DJIA 2OR8A 1RUPH 1FFQA 1T1XA 4UTBA 4IBTA 5IVXA 1MEXH 2NY5H 3S8GB 4YR6B 3QIUC 2AXJA 4D9QD 4HCGA 4PJGF 4PLJD 3CDGA 1H15A 1JUFA 4Q6KA 3C5XA 1KB9K 4KZEL 1S7SA 1MCSA 4IIZA 1NCWH 3TBTA 3LN4A 4PRBA 5DS1A 4KTGA 4NZJA 4NC1C 2IG2L 3P4MA 4PJDE 5JHDA 3HW7A 3PWNA 3QEQD 2BVEA 3IDXH 4JR9L 3OKDB 2OAAA 2PPFA 5DFVC 4NQVB 5BZDB 3ALXA 4QYOA 3IRZA 1BEXA 4MD5B 2ZOOA 4M6AA 3FB7A 2PO6D 1MVYA 2VDRL 4BQBA 3T4AB 3L1OL 3NCXA 4PJCB 3AS3A 5DFTA 1YN7A 5BXFB 1T5KA 4NO2B 1MWAL 3RZWA 4G71B 1DE4A 3DRTA 4DP0X 3ZTDC 2C1PA 1RUML 3H42H 4HUNB 4QRQA 3UC0L 4ODUB 5CD5C 4MNHA 1JZEA 3DX8B 4S1SH 4OCWL 4FA8A 3VFPB 1UKQA 4Y5XA 1KNOA 1PLGL 2ED9A 3FPYA 1DBAH 5G5DA 3GXFA 3MACL 5JHLA 1J87A 4TQHA 4W6XB 4WHCA 5AW5B 1WH0A 5EIIA 5J06A 1AQHA 1R5VB 4Y16D 2WTRB 3QI9C 2YC1B 5AW9B 5TE7L 4ZQTA 4MCNA 2P4AB 4MLSA 3ZDYE 4IRSD 3OJ2C 3PUUA 3ZE1B 3Q8BA 1WSST 3WIHL 2L4OA 3I9GL 1RZFL 4ZW8A 1LD9B 4F5CA 5BVJA 4AUUA 4DQOL 1RXLA 1I1AB 5JW3H 4ODSH 5D2NB 4ZOAA 5IHWA 4WW2C 4HAGA 3HE6B 4WNQB 2X87A 3V0EA 2CA3A 3IDJA 2YA0A 2ZKWA 2PR4H 3WIFA 4APQD 3HG1B 5C2BL 2E6QA 3OAZK 3QDGB 4Y2DA 5B39B 5I6MA 3KYAA 1YAZA 3NMEA 1R3JA 2RALA 1R0AL 1J11A 4Y4FD 2VLJB 3GM0A 1U2HA 1QW8A 1MCRA 3F7RA 3I9PA 3JUYA 4K3EL 3PJSA 4XPGL 5IWLC 3O6MH 3BD3A 4BK5C 3E6HB 3G5XA 3MJ8A 4M02A 4KH9A 4YHZH 3GUFA 3U2JA 1PDKA 4ZS7L 3GHEL 4KKZA 1MRDL 5FFLA 1FO0B 4KHXH 4LLQB 3QEQE 3WUWA 4X0KA 3DTXB 1I3VA 3R06B 4GPVA 5JYMA 4K23H 4NO2A 2JKSA 1AGDB 1HESA 1AG0A 3ETTA 3BAYA 4PUBL 1RHHA 3OWRA 4C4UA 2KLRA 3HUJE 1NOLA 1ZHNB 2ZTBA 5DFVD 1GGTA 4LOVA 3UJTL 2NTFB 5DD1H 2ZUQC 3PAYA 4IGBB 1GC1H 1MFCL 2Q7NA 3JTSA 4K3DL 4LCCC 1QSFB 1ZWIA 2D2CC 2VQTA 4N0YL 2R2BB 1SFDA 2AXFA 1MY5A 4Z7NE 2R4SH 1DVUA 2DJ4A 3H85A 4U2YA 4ALAC 4AEHH 3OPZH 3NJJA 2DJUA 4XBGB 1NCAL 1PD6A 1BAGA 3ZW3A 3REVB 1DQDL 1A1OA 1P4LB 5C9JB 1ZJAA 5MEOA 1ZLDA 4XNZB 3NJIA 4FERA 1V7ML 4XN7A 4Y19E 5HYSA 4JN2B 1AS7A 5EOQH 4C56E 4HLJA 4IU3A 3HR6A 3MV7D 4AM0B 4HS8L 4PJDF 1NMBL 1DR9A 1GGCL 2WP3T 3QXWA 2IQAA 1EHAA 2XKUA 1E6JH 1VJSA 3OM3B 4IEFA 5H94A 3V10A 3FO0H 2I27N 2VOTA 3WFZA 5TTRA 4H25B 4NM8L 2E56A 5F88A 2WXOA 4F15C 4PG2C 3T8VA 4DZ8B 3VFGH 1NMCC 4XMZA 2EXSA 4XVSL 3GMPA 1SHMA 2F54D 3EYOB 3MA9L 5FYJH 2LV4A 4PJAB 4QRBA 1NGWA 3NTCH 1CF8L 1PZBA 1ITBB 1WVZA 4YDKL 1QTPA 4Z7VF 3EFOA 1Q94B 3BGMA 4IOIA 4XCCH 4N8VB 2C4FU 4BXVA 2CCLA 2VXQL 5EIQA 4P3CL 3GXNA 8CGTA 4ZTOL 1JGDA 3O2WL 4N90E 4QJ3B 3ZHKA 3FQNA 1IC1A 1KACB 4EI5B 2QJDA 4LLQA 2N1KA 2W0LA 5GGRA 3T3PE 2WWKT 3T0EE 3F3HA 3CU1A 3N1GC 4HOMA 3EFFA 1PJ9A 4Z77B 4HVBA 4WFHE 5CJQH 1S6NA 3CVHH 3MLVL 2OZ4A 5KJRL 4HD9A 1NANH 3ZQWA 5I73C 4WEBH 3BDYH 4GNKB 4HIHA 2VDNB 2R0LH 3UZQA 1ZGLA 1FA4A 5CHNB 4IRJA 1D6VL 3D85B 2QQLL 4TF4A 3UZVB 3TN0B 5IOKA 1HSAA 5T33L 5LJYH 4NWTL 2VDNL 2Z9TA 3MNVA 4C4KO 2H0EA 1VZHA 2WLZA 1OOWA 2BNQB 3UAJC 2G0LA 3MRCA 4PJFF 3ZZSA 4KQ4L 3C6LA 3WN5C 4Y2DD 4OFDA 1RIVL 1P53A 2XICA 3GSUA 5FYKL 3V5DB 4ETQB 3NIGE 4HWUA 4HOZA 3MRRB 4Z78B 5FYJD 2Z4QA 1RSFA 1MWOA 4PGDB 1EMTL 3WNKA 4LARL 4MNGE 2FBOJ 1W0VB 4RGOH 5LGKA 5IREA 1TMQA 1BM3L 3UPRB 2ZE0A 1RLWA 3MNZB 2NLJA 5ESVA 4RETB 4I8DA 4N28A 5F1IB 2XY2A 5F7LB 4F9LC 1LTXA 4MTMA 1S7WB 2HG0A 4K3EH 5E4AA 2MOQA 3CVCA 4YNYB 3MU3A 3U0TA 3C5ZA 4OGYL 2PP7A 2OYLA 4LCYA 5D6DA 3RU8H 2BSRB 4NFCA 5FLUA 1NC2D 4AXWA 3UADA 4B0MB 4HK0A 1KLUB 2PTTB 1YAIA 2HLAB 4GIAA 3KH4A 4K9JA 3ETSA 3VTTA 1WCQA 4U49A 1UOWA 2HKHH 1FVCA 5EUOA 2ZKYA 2F54E 3W9DB 4A2DA 5HGDB 4OFPA 3FSAA 3FBKA 3IM1A 3CZFA 4YQXH 5E6IB 1QWHA 3Q9QA 1K6QH 3ELQA 2VLKB 1CDHA 2V3FA 3Q5OA 2YSTA 3V0IA 1GS7A 2CLZA 5DLMH 3UJTH 3S5LB 1UA6L 4BQ6A 1AZCA 5I28A 3MNWA 3IETB 2DQUH 4UQ3A 4PP1C 1F18A 2ID5A 2AI0L 4I0PC 2W1NA 3IMSA 4ODTH 1KYDA 2BDNH 2GJPA 2ZX7A 3FRPG 4HX1A 4N2BA 1KULA 3LRSA 4P4RB 5AW0B 3L4TA 3NFSH 4FXGB 1OTUC 3BKYH 1CLOH 1QQDA 2MFNA 5FKPA 4XZ4A 2ADGA 2ZF9A 4XGZA 6TAAA 1X5HA 5C9JA 3P3YA 3VXPB 3IDJB 4UM8A 5CP3H 5E5UB 2CBQA 4OF7A 3ZT5A 3F05A 3VG9B 2OI9B 3B7YA 4QRAA 5I1AA 1BVNT 4M7KH 2QHLA 1F4YH 4AM0A 3D69B 3PDDA 1PFCA 1DJYA 3QZWG 3FTXA 3TFKD 1JDDA 2W94A 4IKIA 5HDLA 4R4NC 1BREA 1ZA6A 1E6JL 3EOBA 4XNYL 3FTWA 1ZT1B 1A3LL 4NENA 5I30L 3QAZB 3Q6GH 1PG7L 3LQAL 3T2NH 1JZJA 3V9CA 2VAAB 1EERB 5FGBA 5I8KH 3WS6A 2XTJE 2CGRH 3LY6A 1P6WA 1FSKC 5HI3D 1NKGA 1MHCA 4LLWA 1J1OL 1KF9B 1ECZA 3QCTH 1MCWW 1FO0A 3RZCD 4M3JA 3LS4L 1YEIL 3VDBA 5L88H 3CZNA 2D3LA 5FKAB 1UEYA 3EYVB 3ARSA 3HCVA 1DVFB 3RDTC 1DLHA 4N8UA 1K4CB 2QGEA 4U3XA 2HFEA 1ZLUK 1CD1B 1GOGA 4RZCA 4BYHA 4N2GA 4Z76A 4EI6A 1IRAY 4W4OA 3BUDA 1VEMA 2HH0L 2NY5C 1KT2A 2IFFH 5CJQL 4HUVB 4JZOB 3NIDB 3W2DH 3BT2L 4L2YA 2OL3H 5DD0L 1AO7A 2B8OT 3C6LD 3TVMD 1I7TA 3MFFA 5DK0B 3X12B 3QQNA 4EBQL 2CJUL 1YDPB 1EZVX 2H1PL 1JDAA 3AGWA 5C0FA 4EO5A 2PP8A 4RMUA 2LFEA 1QZ1A 2AJVH 1GA2A 1N8OE 4WLCA 3TJHD 4QRRB 3H2WA 2XIBA 4ODWA 1BIIA 4OB5L 4TYUA 3BIKA 2EINB 2VJ0A 4WSKA 3X2QB 3S4SG 5DURB 2H0JA 5DMIL 1QQDB 3INUH 3JT2A 5F6HI 2P8LB 2H0PA 2GKIA 3HG4A 4GI9A 3NGBC 4ZPVA 3W37A 4LLAA 4UT9L 4MAUL 3FFDA 1FL3B 1XGTB 3L3DB 4YGAB 1FCGA 2DMBA 4NEHB 3OV6A 3GF8A 4UTAA 2HPOA 2FQEA 4JDZB 2X53A 4ZUUB 3IXTA 4ZJ9A 5GGUA 3UERA 2Y2WA 1QVOA 5KW9H 3T3MB 3SKMA 3NCMA 1VACA 1L7TH 1KYOK 1S9YA 2V2WB 4MZ2A 2P28B 4IRZA 1JJUA 4JE0A 4N4YB 2X4UA 1KIPA 2NDGA 5A6MA 1MIMH 4P4KA 1FH5H 4DKFH 5EUKB 2NY2B 4KPHL 1DFXA 5CLYA 1EJOH 5AAMC 3LMJL 4M5YH 3DGDA 5EZIH 5ELIA 5B1CA 1DFBL 1P84K 4EI5A 3T5WA 5CZVL 4XP6L 1KBBA 1PJWA 5KSBA 4X6DB 1Z1WA 3N0PB 4I88A 3SYAA 4HU8A 1A66A 3WXVH 5BZDA 4WHTA 5HPMB 4LEXH 1AI1L 5E4EC 1XZ0A 3DYOA 1KY6A 4K3DH 1OAZL 2DEWX 2HFTA 2RACA 2VZVA 1MW0A 1KXHA 2FJSA 1H3PL 3H3BC 3QORA 4LEOB 4WHYG 1K6QL 3L7FA 1LQSR 2YPKA 3VMPA 1TVDA 1UXWA 12E8H 2CLRB 4OAWB 2J72A 4CU8A 1Z0NA 3CQQA 2DQDH 3V4PA 2YMOA 1H9DA 1JK9A 3CDZB 3HZKB 3BQUA 3LIZA 3NAAL 4DH2A 1U95A 3RNKA 2PYFA 4H8WL 1XCXA 4WGWB 2ICWA 3LZNA 3QZPA 1I8KA 2QDVA 4L8SC 2J71A 4IBVA 3VFPA 3MRQA 3ILPB 4P07A 4YHOL 3SE9H 4DW2H 4RAUA 3RWCA 3TBVB 4U2ZA 3V6BR 3KLQA 4UAOB 2BIHA 4JY6A 3V4LA 3GIZL 4PG9A 2BSBA 4MQ7A 5CSBA 4HHAA 4FNLH 3OG6B 4A39A 3TT3H 3ZMEA 5FO8A 5CEZE 3ZKXC 2IGFH 3MRKA 2A4EA 3O9WD 4AGNA 3KPSA 4JKWA 2BMKB 3TN0D 4HC1H 2PCFA 3TBWA 1R5IB 1NCTA 4HLZH 5FGCE 2EH8H 1ZS2A 1D5XB 4JDEA 3GSRB 5D7LA 2I26N 1GGCH 5DJDA 3PWPA 1NM9A 3MGAA 5FW7A 4ADIA 3RVUD 2GC7C 1VFOA 3HI6L 1FZKA 4MA7H 4Y2DB 5B39A 3ULVL 3I6KA 2G5UA 1OT1A 4MMYB 4NP4H 3MOBL 1HI6A 3QARA 4H0GA 5I1EL 2CXGA 3DGGB 3APMA 4K3JL 1WDAA 3GHBH 3GBNL 5E8PB 4I4WB 3K71B 3F2LA 3DGCR 4PJHF 3ZHNA 2Y24A 4DEWA 1ZOXA 1VFMA 3C12A 1UD3A 4KXZI 4N5UA 3Q3GB 2CIKB 4HW6A 4I2XA 4F2MA 1GZPB 1A0QL 1D5IH 1RL1A 4LDOB 2HH0H 5F97E 1W6LA 1RULL 4V1DE 5KVFH 5GGTL 4GB9A 4LQ1A 5AB1A 4PBDA 2AJXL 5IBUG 3PWPD 3JV0A 3TA3A 1MRCH 1U91A 1I3GL 4XPAL 1KLFB 1LMKA 2AQSA 3L4ZA 1ZRUA 4TNGA 5KSVA 4U4BA 5B7EA 2H2PD 1HINL 4U3CA 3G6AB 1TSRA 5AW8B 1OPGL 2QVKA 2R83A 3CFBA 5AVZB 3ELAT 4DZBA 3V52H 1E5AA 1FLTX 2CHWA 2XIIA 4OB5H 5BQ7B 4K9EH 4RAVA 1MCIA 1WK0A 3ZQXA 1J9SA 3ILPA 1IZKA 5MENE 2ICWI 4KZDL 3OKLA 4NUJB 3EGDA 4NXSA 3L7EA 4M7LH 1PKQA 2ZPKL 1DBBL 2XWJB 5K1VA 3JTTB 3L4YA 1ASPA 2QQKL 3SKOA 4DO5A 1P4BL 4PJ9C 3SDXE 5B3JF 2PCPB 2ADFH 2IC2A 3GSXA 4OT1L 3CZGA 4JL1A 2J6WA 1EK3A 4FYRA 4XO9A 5BV7L 3BRFA 4P05A 3IEAA 4WFFE 2V9TA 1MCLA 5GGUB 4G1MB 3PF2A 1NEZG 4CADB 5IBLD 1HQRA 3ZRSA 1INEH 3GRGA 2ICEC 4NKMA 2WZ5A 1FG2B 4PGDA 1N3NB 2WLJA 2V2XA 2BVOB 2G5BB 1EMTH 3VWKA 3G9AB 3E38A 3DO7B 3UO1L 3HZMB 2V33A 2KLTA 1BDYA 3QJOA 1QSVA 3GMLA 3FTYA 3G5XB 1I9RL 1S7UB 5I15L 4UTBH 4XPFL 5ITFA 4BCXA 2WD0A 4LHUA 5FA4B 4ABWA 1T04A 4IRZH 3D4YA 1A6AB 3P0YH 4KDTA 3C5ZB 5L8KB 3NSCA 4OV5B 3FT3B 3BUBA 2QADB 5E1AB 3BJ91 4ZX4A 2P24A 4PY7A 5ID0A 4GRWE 3KBFA 2ARJB 1LO5A 5BUPA 2JXMA 1GJIA 3O3BB 5GGSA 2VZOA 1G1YA 3CC5B 1FO0L 5EOTB 3V0DA 1S7TB 4P9HC 5F7FA 4OLXL 4K2UL 4XB7A 3BKCH 5DRXA 5GGVL 1IBGH 1RVFL 4ANUA 1RIUL 1SDAB 1CDUA 2XN1A 1W8OA 3GFUA 2Z31A 3QZLA 5ICYA 2PMZA 1QO3B 3AREC 3BSGA 1IGMH 5C09D 5JW4R 4Z7NB 5E8OB 3KM1A 2AQ1A 2HSIA 4NQQA 5IHHA 1FNHA 2BDNL 2R69A 3FFCB 1PL3A 2JCCF 4O2EA 3TN0A 1EPFA 1Z32X 1P4LA 1LE5B 2Z8VC 4PRIB 2QGBA 1BWMA 5C08B 1SOXA 2P45B 5I0ZA 5EIIB 3S36L 1U3ZA 4X5QA 2IAMD 5DJAB 3B3IB 4Z7VB 4BZ1H 3BKYL 1T66D 4KGLA 5EU4A 5FKPB 3REWA 4UOJA 4WUKH 3HLKA 4H26A 4DP6X 2N56A 1S5IH 2F2HA 2IWFA 1NAKL 2MKWA 3L4UA 3US9A 5IVZB 3ZUNC 2Y7QB 3PNRB 1GYVA 4JDVA 3P11H 5D2NC 3TASA 5EB9A 4HUWB 4X4MA 4AYEC 2I5YL 1I4FB 3B4NA 2CIIB 2OJEA 4MLIA 4NP4L 4KROC 4UBDC 4JKMA 4QOKD 2VLJE 1MCBA 3QUKA 5L0QB 4JMXA 4MQXC 1IJ9A 3QCVL 4G3YH 5E7FA 5JPMA 1KBWA 2ZWYA 5C7XH 2R7EB 2OQJB 1TJIH 4PD4J 3OSKA 2AITA 4APXA 4MRBA 4TUJB 5EO9A 4PRHA 1IE5A 3DSNA 1YEIH 2FL5B 3OGCB 3WL9B 3M8OH 3BISA 4LRNH 4MD4B 3QIWD 4RRPG 3EFFB 3CDZA 5BRPA 3ABLB 3T2QA 2O5NA 4CVXB 4HGWA 1DQQA 3ZDYB 3HNSL 3P54A 4HIHB 3NK3A 1OT4A 4MKMA 5CP3A 2W8CA 5KVDL 3S8WA 1U3YA 2PCXA 4RMBA 5KVGL 2FATH 1YY9C 4WJKB 2Z31B 3V8CA 1RUAL 2BVPA 4EEEA 4PJHB 5AW1B 4J3OD 1CU4L 2OL3L 1DO6A 3P9MB 2ZCHH 4PG9B 1FNSH 4YXKL 1ADQL 1UB6A 5BS0A 2X2IA 2AF2A 1QBLH 5DK0A 3X12A 4M7LL 1KBVA 2GJ6A 2AXFB 3MBWB 4OV6F 1GKOA 2WYIA 2KQMA 3HMWL 4ISVA 4B9IA 2VQ4A 4XCEA 4XP9L 4BFJA 2GVYA 4LO9A 3GSXB 1BXXA 4NRZB 3GSNH 1TTRA 3VE0A 4QHUA 5BV7H 2D0FA 3S37H 3J2PA 3UTZB 4GS7B 4XX1G 3RIAF 3RJDA 4WFEE 4Z7UE 1BVOA 3C5ZD 1G7PA 1OSYA 5HJBA 2EVIA 3DV4A 3O8XB 3QIBA 5C07A 4Y9BA 5SWZA 5HYSB 3WMSA 1AMYA 3VXMD 3O4OB 2BCMA 3KBEA 3HBQA 1FUNA 4HWZA 1E7VA 4I4WA 1HFUA 3FH8A 4JZJB 3BKML 3ULUH 3TVMC 3NPSC 4OZ4B 3SN6N 3KCWA 3DNKA 4EQ3A 1YVLA 2P5EE 3L6FA 3L3JA 2FWLB 1IIKA 1WUNT 2XCMC 4JPVH 2DQFA 4CN4A 3FQUA 4AGOA 1ZGLM 4XH2A 4L9LC 1UADC 5EU7E 5EU6A 4LSQH 1IIIA 3RY4A 4YDMA 4YBQD 3LZFH 4WFED 4FQQB 3OXSA 1EJOL 3KWXA 2WB7A 1SFHA 2OMXA 2UY7A 5CZVH 3T71A 4YHYB 1GJUA 1J05A 5IJCC 4B41A 1N7MH 4IU2A 2R9HD 2VLKA 3IDIA 4WKZB 5JXEC 2B1HH 4NUPA 4Q97A 1HJBC 1BPLB 1RSYA 4IS6A 1MCOH 2DQCH 4MSWA 2X41A 2EE9A 3UIZA 3WUZA 2E75C 1YN6A 3UTTE 5HPMA 5KSBE 1RVFH 5EFIB 4P2YA 3T65B 5B8CA 4YH6A 3MUGA 2I69A 3TJEH 4E41B 4N9GA 1ACCA 1E4KC 4IBZA 1TJHL 5C0GB 2WTPA 5DFWH 2ZP8A 4AVKA 1S9WA 1XAUA 3LXCA 1NPJA 4FNLL 1QLRA 1E8ZA 2GHWB 3WD5H 2EUZA 1U8LB 5D7LE 1RUKH 3U4EA 4P59H 5L7XH 3NAAH 3APCA 5CILL 4FLRA 1CURA 4AGMA 5I73B 3HTLX 3LX9A 4Q9RL 2NRDA 3MRBB 1AFVH 4L29A 2CHNA 5KSAD 2X2HA 2VLRE 1JYVA 2WUCL 4KXAA 5D1XE 4FKEA 2FT8A 5EV7A 3REWB 4KAQH 3P9LB 4ZK8A 1HQRB 2QQNH 4J8RB 4X80L 2CGYA 1GGUA 3IJ9A 5GJSH 2E74C 2GQHA 2VC2B 5K9OA 1O7VA 3JZYA 4HHAB 3O4LB 3IMRA 2HN7B 2V7NA 2ZUTA 1G7QB 4LSRH 3KPRA 2LLLA 2D2OA 4FQ1L 4HKZB 3NQKA 4Z0BH 4N2DA 2Q8AL 3FUEA 7TAAA 3WS3B 2Q6WB 2VLRB 4OIIL 2OJEB 2CDGB 1G9MH 3IJHA 1BFOB 4WNSA 5I1LB 5GS0C 1D5XA 4JDEB 5I26A 1NH6A 4AZUA 2Y2TA 1R46A 1IBBA 2IH3B 2YMXL 3EYVA 3TONA 5GRXG 4BZ2H 1TQCC 2RQ8A 5E2WH 3I6KB 1FGVL 1N8ZA 2A2QT 4B9KC 4QY8A 1H5BB 1JUFB 4JRYB 2E46A 5IVXE 4JQVA 4H20H 4A7GF 1WF5A 4QI3A 3GBNH 3MRGA 2A77H 5KSBB 5HHOA 2UY7B 3BYTA 5SWSE 4BINA 2X1XR 1NDGA 3GJFH 1P5UA 4W6WB 4OLUL 3TWYA 5F9JB 4LQFL 4XVUD 3O2DA 1EO5A 5KEZA 1G87A 1U3HA 2B4CC 4AQ8A 4BKLA 4WEEA 1G7IB 5DRNB 3RVWD 2WUBL 1DSFH 2MH4A 2ZXCA 2A9NH 2WLHA 3CFIC 3GK8H 3L3OC 1BIIB 4BZ1A 4JG5A 2DQEL 3GS0A 1VDGA 5FO7B 3UTTD 3QEHB 5HBBA 4LCWE 1HINH 1QI5A 4WV1A 4ZMYA 1RZFH 4GW5A 1AQDA 1I8KB 4F92B 2DQGH 3FPXA 4LLDB 4HCFA 3QHFH 1IGFH 3V6OC 1KCSL 2V37A 1Q0EA 1VFAB 1FJ1A 2R0ZL 5AALA 1IFHL 2AJUL 3ALWA 4FXGA 1DBJH 3LEXA 4G6AD 3WHXB 3FQ4A 3HB3B 4P2QD 2VIRA 1KV3A 1NPUA 1RK0B 3SE3C 4GQRA 2ZCKL 1TVBA 1B4JH 4ATTA 3CLEH 3SE4C 1G9HA 4L4TA 5JOPD 4ZT1A 4A7QA 1AXIB 5DUML 1SXAA 5HYIA 5FOJA 4KX7A 2IXQB 1B2WH 4MJ6B 3MLRH 3WAJA 1UA3A 4M61B 1AD9A 5IB5B 2E5EA 3CK0L 3U9WA 2BSEA 3RA7H 4Z7WE 1H3TA 1UJ3A 4MDIA 4FXKB 5EF3A 2VQ1A 1WZAA 1F2QA 1W16A 5ALCL 1PG7W 3BP4B 1JZFA 2ZSWA 4GXUN 3VX0A 2G3MA 3QFDA 3B2DC 4PJHE 3VUAA 3ZE0E 2XPZA 2E9BA 1I8MB 5HDOA 2WBXA 1Q4NX 2IH9A 4NYLA 4KHTL 4Q2ZA 1MDAA 4QT5B 5F8RC 4YHYC 1JF1A 4YBQC 4XPFH 2VMJA 3VQMA 3KVPA 1NLBL 3RUGE 3HS0B 4O2CA 4PRPD 2J3SA 4GFTB 4WY7H 1KCWA 3EUUA 1MCOL 2DQCL 4Y7OC 2IAMC 1M2OA 4PGBB 1A7RL 2A9ML 5TDOA 3T2LA 3GI8L 2FEEI 3BVDB 4L8DB 4WSJA 1IQWH 3ROOA 3SOTA 3ZMRA 4UWQB 5EBWB 5ABDE 5AYQA 3VW3H 1E5CA 4F7MA 3GMOB 3TFKC 2ZD0A 3KDMB 4J1UA 5IW1B 2X0UA 1VGEH 3FSZA 1IBGL 2VDRB 4EQ2A 1RZ8A 2CH8A 3MV01 4J4PD 5DZVA 5TE6H 4A6YA 1A4CA 3HVNA 4JFEB 2VWEE 4QXVA 2WGNB 1CL7L 3VI4B 1V5JA 5M95B 4QOKE 2VLJD 3L16A 2FK9A 4PREA 2LAGB 5FYLE 5BO1L 4Z7QB 4POZD 5JOEA 4R8WL 2AABL 1MN4A 3FUDA 4YBLC 2V9UA 3D18A 1O6VA 3FCSB 5D96C 4PJ6A 3CMOL 2JTYA 2CO7A 5FO8B 3HI5H 1N70A 5SX5H 4LCWD 1Q90A 3BLBA 5A1AA 4M43H 4HWZB 1R5WB 1L9MA 3ARPA 1MCQA 3HFML 5E8DL 3ZKNC 5EEYA 1J5DA 1NL0H 1NMAL 4MQTB 4UCFA 4Z7UB 3TLRA 3MRHA 1BLNB 1WBZB 6FABH 1OWRM 3MAWA 4OZ4A 3FT2B 3IFNL 2YJQA 1ONQB 3P3RA 1Y07A 2XPGA 3GIVA 2VUKA 3RZCB 2CMRL 1QFUL 4NRYA 2CDGA 1IGYB 2VWEC 1OF2A 2IALB 3QC6X 4PRIE 3B7TA 1MCNA 4M1CD 4F7TB 4YNYA 5J1TC 1QI3A 1IAOB 1MQ8A 1ZA3A 3AADB 4K3HA 3VWKB 1BA9A 1UATA 1NCBH 1EAPB 1OCZB 5EN3A 4MYWB 5LCVH 3EJYC 3WSQH 1MJ7H 4N2LA 1DLFL 2K6WA 1O7DC 3P2BA 5IBLC 1IKFL 1ID5I 5ACLA 1NICA 2G2NA 1F6FB 1OW0A 3BAIA 1T20A 4OLVL 3TX4A 4ECNA 3DX6B 1CICC 4WDIA 4YFEA 4WHDA 1I1AA 4PJIB 5FYKU 3MJ9A 5D71H 5FO9B 1S3RA 2DYPA 4KI5C 5E9NA 2UVFA 3CHXA 2B5IB 5T1DL 5MEQA 5GZOD 1EAJA 1P0SE 3WSQL 3IJYA 1OD9A 3U46A 2IPTH 2ATKB 4N0CD 1I1FA 4NZTH 3BPOB 4J2QA 4XWOC 2PO6B 3ABKB 4HJGA 1WV7T 4CVXA 5BQ7A 3PWVA 4P2RE 1KEGL 3HKFA 2HA1A 4TTGA 3UP1A 1BFTA 1MREL 1TJGL 5CKGA 3U2IA 5TPWH 2P46B 1EAOA 3CJJA 5A2KH 2VDMB 1H3UA 1X44A 1FYHB 4JFYA 4E42B 3FQTB 5D70L 2PCPA 3D3VD 4WI2A 3CHPA 5CZRA 2ZWLT 3WKPA 1X5KA 1UM4H 2WLNA 4JW3A 4IDJL 1OTSC 4XC3L 2TRYA 4PJXA 4YLCA 4MDJB 2Y5EA 4CDGC 1LO2L 4KTYA 4WKXA 1A25A 3TC9A 2DKMA 1K2DA 2VLRA 1W6WA 4FLSA 5ACMA 5BW7A 5HYEA 4OW6A 4E9QA 2E9GA 2FD6L 3U2SB 4AJYV 3IE4A 1BZ8A 2DMCA 3ZSTA 2YD5A 3OBAA 3WIFB 1WZ1L 3SDXB 3VWJC 2XPGB 1H9VA 3RTQB 5HY9B 5CEXA 7PAZA 4AYDC 2OXGA 1AS8A 2Y7QA 4MXQC 3EGSA 1E4JA 5A43C 5MENB 5DJ2A 5AAPA 2OXHB 1TQVA 1T0NA 3C60C 2K1MA 4L48A 3RNQA 1GZHA 1XGPB 3IKCB 2F6AA 4LKXB 3KWUA 5LNDA 3CFKB 3JSSA 4JFZL 3RL1B 2AGJL 4OJFL 2UZYA 1JGUH 5C0RH 4XVJH 1U3HB 3ZSSA 3IJ8A 4FNRA 2XVLA 1MHEB 5MERA 2J25A 1C1EH 3RWGB 1J5OL 2XFGB 4GRWB 1W72H 4PGBA 3MCLL 4YDIH 1GOHA 4HJJH 5E7BA 4PJEA 1J12A 5EBWA 2NMSA 3IBEA 2BP8B 2BNQD 2L04A 1RI8A 1XR9A 2ZWZA 4RGNE 3IDIB 4WKZA 4NAMA 1DVFC 5GGSY 1KN4L 3GLDA 5LXVA 1U93A 4F27A 5KSAA 4CMHC 4WW2F 4F8QA 1JG9A 3CFDA 3TFBA 1KWKA 3GSVA 1CBVH 5IF0A 2R29A 2VISB 4LLMA 3U0WL 4KAQL 5H8DA 1NC4A 4P57B 5E5MA 1U36A 4KH2A 1CGVA 1F11B 4M03A 2VLKD 3CNKA 4MMZB 15C8L 1T1ZA 4A2HA 3IS0X 2ALWA 2Y6SC 2GG1A 1TTFA 3BH8B 2R2EB 1OOAA 1KNOB 4M62H 1KV7A 2E0PA 4N8VA 3MLXH 4QDGA 4XXWC 4MDJA 2YKLH 4S2SB 2AJSL 3MNDA 5I30H 2R1XB 3MRHB 2DI9A 1YNTF 3EOTH 3F58L 5H4YA 3P9LA 5CU5A 4OD1L 3RFZA 1BQLH 2VZUA 2WBJC 1X7QB 1ZT4B 2CUMA 4R5XA 1EZLA 2CIIA 4YSPA 1IFRA 2VRKA 1EXUB 3CBKB 1JGVH 1DN0A 2A4ZA 1HH6A 2BSTB 4PRAA 2MNJB 2DYRB 4MZIA 5L88L 3RJOA 2VXQA 1OB1B 2YD8A 1FI8C 3MRPA 2EE3A 2Y6TE 3IJHB 4JHWL 2ICEB 4P46D 4QEGA 4J5VA 2AXGB 2X6UA 5LNGA 2LOEA 2ROXA 3GXIA 3WTYA 5FHAH 3L9BA 2QPFA 3GPSA 4YJZL 1TIUA 4R0LB 2X05A 4M8QA 4JQXC 1DQML 2X1WL 4CSPA 4H1LB 4FS0A 4HWNA 4OIBA 5ID1A 2XA3A 4TN9A 1AHMA 4Z5RA 1QKZH 4KRLB 4K73A 4UANA 4HXBH 4JNXA 7FABL 3VGGA 5D6DC 5KSBF 1L5GA 1C7TA 3ESPA 5BOPA 3T2PA 5DC2A 2EEAA 4S1RH 1UWEH 4JPIA 2R0ZH 4C55A 1AGEA 2EDFA 5JDSB 1PG7X 4KVCH 1JXJA 3ZRCC 3CFDB 2EUWA 3GSVB 2OR9H 3MKKA 5AVXB 4AQ1B 2ZCKH 2HX9A 2J1WA 2VLRD 4HETA 1S9WB 3J07A 3MLZH 1JHTA 5F7AA 1AE6H 4U1IB 2ICWJ 2X4RA 4R83A 4AMKH 4EUPB 1D7CA 1O7DE 1WT5A 4LSVH 4QWWC 4RFEB 4KFZC 4X98B 4HIIB 1OARH 4WUUB 4TLTA 4HV8A 4OCXL 3T4AC 1U8OA 2RTTA 3MJ7B 1ZLSL 3ZDYF 4AQAB 4WHYH 3A22A 4KRMB 3MUUA 5HVWA 2R56L 1XO8A 3S3SA 3LPPA 3VH8B 5J9PB 1KYFA 3AWEA 3GTTA 4PJ7F 4PTUA 5F7KC 3WEXB 4GXVH 3VFSB 3K6SA 2X9ZA 2DICA 4L5FH 5PAZA 1QABA 1EO8H 5E9AA 3P69A 4GT7A 2BM3A 2X42A 1QHOA 2VXVH 4UI2A 3BFOA 1G7QA 3CC1A 2RFXB 2OMVB 3IFPB 4FQXC 4FABL 5JHAA 1HN1A 3FB6A 4YLQT 2NUTB 4UB0L 5KBNC 4KKRA 5E5RB 2CO1A 2VYRE 5IIEB 4ZFGL 1JGLH 3CD4A 3LN4B 4FJYA 4PRBB 5F7UA 4IMKC 1T7YA 5FA3B 2CO6B 1HXMA 2VXSH 2C9RA 5DU7A 2KLSA 4N22A 5J6HB 2WVTA 2FAUA 3CQFA 4NKDB 1H3GA 3CUPA 3S0PA 3SKJH 4GKZA 4D2NA 4YHLL 4Z3IA 1A64A 2W9DH 4ONGH 3R1GL 4ZFQA 2UWEA 4KX9A 3AG3B 2F74B 3SY0A 2O30A 1G1CA 2JSFA 3H3PH 3VW3L 1IM3D 1AP2B 1SJVA 2MQ3A 5ICZB 4BHUA 1Q9OB 4FQXD 3VXUD 1MJ8H 3MJ6A 5C0IA 4DP9X 2MKLC 3TNNB 2OSXA 1CFNA 2R2CA 3BWUC 1LM8V 5CCJA 2CUIA 4AGPA 2OYPA 1E6OH 5AW2B 4X6DE 2B59B 3H9SA 1ASQA 1K8DB 1F2XK 2X40A 4I3SH 4R2GB 3RUGA 2WLLB 1J1XL 3DX2A 3F7LA 4MNHB 2Q7YB 4S1DC 3OXRB 2I7OA 3C8DA 2N7BA 4BFOA 3RIFF 1RFDL 3D51A 2K4AA 1T2JA 1K5NA 4QHKJ 5DI8A 4EOWH 4OI9A 5HHQA 1WISA 1RZKL 4TVPD 2GFBA 3MZTA 1N5AB 5I19L 4NCDA 4MGXA 4MAZA 5AOKA 2GCYA 3O4LD 5TE6L 1ZK5A 3O8XD 2ORBH 3QI9B 4DGVL 3EH2A 4O9HH 3DSFH 4PJ8D 1LLAA 1XCQB 1YEKL 5F7BA 5I1AB 1VGKA 3NSYA 2ARJQ 1GYWA 2Y72A 3FN3A 5JDJA 2BFGA 1I9EA 5DJ2B 1NCBL 3MODH 2JLPA 4W1TA 4OZGF 1WFIA 3T6QC 4N8PA 5CD3A 1C5DB 1NL0L 1NMAH 2NY2D 2OTWA 3Q2NA 3UTPE 4B0MM 4MQSB 4MA8H 3U6RA 4XXCC 3GPEA 4P9HH 4YHKL 4OFVA 5AVVB 4Y2OB 1UFUA 1IGYA 1MXDA 1KCUL 3DYPA 1AZVA 1T04B 2DL9A 1Z5LA 3V4UH 1EHLH 4G6ML 4PS3A 3L6FB 3K1DA 4MXWH 5T1DH 1TNMA 2Y9RT 3BZDA 1IAIH 1TQSA 1RULH 3WFDH 2ENPA 4TSCH 4PJEB 2IWKA 5EZLA 3G5ZB 3IWUA 3CSBA 1MRCL 1EVUA 4Z7IA 3DUUA 3ZR5A 1IKFH 2JXMB 3CX5K 4PWIA 4P4KC 3AG2B 4XPBL 1T20B 2ILLA 2WO3B 5AAMA 4HF5H 1DEEA 2ZXQA 5I75C 3QJHB 2EXWD 3FQXA 2ODIA 3WFCH 2J5WA 1TZ8A 3AY2A 1NC4B 4G5AA 5HYJA 2XRAL 4LIQH 3VXSA 4QKTA 2CE6A 2UXGA 4HCRH 3DETD 3WIIH 2W0PA 2WWKO 4F2MB 4PJBE 1KGXA 1NKOA 1L0QA 3LZPA 4L3AA 2EE2A 3B1UA 2NY4D 3L4XA 3ATAA 2AJYL 3VXTB 3PP4H 5IW1A 3FYEB 3N3EA 3B37A 3DXAA 4YHNA 3BDXA 2QQKH 1A7QH 4JFDB 2CJ3A 4JO3L 2BSED 5E6ID 4OBRA 4E5XA 3K0WA 2FR4A 4G6AC 3WY1A 5EOCJ 1QBML 1XGYH 2B08A 3CZJA 3KPOA 2IAAC 3MBEB 5I1KH 4L3ED 5SX4I 2F7PA 4JHBA 5ETUB 3RWIA 4ENEC 4XC3H 1Y18B 1D9KC 3K6NA 4NBXB 3ZL2A 4M5ZL 5CCGE 4HUWA 1MZYA 2MCPL 2WTRA 3WE6B 2IEPA 1MEXL 1OGTB 4B9YA 3T3MF 3O45B 5EU6D 4PP1D 4FYSA 4F3FA 4FABH 1DEDA 3DMMC 1SEQH 4PS4H 1S9YB 3TZVD 3U4BL 4U6HB 4WO4A 2AW2A 1U8PA 2BNQE 1QSEB 1ZA6B 4XVJL 3RTQA 2B4CL 4N0UE 3GGWB 4JO2L 2FIKB 4LVHB 5KSUB 2HKFH 1E30A 3NDZE 4QTIH 5TF1H 4ELKB 5AW7B 3F7YA 2XA8H 1SEBB 4JY4B 4M4RA 5HI5D 5C0BE 4Z5RB 1B4LA 4NXKA 2XZCH 3HS8A 3LQAC 4JFQB 4NIYE 5FM5O 5CSZA 3VXMB 2XETA 1S7QA 4X6DF 4TV3A 4Y5VC 4O2CB 4Q6IA 1OHZA 1B4TA 1DQIA 1S7XB 2Q10A 1I1CA 1HZLA 1TFPA 3LVTA 4OLXH 3QH3A 4LZKA 4PJ5E 4IIQB 5L0QC 4LPCA 4MRCA 5IUSA 4NNPH 3O3AB 3VI3F 2AKRA 5ITBL 4FLOA 3ZU8A 2WNGA 1IC7H 4RISL 1S3KL 2F54B 1UZ8A 1XX9C 2H6PA 4G8GA 2ZYIA 4JO1L 3E9TA 2BFVL 2CLRA 4J3SA 4I3SL 1F3DH 2OMTA 4OKDA 5AB9A 15C8H 3BT0A 4AT6A 1A6VH 2WTOA 2G9HA 1OCWH 1WIUA 3APDA 3MMEA 1WP6A 3U7YL 3N06B 4HSAC 1RZKH 3NQIA 4MMYA 2G60L 5D5MF 1FHGA 3MPCA 3IFOB 1CBVL 1B3JA 3DPDA 1F4WL 5MHSD 4QRTB 3KHOA 4TLSA 1U8CB 5JHLH 1A14L 4PJGB 4OZGE 3MX0B 3KPRD 5IP4A 3U7AA 3RDJA 4FQIL 5SX5K 4NRXB 4JM4L 3DETC 1LDPL 1SY6A 1D9KA 3KXFE 4XP5H 3PWJB 2O61B 2AXWA 1OAYH 4I2XB 3B9KA 3S37X 4C56B 3QEUB 1OZTG 5CD5D 1XF2A 3U30B 3QO1B 1Q9WA 2JJUA 3FMGL 4JCLA 2F1AA 4ZMTA 1MRFL 3OLIA 4R3SB 4JUSA 1KLFA 2MQCA 3UPRA 1UA7A 3O45A 5F6HJ 2MNWA 4F7TA 4G43A 2GK0A 4IGBD 1AD9B 1MF2L 1UJ3C 3HC3H 4IKJA 5IB5A 1I1AD 2ITFA 4N2KA 4E2OA 2YR3A 4BGDA 2Y22A 2DH2A 4NQXB 4Y7MA 4ZO6A 5DD6B 4XP1L 3V4UL 1EHLL 5C0CA 1JIBA 1BM7A 3F7YB 3N1QC 1T1YA 3FRUA 5DO2C 3LDBB 3WDJA 3OPUA 1BZ7A 5CWSB 3OKLB 4NUJA 5T1JA 1A3RL 4WENB 2ZOWA 3HUJB 1CXLA 1BQHB 2FGWH 4V2BA 2DMHA 3GBML 4HIXH 4DOHB 4I3RL 2NOYA 1LK3H 2H0FA 3H1ZA 1FC2D 3ZRFC 1J9RA 3FAWA 4U4IA 2LHAA 4APXB 4P04A 1JYXA 4FFZA 4FTVA 3Q8AA 1TTAA 4I18B 4ZUSA 3ZTNH 1AHWC 1E9OA 4JB9L 4PRID 1LNUB 2GW5A 3AQYA 1YYCA 2DEXX 3FFCD 1IAIM 4Y4FC 4B3EA 1A7OL 1QLRB 3GUTA 1WPCA 1ZEAL 1KCKA 1CDJA 2PWHA 1VFUA 3UZEC 3T0ED 1RH8A 3NJNA 4XO8A 4G7VL 2X5PA 4DK3A 1BVZA 4WFHD 2X1QA 5D2LE 2XACC 3ZQ9A 1U0QA 1I9JH 3CXDH 1F8TL 5KOMC 1JTPA 2JV6A 4G8IA 4KO7A 4LAJH 4WJG3 1PYWB 4LSVL 4MB3A 4X6CE 3QUMB 2HWZH 3C2AL 4OKVA 3OAUH 1IARB 5INDA 4XAWH 1CFVL 3QEUA 3D09A 5FOBA 3NZUA 4HK3N 3FN0L 4KWUA 4XI5C 2VXTH 3V4VA 1LHZA 3B83A 3QA3A 5EZOH 4M48H 1T5WA 5K1JA 3ZE1E 3U4BH 3VFSA 1WIPA 2P48B 1OEZW 1QA9B 3L9EA 3ET9F 5LGYA 4LVHC 1HAUA 3QFJB 4PYHA 4IJ3C 4U1JA 5I1GL 1E65A 1NJ9B 2WBJA 3R8BB 2FO4B 2WPGA 3VU2A 4UIKH 3FC8A 3VD9A 3GXPA 3D3VE 1JPST 3B7UX 2BSSB 2J21A 3LKRA 4ZFGH 1JGLL 3PWPB 1YEHH 4GAGH 1Q1JH 1W9XA 2AXGA 4TVPE 5BJTA 5DHEA 1AR1C 1QYGL 4FFYA 3VGFA 4O58H 3CMGA 3AB0C 3SDAB 1USZA 4FE9A 3NJHA 1QNZL 5F1IA 5CN1A 3HAEA 4NZFA 2XBZA 3VXOA 1NBQA 5A6LA 2B39A 1J1PL 3EYQD 3SKNA 2WXPA 5F9OH 5JW5B 3QEQB 1MNUL 3NSDA 2G30A 3PPSA 4WWID 4ZD3H 2JB6B 2PF6A 3DTXA 4KY1H 4KKAC 1GTFA 4LDEB 3UZEA 1XF4B 3ES6B 1KZYA 4KZ0A 1AYOA 4S11A 5T5FH 2WCGA 1TCRA 4URTB 4D9LH 1X6NA 5FPIA 5E08H 2ZJSH 2QHRL 2EDOA 3FNKA 2B20A 3Q9PA 4NQCD 4PJDB 3WY4A 5K59E 2Y3NA 4KGJA 4J6RH 4LU5L 1G7JA 1N64H 5DK3A 2H32B 3ZGHA 5HDQL 4U0QB 4B27A 1KTLA 3FB7B 3MODL 4JCWA 2HJLA 1UCBH 3KE0A 5E4EB 4JLRA 1WAAE 2R4RH 1KTCA 5E6SB 3REVA 5KJ7E 2FL5A 2XIDA 4XBEL 4ORZC 4WI9A 1KG0B 3L7EB 1BEYL 1NGXB 1YUHA 1I75A 4E68A 1G9ML 4RH4A 5I1CH 1DQLL 4HK3J 1GJWA 4QLWA 3IJSA 5JQ6H 5DURD 1KTDA 3N50A 3ILEA 2GJRA 5IFAH 1OSZA 2ESVB 2VN3A 5FUZH 5D5MB 5GS1A 3QGVA 4WW2A 3T0XA 3C60D 1E42A 2EXWC 1AANA 3T0BA 1W8NA 1YEJL 2FYVA 4P23A 4PGZA 1N6QH 4PJ8A 1H8NA 3FSOA 3JWDH 2ATPB 2ICEA 5FW8A 5SWZD 5GRWA 4JANA 1IO4C 1O6SB 3E8VA 4JJHA 4B95C 3O6LL 3DHMA 4GO9A 3DHJA 4JHUA 2C9PA 2Y1VA 3OAYH 5BVPL 1T7XA 2OK0L 2XXCB 3OLDA 2HJFB 4YK4C 4DVBA 4N2CA 3CFKA 1TETH 2XXMB 3HC0B 3KCPB 4TNWK 1H8LA 3VXSD 4QO1B 2MTPA 1AD0B 3WL9A 5IJVB 1OLZA 3KM2A 4HPYH 1E4HA 4WI7A 5IEHB 4HZLB 2A9NL 1FH2A 4Y16B 5C2UB 1AGEB 1D7BA 4NQEA 4XPBH 1S9VB 1IZJA 3OAZH 3EXLA 1QW9A 1SXBA 5JXAH 1I7ZA 3ES6A 5K39B 1K4CA 1ZXKA 5GGTA 3U1QA 3HMXL 4MNQA 4MWFB 3RY5A 4BA0A 4M1GL 1EEYB 1B0RB 1W0WB 1QBMH 1XGYL 4RZCB 1BECA 5IR1A 4N2MA 4L23A 4EUPA 4PJDA 4YIQB 1THAA 5IF0B 4GAJH 2J12B 3CXDL 1CXKA 3LIZH 1HK6A 1NSNH 1AJ7L 3JVGA 4BH7A 4AEEA 2HRHA 3QO1A 3RGBA 4FZ8H 1M56B 5D1QC 1B2WL 1XGUA 3SDYL 4FQQA 4S0TD 5FK9B 4M7KL 5EEZA 2P5PA 2R1YB 2CRZA 3PXJA 1AQDB 3AM8A 2ZOUA 4DNLA 3OD3A 4TSAL 2IAND 5F8QC 5C09A 2GI0A 3TZVA 1EUUA 2H6OA 2K6ZA 2UUDK 2XG5A 5DZNA 2BMKA 2P5WA 4ANWA 5GZOC 3MLPA 1PZCA 4NRYB 5B7FA 2ADJB 2VXTL 1QWUA 3EOAA 3RILA 3L3GB 3RIAK 4GSUA 4ZYKA 2EDKA 1A5FH 4X50A 2F8IA 1WZMA 3LOWA 4LVEA 5D96B 2UZIH 2FB4L 5E6IA 3UAEA 1X7QA 2ZYSA 4A6YL 3LKQA 4U1HA 5C6PB 2Z4TA 4KJPC 3QJFB 2WJ5A 3OAWA 4X7DC 5F93C 2DTML 2F9BT 3L3JB 1HXMB 1P7KA 1FYTE 5GJTH 4DW2L 5IEKA 4KHTH 1A3QA 1NOFA 3PWUB 4WO4B 5E2TH 4MBOA 3JYBA 1X5XA 2LU7A 3R8QA 1G9EA 1P7QD 2FWOA 4PJ9B 4U05A 1OTSD 1IC4H 2EAEA 3AFLA 3ECWA 3BP5B 2VLME 3PHOA 1OALA 1C5BH 1N59B 5CCKH 2OMWB 3JWNH 5FYLD 1MNUH 1R24A 3WIHA 1Z9NA 2CO4A 2D7TL 2FBJL 3D4ZA 3O41B 1EGJA 4Q6IB 2EILB 3EDKA 4HJTA 5D6CA 5IOPA 5F7EH 5HVGB 3O3UN 4HLZG 1R34A 1SBBA 1T89A 5ITBH 3TTSA 1XR8B 1A1MA 5JHLL 3H8NA 3KR3L 1S3KH 5HHQB 5K39A 5DD5L 4ODUA 1DVSA 5CSGA 3RX7A 4TULH 1SYVB 4HIEB 5DQDH 1R3KA 1AIFA 1KOAA 2B5IC 1G7LA 2FEEL 3MCG1 5E2UH 3T1WA 1BCIA 4RMWA 1RZJH 5INDB 1MFMA 1KJVA 4HYTB 2JKIS 2NY1B 1VIWA 4FOMA 2OCFD 5FK9A 1QI4A 3SE8L 3F00A 3C5JB 2GJ6B 2VDQH 3L9RA 5F96L 3SJVA 3H3KA 2YRBA 5GRVK 1MCFA 1Z9MA 4M93C 4MNGA 5BZXA 2CBMA 4I85A 3KNBB 1Z2KA 3CHOA 3D52A 1W72A 4F5CE 5ACZA 2FO4A 1PAMA 1CK0L 2N0KA 4X6CB 4P0DA 3KXFA 4PFEA 3AREB 3FQRB 4RCAA 5F7WC 1BJ1J 3BVWA 1X5FA 2H3NA 5CJXA 3IPFA 4Y4KB 2VAAA 5E8NA 1QEWB 4XODA 4W9GC 3WJMB 4IMKA 2JIXA 3ZDWA 5CUSL 2WXRA 5PCYA 3ESNA 1I3RA 3AU1B 4HA1A 5DYFA 3VWJD 3W5MA 4AYFB 2IV9A 2BZCA 4A2GA 3VJ6B 5FYKE 1WIOA 4RDBA 4CL7A 5IV2B 2NXYC 5TDPB 4JB9H 5HI3C 2PXYC 1JFHA 5EG6C 3VNZA 1CR9H 4P48A 5BS0E 2PN5A 1UURA 4OCSL 4JY5H 3C5ZC 3BGFB 1DLHB 2AEPL 3CX2A 4BFRA 1E67A 5GIRB 3T4YB 3QQ9D 4M6ML 4DAGL 1NC2B 2I9LB 1KEGH 2LE9A 3TURA 3G5VB 5HVFB 1F4HA 2ZQKA 4Q6YA 1K85A 1KENL 1T7ZA 4O2FB 4D3CH 3QXUA 4K0OA 5ICYB 1OVZA 2DLTA 1IC0A 2WJ7A 3DIVA 5JW3L 5FO9A 3JWNC 3PWPE 3MV7E 4KOBA 3FT9A 5BV7C 1GMIA 4U31A 4XT1C 1WAEA 3CFCL 4YFDB 1MFEH 4H8PA 4DO6A 1JFQL 2RGSA 4AEIL 3JV4B 4N26A 3B56A 1IQDB 4KTDL 2DJMA 1ZXQA 4OD2B 1ETJA 4JG0L 3NCFB 4G7VH 3WY3A 4ZPTA 3B9DA 1YUHB 2VZ3A 3GI9L 1P1ZA 3QFJE 4PJ7E 1B6DA 1UKTA 1UT1A 4NN6B 2YPVA 4YX2L 4KKCD 3TT1H 2R1XA 2DMKA 5C6WH 2PW1B 3G08B 4LCUA 1BZ9A 1A6TB 2NT0A 3NACL 1G6VK 4KKBD 3QDMD 4ZNEA 1NCOA 3WNNA 3WEOA 1XCQA 4M7ZC 5DEZA 1TZGL 4BSJA 2ZWSA 4QXUL 4HBCL 4JN2A 3MYZA 2QDWA 1OY3B 1TFHA 1DCEA 1P2CA 1TTCA 2F5BH 1PKQB 4YFLI 1JHLL 3FCGA 1ACYL 3DBXB 3UCQA 4PRDB 2CCWA 3EYQC 1KLGA 4WVRA 4G9DB 1MCDA 2WWOA 2R39A 2GHZA 3UAJA 1FHNA 1TU2B 3C09B 3LN5B 2ZUXA 4G9FA 3NZHH 3DVNA 4WFGE 1BFVL 3FAXA 3GHBL 3U6RB 2QSCH 4KJPD 3ARFC 4ZMQA 2OQJA 4PI2A 3IU3B 2FWOB 4PUBH 4KRPD 4GKNA 2YBRA 4JR9H 1W72L 4IJTA 4IIQA 1AOHA 4HSQA 1KJ3L 4JG9A 2FUQA 3NJKA 5EBLB 3V5KB 5T3XH 1A0QH 3MV7A 5C8JB 1QNIA 1B0WA 4XVOA 5C0JA 1HU8A 4OZIA 2Q20A 2YPLD 1ACZA 3GMLB 2FHBA 1DANU 2BXYA 5FYKD 4J6RL 3DRQB 4RRPA 4H1LH 2KMWA 1ZLUH 3RURA 3CVDA 3LZQA 4R0LC 4JZNA 3RZCA 1YY8A 2NNCA 3ESOA 2HTKD 3LV3A 4OAWA 4OFYA 3TBWB 2GTQA 1JHTB 1ZHKA 4OM1H 4Y4HB 1J86A 2QPSA 3VXME 3WLWC 1ET5A 3FJTA 4L9LB 4TUOA 3CGTA 3HHSB 3QZBA 4EJ1C 2DLEA 4LL9A 2E3VA 1Y6NR 3MLSL 4XO3A 4HXAH 2ZJSL 4WI4A 4Z7WA 1E8XA 1YPZF 3ATBA 5IG7A 3I75B 3CVHA 5IFAL 4Z76B 1RQ5A 5JR1L 1NGZA 1QO3A 1OK8A 2ZKXA 5CZXC 1UD5A 5KZCD 1E2WA 2FX7H 2G2RA 4M93B 4QRUA 4FI7A 4JRFA 3RKDC 2XN9D 2ZUQB 2JKXA 3HAEH 1MI5B 3DURA 3RPIA 4DERA 3QFJD 1GYAA 1M9SA 2NPLX 1U58A 4I2XE 5EN2A 4AV0A 3VXRB 1A2YB 4N1HB 1JK8A 2VRQA 1E27A 3KXFB 1FFNB 4Y2NA 1QUPA 3IF1B 4X4KA 4F2EA 2O5ZH 2ADIB 1YN7B 3VFVB 2IXQA 3FB5A 4O5LH 5JIKA 4PJGE 2D0HA 1W80A 3HOGA 1I8LC 2P26A 3EDFA 2KH2B 3BSZH 2YAOA 2BY0A 2HRPH 2JJWA 2ZUUA 3DXAE 1ZIAA 2NXYB 3CVHL 5DC0A 5ICZA 1QTYT 3PV6B 4OZIF 4OQTL 1SBSH 1VZIA 1S5HA 4RDQF 1Z9OA 3GZPA 3OQ3B 2OK0H 3VXMA 3ZT6A 4I0KA 3FO9B 2HRGA 2NY0C 2ISDA 2VITA 1BV8A 4EKXA 4GQZA 3G6JB 5AW3B 1IL1B 2BW4A 2NR6C 4R0LA 5CEYB 3BKCL 4M8QB 4BRJA 4AQ1C 1JAEA 2V2WA 5J1AB 5DJZA 2UUDH 3MRJB 3VGHA 3S96B 3K6FA 3F64A 3ZKMC 5J11C 3DJRA 4HCIA 3EHBC 4B53A 4X99A 1IVTA 3FU0A 4XVUC 5L6YL 2C8NA 2DWYA 4GMSH 4FYQA 2A73B 5DQ9B 1ZJBA 3LNIA 3KPMB 1P84J 4PMFA 4UQ3B 3O2VL 5AYUL 5FDWA 5JXAL 1U8LA 3HAEG 3WTUA 4RMRA 3FT0A 3VFRB 5KYYA 2XC8A 4F57H 3W11C 2R4SL 3H6JA 4MCZA 2FX9L 1CMOA 1PZAA 5JHDE 3MA7B 3C5SA 2MQGA 2YUXA 4N0UB 3S36H 1E2VA 1K4DA 3M7OA 1OM3L 1RZGB 4HFUH 3FU5A 3LEVL 1CG9B 1I53A 1PLAA 1RZJC 3EBGA 1E28B 1I1YA 3RBGA 4YC2C 3ZVVA 1V7MH 4G9FD 1IBDA 3MRFA 1X9RA 1F3RB 4P2OB 1GPOH 4K94L 3HI1A 2DDQH 4GQ9L 2YD7A 4GG6B 1ZK9A 1KJ2L 1LD9A 5BVJB 4XR8C 1L3WA 1D2PA 3AAZA 2GSMB 4HGMA 2YJLA 2QSVA 2Z7WA 4U1GC 3B1TA 4FP8H 1G0XA 3IDXL 3L3GA 3DI3B 5IFJB 3RVXC 5JHDD 1BOYA 5JYLA 2ETWA 3NZHL 3VDAA 2JI2A 4NAQA 5EZPA 3NJFA 2OJ1A 3VXUB 4ETYA 1LQBC 2PR9A 1MHPH 5GS1C 2WLMA 4Y4HD 4NSKA 4ZMAT 1OLLA 1KC5H 3ZX1A 3V7AE 4X5XB 1H5BA 1SZNA 5IK3A 4R84A 4L1TA 2VR4A 4ILDA 1AQKH 1EDQA 1IAOA 5FM8A 4HJ0D 1U8IA 4ZFOL 4PJBA 5F7NC 1URLA 1XVSA 4P46A 2RQEA 1A6AA 3WMQA 4S2SA 4GRWF 4LCVA 4PB9H 2YQBA 1VZGA 2BO0A 3JWNE 4OZHA 1KJMB 4X6BA 3J7HA 4B60A 4KO5A 4XNMB 1R3IL 1YYMH 2VDQB 3QUZD 4AUYA 3PXLA 4CU7A 1HZHH 4FTVB 5E0QA 4E9XA 4CDHA 3DIDA 4PJEE 5FECB 5L2KE 1L7IL 3AS0A 3FQYA 1AZRA 1ADQH 3ZDZE 1MAJA 1WBYA 4PCTA 4AENA 3CFNA 1JV5B 4PB0L 4XNYH 4YO0B 4DQOH 2JCCE 2PO6A 1P4IL 1A3LH 1EANA 3STZB 5HGBA 5DC4B 1ZE3H 4J2XA 1KB5H 1TEYA 1ZE3C 2H2SD 2CIKA 3ZLQC 1NCDL 2O5YL 1HE7A 4NUGL 2BIOA 3S34H 2EXTA 5G2NA 2GSGA 1TVBB 3ZUCA 1SHXA 2DPKA 3SDCB 2F68X 5A2FA 1IC5L 5SWQA 1INQB 1KTDB 3MRFB 3MREA 4KMQA 1SRDA 4R4FL 1L0XA 3UC2A 4BWTA 3W39B 3JV6B 5IKCA 1BD2B 3QZMA 1YY9D 4WI5A 4M6NL 3WEAA 3LHPL 1GXEA 3FCBA 1MQKL 4DP8X 2YN5A 4LPYA 2BOLA 3H9HB 4UYPA 5LDSA 5IFJA 1MW1A 1JV2B 4ONFH 2TSBA 3O6FA 4GY4A 4BSVA 4U1HB 2EDMA 3DWTA 5EULV 4M1DL 3WNLA 2FNWA 2XWEA 3SPVA 3BSZL 3BVNA 4H25A 3LNEA 2LR4A 4HT1L 5EU5B 4PJHA 3JTTA 4IM8A 1WE5A 2V5SA 2Y69B 4KV5E 4P5KB 4L8BA 5EA0H 5E6ZA 4G6FB 4MNQD 5HYFA 4XAKD 3WS3A 1KENH 4ODVL 3N9GH 1U8OB 3CVIH 3HE6D 2EJ1A 4R7VA 3GJEB 3UACA 1OP9A 3MNVB 4ZFFB 5FHBL 1ZTXH 2DH3A 3P3UA 4J3OG 5DHYA 2FLRT 2PPAA 1TYEB 3EFOB 2KZKA 4XB8A 1Z3GH 1JFQH 2XYBA 3BC9A 5C6TL 3T3PF 3QORB 3NA9L 4LEOA 3ZL1A 5CIPB 2MHAB 1RURL 5C0BA 1TJHH 3TXAA 1PF3A 3DOIA 2JE8A 4KO9A 2EVFA 1R33A 4QWWD 5F7YC 4ZSOB 3AROA 5GGQH 4DEPB 4Z78A 4DHLA 2ZP9A 4Q0XH 1KCLA 4TTDC 4KROB 1D5BB 2BRRH 1KDJA 5DWPA 5ADOL 3VXSB 2BIIA 4M5SA 2VH5H 1NIEA 3NJLA 4BKLB 2DWEA 3Q5YA 4H8WC 5AL0A 3WENA 5HGBB 3STZA 4RSYA 5EOQL 3OJDB 3MBWA 4TNVK 4WI8A 2ICCA 4FI6A 5E94B 5C09B 4PS8A 5L2KB 1ACYH 4JY6B 1F90H 1R5WA 2IDTA 4P2OC 5GGSB 4P5TB 4XC1H 2WIIB 5C0BD 2QSQA 1FH5L 1RK1B 4DKFL 3HN5A 2BJML 3QRGH 4L4VA 3UTSD 1LEIA 3G08A 2XZAL 1HNYA 4FQ1H 3L5WA 5H37A 4F7EB 1KB3A 1J10A 3NP4A 4HU2A 5TGBB 2PCFB 1WD8A 3E8UL 4QGYA 1GGIL 4M7LT 3TYFB 3UIYA 4JKPL 1BW8A 2GB2A 3B2UD 4DJMA 4LEXL 1YSOA 2C3HA 3BCDA 5DMGD 1Y0LB 5DR5H 1EJ6A 3M88A 4NO0D 3OJMB 4LXFA 4O4YH 4RAHA 4Y5VB 1RUQL 1RK7A 1UD6A 2YA2A 5DJAA 3DDFA 5J6HA 1RP8A 5IK3B 1AKPA 4IHOB 3GDCA 4AG4L 4Y5YB 1ND0A 2V0AA 4DFIA 4KRPB 1LK2A 1HX0A 1RU9H 3AWFA 1X5ZA 2WLKA 3NSFA 5IOPB 1A9EA 1XXFC 4RGNB 1C08A 4GS7C 4AH2A 4Z9KB 4QHMA 1J05B 1VRSA 4PVLA 3LIUA 3LDBC 2ZAGA 1U8KB 4QJ4B 2XN9E 3QJTB 5T3ZD 1R17A 1VCBC 1P7QB 3JZ7A 3IDGB 4P2QA 5IB4A 5LGHH 3DLQR 4PRHD 5B3JE 4K5PA 4X6FA 3B2MA 3W11D 1DJGA 5DS8B 3EOBB 4KQ4H 1YNTB 3BZFA 2JMRA 2R69H 4U3SB 4Y1AA 5D72L 1KIRB 3SYPA 3HBZA 3E80A 4XNDA 4HFWB 1ES0A 1M42A 3PHSA 2ZOLA 3WKYA 3ATEA 1NCHA 5HDBF 3T9WA 1TO4A 4X9BA 4DKDC 2V3DA 1UCTA 4S1QL 5KS9F 2G3NA 1GH7A 4HS3B 1NQBA 4ALAL 2CLVA 3OQRA 2DMGA 3ASOB 3IFOA 3L2LA 5DUMH 3T4AA 2PP9A 3U7WL 2Z91B 3DUSB 2WYHA 2XTJC 3MC0A 2YGVA 3OZLA 4NQDB 4Z7QF 1XH2A 3K80A 4CW1A 3G6JE 4YDLC 1N0LB 1C5DA 4JAMA 4L8SB 3QS3A 3SO3B 5LUMA 5KW9L 3C6SA 3PWJA 2L7JA 1G94A 3P9MA 4OGYH 3MRIA 1BVKB 2GYSA 3QIBC 5EH1A 5HGHB 5IBTH 2RIKA 2UYLA 2W65A 4GSDH 1A3RH 3LKRB 4PRPA 5KVFL 3V7AG 3U83A 4FQJH 3DXAB 3GBMH 4N25A 4G9FB 4HIXL 4YHNB 2A6IA 4LPWA 4UZGA 4QRPD 1K3IA 5E6UB 1BQUA 1MWAH 4NKOB 2TAAA 3B8YA 5K93A 5KG9B 4GBXB 3KGTA 1QP1A 3HC4H 2CNZA 4JFWA 2OMZB 2DQHH 3LJ3A 1OPGH 1PMYA 4QRRA 5LN8A 1NIDA 1KELL 3AS1A 1ROCA 1FPTL 4NZUL 1IX2A 2F53E 3B7SA 4M29A 2Y4SA 5HGAA 3MOAL 3MRGB 5I6LA 1VCAA 3ZYZA 1XD1A 1EHNA 2NY4C 1ZANL 5C3IA 1EDYA 3RVUC 3MJWA 3SBRA 1DSYA 5T1MB 3ARQA 4PJIE 3DROB 3U36A 3HS0C 5KTEL 2YK1L 1NBCA 1IL1A 1AR1B 3GM8A 2CHDA 3U9PL 2E4TA 5JUEL 5CLTA 1YY8B 4YHPB 1DYZA 1CDIA 1XMEB 2DLIA 3LEVH 3I9GH 3KL3A 4FXTA 2XQYA 4DPBX 1GC1C 5CM1A 5T3ZE 4DVRH 2AJ3B 3GT6A 1SEBA 4D7PA 1GPOL 5EEWA 3X1NA 3CMOH 4FLHA 2BERA 4PRHE 1U8QA 3TA4D 4ODWB 1VFAA 1M3IA 1KJVB 5IG7B 2B2XL 4ONHB 4FP8L 2B16A 3TH2T 1FFPB 3IDNB 5BQDA 3MROB 4HFUL 3JWOL 2ITEA 4KITB 3RI5F 3SOBL 4H26B 2Q76B 5C86A 1NC4D 3TYGH 3HZYA 2WMPB 3E8UH 2QSTA 1AR2A 3D0VA 4HZAA 4GINA 1XIWD 4FQLL 3TYFA 1UC6A 3MJ9H 5I6PA 3TIDB 4OLEA 5CP7B 4EDWH 4NFBA 5AFAA 3TN0C 3L3OB 2KERA 4W9HC 3RVTC 2SODB 5BMFL 4NUMA 3IDUA 2DWDA 1IEAA 2P1YA 1BBJB 2QVFB 4JFEE 3WN5B 4UT7H 5LG1A 4KRPC 2F7OA 4JMNA 4XB3A 1C9SA 2IDUA 3F5WB 3C2SA 4QLRA 4GXUM 3A6BL 1NCNA 1IKOP 3LNGA 4HZLA 1IGML 3B9VA 4NC0B 4MJ2A 3SPJA 2XV0A 3CWGA 2OCJA 2APVA 1KTJA 1MFCH 1XIWA 4JVUA 4LDCA 4ZXBA 1X3DA 4RLDA 3DPBA 3PFQA 3CN1A 9CGTA 4UILH 2VXUL 3CSFA 4AEHL 4LVNC 3QUYB 4ZUWA 1NCAH 1I7UA 1A4AA 4LGPB 2YLHA 2BVQA 1YMMA 4JQIA 1L6PA 3WO4B 3QUHA 3INUL 1ZY9A 4FTDA 1J8HB 3ATFA 3HNVL 4G6JL 4N8CL 3GS7A 4OZFH 2YEZA 5CNHA 1Z5HA 1U8MB 3EBHA 1NWOA 4P5TA 3OKOA 2EYTB 4PJAA 1UFGA 4DP1X 1JPFB 5I18L 5A2IH 1YHPA 2R1YA 4IDJH 1KGYE 3FF8A 4YXLL 5C0CE 3C5SB 4PLKD 4N0UA 2LLGA 1A4BA 2ZCLL 3P30L 2VSDA 3ARDA 3MRQB 3X3GL 4XBMA 4MNQE 3FUNA 3OF6D 5F1SA 1MFAL 1O9ZA 4EI6B 1KPUB 3VWKD 3ZYIA 3I6LD 4FXGC 3LQZB 2VQUA 5C07E 3H0TA 3OZ9H 5T1KA 4MXVF 2VR7A 5J3HC 1MIML 3ECUA 1GYUA 2RR3A 1MAML 4JPWH 3MBEA 5T8IA 1R6VA 2PWFA 4MAYB 3OZKA 5F7MC 1K8IA 1TR7A 3NEEA 4HMEA 4Z23A 3OHMB 3L4VA 4FQXB 4QRRD 5DVKA 4PVBA 3LKOA 4PRPB 4PVMA 4PLKC 4YK4B 5AZ2L 5EC2B 4PJFA 1OO2A 4L3EB 4CVZA 3ZE2E 1ESOA 3QG7L 4IHBA 4AC2A 4XTRD 3QWQB 3ARFA 1WYJA 3VI4E 3GWJA 3KYKL 2WVUA 2OZ4L 4NKOA 5MP6H 1JPSH 2SEBA 2WXMA 4KDVA 5EOCH 2DKUA 3PABB 3IDYB 2JCWA 3VFNA 2PKDA 4AVJA 1TEFA 1E3XA 2VM3A 2UWEB 3BVNB 1SHSA 2VUYA 4F91B 2DLHA 1QLFB 3VRIB 3QZNA 2BNUA 3MUJA 1MUJB 3BRGC 2W92A 4NGHL 3DX0A 4Z8FH 2DQDL 4OKVB 5DHDA 2O72A 2N7SA 3FUFA 2C7UA 4RWYL 4Z3FA 1G4MA 5CFAA 5FHBH 4UTAH 3DROA 4H8WH 1MLCB 2WQUA 3WLWD 2CK0L 4XP9H 1UACL 4GJTB 3VFOA 1K8DA 1M71A 3WHE1 2J8OA 4FG2A 5D7HA 2F18A 2Z8WC 1E8YA 3PNWB 4HFWA 5DUBB 3SODB 5B8CB 1A6WL 3DRQA 3JUZA 3U0WH 1SJEA 2ITDB 3BWSA 2FRGP 3ZIYA 5J13B 3FB8A 3LPOA 2AV1B 3ZN6A 4W4NA 3RGVD 2AS5M 3MA7A 3DX7B 1OF0A 3NH7L 1KIUB 4Y4KD 5GGQL 3KJ4B 2EIJB 5EU7C 4YN3A 2OMUA 5MEPB 2COQA 4A7SA 4P3DA 4WAFA 4YO0A 1AGFA 3DECA 2X0VA 3H4FA 2P5EA 4BK8A 5AVUB 3ZO0A 4JFYB 4E42A 1KJ2A 3QORD 3ABMB 3BO8A 4Z7WB 4N5ED 4TOYL 5AKSA 3UTQA 3QWRD 2OL3A 5AD0B 3OR7A 2PWGA 2EKSB 4ZAKC 1KGCE 3NCEB 4J23A 2K0RA 3CSTA 3WFHB 1JZ5A 1M3JA 3QW9A 4PW3A 5L2KA 3CZUB 4O4YL 1ZV2A 2NY5L 2FWUA 5DJ8B 4QAMB 4X5LA 3B9KC 5TF0A 3GHPA 4DGWC 5D7JA 3X1FA 1OGAB 1VKXA 3BPNC 4PSPA 4QF1B 3ZPDA 4YSQA 5IROD 1BLIA 1RZ8B 1U58B 2FSEA 2FX8L 3DJ9A 4MAYA 5D1XB 1U95B 3RNKB 3VDCA 3L5JA 2IG2H 2NCEA 1OCCB 1N7ML 1D9KD 3FONB 4NQSB 1J8KA 3LKPB 4OZFG 2J88L 4AEFA 1AGDA 2ZXBA 4TPRL 3VQLA 1FG2A 1G9NH 4FFVC 4MXQD 4JRYD 2ZICA 2KL6A 3K46A 3BPCA 2AANA 4UUJA 1TJIL 1Q8MA 3CX5J 1HQ4A 2FBJH 2NYYD 1S7RA 2VTFA 3TJEL 1MPAH 4AYBA 4ELMA 2FNBA 4E41E 3TGXA 3MXWH 3QJSB 1GGYA 1VA9A 4KK6C 1CLZH 1C12B 1SXSA 4XBPA 3TVMB 1QLEH 1HWHB 1R3HA 4LVNB 4WTXA 4S1RL 1P69B 3HUJA 5D72H 5D7IA 1NFDA 3FUMA 4FL4C 2VITB 5CINL 3TO4C 3AQXA 4X7TA 5SWSB 3ISRA 4PJ9D 5GS2H 5IHUL 4NENB 5IBUB 1FVEB 4R7DB 4G7SB 2PXYB 2J8UA 3IS1X 4WFFD 4AX3A 4JRYE 1UGNA 3CG8A 3V7MA 5JIQA 1O75A 4EZKA 4KBPA 1HKFA 2HTLD 2IMMA 1XR8A 4X9GA 5E8PA 2VJ8A 5DS8A 3S2AA 3P4MB 4R6UA 1RPQA 5K9QG 4Y9GA 2R69L 3I9AA 2JK5A 1MAKA 3AT8A 3X11A 4HKXA 2ARWA 3H53A 1U3HC 4AQ8C 3I50H 3UTQB 3C9NA 3QUML 4LT7A 1GZPA 4NQCB 4XMXA 1J9TA 1DSWA 2X12A 3AUWB 2ZG1A 3O4LE 4PRNB 4QJ5B 2OV0A 5JPNA 2ED7A 3GEFA 3ZXAC 4L5FE 4PRDA 2VXVL 2XVGA 1KTRL 3CSYB 1WWCA 3O2WH 4MAYC 3RP1A 3U7WH 4P2OA 4UAOC 3ZYJA 1N5YH 2ZG3A 3OKKB 1AKJB 4NKIL 2BHUA 4C83A 3NSJA 1A1NB 4OLZH 4QR7A 4P23B 4MWFA 1T3FB 1NINA 3SPVB 1LDSA 5AZ2H 2AVGA 1G84A 4JG1L 3G5YB 4KJYA 3IU3A 4OLUH 4PY8J 5M94B 5I6XB 3QA3B 3VYNA 5MP6L 4GW4A 2A6JB 1MFUA 2BY2A 2D0GA 1DP0A 3EFDH 5DC9B 1TUPA 5DMIH 4PIRF 4GSDL 4PHXA 1RZ7H 4K7PL 2YEQA 2F08A 3T77B 2XBDA 1R5VA 1DJXA 1Z6JT 5ESQA 4E36A 2WLIA 4DN3L 5DD0H 5MHSE 4KUZH 5K9JL 2JIXB 3RKDD 5D5ME 3C09C 3O3AA 3SPGA 1CGTA 2VN6A 5EO1B 5KG9A 3E7JA 3WOVA 4ISVB 1R75A 3WEBA 1XEDA 3RTQD 1I8AA 2J1YA 2CGZA 3D08A 3BLKA 4JFPB 1ADWA 3ARGA 4KK9C 1TPXB 2MCAA 3KWWA 4ZMNA 3U9UA 1MFBL 1SJEB 2ITDA 4KTDH 3QUGA 2XKNB 4N20A 3GBEA 4G7YL 5T1LB 3GC3A 1W0WA 4GW1B 4RGOL 3NH7H 4RMSA 2Y36H 4TTDD 2YK1H 5SWZB 1DQQB 3OPZL 3VXQB 3U0PA 1OW0C 2WO4A 5DHVA 1I9IL 2NXZC 2X7LA 4ICWA 4EUPG 4OZFA 3GZOA 1YMME 4TNFA 3GSQA 1T7WA 2P5EB 2CDFA 4LKCB 1U8NA 1MCPL 3UGEA 4LASH 5ERWA 1BAWA 4HKXB 5ECGA 1O5PA 5IGXL 2ZXEB 3PQYE 4HCRA 4ZTPH 2B15A 5B7MA 4NPYA 5ALBH 2QMJA 1PCSA 1PIFA 2CRYA 3WFHA 1DJZA 2MTAA 4TL4A 3V5HB 5ID0B 4AQAA 1KTLB 5FYJU 1PCXA 1IAKB 1ETZB 2K7PA 2Z31D 3FO0L 4JFXA 1TVHB 1CVSC 1BXVA 2KI6A 5D7SL 1BZ9B 2CKBL 3OKKA 4C83B 4BQ8A 4QRPB 3CZLA 1NGXA 4H1LG 2Q2EB 4FG6D 4F58L 3FONA 5IROC 3HRPA 4AL8L 1UT9A 5AYTA 2HMID 5DJXA 4M9PA 2J88H 4IYKA 5DLML 5A6IA 4EDWL 3FFCE 1A9BA 1AY1L 3D5OF 1CC3A 5DJYA 1MUJA 5FIEA 4AIEA 4G6KH 3I6GB 1ERNA 1ZA3B 1DBKL 3KL0A 1OM9A 3DYMA 2EYSA 1GRWA 3NUKA 1JXKA 4WI0A 1JXGA 1XMWA 4PJ9A 3DVIA 4HAKA 2Q5BA 2E76C 1NFAA 5IHZA 3L3IB 4BHUI 3SCMA 2D03H 1F4AA 1SGKA 2IDSA 3B6SA 2IGFL 2IIJA 1ZT7A 1ZT4A 3MRJA 4FL4B 1AMXA 2HJFA 4ZFFA 2E9JA 1CYWA 5BO1H 5HGAB 4UZSA 2RBLA 4DGUA 3B5GA 3T8XA 1FNSL 2QTEA 2PXYA 1DUYA 4I18C 4AYGA 1AH1A 2WUBH 5H37H 2WXKA 3QIUB 1BZOA 4HXAL 5AKRA 3EKCA 1QHPA 2VXUH 3KPTA 5HDBB 2MCMA 2GT9A 3RVVD 4CC0A 3OAYK 1ES0B 5EF0A 3G6DL 2BP0A 4MB1A 5ES4B 3SY6A 2KYIA 1AIFB 3NBNA 2Z7ZA 2DIAA 2EKSA 4DTGH 3BMVA 4H40A 3KJ6L 3ZT7A 4F7PA 3QHFL 1JZ7A 1KB5B 4AMWA 3AB0B 1HEJC 5I1DA 3KLLA 1DBJL 1IMHC 1NCJA 3VYOA 3G04B 3LZLA 2YAFA 5D1QA 3NRPA 3O3EB 1HOCB 2HLAA 5CGYD 4J39A 1DBMH 1NEPA 1BM3H 4LSTL 5DMGC 5LLIC 1GSMA 1H6TA 2CUHA 2VABA 3I75A 4K15A 3V4VB 2WP3O 4PS4L 1G7MB 4ZFZB 1F00I 1CCZA 1LMIA 1ORQB 1FZOA 1JPSL 3PXHA 4KK8D 3MLWH 5EOCL 5DO2D 2W65B 2WXLA 5K9OB 1KCBA 1NLDH 2BVPB 2VMEA 2XG5B 4XMKL 4YSRA 5F44A 2GPZA 4U1IA 3V52L 2YXVA 3ZDXB 1RZIA 4F7KA 3EFDL 4JHAL 1Q9WB 1SLUA 1ZKAA 3DX8A 5FB8B 2NY0B 3RNQB 2E27H 3FO2A 3X13B 1HCFX 2EYSB 4DFHA 3LRSB 5BW7C 3A67L 4U1LB 1RZKC 1UACH 2IQ9L 3VD7A 3VRLF 3VE0B 3D2UB 3WEXA 3PABA 3VH8G 3K6SB 1KJMA 1MREH 1TJGH 3CN4A 4GLRI 4WWOA 3RLSA 4J3OF 4CILA 4UZUA 1BYNA 5A16A 3LEYL 4PW4A 4CA4A 2ZWNA 3HN8A 1BBDH 2ERJC 1RAMA 4NNXB 4YDNA 4NGHH 3G5VA 1A9EB 4JFPA 4BIKA 3DHPA 5ISZE 3PDOB 4OF6A 2HFGH 1N59A 2AQRA 1OSPH 4P59L 3R19A 1ZDQA 2I7SA 1FFOB 3BAKA 4B9ZA 4YDZA 5C2BH 4X4XA 4KK9D 2PETA 4MJ6A 4XE0A 3FT4A 1ZPLA 1MIEL 3RAJL 3VO0A 2X89A 2PPEA 1SN5A 1F4WH 2XVKA 1IQDA 2O5XH 2QADD 2FJFA 1WFJA 2CDFB 4LKCA 4MA1C 4X80H 3ZKMD 1Z9PA 4CKQA 4X99B 4S10A 4R8WH 4J4PC 5AUMA 5BZWB 4AC4A 4ZTPL 4HQQL 1MFNA 4AOFA 4GIOA 4XCFL 1IEBA 3BRDA 1LGVA 5ILTL 4M5YL 3H2QA 5A2JH 1JNHB 3QJZA 3D39E 4LMQE 1JNLH 4CUCA 1JPGB 3FZUD 1SNRA 4N2FA 4U1GB 4KDWA 1FVCB 4NO0A 3U48A 4PLNC 1E4XI 3FOLA 4WU7A 3T2NL 4UDTA 1YNKL 3G5YA 4KJYB 2J73A 3T65A 1OSZB 2ESVA 3PLYA 1JV2A 4L4TB 5C0RL 1LE9A 2VSKB 1UZ8B 3L9RB 2PTVA 4G8GB 2XN9A 1NFDE 4PCYA 4TXVB 5FUOL 1Y6KR 1CI5A 3Q8FA 3L1EA 4GAAA 2VGLM 4XMWA 5L8LB 5DVOA 1J48A 1JWMA 1W2KT 3GQFA 4X5RA 1PAZA 2NY6C 4TLKA 5ECJE 2YSSB 1BXUA 4XNQB 2J1ZA 2JNZA 5B22A 3NIFB 1UASA 4BEIA 2Q87A 4MJIB 1KN4H 3CXHJ 4WZ9A 5GISL 1VGKB 4L1HA 1LK3L 2X9YA 4JZJC 3Q43A 1RIUH 4GKSB 1BXAA 4P9ML 2R2HA 1S7QB 1HQ4B 3NJVA 1GW6A 1SVZA 4BFGA 1LJMA 1Z5YD 2VRAA 3KWWB 1A1OB 1DSFL 5KBKA 2XTLA 3EF7A 3SSGA 1JZHA 5FUCC 4MMXC 5IW6A 1GYCA 5TDPA 2C7UB 3HEIB 3HS0A 1CLZL 2V5MA 1R3HB 3ARDD 2WAQA 3BUIA 3H7LA 4OGQC