2JKNA

Drae adhesin in complex with chloramphenicol succinate (trigonal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A structural study of the interaction between the Dr haemagglutinin DraE and derivatives of chloramphenicol.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 28
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jknA00
2JKLA 2VERA 2JKJA 2W5PA 1USQA 2IXQB 1USZA 2JKNA 2BCMA 1RXLA 1UT2A 1UT1A
chains in the Genus database with same CATH superfamily
3AG4B 4UU9B 4U2YA 5GGVL 1JTOA 1SF3A 3LNIA 4QT5A 5TE4L 5KG9B 1J7VR 3FRPA 1GS6X 3K2UH 4PN6A 2X4NA 1W9XA 4FMKA 1OAXH 2DI9A 1OZTG 3BEWA 3FHAA 3JWNH 2YRPA 3JV5A 5L2KA 1QSFB 4F7MA 3FO0H 2IWKA 3QHFL 3BIKA 5INCB 3UBGA 2CAKA 5I6OA 4P2QE 1I1YB 5EUOA 5JHDB 4UILH 4N9GA 4E9YA 5B38A 3SGJA 1Y0LB 3EJYC 5T3XD 1TO4A 4RA0C 4WSKA 2R4RL 2B4CC 1Q9KA 3UG3A 1YA5A 1MHHA 3LXUX 1EUTA 3OWEA 4PGEA 3A24A 4AQEA 3D8MA 3GNMH 5IMLB 3AU1A 4MJ6B 1EANA 2WQXA 2KQNA 5ERWA 1MXDA 3K0YA 1GGTA 1SYVA 1RPKA 3OAYH 4XOAA 3QXDA 1RHHA 3M1BA 5E6IC 3MRLA 3CC5B 4GRLD 4RA3A 5MP6H 2OMTB 1SNRA 1K6QL 2CR6A 2VZSA 3VI3A 3US1A 5HHOD 3FFCB 4LDOB 3EFDH 3U2SB 3UTSB 1VPOH 3FB6B 2YEZB 4UTAA 5BRQA 4OJYA 4LQFL 2YD6A 1S7TB 4WHTA 3O8XD 4XX1E 3VMPA 5ETUB 1OT1A 2YD1A 2JKTM 5CCKH 1ONQB 2GITA 4Z0BH 4YGVB 2Q86A 4D8PB 4LQ1A 3II3A 1ZLUK 3FUKA 5CAYB 1DLFH 1TETH 1E4XI 1N67A 3SKJH 2O5YH 1KIRB 4TN9A 3WKYA 4B0MM 4X5QA 3MXWL 3WO4C 3FZUD 1B0GA 5BRZB 2LV4A 4Z0XA 3WJLA 5D1ZD 1A7RL 3C09B 3CFIC 1DBBH 5F93C 4H40A 4ZS7L 3WJJC 2Y1ZA 2XV6B 1LEKA 1T3FA 3HR5B 2F7IA 1P1VA 1PF3A 3HUJA 3FUMA 3FTGB 1T4KA 3OKOA 3E8UL 4PEEA 3IT8D 4KQ4L 4EE2A 5I6XB 1ZLWH 1H6EA 1IGMH 1FH5H 1DJSA 1QRNB 3ULUH 3SGKA 5J89A 4LRIA 3TS8A 5C0GA 1A9BA 1H9VA 1OT2A 5D2NE 1W15A 2BCKB 2BNRD 2HJLB 2N0KA 5L88H 2YJLA 4GFXA 1WISA 3HJ0A 4XO5A 4YUEL 5GS0D 2WXLA 2DICA 4JJHA 1I3GH 2E5EA 1EVUA 1F02I 2DL2A 3RGVA 2A6DA 1AD9B 4PWEA 2JKRM 4GSUA 1X5XA 4V1DB 1ET5A 5JQ6H 1KFAL 4GKSB 5J8OA 1I1FB 1FP5A 4I7ZC 1MRCL 1Q9OB 3H8NA 4HIPA 1J1XH 3H6JA 4HUKB 2QT6A 2QHLA 2DDQL 1UOVA 4LNRB 5TF0A 5C0EB 3HI6L 4NN6B 1MJJB 4OBRA 1VJSA 3VTMA 4CJ0A 1UM6L 4P4KA 4FG4A 3HKFA 3L7EA 2W0KA 1X7SA 2Q8BH 3IJYA 4B9JA 4AYBA 1EZVX 3Q9QA 4FI6A 1PQZA 3NCYP 4UNIA 2ZKYA 5JIKA 4TSAL 3VFWA 1IGFL 1IM3D 4I5BB 3GGWA 5FLUA 3O6ML 4PJ5E 2VISA 3H3PL 3PHOB 5DS1A 3RWFB 3KLKA 3N6YA 2FDBP 4NZDA 5SWSA 5FR3A 4PLKD 1GMIA 3EOAA 5LAXA 2EIZA 4Z7OF 5DHVH 3MROA 3M1OA 2D4FA 4NAQA 1UKQA 3CPUA 1KTBA 2CK0H 4HDIB 4IRZA 4OQTH 1HSAB 3NH7L 1LHZA 6FABL 3W0WB 5C0JA 3P0VL 3W2DL 1CIDA 5HJDA 3NPZB 3SPJA 1U95B 1T83C 3AS3A 4A7GF 5CSBA 4LT7A 4Y2DD 5IBUG 4YHLL 4QRPB 4Q0XH 5IMMB 1NAKL 2X44D 2PW1B 4L48A 2E8ZA 1SM3L 1YN6A 4MJJA 4PJ9D 3C09C 4N2KA 1LK3H 2H2SD 4YSDA 1CXEA 1EO5A 1K8IB 2HUHA 2BNUA 2R4SH 1CFTA 4NB7A 5IROC 4PRNA 4XN5A 2NMSA 3LMJH 2FGZA 3WY4A 1JZ4A 1BAFL 4PY8J 5CHNB 5I6XC 2DJUA 2EVIA 2DYRB 1HYRC 1HZHH 2FWLB 4ZTPL 4BWWA 4RLDA 3ZK0A 3QQDA 1MFEH 3VXNA 4YVUA 1BXAA 2K6WA 2QMJA 4JDEB 5HYEA 4OD1L 4MNQA 4Y5VB 1IFHH 3WLWD 2DLIA 3AQDA 1NANI 1R5VB 4MXVF 3VXSE 5D5MA 5C09E 3SPGA 4PJAF 1WE5A 4U3SA 5LG1A 5I1AB 3RP1A 1N64L 3MRCB 3UTTE 4PLOB 1C5CL 3QR1A 3FW6A 1PZDA 4EBQH 1AZBA 5ANME 3ZKMD 4TOYL 1T04A 4GYBA 2R2BB 4LCIH 2VSKB 2ZP9A 4KKBD 1XH3B 3JV4A 4CU7A 1YNKL 4YIQB 4AUUA 3APFA 2CGRH 2YPKB 3DMMD 4NN6C 3V5DA 2DQUH 1R17A 2GVYA 3HZYB 1TKWA 4L3ED 1AGFB 5BZDA 1PJWA 4YGAB 3FQUB 3NSJA 1T0MB 4L0YA 5EU5A 4F7CA 1E5YA 1ZEAH 2VDNB 2PPCA 1CL7I 1L9OA 2RMNA 4W9LC 3FFDB 4JS7A 3IJEB 4F15B 4NC1C 2Z91A 3KS0J 4E0RA 2B4CH 3VW3H 5FYKE 3MYZA 3VXME 3WKNA 1DQVA 1MFCL 3DX9A 4OFQA 5DK2A 1R3IH 4P57A 3ZIMA 2VDOL 4LOFA 5TDNA 1J0YA 2EDEA 4AV4A 1NGYA 2OYMA 2DM4A 3LPPA 5HYJB 5PCYA 3FJTA 3GBLA 5EBLA 3HPJA 4Z7OB 5CJXC 1E9QB 2VN3A 2MIZA 3OG6B 1NCBL 1ZD6A 2O6DA 3RHWK 1FFNA 4NSKB 3V0WH 2Y7QA 4KTDL 4PLNC 4DESA 1H8OA 3CDYA 2BFGA 2DQIH 1RZJC 2WSDA 3M46A 3QI9B 4AJYV 4N0FA 3MLRH 3K2UL 4KJYA 4OLWH 1OAXL 3JUYA 2HB0A 4N0UB 4YDLB 2LLLA 3FO0L 2WXNA 5AOMA 1MCIA 1NWOA 5TE6H 1DVQA 2J72A 4UILL 4BKSC 1HEZA 5JUEH 4LLMA 2APVA 4EEEA 3NIFE 4XTRC 3IVKB 1O75A 3RY6C 4NWTH 4QRUA 2VR3A 3BPOC 2GJZB 5AL8A 5KWYC 3QFDB 2Y1VA 1N8ZA 3CZLA 2C9SA 3GNML 1IL1B 2EYRA 2ZWYA 5KSUA 4DP2X 4GNKB 4ZMZA 1RJZA 2Z7ZA 4JO8A 3WOVA 4JREC 5EF0A 5DSCA 3CXHK 3TNNA 1TO5A 5GISH 1PX4A 4KK9C 1KB5H 5MP6L 4Y5VC 2H1XA 5HSFA 2DH2A 3TBVB 1P9MC 4N2BA 3EFDL 1VPOL 1C08A 3C60B 4Q9QH 5C70A 1P2CB 4YXKH 3TNMB 4PJAB 4MA1B 2RALA 4Z78B 5ABZA 2J21A 5CCKL 4Z0BL 2G5BA 3BZ4B 5IVZB 2VM4A 3BMVA 1BW8A 5F88A 2V2WA 2NCEA 3MLTB 5AVZB 1DLFL 1TETL 2AF2A 3DXAD 2X05A 2O5YL 3SKJL 3T4YA 1CD0A 2YWYA 1KCWA 3FTZA 5GS3A 3FQWA 4BXVA 4Y16B 1DBBL 4NRZA 5EA0H 2B77A 3NZ8A 3EJZD 2I24N 3AGVA 2AC0A 4YH6A 3FT2A 3HLAB 4NT6B 5GPRA 3DJSA 3S3JA 1W0VB 3RVTC 2X3AA 3VFSB 3ZJAA 2ERJB 4KKLC 3GSXB 1I8MA 1IGML 2WWMC 1NKGA 4GAGH 1FH5L 5I8EA 3ULUL 2WO4A 4J3BA 1T1XB 1AGBA 1B3IA 1NM4A 5I6LA 2JJTC 4Y5YA 4JG0H 5L88L 3STZA 4O2FA 2XN9A 1MHEB 3QW9A 4QRTB 1XF5A 4S1RH 3TU6A 4XAKE 1I3GL 1LWRA 3DGDA 2Y69B 3UZQA 2WSKA 4YJZL 2CM6A 1PKQB 3QI9C 4EDXB 5ISZD 2VCOA 4JFQA 2YAHA 4PTUA 4RSVA 3HZMB 4WWKD 5JQ6L 3ULSB 5JZ7D 4OCRH 1UWGH 2UWEF 4TPRH 4UIKH 4YDLC 1J1XL 5BXFA 5JNYA 3G08B 3QZWG 1T7ZA 5CZXC 4Y8DC 4EI6A 4KROD 3Q01A 3RBGA 3DGGB 1MVUA 3OR7B 4LASH 2QGCA 2QFPA 2O6FA 3QUZC 4IS6B 4OCSH 5DMYA 2GBAA 1RI8A 2R9HC 3HB3D 2Q8BL 5DYFA 2WBXA 3V6FB 4R9HA 3KS0H 4I3GA 3ROOA 2A9CA 4ZYKA 1HHHB 1I4FA 2AQPA 1YN7B 3U0TA 1TZIB 3LKPB 5A3ID 4R4FH 1WZLA 4XO4A 5IVOA 5AW8B 2GJJA 1E30A 2AVFA 4CVXA 1BJ8A 4LDLB 2PW2B 4NS0A 3RWJB 4WRLA 4DJMA 1E8XA 1FV1A 4Y2LA 2LVEA 5FECB 3R8QA 4RWHA 4JFDE 1JPTH 4UV7H 1Z7JA 3QZWA 3S36X 2XWRA 1P53A 4YBQC 4QR7A 5I17A 3AZUA 3I75A 2CK0L 1M57B 3MV11 4U6HB 1BVNP 1Q8MA 4OQTL 4CW1A 4QLWA 1O6SB 4OF8A 3FB5A 1JHTA 3MV8B 2VN5A 3AMLA 1SVZA 2ZYIA 4Q0XL 3DHMA 2EUVA 1NGZB 5CMAB 1AR1D 2BSDA 2HFTA 4NC0B 3PQYA 1IKFH 4DEPB 3N50A 2Y7OA 1LK3L 1N68A 3PV6B 1OSZA 2O5ZH 3C2SA 5JW3H 1EV2E 1VEOA 2QJDA 2XXFA 4MZRA 2R4SL 1ETJA 2APBA 2VW4A 2J1WA 4JKNA 2NR6A 3FO9A 3LMJL 2E3VA 2EKJA 3PRZA 1WFNA 2VXQH 1E50A 2EDQA 4X6EB 3EFOA 1D5ZA 1F1GA 1IBGH 3HFFA 3QAQA 3I6GA 1WHOA 4D0DA 1WBZB 2IQAA 4X5LA 1MFEL 3CX5J 1VEPA 4OAWB 4MAUH 1J1OH 5CD3B 3T77A 2Z35B 1IFHL 2HJFA 3BAEH 3JZ7A 4LCCB 3JVGC 1NBVH 3L13A 3DPBB 2EEBA 4Y1AB 3GRGA 3DVFA 1X9QA 1L0YA 1AKJA 5EU4A 3W1ZA 4EBQL 5GSRA 1RZJH 4DW2H 4TM9A 5I16A 3WIIH 4LCIL 1UCBH 3ME0B 3EOTH 2UWEB 4QRQB 4G1MA 5D7JB 2CGRL 5I73B 1H9DA 3NCMA 5AVXB 2DQUL 2AZAA 3PWLB 4OLVH 1FZJB 1PAMA 2CH8A 3TCLB 5AW7B 3WFBH 5JLZB 3X1BA 4D2NA 5CN3A 1ZEAL 4K5OA 2I7OA 2CUIA 4NYLA 1G9NC 1HINH 5IHUH 1GOGA 2C3VB 2B4CL 3VW3L 3LNDA 1N2RB 4R2GB 1M71B 2ATKB 5TTRA 1R3IL 1WBXB 3QEHA 2VUYA 1BEXA 2X28A 1LP9E 4UZGA 5F72S 2H6OA 4IMLB 2CO1A 2WD0A 3ZYZA 4F8QA 1IT9H 3MLZH 1E3FA 1U8LB 3GSNA 1OP9A 2WXMA 3LRSB 2CIKB 1RL1A 4GPVA 2BMKA 2NNAA 4A2GA 4LBEB 3V0WL 4GI6A 1BLNB 5BCAA 1FVDB 1QPPA 1E3ZA 1C1EH 1YMME 2CK2A 2F54E 2ZYSA 2DQIL 3DHJA 3F6JA 1KIUB 2P8MA 3MKKA 3TPUA 3MLRL 2MCPH 2GKIA 1SXSA 1I7RA 2ADIB 4P5TA 3RILA 4OLWL 4PJGE 1BD2B 3D51A 3ZE1F 4PJXA 4ZPTA 3MV9E 3TA3B 5SWZD 4N0RA 4DEPC 3HE7A 5DJ6B 1PMYA 4AZUA 5TE6L 2XOTA 4EN3B 1E27B 4HCRH 5JUEL 4A67A 1FUNA 1HZLA 4NWTL 4ZOCA 2JIXA 1U8IB 1G6VK 2GTWB 2QVTA 1VKXA 1WEJH 2UY7A 2VDNH 4HGWA 4APQB 1JD9A 3WXWH 4Z7UF 12E8H 3PWPB 5I5RA 1GCFA 4PI2A 4J4PA 4U1LA 3PJLA 2VR9A 3R7QA 2B59B 4RX4D 5D1QE 1K8DA 4RAHA 1GS8A 3HC3H 5GISL 1OP5K 3O6KH 3RJOA 2P52A 1IAII 1KB5L 4X9IA 4R96B 3GHBH 4QOKD 3QZLA 3SDXA 1M4KA 4RDQF 4NQVA 5LCVH 2CDEA 4D9LH 1TZHB 5J1AB 1IAOA 1XFPA 4Q9QL 4YXKL 1FVEB 1G7IB 2E47A 1K4DB 1IGTB 2C26A 1INQB 4K2UH 4MD5A 2K6YA 5AW0B 4BHUA 3EBHA 1NJ9A 1GA2A 3KPPA 1U8NA 1YC8A 3KLDA 4HPOH 4KKAC 5MEOB 3BZDA 1ITBB 3MNWB 1IEHA 3PUCA 5D7JC 4E41B 1MUJA 1UH4A 5DTFA 3AB0B 3TO2B 2OQJB 3V6ZA 2XPGA 1ZSHA 2IOIA 3NJVA 5DUJA 3BZFA 3EBIA 4JPIA 4YDIH 4ONHA 3BWAB 2X10A 5FYLD 2Z4QA 5EA0L 4LPXA 4S2SB 4TSCH 4W9KC 4BH8B 4BE5A 1AQMA 1IGCH 3M17B 1RERA 2UZXB 4NLAA 4O00A 4UBDC 5DMKA 5FO7A 1U8KA 4WK0B 2ZJSH 3H7BB 1OF0A 3N44B 1QO3B 3K3QA 2GJ6B 5F9JB 3QRLA 5AYUH 1WDAA 3EDEA 5HYQB 1UKSA 3II1A 1N3NA 2NY5C 4GAGL 3MRMB 3CFEB 2K8MA 1QSZA 1QI3A 1TYJA 5KVMC 3IKCB 5LXVA 4Y4FD 4X9GA 4M3KB 5AVTB 2CCLA 1JK9A 2OULB 3MRKA 4JG0L 2V3FA 3VFPB 4S1RL 2XBTA 3D4ZA 5HI3D 3C6SB 1WGVA 3CVHB 2DTMH 1UACH 3GUTB 2PCPB 4KRPB 4X7TA 1R3JB 3VD2A 4HCGA 3OLEA 3GJEB 1RLBA 1RK0A 4OCRL 4OKDA 1UWGL 4DWHA 4TPRL 4UIKL 5L4IA 4OZGE 5T1LA 2WANA 2ICES 3ZE1B 2ALWA 3TA3C 1ITCA 4KK5C 2LFEA 1RPUA 2V9RA 3TBBA 3TZVA 1ZT1A 1IC7H 3QORA 2HX8A 4AV5A 1TSRA 2Z8SA 4LASL 2CR0A 1XH2A 4HC1A 4EN3C 1GKOA 4YVNA 5C0NC 4OCSL 4O2CB 3V9EA 3M1CA 4U4IA 4X2UA 1FFOB 2EXYD 1HC1A 3BRDA 3LNGA 5J1TC 1HHIB 4JJOA 2K8QA 4OJAA 3BKMH 5CP3A 4YN3A 3UEQA 1PIGA 4BUQA 3HKZA 4R4FL 4IRSB 5MI0B 2F53A 2AV7A 4Z7UB 3VXUE 4ADGA 4F93B 2QKIA 3WAKA 5HTSA 5J12C 5LNEA 3ORJA 4G8GA 3TPKA 4QYOA 4W6XB 4DO5A 1BREA 2P80D 1EJOH 5KZCB 1JPTL 3MLVH 4UV7L 4NN5B 3O4LB 4GAAA 3T65A 4XNMB 2OL3A 3FUNA 4BA0A 3S9DB 1G4RA 2IBZY 4CVZB 2A6KA 2X12A 4RAVB 3LSOB 4UOW0 1BQUA 2F19H 3RPKA 5ANMA 1EEUA 3HR6A 3VFTA 1Z9SA 5ESVB 4MA7H 1AGEA 3QJHB 5D6CB 4ZW5A 1ZOXA 4I85A 1T5KA 2HN7A 3QUXC 4OZFG 4ZSOE 2AJXH 3LPFA 2YBRB 2Q7YB 3AB0C 2YD0A 1MFDH 4UM9A 1IKFL 3V6OC 1J5IA 2FT6A 5DEZA 1ZJAA 4WJ5A 3R1GL 4K5PA 4WHYG 5D7IF 2O5ZL 1SHMA 5JW3L 3QXUA 3GMLB 1DZ0A 2ID5A 1B4LA 3NA9H 2WVVA 5FHBH 2RR3A 1CFSA 4FADA 1G9NH 4FDWA 4QRRE 2ORBH 2VXQL 3VXMA 2BOLA 2VLJE 4MAYC 1SFDA 1FORH 1IBGL 3L3DA 4WU5B 1LM8V 1DO5A 3KLSA 3N1GC 3RNKA 4JY6B 1VACA 2BH0A 3N2JA 1UZ8B 4I4WA 3MRJB 3D30A 4ZNCD 5L0QB 4MAUL 2XU9A 1J1OL 3WEBA 4C56D 1DEEA 2TRYA 5C97A 2VO8A 4OZFA 4JKKA 2ADGB 3BAEL 2G2PA 3VWKB 5EF2A 1JBJA 4QXUH 2WOBA 2ZX7A 4U1GB 1NBVL 2QZ5A 2LGNA 3F7VB 2QADD 2XFXB 3F12A 4U7MA 3P11H 1ZXKA 43CAB 4KRPC 3UTZA 3WS3A 4MNGE 4CVWA 6PCYA 2J1XA 4FFWC 1RZJL 3T71A 2JKSA 4DW2L 1QW8A 4EDWH 2IJ0C 3D0VB 3WIIL 5KAQG 1UCBL 3IM1A 3FH5A 3PIQA 3EOTL 1DLHB 2F08A 4L4VA 4NN7C 4OZHA 2XN0A 3QDGD 1Z5HA 2X4OA 5LQBH 2AMUA 4F2MB 1QSEB 2RFXA 5I2IA 4OLVL 5EPMB 1XD1A 2BSTA 3SYPA 2UY6B 3HRZC 2A6IB 4DPCX 2L7EA 5DO2C 1SOKA 5FOBB 2XXCB 3WFBL 3V0DA 2L3BA 4HD9A 3HNSH 2FECL 1HINL 2JJWA 5IHUL 4RGNB 5HD8D 1H19A 4F7KA 3EADA 2AEQH 4GSQA 1J18A 4OKVA 3EGXA 3TYGH 4TNVF 2X88A 4PJ7A 3ECBA 3VTTA 4NIYE 3ECVA 3WHXB 2B9BA 4AC2A 1B6DA 4UOZA 1IT9L 3MLZL 2CJ3A 1KPVB 4FN0A 4JZJA 4FFZA 4XP1H 3LS4H 4GAYB 5I5JA 1Z5YD 3KPMA 2UX6A 4QGYA 5C3IA 1C1EL 1SYSA 3RGBA 1F6AA 4CC4C 5KS9E 2MCPL 4O2EA 5AW1B 3PFUA 3S36H 3CDFA 4X9HA 4XNQA 1D5IH 2FO1A 5F7UA 3CVCA 2QFRA 5KBKA 4ETYA 4RIRA 5E8EA 3A21A 1E8YA 4DK3A 4KZCA 1IQDA 4N1EA 3US0A 2GCYA 5D7IB 4HCRL 2XXGA 1WA1X 3GKWH 5I82A 3G5YA 1KGCE 1YDPA 4M62H 4FNPA 5KSAA 3MBEB 1UXSB 4FMVA 4P06A 1WEJL 2VDNL 4MQTB 2QR0B 3Q9PA 4U0QB 4DP1X 5LNDA 4DUVA 2Y36H 3MTRA 5F6HI 3WXWL 12E8L 1GGYA 5KYUA 5G4MA 4TQHA 1A66A 1R33A 2FZ3B 3Q2CA 5KYNA 2PPDA 5I1DA 4AJ0A 5JIMA 2AABH 2P48B 3VRIA 3ZZLA 4DP5X 3HC3L 2NY5H 1YUHB 3O6KL 5L0QC 4PVBA 4TQPA 3GHBL 2A99A 2BSSA 3VWKC 2NTFA 2YOCA 4ZMPA 1DQLH 2VDPB 3O2WH 1KPUA 4U1GC 1V3MA 5LCVL 4D9LL 2E75C 2I69A 1QOKA 1BSIA 2NOYA 3P3RA 4K2UL 4GO9A 5LDSA 4L8DB 4FKEA 5F6IB 4NEHB 4NOBA 3NTCH 2GABA 3DBXB 5L8LB 4HPOL 5DEFA 1WWWX 1OGPA 1P1ZA 5IG7A 5DK3A 3V6BR 5DJ2A 2IH3B 2PCFA 2WMPB 4FYSA 4U7SA 4F33B 5IW6A 3B2VH 4YDIL 3ARGC 3WIAA 3X2QB 2KC0A 3SN6N 2VH5H 3RHWF 4JO1H 1WFUA 4GB9A 2E86A 3MGTB 3GI8H 2ZQKA 3AY4A 4TSCL 5C2UB 1UCTA 1IGCL 4HLJA 4AYGA 3U4BH 2ZJSL 5AEAA 1FYHB 1S9YA 4QYAA 1HAWA 4M1CC 1CT8B 1D7FA 3CV5A 5G5DA 1PZUB 5AYUL 2Y7NA 1FVCB 4C47A 4LLYB 2ZOLB 4WO4C 4OIBA 4ZFOA 1PDKA 4HU8A 1P7HL 1TJMA 3VRLF 3EO1A 4K4KA 3K1DA 2G9HA 2WBJB 4MA8H 1RZFH 3GLAA 5E4EB 2VERN 4QKXB 3W11D 1CICC 5D7LE 3HG4A 2DTML 3U1SH 1UACL 3VX0A 4PWFA 3MV7E 4HJ0D 5BUPA 5DJ8A 2ODHA 1OGAE 4MB4A 3WIHA 1YC7A 1K4CB 3TJEH 5IQ9A 5HHPA 1GGCH 1T1ZB 4AMKH 4PYHA 1NANH 1DSYA 3IDJB 3L4CA 5JHMA 3KPOA 1IC7L 1ZLDA 2ZP0T 2ODIA 1GW0A 2J8UE 4FQLH 1DJWA 1NDTA 4PYGA 2E7LA 3ASOB 3HPLB 1G0DA 3O3EB 3MBEC 3NN8B 4CNIB 3GSWA 4LVHC 1OM3H 2PYFB 1WWCA 2Y23A 3BKML 2C7UB 3KPSE 5AVYB 3QDJB 4CMMB 4M7ZB 2P5WD 1WAAA 3Q8CA 1IGJB 4Q6YA 4DEWA 4BYHA 1I8IB 3ZGHA 2FBJH 4OV5A 3V0VA 4R5VA 1ADQH 5IB1A 1EJOL 3DJZA 2EDKA 4JQXC 2H7WA 1ZS2A 4YC2C 5TK4A 1QASA 3MLVL 1CL7H 3UX9B 1DFBH 2WKGA 2CLZB 4JQIH 3TH3T 4OCYH 3RJDA 4X8GA 4JDZA 3OKKA 4JHWH 4Y2DA 1WS8A 5ID0B 3MNVA 4OY9A 1PG7W 2F19L 2BXYA 3BKJH 5FM5O 3SJVE 2ICCA 5DJ0A 4MA7L 3WFDH 2OK0H 3KWUA 3G5XB 3L3IA 3UPRA 3CC1A 3KCWA 3FBKA 5HI4C 5T5FH 3ZKND 4ANUA 2AJXL 1MI5D 3OKDA 2WTPA 1XF2A 2WC7A 4D7PA 2W60B 4HHAB 3FRUB 1YECH 3FQ2A 3VNZA 3L3GA 3WL9A 2QQNH 4XMXA 5DCCA 2AQRA 4AQZA 3EYOA 5B1KA 3NA9L 3O6FB 3PL6D 5FHBL 4QAWA 1EBPA 2DQJH 4PJ5D 5GRWA 1A1NB 2BVQB 3RTQA 1G9NL 3VFVA 4AC4A 2ORBL 4GW5A 4XE0A 5B38B 3PYCA 1QHOA 1RLWA 2P8LA 1FORL 3US9A 5BS0E 5ICZA 1LP9A 4L4TD 1MHHB 4PGEB 3D08A 4MVBC 5DVKA 4AQEB 3BKCH 3AU1B 5DHMC 3DTDA 4UYQA 3TEUA 1KEMH 3IFOA 1SYVB 2XKUA 4AXWB 2C9RA 5IHLB 1OAJA 2AK4D 4JPKH 4KO5A 1IBZA 2DMHA 2WBJC 3FQ1A 3M1BB 1H3WM 4QXUL 4R4BA 1ZHNB 3SKNA 4MJIE 5EU7C 2JJVA 1LEGA 2JJSA 1T0NB 5HY9A 3P11L 3P4MB 1MQ8A 3KJ4B 2M83A 2GFBA 4X9BA 2NPLX 1XR9B 4MJ4A 4L1TA 2ZX6A 3DSFH 4EDWL 4GY4A 4WHTB 4Z7AA 2Q2EB 2X7LA 3ATFA 1AQDB 3I84A 5AL0A 2JLPA 5GS1B 4N25A 3BGMA 1HSBA 4JFFB 5LQBL 1KGJA 2YEVB 4RSYA 2VZ3A 4J23A 2CIIA 1E5AA 3OJDB 3PF2A 3NSYA 4Q74A 1WV7T 1AHMA 1NFDE 1ZGLP 1E67A 4N22A 4QGTA 1V5JA 3L9BA 1U2YA 5B39G 4NKOB 4IYKA 3HNSL 4IOSD 2V2TA 4OLZH 2IFGA 1KXQE 2MQ3A 3DA0A 3EYUH 5I18H 2Q10A 1CXLA 4M7ZC 1T3FB 2AEQL 3RYMA 3TYGL 4OGQC 3DROA 3UC0H 4FTVB 4WIQA 2F8XC 4YSSA 4G70B 3CX2A 4KUZH 2YGVA 2WINB 3AG1B 3VXSD 4WU7B 3FUJA 5C09D 5HVHC 4GG6A 4JRYA 4J1UB 4G42B 4L37B 1X5HA 3LEXA 4TUJA 4XP1L 3U6XS 1IZJA 4TL4A 2Y7LA 5DJZB 3LS4L 3B43A 1YEIH 2VXVH 2YAEA 3TIEB 1ID2A 1ID5I 4JM2F 2VQ1A 3B7SA 4P2RB 4MMYB 5B39A 4U1MB 1ORSB 4HAKA 2L7JA 2WNXA 3GXFA 4Y4HA 3S36L 5I1HH 1D5XA 4MMZB 4NKIL 3GMPA 2A0LC 2PP9A 2BSRB 3OKNB 2YSSA 4M03A 4WNSA 2CMRH 3T3PE 2P9RA 1JNLH 2YA2A 4KI5E 3SY0A 2XA3A 3GKWL 1UJ3A 3MMEB 4NDMA 3GB7B 4ABVA 5FYKD 3O6FC 3ES6A 4M62L 5SV4A 1G7HB 3SE4A 1JTPA 4FXGC 3L7EB 5DEJA 3LQMA 2Y36L 4JNXA 3QCTH 2X70A 4LNVA 3V4UH 2COQA 3ZHLA 1L3NA 1JV5B 1T89A 4UZUA 4IDJH 1PX3A 2AABL 3VFWB 3BT2H 2NY5L 5E6RB 2CLRB 3K91A 1BMZA 2VISB 2R15A 3AS0A 4DCQB 5K9OA 1DQLL 3O2WL 3PGFH 5SWSB 2NY2D 1NFAA 4H7VA 4PY7A 4YHPA 2DQFA 4P07A 3Q8BA 4U3XA 3MROB 3KJ4C 4UUJA 4HD5A 1M6UA 1AS7A 4RZCA 2NX5B 1AOHA 1ZA6A 4ANVA 4YX2H 5DYOA 5CFHA 2EDXA 4BH7A 3NTCL 2H45A 1T7YA 3LZNA 3EDJA 2AV1A 1Q9LA 4NENB 3RUGF 1LO3H 4R4ND 3HE6C 1TMQA 2AJ3B 1WZMA 2GIYA 4DP9X 1HTYA 3B2VL 1S9XA 2JXMB 4L9LA 1TPXB 4IU3B 4WDIB 5TQ0H 1ICTA 2VH5L 4JO1L 4PJIE 1SMOA 1DYZA 2N01B 4JFEE 3WSQH 3GI8L 1K5NA 5B1JC 4IQHA 3QG6A 15C8H 1YQ2A 2FH8A 3SOBH 2VRKA 3ILPA 3RDTA 4D9QE 3U4BL 3GTNA 5KVGE 1O5PA 1DVFA 3VYPA 1O9ZA 4Z7VE 3QEQB 5ID1A 4YDVA 5IREA 3VXUA 3PWNA 3RWIB 4PRNB 4TNWK 3VFUB 1TTFA 4ELMA 1G0YR 5C1MB 2V33A 4HCIA 1EUUA 3BD4A 4NKDA 1PEWA 5D4QA 3ROLB 2KZ1B 3WBDA 2APXA 3D87B 1HWWA 4M5YH 5CLZA 1BOGB 1Y07A 5FF6B 3CK0H 2CO3A 5A2BA 5CM1A 4G8FB 5DZOA 3DSNA 4MA8L 1RZFL 4NQQA 3ZKQD 2PN5A 4X4KA 4Z76A 5DD6A 2QLVB 4N1HB 3U1SL 4Q2ZB 5BVJA 3L9EA 3MLSH 4JM2B 5KSVA 5FS5A 3VD0A 4PGJA 3CSPA 3TJEL 1T22A 2PYEE 4MMZC 4WV1A 25C8H 1GGCL 2F61A 2OMWA 4R97C 4NZFA 4AMKL 1RKRA 2AAVA 2B8OT 1PNDA 3PGDA 1ZS8A 1P6WA 3MUHL 3EDDA 3FU5A 3CXHJ 4JVPA 2VITA 4FQLL 1RJLA 5IK3B 2YGPA 5C0AE 3MRPA 5CSGA 4LARH 2EC9T 4JFXA 4WI7A 4HFWB 1OM3L 3WKPA 5FW8A 4YR6B 4KY2A 3KPQB 2AZUA 3IDNA 4LVOB 4BINA 4KK6C 5BVPH 3BP6A 3PNWA 1HI6B 2R83A 4HLEA 1BFSA 3UIZA 2AGJH 2FBJL 3L9RA 2ATAA 4HMEA 2J12B 2XQBH 5C08A 1MVYA 2H32A 1ADQL 1JGEB 3M07A 2VC2B 4XAKD 4HHWA 1W72A 1TU2B 2FAUA 5TDNB 1CL7L 4Y1SA 1HYSC 5KSBA 1DFBL 3BPCA 4BZYA 1TCRA 4L18A 1GL4B 2KZBA 1PBYA 3E8VA 4JQIL 4OCYL 4AYFA 1U58B 5T33H 4JHWL 5E8NB 3ARRA 4MNGA 2Y1YA 4EOWH 1FFNB 1MF2H 5GRYA 1ZCRA 2XZQH 1NGQH 3QR0A 3F04A 2Z31D 4C4KO 3WFDL 2OK0L 2JVUA 5C0FB 4R5XA 3KCPA 5T5FL 5AAMC 2WJ7A 5JOPE 3RUGB 3DUSA 1J8HE 3ARQA 4N90D 3HG5A 3NCFB 2G5RA 1S4IA 1TPXC 1YECL 4ZRGA 2IGTA 3A47A 5C07B 5EBMA 2QQNL 1LD9A 2V2XB 4KI1A 4KTYA 1NBYA 1UT2A 2O4EA 1VGEH 2ZXDA 2VM3A 3R18A 3ZKSD 1MCDA 2X1WL 3EDKA 5E8PA 3T6WA 3C5XA 2BO0A 5E0FA 1R24A 2DQJL 3ZMRA 3OQRA 3CFQA 5IROD 1N18A 4LLMB 4NXKA 3C6LC 3D25A 3C5SA 3LQZA 1CLVA 2NY6B 3ARBC 4GLRI 3ARDA 1MCJA 2QGBA 1JK8B 1TTGA 4FD0A 1FRGH 3MUUA 4CBZA 4D8OA 2EYRB 3BKCL 2LOEA 5GZNA 1Q94B 1W0WB 5E5LA 1KEML 4Q4EA 3P2BA 4X4XA 4OZIA 2E6JA 4I2XE 4JPKL 5FUZH 1HXMA 4BJLA 3NG5A 1SEBA 3MUZ1 2F7OA 2IPUK 3AAZB 5IB2A 1CS6A 4WKZB 3RWGB 1MFMA 1KJMA 2CO6B 5KS9A 4EIZC 2UVFA 1C08B 5GGTH 1GGBH 3DSFL 4FFYA 1T7VA 1IAIH 1UB5A 4ZOBA 1QTSA 1CF1A 4FX5A 4X6FA 3H4FA 4Q58C 4Y19E 4LFHD 5JPMB 2BK8A 4X6DF 2WLIB 2WZAA 3MFFB 4F3FA 3BSZH 1AG0A 4S0TD 4TLUA 1NC4B 1T0PB 4L1DA 4QAMB 5A16B 3O3AB 3QUMA 3B6SB 3IF1A 2R69H 5EN2A 1TQSA 3ALWA 2AK1H 1U9KA 2LLNA 3C8KB 4OLZL 3PJSA 1JHKH 1XMWA 1IO4C 3EYUL 4NIKB 1UD8A 5I18L 1IRAY 4LVOC 3DTXA 4PD4K 3WAJA 1GY2A 2X09A 5KJ4A 4MA3A 3OXSB 1FFTB 3UC0L 1YEDA 3T6VA 4KUZL 1DJYA 2B39A 4YDJA 4AVJA 4XZUB 2BWDA 1A64A 3V0IA 2Z4TA 2NW3B 3P77B 4AG4H 3D50A 2IALA 2XG5A 5LXGH 3P1VA 3PWVA 3CDZB 4FNTA 4NQDD 3CUPB 3ZSSA 1YEIL 2VXVL 5ESQA 2IAMD 4O2FB 5SWZA 4R7DA 3S96A 1SRDA 3ABGA 3AXIA 3BT0A 3IJSB 4N28A 2V5TA 5I1HL 4PJCA 4U1KA 1CGVA 4GRWF 2NLJA 4HYTB 4L5FH 1UATA 3FYEB 3RNQB 3UPCA 3T4AC 1S5HA 2CKNA 2CMRL 5J13B 4MHHG 1JNLL 5GIRB 1CI3M 3OJ2C 3KZ8A 2VSDA 3ZHFA 4XTRD 3JUZA 3WG7B 2DQCH 2DI7A 5HHQA 4UDTB 4RFEA 2Y3NA 3EO0A 5CGYC 5AB2A 3FU6A 3AREB 2EDDA 2VJXA 3QCTL 4FYTA 3V4UL 4TULH 4M61A 5EU3B 4LCWE 1WD9A 4K15A 4QXWA 1MPAH 1LL1A 4IDJL 2ZKHH 2DLHA 4UQDA 4ONOA 1U8HB 3BT2L 2ZOWA 1R5IB 4JG1H 4UQEA 5K33A 5HGAA 1DBKH 4K71B 3TA4D 3KD4A 3NYKA 4J3UA 5DJDA 4HGKC 4KK9D 3HCVB 1ZDSA 1HH6B 3K2KA 1YMMD 2F54D 3PGFL 2GW5A 4L3AA 4AH2B 4BD4A 3ESOA 3QQ4B 4FG6C 3ZHKA 3DNKA 4PM1A 2WN2A 1NEZG 4PJBF 5IJKC 3QZWB 5F6HJ 3IAGC 2GSIB 4JRFA 3HG1E 5DRXA 3I75B 2AEPH 2PTTA 4YX2L 1Z2KA 5FYJU 2I9TB 4Z23A 2IPKA 1OGAA 3K7UA 1CC3A 1DN2A 1WA0X 4KZ0A 4U1JA 4O4YH 3QXAB 4IEFB 5JPMC 1LO3L 1SF5A 3U6RB 1N4XH 4ZMXA 2QZQA 3LKQB 4X6DB 4LU5H 1KBVA 3GMMA 1SMAA 3LN5A 4R8WH 1RZIB 1URLA 5HJ3A 5TQ0L 2J8UA 3VM5A 5H4YA 5CIPA 4FQXA 1HXKA 1UWXK 2ZKMX 5TD4A 3WSQL 1P4IH 2L0DA 4XXDA 3VXRE 5IVNA 1WJ3A 3IDYC 15C8L 4UF7C 2AEOA 1FNEA 4MDRA 4EIBA 2WUCH 4ZUUA 1CFQA 1NEZA 3GJFK 5E6UB 1BIIA 3FTUA 4PJ8A 2N1TE 3ARVA 1TTAA 2EXWC 4WAFA 4Y4FA 3RWHA 4KKLD 3FO9B 2VLMD 4YK4C 4LLQB 1X5ZA 3E6FB 3ESPA 4M5YL 1FYTB 2FD6H 2EYTA 3CBJB 4XC3H 2V7HB 1Y6NR 3ZDXE 2YQGA 3CK0L 3P4NB 5FCSH 3G5VB 5HDLA 2P1YA 1IM9D 2F1AA 4TS6A 2X4QA 5J3HC 3CMOH 4GIAA 4PJEA 4GO6B 3QIUB 5G4OA 3MLSL 3W57A 4AT6A 2ARJB 2X89A 4LP5A 3QDHA 1U4EA 25C8L 1CDYA 1FZOA 3F7QA 4JLRA 3AWGA 5ECJE 1IQWH 1SJEB 5KYWA 1NDMB 5CZXD 3U25A 3B9KB 3QIBD 3S48A 5BV7C 3IETA 1H5BC 1WTGT 3B37A 4FYRA 3NCXA 4N2DA 4O51B 2AKRA 1MNNA 2C1OB 1MREH 3QUZD 5GJTH 3DRTB 4LARL 3BPNC 2CHDA 1MJ8H 2GC7C 5B3JE 1BZDA 4XXCC 2VQ4A 4QLRA 1JF1B 3QP3A 2P80A 3U4KA 1I1AB 2J43A 5A2IH 1YUKB 2FJHA 4PRPE 1YMHA 1BQSA 1I82A 3AM8C 5BVPL 5A6LA 3TJPA 4J7RA 2AGJL 4HV8A 3TO4A 3QFJB 4ZMAT 3NEOA 1ZWIA 3MJWA 2XQBL 3TBYB 1BM3H 1CPUA 4YBHA 3TLRA 4KKNA 4H88H 4X42A 1KZYA 2NW2A 2X9XA 2XTJB 4M7LH 1T5XA 4RQQA 5I28A 4HUXA 2EO7A 1J9TA 4YBQD 5BZXA 2VDQH 3DOSB 5T33L 2WZ0A 4P2OB 2OSYA 3SGDI 2ED8A 4ZFFA 4EOWL 1MF2L 2XZQL 4WW2A 4LL1A 1NGQL 2PXYA 4MCZA 4MD0B 2C9XA 4Y89A 1NGWA 3Q8AA 3ZTJG 2WIMA 5MENA 2FJGB 4JFSA 5EO0B 1AD0B 1KV7A 4G8EA 3ZW3A 3EJTA 1WP6A 4D0BB 2TSAA 4ZFQA 4GUOA 3STLA 4LHJB 4PJXB 4I87A 1BBJA 4XH2B 5ESAA 3RFZB 2VZTA 1PG7X 3B7YA 5EEYA 1VGEL 3II2A 3V4VH 2OYKA 1WRFA 1PFOA 2BHZA 1S7XA 1X5JA 4XCNA 4NO0D 4XR8C 1QBBA 3D18A 1N6VA 1KDJA 4WNQA 3BW9A 1VKXB 1IBYA 2UY7B 2W0FA 5DEGA 2NUPA 1HXYA 1FRGL 4LVNB 4NKMA 4MMXB 1JPGA 1TEYA 3IDUA 3WTXA 3FFCE 3CG8A 1GYUA 1KXVA 1KACB 2VE6A 1GZQA 4KKPA 4XBPA 3K74B 3AG3B 2YPVH 4J3WA 5FUZL 4AOFA 3APNA 4PG2A 4AQAB 1IILE 1YYMH 3O11A 1CO1A 2D03H 5AALA 2HFFA 5FKPA 3QDGA 3QIUC 1JSYA 1S9WA 2BY3A 3IWUA 4NQTA 5EU6B 3ZTDC 5GGTL 3OKLA 5DQ9B 2WXHA 1IAOB 1GGBL 4ZAKA 7CGTA 4H26B 1IAIL 5D2LF 3V0GA 3ZT6A 1XWVA 4CADA 1BFOA 1M1XA 5DFVC 2X1PA 2P28B 3DHPA 5LGYA 5E6YA 3BMWA 4M8QB 2R7EB 5JXEC 4XPAH 3B9KC 3KPPB 4D7BA 1U8NB 3VQMA 3H9SA 3SB3A 3BSZL 4QHPA 3GMNA 5IBLC 4H5SA 1MY7A 4AEFA 4J39A 1JPST 1FGNH 4QRRD 2XPGB 1T4WA 4AMWA 2R69L 2VLJD 1E4KC 2WNWA 43C9B 5JW4M 2NT0A 2AK1L 3BRFA 1JHKL 4L29A 4Z7NE 1I1AC 4GXVH 4BSJA 1QRNE 3WS6A 1ES0A 2D9QB 2M26A 4BZ1H 2AQ1A 3FQTB 1S3KH 2IWGA 4ZO9A 2EE2A 5AUMA 4MS6A 1PYWB 1UXLA 4TVPH 2RQ8A 2OM5A 4WI6A 4FQHA 1U8JB 32C2B 1TQVA 2XTJC 3PGCA 2CO4A 4AG4L 1I85A 4NFBA 4ZODA 5LXGL 1CXKA 2D8KA 3WFHB 4S1DD 4V1DE 2ROXA 2OFQA 4IM8A 4P2OC 1JK9B 2P5PA 3BP5B 2P5EB 3QUHA 3EG9A 4YZFF 5CKAA 3B7UX 2ZUYA 3FO2A 3UFIA 2HP4A 3DUUB 1AP2A 2ICWI 3R4RA 4RISH 5HDBF 1R3HB 3QE5A 2E6PA 1EX0A 5C2BH 4N8VG 1KN4H 4L5FL 4W6WB 4PGZA 3ZMEA 3L17A 5CF3A 3DO7A 4HUUA 2HYMA 2DN7A 4XZ4A 2HT4C 3RFZC 4Q9BA 5G55A 3JWNG 1ZT1B 4PWKA 4WI3A 2ENQA 5GSVB 4RWYH 2DQCL 4M5TA 5DD1H 3FL7A 4X98B 3KGTA 4XCFH 4HWEH 5CEZH 1DCEA 3KWXA 4TULL 1ZIAA 5FOJA 4B9ZA 5HXMA 1DQJA 4NQEE 1S9KC 1MPAL 2CQVA 2ZKHL 4WI8A 4LVNC 4G9FA 5JW5A 4GXFA 3NPSB 4MMXC 2F53B 4JG1L 3PDDA 5JIPA 2V0AA 1DBKL 2WYTA 4KVPA 1BPVA 1A9EB 4HA1A 4WI2A 4N8VA 3X1EA 2I07B 4KGLA 4NQCD 4U05A 1GYCA 2C1PA 2VM9A 4XOEA 1E7VA 1KLFA 3ZTEA 1LO2H 5J0BA 3UXFA 1KIQA 2JCWA 3CFJA 3D39E 4QRPE 2AEPL 3U7WH 1O6TA 2A6KB 3F7YA 3GSVA 1S7VB 4XN8A 5CGBA 2MOGA 4IKJA 3OB0K 5I24A 4O4YL 3VJ6B 1URZA 3IFPA 5DK0B 3E7JA 3V8OA 4WUUE 1N4XL 1KGCD 2EO1A 1AKPA 2QPFA 2ZYHA 3V9CA 4LU5L 4HZ1A 4PJFA 4R8WL 5IB3B 2P7TB 1E4JA 1XTMA 2Y5TA 3GXUB 1W91A 5BV7H 4WFFE 3MDJA 4WJKB 3JTSA 3DX0A 5MEPB 5C0AA 1HILA 1WZKA 1P4IL 5EUKB 2ZXBA 4WJ5B 3QJZA 1P7QD 1FFPA 4UBDD 1D7CA 5EEUA 2WUCL 4PJHF 4HUCA 3TBTB 4KXZI 1D9KD 4PCYA 3G9AB 4W9EC 5CJOH 3LD8B 3HBGA 2EILB 3L3DB 1MHCA 3LEYH 4FFVD 2FD6L 4JPVH 4XC3L 5IEKB 4QY8A 4ZUTA 1VACB 3FQ4A 5C0CB 4OCLC 3BIBX 5F71A 3BO8A 3GXMA 2WZ5A 1KYUA 2IDQA 1SQ2N 3UCQA 5CEXA 3U46A 3ZZQA 3MNZB 3CMOL 4YNYA 2VLKA 4AK1A 1N5AA 2B14A 3SE3A 4C4KT 5JOFB 1T0OA 1HL9A 1SDAB 3WS3B 5HDBB 1MW0A 4LSRH 3KPLB 3L1EA 5D1XB 3TN0B 3UEZA 4ZD3H 1IQWL 3VM7A 3CPLB 2CO7B 1J8HA 4KK5D 4KNQA 3TVMD 3T1FB 1H15B 3EGDB 3E3QC 4NNXB 2BNQD 4OZHB 5LN8A 1BYPA 4QRSB 2AQ3A 5A2CA 1ZLEA 1FJ1A 1MREL 2X4OB 2P5WA 5F0JB 4U7KA 5GJTL 5C0ND 1MJ8L 4FCAA 3CD4A 2BSTB 3DO4A 1DQKA 5TH2A 4C54A 3A4DA 4FXTA 3GM8A 5I1IH 4KMQA 4AKPA 2FJFB 3NPSC 5HHNA 1KPRA 3SDDB 4F7EA 1BM3L 3LN9A 2BP8B 2XWJA 3LVTA 4D0CA 4PJ7B 1KIPA 4H88L 5I1GH 3BN3B 4M7LL 5D7LD 4I2XA 1WG3A 3MV7D 3RVVC 5MHSE 1JPFB 4KTEH 4YLBA 2VDQL 1S7RA 3U9UA 3VXPB 5DRNA 2G4GA 4PW3A 4R0LA 1RP8A 2VDRH 1DUYA 1XGPA 4PSPA 3BH8B 5FYJE 2LR4A 1MI5A 4ES8A 2XPYA 1A2YB 1AMXA 2UZIH 4KDTC 3DURA 3D69A 4LLAA 1ZMYA 4HBCH 3KPMB 2XV0A 2WVSA 4G9DB 4IJ3B 3TH2T 3LKOB 4GRWH 3N1PC 4O2EB 1AHWC 1YY8B 1HT6A 3QUXD 3ETSA 4UM8B 5DZPA 5EO1A 2EUWA 4Q9CA 5E00A 1ZY9A 3HI5H 4FXLA 5GGSY 2XKNA 3KPSD 4R84A 3QUYD 3MA9H 1A6AB 2ZSVB 3V4VL 5LWYH 5BJTB 3BRGC 3NMEA 3UTPE 4L4TA 2XUWA 2WKOF 4WLCA 1YDPB 4PJHB 3QEUB 3SIKA 3N1MC 5C6TH 2WLZA 4NZRH 3EO9H 1HH9B 4MAYD 5DHVA 1T1YA 3MRGB 3X17A 5KOVC 2R1YA 5MERB 1Z9PA 5E1GA 4GRLB 4BKLA 3G04B 5I1DB 4HJGA 4P2AA 2YBGA 1T6BX 2X6AA 2YPVL 3BSGA 3SPHA 3NJKA 1AZUA 5HHOB 2R29H 1KNOA 2MQ0A 4J6RH 4LMQI 1YYML 2D03L 2HLFC 3O8XB 3KLLA 5FV2A 3SHSA 3SJVD 3F58H 4K7PH 3OF6D 5J6HB 4Y0GA 1EFQA 1MIEH 1Q9WA 4OI7A 2XSKA 1UUNA 4B9FA 2E9GA 3K6DA 2FB4H 4X5WB 4GS7B 3TN0C 2D4DA 1ETZA 2WIIA 4E42A 1EFXD 2I25N 4XPAL 5D1ZB 5H94B 5DZAA 3DK2A 3ZX1A 2P4AB 4IOSA 3WUWG 4U1SB 1P1ZB 5KVDH 4CSTA 2YIHA 4PP2A 1SXCA 1A6WH 1FGNL 3RY4A 1D5BB 2BINA 1BZ8A 3I6LD 1ACYH 3I02B 3Q2VA 5TFSH 5BS0D 4JY4B 5AZ2H 4GXVL 4OCWH 3KXFE 3QXWA 5TJWK 2FT7A 3MRRB 2OCJA 4BZ1L 1B0IA 2Z8RA 1S3KL 4WFED 4QMEA 5DVOA 3SDDC 1SVBA 2XHNA 4M8UA 4TVPL 1JGVH 4P9HC 3C5ZD 3HC0B 4MJID 1L9QA 2KS0A 5DUBA 1EERB 2BNRB 4I18B 2BSBA 4L8CB 3I2CH 5DC0A 3BWSA 4A68A 4GUCA 3HAEH 4YDMA 4M93C 3LPWA 3WUWA 1PDKB 2EE9A 4YS4A 3I74A 3QZOA 4FNLH 2Y4SA 3APCA 4M1DH 2I9LB 4LB8A 2EDJA 4EI0A 3BC9A 4K7PY 5FDWA 1KCBA 3CN2A 4RISL 3NRPA 1I7UA 1KJ2H 4H44C 4K23H 3V52H 3WDIA 5C2BL 1KN4L 4Y9EA 5D70H 2DWDB 5F2FA 3RTLA 5JW4Q 2X4TA 1VENA 2LTQB 3BJ91 3B34A 4QDGA 2KPNA 4P3DA 4EN2A 1HZKA 1FCCA 1G6RH 4PRHA 2ZX8A 4XRCA 4QO1B 4RWYL 5EBWA 1AQKH 3VGAB 1DJZA 5DD1L 2ADJA 3T3MF 1IM3B 1TT6A 3QJQB 4ODHH 4R26H 4XCFL 4U0RB 3BHBA 4HWEL 4Z7QF 2OXHB 4CMHB 5CEZL 2YGNA 5E6IA 1B6UA 1IEAB 1CGTA 3QUGA 2CPCA 3CIQA 3ESVF 4Z7WF 1HN1A 3FN3A 1QUNA 1YEJH 1XT5A 4X5XA 5F8RC 4GRLC 5I76A 1U8PA 4ODUA 3SYCA 3GDCA 3IAQA 1E9OB 1DVSA 3R8BB 3F7KA 3V0VB 4EUPB 3HS0A 1ZV5A 2IANE 3ZZSA 5IVXA 3O8XC 2RTTA 3MV8E 4CSSA 1LO2L 3P9MB 3QRGH 3MTXA 3ABMB 2DIJA 3N43B 3ZRSA 3QDMD 3G6JF 3U7WL 4YLQT 3VFNA 2EE6A 4FEIA 2R1WA 1HJCA 3FQXA 2FIKB 4PWJA 3QC5X 4Y2DB 2UXFA 4GS7C 4K8RD 2FQEA 3MNVB 1QWNA 3GUFA 4BFIB 1YNTF 4KI5D 3LKRA 4PJ9B 1I9RH 3WJJA 1MCQA 4NZ8A 1AXTH 1EAJA 2RH0A 4AE0A 5BV7L 4G59C 1BWWA 3ARGD 3OKDB 4J3OG 2E56A 1INEH 4S10A 5FO9A 3WL9B 4PRDA 1BVLA 5CINH 1G43A 3EYOB 3D2TA 1U2HA 3QSKB 3RWDA 3EYVB 1E6OH 4L1LA 3DVGA 3VXOA 4XWOD 2VKWA 4PRPA 1KB5A 4L1BA 1THCA 3MRIB 5GRZA 4M1CD 2DQ6A 5CJOL 4IHOB 3MLYH 3N40P 1AANA 5ACMA 2P8LB 3LEYL 4JPVL 4WO4D 3ZY7A 2APWA 3CH1A 3C8HA 5GS0C 5EB9A 1RZ8A 5ICZB 1J5CA 4UU9A 1FFRA 1PAZA 5IQLA 3VG0H 2YKKA 4PU2A 3CCHB 5KG9A 4YFEA 2Y6TE 2HLEB 4GLRH 1N8OE 3H9HB 4F24A 2PPAA 2V3DA 3CZSA 3EUUA 1CICD 2VQUA 4NFCA 1N7ML 1QSFA 1NIFA 1LEGB 3K6SA 5INCA 1N6QH 2EQDA 1I1YA 4LSRL 5JHDA 4ZD3L 1OL0A 3DMMB 2YRBA 4JFED 2WXRA 5AOIA 4A63A 3OAWA 2FT8A 4L3EB 1MLCA 1Y0LA 4NUJB 5EZJB 1OAYH 3J2PA 4D9QD 3FN0H 2QBWA 3P0GB 1HSBB 1L7IH 1WWAX 3KYMB 5IMLA 3FPYA 2VXSH 4MJ6A 2VQTA 3VGAC 2OZNA 5J57B 3T04D 3GXNA 1E5BA 1JVOA 1H3UA 4PS7A 3T3MB 4Z7QB 1NMCC 4BRVA 3CC5A 3SYQA 3IDMB 5I1IL 2OKMA 3RRQA 2OMTA 2GBUA 1NUDA 4DP6X 3PP3K 1ZVSB 3TT1H 1ILUA 4M4RB 4QTIH 4TUKH 3U2SA 3UTSA 5I1GL 3FB6A 2YEZA 3L48A 1A22B 2BVYA 5F7HA 1S7TA 4CUCA 3V4LA 2QQQA 1ONQA 3MKGA 4D8PA 4YGVA 4KTEL 4GG6B 1NL0H 4N2EA 2IH8A 4NAJA 2KH2B 3KPRD 2VDRL 1T83A 3VX1A 1IAKB 2UZIL 4OFVA 3G6JB 2AMGA 3R06B 4HBCL 2O61B 5BRZA 5ACLA 1LE5B 3KDMB 3KYKH 4E9VA 5HP5A 1CBVH 1YNTB 2DYPD 3L3KB 5HI4D 2EP6A 4V2BA 5F7LB 2W81C 1U8CB 3OR6B 3HR5A 3H0TA 5IROA 3LZRA 3HI5L 4ONGH 1OE2A 5ALBH 3FTGA 2WXOA 5LWYL 3MA9L 4I9XA 5MEQA 2YSSB 3SDAC 3CXFA 2H1LM 4NDMB 4PG9B 1UJ3B 3P73B 1QRNA 3MCLH 4JBSA 4A7TA 4DGWC 3Q2NA 3VI3F 4TVUA 5D6DA 2BHFA 3BE1H 1PCSA 5C6TL 3NFSH 3EO9L 4NZRL 2HJLA 2BCKA 3X1FA 3TJHC 4P9HH 2XNAB 3KYNB 1SOXA 1AD9A 3QO1B 5E4AA 4ONFH 1YYLH 3BVXA 2R29L 3AWFA 5F0LB 1SUHA 4H1LH 3IXAB 4J6RL 4GJTB 4NO5B 4WWPA 3ZU8A 2BX5A 1WFJA 4GKSA 3F58L 1I1FA 5FWRA 4HH9B 2BM3A 4K7PL 3ZKMC 1Q9OA 1MIEL 1AIFB 1UT9A 5C6WH 4JL1A 5JOPD 1XSOA 2FB4L 1NTDA 1WYJA 3DXAB 5C0EA 2EDFA 1MJJA 2AJVH 4KZEH 1JVLA 1A4KB 2MCAA 1X4YA 3DMMC 1HX0A 5TGBA 3NOIA 4MNHB 4AIEA 1X5MA 3MJGX 3GS0A 5L9DH 1UURA 5KVDL 3R7RA 4YHIB 4ZMOA 4OD3H 1IIKA 1A6WL 2XVBA 3VA2C 1G0XA 3INOA 2JKIS 5IP4A 4I5BA 4FNSA 1U8MB 1ACYL 5KANG 5TFSL 2N59A 3PHOA 5AZ2L 3RWFA 4OCWL 3E0GA 1K5NB 1GGIH 3BP7B 3QG6B 4LDCA 1IKNC 3L3HB 4I13B 3ILPB 4B5ZA 1AMYA 4NQDA 4ELMB 1JGVL 2BIOA 1KTKE 2G2RB 4IBTA 1HSAA 3F6IA 4GUPA 3I2CL 3QT2A 5L6YH 3I9AA 3W0WA 2PO6D 4KX8A 3MA7B 1JAEA 1ETA1 5ISZB 1BZ7B 4JFHE 4FNLL 1U95A 4M1DL 4MCYB 4Y19D 4QRPA 5IMMA 1AHKA 2XVGA 1FHGA 1X5FA 4JK0D 4Y4KC 1SZNA 4YSPA 3EAKA 3GSUB 2FRGP 3IN0A 3FT1A 3MBXH 3BESR 1KJ2L 3P2TA 4K23L 4KROB 3V52L 4N5EC 3DV4B 5D70L 1K8IA 3F5WB 3WGUB 3RY6A 2YPLD 2OMWB 2ILLA 5FWQA 3HB3B 3SDCC 4F91B 2BZDA 2D73A 4WW1B 5CHNA 1G6RL 3OXRB 4JKMA 5DJYB 1U36A 4YXHH 1AQKL 3N42F 5IMOB 2NDGA 1R47A 4ODHL 1R3KB 2ICWJ 2CALA 4JFXB 4R26L 2D7TH 4FOMA 3ZDYF 4NXSA 3BD3A 1JNHB 4JDEA 4LLDB 2IWEA 2PWFA 4Y5VA 3O4LE 3G5WA 3L6FB 1II4E 1YEJL 2AVGA 1R5VA 4PFEA 4PR5A 3WO3B 3AS2A 3OKMB 4LCUA 2EDRA 5I1AA 3MRCA 3P9WB 3QC6X 5GS0H 4G5ZH 3BH9B 4N86A 1AZCA 3D2UD 3QPKA 1W72B 2ADYA 2IDTA 1JXGA 5KSBB 5EF1A 3B83A 1XH3A 3RB7A 5CEYB 1TSHA 3ENEA 4YIQA 3QQNA 4AQ8C 2WW8A 5HVWA 3FUHA 1AR1B 2EEFA 1P4BH 3HZYA 4PD4J 4UAOB 4HCRA 1AGFA 4XP4H 3UAJC 4AGLA 1DR9A 1I9RL 1N0LB 3MRDB 3HE6D 4G6JH 5TDOA 1AXTL 3KCPB 2DD8H 2PPFA 3SGDH 3IJEA 3NFNB 3DUSB 4MJ5B 1BQLH 3VUAA 5F44A 4AX3A 1INEL 4LCWD 2DRUA 3G7TA 3H2QA 5CINL 4DP8X 1NCHA 1A6TB 3EZJB 1E8WA 4X50A 1E6OL 5JHAA 2RBLA 3L1OL 5IT2H 5DVMA 3NEEA 4L3CB 3ULAB 1IC0A 2J2ZA 4KQ0A 5HYJA 2JJTA 1LO0H 3MRQB 1M05B 2PWGA 3WIFA 4GI8A 3MLYL 5LCVA 1SHWA 3W82A 5CLXA 2ALAA 4CA4A 4NSKA 5I15H 3Q8EA 4EUPH 1H3XA 4J8RA 1TJIH 3VG0L 3VD1A 3QI9A 1M56B 1TFHA 3MOAH 5EULV 5H37H 3K46A 3ZHDA 1YPZF 1AR2A 4HZAA 2K3HA 4NFDA 3EYQC 5CGTA 4N0UA 1FNGB 4OF0A 1X6LA 4WWKC 4A7GA 1GH7A 5JZ7C 1SEBB 1LQSR 1O9VA 2JTDA 3WTTA 1CQYA 4ZPVB 1A4BA 4F2ME 4KROC 1N6QL 1QSEE 1E5ZA 1FA4A 3Q44A 5K9KA 2Y24A 5C9KA 3IVKA 3UYPB 1VZHA 3VXRD 3NFPB 1YNLH 2GJZA 3COOA 1WO2A 1OAYL 3QFDA 2G60H 2HSIA 3FN0L 3LPGA 3WCYA 4RGNE 1L7IL 3T09A 4F3FB 1IL1A 4W4OC 2VXSL 2PWEA 3T0EE 3WLBA 3BUQA 1HHGA 4DN4H 4URTB 3IF1B 2P43B 1JJUA 2NQCA 3ZDYB 4KK6D 4RBPK 4CC0A 4Z3JA 3TT1L 5AD0B 4QTIL 1WPCA 3TBVA 4TUKL 2JCCB 3GHPA 3C60A 2Y5QA 3TNMA 2ROYA 4PJAA 3C75A 2DOCA 4Z78A 2HWZH 2NZ9D 2W59A 1NL0L 1PPIA 1TJXA 3BZ4A 3MGOB 5IVZA 1ED3B 2XG5B 4HWUA 3PWVB 2WLLA 3IU4H 3G9VA 3NIGB 1BQRA 1H3TA 5IY5B 4RMBA 3ZDZB 4LBAA 2ETWA 1JXKA 4WFGD 4UAOC 3KYKL 3B5GA 2BVOB 2ZCLH 2WN3A 3IN2A 4R7DB 2KERA 1ZE3C 4RVBA 5SWZB 5C9JA 3DV6B 4ZMWA 9PCYA 4U1KB 3RZCD 3BDYH 2CE6A 2WQRA 2ZP8A 4MB3A 1KBWA 4ONGL 3HLAA 5ALBL 4NT6A 3VFSA 3O41B 4RFOH 1W0VA 2YLKA 5H2BB 2HAZA 1RHFA 4LRIC 1YCSA 3JT2A 4UCFA 4QHUB 1KG0B 1OWWA 1XGQB 2Y2YA 2OI9B 3AUVA 3MCLL 4BHUI 2YD9A 5AVUB 3OZLA 3C6LD 1HOEA 2Z93B 4DHLA 5FFLA 3BE1L 2VLRD 5HHQB 4OUUA 3NFSL 3ARBD 4LL4A 1KWKA 5T5NF 5HGBB 1J86A 2ZAGA 1ZGLB 3FU8A 1J0ZA 1MHEA 5C0BD 3RGVC 4QOKB 2VWEE 4RDBA 5GXBB 3JVGA 4P9HL 3LIUA 1X7QB 4ONFL 1O7DE 1YYLL 1PKQA 4UT9A 1XZ0B 3ISRA 2NSQA 3SE6A 3HZMA 1IZKA 1FBIH 1YEKH 5HDQH 3ULSA 4ZO6A 2VW7A 4U1HB 3G08A 1MWOA 4JRXD 4HW6A 2J7LA 4E9QA 1QNZH 3DGGA 1RV6X 3OR7A 4EF3A 4HVBA 2AJVL 4KZEL 4K5LA 3E2HB 2PTTB 2WGXA 4IS6A 4HXBH 4CSZA 2XWZA 3V6FA 5L9DL 2ZUTA 1HHHA 3J07A 4JG9A 2CG9X 1YN7A 1TZIA 1BQ5A 3LKPA 4OD3L 5E2UH 5AVRB 3OC8A 4HJIA 5HJ3B 5CP7B 4FL4C 5F3HB 2PW2A 5CIPB 2B3IA 2WLMA 4LEOA 5DRZB 3RWJA 3Q6FA 4XNUH 1GVIA 5D55A 1GGIL 1ZVNA 5F7DB 2UXVA 4R5TA 1P6AB 2YO3A 1FNEB 1AZZC 1OGSA 4JM4H 4AI7A 4Y4FB 2WYZA 4JFTA 4GW1A 5IEHB 4U6HA 1IC5H 1AO7E 1O6SA 5L6YL 5T1KD 2IAAC 1XSIA 2NY4D 4WI4A 1EJ8A 1M7IA 1G7MB 1JZHA 2GHZA 3JV0A 4GT0A 4KXZH 4FQQB 5JIIA 3PWJB 2H1PH 3EJSA 1OWRM 1NGZA 3KWVA 5FW6A 3NCWA 1MWAH 5AKTA 3UYOD 3MBXL 1E40A 4XBGB 2J71A 1M2VB 1UFUA 1UM5H 3PV6A 5ITFB 1S78D 4FXKC 3B56A 3OMZA 2VOTA 3CHOA 2ZXWB 1BJMA 3F00A 1PZAA 3HZVB 4NJAH 3DJRA 3VGDA 1PSKH 1ZV2A 2HRPH 3JSSA 3QDJE 4H8HA 2BRQA 3PPEA 4HQQH 1T1WB 4X6EA 3NCCB 4YXHL 4QI3A 3SQRA 4AVKA 5IOPB 1DVUA 4FCHA 3TOPA 2D7TL 4J2QA 3MRNB 5CGYD 3ABZA 4A2EA 2Q3XA 4OAWA 1CDIA 5GGRY 4NQCA 2H3KA 1ORQB 5CD3A 5ELIA 5PAZA 2Z35A 4HK0B 1QSVA 1X5GA 4TVPD 1N59B 2L8AA 4LCCA 1UYWH 4PJDF 3MJ9H 1A4JB 3DPBA 5BOPA 2DTSA 4AJWA 1I9JH 4Y1AA 1ZWIB 3HNTH 5GS0L 4G5ZL 1ZANH 4B96A 3FOLB 2HRLA 1C8PA 5LN4A 2OXGA 2A83A 2O6CA 2AHIA 1YVLA 1OQXA 4OI8A 3QQ9D 3ME0A 4HUXB 2UWEA 2B7DT 4QRQA 3GJFH 3DWTA 5D7JA 4HIXH 3BVUA 3QNFA 1SHSA 4I3RH 1TIUA 3PWLA 4C83B 1P4BL 4XP4L 4GQPH 3F8UB 5L2KE 1FZJA 3DI2B 3KWWB 3TCLA 4UAHA 2HCZX 5HDOA 3W3BA 1JS4A 4JM0A 1A1OB 2OBGA 3FQRB 1NGWB 2ZOKB 4G6JL 5EUOE 3B7RL 2DD8L 4WENB 3LXAA 1BQLL 4V2CB 2C3VA 1P5UB 2IBBA 1N2RA 4MZIA 1M71A 2ATKA 4N26A 1BBJB 1THAA 4NQED 1WBXA 4PV9B 1DN0A 1R4XA 3FF8A 1ZKAA 5H4ZA 4IMLA 2D0HA 3AC0A 4E5XB 1P5VB 5IT2L 4N8UA 5CEZD 1U8LA 2Y0SA 1LO0L 2XJKA 3LRSA 2CIKA 4QIRA 4F8PA 4IKKA 4UQ2A 2RCSH 1L5GB 3NCJH 1HNGA 4P59H 4C56B 2COVD 4XOBA 4UTAH 2NQ3A 4LBEA 5I15L 3L16A 1KFGA 3PXHA 3QRBA 3TFKD 1FVDA 3VSVA 3D39D 2VMCA 2K4WA 1TJIL 2EZ0C 4XMVA 1QVOA 3K6OA 5E8DH 1GZQB 2QADB 3MOAL 1FN4A 4XBPB 4XPGH 2ADIA 4QKTA 2EVJA 2MQCA 3GLZA 1BD2A 4POZD 4JO3H 1RJCA 5TE7H 4UIMB 1DBMH 3D5OF 1OPGH 4WUUD 5J3HD 3TA3A 2JE8A 1U93B 1JMZA 1AS8A 2HFFB 3BAYA 5DJ6A 3GXTA 3QDGB 1JUFA 1S9WB 2Y07H 3NJFA 2D7QA 4EN3A 4RGMB 1E27A 1CN4A 3NGBB 1FL6B 3X3GH 1ZE3H 3MSPA 1YNLL 1RSFA 3WN5B 1U8IA 5JHBA 4P5KB 4KHTH 3O4OB 2G60L 2AXJA 2ZOOA 1V8HA 1F97A 2KHAA 4F58L 4Z3HA 1BVKA 3PWPA 4LMQE 2Y6SC 4EI5A 3HUJE 2D7PA 1VA9A 2DM7A 2NNCA 4H5SB 4ZQKB 5I19H 2B59A 3UABA 4DN4L 1XIWC 1BCIA 2VMEA 1JZJA 2IDFA 4R96A 2ESVD 4L29B 4BBWA 1NCDH 1OCWH 1DQTA 4AENA 2BOBB 4Q4IA 1GOFA 1TZHA 3DI3B 3CZFB 4JHZA 4PJDB 5J1AA 4AYID 1FL5A 3HI1B 1FVEA 7PAZA 1G7IA 3OKYA 1K4DA 1IGTA 3SKOB 1INQA 3V7MA 2HWZL 3Q5OA 4H8WC 5GQBA 1FSKC 1UC6A 2MHAB 4DAGH 1OM9A 2ENJA 4HEMA 5MEOA 4BGDA 3RPIB 4YHOH 3IU4L 5FM4A 1A5FH 4J6IA 5CWSA 2ICEB 3QUXA 4E41A 2WVTA 1SJMA 5DHXB 2DS4A 2OQJA 4KOCA 3TO2A 2C3HA 1YEEH 2Q6WB 3V6OA 2GK0B 3BWAA 4L8SB 4U3HA 2ZCLL 3KH4A 4HPHA 1O6VA 2EDMA 3U36B 4B95C 4S2SA 1F3JA 4CBPA 2CZNA 3M17A 3BDYL 5CD5D 5K9QG 4RFOL 1P5UC 1QO3A 5E70A 1KF9B 2FIRT 3LNEA 4HUUB 4ZBJA 2GJ6A 2IOOA 5F9JA 4MAYA 5DVLA 4N2HA 1ADQA 3MRMA 3CFEA 3DIFA 1JWUB 1KGYE 1FO0H 2CBTA 4U49A 1CK0H 2QLYA 3F2LA 3KGUA 2F0CA 5SWSE 5MHSD 2E9IA 1R6VA 1F45A 4JQIA 1R34A 3VFPA 3X1NA 2CDGB 4IRZH 4XODA 3C6SA 5BZZA 1Y6MR 3GUTA 2PCPA 5FYJD 1R3JA 2WCSA 3AT0A 2QADC 4IK7A 4S0HA 2CNZA 2BVUA 1DQQB 3GJEA 4Y5XB 1UEMA 5HDQL 1FBIL 1DTUA 1YEKL 3FCGA 3QQ3B 1XGUB 8PAZA 3ML9A 3LH9A 3S2AA 2DLTA 2R0ZH 1QNZL 4RDQG 2ZG3A 4Z3GA 3L08A 4LO9A 1A25A 4RGMC 2DAVA 3RKDD 5CZKA 3NGBC 3OPUA 1FZKB 4HXBL 3GLEA 2N3JA 1F90H 4O2CA 5DFVD 4PTTB 1FFOA 5I26A 5JXED 2OMZB 3UTPD 2YARA 1HHIA 4U6YB 2EC9U 2IOMA 5F7NC 1EDHA 2YUWA 3PXLA 5E2UL 4DP0X 4A2DA 1EXUB 2XICA 2ZWNA 5DS2A 4BM7A 4Z7UA 1SHXA 5IBLD 2JTYA 3SCMC 2D31A 4G1EA 2IQ9H 2O26U 5HD8C 2WQ8A 1M7UA 1MY5A 3JTSB 2YN3A 3GWJA 4IBLT 4P5MB 4XNUL 2C5DC 4Q9RH 3KLHC 5T1JA 1F13A 3MR9B 4L9DA 5KVEH 5E08H 1WT5A 1HL4A 1EEQA 3BUYB 3OHXB 5LKNA 4JM4L 1YO4A 4XNMA 4CVZA 4MNQE 3HN5A 1IC5L 1PU0A 2AXFB 4MWFB 5IFJB 4RAVA 1OKEA 3LSOA 5D5ME 1OB0A 1MHCB 3N55A 2IMMA 2JFCA 2ZXAA 2UZYB 2WTRB 5ESVA 1ZTXH 3QJHA 5D6CA 3K1KC 2H1PL 5HHMD 4QWWC 2X0UA 3QBTB 1LXMA 2YBRA 4BDVA 3U46B 1MWAL 1W8OA 2KT6A 3PHQB 4HT1H 3T0XA 1D6VH 3PPSA 1LWHA 2MNWA 1UM5L 3SD2A 1N5AB 1EZLA 1I3UA 1S9VA 4PGDB 2ISDA 3GMLA 3OZKA 1OP4A 3QEGH 5F1OB 1U6AH 2XX1A 2BOCB 4NJAL 5FYLH 2CDFA 3GD1C 1A3QA 1PSKL 4HF5H 2HRPL 1UTDA 5DUMH 3KXFD 1O9WA 4HQQL 1RY7B 4B53A 4OF7A 3K4DA 2P5WB 4JY6A 1MDTA 3DX1A 3FB7B 5EC1A 1UZ8A 2MJWA 1N26A 3UO1H 5D2NB 3MRJA 1ULVA 2CKBB 3OB0H 3T08A 1TYRA 1L0XA 3ARPA 1OK0A 3MJ7B 4LF3B 5TH2B 2DW5A 3VWKA 2ADGA 4ZUVB 3GXPA 5EEZA 2R59A 1UYWL 3MJ9L 3F7VA 2Y72A 1GYAA 5HHNB 1I9JL 2XFXA 3HNTL 5EZLA 1ZANL 2XWJB 1TUPA 3KDPB 3D0VA 4YHKH 1P6FA 4CILA 4AGOA 1DLHA 1PD1A 2FGWH 3N06B 3OB8A 5DC2A 1B4RA 3U9UB 4HIXL 4I3RL 1DUYB 1URIA 3UAAA 1QSEA 1MI5B 4KV5F 5EPMA 5EOTB 2UY6A 3D69B 2A6IA 5CFAA 5FOBA 3NZSA 4NUMA 1UZ6E 1K2DB 2UVEA 3Q5TA 4DETA 3PL6B 4WKXA 4PJ5B 1KWGA 4G83A 1S7WA 1MQKH 2MPAH 3WMSA 1CLYH 3QQXA 2F15A 1WCBA 3WHXA 5C0RH 5FGSA 5CJBA 2BCMA 4L4TB 1KPVA 2CNYA 2ZZUT 3A3YB 3TEYA 1BG9A 2ZD0A 2RCSL 3OHXC 1AGCB 2IAND 3NCJL 3ZXAC 1G7QA 4P59L 4UT7H 4UTAL 3UROR 2Q20A 1T7WA 2AK4B 4GAYA 5I1LB 5E99H 1X5IA 3OX8B 3TYFB 4PHZA 4OUOA 4XPGL 3ZHNA 4DOHE 1IE5A 4H8WH 4HJ0C 4RFNB 5TE7L 4JO3L 4XVUD 1OEZW 5CNHA 5B3NA 1DBML 1SMDA 1OPGL 3E1F1 4W9GC 2J8OA 2YZ1A 4JO5A 3OHMB 2V8LA 3ZE0E 4X6CB 3NIFF 5FA3A 1Q9WB 2Y07L 3BH4A 1S46A 5D7IA 2EABA 3X3GL 3QWQB 4YSTA 3MBEA 1UXSA 4PRBB 2GIXA 2WIIB 4UV4H 3JYBA 3N41B 4KHTL 1ZLVK 2QR0A 2Q2LA 2V5SA 2VXTH 3E9UA 1P69B 3L5HA 1V3JA 2RQEA 2PWDA 3ESUF 3BUBA 1MCWW 5I19L 1CGXA 3BDBA 5EN3A 2NY7H 4GXUN 5D2NC 5DZVA 4WEMB 1GC1C 4JQXA 1XVSA 3ABKB 1NCDL 3VXSB 1OCWL 1GZHA 1NFIB 4IDLA 4QXGH 5C09B 1GYVA 3IE4A 2Z0BA 4RMRA 3KPRA 1P84K 4TLKA 2F5AH 1G9HA 4MRBA 3QWNA 4G72B 2XN9E 4KFZC 1CWVA 3KGSA 3I9IA 3RVVD 3LH8A 4L8DA 5IQMA 4DAGL 3KLQA 2P46B 2KPWA 3VGEA 2XZZA 5IHHA 4DPBX 4YHOL 5G2NA 2FWOB 1A5FL 2IH3A 2WMPA 5CLYA 2A9DA 5F21B 3Q2WA 5JR1H 3CH8A 4F33A 1DDHA 2Y22A 1OT4A 2WLKA 1YEEL 2A7BA 2YQ3A 3LZOA 5C0DB 1DL7H 1BOYA 3DX8B 1ZK9A 2C7FA 5FDWB 4JB9H 3MGTA 3U83A 1PX8A 3CQQA 4MQSB 4F37K 4J28A 4OM0H 4R3SA 1BMGA 4JKPH 4EQ2A 3WD5L 4RAUB 4XHQA 3OZ9H 2WO3B 3EUDA 4GT7A 3LRKA 4RMSA 4Z18A 4LLYA 1ZT7B 2VRQA 2ZOLA 4XRCB 3DVIA 1FO0L 1TZGH 2A74C 5EBWB 5F7YC 3VYOA 4YHNB 1CK0L 5IB5B 1OB1B 8CGTA 2X6BA 2WBJA 3ARFC 3OBAA 5JYMA 4IRZL 5EDSA 1FLRH 4OLUH 4UQ3B 5HYSB 4IGBC 2NY2B 3D6GA 2W65B 3DVNB 4GI9A 2EEDA 4UI2A 3BQUD 3IGKA 3HG0A 2XDHA 1ET8A 1K4CA 4RFNC 1JZ6A 1X5KA 2GEEA 4PRAB 1J10A 3WKQA 4XMWA 3QORC 3IDJA 3KGRA 4OF3A 1TQCC 4TQ8A 1EHLH 3IK2A 3X11A 2R0ZL 1UA6H 2W80C 3LCYA 2VMDA 1KLUB 1QAWA 3S3DB 3IGAB 4N1CA 3QHTC 4A7QA 1F90L 2R1WB 3PQYE 4I77H 3V0EA 4CN6A 1KSRA 3HPLA 2K7QA 3O3EA 4CNIA 2E46A 3NN8A 1SY6H 4G7RB 4PBXA 3SGEI 5E6ZA 1DBJH 2PYFA 3BGFC 2OYPA 3LIZA 3SEPA 2PETA 2C7UA 2QKIC 3BVTA 2A73B 3QIWD 2XIBA 1IGJA 1ECZA 2IQ9L 4TNGA 3IJ8A 1I8IA 1RUMH 4G11A 1V3LA 3T0DA 5AAWA 3K72B 3HW7A 4Q9RL 1F00I 2YC1B 1X6NA 1WD8A 1FYTE 3TV8A 3P3TA 4PRDB 3S88H 2UX7A 3S35H 4P5RA 4FYQA 5KVEL 5E08L 3K8LA 2JWYA 3KVDD 4M6OH 3RWDB 5F9DC 3VFRB 3B2DC 1QR1B 2C9AA 3I6KA 2EICA 4Z3TA 5DC4B 4YPGB 1KB5B 1E42A 4F1SA 2CLZA 3ZTNH 4ZX4A 1N10A 4BFJA 5ID0A 5GGTA 4EI5D 3ZSTA 3GLDA 4H0LC 5B4MC 3ASWA 2FLRT 2JLLA 3C6EA 1ZTXL 4HKZA 3VWJD 1KB9K 5IFHH 3G5XA 3V5KB 4XB7A 1TNMA 4WUKH 5A2KH 4F2FA 4F8TA 5J9PB 1JNJA 4QNPE 4M48H 1JF5A 2W60A 4HHAA 4HT1L 1D6VL 2Q76A 3BSZA 3IDGB 4MSWA 3FRUA 1GJWA 3BI9X 3V4PB 3LVEA 3K6SB 5CSZB 3QEGL 4OZ4B 1U6AL 3O6FA 4HLZH 3RVWD 1Z3GH 5FYLL 4G7SB 1A1NA 2BVQA 5LDUA 4HF5L 4FXGA 4DNLA 5DUML 1WZAA 4FI7A 1MCBA 5C7XH 1MLCB 4U6VH 3S97C 3ARSA 5DQJB 4NQSB 5IQ7H 1EJFA 1AAJA 1F3RB 4MDIA 4B27A 5E8OB 3SBWC 3L8QA 3GZPA 5J6SA 3UO1L 4EZLA 5JO5A 4AXWA 5GRVK 2EIMB 2F8OA 3NUKA 3TFBA 3KLAB 3QVAA 3FOMB 1ZHNA 6TAAA 1E2VA 3H3BC 2NY2C 3GS7A 4JFHD 1T0NA 4NP4H 5F1NB 3P4MA 2TAAA 1FI8C 4XNAA 3OGCA 3GF8A 1VRSA 1QNIA 1QEXA 3MREB 4MD4B 4PCTA 1FCGA 1XR9A 5FGCE 5EZPA 3VGBA 3ARXA 4OFYD 4LSDA 2DWXA 4YHKL 2X2IA 3OMAB 1KTRL 1BVOA 1AQDA 1Z1WA 4XCEA 2FGWL 2Z31B 3AQZA 5GS1A 5AWNH 2FX7H 4JFFA 3S5LG 4GRMB 1U3HD 4R4NC 2LFGA 4PJXE 3OJDA 1QP1A 5IF0A 1F5WA 3B3IB 1MCEA 1V05A 1TQBC 4PREB 4WSJA 1BDYA 5B1JA 3Q5YA 4NKOA 1W80A 2QGDA 3KHOA 2XWXA 4M9PA 1BGXL 4UWQB 4Y9CA 2DWEB 2HRHA 2B16A 3GRWA 1LP9F 1MQKL 3H0TB 2MPAL 1X9UA 2IV8A 2X9WA 1CLYL 2ZKWA 3ARYA 4FTVA 2R0WH 5MEQB 3U0PA 1J0JA 5C0RL 2WINA 1RP9A 4WU7A 1IBFA 1RH8A 4I0PC 5KOMC 5EIQA 1F4XH 5AW4B 4XO8A 2CKBH 4J1UA 1GC1H 4G42A 1E43A 3K80A 4L37A 5DZLA 2EH7H 4GBXD 4B60A 3ILEA 3S5LA 2BSED 4UT7L 5DJZA 4FLSA 1A6UH 2EE0A 5E99L 4YWGH 3SDXE 3TIEA 1PLAA 2H0EA 4B7IA 2Q3ZA 4PJGF 1V27A 2Q8AH 4P2RA 4MMYA 2DBJA 4U1MA 1ORSA 2ZOTA 4H8WL 1WK0A 1I3VA 3ZQ9A 2AP2A 4LLUB 4MMZA 5ICYB 3LV3B 1LNUB 4Z77A 2BSRA 2W07B 2DJSA 4JCWA 1UB6B 4FHBD 3OKNA 3JTBA 5B22A 3QZNA 4UOJA 4X9FA 3PP3H 4PCKA 5GGQH 3H9ZA 3AG2B 2DLGA 2WNGA 3GB7A 3MMEA 3QJFA 4AITA 1IC4H 3IAPA 4XVJH 1G7HA 2WWKO 4UV4L 4NUQA 3DLQR 2JB6B 5TGBB 2VXTL 5DU7A 5E9DD 2GYSA 5DRWA 1U3YA 2G75B 3IXTB 2PP7A 4WTXA 1NSNH 1VERA 2YD2A 1JV5A 5F7FA 1E90A 3EBGA 1F1AA 3ERXA 2BP5M 2NY7L 5J11B 2CLRA 2HVKB 1L7TH 3EJQA 2LE9A 3RX8A 1WUZA 4DCQA 4QXGL 4U3CA 4IRJD 3UBXI 4XT1C 1EDQA 3D0LB 4M9OA 5DURD 3P30H 4AW4A 2F5AL 4TTGA 1N6UA 3EXJA 2P5EE 4HKBB 4B3EA 4NQDB 1OD7A 2NX5A 2R23B 4P2YA 3NK4A 1V7MH 1D3CA 2IAMB 5D96C 2PPEA 2V5MA 3NRQA 4GUPB 1QLFB 1QLEB 4RMWA 3NP4A 4PPTA 4NENA 2Z31C 1MCFA 4CAGA 2AJ3A 5JR1L 4P2CG 4BFBD 3CNKA 3D12B 4FLOA 4TQIA 2JXMA 4WDIA 1MG2C 2D3NA 4IU3A 1DL7L 3NAAH 5FK9A 1VGKB 3AY4C 1TTCA 3ETTA 4JB9L 1XDTT 3H2PA 5AOLA 4NAMA 5BNXD 2SODB 4LPTA 5FFGA 3T0ED 2VTFA 4OM0L 3KMDA 1VCAA 1CU4H 4JKPL 3QEQA 3C6LA 3WEXB 4W9DC 2VLRA 5HI5D 3BPOB 3RWIA 3VFUA 1WAPA 3OZ9L 3FS9A 2A4CA 5F9OH 4G2AA 3SDAD 1M1SA 2F53E 3GI9H 3ROLA 2Z7UA 3LZQA 1DE4A 1L6ZA 4DK6A 1BOGA 1TZGL 4HUVB 1Z5LB 4G8GE 3U82B 5FF6A 4OGAD 4JREB 3WTYA 2OL3H 4G8FA 4HIEB 2XWEA 2WBWB 3D3VD 3H53A 2DQHH 3Q43A 1FLRL 4OLUL 1YMMB 2F54B 3TJHD 2YZ8A 3MRBB 4PR5B 2X9YA 4Q2ZA 3WNNA 1BYNA 1JYVA 3T8XB 4EPSA 4FJ6A 1S7QB 3ZMNA 4LCUB 4JM2A 4OZGF 4PJGB 1BF2A 4AM0Q 5F3BB 1HOCB 1ND0B 3I3DA 4LHUD 4YSOA 3N40F 5AVWB 4F9LA 1EHLL 1OAZH 3L1FA 5ES4B 1UA6L 3LZFH 2R8SH 4NQXB 3IRPX 4IBVA 1KGXA 2PLTA 5IK3A 2E7BA 2V17H 3V4VA 4I77L 1QFUH 4ODXB 1FQ9C 3ZO0A 2Y06H 3QPXH 1BYOA 1SY6L 3MX0B 4HFWA 1DBJL 3IE9A 5F70A 2IWFA 3UP1A 4HCFA 5FYKH 4YR6A 3BYTA 3KPQA 3IGUA 1I3RB 5DI8A 4P46C 5TDOB 3CZJA 4I1NB 1HI6A 1NC2D 1RUML 2WO2B 4K9JA 2IBZX 1E2WA 4J3XA 3V5HB 5J11C 3AMKA 3S88L 1JGEA 2V6HA 2AANA 2YPVA 4OZFH 3S35L 1TU2A 4M6OL 3B9AA 7PCYA 5ALCH 3X12B 2J2ZB 1JN6B 4WHYH 3ZTNL 4KO6A 4DKDC 1U58A 1X5AA 4P4RB 4UTCA 3WIFB 1TLKA 2Z7YA 3KR3H 5E8NA 5JW4N 5I1KH 1IM9B 3IMSA 2IAMC 3GSRB 1G1CA 1EHXA 3VDBA 4HK3J 4ZO8A 1E6JH 2R1XB 1FGVH 4J8RB 5C0FA 5IFHL 4J8QA 3QYMA 4WUKL 5D1XE 2ZF8A 4PRID </