4RDBA

Crystal structure of an immunoreactive 32 kda antigen pg49 (pg_0181) from porphyromonas gingivalis w83 at 1.45 a resolution (psi community target, nakayama)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
305
structure length
303
Chain Sequence
GDRSIEISIRVDDFTKTGERYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoreactive 32 kDa antigen PG49
publication title Crystal structure of an immunoreactive 32 kDa antigen PG49 (PG_0181) from Porphyromonas gingivalis W83 at 1.45 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 86
structure length 303
sequence length 305
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4rdbA01
4GPVA 4JRFA 4RDBA 5DHMC 3UP6A 4JG5A 3R4RA
chains in the Genus database with same CATH superfamily
2VSMB 2NY3B 3RVWC 2EYTB 2FUQA 2BVOA 4ZQKA 1O6SA 2FL5A 2WQUA 5IGXH 3GEFA 3KNBB 1AMXA 1EEYB 5AL8A 3VXSB 5I8CA 3G6DL 1ETZB 1GVIA 4Q2ZA 4D3CH 1V5JA 5ICXB 4TSAL 4H0IA 2DQDL 3QORB 3R0MA 4IRSD 3CTTA 4EXPX 4HEPG 3ULAB 1ZT4A 1WBZB 4N90D 5EUOE 1HT6A 1T7WA 2OMWA 1E4KC 5K1VA 3NQKA 1UB5A 1FQ9C 5BMFH 2FSDA 2Z91B 3RPIA 5JHLL 4PJFF 1WS7A 2OSXA 2PR9A 2X0UA 4UQDA 2AW2A 5DD0H 3D52A 4LP8A 2AJ3A 3WUWA 3GSNL 4F9LC 4APQD 5BRZD 4TPRH 2COVD 5AYQA 5C09D 3HC3L 4PGDB 4HUUB 4QRQB 4LAQH 2VLJE 1ZLSH 3O3AA 3B3BA 2Z31C 2R0KL 2XXGA 1JOIA 4K9EH 1OP5K 3GM0A 2ICEB 3CCHB 4Z7UA 4NT6B 2H2PD 1DFXA 3P54A 1OLZA 1T0MB 4R26L 3BT2L 3S4SB 4NQDE 2VR8A 2VZ1A 3VYPA 4KRPD 4TVPE 4TSCL 5A3ID 3GD1C 3I6GB 3GSXA 1TZIB 3Q5YA 4PV9A 3ULSA 5JPNB 4JUTA 4Q56A 2F19L 2ZG1A 2ZX5A 5LNEA 3S5LG 3SDXA 2XN9E 3PPSA 5CJQL 2W0PA 4UM9A 3E6HB 4AIZB 1YQVL 4EDXB 4A7VA 5I1GL 4N3TA 5LBVA 1LEIB 4JG5A 3QXDA 2VZTA 3NSXA 3PWLB 1JGUL 4FNPA 2VWEE 1LE5B 4XMPL 4Y16B 2GJRA 1T4KB 5HPOA 4WW1A 3WN5A 1Q9OB 3RVXC 2F54B 4KHTH 1S3KH 4NRZB 3ZN6A 4LPWA 2WXGA 4WHYG 3VCLA 1U58B 1NIFA 1MVYA 2OMUB 4L4VD 3TEUA 3KMDA 4AGNA 3O6KL 1NUGA 2R0WH 3PJSB 3MFFB 2C8NA 2HVBA 2X1QA 4MA3B 2DZEA 1P5VB 3AU1A 4K7PH 1NL0H 4N2NA 4HF5L 4I9WD 3VGDA 3BZFB 2GBTA 3QT2A 5CO1A 4OGXL 3RNQB 3N1FC 1LDPL 4M8QB 4HFUH 4ZUUA 5KAQF 3LMJH 3EHBC 2YUVA 4NO2A 2MNWA 3NJJA 4YFLI 4F15C 1V27A 4YHIB 4N8VB 4Z0XB 2B9BA 4WFGE 4GAGL 2IWFA 3OR7A 3ZVVA 3KYMA 1LO3L 3FMGL 4RMUA 2Z35B 2WYHA 3LPWA 4NQXB 2R1WB 2XQYG 2D7PA 1SHWA 1TVHB 3MV01 2BY0A 4DGIL 3HZYA 4KTDH 2CGRH 3V10A 1UTDA 1ZANH 1T7XA 3BKJL 5IBLC 5E2WL 2AQRA 3HZMA 2BFVL 1X5AA 3A6BH 4XHJD 5E6SB 4OFDA 5GGSA 3T65B 5HYJB 4RLDA 3QEHA 2R69L 4ELKB 3N91A 1KPUA 3NCCB 4NQTA 2BNRB 4MWFB 2VDNB 2HWZL 4J3VA 4CADB 4DN4L 2QSQA 2RJMA 4NO0A 4LOEA 2IAMC 2ZP0T 3WJLC 4YNYA 5FPIA 2CLZB 2LLLA 4UT6H 2SODB 1MH5A 3KH3A 3MCKA 1VFOA 2IGTA 5FF6A 1U8NA 1OARL 1U92B 1J12A 3S2CA 2X28A 1DVUA 2MQ0A 3BWAB 5LUMA 4MA1C 3MLVH 1IGTB 1TJHL 4NM8L 1OK0A 1W15A 4ZW3A 4FLOA 3P3UA 4PJEE 3GTTA 2WXNA 4U7KA 5KSVA 2E6QA 4M3JA 2R8SL 2GHZA 2OTUA 4QWWD 3FFOA 3DVNA 1JPGA 4ERSH 3F7PC 2YK1L 3H3KA 4B9YA 4R4BB 1Q0EA 3CVIL 3PGDB 2PTTB 3CDGB 3HMXA 4P4KB 4AKPA 1FFPA 3ZTNL 1MHHB 3QR2A 4UOJA 2HUHA 1XZ0B 4MAYC 4W9IC 4LPCA 1NKGA 1XZWA 3U0PA 3VU2A 4L8SC 5JHDD 1IKFH 1UT1A 3K72A 3EJZC 4PJHA 5DFTA 4ANKA 3N40P 3EJSA 1UH2A 1IT9H 4LSUH 1BM3H 1TZ8A 4MQXD 2NY0C 1KCRL 1UACL 2V7HA 1DFBL 3QEGH 4P59L 2QZQA 4PJIE 4PTTA 4Z7VF 4X5XB 5F7WC 1E5YA 5SWZD 5J5EA 3NA9H 3KG5A 5HHMB 4R2GD 2IALB 4AQZA 5I1JL 5T1KB 4YSPA 3SKJH 2HKHH 2HTKD 4Q89A 4UCFA 1QSFA 5F71A 3K80A 1GIGL 1WTGT 4ZXBC 1X44A 1DBBH 3VXNA 5K59E 4JB9L 1FYTD 4Y4KA 3I6KB 3D4CA 2BOBA 3HG4A 4QRPA 4ZAKB 4DHLA 2DQEH 4C4UA 3UACA 1DSWA 4Y2OA 1V7NH 2NY6C 1MCHA 3NGBC 1T0OA 3DGDA 4U1JA 2NY4D 1I1AA 3QEQB 2QLYA 4QXTA 5BPPA 3DOHA 1G5AA 1A64A 3BP7B 4OKVA 4PRID 3BLKA 1PZ2A 4PBDA 2E3VA 1B4RA 1AE6L 3SBWA 5DVOA 1FAIL 3MROB 3SQOL 1IQDA 1WZMA 3DJZA 1IFHH 1TMQA 1ZWIA 3D0VA 3N43B 1CZ8H 4TQIA 5AW2B 1BXUA 3V6BR 5IEKA 1EAOA 1VEOA 2JJSC 4UYPA 2O93L 4KY2A 2JLPA 4P5SA 1EEZA 5HI5D 3O11B 4GUCA 3DRTA 2W94A 4FJZA 5HPMB 5I1HH 4PS8A 4PJXB 2YQ2A 1JHTB 1PG7W 2BVEA 3HNTL 4G6JH 4KK5D 4FI8A 1QFUL 3SPGA 3DC0A 3MRJA 3QVAA 5GS0H 3IT8D 5IM7A 3G9AB 1ADWA 4LVNB 5HI4D 3KDMA 4HS8H 4GSUA 1UH4A 5KBNC 5EEYA 5DJYA 3D0LA 1L9SA 1U2CA 1H19A 2YXWA 1TVBB 2YAOA 3TZVC 2WIIB 2VMJA 2WBKA 4J6IA 4YH6A 2HVKB 3U0WH 4ORZC 2XFXA 4PGZA 2C7UA 3EXLA 2BZDA 4ADGA 4NZUH 2CMRL 4I8DA 2VLLA 2I5YH 1AKJA 4JPIB 5D2NE 1A14H 1CE6A 4FNRA 4LSVH 1IBGL 4PJDE 4QHPA 3B7YA 1WCBA 1GJUA 5LN4A 3SKMB 2ICEC 3BKCH 1OTTD 2IPUK 4U4IA 1MDTA 4LLVB 3PLYA 4U3XA 2AGJH 1MQKL 2HX9A 4P3CH 5INDA 1SOXA 3OXRA 1G7PB 3L1OH 4WAFA 1AZRA 4XN9A 4ZMTA 5KYWA 4KC3B 5GRVK 5L7XH 5JPNC 4DIXA 3JTTA 1JGLH 1GYUA 3LH2H 2O61A 1BQKA 4NN6B 3TA3A 3IXAA 5HJBA 5GS0D 5I6NA 3FQXB 2WB1A 1YN7B 1TJMA 1N8ZA 2NY5L 3NABL 4HUCA 5LBGA 4QXUH 2OSWA 4A7GA 3A24A 4JRXB 3VFWB 1C1EL 2JTYA 5C2BH 5D1XD 4Y16C 4WKZB 4JFDA 1E8WA 3FUKA 3C09B 4XVOA 5F89B 2CRZA 1KZQA 3II1A 4KK8C 3FB6A 4I85A 4UB0L 5CCGE 2X2UA 5KVDL 3UJTH 4ALAH 4YDKH 4OF3A 1N5AB 4GH7B 4HJEA 1R3HB 3VXOB 4Y5YA 2PR4H 1XIWB 3I2CL 1MI5D 4RFOH 4B3VA 4PVBA 1OPGH 3TCXA 3X1EA 4U6TA 4F93B 1SM3L 4UOW1 1BP3B 3UG3A 4WI6A 4XNMA 5A40E 3VXRD 2GKIA 3QFDA 1CLYL 3V79C 1ROCA 1B0RB 1ZA3B 1KG0B 2GJ6D 2A6KA 2Z8SA 3G6AB 5IEHA 4BHUI 2K9FB 1KEGH 4NRXA 4I18A 3Q9PA 1JG9A 3GHPA 1HFUA 1GR7A 4PW3A 1HWHB 2J20A 4BCXA 1J8RA 4EI0A 3WEOA 1OT2A 1RK0B 1RHHB 1ECZA 4X9FA 2K3TA 4ZTEA 3LN4A 4X7FC 3RE0A 1KEMH 1USQA 4HBQA 4JFYB 4F8TA 4QRRA 4XN2A 2QMKA 4NHUA 1JPFA 4X8JB 2RAMA 1HH9A 3A6CH 3G6JA 2VT0A 4FQXB 3BVTA 4FHBD 3P2DA 1DBAH 4ONFH 5C08A 3DSFL 3TPUB 2YEZB 4N8CH 5DS2A 3SD2A 4TOYL 3SEPA 3OHXC 2CNZA 2K70A 3C5JB 4ONGL 3UAJD 2O6CA 3WEBA 4XP4H 2YSTA 2J8UE 1M71A 5BRPA 1E5CA 3UMTA 4J3UA 1UD4A 2XIBA 3GPSA 1HAUA 2JKWA 4NN7B 4JJOA 3H4FA 5LN8A 1N5YH 2VH5L 3H7BB 1H8OA 4ZUWA 2F5AL 2NW2A 2DQTL 4N9GA 1FO0A 2LHAA 5CGYC 2VIRB 1AZBA 4JZNB 1MCNA 1YMHB 2NYKA 5FB8B 5I1LA 2OZ4L 5IHUH 3PGFH 2WTRB 3O41A 1FNGA 4EEEA 4JKPH 2X4OA 1B4JH 5IW3A 2J6EL 1TTUA 4U1NA 4LASL 5E5LA 4PJFA 5KS9E 4KUCF 4YQXL 2CDEA 2GTWA 3FRPA 4KNSA 4JZJA 4V1DE 5KYXB 3CN3A 3MJ9H 5TH2B 4M6OH 2B77A 5C0RH 1YMMB 1CGSL 2CKNA 4U1IA 2Z92A 3D87B 4J1UA 3HI1A 1QI4A 4TQEH 5I6XC 1MJ7H 1BBJB 1DANU 1OALA 3L5WA 2JKXA 4YPJA 3MODH 4HHAA 4DZ8A 1QVOB 1QFWH 3PHOB 3WEMA 2QVFB 2C4FU 4KKBC 2WQXA 1P6AB 3FN0H 4MCYB 3CGTA 4HQQL 2X53A 1DVFB 1NFIA 1Z9OA 5DD1H 4NQEE 5DTFA 3BUIA 2DL2A 2DMBA 4Q6IA 2JK5A 3T5WA 3RTQA 3ARBD 4KQ0A 3KPSE 3LHPH 4OF0A 3V7AG 2X4RB 2LU3A 4DCQA 4GNKB 2EDXA 2MTPA 3EW3B 2O1AA 3K74B 1WZKA 4MS6A 4J3WA 5FEBA 4CW1A 1GHFL 1SQ2N 2FO8A 2WPGA 1FI8C 4HH9A 1LEKA 2XWTA 4G8GE 2FWOB 4WKXA 2Y1AA 3D69B 3RAJH 2XQBH 4Z77B 1J1XL 2Q10A 4LBAA 2B1HL 3IPEA 4Z7WF 2DIJA 2OM5A 4GKNB 4LCCA 3T2LA 3W0WB 3MBED 1OXYA 2WXRA 3P11H 1CGVA 3EGXB 2UVEA 5DJZB 2CGZA 5AFAA 1UJ3B 2MKLC 2YFOA 4WHTA 4HFWA 5JW4Q 1IJ9A 4OUUA 3IDJA 2P5EE 1GJIA 2HLFD 1HAWA 5DO2D 5KYUA 1FVCB 1IBFA 3FH7A 1OSYA 1PX4A 1LXMA 5E8NA 5CS7A 4P04A 1LHZA 3FT4A 1A4JB 1EA9C 1YRKA 4XBEL 4LVNC 1CLVA 3ARFD 1OAZL 5D1ZD 3MA7B 3GIVB 4Z3TA 1Q0XH 1MLCA 4YO0B 4KI5E 4NQQA 3EF7A 3BGMA 1U8KB 2UY6A 3IDGB 1MIML 3GJEA 4HLJA 2BC4A 5HGGS 5AW5B 4MRBA 4FTDA 3U4EA 1FP5A 1AZVA 2P24A 5D7HA 1UQSB 2PCXA 1A1OB 4AWJC 3EUUA 1CCZA 1E27A 1EXGA 2QVIA 4XOCA 1MCBA 2GK2A 2ESVD 3IJYB 4N0YH 3J8F7 4UILH 1GS8A 3HJEA 3ZU8A 1WFNA 4N6RA 3L1EA 1KTDA 1E8XA 3ET9F 2JH2A 3SDCA 4ZFOL 3HI6H 1OO2A 1AP2A 4AM0Q 2YD8A 3OGCA 2D03H 3QXUA 3CFEA 3CHOA 5C0EA 4GO9A 4NN6C 1ZE3C 4TM9A 4NFBA 5A1AA 1W0YT 3QXAB 4JGUA 4PRDA 1UASA 1RULL 4LK4A 5FHAH 3RVVC 2NY5C 3BSZA 4M1CC 4NNXA 1MCLA 2JI3A 2DIBA 2JSFA 3MLXL 3UC0L 4Z3IA 3UC2A 3VACA 1X7QB 3CIQA 1U4FA 3EIFA 3O6FD 3OHMB 1PMYA 3ZKNC 4LIQH 4PIBA 1CDHA 1SDDA 2XZAH 4W6WB 1CFTB 1JYNA 2EDDA 3RX8A 1S3RA 4WTXA 1ORQB 1S78D 1KIQB 3ZL4H 2HRLA 1OZTG 4IMLB 4F8LA 2A77H 4M9PA 1AD0B 3VXMB 5DO8A 4ZFFA 4JM2D 1G1CA 5DQJB 5A2JH 4Z7VA 4J5VA 5FKPA 4X5WA 1EFXB 1PTZA 1NIEA 1S9VB 1AOHA 1NC2B 4YXKL 1ZDQA 3X14A 4IM8A 3F64A 5DRZA 3MO1B 4XP1L 3N40F 1A7QL 1BIHA 4IW4C 4CU8A 4Q9CA 1NINA 1R3JA 5FYKE 4AQ1C 3T6ZA 4JE4B 5EORH 5D4HA 5IFHL 1BPVA 4F57H 1CL7I 2Y5QA 2IANB 3FTVA 1TNMA 4LKCA 3ULUC 3L2LA 4JFEE 4OGZA 3U0TA 2AEWA 3DPDA 3KD4A 4HDIB 4W6YB 2WINA 3O9WA 1IC7L 3NFNB 3MUHL 4MDJA 3JVGA 3BP6B 4BKTC 1SDAB 1EGJA 3BN9D 2W07B 4OQTH 4MQ7B 3SDAD 4HOMA 3EXJA 4YDJB 5GRVL 2VM4A 5AAPA 5K9JL 3U9UB 1PCSA 3WO4B 4ZO6A 3VWKB 3LTVA 4ZZFA 2VDRL 4FEMA 5I1AA 3LN5B 3FT0A 1RXLA 1J5CA 3RVUC 3K1DA 2KC0A 1S9YA 5T3ZE 4FQXC 4OJFH 1QNZH 4BWWA 2VDRB 3LJ3A 4U2YA 4NUGH 5E5MB 2ZXAA 1D5RA 3CFBA 3D3VB 4NUPA 3CDZA 4XN4A 3BPCA 4O2CB 4MNQA 4TVPH 1XV8A 3A6OA 4BKLB 2BXZA 4FXKB 4IRSA 4NN7C 5JXAL 1WE5A 2EO1A 3H2QA 4G11A 1URIA 4ZMQA 3LPGA 3H9HA 1BD2B 1LK3H 3OB0H 2JB6B 3SD5A 2BIQA 4XVTL 2BS71 2DJMA 4X2UA 1NGPL 1HEJC 4X4ZA 3UIZA 5I1CL 1CBVH 3X1GA 3QNYA 1U3HA 2ZOWA 2JQMA 1QMUA 3IDMA 4UM8A 2UZIL 2VAAB 5G2NA 2VQTA 1OGSA 2CO4A 3K6OA 5LWYH 1PG7L 4APQA 2L3BA 5BRZA 3QQNA 1U3YA 4HLEA 2J55A 4O9HH 1QHQA 4R83A 5C09A 1WRFA 2ATKB 4XPAH 5HHPA 1HHJA 2VLJD 2CDGB 2H9GB 3HAEH 1EBAA 1IVTA 2FJHB 2ZUTA 1A7OL 4IKLA 1TQBC 3OF6D 4U1LB 4ETQA 5F3HB 4ACTA 4HSAC 4LOUC 1JCKA 4QTHA 4NQDD 4I7ZC 4U1MA 2FYYB 2OPCA 4PJGF 3D18A 4G83A 4TVPD 2WGXA 3EOBA 5TF1H 5CLYA 2CLRB 2WSKA 3QO0A 4QRSB 3FCSB 4I5BA 2V3FA 4WWNA 2JWYA 3TCLB 2XN9D 3MRFB 1DVFC 2G5BA 5ICYB 3DRQA 3HG3A 4XNQA 2C26A 4I3GA 4P9MH 3CBKB 1GKOA 3FQRB 5GJTL 2DB8A 2HTLC 3DX8A 4N0CC 3V2AR 5K9OB 3B6SB 2WZAA 1HZKA 3LSOA 4GJTB 4F5CE 3D7PA 2J3SA 1VACB 3IAPA 3MRKA 4P3DA 4TL4A 2XBDA 1D5IL 3PWJB 4ZS7H 5IT2H 2LOEA 1PSKL 3OMIB 2Q3AA 2MPAL 2VLKB 2CR3A 4HJ1A 2K6YA 1ML0A 4ZPTA 2F18A 3C6SB 5AVRB 3V5DA 5DJXA 5DMKB 1P2CB 4Q4IA 1B4TA 4N2DA 4KMTH 3T3MF 3U30B 2E7MA 2X2JA 3B9EA 5HVHB 3ZHDA 4NQVA 1O9WA 5IVXF 1DJGA 5C07A 4PLOB 2BVOB 1OAXH 1O6SB 4WFGD 3V6OE 4YMPA 3VSQA 1SHMA 1VDGA 3ZR5A 4FQLH 4Q2ZB 3P77B 5KVFE 2AQSA 3ZZQA 4R4FH 5E70A 2EE3A 4Y4HD 5D2LF 3VGAB 1PZUB 1NANH 4JN1L 5K39A 5DURD 1U3NA 2OMWB 3L13A 4BDVB 3MKGA 1UB5B 2YRBA 4TUKL 4WUUE 2E74C 1S5IH 5H2BA 4G9DA 3QWQB 1EMTL 1PW3A 2ZAGA 4L1SA 3GK8L 3VFGH 4NENB 3NIFE 1ZA6A 2AJ3B 2D0FA 1A1MA 2DLHA 1FFQA 1VESA 1X7SA 2WZ5A 3OLEA 2YKLH 1XBDA 2DLGA 5D5ME 2X42A 4GP4B 3K3QA 5C6WH 1TTFA 3H3PL 3O3AB 4QGYA 3WMSA 4OZIF 5L8LB 3P3YA 5IOKA 3ATDA 4NJAH 4ELME 3FO2A 3H2PA 3UYOD 5FFGA 3KBPA 2NW3A 1KN4L 4ABVA 3ZSTA 4L3EE 4P9HH 4PV9B 4GSQA 3SDXB 3INOA 3QIUA 4IMKC 1RJYA 1IC4H 3ZT7A 4L2YA 3KBFA 3T6VA 3KPRA 4F9PA 3WY2A 5HHOE 2L0DA 3RKDD 2FATH 5ICUA 3BVDB 3HCVA 4C56A 3WN5B 2MHAA 1NAKH 1CVRA 1P4BL 5JHDA 1G7QA 2FSEA 4XCCH 3TV3L 4U0QB 4P3WA 3EOTL 1AZZC 2XPGB 2BRQA 4UAOB 1L9RA 2VNCA 2X38A 2ADIB 3AU1B 3UERA 4ZMAT 1RIUL 3TS8A 4KRNA 2MNJB 3RUGB 2J4WH 4JM2F 3UGUA 2D2CC 3OR6B 2XICA 2VM3A 3IU3A 4L1BA 3U82B 2B16A 5BUPA 4AKOA 2AAAA 5SWZA 5DA0B 1IE5A 3BISA 1DUZA 5A2AA 3ABKB 3OR7B 2YBGA 3AW5A 5GJSH 1NCTA 2WP3T 1I1RA 3TN0D 1QLFA 4WSKA 3TLRA 3HZYB 1XAUA 1WT5C 3GO1H 4NWTH 4QHUB 3K6IA 3T4YA 2BIIA 1NEZG 1Z9SA 1GY1A 5GGSB 5AOJA 1FFNA 1FYTA 3OAZK 3QEHB 3DKHA 1QBML 1HL4A 1KPUB 4LQFL 2ZJSL 1JWUA 3BKYL 1G1KA 4UTAL 3DJ9A 4KXZI 3WD5L 1NCJA 1RZ7H 3MJGX 3UL4A 3AWGA 4KDTA 1AXSB 3RPKA 2R15A 1GGCH 1NKRA 4YNYB 3P4OB 5IB5A 4PRIA 5ILTL 4PIRF 4I1PA 1DBKH 1WA0X 3MR9A 5KVEL 1MH5B 4X6CE 3MCKB 3MLUL 1MWAL 2ZXGA 4BIKA 3MZGB 4Z7WA 4KJPC 4PLNC 3BJ91 1KCWA 5C92A 1NIBA 4LL4A 4X0NA 2C9RA 1A0QH 5JIDA 3QUZD 4HCRL 1TLKA 3FS9A 4M5YL 4Z7AA 2DYRB 4I1RA 4QGTA 1QLEB 2AV1A 2UYLA 3UTTE 5JNYA 5KSVB 5EUOF 2OTUB 3S97C 4FXKC 1QHOA 2Y7SA 4HV8A 3DVNB 1JPGB 2XV2A 4PMEA 2IDQA 4DJMA 3APDA 1ZPLA 4GQZA 2AKRB 4M7ZB 1RU9L 4OI7A 4EAEA 3U0PB 1CK0H 4PGBA 4DOHB 4TULL 2OL3A 2RMNA 4GI9A 4D0CA 5FV1L 4PJHB 5EOTA 3U7WH 5E1AA 4L5FL 1A3RH 2XZQL 2EDEA 2CUAA 2EE0A 2V7NA 1PG7X 2WHVA 4JGJA 3V0JA 2HH0L 3E38A 4IRJB 4GBXB 1UM6L 3EOAA 3CZNA 1OWWA 5IJDC 2WCGA 1H5BB 1OQXA 5E0QA 3HG1E 5TE7L 2XWXA 4AUYA 2H26A 3KJ4B 4HIHA 5DSCA 2A9ML 1IGIH 4EJ1C 2RA1A 3QUYA 2BSED 5C0FB 1SF5A 5I19H 5I0YA 2QPFA 2BSDA 4P0DA 4P2YA 4JO4L 1KFAH 3VXNB 4XNXL 4OKDA 3Q6GH 1IGYA 1XGPA 1W80A 5FO9A 3TYFA 3D4YA 3GSWA 2FLRT 1I9RL 3GUFA 5D1XA 3SODB 2QV4A 3PNRB 1VFBB 2DBJA 1LILA 5KYNA 5F3BB 1RURH 3NEXA 1LGVA 2XNAA 3FAWA 4U1JB 4AGMA 3VFPB 1I1AB 2DN7A 3WDIA 4QXTB 3I3BA 1JZ3A 5EOCH 2WN2A 1PIFA 2C3VA 4ZX5A 5A2FA 3IMTA 1HHHB 1SEBA 4YAQA 5FUCC 4PYHA 4JZOB 3ZT6A 5HVHC 1MY5A 3ZT5A 1KCBA 3BP5A 4HAGA 5IEKB 3ZE1E 1KELH 4X6DE 3P0YH 4QPEA 3WBDA 2OP4L 1CLOL 5IESL 4ODTL 1EO5A 3FHAA 3OVUB 1Q9KB 4HS6A 5EZOH 3VXRA 3QI9C 1A6WH 4RMQA 4H4NA 2W1NA 1UM5H 3MRJB 5AAWA 2QADB 4M1GL 4F7EA 4FJYA 1CFQB 4PD4K 1JF1A 4NKOA 4TUJA 4P5TB 3SGEI 3KDMB 3QH3B 1I8MA 1MCDA 4KKCC 1M42A 5E2TL 4OJDH 3QYMA 3CNKA 1SBSL 2B3IA 2EVHA 3L95A 3CFIC 3QIWB 4TLSA 4R9HA 1AQMA 2NZ9D 3GLEA 5JW4N 3MZTA 3GB7A 1YECH 5T8IA 1M57B 2XFXB 2FJGA 3DXAA 3AXLB 2OK0H 4AE0A 2NYYC 1BF5A 5AVXB 2VLLB 1AKJB 2TRHA 1PZ3A 1R24B 4UOZA 1CE6B 3FNKA 1M3IA 1WCBB 1IC5H 2WWMC 3CUPA 4FL4C 4PJEF 2MJWA 4XMLL 4BUQA 3AACA 4WJG3 5INDB 3HS9A 1KN2L 3OXRB 2AV7B 3MTRA 4PB9H 2NR6A 5LBSH 3UTZA 2ATPA 2JE8A 2PCFA 1KLFA 5KYWB 3G5YA 4K07A 4KWUA 5CZKA 1B88A 3JTTB 5CJXC 2O61B 5JHMA 3TA3B 3IXAB 5E8OA 3WJMA 2JKRM 3GKZA 3LIZH 5CLTA 4MJJA 2MOQA 2DMKA 2R39A 4MXWH 2WLMA 4KPHL 5AVUB 2CCLA 1BCIA 4FA6A 2FJSA 1T6VN 3EH5B 3OLGA 3Q8EA 2BWQA 1EZLA 5DUPL 2YOAA 3RY4A 4GSDH 3VTMA 2ZWNA 3O4LB 5F9OH 3LH8A 4H1LG 5TD4A 3DA0A 3MV9E 3HLAA 3V4PL 1YJDH 2ZKHL 3FB6B 3RVTC 4V1DD 4PJIF 1A3LH 4XVUC 4GG8A 2ZUSA 4I48A 2XA3A 3MREB 2DD8H 5FWQA 3GI8L 4A2LA 4KX9A 2DTMH 4QHKJ 4Y5YB 2IQAA 3B37A 4XPGL 1JI2A 5FFOA 1WUNT 1TQSA 4H8WL 4I4WA 3S6CA 4JR9L 1E5ZA 2GFBB 3K2UH 4BE6A 4WNQB 2WV3A 4L9LA 5LGYA 2X4NA 3BDBA 2QSCH 3EO0A 4YS4A 4DAGL 3LZFH 4PJGA 4XNMB 2WLKA 1PLGH 1Q4NX 2GB2A 3VB9A 4F3FA 3IAGC 2MCPH 3QFDB 3QUGA 3ZE0E 1BLIA 4NQED 5EOCJ 3VD3A 4E5XG 4Y9FA 3QCVH 3P9MA 2A6KB 3H56A 4ZW5A 5IEHB 4MDRA 3KPSD 1E7VA 1M3JA 3ARBA 3MJ6A 5AW3B 4DGWC 2FB4H 4NRXB 4I18B 3V4VL 3V7AE 5JPMB 2VXVL 3JT0A 6PCYA 2N7BA 1FNSH 2XV6B 2CPUA 2C4FT 3R19A 1Q94A 4R5XA 1LVEA 4L9DA 5KUMA 3V4VB 4G8GD 4P2QE 2PO6D 3WHXA 5HJGA 4AQ8C 2J1XA 4PW9A 1NFAA 2FR4A 4L0PB 1MREH 4RMWA 25C8L 3DURB 4FNUA 1R5WA 1VEPA 4QRRB 4TF4A 1JPFB 1WZ1H 2AMGA 1HH9B 2WCPA 4U1GB 4OLXH 3ETSA 5C08B 3K7UA 1F3JB 4S1QH 3GINA 5DUBA 4HXAH 2P5ED 1IM9A 4JFQA 5C9JA 4KROB 1M71B 5GZOD 5CAYB 3TH3T 3FU0A 2FDBP 3BWUC 1OCWL 1JGIA 4D8OA 2BDNL 2CRIA 4MA7L 4W9HC 1JFQH 1N10A 4ZUWB 5A7EA 4JFSA 2NW2B 1ZY9A 2X9YA 4N9GB 1S2EA 5D2LA 4OGAD 3U7YL 1L7IH 3ARFA 4M7ZC 4DUVA 5I1LB 5CUSL 1ROWA 3B7SA 3O41B 1FNGB 4KI5D 5EO0B 5TQ2L 3S3DB 3T4AA 4ZMVA 3IE4A 3II2A 2IQ9L 3PFUA 5JA8B 3BN3B 4U1NB 4KKAC 4ODWA 5M94B 4PJFB 2R1YB 4KQ3H 4PJDF 4G6AC 5FS5A 5C7XH 3RWHA 3FRPB 4JAMA 4WDIB 3IPFA 4JZJB 3MBXH 4HJ0C 4ES8A 1I31A 4LLQA 2F1EA 3QIBD 5DD5L 1RP9A 4IRJC 4GBXC 4UNUA 3TH2T 2W59A 2WQVA 1HHIB 4YHZH 1A9VA 4J1UB 3T2NH 3HI1B 2GCYA 1BA9A 4M9OA 2ESVA 1H5BC 1TETH 5CCHE 4A2EA 2DJSA 3FFDA 3L5WB 4Y7MA 1EHLL 4HHAB 4S1SH 4DZ8B 5CEYA 4OZIA 4IBZA 1EO7A 3KJ4C 1JI1A 3HRZA 3OC5A 3LEXB 5JYLA 1JWSA 4BZ2L 1ZRUA 1NFIB 3U4KA 3VH8G 3VXSE 4WEBH 3V4LA 4Q6IB 1C08B 2JK5B 1T3FA 3RTQB 4H2CA 1QACA 3DX7A 5FYKH 2OX5A 3CFNA 5DZOA 1E40A 1KTBA 3KGRA 4G6ML 3C5ZD 5TDOA 4BQCA 2XTLA 1AGEA 3HA0A 4DCQB 1J0JA 3STBA 3KGUA 1BZQK 1MG3C 4CW1B 3G5VB 1QW8A 3QZWB 2EO7A 4ZSOA 5CBEB 1E2VA 3FUIA 4U05A 3O6FA 4P2OB 2YS4A 1E90A 3CDYA 3F00A 3KEHA 4GFTB 4IEFA 4H8PA 1MFCL 3C08H 3ZRFC 2Y6TE 5A2CA 3IJSA 1DDHA 4FYTA 4LCCB 2HPOA 3SO5A 3UTSA 5L6YH 4GKZB 1IRAY 4ZTPL 4JM2A 4N1CA 4PCYA 1U8HB 5T3ZH 2EE9A 2X1PA 1MHPL 3LRHA 5F0JB 2X70B 5JMRA 2FEDC 5KYUB 4ZD3L 3LKPB 2A4CA 5E8EB 2W0KA 5AQ0A 5EOQH 4D94A 5FYKD 2J44A 5E8NB 3C5SA 2QADC 3EYSH 4NYLA 4P5TC 5EBWA 3MGTB 4NNPL 4JFED 1L9PA 2FJUB 5IW6A 5MP6H 3BP4A 3ZZ1A 1QKZH 4Z3JA 1IAIL 3QIWC 1W9XA 3BGMB 4HIJA 4ZMYA 1A25A 2UY6B 1CXHA 4LL1A 4WWOA 5CKGA 3CPLA 2PWFA 3GZOA 2F54E 3NIDB 5DF0A 3NACH 1OSPL 5GGQH 2Y36H 4M61A 3GIZL 3M1BB 1TNNA 1E27B 3W82A 4JY5L 2DWDA 1CFSA 2B4CH 2OTPA 5BO1L 5T3ZD 5I1IL 4M8UA 2FNWA 5KOMC 1KC5L 2QQLH 3RIAF 2J8UF 5AW9B 3MNWA 4N6RB 4JNXA 1KTDB 2MNUA 2YD2A 2E7LA 1F4WL 4AEIL 4GUPB 3LVEA 1SOSA 1J5HA 1AP2B 1UB6B 1V10A 3CFEB 4WWPA 2WBWB 1SXSA 3TYGL 4S1DD 2ID5A 1NLDL 5EG6C 4Y1AE 3TA3C 5KW9L 2QPSA 1JPTH 5EUOA 4AMXA 2KH2B 1I7UA 1KJVA 5C2UB 4TTDC 4HBCH 1A1NA 1QD0A 4YHYB 1Q72L 2HRHA 3BUBA 5KS9F 4OQTA 4ODSL 1J1PH 5HYJE 2MWCA 2RGSA 4IIQA 1IAKA 4WHYH 2AERT 3GMQA 2WLIA 3WKMH 5IQNA 1NAML 3ZYJA 1SDDB 1IBYA 3WUWG 5DMGC 2BNRE 2PLTA 4P5KA 1HXYB 1RHFA 3UG5A 4RQQA 3NK3A 2BW5A 2BOCA 3V8OA 1NAMB 2HLEB 4ZQTA 5FM4A 4JDZA 4Y5YC 3CQQA 1YNKL 2YD9A 4DKEH 4ZFFB 4KGLA 4JCWA 5E5UB 3ZMNA 2ZIDA 3ETBJ 4NQDA 1E30A 3D06A 4Z7VB 4ZYKB 3KLDA 2N0KA 4X5WB 2VQUA 3HBZA 3NCWA 3UYRH 3JWDC 4N22A 1KLGA 5FOBA 3D30A 2UXGA 3MLWH 1UURA 9PCYA 4H8WC 4RBPH 4MB1A 3VVVA 5DRZB 5KVFH 3NAAH 5E8PA 1SPDA 5DZAA 2PXYD 1R3JB 2BHFA 5IREA 2Q5BA 2DPKA 4GSXA 1KACB 5E7BA 5A6LA 1E8YA 3VNZA 4PJ8B 4LKCB 4FNQA 3TT1L 2WINB 3PV6A 3O9WB 4PWJA 4U1HA 5JPMC 4MDJB 3A23A 4N2BA 2B5IB 4XO3A 3QO1A 5DLMH 3HAEA 1N0LA 2XYBA 3MTXA 5D6DC 1CS6A 1G6RA 1H3VA 1SVZA 4PSRA 5F7AA 4X8CA 1SHXA 2WZ0A 1NMBH 4J3OG 4LAJH 5FDWA 2BNUA 4N6QA 2ZOKA 2WUCH 4AXWA 5B7FA 4YSAA 3MLRH 4C83A 3GHBL 2G9HA 3F5WA 1CU4L 2G2RB 5EHFA 3BH9B 3E9UA 5ICZA 4DKTA 1KXVC 3CFBB 4ZMZA 1D2OA 3CDZB 1S9WA 5PCYA 3BPCB 5M95B 3VRJA 4MNQB 4CMMA 1M1XA 4KROC 2BLFA 1PD6A 1HNGA 4Y2DD 4Y4HA 3U36A 5HHME 2WKGA 3BQUD 1L6PA 3C6LB 3H9HB 2EXWD 5CR1A 5IBTL 4WUUD 4KI5F 4HC1L 4O02L 3SE4A 1CT8A 4OCYL 4YFLF 2XWBA 3JSSA 5EF3A 1NCHA 3QNYB 1U3HB 3UBXA 2EKJA 3IDMB 3O0LA 4UM8B 2XWJA 4CJ1A 2LU4A 4EDWH 4JW3A 4APQB 2E6JA 5IQ9A 3RP1A 5L88L 1T5WA 1VGEH 2HJFA 3B9KD 4JZJC 1AHMA 1HHJB 1ORSB 3FXIC 2W0FA 3KLHD 1DYZA 3ECUA 3QCUH 4NPJA 3AM8C 5EU5A 3QEQE 5C8JB 3EFFA 1N6UA 2EH8L 5CP3H 4ETQB 1U8IA 1BVLB 3BVWA 4WK0B 1BOGA 3BFQG 1QYGH 4XC1L 1CBJA 5I9QB 3D18B 4X6BA 5IB3A 2CJ3A 3EOBB 4L3ED 4WTQA 4MAUL 2JTDA 1J1OH 4OD1H 2PPCA 3A47A 3MJ7A 1U8QB 2C1PB 1XGUB 3X11A 4X4ME 2G5BB 3DRQB 5F7EL 4HIIA 2TRYA 4XNQB 3DX8B 5TE4L 3ZYIA 5HHOD 3GDBA 4PJXE 5AB1A 3B5HA 4F80A 4HJJH 1LJMA 1NGXB 3CX5J 4P3DB 3MRKB 3TNMA 3ML9A 4XPFL 1GPOH 4RNRA 5BVPL 3PXHA 2L7JA 4ZUTA 4NKIH 1KXQE 2WD0A 4NFCA 3A3YB 2XWCA 4P2OC 1YVLA 3PREA 2X4PA 4YR6B 3V5DB 5DJXB 2J21A 1WZLA 3AWFA 4WFFE 1Z1WA 3BEWA 2Z7YA 4QAWA 2P8MA 3B2UD 4GQQA 4PJIA 5C0DA 3MLSL 4LRNL 1Y6NR 4MZ3A 4NQVB 4Y4FA 1YN6A 4Z18A 5C07B 5HTSA 5FCUH 2WP3O 2CRYA 3T8VA 2AQPA 1PNDA 1M6OA 1KTLA 3A4AA 3O3BA 1UT2A 5F7BA 2XRAH 4R7NA 3H7LA 3AITA 1H3PH 3TN0A 3W11D 4G70B 4XN5A 2JLLA 2VO8A 3ETBF 1N2RA 3IJ8A 4AM0A 1ASQA 4FX5A 5K69A 2LVCA 4WLCA 1HSBA 3PAUA 5JORA 1HWWA 1F4XL 5GGVH 4KV5E 3UBFA 1IKNA 1WTLA 2HT3C 3VSVA 5H2BB 4N5ED 4C55A 4G9DB 2PP9A 3BMWA 1FIEA 4XN8A 1ZA6B 2DKMA 4G80B 1UT9A 3WEAA 3O2DA 3FO1A 5E9DB 1DQDH 1Y1DA 4PLJD 3F7KA 3LRGA 4QXGL 2NCMA 3IDIB 3LZNA 1UOKA 1VPOH 4L1LA 3L3GA 5SWQA 4M1DH 2WQRA 4FQ1H 1WBYB 2P46B 1RKRA 3FO2B 1XF5B 3S35L 3VE0A 2NW3B 2WQSA 1ZHLB 3OZ9H 4YWGL 5T1LD 1RVFL 2CO7B 3QUZA 5EO1B 1E5BA 1FFOA 3UTTD 5KVDE 5FYJL 4KQ4H 3QIUB 3SE3A 5D4IA 1IGMH 4DK3A 1RJYB 2NNRA 5PAZA 3OD3A 1BFVH 5KTEL 3MMEA 4TQPA 3KPRB 3X2QB 4ECNA 4PB0L 4N0FB 2Q7YA 4UIMA 4W9DC 3E2HC 2WKLA 4PJ9D 5AW4B 4YHYC 3CXHJ 4C56B 4Q14A 3NESA 4PBVC 4PS3A 2VZVA 2BX5A 2W8CA 3ULUE 1ZV9A 4RMVA 4WJKB 4OB5L 4AY0A 2G5RA 1FH2A 1R5IB 2F53B 2O5XL 3TO2A 4LVHC 4YSTA 3D4ZA 5D2NA 4PJDA 2DDQH 3DMMA 4NO5A 3GSRA 4NAQA 4LDEB 2OA9A 3IU3B 3P0VH 5AVTB 2L7QA 3NCJH 1C5CH 5SWZB 1BLNA 3HG1D 3KVDD 1SMAA 1E65A 1QO3A 5H37G 3RVWD 1HNYA 1IFGA 2V5TA 4GMSL 4DQAA 5I0ZA 1IBBA 5IJKA 2GITA 1NGZA 1BVNT 3GYRA 5C6TH 1JDCA 3EJYC 4IKKA 1U93A 2BSEA 1TCRA 1AZCA 2AABL 1AR1B 3E6FA 1SMOA 4XMXA 4F37F 5IY5B 1KCKA 4QDGA 3T6WA 4HOXA 3SBPA 1Z9SB 5EUKA 1FYTB 2VKWA 4FQCL 1ADQL 3TBVA 4PJ8C 1E4XL 4FFWC 2EDWA 4U1KA 5IKCA 2OV0A 2P42B 3RILA 2JKNA 1NCWL 3RURA 3HC2A 4HIEA 4Q7DA 4BH8B 1JGVH 3D12B 2MOVA 4YDLB 1RZKL 1UWXH 4UI2A 5IB5B 3WHE1 5EU7C 3MR9B 3IFPB 4OF7A 3VWJC 4DP7X 4EUPB 3U4AA 2ADYA 1YEEL 1ZJBA 2DWSA 3QB7C 1F2QA 1IQWL 1E8ZA 4OCXH 1G0DA 2Z31D 5FK9B 4JREB 5HDBB 4A04A 1YMME 1F6AA 1N18A 1IJNA 3OAUH 4A7SA 1CL7H 2BY2A 1H3XA 1A6PA 3I85A 2F7PA 3IDNA 1JHKH 1TFPA 4HV8B 1A7RH 2WVTA 1NCCH 2AXJA 4IU2A 1DBJL 3C6LC 5D71H 1F3RB 2VCOA 3NIFF 3X1NA 2BSRA 1VB9A 1AIFA 2G75A 1ZLVK 4MJHA 1Z32X 1BG9A 3IFNH 4PGBB 3DX9A 4OLZL 1U3HC 2OL3B 3KLAB 1YY9C 4MGXA 4D0CB 5EOTB 1HHKA 4M5SA 4LEBA 4CJ0A 3BGAA 5E1AB 3RVXD 5E1QA 2VDPB 1JV5A 1NCBL 2V7NB 3JV6A 3BH4A 2H6PA 1B0GB 3UZQA 4RDQG 4QRAA 4XOAA 4U31A 4MQSB 3K6SA 1WFJA 2E4FA 4FN0A 2V17H 1YY8B 4TQHA 2EDRA 1OPOA 2H7WA 2BP8A 3OX8A 2E0PA 4WFEE 5I9QC 3W2DL 2ZWSA 4MB3A 2AXFA 3OLIA 4HIHB 1KBGH 4M02A 3W0WE 1RSYA 1QX1A 5DSCB 2J8UA 1G7HB 3QUYB 2IH3B 3CE1A 1RZGA 2GSIA 3B7UX 3UTPE 1UCTA 3J7HA 1C16A 3KLSA 3IN0A 4X98A 1YNTF 5INCB 1IGYB 1XGPB 3QYCA 2KLRA 1UM4L 1PJWA 1TEGA 3GSWB 3TYFB 5IBLD 1DQMH 1BAFL 3VVWA 1RIHL 5FO7A 2B20A 1ED3A 5HDQH 3UJIH 3MV9D 2D7TH 5E08L 4B53A 3QNZA 2C3VB 1NGQL 3JWNC 4G59C 4V1DA 4HULB 2PMZA 2WBJA 3KYKH 5DC4B 1SEBB 5F0MB 3PL6A 4YAQB 1WBXA 1V7MH 2IAMD 3FRPG 3TP4A 5IV2B 1UWEH 4YSDA 2EDHA 4GT7A 5LBSA 1NLBL 3NEOA 2OXGA 4OLVH 2A2QT 1JVLA 1A6TB 5IB4B 2BM3A 1I9JL 2DKSA 7PAZA 2J5LB 4EKJA 2NT1A 3VXRB 5D72L 2A73A 2RQEA 3IRPX 3LIZA 4YHKH 4NQEA 1JZ6A 1DJZA 2GSMB 4P57B 3B2PA 3WS6A 1UOWA 4F7EB 5SX5H 1JF1B 2XKUA 3KPSA 2PCYA 3GS4A 4NKOB 4TUJB 5FM5O 5LCVH 2P45B 4ZMLA 4IBVA 3FQTA 2OJZL 1OE2A 1UA6L 2IBBA 1I8MB 2H45A 2XG4A 1OAUL 5FOJA 3QHFL 2A4ZA 4LPXA 3U2JA 1YHPA 4MAYD 4CSPA 4DZBA 4P2QD 1ZV2A 4G8GA 4X6CF 2PO6A 3GSOB 4FZEH 4DP1X 2FJGB 3DXAB 4R6UA 3MQIA 1TUPA 3EJZD 5E6RB 4X80L 4S2SA 3HE6B 3FL7A 2EC9T 1IBDA 3A67L 3QPXH 5CLZA 3S88L 1T5XB 2VW6A 3QZLA 2NY0D 5EEWA 5D8JH 2DI8A 1EEQA 4CU6A 3WIFA 1JRHL 1YEJL 4TNWF 4E36A 3UTZB 2G0KA 3DK0A 2PCFB 2ATPB 1I7TB 2PKDA 2P5EA 1K4DA 1D6VL 2Y2YA 1KLFB 4XRCA 1T7VA 4XPHL 3CLEL 3CDCA 3G5YB 3VXME 5GZOA 5KAQG 3IMVA 1NBVL 5CJBA 5D93C 3ROOB 4BFFA 2W9EH 1T20B 3QIUC 5E8OB 3WJMB 1FBIL 3OKMA 5IK3A 3CSTA 4GOSA 5BO0D 1GA2A 1X5HA 3M86A 1G9EA 2AEPL 3ARZA 4LHUA 4RIRA 1MRCL 4AYGA 1YEDA 2IGFL 5IQ7H 2Q76A 7TAAA 1MELA 1Z0NA 3G6DH 3OKYA 1XR8A 2IANE 1KOAA 1DDTA 5A43C 5D7JC 4HHGA 4AV4A 3HLAB 1H3WM 1OE1A 3HVNA 4HZAA 4F7TA 3V0IA 2EDOA 5DZLA 2V3DA 2WB7A 5GISH 4BFBD 3AS0A 4GG8B 4RGMB 2C3HA 2D73A 4I48B 1FLTX 3B9AA 3LPOA 4Q0XL 1ASOA 2NDGA 1JPSH 4LZKA 3BE1L 3HBQA 5JHLH 2IQAB 1W8NA 3PDOA 4I4WB 4OM0L 3QUMA 1NCDL 2YC1A 1BQHB 5GSRB 3K0YA 2NY3D 5LGHL 2N1KA 4FG2A 4L9LB 2X4NB 3EO0B 3ARUA 12E8L 2YKKA 2YR3A 2JI1A 1ZS2A 4P06A 3ZDYE 3WY4A 1T89A 5T3XL 4F7PA 5ABAA 1AR1C 1GGBL 3VXSD 3D3VE 2R0KH 1CO1A 3P9MB 4JKMA 1OKEA 3FU8A 2YMXH 4U6VL 1SUHA 5TFSL 1I8IA 1R33A 4BCYA 1A7NL 4MA8L 4ABWA 1A7PL 3EDFA 4AGQA 3FSWA 1BD2E 4JQVA 1KB5L 4EIGB 1Q94B 2RCSH 3QULB 4Z78A 5HVFB 4GIAA 2PCPA 2I9LA 5IB2A 2Y72A 1AQDA 2Q7AA 1UWYA 5CJQH 3WHXB 4YDLC 4S10A 3OAYK 3G3LA 2ZXEB 3TZVD 5JO5A 2FR4B 3B9VA 2EDYA 3T8XB 2R83A 2Z4QA 1F56A 1PIGA 1ND0A 3D5OF 1R5WB 2VITB 1RZKC 5DJDA 4BQBA 2GBUA 2F1AA 4JY6A 4K8RL 3UP6A 1C12A 2CPCA 4WI8A 4I0PA 2ZCLH 4JREC 3O6KH 1WAAE 3DUUA 4UQIM 5DUBB 5CINL 2KLSA 2TSAA 1IM9B 4YXHL 4WWID 3EFOB 3IDXL 5C9JB 3P9WB 5J89A 2H32A 1V3JA 3MOAH 3WLWC 1FH5L 5A2KH 1D6EA 1MJUL 1XXDC 3HBGA 1HEZA 4W9LC 5GRUH 4IQHA 3T0XA 2WLHA 3MCYA 3WTVA 1N12A 4KXZH 3KDPB 5D2LB 1IIIA 4RDBA 3ARFB 3CLWA 4GAGH 4WGVB 4XBGA 1LO3H 3EH2A 1E9PA 3MRHB 1ETB1 1TZGL 2XU9A 3HMWL 3T4AB 5ADPL 4HG4J 4A6YL 3OKEA 4CNIA 4Y16D 3BYTA 2HRPL 3QWNA 1ACXA 2WAQA 2I07B 2F54D 4ETYA 3RWHB 4JAMB 4AX3A 5E2WH 4BZ1H 1LMKA 2VLKE 3EO1A 2GABA 3VFUB 5KSAB 4AI7A 4LLQB 4RESB 4KK8D 2WMPA 1EUUA 1XEDA 5ES4B 3BZEA 4JFZL 2NNCA 3NYKA 2R69H 1X5ZA 3ALPA 5TE6L 3RFZA 5F7DA 1MNNA 2FECL 3CSBA 1FVDB 4XPBH 5L9DL 5FUCE 3MUZ1 2HWZH 3FFDB 3SKOA 5CEYB 1A66A 2ZUXA 1RQ5A 1RZJL 3B7TA 4X9IA 1JWSB 3IK2A 3QUYC 5BZWB 3TBSA 3OZLA 3BKML 2X6BA 4X5QA 3FTSA 5I1EL 4Y1AD 1DQQA 1XEUA 2WJ7A 2OBGA 4NO3A 5AOZA 4M43L 1OARH 1UCBL 4M7KL 2P1YA 1T3FB 3NZHL 1SJMA 3SYQA 4DT2A 4LF3B 2OX5B 4ISVB 5LAXA 4DO5A 3QQDA 4KJWC 3OGOE 1AJ7L 2OJEA 1TJHH 5TDOB 2R0LL 1AGEB 4G7VL 3WFEL 1Z66A 3PE9A 3U7AA 1VA9A 5HYJD 4ZT1A 3S37X 2R8SH 3NCFB 3O6FB 2WTPA 3QUKA 1D5ZA 3CD4A 5C71A 4OCRL 4IEFB 5FGBA 3T0WA 2BNRD 3UBGA 1U8OA 4Y1SA 3ZTNH 3IJSB 2Q7NA 3UTSB 4YJZL 1K3ZA 1G0YR 2E59A 2P5WA 3L4YA 4D9RE 2FE0A 5C0JA 2OMZA 3DVGA 4K0OA 4K4KA 3ZE0F 4YE4L 3QDJE 2KZKA 3VFVB 2WVVA 2J5LC 5MERA 4AT6A 1XTLA 4P59H 2PXYA 4P07A 5JUEL 2BMKB 3GNML 2DWTA 4UUJB 5EC2A 1SY6L 2VM9A 5EBWB 3SDXE 3UPAA 4F5CA 4BA0A 2O5ZH 4P5RA 5CGYD 1E9OA 1ZIAA 4HIJB 1TDQA 4NZ8A 4LBEB 3CPLB 2XVKA 2V9UA 4NC2B 1HKFA 5AD0A 1EO8H 3HE6C 3FTYA 1OGPA 4JB9H 3T2QA 2AF2A 4M61B 1TQUA 1V8HA 3C12A 1LO5B 4DWHA 3FUHA 2DWDB 3KHOA 3PAVA 4Q8BA 3RUGE 2AQNA 3V6OA 4FI7A 4OUOA 3LNGA 1U6AH 3I6LE 3RZWA 4CU7A 3SGEH 5GGTL 4BH7A 3LIUA 3BUPA 4WY7H 4YHLH 4Y2DA 5HHMD 1GZQA 1AE6H 3BQUA 1CF8L 5C86A 3SQOH 4KKBD 5DJAA 2H1XA 1CC3A 3W81A 4DGVL 1I7UB 1KJVB 4WUUA 1IC1A 1S7UA 4KY1L 1T83A 2OKMA 4MCZB 1JYWA 1V54B 3NJFA 4G9FB 4QYOA 4RMSA 1QRNA 2ORBL 4IIQB 1IAKB 2Q2EB 3HNTH 2VDLL 4BFOA 3GMQB 2WLIB 1QFUH 4PRAA 1CQYA 5DUMH 1JHLL 4DF9A 4P5KB 1I3GL 4RGMC 2VDLB 3N44B 3QEQD 2WYIA 2BOCB 5CGBA 5EWIH 1J9TA 4IIZA 3IVKA 1FNAA 3BD3A 3L7FB 1WPCA 4FDWA 3MUJA 2V5MA 1HXMA 1LQSR 1CDGA 2J8OA 2XZZA 4L3EA 4LOFA 3TL5A 3LQAC 1KLGB 1OGAA 2QHLA 4L9LC 4MS8C 4WTZA 3V0AC 4F2EA 5FOBB 2H3KA 5KVEE 1I3RA 1MFDL 2OS7A 3LS4L 5E8PB 5IW1A 3WOVA 2CO6B 4NI3A 2RFXA 4LNRA 3JUYA 4E9SA 5I73B 5HHOA 1MQKH 1TIUA 1HKLH 1QBLL 2CDFA 1SF3A 1KF9B 1YNTA 3PV6B 2JJTC 1ZE3H 3FQNA 2PWHA 4TTGA 2HZHA 1FFRA 2UZYB 4DOHE 5JIMA 1BVNP 4WFFD 3BAYA 3SE8H 1KLUA 1N0LB 2NY5H 3NABH 3EO9L 4LXFA 4XP6L 4PJHE 3H6JA 5CP7A 5ADOL 4I2XA 4JJHA 4UINH 1G6RB 5AUMB 1EJ6A 1C1EH 4Y7OC 5CP3A 1MNUH 2CK2A 2BNUB 1T2QL 2ZOKB 4AXWB 1PBYA 4HT1H 3WY3A 2G9HB 3F5WB 3RL2A 5LGKA 3GUTA 2QTEA 2XVBA 4J3XA 1QUNA 2C9XA 4L5FE 2EE2A 3HB3B 2VSKB 4OIFA 5ICZB 1A6AA 1FPTH 5B21A 1TTBA 1S9WB 4K8RC 3NSCA 2XX0A 4YBQC 3VRJB 1M1XB 4WRLA 4CMMB 5I6KA 5B22A 5IJVB 4D9QE 2PPFA 4Y4HB 3B3IA 3U36B 4XO4A 5KVDH 2ZPKL 2FBJL 3GJFK 2Y22A 2J6WA 2NT0A 2LABA 2VUOA 4PJCB 4S0TD 1KYDA 1NFDF 4XP9L 4ODVL 3AWEA 5DURB 3I2CH 5IBUG 1KCUL 5TDPA 1A9BA 2K7PA 2XWBB 1SM3H 3WFHA 4XODA 3UBXB 5GZNA 2R56L 3IMRA 4R0LA 3T4AC 2VMEA 2AMUA 2XWJB 3VRLE 2GI7A 2KZBA 3RVVD 3ZLQC 1CLYH 1X9QA 4M1CD 5DMYA 4Y5VA 3PG2A 1T5WB 1BECA 4XHQA 3ULUH 1MIEL 2IOMA 5I0XA 2OW7A 1CD9B 4KKRA 2I32A 3DYOA 2XA8H 1WIUA 3Q8FA 4MMXA 3JV0A 4PFEA 2W0FB 4X6CA 2FQFA 1OP5H 5HYQA 5KSAC 3ZKND 5E03A 2Q8BL 2ZSVA 4JFPA 1U8IB 3FB8A 1Z5LA 4HUVA 2AJVL 4GUOA 4XNAA 1IARB 4BJLA 4LARL 4URKA 2A9CA 5IB3B 3CG8A 1PZ5A 5FKAA 1XIWD 1FRGH 3ECBA 3JZ7A 3UDWA 2HP4A 2NSMA 4RGNB 4R7LA 5D7SH 3UTTA 3MJ7B 3HE7C 4G8FA 1KDJA 2F7OA 5HYIA 1RZJC 3E1ZA 1J5OH 4TNEA 4IK6A 4FAAB 3ESOA 2CXKA 3AQDA 1KNOA 3DSFH 4WWKA 3BD5A 3BC9A 5E99L 1VRSA 4TOYH 4MMYA 3TNMB 1J0KA 4IDLA 2R0ZL 4RNRB 4JCLA 5CBAA 5AAMA 3KL3A 3ULUD 4EE2A 1DE4A 2G5UA 2FX7L 3ZKMC 2X4PB 4WEEA 4U0RB 5BUAA 1F2XK 1Z2KA 2GC7C 2J25A 4L1HA 1G84A 1A7BA 2DQTH 4AH2B 2QT6A 2XFGB 1X9RA 4BYHA 3WFCL 5IT2L 4WGWB 1WH0A 1R3LB 2OZ4H 2O26U 4Y4FB 1YN6B 3RX5A 3CZLA 5LQBH 4KAQL 3T08A 1T2JA 5E7FA 5JOPE 4OAWA 2J6EH 3RVUD 4LASH 1M6OB 2C9SA 5KG9B 4L18A 4MJ5B 3H55A 3CFTA 4FQXD 5JHAA 4R7NB 3KWXA 4A2DA 4LCVA 1I82A 2VLME 4BSVA 1I4FB 2WQ8A 4APXA 3NIGB 1QFOA 2N4IA 3SPVA 2EDFA 1CGSH 5JORB 4PWFA 3VDCA 2FX8L 2F5BL 1NQBA 4YGAB 1SJHA 5CZVL 4UMSA 5HHNA 3W9EB 4KMQA 4JANA 3WTWA 3L9YA 1QFHA 1DO5A 4HQQH 3Q2WA 5DQ9B 5ID1A 3BOVA 2VAJA 3FO1B 3O4LE 2DBLL 4XVJL 4F9LA 4OJCA 1VSCA 1FLRL 1JTPA 3EFDL 2H8PB 1NDMB 4D9LL 4B9CA 3L3GB 5SWQB 3QFJA 3BWZA 3H2WA 1UKSA 5CJOH 3SPHA 3KWWB 2FO4A 3VE0B 2VXQA 3C9NA 1GHFH 5LO7A 1YMMD 3DARA 4WV1B 1I7RA 2E7LC 2G3NA 4F7MA 3BZ4A 3VMOA 2VDKL 4LOUD 1FFOB 1FIGL 4K94L 1EVTC 2OTWB 3MXWL 4NP4L 5ACMA 2Q86B 1BJMA 4B27A 4J39A 3EZJB 4ICXA 2F08A 3CJJA 3HPLA 5IIEA 4LVEA 3WXVL 3MLTA 4GSRA 5SX4I 4N24A 3IF1A 4GO8A 5E6IC 1DVFD 3QS2A 1BPLB 2FH6A 3KS0H 4GAFB 1VADB 2IFGA 5I6OA 2HTLD 4N0CD 2AK4B 5J3HC 4X4KA 2CM5A 3WSQL 3WE1A 2XQ0A 4L3CB 4H26A 1XHHA 3APFA 3WIHL 5T5FA 5CF3A 3EBAA 4YZWA 1K2DA 4DKAA 5CM1A 3DMMB 4NO5B 5E51A 3GSRB 4EIZC 2CGYA 3IFOA 3I75A 3P3TA 4WI9A 2FZ3A 1D7BA 3QYNA 3D08A 2XIIA 4WFED 2R27A 1QO3B 3EYQC 3U1SH 4QRRE 3W0WD 1HOCA 3DV4A 2GITB 4A38A 2F74A 1AH1A 3QZPA 4RFEB 5C08E 3MCLL 3UTPD 1AG6A 1TCRB 2YWZA 4OLWL 4PJXF 3K8KA 4LEOA 4ZMXA 4HKZA 3MRCA 1L0PA 3HC4L 5E00B 5EUKB 3TBVB 2AI0H 4QCIA 3NBNA 2LLNA 2YPKA 4MXVE 5F88A 3SPJA 4U1KB 5L4MA 5IKCB 2Y6SC 5KYYA 2W81C 3VM7A 1GJWA 1R46A 1D2PA 3GRWL 3OTTA 5B39G 1N4XH 4HIEB 4N2CA 4FXLA 3M8OL 4QJ4B 4F27A 4G8IA 2AP2A 3SYPA 5C0CA 2WJ5A 3PWVA 1RULH 4Z7QF 4FFYA 4PJFE 3CVCA 1LE9A 1F41A 4Z8FH 2Y06L 2Y9RT 2IAMA 3WJLA 2KKQA 2P80D 4XMVA 4W9FC 4PMFA 5J13B 2DQFB 3MLXH 3EKCA 1P4IL 4OU3A 4HIXH 3HB3C 2DMGA 2MMXA 2W65A 4DN3L 1JXFA 4NQCB 1N7ML 2OMXA 1EZUA 1X5FA 3IXTA 4ZOCA 3S36L 4A2GA 1BDYA 2XPZA 4PUBL 3QQXA 4KV5F 3QG7L 4WEMB 4IU2B 4JX0A 3QQ3A 4L48A 1MJ8L 4PAZA 3ARPA 4UBDC 5DVNA 1BF8A 3NJVA 2B1AL 4KZEH 2D7QA 1GMEA 3HFML 2BSRB 4TLUA 1AIFB 2G75B 1BQUA 3DX9B 4G3YH 5GGRY 2FLMA 4YXKH 3CHSA 1B6DA 5F9WB 4MAYA 2IWKA 4CC4A 1KJ2L 1M7XA 1ZHBB 2VB5A 2PP8A 4P2QA 5EZIL 3TIDA 3TNNA 1XSOA 1JV5B 3JV6B 2J71A 1Q9WB 2CUIA 5IFHH 3MC0A 2H6PB 4XMZA 1NM9A 1HH6B 3UZQB 4D8PA 1EJOL 1NMAL 1KB9K 1AQKH 5AOIA 3K6SB 3K0WA 5B38B 1CN4A 5ESVB 5I8EB 3KLQA 4QKTA 2BP8B 3IKCA 3KS0J 1CMOA 3O8XC 2AQQA 1M7DA 4Q52A 2AXFB 3VXMD 1FZMA 5K9JH 1T03L 3LDBB 3MUUA 4GRWF 4HKJA 4IKIA 2XZCH 4RGNC 2VRQA 2GSIB 3C75A 1EFXD 4RH4A 4LCUA 1WGOA 2VE6B 3BUQA 2VDRH 4OM1H 2WZPD 1KENL 1C16B 4UV7L 1NC2D 4H5SA 5TF0A 4X98B 2GTZB 1EPFA 1RUML 1JFHA 4LCYA 5EU6B 5A2IH 2E7HA 3TONA 4B5ZA 3RIFK 3ULUF 4ZXBA 4J4PC 4GW5B 3GLAA 3W37A 5FO7B 2VL5A 1W0WA 1SYSA 3LB6C 4OCSH 1ED3B 1Z5HA 1NPJA 2IAND 2LTQB 5G4MA 5ALCH 2X4QA 1F0LA 2A9NL 3MAWA 3R06A 4MNHB 5JXAH 1E4WL 3QNZB 3AXHA 4U0RC 1DZ0A 4UNIA 2BNQA 2WBJB 3N41B 3L3DA 3PL6B 4I3RL 1WBXB 4M5ZH 1NGPH 5IB1B 1JUFA 1NOFA 1FGVL 5I1CH 3VWKD 4J8QA 3NIDE 4Y4FC 3BVXA 1AANA 1BBDH 3GJFB 3B2VL 2YAMA 3MRNA 1E6OL 2UZIH 5DHMC 4FFZL 3D05A 4XOBA 2OW6A 3MRGA 2OXGB 1PG7H 5HYFA 5K1NA 3ZGIA 3UPCA 4JLRB 4AL8C 1UD2A 4KJPD 4GB9A 2P7TA 3K4DA 2HFTA 4DVRL 4AYDC 2JJSA 4KK6C 1KIRA 1JYVA 1YYML 3RKPA 1DBMH 1FORH 2A73B 3TJHC 3AMKA 1EEYA 3D3VD 1FAKT 3VXSA 3GBNL 3I9GH 1DSFL 4FQIH 5ICXA 2QKIA 4PY7A 4X99A 2AJUL 2O5NA 2ZSWA 3ARGC 3RTLA 4QO1A 1QPPA 3S34H 1BD2D 1CD1B 1MCQA 1T5KA 5FCSH 1FG9C 1WICA 4UT9H 4CAGA 3GEWB 3VSTA 1TLMA 1NMCC 3ESPA 3S96B 1PQZB 3QQ4A 4G8GB 3I9AA 3TZVA 1U3JA 3MDJA 4S2SB 1JL8A 2C9AA 2F8OA 1OE3A 5GSVA 1U21A 2YBRA 3UCQA 4EPSA 5EDSA 1UUNA 3UXFA 5JHLA 4JRFA 3CFDA 3KGTA 1MCKA 4H8VA 5JTWA 3NTCH 4XT1C 4HUUA 4QRQA 3GSNA 1G4MA 1PSKH 1KBWA 3WIFB 2FVNA 2MPAH 3MJWA 1LO4L 5CN1A 4YUEL 4WV1C 3BLBA 4NT6A 4XRCB 3MRBA 3VFSB 2CJSA 3DX0A 4JO1L 2Y07H 3MYZA 3MNVA 2CK0L 1OAKL 2MH4A 3TBWB 3VO0A 2W9DL 1X3DA 4K94C 1MCIA 5JPNA 5IK3B 1M05B 3NP4A 1HN1A 4LHUB 4LHQB 4RIRB 4HKBA 1EZVY 2FGWL 4JG1L 2AK1H 1NFDA 1RUKL 4XBPB 4FXGC 3G04A 1QPXA 1QWHA 2NXYB 3O3DB 5HYSA 4Y16A 2OMTA 4J23A 5DEGB 2ZD0A 2F54A 4JN1H 2NQDA 2HT4C 2DQ6A 1IAMA 2VLKD 2OMUA 5K1JA 2VN4A 3GRGA 3BVNA 5CCKH 3PJSA 4TUKH 3DMMC 2NY1C 1P5VA 1FV1B 1EMTH 1II4E 2FQEA 2XYCA 3M17A 4CKQA 3F3HA 3PDOB 5EU7E 1EXUA 3DJSA 1OAJA 3GK8H 3IYLW 3QUMB 5HJ3B 3RNQA 1UATA 4M8QA 2BSTB 1RZPA 1X9UA 2OXHA 3FCBA 3GXDA 4JHZA 3RFRA 4Z0XA 4X8GA 5MEOA 4Y1AA 3D2UB 3HNVH 1FNEA 2XTJC 4MNQE 1A6UL 1JNNH 2APSA 1OP3K 1KXHA 3CH8A 3OMNB 3UO1H 4DSYA 1H6UA 3ZHNA 4A2FA 3AS2A 2EJ1A 2HLAB 4GP5B 2LAAA 2CLVA 3V9FA 3U48A 1JE6A 1KN4H 4XO8A 3SBRA 3OKKA 2KUTA 3L2NA 4MKMA 1R3IH 4Z78B 3G5WA 5HYJA 1KXTA 4W9GC 2PCPB 3GXIA 4KKCD 4TV3A 1KGJA 1CXIA 4OFQA 4UNVA 3THML 2IDCA 5JO5B 5B1KA 4MWFA 4HU2A 1UWGH 2Z4QB 2R69A 3LD8C 4CADA 3FB7B 1ND0B 3HS0B 4V11A 5DJDB 3ARDC 1ANUA 1ZMYA 2RBLA 4GXUM 2NYYD 1C12B 4TVSa 1RJLA 4A1RA 2A38A 4AC4A 5J13C 1INEH 1I1YA 4OZFB 3WFBH 4I0PB 4KOBA 2C1OB 3T0EA 3FPXA 3EOTH 1UWFA 2WWMD 4LLUB 4NRYA 3BWAA 4PV1C 3QDJD 1KTRL 2H32B 3V5KA 1JPEA 4EZLA 3BH8B 1RIUH 1IGTA 1D6EB 3EH4B 3OHXA 4AJWA 5ISZB 2GAZB 2IBZY 1V05A 5EIQA 4CN1A 1SDYA 4GQ9H 2DWEB 2KDGA 3V52H 1V55B 3GGWB 1PF3A 4R4BA 3PGDA 1ZHNA 4CDHA 1E9PB 2PTTA 4ICWA 1XZ0A 2ENJA 3MUGB 3OKEB 5F9WC 4CNIB 1AYRA 4WI2A 3H42H 5JIHA 1M7UA 2VERN 3QJOA 2B0SH 2LQRA 1I1FB 1MPAL 2WMPB 3BZEB 1UVQA 3RVTD 2CBOA 4GQPH 3HAEG 1KV7A 2ZUQB 3JWNE 5F7DB 3ENEA 4LQFH 2ZJSH 3BKYH 4UTAH 4UAHA 3I6LD 4PJ6A 2A1WL 5E6ZA 4FG6C 5CN3A 2J8HA 4X5XA 4KDWA 5C07E 3LDBC 2H1PL 1YEFH 3TBSB 2X4UB 3LXAA 2Y24A 5KBLA 2N0MA 5KVEH 4NO3B 2A6JB 3MRLA 3N0AA 1MWAH 4KTEL 2IBGA 4OT1H 3NFPA 5LAXB 1I1CA 1YYLL 2D3VA 3QQDB 1QLEH 5T1DH 2YAQA 1AHWC 3A4EA 1RCYA 3NH7H 4U3HA 2CH8A 4M5YH 5DJ6A 3M7FB 2LTQC 1B4LA 4UQAA 1FZJB 3IMBA 1KPRB 4GW1B 1NCAL 2CU9A 3UBXG 2F7IA 3DDFA 4OVUA 4K71B 3OKDB 2ICWJ 3D39A 2WBJC 1U8OB 3ZW3A 1VIWA 3PL6C 2FBRA 2FHBA 5BMFL 1P9MA 3WNKA 2Y23A 1XBRA 5CN2A 5E9DE 4MZ2A 2P5WB 4S0SD 2XVGA 2D4DA 1ZGLP 1K8IA 3DVGB 3ZDYF 4L5FH 2EACA 2YOCA 4ZJ9A 2XZQH 4UQ2A 4I13B 4OGYH 4MSWA 5I75B 3RU8H 1TO5A 3JTBA 5J1AA 4AT6B 4LAQL 4GYBA 4Y2LA 1UFUA 3OV6A 1PZSA 2DEWX 3L3JB 1UM6H 1LWHA 3Q2LA 3O11A 4K9EL 4KO7A 4HWZA 5EC2B 4E0RA 1KT2B 2YSSA 5F21B 1L4IA 3KPRE 2ZCKL 2A9MH 5B4MC 2IEPA 4AZUA 1KXQA 4J12A 5IUSA 4NZRL 1FA4A 4POUB 4C56E 1FCCA 1J11A 4JO4H 1ASPA 1PCXA 3HZVA 5AD0B 4KKAD 4XNXH 1U33A 1QATA 3SGDI 2HVKA 1JVOA 4JDTH 4G6AD 2F53E 2VDML 4HJ0D 4KHTL 4JPIA 3ATFA 4IRJD 4GBXD 4MJIB 4HK0B 3CFUA 2R0WL 3VG0H 2VDMB 1SJEB 4FADA 1CD0A 4XE0A 1FGNH 1PY0A 4HGWB 4HD5A 4LLVA 1XD0A 1I75A 3IB4A 4D9QD 1SFHA 1UZ8A 1UXLA 5FO2A 4F7CA 4Y19E 4P23A 3BQUB 3QJFA 1M2VA 5DJAB 2XX1A 1UENA 1OLLA 8CGTA 3BAEL 1S7UB 1ZXKA 3N1QC 4WENB 5IESH 4NJ9H 1YN7A 4ODTH 2A6IA 4ZG1A 3FQ4A 4XTRC 5JIPA 3VFWA 4QYOB 4ODXA 1QRNB 2NXYC 2OMYB 4DQOH 4A2HA 1BQ5A 1RSFA 2AJZA 3DX6A 5CWSB 4B9ZA 4H8QA 1T4WA 3A6BL 4I0KA 3DVIA 2XCMC 2A9DA 1I1AD 1A6ZA 1WYJA 1O0VA 2EIMB 3H9SA 3HFFA 3IVKB 5E4AA 1HXMB 1FDLH 2F1BA 1AR2A 1R3HA 4L3EB 4Q6KA 1OGAB 3CXFA 1EANA 4ZDHA 2IXQB 4TSBL 4W9JC 1I3RB 1WD9A 1QFPA 4UT6L 4RAHA 5C7ZA 5A7BA 5AZEL 5HDBE 5E0FA 1NPNA 2RFXB 2FEDD 4EZKA 2B1OA 3FQ1A 2L4OA 3PCYA 4PR5A 4WIQA 5G5DA 1FSKC 4YOKA 1S7TA 4XMLH 1ZA3A 3KCPA 3QNXB 4AQ1A 2CDFB 2QADD 1EUTA 1YNTB 4RZCA 2WWNA 5LNGA 1X6LA 4P5TD 5F96L 4OTXH 3U46A 4OCNC 2X1XR 3FCTB 4MQTB 4DEUA 2CA3A 3QIWD 3VD4A 1KLUB 3GMNB 3PHQA 5E4IA 3VG9B 4I2XB 2V37A 5DR5H 2DJUA 1ET8A 1RK0A 3HS0C 4KPHH 4O2EB 5DK0A 1M9SA 3MRMA 5DUPH 2Z0BA 5JOPD 4K3JL 4UWQB 1AKJD 1QUNB 3T6QC 2GJPA 4I0PC 2DQGL 2R2HA 2AJSL 4CC0A 1IT9L 1A4KA 2ZKHH 4LSUL 3US9A 2VLMD 4B3EA 3TPUA 2HN7B 1BEYH 4X6EB 5EZPA 2RIKA 2XG5A 5B8CA 1AGFA 3SDXF 1VZHA 3QARA 2DRUA 2QQQA 3UZVA 3GI8H 5G4OA 3X13B 2NQCA 3FSOA 3JWDH 1IEBA 3S98A 3TA3D 2ITDA 4YFDB 1HCVA 4JR9H 5TDPB 4CSSA 3WDJA 5HHVH 3HPJA 2AJYH 3H7BA 4R0LB 5EBGA 1TEYA 2HKHL 4TTDD 1EAPA 4DAGH 1LWRA 2ZCZA 4JZNA 1UKTA 1ULVA 2H1LM 2AS5M 4Y5VB 5SV3A 2WTRA 5IFAH 3FYEB 3O4LD 1JZ8A 2VC2B 2WXLA 4MMXB 1WD8A 2KPNA 5HYQB 2OZ4A 1EFQA 3RUGF 3F7VB 4L4TB 1SLXA 3V4VH 2ALAA 2ZUQC 2VXVH 2J6EA 3FB8B 3POCA 4JFPB 5DMGD 4B95C 5KYXA 1C7SA 1U8MB 2MCAA 3UBXI 3VYNA 2QSVA 3S8FB 4KKPA 4KX8A 3ECBB 1I9EA 4IJTA 3UTTB 2J72A 3LQZA 4G8FB 25C8H 3PHOA 3UG4A 3TFKC 4X9HA 4PEEA 3WKPA 3UTQA 1YPZB 3OZKA 3BLPX 1CZ8L 4JPVH 3RJQB 4DP4X 1XGYH 4UOQA 1KNOB 1DVFA 3LNFA 4WWKB 3TO4A 1FJ1B 1KDIA 3F62A 3T04D 5CBAB 2JVUA 3ILEA 2EIEA 2C3WA 2X4RA 1OCWH 3GHEL 1E0OB 3GMPB 3D85D 2OQJA 4K71C 1BVOA 4MA7H 1B2WH 3LN9A 3BPLB 4ZUSB 3PP4L 4JFHE 4LNVA 3U7YH 4HS8L 3D25B 5AEAA 4QAMB 2YN3A 1WO2A 3NSJA 2MCMA 4OZHF 3IEAA 3DXAE 3D69A 4P46B 1DLFL 5I6PA 4K23H 4OAWB 1J8KA 1HL8A 4R7VA 4GKNA 4MYWB 4QRRD 3PF2A 1FG2A 4UQ9A 4WO0A 5DJZA 1FL3A 4QLWA 2I60L 4FHKA 5C08D 1JNJA 4BSVB 5I75C 4L37B 2A83B 1BAWA 1A14L 2VDOL 4LSVL 5DD5H 4KROD 1P5UA 2E9JA 3BKCL 3OAZH 3C87A 5IVZA 1FVCA 2FK9A 1WIPA 2JKSA 2YEVB 5ACLA 4P3CL 1L0QA 1TVDA 3QDHA 3C8HA 5HHNB 3O4OC 1A4JA 3L1OL 5CU9A 3DIVA 4X83A 4RMRA 5JIQA 1OD7A 4PJHF 2HFEB 3F7LA 3MA7A 3GIVA 2DWYA 2HFGH 3ABGA 5DUJA 2IFFL 1PJ9A 4QEGA 4LPVA 3P30H 3FKUS 4KX7A 1BYPA 3PABA 4QXUL 1U8KA 2FLBT 2IJ0C 3IDGA 3L6FB 5C2BL 3AY4C 4G6MH 1HL9A 3EDEA 1S5HA 3QFJB 3EH3B 3VX1A 5BOZG 4WW2A 4YZFE 3TC9A 2CSPA 3RGHA 3VFMA 4ZMPA 2FO4B 3VD2A 3OQ3B 1UQSA 4OIIH 1A1OA 2FX9H 2EIBA 1ONQA 1GS7A 1I7RB 3EBGA 3MLYL 4F7MB 3ZJAA 3TVMA 4WI0A 1MFCH 3F6LA 4FQQA 3NT0A 3UJTL 1UOVA 2LVEA 1WAEA 1ESOA 4P5MA 2NTFA 4BQ6A 1HYSC 3MLTB 1ITBB 3IF1B 4ZTPH 1T1XA 3MRQA 4ZFOA 4IMKA 1PL3A 3VRLF 1MAML 5K9KA 1KYFA 2DLEA 1T83C 5JA9A 2YQ3A 1UGNA 1XSIA 3LNDA 1XH2A 1DJIA 2CJTA 2FT6A 5TDNA 2R4RH 4ZD3H 5AENA 4FNTA 2F8XC 2BJMH 2OJ1A 2V5SA 3EBIA 3FAXA 5E6YA 3L1FA 4BUHA 1KEGL 1X7QA 2N7AA 2XWEA 3OPZL 4KXCA 1D5BB 1TJIL 3M1CA 4P2OD 2FH8A 3TH4T 1U9KA 4TVUA 3IFOB 5IQMA 3I75B 1JXGA 3HJ0A 4CN6A 2FZ3B 1A8JH 3RY6C 3MRIB 4H20H 5FECB 1FNLA 1ORQA 3KHQA 4IBLT 3EHBB 1P1ZB 3CZKA 3VXMA 1HOCB 4F15B 3KLKA 4OSUH 2F74B 1NCUA 5DQJA 4MZIA 2VERA 2PPEA 4C59B 1IEAB 1I9IH 3P73A 1KEML 4LEOB 4HKZB 4Q74A 5I17A 3MRCB 4FA7B 5BO1H 1RK1A 4JO8A 5I1IH 4ONFL 1DBAL 1KC5H 2X3BA 1DEEA 4FTVB 4YVUA 4N8CL 3BAIA 4K3DH 3TTYA 1F4WH 2MOGA 3L3HA 4AEIH 5JLZB 3VI4B 5KYYB 3JXAA 2ZF8A 1X5KA 4H88L 4XP4L 5D2LE 4IBWA 3L4WA 2X9ZA 4LHUG 1L5GB 2HT3D 5FGRA 3TYGH 1RMFH 4GW4A 5ID0A 1N5YL 1SEQH 4PI2A 4G8IB 3NFNA 5KW9H 1A2YA 4OW6A 3BP6A 4BXSV 5C0CB 3PWVB 2W07A 3WAJA 4MQ7A 1LE9B 5AKRA 5DHXB 1XF4B 2X9XA 3U9UA 2Q9OA 4OFVA 3K71A 3WL9B 3FTXA 4X4XB 2W65B 3DV6B 2DF3A 2ODIA 3PDGA 2OMXB 4MA1B 3QC6X 4Y89A 1COBA 1NAMH 3IXTB 1FNFA 5MI0C 3MJ9L 3RZCB 2Z7ZA 2F7QA 3D3VA 4O2CA 2RB8A 2NY4C 4ORGA 1ACCA 3FU9A 4A7GF 4DEPB 4ZNEE 1KIPA 3BO8A 1B90A 3QUXB 2M83A 5GHWL 3G5XB 3DI2B 3Q13A 5HDOA 2JB6A 5GZNC 2IPTL 1R4XA 3DIDA 1USZA 3IKKA 5KSBA 3FN0L 4QUOA 4FKKA 3VXQA 5AZ2L 4Y5VC 3SY6A 4X7DC 3TNNB 4CSZA 3L54A 2LAGB 3VD7A 3W38A 4QHKI 5HI5C 1RZIA 4D8PB 1NDGB 5EBMA 4O5LL 1MRDL 2ED7A 3O3EB 4M7LH 1QBBA 1ZKAA 3GTNA 2CDGA 4BUGA 3QXTA 3AT0A 3IKCB 2FJHA 1M7DB 1U3ZA 1SGKA 3UTSE 2JQAA 3H54A 1BIIA 5BNXD 3K8LA 1BVZA 2AEIT 2GC4C 4QT5B 4UTBL 3Q1SH 2FYYA 3RAJL 3LKNB 4N5UA 4DW2L 4LCUB 2YA0A 2CLRA 4NPYA 3EG9B 5L2KB 4KZDH 1DQJA 1DVXA 1ZVHA 4H5SB 4MNGB 4QRSA 4KMLB 1JGDB 3P11L 1J0HA 3EJYD 2WVUA 4WK2B 4EXKA 1J86A 1XB6A 4C4KT 3MRFA 3D51A 3ABZA 1F4HA 4WWKC 5ICYA 4ZXBB 2M26A 3EAKA 2Y7NA 2VL5B 1W0WB 1SYSB 3ASNB 3FQRA 4GRLB 3DTXA 4PG9A 4PJ8D 3QJXA 2V0AA 4PWGA 4FFWD 3JT2A 5FW8A 3PWJA 2HFFB 4IOIB 2C4XA 2BNQB 2KHAA 2NY6B 2K9UA 3BPLC 3C6SA 3DHMA 3S3SA 2AFNA 3UOAB 1Q0XL 3MRNB 4P46C 1VCBC 3B4NA 1EXHA 4YSRA 3MRGB 3QRBA 3FBQA 4AC2A 2EDMA 5HDLA 1IE4A 1A6VL 3FTUA 2P7TB 4QYAA 5AWNL 1YC7A 1KIRB 4JMNA 5CJ8A 1SVCP 1PD1A 1GCFA 2YN5A 1ZEAH 4MDIA 4MNQD 4LVOB 3P77A 4MXVF 1PNCA 3TBTA 2EH8H 5GRXG 2GIYA 2QKIB 3QDME 3QI9A 4PY7B 3HZKB 4X99B 4XC1H 2ZSWB 4QO1B 1B9KA 3C6LD 3WUZA 1U2HA 2CHDA 3O2WL 4HPOL 3REVA 4MAUH 4BDVA 5I30L 4KXDA 1LDSA 3MVSA 4I87A 4NDMA 3UROR 1NGYA 2D03L 4R90H 5F6IB 3LRMA 1FVEA 1AY1L 1TJXA 3QQ4B 1U3HD 1YY9D 4AVHA 4OI9A 5F7EH 3TZVB 1XVSA 5C3IA 4NENA 3X1BA 1OAQH 4G9FE 5GSVB 5TE4H 2YBRB 2PNDA 2WXOA 4YDNA 4PD4J 3CFDB 4TNVK 1H3UA 3S5LA 3GQFA 4K55A 4XNUL 1YEKH 2I69A 5JXEA 4XPFH 3GSNB 1MUJB 4KHXL 5GPRA 3EYUL 3JWNH 2ZUUA 5EN3A 1GAFL 3Q6FA 4YEEA 2ICWA 3MRBB 4YK4B 5FM8A 2OI9B 3QDJA 4LIQL 2IDFA 3RPBA 3FUJA 3MNVB 5H4YA 1THAA 2ZKYA 1YEGH 3VUAA 3F12B 2WVSA 3BI9X 2A77L 4OJAA 3MLSH 4LRNH 5HGBA 3DJTA 5CJXA 4A37A 3K2IA 3FH5A 2K78A 2I25N 4HKBB 2PWDA 2X40A 3FO9A 2ZWKA 5CNHA 3RWEB 4BFIB 1NFDB 5KSUA 3G04B 4HOWA 4BV1A 4V2CB 2OMNA 2I7SA 5HYSB 1F3DH 2Z4TA 2OMTB 3ZL1A 4JO2H 4YLBA 3FPYA 5LGJB 5EORL 3UAJC 2YXVA 3BVNB 3NA4A 2XPGA 4LSPL 3JWOL 4RGOL 1MCJA 2ADIA 3M17B 4FNLH 5I8OH 1L7TH 2YGQA 1EXUB 1ZLUK 3RUGA 4U49A 3OR6A 4RRPM 5LKNA 2F6AA 3TXAA 2OXHB 5C07D 5SX4H 1TZOA 4NZJA 1MJJA 1SOQA 3B56A 5I6LA 5MEOB 4QXGH 1NSNL 4Y1AB 1J7VR 1FNEB 5ENWA 3TF4A 1QZ1A 1SVBA 5ERWB 3RI5K 1CFVH 5ETUB 1GW0A 5EPMA 1QNZL 3S35H 2CLVB 3N9GL 4QHUA 3OKKB 4PJCE 4XO9A 4YWGH 1W0VA 3MOBL 3AT8A 1CGTA 1KXTB 1KBKA 2H5UA 3NFSH 5TGBA 4AE1A 5F7KC 4HGKC 4EOWL 5KTEH 3NIDF 1E3XA 1LK3L 1XD1A 4PB0H 1QSVA 5DLLA 2NLJA 1AXSA 1UOLA 4ZPVA 4AQ8A 3P02A 1ZLDA 1TYJA 1ES0A 4UTAA 5E9DD 1JYXA 3P4OA 1RJLB 4LP5A 1I1YB 4OZHA 3T0EB 2VMCA 3LXBA 4OB5H 4NRYB 2EUVA 5TJWK 3V5KB 2RQ8A 1PLBA 2K45A 5F7LB 3HNSH 5EA0L 3ZY7A 2HRGA 1MWAA 1OHZA 1OTUC 2VN7A 3OHXB 1M7IA 3RZCC 4WTZG 4JRLA 2KERA 3CMOL 4ONHB 4BINA 4RGNE 4X7SL 2A0LD 1BVKA 1XGZA 3CPUA 1MCOH 2KLTA 3QIUD 2Q8AL 3UO8B 4DEPC 4HCRA 1FE8H 3QW9A 4YHOH 1ZHNB 3QUXC 1IVLA 5DJ8A 3GZQA 3KPRD 2QTVA 2AKRA 1UEMA 4F1SA 1Z9LA 3MBEC 5H94B 4CC4C 4C56D 4M62L 4B7IA 5EB9A 3VD1A 3BX7C 5D7JD 1FF5A 1WISA 2KYIA 4FQCH 5DO2C 4HHWA 5GQBA 1UVQB 2F53D 1WV7T 2JKIS 3GXTA 4ZS7L 3HC0B 3V5HB 4KUCD 1KV3A 2E46A 4NZTH 1WF5A 4IRJA 5LAPA 1L6ZA 4GBXA 2NY7H 1NCWH 2YWYA 3X17A 4ZW8A 4BFEA 5F7MC 2P8LB 3LYRA 1W72L 1RZKH 1U95A 1UXSA 2W60A 4W68A 1IGFL 3UX9B 4EUPH 5I6XB 1H5BA 3ZMRA 1F3DJ 4Y19D 3RGBA 2JB5L 4H0HB 3ZDZE 1BYNA 5E6UB 4XWGL 3P2BA 3MRLB 1RAMA 1OCOB 1T66C 3NFPB 3AG4B 1IQWH 2YD5A 5C0FA 3NIGE 1AR1D 3CQPA 4FQLL 1AVAA 1RUAH 2CO1A 5DJ6B 4GRLC 3E80A 3APMA 3EGSA 4MX7A 1XMEB 1VFBA 4IGBC 1DBJH 3D39B 5F3BA 5FUOL 2OL3H 4GQRA 4UT7L 1F97A 1FZKA 3VFPA 3RDTB 1S5IL 3G08A 3WO3B 4HS3A 2VDPH 1HHHA 3PRZA 3V0GA 3VFGL 5AB0A 4JZOA 1K8IB 3VXUA 1A9EA 1TFHA 2BIHA 3QZNA 1WEJL 2V9TA 3SY0A 4UQ2B 4H2AA 1DVSA 3ZKSD 4MSWB 1PLCA 1CGUA 5J1AB 3L4CA 4K15A 1C5DB 3L9EA 4NZFA 4LVOC 1Q9KA 3WLWD 4E9LA 1MCPL