4RDBA

Crystal structure of an immunoreactive 32 kda antigen pg49 (pg_0181) from porphyromonas gingivalis w83 at 1.45 a resolution (psi community target, nakayama)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
305
structure length
303
Chain Sequence
GDRSIEISIRVDDFTKTGERYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Immunoreactive 32 kDa antigen PG49
publication title Crystal structure of an immunoreactive 32 kDa antigen PG49 (PG_0181) from Porphyromonas gingivalis W83 at 1.45 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Porphyromonas gingivalis
total genus 86
structure length 303
sequence length 305
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4rdbA01
4RDBA 4GPVA 4JRFA 4JG5A 5DHMC 3R4RA 3UP6A
chains in the Genus database with same CATH superfamily
2Y7QB 3VFNA 2ZE0A 1S7SA 2JJSA 2KS0A 1R34A 4H0HB 4JUSA 4ZFOA 5CZRA 3T77B 1S9VB 3C6EA 4KJWD 5BW7A 2YUXA 4ISVA 3A0OA 2XKSA 4IOSD 2W0FB 1W0VA 4IOFD 4R97B 4G8GD 5FYKH 3OL2A 3A6BL 2E6QA 4NHUB 4ZI8A 1ULVA 3NABL 3ARQA 3DBSA 4H44C 4J3OC 3RY6A 3CVCA 4LLQB 5DWUH 3SYPA 4Z7UF 4KO9A 3DETD 5IHLB 1Q94B 1FH5H 1M6UA 4B5ZA 3TBVA 1IM9A 1YEHL 1N8ZA 5A2AA 4LK4A 3CUPA 4LCIL 1GOFA 1KEMH 5B38G 1VFBB 2BSSA 4JO4L 4TPRL 4W9JC 4GSXA 1FUNA 1CXHA 3D0VA 4NZRH 4G1EA 4JE4B 1G7MA 5SX4H 3AY2A 3F58L 2AEWA 3WE1A 3ZTNH 1ZHLB 2FL5A 3DIFA 5G5DA 4ZW5A 2VDQB 4HWEH 3BDBA 4ELDA 1C5BH 2X4RB 3UZQB 4QLWA 3CAFA 3L3KB 5TD4A 2AAAA 3PYCA 4AITA 4PG2A 4IK6A 3VH8A 4JFYB 5CZXC 1JVLA 4WO0A 4FLSA 2JNZA 2WP3T 1TU2A 5GZNC 1MOEA 3IRCA 3X17A 1R3KA 5IHZA 1Q72L 1TYRA 2R69H 2AERT 1QEWB 2DAVA 2JMRA 4OGYL 2FT6A 4XE0A 5BZWB 5B38B 1NMAL 3ARVA 4KUZL 4AMWA 5C0IB 3HNSH 2JTDA 3QA3B 4NM4L 4XC3H 1HH6A 1U92B 1EDYA 1BJ8A 3QC6X 2KYIA 2OMYB 1X9UA 3COOA 5ANMA 3SGJA 3SKJH 2YGOA 3LPPA 3QHFH 4L18A 1KJ2L 3ZYIA 4DN4L 4M6ML 2GJPA 4TUOA 2FSDA 4MS8D 4P5KB 3NCYS 3CMOH 2QHLA 1J1OH 5SWZB 3O0RL 3SGDH 4J5VA 3MUGB 3MBXL 3QDHA 3TFKC 4J1UB 3WS3B 3ZDYF 4RSYA 2VXQH 2WWMC 4XRCB 4YGAB 4D7PA 5AB0A 1C8PA 4MMZB 1R3HA 1AAJA 1CPUA 2XCMC 3EIFA 5DR5H 4M5ZL 1HHKB 3MI6A 4XPAL 4K3HA 4XWOD 3QUZD 3DV4A 4ZUVA 3IFPA 3VXMA 3AY4C 4HZAA 3U6RA 5T33L 1QX1A 2XXCB 5BRZD 2XDHA 2WYZA 4BV1A 2DJUA 5I82A 3WTXA 5C0NC 3BLKA 4XGZA 3HOGA 1J86A 1W8OA 2QKIA 3H54A 1OPOA 4KZCA 1I8IA 3SGKC 3SGEH 4NSKB 2LABA 2PYEB 2QGDA 1TZGL 5IJVA 2CG9X 2HVJB 3BQUA 5B1JC 3SJVE 3IMVA 4JGUA 1A1MA 3VFVA 5IQNA 3ULUF 1NBCA 4XPFL 3QUKB 1F45A 2VXTL 4J23A 4L2LA 2ZKYA 4HUWB 2MTAA 1MH5B 2ATAA 1TSRA 2CJ3A 3SBPA 1L5GA 1W72B 2X6CA 3AREC 2BVOB 4FZEH 1UD3A 3T3MB 3OJMB 3FZUD 1D7CA 2BP8B 3QO0A 4MJID 4MD0B 5DJZA 1G7PB 3VFUB 2LAAA 1MW3A 5DUPH 4M3JA 4UT9H 3FB7A 2ZP0T 5C0CB 3IDYC 3T3PF 1KLGB 3IU3A 4PJIB 3TCXA 3UAJD 2G2RB 2WBJB 5DA4A 1H8NA 1IC1A 2PPEA 1W0WB 1IKNA 1BM3H 1I8UA 3FYEB 1KJ2A 3FQXA 4ZUTA 4BE6A 1XSKA 1ES0A 5F1IA 4PJDE 2OW7A 2AEOA 5FOBA 5GSVA 3RAJH 1UWEL 5K9JH 1CDGA 3JV6B 1Q9WA 3VD1A 4AT6A 5CD3B 2E3VA 4PBVC 3OX8A 3X12B 4HOXA 3HBQA 1K3IA 2C7UA 5DUBA 4R26L 3DIDA 3UEQA 5EIQA 4L29B 3Q8AA 1M71A 2VABB 4LNRA 5F7LB 5ICXA 4DVBB 4FXTA 5MEQB 1AQMA 1DFBL 1AP2A 4LMQI 3I50L 4NO0B 4FYQA 4RGMC 5I28A 3GMNB 1P7HL 2DKMA 2XG5A 2VTFA 4L8BB 2WY3B 2EVGA 3B9KD 1MIEH 4X9GA 2Y3AA 1IM9D 1X7QA 1WBXB 4XZ4A 2J1XA 1YN7B 3EG9A 3QDAA 4LL4A 4PJXE 4PV1C 5CGYC 1U8MA 4LCWB 3S3JA 3CPUA 2J5LB 1UXSA 3K3QA 3KPQB 3BPCB 3L4UA 3MODH 5KANG 1I8LA 1JXKA 3PQYD 5CCKL 2FAUA 4QKTA 4LFHD 5IG7A 3BWZA 5EEXA 1T7YA 3MLXL 2I27N 1B4RA 4AJYV 4CVXB 1EANA 4E9VA 1ADQH 2ATPA 3T0VA 3CLEH 4UNUA 1TETH 5T5FL 1MI5A 3NSFA 4MDJB 5D72H 2WQUA 2F58L 1Z1WA 43C9A 1MCPH 2FE0A 1UGKA 5L8LB 2ARJQ 5FXCH 1BXAA 4E9QA 2A9BA 4B9YA 4U6VL 5CUSL 4B9FA 3ESUF 3RBSA 4AGLA 4JFZL 5CP3H 2ZWSA 1E4JA 4DGVL 2DYRB 3GMRB 4HMDA 3WY4A 1TENA 2GSIA 4FYSA 5JW4M 2WP3O 5DJ8A 3L1FA 2BNRB 4EN3C 2FQFA 4KZEL 3OKMA 2I60H 1FWXA 1FZJB 3FBQA 2X4PB 4BA8A 1LEGA 2FB4L 3V6ZB 1V3MA 3UPCA 3IKCA 3KLHC 3BIKB 3QFJA 5CP7B 5IROC 5IB4B 4I18A 2NY2C 3MLRL 4HJTA 5AW1B 4XPGH 2AI0L 5FF6B 4XBEH 1JFQH 5CLZA 4BQ9A 1F4YL 1UH2A 4RLDA 4W4NA 5IEHB 2DMGA 1S7RA 3E38A 3VXMD 1PIFA 1BQHG 2WINA 3II3A 5HDBF 1AQKL 3FSZA 3O3UN 2EH8L 2ED7A 5IT2H 5JORA 4NUJA 4AQ8A 3TYFA 2O5XH 2R2BB 2WIMA 2XBZA 2FNWA 4ENEC 3DGGA 4FKKA 3RI5F 4CSZA 3TJEL 3NRQA 5IOPA 1BVNP 3HNTH 2ADYA 4TLSA 2HUHA 4NHCH 4Y4FB 1PS3A 1G9NC 2DMCA 1MSPA 2PABA 1LO5A 3SHSA 5E5UB 2V9TA 3F7VA 2YAFA 5T3XH 1EQWA 1WLHA 1NCNA 2F15A 3MRFB 1XGQA 3KCWA 2A4CA 2UV3A 3NA4A 3QUMA 1HQ4B 4X80L 1XF1A 1BOYA 5EG6C 1XF5A 2ZTBA 1SEQH 2AEPL 3NGBC 3HJ0A 4AW7A 2X53A 5B8CA 5MI0C 1NL0L 2Y07L 1QYGH 2AKRB 4P9MH 1Q0XL 5EO9A 4PJFA 3CSGA 1F58H 3DMMB 3ZT7A 1YPZA 2Z93A 3ZKSD 1HHHB 2XVLA 1RSFA 3UJTL 4DERA 4AEIH 4Y2DB 5IFAL 1JDCA 3QUXB 1JZJA 4BRJA 5E23A 1WFUA 3CSBA 3HUJF 3LQAH 1KB9J 3IU4L 2GJZB 2E8ZA 1IBGH 1ND0B 3KJ4C 4PJAB 2YWZA 1ZHKB 5JR1H 1E4KA 1MRDH 3U25A 4GW5A 3HRPA 1PFCA 1SHXA 1TJIL 2V0AA 4GLRH 3O9WA 3D18B 4I48B 3O3AA 2RD0A 3K5RA 4HAGA 4A7UA 2X05A 1WHPA 3P30L 3ZL2A 4I1RA 4YXKL 5E5MB 5FO8A 3V7AE 1GPOH 2FJGB 3OKKA 5KUKA 3E8UH 1KNOB 5AG9A 5KJ7E 3R8QA 4YC2C 5EFIB 5JIIA 2Q5BA 3TASA 1MAML 3F7YA 3IVKB 1AXSA 1KFGA 2O6CA 2UZYA 4PRAB 3MNZA 3BPOC 3TONA 1OARL 4UT7H 1FL6B 5E51A 2J43A 4IU2A 5C2BH 3QDGE 2R8SH 2J20A 5B22A 1PF3A 2JCCE 4YHLL 4KHXL 5GS3A 5AW7B 3WFBL 3X2QB 4ODBD 4YHPA 3SN6N 5I1CL 5I1AA 1S7VA 3N85H 1BZ9A 4YN3A 2ID5A 3ATEA 1LGVA 2RALA 5F9WC 4TXVB 4R96A 2FLMA 3T8VA 5BZZA 5F93C 1FZMB 5DO2C 3N6YA 1N4XH 1XIWC 3IJ7A 1GGIH 5D2LE 4MA1C 1MI5D 4WFGE 3CDGA 2Z0UA 4QMEA 3BVXA 2YOAA 5KVFH 1I7UA 2HKHL 3CZGA 2VH5L 5JHDA 1KFAH 1NH6A 2FR4A 3GLDA 2OL3H 2R9HD 3IDJB 4BH7B 4JPKL 1WFIA 4MFHA 2W07A 4DCQB 5C0FA 1YUHA 4UANA 5GISL 4E9TA 5CBAB 2C9XA 1PQZB 2BDNH 1V3KA 3LZQA 3UJJH 1PLGH 2BY3A 3P3RA 4Q7DA 1M7IA 1DEEB 3QNYB 3BPLB 4FL4B 3VFWB 5D1XA 5BO1L 1JUFB 1DJSA 2LLGA 2VAAA 3ARDB 3MROB 3Q8FA 4YHYC 2DV6A 3ZJAA 4AKQA 2J4WL 2IAMB 3BKCL 3Q1SH 4R83A 5HHNA 4M7KH 2X89A 1OQOA 4N0CD 5A2BA 2FCBA 2ADGA 4F7KA 1FZOA 2NCEA 3Q5OA 2IWFA 5L2KB 2L7UA 1VJSA 4PRHD 5GXBB 3V6OE 4MA8H 3QR0A 1HKFA 4ODVL 4APQA 5FAAA 3VU1A 1AXIB 2PO6A 4JO5A 3WNIA 2PTVA 3IJYA 1COBA 3LKRB 5JOFA 1YMMB 5TQ2L 2EECA 1FFNA 2IH1A 2QFRA 2XA8H 5F89A 5I6KA 1A9VA 1GYAA 1XGYL 3MRIA 4HUMB 2IC2A 5M95B 1U3JA 3IAGC 1KEGL 1WC7B 3QZWA 2DWSA 4FG6C 1OGSA 3U46A 3CXHK 2ED9A 1NC4D 5E9DB 5I17B 3QQNA 5LKNA 2EYRA 1K4DB 3ZGIA 3L3IB 4IRZH 4WGWB 4OQTH 4JQVA 1RHHA 4P5TC 4IIQA 2XJLA 4NQEE 3WEXA 3CSTA 3L9RA 2NY0C 1MHPH 1INDL 1JK8A 1MNUL 3BWAA 4MMXB 4NBYB 4ZZKA 1HI6B 4NQVA 5JUEH 3L4CA 3V6FB 2CHWA 2PYFA 3OKLB 1NCDH 1T0NA 1BAFH 1F2QA 1WZ1H 4JR9L 2NTFA 4LU5L 1JYXA 2Z92A 3C5JA 4UM9D 1L7IH 5EN3A 5C0RL 4JO1L 4WW1A 4XH2A 1GSKA 3QG6A 1OF0A 3O6KH 4Q6IC 2X28A 5CZKA 5D71L 1SY6H 3F7LA 1PPIA 1GGUA 3DV6A 2WZPA 32C2B 4DOHE 5ENWB 3CVHB 2BIQA 3NJHA 1RI8A 4A39A 4KX7A 4NT6B 2ERJB 4XO9A 5IVZA 3FHQA 1YEJL 1U8PA 4L0ZA 1GMEA 4X5XB 1N70A 3NEXA 3SE8H 1N6QH 4NFBA 3D34A 4QXTA 4FABL 1I82A 1ZJBA 4OI7A 2VDOH 4Z7QF 3FQ4A 4XNQA 3U0PB 3TCLA 3U4EB 4NPJA 6CGTA 4HUKB 5BO0D 5IR1A 1T2QL 5F6HJ 1Z0NA 3RWIB 4O4YH 2IQAA 5HHME 1R3LA 2NYKA 5GZOA 3BGAA 3BUYB 4LHUA 1BQLH 3HKZA 4Y4HB 4CU8A 1HTYA 3KGSA 4ZMNA 2GK0A 3SE4A 4OF8A 3D06A 1H5BA 3CFEA 2X1PA 1JGLL 3C09C 2CQVA 2C4FT 4ZODA 5F88A 3OHXB 1QSEE 5C6TH 5IMOA 5FUZL 3KGRA 2V9RA 2LGNA 1KELL 2IDUA 3QIUC 3QEGH 4C57C 4PY7B 2DQIL 2GCYA 4PP2A 4TVUA 5EH1A 5AVTB 5INCB 3WDIA 1N64H 1MCLA 1IE4A 1WVZA 3NJJA 1CF8H 1DQKA 1FJ1B 3IXAB 3EJZC 3LQZB 4P23D 3KGTA 3VX1A 4GUQA 4WCYH 1E27B 1FVDA 3FT4A 3QUYA 3ME0A 1A7OH 1ZT4B 5HJ3B 4I87A 4X6FB 4WSGA 3HG1E 4ZSOB 1KLFB 4MWFB 2EKJA 2GJ6D 3NQIA 4JUTA 4NCDA 3PXLA 1IM3A 2X6AA 1XB6A 3ZHFA 3PJSA 3MCLH 1UEMA 4MQTB 4DZBA 5HJGA 1TEGA 5C8JB 3FTGA 3IYLW 4GSQA 1FAIL 5BOZG 1UWFA 1AIFA 4JEGB 2F54E 2L0DA 1N0LB 4L1LA 4WWKA 2EINB 5ESVA 4RGOH 2Q76B 1AHWB 1BM7A 2I9LB 2JFCA 3P9LB 1UB5B 1ONQA 1D2OA 3OHMB 4LBAA 1O7VA 4E42A 3IMRA 4W9CC 2OCJA 3SD2A 1SOSA 5JA9A 1QUPA 5KYUA 4FI8A 1EAPA 1I9JL 1PD0A 4UOW1 3MRBA 3GK8H 5DJAB 4HPYL 4OLZH 1JYNA 3P0VL 5AZUA 4JJOA 3S5YA 3R19A 5HI4D 4V2CB 1FFOA 1RUQL 2PO6D 3U7YL 2DL9A 3K80A 4KI5C 5ESQA 5SWSE 2Q7NA 1RMFH 5AVZB 5MENB 3ENEA 5AOIA 2EVFA 3WFDL 2XY2A 3KBEA 4CAGA 4I3RL 2Y6TE 4RX4D 3VRIB 2D7TH 3D39E 5JQIB 2VDLH 2R0WL 1IJNA 3BH4A 1B4JH 4QCIB 5TQ0L 5JA8B 2BNUB 1T04A 4GG6F 2BC4A 2H0EA 2QZ5A 4WGVB 1HL9A 1MWAL 2VJ8A 4LASL 3TX4A 1HZLA 4JZJA 3P4NB 1ZLUH 4GLRI 3QEQA 1F4WL 3LH8A 4OZFA 1ASPA 1I1CA 2CBOA 1MLBA 3EGSA 4ONOA 2OR9L 4KO7A 2GEQA 4BCZA 2XACC 3ZSTA 4BKTC 2CKBH 2Y2YA 4HJJL 5EB9A 5GZND 1MFCH 5JOPE 1AACA 1J18A 4ANKA 5KBDA 5J11B 3PY9A 4KNQA 2EIZB 4PWGA 4YDLB 1U8LA 5BUAA 4JVUA 2Z7ZA 2ZUUA 1OM3H 3CHPA 5H4ZA 4W9HC 3CVDA 2FEEI 1CGUA 1F2XK 5F44A 4ZUWA 4BFNA 3CDFA 1N18A 3KNBB 4L8SC 4P4KA 5GGRY 3ZUCA 5I18L 4W70A 5HVHC 2P24A 4UOW0 2XRAH 1JWUA 3A3YB 2NRDA 3N06B 2BSRA 3ALPA 4HWZB 4WHTA 4ZXBC 3E6HB 3KPRB 3U79A 3PGDB 2NXYC 1JPSH 3ARFC 3WHE1 2CNZA 1I1AB 5IREA 1CFTB 3STZB 4PV9A 1CK0L 5JQ6H 5E9AA 3TEUA 3EYSL 2CCVA 2C1PA 4F33A 5GZOD 5I71B 2B1HL 4LVNB 4KK5C 5GHWL 4LHUD 1Z9SB 1LNUA 2ZOLB 4OUUA 4BQCA 4AUJA 2QVIA 5F7AA 1JD9A 2XT1B 3SDAA 1QD0A 2A6IA 3SBWA 1ORSB 2CNYA 3WFCL 3WGVB 3AMLA 2VLME 5GGQH 2ZYSA 1NGYB 3PWUB 4AGQA 3Q3GA 1RJYA 1K9TA 1SDAB 1MVUB 3H85A 5DDHB 1CTOA 4XCEB 3C60A 1I7TA 1AC0A 3H3BC 2KLSA 1A25A 3M8OL 1MVFA 4J3TA 4LLMA 2P8PB 1T89C 4LPWA 4CW1B 3C6LA 1UYWL 3TWCH 3HZVA 4BUHA 2W9LA 2CO6B 2KQNA 1UA7A 1LHZA 4P5MB 1OTTC 4J6RH 1PG7X 4NN5C 1ASQA 3APFA 4LLYB 3VD5A 3QFDA 1G9ML 1MWAA 4KKQA 1NBYA 4JKWA 1AHKA 3RDTB 1YEFH 3VFPA 1RZGA 4Q8BA 5KJ4A 1T5XB 3VXUB 4ZPTA 1A7BA 1DN0B 2NT1A 3APDA 1ZANH 2ZUQB 5AVYB 1DQJA 2Z4QA 2ZF9A 4I4WB 2EXYD 2FECI 4NN7B 2YIHA 4YNYB 1LE5A 5CILL 4I2XA 3MRJA 1ACCA 5FYLH 1IV8A 3MRKB 5DJ2B 1ZOXA 1F56A 4F37F 2WCPA 2G0LA 4M48H 1F90H 4Y1AD 2WQVA 2AJXL 4LXFA 3WHE0 4WWKD 3EZJB 4MQ7A 3U30B 2CHNA 4JN2B 3KL5A 4LOUD 5D5MF 5ALCL 4F8QA 2IO5A 2ED6A 1AH1A 5AQ0A 4RIRA 1DSYA 3CVIL 2RHEA 3ABKB 1B2WH 3JWOH 4W68A 4LIQL 1WE5A 2AXFA 2QSCH 3AXLA 3IDIA 1FHGA 5AZ2L 4OCWL 4JQXC 3G6DL 1VB9A 1NFDB 3T6XA 4JY4B 3GJFA 3GI8L 2I26N 2DYPA 3L81A 2BVTA 5F7DB 4AQZA 4KOCA 3ZKQD 4N2CA 5KSBF 1S7TB 4H25A 3H7BA 2DY2A 2H0PA 1ZA3B 4PJ9C 1I1YB 1QFUL 4BSVA 3JTTA 1XXDC 3EBAA 4OF6A 1S3RA 5MEPB 5CJBA 4PFEA 4ANWA 1UJ3B 4MAYC 3U7WL 4H8VA 3WELA 4NENA 3RTQB 5HGDB 4NM8H 5CGYD 3K6IA 1KB5A 4HV8B 1BMZA 3BEWB 3LNIA 4Y8DC 4JM4H 3U48A 3VGFA 3CFNA 1D5MB 2WD0A 3AU1B 2HG5B 4JFEB 1P7QB 4FMVA 2QGBA 1IIKA 1JHKH 3MRNA 1YECH 2TAAA 3B34A 5DEFB 5DJYA 4AZ8A 4OCYL 2V2TA 5L9DH 3QEQD 4TULL 4AX3A 4M43L 4WF7A 3O81A 4P2CG 4ZD3H 1BZQK 2DLFL 5I76A 1IC4H 4HK3J 4NC1C 4RVBA 2JJTC 5IW1A 3CPLA 2ATKA 5ID0A 5JW4R 5E1HB 2V9QA 3TA3C 2FX7H 4EN3D 1A4KA 1INQB 3WV0A 3FN0H 1BD2E 3QWOB 1ZLSL 3SYOA 3CFDB 5DI8A 4YBQC 4ZNEA 4WEUD 4UCFA 4HKZB 1KOAA 4LDEB 4B9JA 4QXVA 3X1GA 3MOQA 3KLHD 5E8OA 2EEFA 4G11A 1GJWA 4ELME 3IBOA 3LOWA 3G08B 2OSLA 1SYVA 2AV1B 4K94H 5CBEB 2NY5L 2H2PC 3BGFB 4QOKD 4DVRL 4F8PA 2AK1L 1LDPH 4ODXA 3JUZA 4FMKA 4ELKB 1F11A 2Y36L 1BZ8A 4N26A 1S9YA 5CD5C 3ETTA 3EBGA 4G80B 5FA3B 1MEXH 1DQQA 8FABA 1LK2B 1T0MA 4NUPA 5B1BB 5EEZA 3K71A 1G87A 4Q6KA 1BSIA 4PJGE 4AGOA 3SDAD 1EHXA 2Z91A 3WBDA 3US1A 1U4FA 4ENED 3B5HA 2V17L 1ETB1 4ZUUA 4D0CB 3T4AC 4JPWL 5K5YA 4RFOL 2AXGB 2WBJC 4XCCL 3TPUA 1OK0A 2N4IA 1B90A 3HN5A 1E8WA 3GSRA 3QIBA 3ZDZE 1MWOA 1T0OA 3DXAA 4B50A 5I1HL 5EEYA 4ZO8A 2OXGB 3GBMH 3HR5B 1KCLA 2DBLL 4Y2OB 1PZ5A 5DD3L 2X2YA 2XWTA 1CXIA 2JELL 1MIMH 1S3KH 2AJZA 2MNUA 3CSYB 3WS6A 4QTIL 1CFSB 2UVEA 1Q9OA 2ROYA 4HXBH 4NJAL 2W81C 3VFMA 1B6UA 4S1RH 1PNDA 1RZFL 4ZMPA 1BVZA 4XNYL 2BHFA 2WLIA 1K8IB 3AGVA 4YZFE 3WLWC 4LKCA 4EUPH 2FUTA 1L0QA 3QZNA 5C08E 5KSAB 1OAZH 3WUWG 4EZMA 2K6YA 2B3IA 2J1KA 3GYRA 1QRNB 4XP1L 5AOLA 1S7WA 1UD6A 4X4XA 3AQXA 2R1WB 4FXKA 4BD4A 1P5VB 5ES4B 2MJWA 2ZCHH 3PE9A 2J5LC 4GG6B 4HF5L 2CAKA 1D9KA 1N0XL 4IKLA 1FSKB 2R83A 5BOJA 4YPJA 5JHBA 3VDAA 3EGDB 1JPFB 4ZW8A 3QJUB 1R5VB 1JNHA 3A4EA 3ILEA 3MRDA 2ZJSL 4KHTL 3SB3A 1VHPA 1ZAGA 1F4XL 1Z32X 3BZDA 4HMEA 1E50A 3VQMA 4U3XA 1DVXA 1PG7L 3F12B 2Z35B 4LZKA 2DTMH 2NW2B 3WUWB 2X4SB 2G4EA 1DUZB 1LXMA 2JWYA 2V8LA 4ODHH 1DVFA 3PAYA 1YNLH 1ZT7A 4ALAH 5AZEL 4J27A 4FLQA 3RUGA 3DX8B 4N5EC 1IKNC 5IQ7L 2P49B 4HX1A 1PX8A 4M5SA 5DRZB 4U1JB 5JHAA 4PJ5B 1Q4NX 3FL7A 3MRPA 4J6IA 4UUJB 4KKCC 2UYLA 4JAMB 4P2RA 1BIIB 1OALA 1K8DB 3TJPA 3ZU8A 1A65A 2LU5A 3Q1EA 4RFNC 3N9GH 4G7RB 5FEBA 3WIHH 2AQTA 3S37H 3QJFA 1QNIA 1UCTA 2VDMH 4MB4A 2IANA 4OBSA 2DQCH 2DWEA 2WMPB 2BP5M 4JFFA 1J8HD 2KDYA 4FA8A 5KS9A 4FTVB 5IB1B 3MBWA 1AOZA 1FBIL 4UI2A 4XNAA 3IFLH 4I9XA 4MZRA 1S78D 2X44D 4LNVA 3FUNA 4L8CB 4HFWB 4NDMB 3SQRA 1PD6A 1A7NH 2RQEA 1XF4B 1A3RL 3GQFA 2DQEH 4P2QD 2R0KH 3ARZA 5ANME 1EMTH 1WA0X 3I6GA 2NY3B 3RLSA 1R9FA 2BSBA 5C0BD 1LEKA 5DJCB 1DQLH 1FDLH 3HAEG 1H3GA 4AMKH 5HYJA 3OXSA 5LDSA 3BW9A 3MSPA 3PDDA 1Z5LB 3LCYA 3EDDA 3N1MC 2QQNL 3PGFL 5EZJB 4AGNA 1R33A 2APBA 4UTAL 3FCSB 3U36A 3IGAB 1X9QA 2QVMA 4TUUA 4DEPC 1YNTB 3WY1A 3LB6C 5E6UB 1IFHH 4LEBA 4UINL 4AQAB 4B53A 1QR1A 4Z18A 4MNGA 5EZLA 3IWUA 4XMXA 3VXME 5JYMA 5F7EH 2VSDA 4C4KT 1PYWA 1JZFA 4FZ8H 3HAEB 5D7SL 1E2VA 1VGEL 3SE9H 3THMH 5L0QB 4A6YH 5TE6L 3UTZB 3HPJA 1HSAB 1QI5A 3NZUA 4N3TA 5C09A 4Z7OB 5HHXH 4WHDA 5AD0A 2MQ0A 3ARBC 2PW1A 4R6UA 5E4EB 3QO1B 3OR7A 4GQRA 2GABA 5D7EA 3H0TA 4UZGA 1IAIM 4XXWA 4G9FB 4A67A 2PTUA 3ASOB 4H40A 1KTJA 4FG6D 1SMOA 1TZHB 2X7LB 4Z0XA 2WZAA 4R90L 4PW3A 4YDNA 5KTEH 2Y24A 2MTPA 1UD5A 4R7DA 5H2BB 4KDTA 3QIBD 4HWBL 1A6AB 3FCTB 3IWVA 4QYOB 2NDGA 4DP9X 4PREB 5E08H 1WV7T 3PAZA 4GT0A 4XN5A 2NY0D 1CJYA 3H3PH 5C0EB 1Q1JL 1A6PA 2ZCKH 3HE6B 3TF4A 3W38A 4I0KA 3TF7C 4WY7H 3NA9H 5KSBB 2VQTA 3LRMA 3LQMA 3FQYA 4N2MA 1MRFH 1IU1A 2OZ4H 2XN1A 3T2QA 4EI5C 5LQBH 4AENA 4W6WB 3CX5K 4XMKL 5I1KL 1NCAH 4QT5B 4NQDB 4LEXH 4S11A 1JZ8A 5D7IA 3VX0A 4AYSA 1RL1A 2YR3A 5BV7H 1BVLA 2C9AA 4F57L 4RETB 1EEZB 4WGKA 3EGXA 5E2WL 4M4RA 1VGKA 4L05A 5FM5O 3P02A 4DUVA 3QCTH 4PG9A 2E47A 1XF2A 3S0PA 4XAWH 5IFJA 5B8CC 1DJGA 1P4UA 4PU2A 4OKVA 1D9KD 1OGAB 1K6QH 3OKDA 4UTAA 4BFGA 4GXVH 3VDBA 1RZJL 1ITCA 2IOIA 2VDQL 2ISDA 1JZGA 5DHYB 1FO0H 4Y9EA 5BVJA 3FCUB 4BCXA 4K4KA 3PGCB 1KIPA 4KNTA 1S5IH 1P53A 1C16A 3Q9PA 1ZKAA 4LLWB 1I8AA 2P5EA 1TO5A 4NRYA 3WNMA 3EDJA 4L8DB 4ODWB 2WNGA 2V7HB 3N41B 4OD1H 1XZ0B 4NXSA 4IS6A 4TTGA 2J8HA 3GSVB 3SY0B 4Y9CA 1J88A 1QFPA 4EMZA 2VZSA 4XMPL 5GGVL 3VI4A 3VXNA 3K6SB 1PY4A 2L4OA 3ULUC 3D12B 3CSPA 1EH9A 3QG7L 4P59L 2GY7B 4JRXB 3V4LA 2QADC 2K78A 4FL4C 1MI5E 2XTJD 3WAJA 5ILTH 1DBJL 3I2CH 4K7FB 2IAND 1IKFL 5ID1B 4HWBA 3MNVA 4PHZA 4GNKB 2V3DA 3U82B 2IAMC 4RWYH 2Y7QA 1MY7A 3N43B 1E6OH 4WEBL 5ALBL 3EADA 2ENSA 3GSNA 1YY9C 1KPVA 1S9VA 4RBPH 2AAVA 2OA9A 5GSRB 5AW8B 4AEHL 5KOMC 1I3GL 5EU3B 1DDHB 1CDUA 3ILDA 4ABWA 5DC4B 1N6UA 4NHUA 1PDKB 1QBLH 2XPZA 3ZT6A 5FUOL 4NP4H 5INDB 1J9CT 4KAQH 3E1ZA 4XVOA 5HYJD 4M8UA 2P7TB 6PCYA 4RMWA 5CMAB 3HI1B 2Q3XA 3AWFA 4MVBC 3QFJE 2XN0A 3L3OC 2N1TE 1CLZH 2EDRA 2BNQD 4MB5A 3EHBD 1OAKH 2HG0A 4YVNA 2G2NA 3G6JF 1A1NB 2EZ0D 3LKNA 2B2XL 5F6HI 3W2DH 4CU7A 5EORH 2DOCA 5J13B 3ROLB 1ZV2A 3VFOB 5ADOL 4PRDB 5I66B 3I85A 3TH4T 1AGCA 2VDRH 4NNPL 4ODUB 2AMGA 1I3VA 1WQVT 4YUEH 1W72L 3QQ3B 4GKNB 2GJJA 3E3QC 1KTLA 1OAQL 3L3KA 1N5AB 2H2SC 3B8SA 2Y23A 3ETSA 3NDYE 4DN3L 4JRYB 3CN4A 5ISZB 3RILA 1IGIL 4GG8B 5EPMA 1YC7A 2Y6SD 2CGZA 1OD7A 3AXHA 4KI5D 1F3DJ 3QCVL 4OBRA 2OJZL 3W1ZA 4C4KO 1DBMH 2AJSL 2D0GA 2CO4A 5DWPA 2HRPL 5C0IA 4PV8B 3QA3A 5GGVY 1U92A 3VQ1C 3T0EB 4MZ3A 3D08A 1J5DA 4LRNL 1BOGA 5C07A 3RNKB 3ATFA 1FNEA 2J88H 4KX9A 2R51A 1DBKL 4PJFE 5CXPA 1U8NB 1CF1A 4HSQA 1YPZE 1E9QB 3CH1A 4RNRA 3T65B 1JZDC 5SWZA 3HS0C 2NYYC 4O9HL 3ZL1A 1RIUL 3ATAA 5IK3B 4GW4B 3GRBA 4MMZA 4CC0A 1L4IA 2OM5A 1ZS2A 4M7ZB 2JB5H 2FYVA 1AGEB 1HQRB 2AQRA 2YLKA 4Y4HC 3FFCA 4WU5B 1AZRA 3MA7A 5IQ9A 1DJWA 4RAUA 1UWGL 2CU9A 4HOMA 1PY9A 4IOIB 3W56A 1DE4B 2YMTA 1S5HA 4KQ3L 2HP4A 1VZGA 3K6NA 3FUEA 1NCCL 4R2GC 3OHXC 4HGWB 3D5OF 4PW4A 5I74C 2DQGL 4KITB 2IDFA 4G7VL 4M00A 4LCCC 2QVKA 4X4ZA 1QOKA 4QPEA 3KVQA 4XVSH 2CALA 3FRPA 2HVJA 3WIIH 3D4YA 4OZIB 3GPSA 4WK2B 3VI3F 4Q2ZB 3V0DA 4TLTA 5CJOH 2OTWA 4K7PH 3QUKA 3ARFD 5BS0B 3MRCB 1J5CA 2J6EH 4HUWA 4JANB 4NAMA 2MHAB 4H20H 1EGJL 2IWEA 3D4GA 5KJRL 4BK5C 5DLML 3CLWA 4OLYL 1A6UH 4AIOA 1NJ9B 2YEZA 3CFCH 5ACMA 1IGFH 4H8WL 1DBAH 1FA4A 4KROB 3WXVL 4GRMB 3MLTA 4MD0A 1P7KB 3E80A 4PRBB 1NMBH 4G1MB 3HC3L 2GT9B 3PNWB 3FFDB 4DP1X 3BAXA 1S9XB 1O6SB 3L2LA 5CCHE 2VMJA 1KPRB 1F1GA 3GMLB 3CH8A 2IPTL 2W8CA 4MQSB 5C0CA 2BVQB 3EJUA 4N2AA 4JZNA 1WP6A 4BWTA 2G2RA 1E4WL 4M1DH 2BFGA 4QRRA 2FATH 2QPUA 3ZUNC 4KTEH 1AE6L 1JGEA 4I0PA 1AHWC 4KFMA 3A6BH 2GBUA 1MCFA 2XV2A 2VDKH 5JHDE 1JV2A 4HCRL 1CL7L 3JV6A 3IF1B 3FO9A 4PBWD 3GHBL 5I5RA 4I1PA 1DVUA 1XX9C 2B0SH 1PJ9A 1ZHBB 5CD3A 4YHNB 4LCIH 2JXMA 4TPRH 4P9HL 3B83A 4HBCL 3V0HA 5JW4N 4HP5A 5IB5A 4L29A 1QACA 4XO4A 1H6FA 1RK7A 2P5WB 3AM8C 1KBGH 2FZ3B 5MEQA 1CT8B 1CFNB 4Q9QL 4NO3A 1S9WB 5D1XE 2CIIA 3GXIA 3GMNA 2H32H 3HE7B 3QORB 1HL5A 3NZ8B 2BMKB 2D2OA 1R47A 4QHPA 4UNIA 2MCPL 1NCBH 2NX5B 2Q8AL 3ZHDA 3P3UA 3VG0L 4LCWA 3V2AR 3GZQA 1A4AA 3VWJB 3PDOB 1Q72H 2QZQA 3OKNB 1FZKB 5DSCB 3NVQA 2IPUK 1NMAH 2I9TB 2HUEA 3JWNG 2FQEA 4FGMA 4FMFA 3D1MC 2ZKHL 3AW5A 1CD1B 3FF7A 4NM4H 2ZWNA 5AVWB 2XWJB 4X6CB 1QA9B 4MDJA 1RD6A 4EE2A 5F3HB 3ARYA 4NNXA 2XTSA 4AM0Q 1BGXL 5DFTA 4M6MH 5TE7H 4DN4H 5L6YL 4H13C 4NO2A 3T04D 1GGBL 3B9VA 2UXVA 3EH3B 4PJ9D 5DK0B 1R0AL 2YO3A 4YDLC 3MVSA 4JLRA 4X7FC 4YPGB 4YFLI 2VMFA 1QAWA 1G84A 5D4IA 1P9MA 1N3NB 3MBXH 3GMRA 4XWGL 3TO4B 1U8IB 3C08H 2YC1B 3BZ5A 2R56L 4PJCF 4M5ZH 2BNRA 4BWUA 4GI6A 4BHUI 2W80C 4M1CC 3WKYA 1Z5YD 4QHMB 3LRGA 1OB1A 2CKBB 2N0KA 3T0BA 3W37A 4M3KB 2K8MA 4WHYH 3LN4B 3ETBJ 3VACA 3KPNB 4L3CA 4XPTL 1YYLL 2WXOA 3GDCA 3BIKA 3KLAB 2H8PB 5SWZD 3ZTDC 4HCRA 2X12A 1XGPA 4JY6B 4LVNC 5IMKA 5IEHA 2WXKA 2A74A 4XPFH 1OQXA 3B2VH 4XVJL 2VXTH 4RDQF 5I0ZA 4X6DF 5A3IC 3S3DB 4L37A 2R2BA 2NPLX 1T22B 1RLBA 3FU5A 3MTRA 2XBTA 3K2UL 4FFZL 3UTSA 3ZKMD 2PYED 1J9TA 5HGHB 3BZEA 1RUML 4Y4FA 3U0TB 3JUYA 3MXVL 4TSAH 4DK6A 3CCHB 4ZUSB 5T3ZH 1IAIH 4WW2F 3MRFA 4B9IA 2HSIA 2W65B 2YUWA 4BDVA 4KRPB 5IJDC 1EFXB 2H2PD 4PTTB 1AKJB 9PCYA 3GGWA 5TK4A 4C83B 5HGAB 3VJ6A 1ICTA 4JQIL 3WTYA 5CD5D 3S8WA 2GI0A 3STLB 4IMLB 2L7EA 1HHHA 4K5NA 1IGTA 4BJLA 3IMBA 1MCWM 1EDQA 5A2LH 3RL2B 1QO3A 4NN7C 3QUXA 4HHGA 3FOLB 4U6XA 5E4OA 4DGYL 4H1LA 4ONGH 3G6JB 4X6BA 3ULUL 1CQKA 1R3JB 3LHPL 1CXFA 2WBJD 1J7VR 2F74B 3RZWA 4JG1H 1ND0A 2IOMA 3MO1B 1OSYA 4JM2A 5D6DA 1V10A 4PJAA 4XTRD 1MRCL 4JHBA 4Q6YA 2Y1VA 3U30C 2QQKL 5L88L 1BVOA 3DHPA 4U1GB 3DBXB 1KJMA 7PCYA 3Q06A 3QJSB 4I48A 5KYXA 1HKLH 6FABL 5EU7C 4W9GC 2ZXAA 3GHEL 3GBNL 3MLYL 3V4VA 3WHXB 5E5MA 3SPGA 3OGCB 3TWYA 3RKPA 3TZVC 5I6OA 5I1EL 1WIPA 4QRSB 1KG0B 1KZQA 4JFQB 3ZE2E 1XCTA 5H35A 5E94A 3I84A 4PJ8B 1UXLA 4DUWA 3IVKA 5DJ0B 1CGXA 2GC7C 1XAUA 4IRJB 4PRAA 1RULH 5CCKH 4OVVA 2B1AL 4X6EA 3MLXH 5T1KB 4D9QD 1ED3A 1FL6A 4HAFA 4AL8L 1OOAA 1BZOA 4H0GA 4NO0D 4PJ6A 3EYFB 3N2JA 3WKNA 3BXNA 4ABQA 5T5FH 1FL3A 5DC9B 3KL0A 4BSJA 3UYRL 4WFFE 4FFZA 3A6CL 4LCWD 1R5WA 2AABL 3OM3B 2WXLA 4ZFFB 2GAZB 4JFZH 2FHBA 2ENQA 3DX3A 1WT5C 1BLNA 4DGVH 2OYPA 4APXA 4TQHA 1FZMA 1HAUA 4LHQB 1AG0A 4Y2NA 5D9SA 4BFFA 1ZK9A 4HOZA 3LMJL 3FU7A 4GQ9L 1TQVA 3MUHL 3GFUA 4MSWA 2OYLA 3Q44A 2V3FA 3KVPA 4GI8A 5KYYA 1LO0H 2J5WA 4Q4IA 4XXCA 3GTTA 3CVHL 4N5ED 5DUMH 2DEWX 1RHFA 3WJJC 2HT3C 4BH7A 4DCQA 1MLCB 3MLRH 4P3DB 1XR8B 3LZFH 3L5XH 1IBHA 1E4XH 1AMYA 5DRXB 4AQEA 2E7LC 1PQZA 2Z64C 2BNRD 4NN6B 4KKCD 5IESH 5MHSD 3ULVL 2OLDA 3VI3B 1TTUA 4OD3L 1F4YH 1JIBA 3PLYA 3JTSB 4QD2E 1DEEA 3QEQE 1ROWA 1F3DH 2DN7A 1JUFA 2EH8H 3BVDB 3ARDA 4PLJC 1ZMYA 4IU3B 3KPMB 3GIVA 4XR8C 3HZMA 5FYJD 4L0YA 2LVEA 5HP5A 2ZX6A 3VE0B 3KW8A 5C71A 2JLLA 1Q9KB 1H8SA 3ESOA 5AOMA 1BXUA 4X7EC 1CE1L 3QIWB 4JG9A 4NBXB 1WD9A 1EWHA 1GTFA 4GAAA 2DS4A 3N42B 2I7OA 4X80H 2QPFA 1HNFA 1KTCA 1QSFA 4K3DL 3RGBA 1YMMA 1ZEAL 4PYGA 3HBZA 4XE5B 5H8DA 1S4IA 2HN7B 3QWRD 2MH4A 1NL0H 4ACPA 2ADIB 3TFBA 1RJZA 3QB7C 2Q6WB 1R6VA 3BPNC 5IJBC 4W4OC 2JJWA 3MLPA 3H56A 5I17A 1T21B 2WVTA 2PPCA 2JF1A 3L3IA 3PRZA 2JB6A 1QSZA 4TVPL 1PLBA 1A2YA 5KVEL 2EIJB 4JDVB 5H94A 1P1ZB 2ORBL 3RGHA 4CMHB 2BM3A 1GHFL 1O75A 4MMXA 3EFDL 1T83A 4X42A 3V6FA 3BKML 3OKLA 5IB3A 4PMEA 3ZE1E 5HBBA 3LEXB 4N2NA 1UA3A 1MY5A 3DMMD 3BLPX 4PGJA 4KKPA 1BX2B 1TYEB 4HS8L 2PW2A 3TBTB 4A2EA 3B1TA 1HFUA 4Y2DD 1YRKA 3QUXD 4HJ1A 3RKDC 3P30H 1G6VK 3ZDXB 4YXKH 3L6FB 1DSFH 1G7IB 3CVHA 5GRUL 5KSAC 4NT6A 3D0LA 2IDQA 3Q43A 1CICC 5KUMA 3VD0A 1U4EA 4FQXA 1X5LA 3P0YL 3GNMH 3BP6B 4N28A 4TL5A 5CIPB 5EU4A 3OLGA 1OARH 4J3OH 4X4KA 4HLZG 3T1WA 2VLRB 2HRHA 1FSKC 2IDSA 1MQ8A 3C5ZA 4MB3A 4QHNB 5JOEA 4FQQA 1T4WA 3MRGB 4GPVA 2YJQA 3MJ7B 4YHLH 4KHXH 1IGJB 1MCNA 2GKIA 1F6AB 3WFBH 4QTHA 3ZTEA 3FUIA 5I1CH 3LNEA 2WGNB 4I2XE 4NP9A 2DWDA 4EVNB 2KDGA 4E5XA 3BUYA 3OB0H 5E1IA 5E5RB 3LSOA 4OGXL 1EAJA 1U2YA 2D7QA 2LFEA 2R29A 3HW7A 3SGEI 3SEPA 4LDOB 3W9DB 5GRZA 3ASWA 4NQXB 5EZIH 5DRWB 1YLBB 4PJCB 1QFWI 1OT2A 3H9HA 1SFHA 4RAVB 1ZLUK 4FXGB 5CGMA 4RDQG 2WNKA 3BO8B 4FS0A 4I1NB 1MFBL 5FM5M 3TT1L 3B7TA 5C0JA 3KWUA 1MQKL 4E9LA 1A6VL 4MRCA 2I32A 4WFED 5KBNC 4PY7A 1VDGA 1F5WA 3VXOA 5INCA 4Q9CA 3LIZL 3NIDF 1P5UC 3EJRA 2P8LB 5GISH 5I8EA 5E24E 2BOBB 2J7LA 3KWWB 5IWLA 3TNMA 3LQZA 3IXAA 1PW3A 3CK0L 5CSBA 1E27A 2Z31B 3AFLA 3ZE0F 1NCWL 2NLJB 1M9SA 5FO7A 1KB9K 4L3AA 2CLRA 4X6DB 5BO1H 5IUCA 2VDMB 4WHCA 4NC0B 1NPNA 4FF9A 5IGXH 2J4WH 2PKDA 3BKCH 4ZSOA 2NY3C 5KVDL 1KLFA 4CNIB 1KXVA 5IP4A 4K73A 2CR3A 3VFTB 5A16B 1KJ3H 3WSQH 2Q0ZX 3BAYA 4WK0B 2M83A 2WSPA 1DLFL 3IDNB 5C8JA 3ULUD 1SPDA 2IMMA 3HS8A 3NDZE 4ODVH 9CGTA 3MOBH 2OCCB 4WW2B 5BPPA 4UAOB 3P9LA 1UB5A 3ARDD 4QRFA 4HK0B 3U9UB 2IAMD 3CHQA 4PRNA 3CFTA 5DZ9A 4P2QE 1NCHA 2KKQA 1JG9A 1ID2A 1YY9D 4PB0L 4MMYB 5L2KD 5C0BE 1KXTB 4PMFA 4W6XB 5H37G 3UDWA 4B0MB 5I0XA 3GIZL 5L0QC 4NAJA 3OLIA 2A1WH 1SN0A 1KYFA 4HEPG 1M4KA 2GBAA 4POYA 1T1ZA 1J05B 2OYMA 3DHUA 4PRIB 5IVXF 4ZNEE 3TYGL 2EDXA 4QNPE 1MNUH 1YMMD 1CC3A 5G4NA 5MENA 3DVNA 1ORQA 2ZSVB 4IBSA 1CDHA 5D1QB 5CJQH 4MQXD 1HNGA 4M62L 4LU5H 3VRIA 5E9DD 2N1KA 4WUUB 3TN0B 2A9NL 2WHVA 4HIJA 3PXJA 4JO1H 1T20B 2G5BA 5GRJH 4ZMWA 3ML9A 1EXGA 3U0WL 5D71H 3OF6A 4JFSA 4XOCA 3HZ3A 1ANUA 1GRWA 1VZIA 3HPLB 4UYPA 2BNUA 4OJFH 3LIZA 2E6JA 1V5JA 4QRPB 3HE6C 5IQOA 3LD8B 3P4NA 4J4PA 1AXTL 1YEJH 4BZ1L 4G8GB 1I1RA 3NH7L 4NKMB 3SYCA 5C3IA 1FYTA 3W39A 2EXWD 1ZWIA 3JWDC 4MCMA 3QJZA 4U6HA 2NQ3A 4FABH 2WVVA 5IV2A 5C1MB 1LK3H 3GXUB 5CCJA 1SBSH 5IBLC 5AB2A 3C8KB 3GI9L 3DXAE 1PAZA 4TMPA 1SEBB 1T2QH 1BVKB 3ZHLA 4E9WA 1E40A 3ILQC 1FG9C 3GSOB 3IKKA 3UPRB 3KNBA 5FYKL 1TQCC 2VWEC 3ULVD 2IG2L 2H4EA 2EXSA 4PI2A 1WA2X 2VM3A 4YBHA 1MF2H 3UAAA 5BV7B 1T03L 4HWZA 1OGTB 3E6HA 3KPRA 3QNXB 4GS7B 5DWUL 3PGDA 1JGLH 1ECZA 2BSED 1OP3H 3PJLA 1I1AA 5EO0A 1CFTA 5FM4A 2NYYD 2XI9A 3L4YA 1CMOA 2X9YA 1JGVL 3K4AA 5CHNA 1TKWA 4H0IA 1OHQA 3QI9C 3KD4A 1EVTC 1SBBA 3NCCB 4U4BA 2DQIH 1Z9SA 2ZOLA 4Y4HD 4NZRL 1YC8A 3NMEA 3WXWH 4P46B 3ZTNL 4N2HA 4Y9FA 5F8QC 3VRLF 3VSVA 4HWEL 4NB7A 1FO0B 1C5BL 5FHBL 2X0VA 1KIRB 1ORSA 2JJUA 4HU8A 5K59F 1AFVH 1OPGH 3ISWA 4FYRA 4YHIB 3RWDB 5G2NA 3PWUA 6TAAA 1X5JA 1H8LA 4JKLA 4LBEB 1Z2KA 3FTWA 1MHCA 1QPPA 3FTVA 3OJVC 5TE4H 3VW3L 4D0DA 2R69L 2VLKB 3BUIA 3KLDA 4GIOA 3ZYOA 2P8PA 4MZIA 1QBML 1IVTA 4UQ3A 2CO6A 4M6NL 4P5MA 4YDKL 2G0KA 1BHGA 3HNSL 1SLUA 4LLYA 4W81A 4O2CB 1OXYA 4HK3N 3RUGE 5JPNB 1FAIH 4JPIA 4BZ1A 1UUNA 4OZGF 4P2OA 1LE9B 1T5XA 1DN0A 1LM8V 3T6QC 5BRZB 2EDBA 2H1PH 5LBSH 3FQTB 4JN1H 4N68A 4P2RE 3CMOL 1J1OL 1RZ8B 2B59A 2ITCA 4I4WA 4N2EA 2XIBA 3EOTH 5ILTL 4MJ5B 4YNYA 5C6WH 5JHMA 2QLVB 4JGNA 4XO5A 2XTJE 4XN8A 2Z1KA 4HPYH 5DR5L 4K8RC 2RAMA 2IANE 3IFOB 5EN2B 4JFFE 3T08A 1MAKA 2EAEA 1MCCA 1VKXB 4U3CA 5KS9E 2BIOA 1SOXA 4LOVA 2F9BT 4FQ1L 2ZOKA 3SKUD 4JN2A 2GK2A 3U7YH 2G5UA 2MQ3A 3A6OA 3HG2A 2ZG3A 4U7MA 4WI3A 5D1ZB 4JFWA 1A6TB 2GFBB 3DLQR 4YO0B 3ISYA 4WI9A 1UACH 3WFEH 4OJAA 3WFDH 4AYDC 2J1WA 2J1ZA 3GDBA 4LGSB 5AKTA 1NFDA 1WSST 4KC3B 2GEEA 1G9NH 1B3IA 3QULA 5FUCC 5HYJE 4UNVA 2R0WH 1AZBA 5F7DA 5KEZA 1U0QA 2G4GA 1KC5H 4UQ9A 2P26A 5JZ7C 2O61B 1I1YA 2P44B 3STBA 2D3VA 5MEND 5MEPA 2GSMB 5E0FA 1TT6A 3OC8A 3WTUA 5D2NC 1IBDA 1OIOA 4MNGE 3RTQA 2GHZA 1PKQB 3N44F 3P73B 3BMWA 2CBQA 1QW8A 3WIFA 5DUPL 2J8UA 2XPGA 3O11B 5CU9A 2R69A 2VN5A 4UT9L 3AQDA 1BQ5A 3GMQB 3CNKA 5C09E 5JMRA 4PGBA 2VO8A 3MV8A 1PZDA 2CXGA 4J4PD 2N01B 1LILA 4G6AD 5AVUB 4MX7A 5T8IA 5FDYA 1NFKA 4I13B 5FO2A 2VLJB 1WAAE 1GGCL 2PXYB 2AVFA 3EDEA 3OJDA 2D4DA 2K4AA 3NK4A 4JW3A 4HLJA 5JXEC 1ZE3C 3P9MA 1CK0H 2VXQA 2G3MA 3O8XB 2DZEA 4QGTA 4MNQB 4QHKI 4MA3B 5EEUA 1UXMA 2PR4L 5GHWH 2FQDA 1OCRB 2L7QA 4Y1TA 4TOYH 3CFDA 2G60H 2WBXA 3S2CA 1J5HA 3D3VA 4HKZA 3QARA 3EOAB 2YHGA 1X5GA 3KPRD 2KC0A 3LVTA 3M45A 2NNFA 1QASA 1ZTXH 3FONA 1UTDA 1T6BX 3BE1L 1KPUB 5D7IE 1I1AD 2F18A 2ZXDA 2FX8L 3G08A 1A5FH 4CGUB 2AV1A 5DGRA 5CBEA 3EYVB 1M9WA 4PVMA 1ZDQA 4IRSB 2E9GA 4ELKA 3M8OH 2G30A 4C54A 4YLCA 3GHPA 4F7CA 5E6IC 5FA3A 3DUUB 3T0XA 1UYWH 4MJHA 2X6BA 3BUPA 4YAQB 1FC2D 5AFAA 6PAZA 1ADQL 4AYEC 5FDWB 3CLEL 5D72L 1G9MH 4D0CA 1MCPL 1QKZL 2BJML 2P80D 4RQQB 4IDJL 1THAA 4X4MA 3B4NA 2CSPA 1JOIA 3WJMA 2DI8A 4JPSA 1KCSH 1X4YA 2OXGA 5CILH 5EF0A 2P5EE 2CUHA 1U8CB 1LO2L 3OLEA 4UT9A 1S7QB 5TDNA 2WJ5A 2I60L 1I3RB 2NTSP 2AJXH 1CFSA 1GJIA 3RDTD 4BKSC 5IVXB 3SPHA 1ADWA 3VXUD 2BS8A 2KPNA 1OAJA 5ALCH 1YN6B 3VI4E 3RFZC 1BYPA 3CVIH 1SXCA 2UXGA 2VDKB 4LIQH 4BSWA 2N0MA 4H2AA 4HEMA 4OCWH 4U7KA 3G6DH 1KF9B 4F9PA 3N40F 3QXWA 1E9OB 4PLNC 4XVUD 2ARJA 4UQBA 1QRNA 1U3HB 3PABB 3HE7C 4XOAA 3QORC 3TT3H 3UBXI 1JFQL 2Z7YA 2PLTA 4WTZA 1P5VA 5FYKD 2XA3A 2UY7B 1CFVL 1JGUH 2AC0A 3GMPA 5IT2L 1K4CB 3VWJC 2BZDA 2O5XL 2OZNA 1J0IA 1EK3A 2VMDA 4DKAA 1Z9OA 4KOBA 3EGDA 5ABAA 1JPFA 2J1YA 5F96H 4M6OH 3ZKXC 4OV5A 1KYUA 4GKZB 1ZGLP 1SVZA 5EOCL 1HJBC 5LO7A 3F12A 1U8OA 3FT3B 4KRNA 5T3XL 4F7EB 4YS4A 2X4SA 4KZDH 3OKYA 2HXAA 4OZGA 3AB0B 3X14A 2KLTA 4LOEA 1YYML 2Z6FA 2EE3A 3NSDA 4G6ML 3NPSC 2NNRA 5HI5C 3H4HA 3QJHA 2E76C 1T1YA 3MU3A 3RVVD 1V55B 3DTUB 1ADQA 1QYGL 4U1JA 3T8MA 2CO7B 1NDMB 3U4BH 1F58L 2HKAA 3EH4B 4GXFA 4S0SD 3RTQD 4AQOA 2C1OB 2VXSH 4K2UL 3L7FB 4OZHF 1K8DA 3H9ZA 3K4DA 3JWNC 4K5PA 5L8JB 1T1XA 1KULA 2P4AB 1PEWA 2WKLA 2QV2A 3IT8D 3LQAL 4JFED 2BIIA 5CP3A 2KH2B 4DP4X 1P7QD 2WMPA 1AQHA 4PJDF 1TQBB 5TDPB 4FTVA 2F19H 2KZWA 3MV7B 2V5MA 4WO4C 1MVYA 5DMKB 1X5FA 4CMMB 4NZUH 1XWVA 2VQ4A 1ETZB 3NJLA 3IFNL 4L8CA 5IOKA 4FNQA 1HZHH 2C3XA 1A3LH 3G5XB 2VL5B 5DJDB 4LRIA 3TJHC 3QPQC 4WZ9A 1U2CA 3DTDA 5A6LA 5M94B 2Q3AA 2HT3D 3FU0A 5C07E 4YJZL 5DJCA 4B9GA 1GPOL 5EMYA 1ZGLA 4N2GA 4S1DC 3LKQB 4PSRA 3D2UB 2AK1H 5DD5H 1Z5LA 3W5NA 1RK1B 5J5EA 4F7TA 5SWZE 4PJXF 4KJYA 4M8QB 3L2NA 4YSQA 1WJ3A 3CXHJ 2Z8RA 4UT7L 3AT0A 3FCSA 1TVHB 5C2BL 3IGAA 1TZ8A 4PLJD 1YNTA 1NEZA 3BVTA 4WKXA 2WKOA 4YL9A 2V17H 1O7SA 1RUAL 2DIJA 4LKXB 4WV1B 3FFCE 3SBQA 3QZBA 2YA2A 5D8JH 1E2WA 3N85L 1U8KB 1SMDA 3FULA 4FOMA 4UDUB 3LDBC 1P6AB 2YN5A 4B9ZA 1DL7L 5I1HH 1YDPB 3RIFK 2VDPB 4LSQL 1HSAA 3W9EB 4Q9BA 1H3UA 1N4XL 2DBLH 3MGOB 1E3FA 5JLZB 4RBPK 5DD3H 2FJFB 2JELH 2VXUH 3T2OA 3FRUB 2FWLB 1UD2A 1JN6B 4G9FA 4QTIH 5FKPA 3RWFB 5KVFL 1M6OB 1ERNA 3I75A 4LPYA 1QHQA 1BLIA 2MNJB 4YGVB 5AB1A 1RZFH 5T1LB 1J8KA 1BYNA 2OL3L 4A2MA 2YPLB 3HZYA 3S96B 5H2BA 1J5OH 1OP9A 4XNYH 3MUUA 1PAMA 3B2DC 3FCTA 4QYOA 4OCSH 1KJVB 3T3ME 4GBXB 4PREA 5C0EA 2HX7A 4U3SA 4XP1H 1BEYH 3MJGX 4UNTA 4AK2A 2CMRL 2F1EA 1UA6H 4B9PA 3EO1B 5MP6H 1UZGA 1SJVA 3DSNA 2N56A 2AANA 4HF5H 5C0CE 4YDVB 4QT5A 5FGRA 4X5PA 4X7TA 3QJXA 1M57B 3Q1SL 1CG9B 4IRJC 4M7KL 4QRRE 1CYXA 3C2AH 3GSQB 3ZR6A 3FJTA 3O3EB 1EEYB 3O6FB 1G6RH 1IC5L 5KSAD 4DPBX 1F4XH 4ZMQA 1TZOA 5IM7B 1NC4B 3OMIB 1QRND 4CBZA 3MHZA 3EBHA 1NSNH 1PG7H 3R18A 4G8IB 1BFOB 4GRLB 1ET7A 1G4MA 4WSKA 3RZCB 1QLRA 1OGAA 2C5DC 3CV5A 4YH6A 5LGJB 5AZEH 1F8TL 1J9RA 2XA8L 1KCKA 1J0HA 5FB8B 2D03L 5IQ7H 1KCWA 4H5SB 1DQIA 5DHYA 3ARTA 2IPUG 4D9QE 1E5YA 3PGCA 5I1LB 2VIRA 2DQTH 1IEAB 1UKQA 4YSDA 3C75A 3HG0A 3K2MC 4LLWA 2F08A 4JFVA 3AROA 4YSSA 1X5KA 3S36X 4XCFH 5LWYL 1KT2A 3ARGB 3Q6FB 2PP9A 4AIZB 5BZDB 5F97E 2QKSA 5B21A 4LCWE 5EWIH 1IBFA 2WJ7A 1XZ0A 3BCDA 2AMUA 4HZ1A 4IM8A 1NCDL 3RHWF 2E8YA 5CR1A 1JYWA 4CSSA 3VXRA 4PJ5D 1WZ1L 3SY0A 3U1PA 1KN4L 4A68A 1DVZA 4MB1A 3K6SA 1E5UI 3TM6A 2JTYA 4NQTA 4NQCB 1A3RH 1YHPA 4LVHB 1XDTT 4AXWB 1SY6L 1MCRA 1HXMA 2OL3A 3LZRA 2RA1A 3WEAA 1YEKH 4QJ5B 2ZWZA 2EUWA 5AVQB 2VJ0A 3UYPB 5T1JA 4FTVD 4UOQA 1PEZA 2WZ0A 1U21A 2HFEA 2QQNH 5EOQL 2X6MA 3KR3L 1KXHA 3F65A 4WDIB 1G0DA 4OW6A 3SE8L 1N6QL 1Q1PA 2VQ1A 4MBRA 2P8MB 4MAZA 2BNRE 2VDOL 1HWHB 1DDHA 3DX6B 4GRWE 4LLVB 5DVOA 1KACB 4HUUB 1XF3B 4X9FA 2NY3D 4DPAX 1ZK5A 2BXYA 3MCYA 4FRWA 4F5CA 3ZLQC 4O4YL 4OGZA 2MOGA 2BWQA 2P7TA 2JCCF 4RMSA 5F1NA 3IETA 2QTVA 2IGTA 1BQLL 4HQQL 1MCHA 1KLUB 5CEXA 3RTLA 4N2FA 4U1NA 1UHVA 5D7SH 3K2IA 4HJGA 3RY4A 3C9NB 4LSRL 1UT9A 1D5IH 2H6UA 2VKWA 3NRFA 5HPOA 1QNZL 3ROLA 5K9OA 3P3SA 5C6TL 4NO5A 1QW9A 1C08B 4XNUH 3DVGB 4ODUA 1QUNA 3KXFA 3AAZB 3FBKA 5TF0A 5D2LF 4YSPA 2C3VB 3QEGL 4ZMZA 1XZWA 1NGXB 2TSAA 1HCVA 1N5AA 3OMZA 5E2VH 3PS6A 3O41B 4G7SB 4JRYA 2EDTA 4XNZB 3Q05A 2VMEA 4HWBH 4GG8A 4LARH 4WKZB 5J1SC 4ZO7A 1CF8L 2AJ3B 4UV7H 1Q1JH 1HHGB 3LZPA 4XBGB 4WCYL 2WIIB 2EADA 1I7ZB 5EV7A 1GVIA 4G9FD 4YSTA 3SJVB 1EUUA 4NCC2 4F3FB 2AJYL 1S2EA 2WXMA 1CDJA 3K1DA 4I3SH 3T0EA 4ZX5A 3OV6A 4EI6A 3ZQWA 3U2SB 4ABVA 1SY6A 1QP1A 1MJJB 1AGFB 4PWFA 4IJ3C 4P07A 2JJVA 3MCLL 3T65A 3LV3B 3HE6D 1X9LA 3LXCA 3MN8A 1F13A 1F18A 2BH0A 4HJIA 1MJUL 4GW4A 4Z3TA 3PPSA 3DHJA 1AGEA 4NQDD 1XQ4A 3KPSD 5CFAA 2J3SA 4WU5A 5DFAA 4PJAE 2VDQH 3M17B 2NZ9C 3GK8L 5IBLD 2Y7NA 1DE4A 5EIIA 4FXGC 1X3DA 1QZ1A 1KGCD 1EZUA 1IAKA 3DYOA 4OZHB 4ZAKB 3ORJA 3ILQD 1OZTG 5HHOD 5DQ9B 2XWBA 4NFDA 4MXVE 4JFPA 1N5YH 1JZ4A 4PJDB 2IALB 1YMHB 1SVCP 4AYID 3UOAB 2B20A 4OZIA 4C47A 3D9AL 1TZIB 2CPCA 2IDCA 3NN8A 1PL3A 4WWID 1JVKA 1FNFA 3FC8A 3MRCA 4BFOA 1C5CL 3DJTA 3GS0A 3NIGE 4XMPH 1Y0LB 1ZVHA 1LP9A 2D7TL 3DIVA 4MCNA 2PCPA 2AK4A 4AI7A 2Z31C 4P59H 5FV2A 5I9QB 4MAUL 2ZX8A 4FQXC 1IKFH 1CFQA 2X1OA 3CMGA 4GRMA 2IBBA 4PGDB 4PRBA 3IN2A 4PTUA 4WFEE 5EIIG 3DRTA 5ITFB 1E3XA 3JVGC 4XNDA 3PNWA 1C5DB 2GT9A 2YN3A 3LN9A 3HCVB 3LEYL 4PJXB 4WEBH 5ALBH 5FO9B 5HPMB 1O6SA 3B9DA 2CO2A 2WQXA 2BRQA 4N9GB 2QELA 5JHLH 4F2FA 1ZVNA 3GXPA 2CKBL 4QGYA 2WAHA 2HX9A 5DVMA 2AS5M 1GL4B 3QWQB 1G0XA 1G1CA 1I3GH 2DLEA 4WW2C 5ICZB 4JRXD 2FH6A 3M46A 1HSBB 2H9GA 3RGVB 1ITBB 2BZCA 1OM3L 2CDGA 5FUOH 5I5MA 1OTSD 4WUKL 3BH8B 3FAWA 1JYVA 5C7XH 4ZFGH 5AKRA 2BSTB 5TGBB 1LWHA 2XRAL 4YHNA 2WXQA 5I1GL 4QHUB 3MOAL 4YSEA 1UCBH 2B2XH 2WTPA 4E36A 3FT1A 2JIXB 5IMLB 4EO5A 2P5WA 5ADOH 3NJKA 3FQ2A 3U6XA 2XC8A 2FZ3A 1CT8A 1CFNA 2FUQA 1B9KA 3S36L 3A67L 3CBRA 4JHUA 4V2BA 1S9WA 3QXUA 1W72H 2I07A 3REVB 2NNAA 5HYSG 5D1QC 1T1WB 2GW5A 3HHSB 1I53A 1QBAA 4IW4C 1DLHB 4JHAL 4RRPG 4DN3H 4A04A 4X5RA 3ZHNA 2IBZX 4L4VB 2HH0H 1FI8C 2BSDA 2V7NB 1RVFL 3Q01A 1QPKA 2D9QB 3MV9A 2OJZH 3VGAB 1L7TL 1S9KC 2A77H 5DSCA 3AREB 2I9TA 3G5YB 4YL4A 2HRPH 3MRRB 4H8UA 1HS6A 2OMVA 1CD1A 3VXTB 1QSFE 5DGQA 3MBEA 1YMME 2X4QB 2XWJA 4X6CA 1FFPA 4JRYD 2ZICA 3BDYL 4NUGH 5ISZD 4KKAC 3OAUH 2XXMB 4NRXA 5B7FA 5HYSB 3VD7A 1TQWA 5JZ7D 2B08A 4QHLB 3JSSA 4J6RL 1SHSA 4YPGA 3NQKA 1JXFA 4Y1AB 3V5DB 4WNQB 1N3NA 3VB8A 2CK0H 1RIUH 1YEFL 2XQ0A 2YC1A 2XKUA 3MNWB 3FUDA 5I16B 4B5EA 1ZANL 3QJVB 3CFBB 2FJSA 3T0ED 1KCBA 2CKBA 4TQEH 4BBWA 3BKJH 2WWKT 1UWGH 3LN4A 4PCKA 5FYLL 3WMQA 2HFGH 4I9WD 5DJXB 5E8NB 2H8PA 3QQ4B 1F90L 4MCZB 2DQGH 2Y5EA 3S37X 1T2JA 5KBLA 1XD1A 4JY6A 3V7AG 3SDDC 5K1VA 5HVWA 1H3TA 2QMKA 1JS4A 4OFDA 2W38A 1MFAL 4RGMB 4A7GA 2QSCL 3ULVE 2FWOA 3QWNA 1CLCA 1FG2B 3DROB 4MJ4A 4PB9H 1Q38A 5GS1B 4UQ2B 1EGJH 2OJ1A 3LRHA 3JYBA 4LSPH 2AQQA 5KJRH 2EYTA 4DAGL 4AQ1C 2MCMA 3C2SA 5T5NF 4GO9A 1JVOA 4L3EB 4IMKA 3EJQA 3U0TA 3V0IA 4P04A 4FFTA 4N2OA 4TNVF 3ZY7A 5K9QG 3CCHA 2E74C 3HC3H 3VXQB 1MFEH 1UZ6E 4NWUL 5BS0D 4BQ8A 3BP5B 2IPTH 2JCWA 2W65A 4LSVH 4NM8L 4LDCA 3VSQA 4ZS7H 1EFXA 3CD4A 5FYKU 5JPNC 1E4WH 5FLUA 4OFIA 4JM4L 1AE6H 1KIUB 1UUSA 1MFMA 5FW6A 3DPDA 3QDGB 4IMLA 1JNLH 4C4UA 4KROD 1JHKL 4H2CA 5LNGA 3REWB 2JCCB 1YECL 5FYJH 3IJHA 5HJBA 1EHAA 4G8EA 3RL2A 4HCRH 2AQ2A 5EOTB 2LV4A 1XCQA 2OW6A 3ESNA 3GXMA 3ECVA 3VWKB 2N3JA 3TH2T 4TVPE 2H45A 4ZD3L 1DJXA 5KVEE 2F74A 3GEWB 4P4RA 3DJZA 2PCYA 4E9YA 1I8KA 2NY2B 2YARA 4Q9QH 1U58B 3OWEA 1QI3A 2ZWKA 1IEBA 3QW9A 4MDIB 5JDSA 1QLEB 2IIJA 4M6AA 1CBVH 4PJBF 1MUJB 5D7JB 3FN0L 2OX5B 5CR8A 3M1CA 4ZSOE 2MCPH 3TO2B 4MKTA 1L9QA 5IMMA 4PLKC 2D7OA 4L1BA 3VG0H 2BIPA 1FNAA 1GS8A 2VITB 5HD8C 5C0GB 1DR9A 4PJ8A 3VMNA 4KXZH 4YXHL 4DEUA 5DJ0A 2P5WD 3SDXB 3L5WA 2D9CA 3P4OA 5E6SB 1J0ZA 1MCQA 1JWMB 2BCKB 3EDKA 4UQIM 2HPTA 4HSCX 1LDPL 4L9LC 3HE7D 3QORD 2XPYA 4LLUB 4WEMB 2YD3A 3BESR 2NX5D 5L6YH 4I5BA 4TNGA 1NCUA 2IPKB 3MLZH 4XBMA 4UQCA 3VWJD 1R0AH 4PJ7B 1CFMA 5E6YA 3B2MA 3BKYH 4O5LH 5JIPA 4KFZC 1OHZA 2C9VA 3GBDA 5MI0B 5PAZA 2E4TA 4FLHA 2CUAA 2J73A 1DVYA 1HESA 3G04B 1U3YA 2H0FA 1TFHA 2R56H 4XHJC 3LKPA 4HUVA 4NKOA 2DIEA 4QEGA 5GS2D 3KYNB 5MENE 2ADFL 2BPBA 1H0DB 2PXYC 5D93C 2LT9A 2FO1A 1YEWA 1YYLH 4H0LC 3ZL4L 3C6SB 4N0FA 4Y5VA 1MIML 1S3KL 1VACB 4Q56A 1MLCA 1XR8A 3OB0K 4G7QB 4P8QA 3T2LA 3O8XC 4S1RL 3TO4D 2TSBA 4P3WA 4EPSA 2EH7H 4AYBA 2VM9A 3U1SH 3DYMA 4Y4KA 4NQEB 2UVFA 3IPFA 3JTSA 3QEHB 4EEEA 3UP6A 4PCYA 4XVJH 1XSIA 3NZSA 3L3GA 1D7BA 3EJJX 3RVTC 5DTFA 5CJXA 1FYTE 4IU3A 1OCWL 5J7CC 4YC2B 2NR6C 1IILE 4G43B 4RAHA 3GEFA 4K3JH 3T2NH 3K2UH 4J8RB 4FQCH 2ZCHL 3QPXH 5KVDE 3BPOB 1Q9KA 3G5WA 4IRSC 4D9RE 4FA6A 3PL6A 2MOVA 2V5RA 3QIWA 2RMNA 3CFJB 2HMID 1JWSA 2J2ZB 3MXVH 3RJDA 1QSVA 4DP6X 3QHTC 1VESA 2IH3B 4HFUH 4Y7OC 2HJFB 4YK4B 1M42A 4O02B 3FB6A 5TTRA 1M05A 4LEOB 2HN7A 4S1DD 1EZVX 1SOKA 4C56A 3DX1A 3KPRE 3MREB 3NG5A 2DTML 3S48A 2ADIA 5BQDA 5AAPA 4QXGL 4JQIH 2HLFD 5CN2A 4Z3FA 4CADA 1HXYA 4L9DA 1T21A 5CFHA 4IBUA 3ELQA 3D07A 1XH3A 1XIWB 4AE0A 4MA1B 4TVSa 3PHOA 1PZCA 4DGYH 3UTOA 4RMBA 4H88L 3ULUH 5ETUB 3LHPH 5C9JB 1EFXD 3SDYH 1AKJD 2W88A 4G3YH 3LEXA 3N9GL 4OFPA 5GS0C 5KVMC 4QY8B 3WIHL 3WN5C 4Z7NE 3S37L 2QQKH 5L88H 2VDML 3I02B 1BX2A 1RY7B 2DQCL 3SKNB 4JL2A 2BFVH 4HH9B 4E68A 4GP8B 4UWQB 1AR1B 3DO7B 2BS9A 3WNKA 5CEZE 2Q20A 5DRNB 3IFLL 3MLYH 2X0WA 4OFYA 4ZBJA 1UFUA 2G75B 3BFQG 4YHML 4FNUA 4HGMA 3SDYL 3HC2A 1BBJB 3BP7A 2AQPA 4L5FL 1VLXA 5DT1H 1CO1A 4ZO9A 2CBMA 2DQEL 3P69A 5DYOA 1BZEA 2R0KL 4HJEA 5IW6A 5AAMC 1OCZB 5KYWB 3FN3A 4PUBH 7CGTA 3MA9H 1DQLL 2IBZY 3ZYZA 1QLFA 4AMKL 2VR8A 5FYLD 5E56A 4EUPA 1NPUA 4ELMF 2EEAA 4QHNA 3N0PB 4U1SB 4Z3JA 1NC2B 3V79C 3MRGA 4KDWA 5D6CB 3MJ7A 1AC6A 4WIQA 1IGJA 5E2UL 4WWNA 1GTNA 4W1TA 3KLKA 3UYRH 2UZXA 2VLLB 1EBPA 4KKBC 2ZX9A 2AABH 3HG1B 4KK8D 3SCMA 1D5BB 4UQDA 4BRVA 4PJ8D 2VUOA 3MC0A 3RIFF 4R0LA 4UV4L 2Q8BH 4IRJD 1T5WB 1PGRB 4PJGF 1XO8A 5FYKE 5T1KD 5E00B 4HKJA 4RAVA 5FFLA 1KBVA 3GMOB 1JV5A 4U1IB 5HI3D 2CCLA 2F54B 4ILDA 4GQ9H 4FZ8L 1MW2A 3ECWA 3THML 2F53A 4CJ1A 3SDCA 4A6YL 3V5HA 1A64A 2CE6A 4CBPA 1MPAL 4P5TB 1NKGA 5HHXL 5T5NG 1F3JB 1NFDE 5JW3H 1CTNA 3S5LG 1WRFA 3OVUB 3ZDZF 2H7WA 3IS0X 1BREA 1XTLA 4A2FA 3FCBA 3ERXA 2P8LA 3TEWA 3BQVA 2OTPA 4UMGA 1A7RH 5DS8B 2BOBA 4O51B 1WIOA 1ZA6B 4W9ZA 1I7RB 3QNFA 1N7MH 3FYIB 2X4TA 2Z3FA 5KTEL 1IQDB 1MJ8L 3UC2A 3MNMA 4XMWA 4K7PX 4OD3H 3RBGA 4F9PC 5IHUL 2Y1YA 3ASNB 2NLJA 3WIHA 4Z5RA 5E08L 1OP3K 3L1OL 3NCWA 1JPGB 1DYZA 3QT2A 3UMNA 4AG4L 4WY7L 3NA9L 1J5IA 1EZLA 1MHEB 2ZG1A 4YZFF 2OZ4L 5DFVD 2J8UE 1AD9B 2JH2A 3B2UD 4LPTA 5EU6B 5A16A 4M7LT 2JKSA 2YSSB 1NCAL 2WN2A 3VDCA 3MV8E 3BN9C 1GXEA 1RZKC 5E7FA 2YS4A 5BV7L 4IGBA 2QQQA 3GRWH 5DMGC 2WCGA 1UXWB 4A63A 3QK0A 3QCTL 4WV1C 2W59A 1ZIAA 2X40A 4IBZA 3LRSA 3X1BA 2OKMA 1MCWW 4XAWL 2H3NB 3GTNA 4MMYA 4BWWA 3CJJA 3LS4L 2Z7UA 4A2GA 5ECGA 5DHMC 1VFMA 4IHOB 3SKMB 1E5BA 1RFDH 4F8LA 1ECYA 1KBKA 3C09B 1BF2A 3GM8A 3BAIA 5KVEH 1WITA 1J05A 2ORBH 1FO0L 3SPCA 3EYOB 1FNHA 3ROOA 3D3VE 1TCRA 1BWMA 1NAKH 3S2AA 5FGSA 1L9PA 1PLCA 2FO4A 3QIUB 2RBLA 1S5IL 3Q48A 4JMXA 4LPUA 4DF9A 1JXGA 4E9XA 2EDWA 1WH0A 4HC1H 4B60A 3IGUA 3WL9B 3M6DA 4YHOL 3V4PH 5K39A 1CL7I 2ICEC 3TN0A 4HS8H 4A6YA 2YWYA 1SLVA 1T20A 2AQNA 4OD1L 4PJBB 4S0HA 1XHHA 4G9DA 4ZW3A 1E7VA 2BCMA 2BS71 4GBXC 4NZTL 2EACA 3HPLA 2AQ1A 4DKFH 1UADC 4MNHA 1I1FA 2JKTM 2W0PA 4N8VG 2LFGA 4OD2A 4G8GA 3P0YH 4QRTA 4GW1B 4D3CL 2N59A 4NKMA 4F92B 3LKSA 3PWVB 4AOFA 3QGVA 4W6YB 1QRKA 2DQDH 5J06A 1Q9LB 1JP5A 3H9SD 2D31B 4HYTB 1E6OL 4S1SL 1H15A 1F97A 4X4ME 2CWRA 5IB2B 5AW5B 4L4TB 3BVUA 3O6FC 2B9BA 4M9PA 4U05A 3F5WB 3I9PA 4DP8X 1SEBA 3S4SG 2OZ4A 1WWCA 2WO2B 4KXZI 3GSOA 1QABA 3UPRA 1HNYA 2YOCA 4TM9A 4GRLC 4BA0A 1UD8A 1IGML 2IV9A 4OGXH 3FQRB 3RZCC 4N8VB 3MX0B 4B27A 3KZ8A 3ZMEA 2OMWB 1QBLL 2AW2A 1SMAA 2VLRD 5GGSY 4NP4L 2DB8A 3MGAA 1KGUA 2D73A 4UM8A 3QNXA 5GGSA 1IUZA 1G6RB 5AAWC 2EDJA 1HWGB 3LZNA 3TT1H 1CLZL 1A6VH 1JHTB 2VL4A 1G4RA 2H1XA 4HEME 4KKRA 4HULB 1B4LA 2DMBA 5DD6B 1UM6H 2QSQA 3B5GA 1QRNE 3MUJA 4U1KA 4N4YB 3RPBA 3S4SB 4UDTB 1VENA 4P46A 4HZLB 1ZTMA 2BVPB 5I2IB 2IQ9L 3TP4A 3V0FA 5F7BA 1OAYH 4EDXB 1FO0A 2O26U 3CK0H 5FHAH 5L2JB 2GUOB 3RWDA 2BP0B 4QUOA 3H9YA 4LBEA 2WNXA 2KPWA 3LYRA 5HYQA 1L0XA 3O3BA 2YD4A 5I30L 2ZOWA 2HT4C 2VLKA 3KVDD 4ZQKB 1U91B 1DBML 3MJ6A 4J7RA 2DW5A 3MV11 2SEBB 4TL4A 2YEQA 1L6XA 4KK6D 2BY1A 5DZLA 4ZFZA 3VU2A 1EJOH 1DLFH 3PHQA 3RFRA 5BUPA 3MJ8B 5I75C 3KYMA 1JPTH 3PWLB 2J57A 2Z31D 4MXQC 5EOCJ 1LMKA 2D4FA 1TG8A 2K70A 2HA1A 3ARUA 4XMVA 1HEZA 5BRZA 4WWOA 4NPYA 2BVEA 3H42H 4GKOA 4AH2B 3H2QA 3P77A 4L8SB 2DWYA 2CRMA 3I6KA 1E8XA 2JB5L 4HUXB 3EO9H 3IFOA 1B9ZA 3Q9QA 3IMTA 4F8NA 1GGYA 3GSXB 1NLBL 4W9EC 3GIZH 2B77A 4FTVE 1T7ZA 2EKSB 1EZVY 3KLSA 4M93C 4XZUB 4ZXBB 2WW8A 4N8CL 4ZG1A 4WK4B 1GC1C 2NXYB 2XNAB 3AADB 3OPUA 2DKSA 3TYGH 3UAFA 3VXPB 1SDDB 2Y0SA 1Q0EA 5D1ZA 4OVUA 1A6TA 2GFBA 3ARPA 1DDTA 1BFVL 1N59A 5DEJA 5D4QA 4A55A 1PFOA 3IMSA 3WAKA 1YSOA 2YKKA 3CC5A 5F9OL 3PWNA 2EJ1A 4NZFA 5MERB 2UY6A 1QI4A 4X8JA 4XVSL 3WIIL 2HCZX 2A9NH 4E0RA 4MJIA 2V5SA 1SN5A 1JNNL 2BWIA 2XN2A 2UWEB 2XQYG 1AZNA 4K7PL 5CSGA 3O45B 4PRID 1RIHL 3FOMB 2R4SL 3UABA 2O61A 2ZNXA 1O0VA 2EABA 2MIZA 3QJTB 4Y9BA 5FKAB 3UAJA 3K4ZA 5JIMA 1BD2B 1MCBA 3PUCA 3A4FA 3T4YB 1A6UL 2WM0A 5D1QD 1OEZW 3HI5H 2Z65C 3CFCL 3B3IA 4U6YB 1IGFL 4AEEA 1DBAL 4GAYB 1TTAA 5DHDA 4WUUD 5EO1B 3TN0D 3TL5A 1F02I 4ELMB 1NMBL 4A37A 1GJUA 3B6SB 2IOOA 3TNNA 4GQQA 4NN5B 3OBAA 4GEJA 1M1XA 1JGDB 3BUBA 1EO8L 3GI9H 1G7LB 2AGJH 4QRPD 1D5XA 5EUKB 1KTDA 1TZAA 1NM4A 2M8XA 4JKMA 4CN1A 4FADA 4Z7OE 4M1DL 4AE1A 3PV6A 4GFTB 2FATL 2IG2H 3ARWA 4KTEL 1CWVA 1X7TA 2YZ1A 4G9FE 4R5XA 2VLJA 1T03H 2QQLL 1OSPH 2VDKL 4AGMA 3U4AA 1LO3L 2HT2D 2OMTB 2DM4A 3OKOB 4S0TD 3B9KA 2Y4SA 2ZG2A 2WLZA 2B0SL 2F61A 4LP8A 1A9EB 4ZAKC 5T1MB 4BFRA 4JL1A 1JGVH 4JFUA 4Q0XL 3IJEA 4Y16C 3VCLB 3ZPDA 3L5JA 2EC8A 5FOJA 3MYJB 3PQYA 5EBWA 3CZNA 1K2DA 1PCSA 1KBGL 4K07A 1FN4A 2J55A 1Q0YL 2NY7L 5FHBH 2D7MA 5JPMC 1WBYB 1CGVA 3NSXA 1AGDA 3BH9A 3D33A 1K5NB 2LU3A 1NCBL 4NS0A 3SD5A 3EYVA 5TFSL 3KDPB 4I7ZC 3AGWA 4PJ9B 3SDDD 5I9QC 3VW3H 4BH8B 3B37A 4DPRA 2FGZA 3LH2L 4ZOBA 1NMCB 5K33A 1D6VL 4K7PY 4P46D 1QBMH 5D4JA 3FU8A 5C08B 3BX7C 1KWKA 2GTWA 2R7EB 4JCLA 4M6NH 4MAYB 5AL8A 4YDKH 1IMHC 1L9NA 4NEHB 2J6EA 2RFXB 1OGAE 2H26A 3VFNB 1S7SB 5AYUH 5FDWA 2ZONA 5F7NC 4FQ2L 5J0BA 4WI6A 1O7DE 1AANA 4R4FL 5TE7L 4KGLA 3V5KB 4ISVB 1SUJA 3CLFH 4RQQA 4LFHG 3KPPB 3FQ1A 3WJLA 4Y19B 1W0VB 5B3NA 2WXGA 2Y06H 4XPHH 2VLKD 3I9IA 5CLTA 3E9TA 3RGVC 3ARSA 1A0QH 4PJFF 3K91A 4ZTEA 3TLRA 1J0JA 3KPOA 4NJ9H 5TJWK 3VH8G 1YPZF 3ZRCC 3BD4A 3C08L 4Z1PA 1U8CA 4RGNE 1GIGL 4Q4EA 1I3RA 5IHBA 1N8ZB 1TJXA 4FQ1H 2BP3A 3CUPB 1NEUA 4K3EH 3VXRE 5IQLA 4I89A 1KBWA 2BLFA 3HMXL 5FA4B 2AV7B 1G1YA 3QDJB 4G1EB 5KVFE 3TA3B 1G7MB 5I1IL 3GUTA 4Z7AA 4PS7A 3IDMA 2FL5B 5G5DB 4AM0A 2WV3A 5CSZB 1CZ8L 3ZVVA 4WRLA 3ZXAC 4CRPA 1U3HA 1KGYE 3PABA 1OE1A 2CBPA 1RZKL 1MXGA 2XHNA 3MLUH 2K1MA 2X1QA 3B2VL 1KCRH 1TU2B 2UY7A 2OJEA 1ZXKA 4Z7WA 1BF8A 1RUPH 2DTSA 4E41B 4Y0GA 5D1ZD 1R3KB 1YJDC 3VGAC 4W9IC 1JCKA 4OGAC 1AYRA 3KCPA 5CZVL 1U93A 4MD4B 2DBJA 2H32A 2KERA 3DRQB 3LZLA 1FRGL 4PLKD 4F5CE 1R4XA 4DP5X 1Z9LA 5ANMB 4N25A 3QQXA 4TSAL 2WO4A 5T3ZL 1IAIL 4POZC 7PAZA 2MKWA 3FU9A 3T4AB 2IH9A 1CUOA 4HU2A 4WLCA 4PJEA 1P2CB 3HN3A 4JO8A 4Z76B 2CO7A 5IZ7A 4IKJA 3MYZA 2V2WA 2BXZA 3CWGA 1P84J 1JMZA 3CDCA 3KXFE 1J12A 2C1OA 3BHBA 1GGCH 1DZ0A 2VC2B 1CLOL 4ZUVB 4AUUA 2DQMA 2F8IA 3IFPB 4HGKC 4R9HA 3DKHA 4NUMA 4UQEA 4JRYE 4X98A 3PXHA 1MREL 4ONGL 5E99H 1WGOA 3EFFA 4JG1L 4XHJD 2PR4H 3M86A 3MV7A 3VAEA 2YFOA 5DC2A 1I8IB 4G6FB 3VFRB 4FP8H 2VLJD 3BQUB 2BY2A 2PXYD 1UVQA 1A1MB 1HKLL 4KVPA 2XIIA 3QH3B 4Y5XC 3OSKA 3T0EE 2MOQA 3BE1H 3M1BB 1CGYA 3PCYA 1V7NL 4FCAA 2FX8H 1N2RB 1DANT 5GS1C 3JYCA 4MS6A 1IC7L 3O8XD 4MNQD 4I9WE 5IJKC 1F0LA 2WQRA 2WQSA 1H3WM 3PAUA 3LKOB 1TPXB 5E8DH 3RWJB 4EI0A 1MW1A 3FSOA 2H6PA 4PJHA 1RULL 2AXJA 2ZIDA 4DPCX 1HL8A 4U7SA 2L3BA 1AVAA 3TGXA 3QO0B 1TVHA 2ZF8A 3RVTD 4JG0L 1TOXA 3FO2B 1RP9A 2NR6D 2CZNA 5DMYA 3RVXC 1EXUA 4J8QA 3FB7B 1QKZH 2BJMH 4QWWC 5GGUA 3TA4D 4N1HB 2OSYA 1U8KA 5A2JH 2CHDA 5I5IA 4IRSD 4IDJH 2QLYA 3VM7A 2KI6A 1BQUA 5E1QA 5H4YA 1IVLA 1KJ2B 3SE3C 3FQXB 4ZUTB 1WFNA 1ES0B 4HXAL 4TNWF 3SODB 5HGBB 3MGOA 4HETA 1LO2H 5GSVB 5FOBB 3VWKC 4OZIE 1RV6X 4Y5YC 4NOFA 4ANVA 3FRUA 3QSKB 4RFNB 3RQ3A 2PP8A 1N6VA 4AT6B 1M6OA 3OX8B 1AQDA 4JBSA 5DUBB 1LO0L 3O3DA 4G6KH 1LP9E 5KVGH 4ZTPH 2AK4E 4LNRB 5DUML 1M71B 5ICXB 2Q7YB 1RURL 4CVZA 4CILA 2F1BA 4UILH 3LZFL 2F5BH 1U8HA 1AP2B 3L5XL 1E4XL