1MCHA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
b'PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 38
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA02
4PD4K 2YEZA 3EO1A 4F15B 1DFBL 1RUPH 4P57A 3H7BB 2BY3A 1L7IL 4R6UA 2AABL 2D7MA 3M8OL 3FTGA 2DQTH 2BDNL 1OW0A 2JE8A 3HE6A 5LVEA 2R1WA 3BDXA 5EBGA 5D1XA 3O9WB 3QIUB 3LHPH 4XXDB 2V6HA 1KIQB 4KKLD 1RZGA 4WTZG 4ZTPH 4YHIB 4QHUB 3AVEA 2X4QA 4NUJA 1KXQE 4M7JL 3NPZB 2L4OA 3MRBA 4PGZA 4U1GB 4IOIA 5FF6B 3OL2A 2BNUB 4GG6E 2GK2A 3ZSSA 4X6DF 5C92A 4G9DB 4YLQT 1HQRB 3PWUB 1S7WA 4X80L 2A6JA 4NUGL 1AO7A 1UCBL 1DP0A 4EBQH 5JW4R 25C8L 2OM5A 3RL2A 3OB0H 4AT6A 1YEFH 3BAEH 2BSTA 3PJSB 1IGTA 3LSOB 5I17A 5DK2A 2Z35A 4NGHL 2HG5B 2UVFA 2ZUQC 3BKYH 4TOYH 2D03L 3V6ZB 1JGEA 5CJQH 1AE6L 4HUMB 4OZHE 4PB0L 2AQ1A 3ILQD 1NDGB 4MDJB 4Y19E 1XH3B 1LE5B 5LCVH 2X4SB 3C60C 3HUJF 2R0LL 3SQOL 4Q9RL 4GKSB 1PGRB 1MHHB 4FXKA 4I5BA 4QHNA 5CBAB 2CKBL 4LQFL 1JPSH 5D7IE 2HWZH 1JGUL 5C6TH 2E9JA 1SM3L 4LSSL 2K9UA 4RIRA 1G6RB 1HOCA 5DUBA 1F2QA 1AFVH 3LN5A 1SYVA 1YJDL 2DYPB 2P47B 3CSGA 1IMHC 3LDBB 5D7IB 2EZ0C 3O6FB 4ZFOA 2IMNA 2GEEA 3GMLA 5CZXD 3QDJE 1MCJA 4XC1L 5IM7A 1NBZA 1EGJA 1F4WL 1DN0A 4B50A 4PLOB 4I8DA 3VXUE 4WJ5B 3V0WH 4RMUA 1CLZH 1TETH 4GRWB 1IEAB 3CVHB 2PW1B 3DX8A 5D7JD 3QDJB 4JKPL 1BF2A 1KCRL 4ZNCD 1KB5L 4XWOC 5IWLC 2VTFA 4XB7A 4P4KB 1X5FA 1YQVL 2NCMA 3OPZL 4AIOA 4NC1C 5AYQA 3VXUB 5AAMA 2Q6WB 5BJTB 1I85A 4K3DH 1U41A 1MHPH 1FZOA 1QBAA 2Q86A 2XZCL 4M4RA 3RGVB 4HKBA 3CMGA 4PRDA 4NKOA 4JHWL 5C0IA 5IB2B 5E2WH 4ELKB 1JVKA 1F8TL 5SWSA 3LPFA 1OP3H 4PJIB 5I75B 4LSRH 4AK1A 1A6UH 3VH8G 5IJKA 3BD5A 3WFCL 2DKSA 1KXTB 3MRRB 4X6BB 1FHGA 4HBQA 4X6FB 4N8VB 4TPRL 1RV6X 9CGTA 5CZKA 1BJ8A 3NCJL 5MHSE 3VRJB 5FV2A 2R2EB 4P2CG 5I73C 1UWXH 1FBIH 5KVGL 3MMEB 1TJGL 1OAYL 1CD9B 3WXWL 1EK3A 2V5YA 1A4KB 3TO2A 3MRGA 4BQ9A 5FO8A 3FONA 4R7NB 3C8KB 3GMNA 2AJYL 4PJ5D 2J8UE 1V8HA 3MREA 3NA4A 4BKLA 3MV9A 2RR3A 3MRNB 4H0GA 3UPCA 1JNLL 3ZHKA 4P9HC 3THML 3QNZA 3I6LE 4ZFGL 2H2PC 1A0QL 4G9FB 3TZVB 3VWJC 1UZ8B 4U3HA 5F89A 5DI8B 3RNKB 3Q48A 3HC4L 5ADPH 3KLAB 4JVUA 2KUTA 5L9DH 1CVSC 1R5WA 3T3PE 4G6MH 3GSNA 1QQDB 3SKNB 4HWNA 5HD8C 1ZLSH 4WI2A 1S7XA 3FHQA 4JCMA 4JFQB 3L5IA 1HSAB 3BEVA 3AAZB 1T7XA 1ZVHA 2MQ3A 5E2UH 2EH7H 1S5HA 5KOVC 4NKIL 5I9QC 1MCPH 1KJVB 4NM4L 2VR9A 2X09A 5BXFB 3JZ7A 1SJEB 3MGOB 1IC1A 1A2YB 4UI2A 1FE8H 2ZWLT 3NFNA 1BVKA 5EIIA 4ZMAT 5E0QA 3JTTB 2CJUH 4XCFH 3VXSB 1UM6H 1SBBA 4MCZA 5HHPB 2BNRA 5I1CH 5JNYB 1CQYA 5IHZB 4QRTA 4HEME 4K23H 5F3BB 2IADA 5FB8B 2PYFA 1J05A 3QIBA 3QQ4B 4P2RA 4R4NC 2OTPA 4ZO7A 2GTWB 5I6XC 2Q1EA 5EO9B 1EZVY 1DBAH 4NYLA 1ES0A 3BDYL 4RFEB 4LVOB 1QR4A 1RK1A 3SKJH 2B1AL 3BGMB 4Z0XA 5BW7A 3UPRB 1OOAA 2BP3A 4N8VG 2PCPA 3AREC 4LU5L 4WEBL 5E2TH 5JIPA 1UXWB 5K9KB 2HRLA 4N90D 5GHWH 5FHBL 4LLVA 4Z6AT 3TVMC 2FHBA 1XGRB 1NUGA 3EO0B 4OM0L 1DEDA 4QO1A 3ZE0F 3VE0B 4P3DA 5AWNL 4M1CC 2A73A 5C0AD 2IF7A 2JCCE 5E8PB 3UAJC 2FRGP 4ZFZA 1IAII 4BZYA 3RDTC 5J89A 1NCBL 3KWWB 4J3OC 4G43B 1CZ8L 4APQB 4H1LA 3W0WE 1GOFA 2X41A 1A5FH 3BW9A 4KJWC 4RGNB 1NUDA 1CT8A 3ZYIA 2JCCB 4IOSD 1AXTH 4XWGH 4ODUB 3PGCB 5D7LD 4DKEH 3KPPA 3V5DA 1WBXB 5DRNA 5HYSA 1T20B 2EDKA 2NW2B 1K8DA 5DQ9A 1I1AD 1RUAL 1E4WL 2QLVB 3QUML 4GXUM 4NWUH 2WWKO 3SGKC 3UTZA 4P46D 4DTGL 3O2DH 4M7LH 4IMKC 2XI9A 1J5OH 1T2QH 3QI9D 1IE5A 5B3JE 4ZNEA 2H9GB 4FQHA 4G5ZH 4KKLC 3REWA 4L8SB 3LQZA 1YZZA 4OTXL 5DVMA 2OL3L 4XPAL 1VDGA 2XYCA 4JREC 4WCYL 3SOBH 3B43A 3ZTNL 1D5XA 5TDPB 5F7FA 2I9TA 5I1DA 1UH3A 2BMKB 3G5VB 4B0MM 2D7TH 4OBSA 4BSVB 2VLRE 2ARJA 2FBJL 3OJDA 3R0NA 5K9OB 1HINH 3HPLA 3VFRB 1RZFH 4X8JA 5D7SH 1QNZL 3HI6L 1ZLVH 4R96B 1Q94A 4YO0A 2HA1A 1WAAF 3HS0B 1EJOL 4CBPA 5CEYB 5FYLD 2FX9H 2GITA 2VLRB 2NY6B 2YK1H 2CDEB 5T1LA 1XIWD 3QEQD 3PWNA 1ADQH 5FCUL 4LBEB 1I8MB 2JB5H 4PRAA 4WHYG 2MPAH 3WUWA 3ILQC 4Q6IC 1IGMH 4DAGL 4F7MB 5FYLH 4KWUA 3KYOA 1FQ9C 1UH2A 4JE4B 1NFDA 3GKWL 3C5ZB 4KK5C 1PX3A 3OX8A 4R8WH 1JPTL 1RFDH 4PPTA 3UTSD 4EI5C 4KU1A 4OD1L 4M1GL 1JZ7A 2APVA 2RIKA 3PXHA 3NACH 4FQJH 1KPVB 3FFCA 3G6DL 4MA3B 4BZ1L 3G6JF 1UKTA 2FATL 5GGSA 3MNWB 4LF3A 1RZ8A 3O4LD 2UZYB 1EO8L 2CLZB 4H5SA 2XACC 5LQBL 4TNWF 3KXFD 5FOBB 3GNML 2Z31C 3QPQD 3ARDC 2Q20A 4I2XB 3GMOA 3G04A 3BP7A 5SWQB 3BD3A 4XVTH 2DBLH 5C7XL 3OKKB 1MCIA 4JR9H 5D2LA 5DMIH 1JZ3A 3AGVA 4ZUTA 2C4FT 4ETYA 5K59F 4PY8J 2UWEB 4GW5A 5FYJE 3EW3B 1ZLUK 4JO4L 1I3RB 1NGPH 3U1SL 5IOPA 3MLXH 3GM0A 5FYKD 4K3EH 4Y16C 4PRPD 4ODVL 1FGVH 4JZOA 5EDXA 5J9PA 5IEKB 1KTLA 3VGFA 4GW4B 3K3QA 1JTPA 4JEGB 4LNRA 4ZTOL 5EU6A 5D4QA 4WIQA 4I0PD 3CLFL 2WUBH 3U7YL 2K7QA 3TBVB 1YEEL 3CX2A 3U46B 4JFZH 3GI9L 1J0YA 3GHBL 1T83A 4JKKA 4UV7H 1C16B 5IB4B 3LKPB 5I1GL 1DQDH 5IFHL 5CINL 5JDSA 5A3ID 5KZCD 3MUGB 5HI4C 4NBZB 2RFXA 5F72S 3PQYA 1YMHA 1H15A 4LCUA 1DANT 2KDGA 3GSVA 2ADIA 4X7TA 1C5CH 1FFPB 4MWFB 1B90A 1VESA 2EEDA 2FX7H 5IK3A 5F7EL 4LCIH 3AS1A 4NZRH 4BH7B 1FSKB 4FFWC 4J1UB 4EUPH 3C8HA 5EWIL 3IU3B 5EC2A 3TT3L 1D9KD 1JGDA 3SCMA 5DD1H 4XAKD 3U0PB 2C1PA 3RZCC 5FO9B 4GQ9L 4F7CB 2FR4B 4U0RB 1FC2D 3HE7A 3BPLC 1O5DT 2BVYA 1D6VL 1UM5L 1T1WA 3KYKH 4XAWH 1JZ2A 1EJ6A 3RHWF 2X9WA 4J6RH 4M7LT 5J3HD 5HYJA 4NZTH 5IHLB 4XX1E 1MFAH 2JJTC 5H35B 3S35L 5CHNB 3ZKXB 3B9KD 5EN2B 3NTCL 3WEXB 1ZGLA 1X5IA 3BP4A 4MA1B 4NPYA 3P77B 5BVPL 3MNVA 5D5MB 3SGJA 4D0DB 4F3FA 5HYQB 3MLZH 3Q6FA 4YXKL 4U05A 1FCGA 4XHJD 1JYVA 1Y18A 3ARPA 4ENEC 1W2KT 3ARFC 3JWDH 1UA6L 5IVZA 4WFHE 3RWIA 2CK0L 1I9IH 1JGVH 3WBDA 4HEPG 4M5YL 1KNOB 3RVVD 4POYA 1JNNL 1AGBB 2FJGA 1U8IA 5JDJA 4Z5RB 3WHXB 1RJZB 3C09C 4HWUA 4NQVA 2KH2B 5DJ8B 2ZOKA 4JQVC 5A2LH 4LCCA 4YDJA 2G2RA 3BEWA 1Q38A 4PJ9B 1XF4B 4Y4KB 4JO1L 1N3NA 3GSXA 4FP8H 1A8JH 1IM9A 4DZBB 1JK8B 3MV7D 4OBRA 4PJBA 3V0AC 5GRUH 1GGIL 3D25B 2Q7YB 3K4DA 5K9QG 3T0XA 2P5EB 1KSRA 3I6GA 3ZE1E 2H45A 4GS7C 5LG1A 3FQTA 4LLAA 2GK0A 4PS4L 5EULV 5DHXB 4QYOA 4M48H 1I7RA 5EBWB 4MNQD 4TN9A 1NLBL 2R1XA 2YEZB 1S9XA 4P57B 5ITBH 5I74B 1DBJL 5T33H 4OCSL 4Z7UF 5DURD 4LMQE 1VKXB 1AI1H 3C87A 4XH2B 1CDBA 1E6JL 1KEGH 1I9RH 2FJFB 1LDPL 2JJWA 3FTGB 3IDXH 1NUNB 3I84A 3T0DA 5D1XB 1YY8B 1TQCC 1J0IA 1U91A 1NQBA 3NA9L 1RZGB 1U3YA 4QRPA 5AD0A 2X4QB 4NUJB 1R3HA 4JY4A 1GZQB 3TBSB 5I1AA 4OM1H 4HWZA 4ZDHB 4XB8A 1DSFL 2QHRL 4GW1A 4JFYA 4DW2H 3UBXA 1KN2H 4RISH 5KVEL 2XN9E 4HBCL 1PVHA 1S7WB 3BO8A 2A6JB 1FJ1A 3DETD 4MA8H 5I1KH 3VRIA 4U49A 4E41A 2ZSWA 3LKOA 1K8IA 3BHBA 2YRPA 1I8LA 4AT6B 3G9VA 3DMMD 2W9DL 4J3WA 2BSTB 1GRWA 3PP4H 4Q9QL 1IGTB 5I17B 3I02A 5DK2B 2Z35B 3D0VA 5C07A 4YR6A 4S2SA 2BOBA 1LP9F 15C8L 4YFEA 3GDBA 5J6GB 4K3HA 4LEOA 4XVSH 5F9OH 3VDBA 1A7OH 2NXYC 4G80A 5CJOH 3D0LA 4K71C 4L3ED 3ILPA 1JWSB 5JQ6L 5E9DE 1VFOA 4EDWH 2NXZD 4LKXA 3H9HA 2NY2B 3ALWA 3VFPB 4LL9A 3O8XC 3RTQC 4FTVA 4NIKB 1S9KC 1G9MH 1Y6MR 4QWWD 4S1SH 5L2KD 4M8QA 3NFPA 4RIRB 1HOCB 4OGYH 1TZHA 2R9HC 4IIQA 1HK6A 1SYVB 2L7JA 3FZUD 3S6CA 1Y6KR 4HFWB 3BRDA 3R1GH 2VQUA 3ARGD 3GMLB 2H6PA 5T5NF 1L6ZA 1KACB 5IM7B 5EZIH 1YN6B 4MD0A 4OQTA 1DN0B 3MRJA 3FOLB 1AQKH 3VD5A 2X7LA 1W0VA 4FNLL 3U4BL 2AXJA 4B7IA 2B8OT 1MREH 3OAUL 4OIAA 3DX8B 1CU4L 1MNUL 2DLGA 1EH9A 1KIRA 2HTLD 5FGCB 5TFSL 4GH7B 1BD2E 1NAKL 2KQMA 1CF8H 4K9EC 1FZOB 3O41B 4TSCL 4MQXC 4XCCH 4HKBB 4WW2A 3AS0A 1MPAL 3U4EA 4PRDB 4NKOB 5C0IB 2DQDL 3N06B 4K94C 4QRSA 1X5HA 5SWSB 4CMMA 3R0MA 1MI5A 3KPLB 3SJVD 5HVHC 3LS5L 3I85A 1YY9D 35C8L 1DBKH 5C0NC 2ZUWA 3DUUB 2A6DA 2HT3C 3MGTA 3MRDA 2QKIA 2AGJL 1P53A 1NBQA 1N7MH 5DJAB 4XPTH 4PJEF 2FEDD 3VGAB 1OF2A 2ICCA 3OHXA 3DGGB 4U6VH 2MNUA 3LKSA 5F7NC 1IKFL 1AQDA 5HY9A 4PJAA 4HC1A 4GXVH 3VW3H 3GHEH 2A6IA 3DWTA 1EZVX 3DRQB 5C6WH 4WUKL 2O5YL 4L4VE 3TO2B 4PFEA 5AZ2L 1QSED 1CGXA 5MEOA 5IBLC 5FO8B 3FONB 1RHFA 2EEBA 3MREB 1Q9WA 4MX7A 4LSTH 2VSCA 3MV9B 3QIWB 4QRRE 5IB3A 3HCVA 3QNZB 4L4VB 3QBTB 3T3MF 2PW2A 3ESUF 2K1MA 3RKDC 3MXVH 3O6LH 5F89B 3MJ9L 1M1SA 3HLAB 6FABH 3KLHC 3RZWA 4EN3C 4MA7L 1II4E 2VIRA 4QRRB 4JLRA 4ZS6D 3GSNB 1FFOA 2R0ZH 4KQ4L 1WZ1H 1I7UA 1QG3A 2X6MA 4OZ4A 4FQ1H 1JI1A 1YQ2A 4L9DA 1UXSA 5ICXA 1UZ6F 3R8QA 4R2GC 1EPFA 3MRCB 1IAIL 1XF1A 2JIXB 3OXSA 3ZL4H 4HXBL 3NPSC 5DMGD 2A1WH 2ADFL 3MYZA 5JW3L 1MCQA 2VUOA 3SGDH 3NFNB 4LSPL 3QEHA 3MYJB 3NVQA 4YHNB 1PLGL 1EVUA 2BSRB 4MCZB 3E6HB 2BNRB 2MHAA 4JFFE 3QXUA 4AG4H 1H3PH 4XNQA 2EE9A 1WWWX 2IADB 3KPQA 1T66D 1FGNL 3S3SA 4P2RB 1FIGH 2K7PA 2VE6A 3SPVA 4HIIA 1HNGA 2YS4A 4NYLB 2IBZY 1ES0B 3LAFA 1OAZH 2ORBH 3BP6B 4IRZH 4F7PB 3WXVL 1RK1B 5DRWA 2DRUA 2YD8A 3ULVF 2FYYA 2PCPB 3QJFA 3FFDA 4F58L 4OZIA 3MCKB 4H0HB 3V6FA 1T1XA 4ODTL 4PJHF 4RMTA 5DR5L 3KGRA 2C1OA 5GRYA 4MXWL 3UTTA 3QA3A 1RUMH 1J1PL 3ROLA 3PP3H 4P3DB 1EHNA 2DYPD 4YDVB 4JN1H 1SVZA 1HI6A 1SYSA 1A4JB 3O3DA 3X3FH 3QUXD 5DUMH 1BOGA 4E0RB 1KULA 3RWHA 4DOHB 1RUPL 4PG9A 3AUVA 4OZGA 3BW9B 1G6RH 2APBA 1DVFA 3TBTA 3QDAA 3VI3E 2BHYA 43CAA 1WUNT 1UEMA 4W81A 2Z91A 4EXKA 1TVBB 2DQTL 3V5DB 5DRNB 3S3PA 3RWDA 3LHPL 4Y5VA 4ZTPL 1K8DB 5DQ9B 1LMKA 2CLRA 4PGDA 1EHAA 1FNLA 4Y5YA 4FQHB 2R0WH 4GRWH 2F54E 3LQZB 2FGZA 4XBEH 2W0PA 4PJFA 3CZFA 3T2OA 4X5WA 4KHTL 1D5XB 2I9TB 4JCLA 3V7AE 5I1DB 4ELMF 3QCTH 4EBQL 1N8ZA 5EU7C 2ARJB 5IVNA 3GJFK 1YEFL 2ITCA 1ULVA 5F7DA 2GSGB 3QXTA 5FM8A 5KS9F 1Q94B 5BOPA 3BKYL 4TOYL 5DJ0A 1FLRH 1EHLH 2QEJA 1G1CA 1CGTA 1XMWA 5CJQL 4G8GD 4PRIA 5E6IB 5H37G 2GITB 4F7TB 2CQVA 5IUSA 5T1LB 2P5WA 5GJSH 3PWNB 1MCHA 3RY6A 4PRAB 5ALCH 3WUWB 2KL6A 3WFBH 3IF1A 3OKEA 1NFDB 4Z0BH 1DEEA 1JPSL 2HWZL 2YBRA 3OX8B 5C6TL 1KUMA 2PTVA 3B2VH 3F7QA 4JM2C 3HC0A 3T0BA 4G9FD 3TGXA 3X12B 1C7SA 3BIBX 5FGBC 1AFVL 4I13B 1WITA 4NNYA 2EDBA 4YDIH 5ESAA 4PLJC 3QUYC 4JDZA 1AD9B 3EYSH 3FFCB 3PE9A 5IIEA 3OKNB 5HYIA 4PJ8D 3LN4A 4F9PA 3U6RA 2WW8A 2BVOA 1FFQA 4H5SB 4O4YH 1X5GA 1Z0NA 2GY5A 4XHQA 4PJ7A 3KVQA 3V0WL 3EYOA 4DGYH 1CLZL 2Q3ZA 1TETL 3PWPD 3GMOB 3G04B 5DRZB 4QGYA 5HYSG 4KKBD 4OIIH 3HPJA 1RY7B 5D2LB 4K3DL 3VXSD 3HZKA 1MHPL 2ZUYA 1FV1A 4HS8H 4GG8A 5E8EB 4DEPC 2GTZB 4X9BA 1CXLA 5IW6B 5EUOA 1C12B 2WBJD 4D8PB 5E2WL 5KW9H 4JZOB 1RK0B 2ADJA 1KTLB 3TPUA 1QBMH 4X7FC 4N8CH 3CNKA 4LNRB 2EKSB 1A6UL 5B39B 3W5MA 4I4WA 3LV3B 4TNWK 3AS3A 5I1LB 1NC2A 1FBIL 5JDSB 3VXMA 2UVEA 3WIIH 2R8SH 5E94B 1LNUA 3EDEA 3ULVC 2YUZA 5KG9A 3PQYB 1PAMA 4LCWA 2QR0A 1YMHB 4WHYH 3DURA 5DDHA 1YC7A 3WUWG 5EZJA 2GYSA 5IK3B 3EYVB 2F19H 3QH3A 3C60A 4HCRA 4RGND 3LD8B 2CKBB 1YPZE 2GIYA 5ADPL 1RULH 1ZT4B 3WO3B 1IC4L 1BZ9B 1U58B 3WO4C 1JGDB 1R5VB 5L9DL 4G6ML 1YN7A 2XV6B 3HFMH 4MLIA 1F4XH 1U0QA 1ZLSL 4XRCB 1MJ7H 1KCLA 2EXWD 2DWEB 3HE7B 1YPZB 5I0ZA 5KSAB 1T1WB 1X4YA 3CH8A 3F7VA 4TQEH 1JHTA 4R97B 2PXYB 2B7DT 5E2UL 2EH7L 1T4KB 3DYPA 5E5RB 4C56A 5BZDA 5HYJB 2ARJQ 1I1CA 3SDDC 1MCPL 1DN2A 5L7XH 1ZGLB 1FE8L 3BP4B 3CIQA 3HG1E 3IETA 2VWEE 3MNVB 2RJMA 3Q6FB 3QZWA 5J13C 3VGHA 2CJUL 4XCFL 4M7ZC 2D7NA 1UM6L 5CJBA 3D6GA 5IWLA 3WN5C 3RWIB 2ESVD 5I1CL 3V6OC 3HG1B 2H2SD 4MVBD 4K23L 3TBWA 1KV3A 5HPMA 3WCYA 1U8IB 1MCRA 5T3ZD 5TE7H 4NQVB 4LLUA 4U33A 3NAAH 4NCDA 4D9QD 1CG9A 2FZ3A 2NY6D 3RKPA 1DBAL 4K3JH 2G2RB 5B39G 3DVIA 3PV7A 1QFUH 2QADB 3SKJL 5DJZA 1N3NB 3GSXB 4JRXE 2BRRH 5E2TL 2APWA 3RHWK 4AEHH 5ITFA 3EJYC 5DQDH 1OAUH 5T3ZH 4G6FD 1OP5K 5I1IH 5GHWL 3C5ZD 2B2XH 3HB3D 4FQIH 5BRZA 4YGAB 3FQTB 4OUUA 4XNMA 3OR7A 4XCYB 4J2XA 4QYOB 1I7RB 3MSPA 2YD9A 4YHLH 2VDMH 4FFZH 3K4AA 2BK8A 4HD9A 1S9XB 3L95A 4OI9A 5C9KA 5LWYH 2NX5E 5C0BD 1A5FL 3VFWA 4KK6D 5HHQA 1AXTL 4XWGL 4N0CC 4RFNB 4N9GB 3O0RH 1S78D 4DKEL 4MJIA 1DLFH 1NAMA 4ZUVA 1U91B 4OCLC 3VWJA 3K8LA 2F8OA 2NX5B 3BD4A 3GGWB 4NWUL 4QHMA 1WWAX 5A1AA 4JY4B 3O2DL 4M7LL 5FGSA 1J5OL 5CSZA 5I1AB 1T2QL 4HWZB 2K3TA 3STLB 1LO3H 4KMTH 4G5ZL 1HH9A 2EE2A 4GW1B 4JFYB 1T0MA 2R2HA 4LHUA 5FEBA 4IJ3B 3GBNH 3VXQA 3ARVA 3NFSH 3BO8B 3Q3GA 1FJ1B 1FN4B 2WIIA 5E1AA 4HUXA 3REVA 1V5JA 3SOBL 1HKLL 3N50A 3VRIB 3U48A 5GS0C 3LKOB 3BHBB 4M43H 1XGUB 2D7TL 1QRNA 2J7LA 4LLDB 4BA8A 3U36A 2JK5B 1KYOK 2A38A 4MXQD 1HINL 4PTUB 4TULH 1RZFL 2XKNA 1QSFE 3BDBA 1AGEA 5D7SL 5C07B 4YR6B 4NO0B 4YDLC 2BOBB 4POZC 2XA8H 3ZDXF 5KSBE 1MFBH 4UTBH 1JYNA 3C6LD 1EX0A 4BQ8A 2FX9L 3JV5A 3D0LB 4Z78A 1T5WA 2YK1L 1Q0XH 1AR1C 4XC3H 3ILPB 4MJ5A 4NFCA 1J11A 3MUHL 1AXIB 3P4MA 1ADQL 3BZ4B 3H9HB 5IFJA 2JB5L 1OTUD 2C4FU 1FORH 3TFKC 1IGML 4FTVB 1WTLA 5FYLL 4WNQA 5K33A 4I18C 3AREA 5LGHH 1QACA 4R8WL 4M8QB 3F7PC 3NFPB 4BQCA 1SMAA 1XF5A 1RFDL 3N1MC 1JE6A 4H26B 1YUHB 5ISZD 3TVMA 4FQJL 3NACL 3HUJA 3TBYA 3DO7A 1X6NA 4PGEA 4O00A 4HT1H 2H6PB 2FWOA 3VXOA 3TN0D 1TZGH 5DD3H 1H3XA 1IARB 4M8VA 4BH8A 3RDTA 4X99A 4PJ8C 2J2ZA 2N1KA 1AKJA 3OKMA 1KIRB 3KNBA 2Z93A 3L1OH 4XVTL 2VAAA 1BBJA 3AROA 2DBLL 4RGMB 4JR9L 4RQQA 2AJXH 7CGTA 1DANU 1CXHA 5DMIL 3BPOC 4G6AD 3TO4B 3S34H 2EDWA 2IQ9H 4KKBC 2WNGA 2X89D 4WW2B 3DXAD 3SGKA 3U4EB 1NGPL 4P99A 4UTAH 3MLXL 4IMKA 4K3EL 4KJQD 5TE6H 1T0PB 4CMMB 4DZ8A 1FGVL 2YKLH 1JV5A 3IJHA 3GB7A 2F53E 3EOAA 4FXGA 4XGZA 5DJYA 3RVXC 2I26N 3MGTB 3MRDB 1UC6A 4JPIB 2WUBL 4WI3A 3D3VE 5DFVC 2FB4H 3PWJB 4Y4KD 4JFZL 3LRHA 1OF2B 2OR7A 4AQ1B 4NC2B 3LKSB 3IS1X 5KAQG 1N2RA 3G5XB 4UV7L 5T1DH 4PJAB 4NN5B 1DQDL 1N0LA 1EUTA 2A6IB 4ZAKB 2IBZX 1P4LB 2P5ED 4LLYA 4UOJA 4HKXA 1KCUH 4OCYH 1J1OH 3PL6C 4LSVH 3X14A 4WWKB 1Q9WB 1P6FA 1C5CL 4KRPD 3L3GA 1V7NH 1D5ZB 4HUNB 3MJ8B 4MQSB 5IB3B 1EMTH 1C5DB 5F7YC 4ORGA 5J57B 2FX7L 5IJVA 4U1NB 3ES6B 4JKWA 3TWCH 4LCIL 3OJVC 4NZRL 4OF8A 3WDHA 3ZT7A 3D39A 1HEZA 4PBXA 1ZSDB 5HVFB 4Q6IA 5KOMC 1KG0B 1TPXC 4LVHC 4NJ9H 1CDJA 2VIRB 4JLRB 3HE6D 5DD1L 1FFOB 2D31B 5D1XD 1I7UB 5HI3C 4OZ4B 5GGSY 5EUKA 4EI5A 5BS0E 3FO0H 2A77H 5I76A 4PGCB 3KYKL 3TH4T 4XAWL 3VXPA 3L7EB 3QDMB 3OXSB 3EZ8A 4J6RL 4NZTL 3L6FB 5C09A 5BS0B 2VOTA 3CD4A 3V4VH 4W4OC 3UTPD 3VCLA 2Z31A 4MB3A 3QEHB 4MB5A 3ARDA 1AO7D 1RZIA 1YC8A 2R1YB 3MLZL 3ZE2F 4EDXA 4OT1H 5HTSA 3QO0B 1OWRM 5C71A 3JWDL 4PJGE 5DJCA 1KJ2A 1I9IL 1JGVL 5CEXA 5F1IA 4XNQB 3KLSA 4M3KB 3KPQB 1IBGH 1A6TA 1E4XH 4WO4C 2BHUA 4QGTA 43C9A 4HIIB 5C08E 5ESQA 4Y16A 4PJGB 4E5XB 4AIZA 5DJXA 2H2SC 3FO2A 5DRWB 2MKLC 4BFGA 2EIZA 1RVFH 3LN9A 3SDCB 4CW1B 4FP8L 3FFDB 3TCXA 1OLLA 2XWBB 5EU3A 1U2CA 1DQMH 1FZMA 2NY2D 4OZIB 3V6FB 1NBVH 3FHAA 4PGJA 2ZJSH 1QO3A 3RFZC 5GRUL 2X40A 5CJ8A 1CICC 1F3RB 3UTTB 5DMYA 1D3CA 1OD7A 3ROLB 3T4AA 4LPUA 1BMGA 1HHHB 4K7FA 3CU7A 1FYTA 3NIGE 2VNCA 4M48L 1HI6B 2NZIA 4MJ6A 1SYSB 5GGRB 3B9DA 1IL1A 3UYPA 4NOFA 1I8KA 2B1HH 4PG9B 5ITBL 3VXTA 5T33L 1DVFB 1TENA 1AI1L 2R0KH 43CAB 2Z91B 1L4IA 4P48A 1LK2A 1KEGL 1I9RL 3IDXL 4X6CB 2GCYA 3O2VH 5FYKU 5CAYB 1DQJB 1NANH 3MLVH 3TA3C 4FQXB 4WU7B 4Y5VB 2Y6SD 4KJYA 4KK6C 1EGJH 4S10A 1RZKC 4PGDB 4LVEA 3EYQD 1JTTA 3GSRA 3RZCA 2NY1B 4JPKH 4PRNA 3GJFA 4GSDH 3MV8A 4OM1L 3UJJH 5GRJH 3GRWA 2CLVA 4PJFB 4WUUA 4JZNB 4DW2L 3GJEA 3CZFB 3CDYA 3T2QA 1KN2L 4RISL 4X98A 2V2WB 5ICZB 1OTTC 5SWSD 4X5WB 3VD9A 3NGBC 1QLFB 4MA8L 4NRXA 3Q5YA 5I1KL 2Z8WC 1MVUA 2JJTA 5F9JB 2VL5B 3ULUE 1KC5H 1TVHA 4OFYA 1JL8A 3IXTA 1KEMH 2ITCB 3PP4L 5IP4A 4G8EB 4JRYA 4Y2DB 2HFFA 3L9RA 5DJ0B 1ZT1A 2D7OA 2YSSA 3ARFA 4KH2A 4D3CH 4N5UA 1EA9C 4U6HB 3WD5H 2IPKA 4XVSL 5F9OL 3PGFH 1A7OL 5CJOL 3EIFA 3FO1A 3B6SA 1NCWH 5DUPH 1A6AB 3C6LC 4JQVA 4EDWL 3MV9D 1V3JA 3IF1B 4FFVC 3OKEB 2Z0BA 1G9ML 4AM0A 1WAAA 2YBRB 1Z0MA 2XZAH 2NY3D 3HC0B 4S1SL 3KS0J 1CGWA 4RBPK 4OGYL 1BX2B 1LDSA 5ALBH 5HHOE 2IANA 2WP3T 5DF0A 3WFHB 4NNYB 2EE6A 4V2CB 5EA0H 2VDOH 4JDZB 5KANI 5HHME 3R1GL 4L29B 2I9LA 5E1HB 2YRZA 4Z7VE 1MH5B 3U6RB 2DD8H 2BVOB 1SY6H 5EZIL 4CNIA 5HHOB 5ICYB 3IDUA 3RP1A 1N6UA 1BWWA 1LO4H 1AQKL 4PJ7B 2VSDA 4Y4FB 5EH1A 2FJHA 3EHBC 3EYOB 1LO5A 4M00A 1MREL 3GSNH 2IGFH 3QJHA 3SN6N 4ZUUB 1A02N 3TN0C 1ZT7B 2XTJE 3I9GH 3RWJB 4U3XA 4I0KA 4YHMH 1MAKA 3G6JA 4JFPB 1A7RH 3KS0H 1CF8L 1CFSA 3HZKB 2P43B 4XCCL 2BNRD 4KDWA 2YPLA 1A14H 1PZ5A 3CFJA 4O2EA 5EUOB 5EG6C 1JPFA 4CAGA 3QIBD 4MLSA 3GMRA 4MMXC 1ZMYA 4GKNA 4P2RD 2N56A 3MJ6A 2ADJB 2VDQH 1DBKL 4MGXA 4TTGA 1MF2H 1OGAA 1RZJH 1KCKA 3R06B 4I4WB 1N7ML 5J1AA 2P44B 4XPTL 3RBGA 2DLHA 3HMXA 1NSNH 4U6VL 4R0LC 1G0XA 2MOVA 1NC2B 3C2AH 3L3HA 5H37H 4GXVL 3VW3L 5DJ6B 4D0BA 1LNUB 1U6AH 1CFTA 1A22B 2ZUQB 4Z7WE 2DF3A 4LCWB 3MRLB 2QR0B 1NEUA 2R39A 3DURB 3QFJE 4JANA 1V3MA 5ACMA 4LSTL 1P7QA 1FIEA 1VEOA 1JZ5A 3C60B 1QR1A 3BN3B 3STZA 4KHXL 1U8JB 5SX5K 4NQCE 3PWVB 3MXVL 3O6LL 3QFJB 4WI6A 1QOKA 3O8XA 1NKOA 3RTQA 6FABL 4V2BA 4KV5F 1P69B 1NMCC 1IGYA 1N5YH 5GZND 1QFHA 2R0ZL 5INCA 1WZ1L 4ZXBD 5JZ7C 2XQBH 4FQ1L 4H1LH 1LEIA 4NQCB 2BY1A 1CYGA 1JHTB 5DZOA 4OI7A 4TYUA 5GGVY 4C56B 2GJ6A 3ZL4L 3VFNA 5BZDB 3U7AA 5CD3B 4CJ1A 5HBBA 1QA9B 2A1WL 5SWZA 3WHE1 4HV8A 5HGHA 4Q0XH 3MLPA 4QRUB 5CD5D 2VB5A 2Z4QB 3QZWB 4FQCH 3DX7B 1CFNB 2I27N 2ED7A 5BVJA 2DQJH 4XXCC 1M7IA 4AG4L 4R3SA 1DL7L 1H3PL 4CU7A 3TBWB 1XT5A 5HPMB 4L1DA 2CUHA 2BY2A 2FHCA 5I18H 2ZCHH 1VEPA 5ESVA 4JAMB 1CG9B 2FZ3B 1TTFA 4OLEA 3T4YA 1OAZL 1HE7A 2AJUH 2ORBL 3LB6D 5E6YA 4IRZL 5T1LD 3T04D 1PKQE 4GMSH 4YHKH 4IRSB 4AQOA 3BPCA 4BFBD 5J0BA 1RZ7H 5ITFB 1YEHH 5IW1A 5MI0C 1DBMH 4FOMA 4NN7C 5BRZB 1IRAY 3LKRA 2FL5A 5HVWA 4YHOH 3DI2B 1RUML 4LPYA 3NABH 3FB8B 2DQIH 1MWAA 1DE4A 4PYGA 5KSVB 2X4OB 2D9CA 4JN1L 3RPIA 1QKZH 2IQAA 2YC1B 3PF2A 4P4RA 3X3FL 5DUML 4GBXC 5HGAA 1VADA 3GMPB 1G6RL 3VFWB 1U42A 4OJFH 3QUMA 3W5NA 3GMQA 3W9DB 4O58H 5IROC 4NQEA 2EH8H 3KPRA 4S0TD 4ZUVB 4BQBA 3HC3H 3VWJB 4FHBD 1F5WA 3HA0A 3GKZA 4EN3A 1BM3H 2OL3A 3SDXE 3MJ7A 4QKXB 4GRMA 3L5JA 1UWGH 4JVWA 1CFVH 2GHWB 3IT8D 4Z7UA 3OAZK 2R0WL 1XF2B 1HH9B 4KTEH 4D94A 4XBEL 1F58H 1WICA 5C0CA 1T0MB 4IRJC 2FX8H 4YHPA 3VXQB 1MAMH 2D9QB 1CD8A 1QEWB 5E1AB 4HUXB 4X6DE 3REVB 5EZLA 1TJIH 3QZWG 5EU6D 3U82B 2ZUVA 3ZO0A 5GS3A 4I1NB 1QRNB 3QCTL 2VITA 3T77A 5JPNA 3U36B 1Q1JH 3HI5H 3CSBA 1G7MB 2XKNB 5HVGB 1UQSA 4LLQB 1AGEB 1FAIH 2Y06H 1IZJA 2W92A 1G9NH 4X6DB 5EOQH 5C0RL 1FLRL 1EHLL 3H9SA 1CGYA 3SDAC 4PJDF 1BGXH 4P2OC 3U9PH 4Z78B 3JWOH 2RBLA 3PQYD 4MAYB 4P5TD 4PRHE 2XZQH 2DQHH 1INDH 5GJSL 3LQAC 2PTTA 3MBEB 4N68A 5ALCL 3MO1B 2EDLA 3QFDB 3ARUA 2FLBT 2EECA 4RZCA 3WFBL 4GKOA 4WNQB 4MHHI 4ZSOA 1JZ4A 4MS8D 4Z0BL 1LP9A 1LEKA 3B2VL 2E7BA 5CMAB 1U92A 4PRHB 5EC1A 2H32A 4NKDB 8CGTA 3MRIA 3WJJC 2FD6H 3SCMD 4BZ2H 4F33A 1YMMA 4YDIL 4O02H 2V2TA 3EYSL 2QSCH 3TBYB 3DO7B 5DWUH 2FWOB 3MV7A 3K1DA 4NO5A 3HE7D 1BPVA 2EYTA 3DPBA 4O4YL 4Y4HC 4N1CA 1I3GH 1EBAA 2EDQA 4WHDA 3RDTB 4UNTA 4X99B 2X4TB 4EIGB 5KN5B 4DGYL 1I8IB 5HYJD 2EKJA 1AKJB 3OKMB 3QRGH 5I8EA 1D5MA 4DUWA 3KNBB 5E6ZA 4OIIL 2CRMA 4RQQB 4L8CA 3CFEA 3QSKB 1MRCH 3BXNA 4BK4A 4XP4H 4HS8L 1YECH 3WL9B 4PD4J 4QHLB 4YEEA 4PV8A 4DZ8B 5KW9L 3IDGA 2OJEA 2E7MA 3K80A 1JV5B 1QBML 4HUKB 2PF6A 3E8UH 3GB7B 4N8CL 5GSVB 3EOAB 4FXGB 4U1HA 5DJYB 2A0LD 2DDQH 3AM8C 1R3LA 5F6IC 5CJ5A 4GXUN 2VISA 3KPNA 1HXMA 1IM9D 1N2RB 2B0SH 2ATPA 5L88H 5CP3A 3DUSA 2BVQA 2YA2A 3WIIL 2R8SL 1EAPA 2QQLH 4KDTC 4LLYB 1WCBA 4HLZG 4HKXB 5DZLA 1L7TH 5JHDA 3BESR 3JXAA 3ZKMC 1V05A 3X14B 3N85H 5DHVB 4ORGB 2DQEH 2I24N 4JO3H 4XBGA 5FECA 5IJVB 3LKNB 2F19L 3KDMA 5GRZA 4QLRA 4NHCH 3T0EE 2EDFA 4Q6IB 4YBQC 4HJGB 2Y23A 3UZVB 4Y0GA 3BUYA 1FL6A 1VFAB 4JM2A 2W1NA 5L8KB 3HFML 1F4XL 2EO1A 5EUKB 4QRPD 1K6QH 1MJ7L 5FGBA 1RAMA 1U36A 3NN8A 5I76B 1N5AB 3QUYA 2MQ0A 1KPUA 4TQEL 1A0QH 4PLNC 3VWKC 1HWHB 4GG6F 4ZXBC 1KFAH 5F88A 3QWOA 2D7QA 1MCSA 5C09B 4OD2B 4M02A 5JW4Q 3ARYA 5L7XL 3PHOA 5ID1B 2X1QA 3VCLB 1S9VA 1RZIB 4QXGH 4X4XA 4ONFH 2VXTH 4EDXB 4E41D 4PRBA 1I1YB 1REIA 4JKMA 2C3XA 1YNTB 5DJCB 1Q0YH 5CEXB 1CXKA 3HHRB 4S0SD 5F1IB 3EZJB 3LIZH 1A6TB 5B38B 4OZHF 1CL7I 3OXRB 1K5NA 3RVTC 3IKCB 3O3UN 5TE7L 1GIGH 4ZUSB 43C9B 3NAAL 3M45A 4AIZB 5DJXB 4KKCC 4K3JL 3FO2B 3AY4C 1QFUL 1XR9B 2EIZB 2C3HA 2BRRL 4AEHL 5EU3B 5DQDL 1OAUL 1FZMB 4RRPA 5T3ZL 5I1IL 4PJBF 4FTVD 5DD0L 3SE4C 3TP4A 2KKQA 3M1BA 5DYOA 4MD4A 2Y1VA 2B2XL 3DECA 3JWNC 1K3IA 4FQIL 5ENWB 5GS2D 1F42A 1WFUA 1T3FA 4NFBA 2O5ZH 3T4AB 3KPSA 4WFED 3S3JA 4MJ6B 3S5LA 4YHLL 4FFZL 2W60A 1IL1B 3MFFA 4PJ5E 1I8KB 4IS6A 1ETZA 3WNMA 4PP1D 5GS2H 5LWYL 2JTDA 4PJHA 5D2NC 4UQ2A 4UT7H 3G5ZA 1LK2B 3H7LA 2GCYB 2ZPKH 3O0RL 4OCMC 1DLFL 4PJ5B 1T6WA 4U3CA 4KJYB 4OQTH 1OTSC 3O6MH 2P49B 1Y0LA 2EYRA 1GVIA 3GSRB 5GGVH 5HXMA 3RZCB 4PRNB 5BQ7B 5ECJE 1ZLWK 1LO3L 4UUJA 4KMTL 1A9BB 2CLVB 3BPLB 3GJEB 4V1DA 1T7ZA 2UZIH 3GBNL 1MI5D 3NFSL 1JWUA 1QSVA 3QDGA 2EXYD 2L7UA 5CCKH 4NRXB 3SDDA 2V9RA 4HMDA 1MVUB 4O2FB 1ZHNA 1ZVSA 4M43L 4NP4H 4L9LB 1TVHB 1G7QA 4L4TA 3DX6B 1G7PA 2WIMA 4Z77A 4JRYB 4NQDA 5GGTA 4TULL 1XEDA 3L9RB 5B38G 3CUPA 1ZT1B 4LRNH 3NCEB 3ARFB 3MA9H 4PBVC 2XA8L 5D1QC 4ONGH 3WN5A 1MFBL 1JRHI 4UTBL 3STBA 2IPKB 3V6OA 2GSIA 3ZDYE 3A6BH 3LRSA 2X4RA 1Q0XL 1K2DA 2CGRH 4X9FA 3FO1B 4G8FA 2J8UF 4XC3L 3CH1A 3B6SB 1FFNA 4ZUWB 4F15C 2X1XR 3I3DA 4HC1H 4RNRA 2YPVH 4NO2B 1FORL 5B22A 4GUPA 3D18A 1EJOH 3T2NH 3OQ3B 4P5TC 3BMWA 1IT9H 3QXDA 5LGHL 4LKCB 4N90E 2GJZA 5ERWA 1CCZA 3T3PF 3H3PH 1FVEA 4DVRH 3O9WC 3QIUC 3H42H 2HJLA 5EO1B 4KGJA 3CDGA 5C0AE 1F97A 4HT1L 4S1QH 5JXEC 4U1GC 1TZGL 5DD3L 4KKAC 4ZQKA 2WM0A 1BQSA 5DMKB 3P0VH 2YUXA 2WAHA 3VFVA 3LMJH 4F9LC 2FJHB 3PHQA 1I7ZB 3SE3C 3VFTB 4QOKA 5C0AB 3FB6B 4U7KA 4JY6A 2UY7A 1SEQH 2G75A 3L1OL 1ITCA 4U1SA 5D7LE 3G6JB 5JOPD 4QRQA 3B5TA 1ZS8B 4PREB 1LE9B 3WLWC 4X83A 2AJXL 2DM2A 1NDMA 1MIEH 5C0DB 3S34L 2R23B 4PTTA 2IQ9L 7FABH 5DO2C 2YPLB 3GNMH 1IAOA 1PZ5B 3CFJB 4UTAL 4BFIA 5TE6L 2H3NA 3GMRB 1INQA 1G7LB 3HRZA 1TJHH 2AS5M 3KAAA 3VMPA 2YKLL 5TDNB 3K74B 4Y8DC 2LU3A 1MRFH 4P46B 2QTEA 3T0WA 4J3UA 3V8OA 1PG7H 5I66A 4XNYH 1AR2A 5C3TA 3MR9B 2FB4L 5C0EB 4FS0A 1BJMA 3MQIA 2OBGA 4NM8H 1BBDL 4KI5D 3VGGA 1UJ3B 5E2VH 3L3HB 1JFQH 5T1DL 2LU4A 5E8NA 1U8MA 4XCNA 4W4NA 4D0BB 3T0AA 4XNUH 3UTTD 1MFCH 2PO6C 2V7NA 1KCUL 1T89C 4OCYL 5FYLE 1J1OL 1OQOA 2AJ3A 3O6FC 4LSVL 3L3JB 1PYWA 4XI5C 5E00A 4I77L 1P7QB 5D71H 5FM5M 1V7NL 1HZHH 4K71B 4HPYH 1EMTL 3QEQE 3QPXL 3IFPA 1QR1B 3STZB 2V9QA 4MZ3A 3TWCL 1DVFD 4G8GA 2OQJB 3FQXA 3O8XB 3L3DA 1X7QA 2Y5TA 4HW6A 4NJ9L 1N0XH 4ODWA 1IGYB 3ZHDA 4I18A 3DVNB 5INCB 3UTSE 5BMFH 5IQ9A 3QCUH 5I1HH 5C8JB 4NJAH 3SDXA 5FAAA 3FO0L 4HAFA 5GIRA 2A77L 5B3JF 1KJMA 5J6HA 2AV7A 2GI7A 5CBEA 2D3VA 4F37K 3O4LE 2P24A 5I19L 3IJSB 3EJZD 1FZJA 1K4CA 3KXFE 3MOBH 5I75C 1R3JA 1WFTA 1FZKA 2HT4C 3V4VL 4PY7B 1PEWA 4PJ8A 1U8HB 2VDRH 3O4LB 2VLMD 3B9EA 4OT1L 2IMMA 3IDMB 1QFOA 2OS7A 5BVJB 3T0VA 1M7IB 5H2BB 3C9NB 1IBGL 3FKUS 4HHAA 5DA0B 4CMHC 1E4XL 2AEWA 4ISVB 3CFDA 4PRID 5FYKE 3P4NA 5DXWA 1FL3B 4PRPE 1MEXH 1J87A 4WI4A 5D9SB 4K8RH 5KSUA 3T4YB 2X4PB 1NMAH 4QXUH 1W72A 2FNBA 2P5WD 1RVFL 1TXKA 4KI5F 4HH8A 4KKNA 1A47A 5IW1B 1DQML 3C8DA 4X5LA 3ULUH 5GGUB 3TZVC 4PRPB 1NBVL 3LKQB 2ZJSL 3CFBB 4LGSB 1C08A 3LKRB 2VLKA 1JHKH 1FNAA 2AXGB 3UROR 4I0PB 2NY0D 5HHVH 3ARZA 1F11A 3RPIB 4JO1H 2C3VA 1HSBA 3IJYA 3GSQA 4P4RB 1A1NA 3ARSA 4KK8C 4HAGA 5I8KH 1KN4H 3PL6A 4TTDC 4OZGF 3P4LA 4XCEA 5J7CC 1S7TA 3RUGA 3GMQB 1UGNA 2R0KL 4FFYH 3S96A 2GUOB 5IG7A 2P8MB 4NQEB 3O2VL 5HDQH 3BGFB 1IAKA 4EUPB 4ZFOL 1OGTA 1A6ZA 1MFNA 3MLVL 3ORJA 3S9DB 3ROOB 2PYEE 5E03A 4J4PC 3UBXI 2VZUA 1EGJL 5AG9A 3MJ7B 4B53A 1FC1A 1ZLUH 4NSKB 4Z7UB 4JPKL 1T2JA 4GSDL 1J9CT 3UJJL 5GRJL 1LDPH 1S7SA 3QO1A 2HVKA 8FABB 4OZFA 2FHFA 3D5OF 4YHPB 5I2IA 4JDTH 1RMFH 2A6KA 4PBWD 2LAAA 4IHOA 3KYMA 3GO1H 3NPSB 4LVOC 4BSJA 3SY0A 2D0HA 5I8CA 4G6KH 1KC5L 2O93L 5JPNB 5E8OB 4W4OA 4S11A 4YJZL 1KEML 2A74B 4NDMA 4HWBA 1UQSB 3I75A 1WZMA 1TIUA 3AFLA 4I48A 5HHXH 5EOTA 2VKXA 1T0NA 1NC2D 4ZYKA 1CD1A 2V2XA 3H9SB 5KVEH 4D3CL 3VXMD 3DHJA 3WD5L 3LVEA 5DRXA 4RWYH 3PGFL 1HWGB 1ZOXA 2RQ8A 5HPOA 1NFKA 4LCWD 3VI4E 2OK0H 3J8F7 5D6DC 3UZQA 4WO4A 1NCWL 4G8IB 1KTKE 5DUPL 2PTTB 1P84K 1KLGB 4P49A 1G7JB 5I71C 1MCBA 2WANA 4RZCB 4U1MA 1GXEA 4AJ0A 3F58H 3C60D 1LEKB 2AI0H 3LRGA 2XZAL 4OAWA 1UWEH 3CVIH 2QQNH 2H32B 5ALBL 3BH9A 1BFVH 3MRIB 5EA0L 3O2WH 3ZLQC 2VDOL 5I15H 2V2TB 4JFEA 4RFOL 1CICA 1EFQA 3HMWH 1IC7H 4PUBH 4DUVA 5J11C 3MV7B 4MNQE 2VMFA 4HCRH 4Z9KB 3W11C 2DD8L 1SY6L 2XKSA 1T6VN 4L8SC 1HXYB 3OR6A 3ZKNC 4KI1A 4J3TA 3F5WA 4NFDA 1LO4L 2EZ0D 4C56D 5F7MC 1ORQA 1N59A 3GSNL 5T5FH 2IGFL 1Z9SA 4H0IA 2EIEA 4XPGH 5CUSH 4RMRA 4HIXH 4MNQB 4EUPG 3VXRA 3I9GL 4YHML 2E7CA 3RJDA 4KGLA 4OLZH 2J5LC 5DEZA 3DV6A 5EBLA 1CLYH 3KYAA 4YQXH 4NCC2 2VLJA 3GIVA 3TA3A 2GAZB 2KPNA 4XWOD 5T1KA 1HHKA 4HGWB 5D6CB 1A14L 3DBXA 4K7PH 3FO9A 1JIBA 3U0WH 1DUYA 3IDGB 4NOBA 4WFGD 1ZHBB 5C0FA 1ZHKB 1OB1A 2OJEB 3QRFM 3V0VA 5CSGA 2VDQL 4U1HB 3RGHA 1IQWH 1MF2L 4ODSH 5AAWA 3S4SA 2Y72A 1RZJL 2CDFA 3C5JB 3MLTB 1FLTX 2X70A 3HZYB 1HXMB 1NSNL 4LEXH 4D9RE 2ATPB 3C2AL 4PJEE 3DUSB 2BVQB 1DUZB 1EAPB 5GSRA 3ZE1F 1D5BA 5BRZD 2FEEL 1U6AL 4JDVA 3ALXA 4NT6A 5E2JA 1MCFA 1TQBC 5IVXA 2ZUXA 4PJEB 4YNYA 4L3EE 3ZYOA 1IKFH 4XBGB 2HFEA 5L2JB 2VZOA 4M03A 5FA4A 3C6LA 3V2AR 5DC4B 1WFNA 1AD0B 5HDLA 3GSOA 5L2KE 4HUUB 3BUYB 3BKMH 4MJID 1N5YL 1I1FA 2H2PD 1CN4A 1PBYA 3VWJD 5DS8A 4P23C 4HSQA 3QCVH 2XQBL 3KHQA 5AZEH 2SEBA 3NN8B 3OKDA 3GI8H 3L5HA 1KPUB 4P9HH 3D1MC 1JF5A 5HD8D 5F88B 3QWOB 3FB7B 1NAMH 2QQKH 4MA7H 1RIUH 1BREA 3P9MA 4LHUD 1DTUA 4WDIA 3VFMA 3S37H 3NZHH 4KRMB 2W65B 3B8YA 4X4XB 2A83A 3SEPA 3TN0A 5T5NG 1NGWA 4FQCL 4M6MH 1QRND 4NHUB 2IALA 3WKMH 1IAIH 4HQQH 1W0WA 3QHFH 2ZOLA 4HUVB 4K7PX 1U3HC 4D0CA 2OSLA 1KT2B 4M7KH 4UDTA 2X9XA 3JV4B 4DEPB 5I18L 2VZSA 2ZCHL 4M61A 4OFIA 2VABA 1AGDA 3SJVE 1WBYA 3QQ9D 2AJUL 4LPCA 3GSWB 4GMSL 4YHKL 4RMSA 5ANMA 1CXFA 4R4ND 5GRXG 5B21A 3QG6B 1Q9LB 3IFNH 1RZ7L 3PIQA 2EIDA 1YEHL 3F7RA 3PDOB 3H3KA 4MSWA 1WV7T 1DBML 1TVDA 2F8VA 5EFIB 1FSKC 1J8HA 2X1OA 2ZZUT 3M1BB 2WUCH 5DYOB 4HLZH 4MD5A 4MD4B 3SJVB 2H1PH 3SO3C 3ARED 5DK0A 4AY0A 1T3FB 4R0LA 2CD0A 4YHOL 3BZFB 3NABL 2DMCA 2DQIL 2ED9A 3TVMD 1Z9LA 3S5LB 1QKZL 5EU4A 1QSEE 3NH7H 3MFFB 1UYWH 4OGXH 4XZUA 3NCFB 4M1CD 2FO4A 1ETZB 3UAJD 1ZEAH 3VG9C 4JJ5B 3RDTD 3P0YH 3G5ZB 3ZTJG 3RX8A 4OJFL 4YAQA 1H3VA 4NBXB 4NNPH 4O58L 1T7WA 1BFSA 2EH8L 4PYHA 4MA1C 1AKJD 4YHZH 4HK3N 4JG1H 1M7DB 4KJWD 1L0XA 3HC3L 4M93B 4R90H 2FSEB 2F15A 1S9YB 1BM3L 3WO4B 3AS2A 1Y0LB 3LEVH 4OGAC 1VACA 4P3CH 1UWGL 1CFVL 1T03H 5LAXA 4R4FH 4EI6B 2HFTA 4HIEA 5SX4I 4KTEL 5JIIA 1F58L 4L1HA 3MLRH 2FX8L 3S37X 1MAML 1JWUB 3BN9D 4ZG1A 3DROB 1RIVH 3QDGB 4PIRF 3K81A 2DMBA 3SDDB 2N7BA 1TJIL 1T80A 1ZHNB 4N0UA 2BCKB 1G7QB 3RX7A 4L4TB 4GAYA 5FO7A 1Q1JL 1KELH 4Z77B 3HI5L 2VLLA 5DEGA 4ELME 4TRPH 5KVFH 3WLBA 1FAIL 2Y06L 2XNAB 1G9NL 1A1OA 4GLRI 5EOQL 4WVRA 4FQPA 4JN2A 5L8JB 1BGXL 4XXCA 5KS9E 4KHTH 5MERA 2GSIB 3O3EA 3U9PL 3LRSB 3BFOA 5EPMA 3VH8B 1K2DB 4RGOH 3JWOL 2BNQA 4ELMB 3CH1B 4H88H 4TNVK 4U1IB 1FFNB 2XZQL 1HCVA 1INDL 1J0ZA 1GC1C 2DQHL 4UDUA 3WNLA 4Z8FH 1W8OA 1OHQA 4RNRB 2CDGB 4F57H 4ZPVA 1T22A 2YWYA 3X13A 5KS9B 4GUPB 2P46B 3D18B 4YDKH 3N1PC 4YXLH 3QXDB 4P2QA 2IH1A 2ZP0T 1CXEA 3D39D 3CK0H 1FVEB 3CX5K 2DQCH 1ONQB 2FD6L 4BZ2L 4KK5D 5DHVH 4O02L 5H94A 3S5LG 4L4JA 2QSCL 3CDGB 4JGJA 4ODXA 1RIHH 4JGUA 4EI5D 5DWUL 2NY5C 1MCLA 4LLMA 5CGYD 4C55A 2CO7B 3JVGC 5MENA 1I3GL 2F54D 5JPMB 2YPKA 3VFVB 4JHAH 3PHQB 4GBXA 2FDBP 4U7SA 4QOKB 5C09D 4JY6B 3QRGL 4NRYB 1S3KH 3IDIB 1OAXH 2G75B 4U1SB 1AGCB 4GRWE 2Z31D 3QUXB 5IROA 5JA9A 3ARDD 3NIDF 3BQUC 1NDMB 4LFHD 1DLHA 3SO5A 2WWMC 1MRCL 4XP4L 1YECL 1EEZB 4DKDC 1HHGA 4TVSa 1JN6B 4POUB 5JW5A 3WKNA 4DGIH 5JLZA 3EFDH 2G5BB 5DQJB 1FG9C 4CVUA 5IMLA 2XPGA 2XKUA 3E8UL 5E08H 3SGEI 1G7HA 4Y16D 4IRJA 2IH3A 3WIFB 2DLFH 4PJIE 2X2YA 1MFDH 2DDQL 5JXAH 1A7PH 3MRMB 4NC0B 4AH2A 3FRPA 2GT9B 4FG6C 2B0SL 3CMOH 5L88L 2PNDA 4JKLA 2FCBA 2QQLL 1R5IA 5TGBA 1XCQA 5GZOC 2W59A 1U2HA 2V7NB 3MC0A 4LMQI 4PJCA 3F7YA 4Z7OF 1L7TL 3IDJB 2AJ3B 4CVXB 1FYTD 3SDAA 4P2OA 5E00B 3N85L 5HI4D 4Q58C 1GAFH 4M5ZH 1A9EA 5DLMH 2W91A 2DQEL 3VDAA 4HUWA 4JO3L 4A2MA 3UZEA 4DVBA 1QTYT 4HZLA 1HHIB 4G8GB 4JY5H 5T3XD 1ODAA 3CFCH 2AK4A 2HYMA 1T04B 3D69A 4NHCL 1JPGB 3S36H 3F6IA 3FQXB 3IS0X 3L3DB 1X7QB 2Y5TB 3KYNA 2AEIT 1XF3A 4G9FE 5HHNA 4I18B 3ESVF 4UU9B 5IQ9B 3OKOA 3W9EA 4FFWD 2YD3A 4RAUA 1K6QL 1WJ3A 4I3GA 5T3XH 5GIRB 2CRZA 3WJJA 2RAMA 5LGJA 4U1JA 4H8WC 5E5MA 3RZCD 5FUOH 4PJXA 3MV8D 2P24B 1KFAL 2NTFA 3BH8B 1LO2H 1FZJB 4WHTA 1IC4H 1S5IH 4WUUD 1P7HL 4Y4HA 3QAZB 3SE9H 2IG2H 3RJQB 4YK4C 3CPLB 2ERJB 1AHWB 5CEZD 4YWGH 3MA7B 3PWPE 1LK3H 4X0KA 4PJ8B 4S1DC 4QXGL 4ONFL 2VXTL 3EYFA 3GRWH 4GKZA 3RVWC 3EOTH 4OFYD 2BSSA 1Z5LA 1Q0YL 4XVUC 4JRYD 3VXSE 3PWPB 3AB0B 3BPOB 5CEZH 4U1KB 3LIZL 4ENED 3ARFD 2LAGB 4Y1AA 1GIGL 1FDLH 3P4NB 4X4MA 3SKMA 3MNZA 1LWRA 3L3OB 1E4JA 1MQ8A 2Q3AA 4RA3A 4ZO8A 1SBSH 1CK0H 2BVPA 3B9AA 4HGKC 4UQ3B 3QIWC 3LS4H 5KTEH 2M1KA 3GMMA 2OR8A 3HZVB 4LK4A 4HH9A 1NH6A 1H5BC 2WBJB 1DQQB 3CSPA 3QQ9C 3AM8A 4QXTA 1BIIB 1C08B 1HDMA 2VLKB 2YXFA 3FT3A 4YFLF 1LILA 3ZT6A 4NWTH 5IBTH 2O5ZL 1KTDA 3L5XH 2IAND 1M71A 2C3VB 4KDTA 3IJYB 3T65A 4KJPC 2OI9B 3PL6B 4TSBH 3OKLB 1FP5A 2YUVA 1X3DA 1S7TB 4UV4H 3CCHB 3S36X 4UT7L 3S96B 4C83A 4RGNE 2ZPKL 1IAKB 5E7FA 2CIKA 1XZ0A 4AEEA 1TPXB 4LVHB 1U8QA 4OQTL 4UIMA 4EVNA 2P8PB 1OVZA 3O6ML 4Y5XC 4IMLB 3TIEA 1TZIA 1AP2B 5GGVL 2ATKA 3U30B 4HS3A 5FUCE 5JHLH 2YPLD 3DTXB 2ITDA 4ODBD 5BV7B 1JWMB 2HVKB 3DUHA 4OZFB 4KXZH 4OQ1A 5JUEH 2NY7H 1HHJB 2UZIL 4JPWH 3VWKA 5DTFA 4IHOB 1AY1H 4ZXBA 4L8BA 5CCKL 5IVOA 2NMSA 2CIIB 3SY0B 2FLRT 5I8CB 1U93A 1OGAD 2EDRA 2ICWI 4TUOA 3MPCA 4WTXA 5TJWK 5B8CB 3HNVH 4NP4L 4W6XB 1MQKH 4HK0A 3BN9C 3I75B 1J86A 4FRWA 3BP5B 4I48B 3V5HA 1ZA3A 2ESVE 2V2XB 4LRNL 4ZS7H 3TH3T 3MA9L 4H25B 1ND0A 4ONGL 5C9JA 3D85A 1MHCB 4HIJA 5DRXB 1DDHA 3FB5A 1HKLH 3A6BL 3EJJX 4J23A 5T3ZE 5JORA 2CGRL 3C5SB 3D9AL 3HMXH 5D7KE 2G9HA 4D9QE 5AEAA 2ESVB 2NY4C 2NXYD 1P7QD 2H26A 4HC1L 2DLEA 2YPVL 3INUH 1NGYA 3VU2A 3AY4A 2AV1A 1YA5A 5F9WC 3T2NL 1IT9L 4JFDA 4PJDA 4OAWB 5CP7B 4PLKC 2VZ3A 5ADOH 3O8XD 3H3PL 3RTQD 4DVRL 3BH9B 5IW3A 3SE4A 2JB6A 1QFWM 3H42L 2XFXA 1Y6NR 3FT4A 1F4YH 1CICB 2NYYC 1EXUA 3WS6C 2R9HD 5DMJB 1DCLA 2UY6A 2Q76A 4G6FB 4WTZA 4S1QL 2E7HA 1A7NH 3JSSA 3F62A 4NZDA 2DLTA 2G5RA 5EU5A 1ED3A 3QG7H 3P0VL 5CILH 3LMJL 2GJ6D 1SMOA 5E24E 2IAMD 2WZPD 3RIFF 4QF1A 5SWZD 5INDB 1CD0A 5CGYC 5D2NA 5FHAH 3T08A 3U4AA 1OQXA 4XT1C 1SEQL 4I2XE 3X11B 5EBLB 2EDXA 4WWID 2C3GA 1KB9K 2VLJB 3O45A 4XP1H 1CGUA 1OD9A 1S7UA 3TA3B 5C0BB 1MIEL 5T1KB 1RUQH 1HHKB 7FABL 3MZGB 1K3ZA 2X4UA 2UWEE 3L5WA 3DBXB 3FO9B 3RNQA 5E6IC 3IFOA 2QBWA 4OZFG 5IB1A 1DUYB 3FCTA 4MQXD 5C0FB 1OB1B 1TJHL 5GGQH 1MJUH 1MRFL 3AMKA 1KF9B 1P1ZA 1KCSH 4XBPA 2J3SA 4CRPA 1PG7L 1TNNA 4XNYL 3WS3B 3NGBB 4MNGA 3N9GL 4K9EH 1OP5H 5C0ND 2HTKC 4NM8L 2HT3D 5E2VL 1XGQA 3CFKA 1JFQL 2YZ8A 2NZ9C 1L0QA 1I3VA 2B39A 1D5BB 4K94H 5DJDA 4XNUL 1MFCL 4HIHB 5D1QA 5I30H 4DCQB 5DD6A 3MLUH 4N9OB 1U8KA 1PZUB 1P4IH 5FYKH 4MAUH 5D71L 3C6SA 3MLSH 1HZHL 5MP6H 4HPYL 2IBGA 5IBLD 5FA4B 2EYSB 3C6LB 5F7UA 2DOCA 3GSOB 1MWAH 3I6KB 1KYOJ 4NQED 1EUUA 1N0XL 4HF5H 4P5TA 1G9EA 3KPRD 4L8DB 3RKDD 1J0HA 3ZDZF 5DS8B 1NL0H 5BMFL 5ISZE 3QCUL 2WWKT 5I1HL 1NJ9B 1N6QH 4NJAL 4PGBA 4TUJA 3KLHD 4EN3D 3O9WA 3QIUA 4XXDA 3TCLA 1KIQA 4A6YA 5IV2B 1VFMA 4YHIA 5HYFA 5D70H 4WV1C 3BYTA 1AH1A 5JXEA 1ZTXH 5F1NA 5ISZB 4R2GD 5JIHA 1XR8B 2PTUA 5C0CD 3P9MB 5FF6A 1SJHA 4QY8B 4WDIB 3MOBL 3VFMB 3DSNA 2HLFC 4F9LA 3QULA 4G9DA 3SE3A 1GGCH 3PWUA 2VDRL 2A83B 3JWOC 3TN0B 3E0GA 2IALB 5D5ME 4RWHA 2JELH 1F6AB 5KJRH 5KANG 4GG6A 1W0WB 3ZE2E 2ZOLB 3IDNA 2P45B 3MUJA 4FXLA 2X9YA 4N1EA 4D0CB 5KSBF 3H9SD 3DXAE 3O3AA 2HG5A 1YDPA 1HYSC 2V17H 5M94B 2G60H 3V6ZA 4M61B 1MEXL 2E8YA 2VABB 4I9WD 3VFGH 1AGDB 4K8RL 1NCAH 1WBYB 3S4SG 4HFUH 5ANMB 1NMAL 4QXUL 1NDGA 4MDJA 3ZYZA 3FQWA 1XH3A 4YFLI 3PIQB 3DXAB 4TVPD 4X7CC 5D93B 3MROB 3CLEH 4U7MA 4WFFD 3VD3A 3LD8C 1EVTC 3GBLA 1UCTA 3ULUL 1J8HB 4OZHA 4MD5B 1MHHA 4EXPX 3L3KA 5CBAA 1JHLH 3QUZD 4OV6F 4Y19A 2C26A 1JHKL 3O3BB 3RY5A 1YJDC 2O26U 5HHVL 4TVPH 2P5EE 1YEIH 1YMMD 1FVCA 5KSAC 5I8KL 2PO6A 3KR3H 4Q97A 1F3DJ 1KN4L 4QTHA 1T89A 2PXYC 4M6OH 5D7IA 3O6FA 5CIPB 2EDNA 3U79A 3M07A 5B4MC 2H32H 4YAQB 4FFYL 4GRLD 1ZA6A 5IT2H 4M6NH 3HN3A 1QFWH 5HDQL 4ONHA 4BYHA 1IEAA 3CVHA 4KRPB 3QDJA 3EO1B 3MV11 5DFWH 1VACB 3V79C 3L3IA 4EOWH 1PY4A 3VXUA 5BJTA 2VWEC 6CGTA 1YYLH 3CFIC 3ARRA 3WMSA 2EE3A 1F3DH 3HE6B 2R1WB 4JDTL 1JI2A 1RMFL 5CSBA 2DWDA 2VN4A 3GO1L 4NQUA 2M2DA 2QADC 4BELD 4N0UB 4RCAA 3UTPE 4G6KL 3UP1A 3P4OA 3ZKQD 1EEUA 1AO7E 3MRBB 5EBMA 5FO7B 3EBAA 3DHMA 3IAPA 4IOIB 4KY1H 2VLLB 5DEGB 3LH2H 5HHXL 3RAJH 1A6WH 1NCDH 3NOIA 4XTRC 3VRJA 4CADA 4JN2B 2R2EA 3UJTH 3QEGH 4UAOB 3O81A 4QXWA 4OI8A 1JUFA 4K55A 5MERB 3O3EB 4NNXA 1AO7B 4RWYL 4BQ6A 5TE4H 3IKKA 3KJ4B 1B0RA 2BNQB 5JHDD 2OK0L 3BPNC 2YD2A 3FN3A 3RL2B 3WFZA 4LPTA 5H8DA 2FIKA 4UDUB 1J0KA 3VMOA 1ZK9A 2LV4A 3C8KA 4LIQE 4UBDC 5CP3H 3X13B 4CVZA 2MCPH 1JGEB 3F58L 4RFNC 2AI0L 4P2QB 2IJ0C 5GRVK 1UWEL 3CVIL 4U6XA 4KTDH 2QQNL 4WI8A 3TZVA 1BFVL 1BVLA 3RNKA 5TQ2H 3O2WL 2J8UA 5H94B 5I15L 4JM2D 4MJ2A 4ODXB 3HMWL 1IC7L 4PUBL 1QQDA 3SKNA 4Q9BA 4LLMB 4FXKB 4HCRL 4I5BB 2D0GA 4QHNB 3ZTJH 4PLJD 2CKNA 3QUYD 4JFQA 4KXZI 1HSAA 1M4KA 3H0TA 4GBXB 5DUBB 3RY4A 1P9MC 3IGAA 5T5FL 3LN5B 4XPGL 5CUSL 4HIXL 4M3JA 4OLZL 3MGOA 4ZFOB 1CLYL 4YQXL 5FDYA 5FGCE 4KAQH 2IAMC 1NBZB 1DLHB 1GCFA 4PJGF 3SDYH 3JTTA 4RA0C 5J06A 4J4PA 1YNKH 3P9WB 3VGEA 4KRLB 1HHGB 5HDBE 4K7PL 5JNYA 1PEZA 5IHZA 5JW5B 3U0WL 4DN4H 1FAKT 5F3BA 5FB8A 5IMLB 3QQ4A 4PG2C 1G7HB 5SWSE 4XP5L 2GTWA 1A1MA 4IRJB 1IQWL 1GZPA 4ODSL 2OXHA 4OGZA 1V7MH 2Q86B 1UFUA 5DZNA 2VQTA 5J4MA 1PW3A 4AH2B 3BGMA 3UPRA 1Z6JT 4CGTA 4LEXL 4YHYC 1BEYH 1A21A 3WSQH 4P59H 4XPFH 2QJDA 5DVNA 1RJLA 4RSVA 1NCNA 3OKYA 4UB0H 2DJSA 3TC9A 2IBBA 3NIGF 2Y25A 5HHMD 3KPSD 4L3AA 2F9BT 4P2OB 1BAFH 5E8PA 3ULVD 2BJML 1TTUA 3PGDA 1J8KA 4HUWB 5D6DA 4DVBB 3MV9E 4HZLB 4G43A 4KK9C 5F96L 4Q2ZA 4X4ZA 2P4AB 4KROC 5AYUH 4DWHA 2VR4A 4JFHD 4LLWA 1AC0A 3KYNB 2JCCA 3MRGB 5JOFA 3SQBA 4RAVA 3ULVH 3BKML 3M17A 5IR1A 3GMNB 3PGCA 4JM2F 4RGMC 4MXVF 3OKOB 4BKLB 1WBXA 1WWBX 3QCVL 3TO4C 1XFPA 5AZEL 3W0WA 1FNSH 3GI8L 1G0YR 5E5MB 4KHXH 4P9HL 2NY3B 5K9JH 5FKPA 3IU4H 1NAML 2QQKL 4ZFFA 4WHTB 1RIUL 4Y4HB 1R5WB 4L8SA 4NCC1 4V1DD 1AJ7H 1J18A 5FDWA 1QVOA 4MHHG 3S37L 3NZHL 1D5IH 4QNPF 3S35X 3QDGD 1S7XB 1VEMA 5IFAH 3WUZA 3SDDD 1KGCD 3BEVB 3BKCH 4GKZB 4M6ML 5E99H 3WKML 1DZBA 2BMKA 4L4TD 4RDQF 1S5HB 2RCSH 4LOUC 4HQQL 1A6PA 2IC2A 1WF5A 4NQDD 3QHFL 1J0JA 1R0AH 4ZAKC 3VFRA 2BNRE 3V7MA 4M7KL 1B0WA 4BUHA 1QP1A 3B2UD 4R96A 2VC2H 4YFDB 4N0RA 4YX2H 1BVKB 5EIIB 1FFRA 4P2RE 5CKAA 4WWKC 1YYMH 2YA0A 2VLRA 1P2CA 5GGTH 3GMMB 3IFNL 3FRPG 4HH9B 1DL7H 3W39A 2OLDA 4QRTB 4LBEA 4WU5A 1I8MA 3V4PH 3H2WA 5HDOA 3RWEA 2PYFB 4QXTB 1J05B 3QIBB 2MCG1 4RBPH 2WUCL 2H1PL 4F7MA 5MEPA 1HDMB 3EJYD 3FT3B 4ZO9A 1KTDB 1PFCA 4JM4H 1B4RA 1CDGA 4KDVA 4Z7VF 4Z0XB 3PDDA 3T65B 3MGAA 3NH7L 3QUZC 4U31A 1ITBB 5DFTA 1UYWL 4OGXL 3RQ3A 1BQLH 5LXGH 4LLVB 1ZEAL 4HKZA 3MNWA 4FABH 2KZWA 2CLZA 1IGCH 3P0YL 4DOHE 5DJ2A 4NNPL 1MFEH 3UYRL 2A73B 4QOKD 4YHZL 4JG1L 3NIFE 3HZMA 1XZ0B 4ZFZB 4O5LH 5F93C 4L5FH 4R90L 4N0CD 2BSED 4KZEH 4GRLC 1JGLH 4EVNB 2XY2A 3TIEB 4EEEA 3MJGX 4H1LB 3LEVL 4P3CL 3CDFA 1CT8B 1T03L 2ATKB 4OF0A 4P23A 4R4FL 4HS3B 4F80A 3EGSA 3HI1A 3ARQA 4ZNEE 3KPPB 4TSAH 4HS6A 3MLRL 1I3RA 2V9TA 3QQNA 5HYSB 3TYFA 1C8PA 5DTFB 4ZXBB 3EDKA 1CDYA 1RIVL 2JJUA 5JA8B 5F9DC 3UTZB 4OLYH 1U93B 2X44D 3SDCC 4GW4A 2F8XC 5E56A 3IVKA 2MQCA 1Z3GH 5KVDH 3REWB 1KELL 2AJSH 3TBVA 4TRPL 5KVFL 5GS0D 1ZA3B 2I25N 4PR5A 1X4XA 5C9JB 1MSPA 5CS7A 3D85B 3RPKA 3LKPA 4Z7WF 1DDHB 2J6EA 1EBPA 1U3HA 2AEPH 4YBLC 3LPGA 1J12A 3MUGA 4POZD 3QISA 4RGOL 5EIQA 5E4EC 4H88L 2HT2C 3OJDB 5GS0H 3FQUA 3JTSA 4Z8FL 3HPLB 1N26A 5DSCA 4X8JB 1ACZA 4F57L 1NGYB 1AR1D 4YO0B 1QFWI 3QDHA 2CSPA 5SX5H 5C0RH 4MWFA 1BF8A 1FO0A 3O4OB 3QNXA 4YDKL 4YXLL 4S1RH 4PJDB 3CK0L 1NFDE 3TFKD 3B4NA 4FQXC 2JB6B 2DQCL 4BH7A 5IMKA 5D1ZC 4J1UA 2AK1H 2XFXB 1QLRA 1EXUB 1Z2KA 4MMZC 1RIHL 2D4DA 1D6EA 5AG8A 5JR1H 2Q76B 2NY1C 4NZUH 5JQHC 3FFCE 3KYOB 2HMIC 4F7CA 2FR4A 1A7BA 4JHAL 1BECA 1GGBL 3GSUA 3Q0HA 2YD4A 4QF1B 1X5AA 5E7BA 1SEBA 2AKRA 1S3KL 5D2NB 1OAXL 1IAMA 1WTGT 3QT2A 5H35A 5CHNA 3UDWC 5GGSB 3WEXA 4LF3B 4K8RC 1RZ8B 2XICA 3O45B 4B5EA 4H1LG 3DVFA 4Y2DC 1A7QH 5D2LE 1LVEA 4HDIA 5EOCJ 1EEQA 1WLHA 5JO5A 3L5WB 4K07A 4P5MA 3ULUC 3BP7B 3RNQB 3IFOB 3O11A 4DGIL 3EFDL 1KNOA 3DNKA 4E42A 2KBGA 5E08L 4Z5RA 1P1ZB 2QQQA 4ZUTB 5DJ8A 2DLFL 1MFDL 4GW5B 4DQOH 1OLZA 5EU6E 5JXAL 3E2HC 1A7PL 4LP4A 3RVXD 5IOPB 1XGQB 3CFKB 3RIFK 3CMOL 5DFVD 4DZBA 4YZFF 5J9PB 3G9AB 2N4IA 1P7KA 3ARBC 5DJDB 2VLKD 3QQ3A 2XG5A 1W72H 3D25A 3EAKA 5EU6B 3A0OA 2V5MA 5F6HI 5EOCH 3EDDA 5D1QB 2EDYA 3V5KA 4IBLT 4HJ0C 3QUKA 1KIPA 3V6BR 2Q8AH 3PQYE 1GAFL 4M5ZL 5EBWA 2NW3A 5F7HA 3S98A 5DLML 4OF7A 3PL6D 1MCWW 4Y4FC 1WGOA 3DSFH 4JY5L 3CFCL 4JZJC 3S36L 5CJXC 1VKXA 4XH2A 2RFXB 4CJ0A 1UKSA 4P5TB 1H15B 2FJFA 4LCUB 5CKGA 4O51A 2F74A 3GSVB 3UTQA 2ADIB 4X7TB 1S7VA 1YEGH 3QWQB 5TQ0H 2APTA 3SDXF 4PGBB 4TUJB 1YY8A 4CVWA 4XNZC 1G84A 1O0VA 3TCLB 4A6YB 4NN6C 1JZ8A 5T3XL 2XTJC 3OAZH 5IF0A 5HI3D 4CN1A 3FL7A 5FUOL 4KUCD 1GZQA 3TBSA 1B88A 1NCCH 5DC9B 5F1NB 5IB5A 1LO2L 3LOWA 4ZDHA 5EC2B 1S5IL 2R29H 3SCMB 1SJHB 3SE9L 3JVGA 4GJTB 2C1PB 2IG2L 2IPTH 5HYJE 3QULB 4YWGL 1LK3L 1BFOA 2O61A 3MUZ1 1IILE 4GT7A 2XA3A 3GRWL 3EOTL 5BV7H 4GG6B 4OZFH 4QCIA 3IDNB 2DBJA 3BQUA 5CEZL 2XN9A 1XGPA 3O3AB 1EDQA 3ETBF 1YDPB 4NPYB 4HMEA 1FDLL 1J10A 2I07A 4F3FB 5J6GA 5J12C 3OAYH 4DN3H 3A67H 5DGRA 4CKVX 1SBSL 5ACLA 1CK0L 4Z7NE 5KTEL 1Y18B 4X5XA 3LS4L 4HWBH 3FQWB 4WO4D 5IVZB 1T5XA 3B2UC 3K46A 1JWSA 2BX5A 4P3WA 2FJGB 4OZHB 3VFPA 2MSPA 3T0ED 3OBAA 2UUDK 3WIHA 3L3KB 4U1LA 2ZOKB 4LCCB 4Y19B 3BMVA 2OP4H 4PJBE 4NWTL 5IBTL 4YDJB 3L5XL 1F3JA 4AEIH 3BEWB 4U2ZA 5E9DA 1E28A 1QPPA 4JFED 5GS1C 3VD4A 1CICD 3MRHA 1FVCB 2PO6B 1IM9B 4HFWA 5F7WC 4ALAL 4JFOA 4QTHB 4DGVH 4ZOBA 2ZG3A 1UENA 3MOAH 1HQ4A 1VCAA 4TSBL 5DD0H 4ZD3H 4PJBB 2QL1A 4HMCA 4OSUL 3RUGF 1JF6A 1YN6A 4UV4L 1RJCA 3I6GB 1ZA6B 2XRAH 2GK0B 3FOLA 3HAEA 3MXWH 2JKXA 4ONHB 3OGOE 3T8XA 3VXRD 3VMNA 3JUYA 1ZV5A 2R1XB 1NCTA 2DICA 2ZCLH 4GAFB 3SKOA 2QHLA 2CO6B 2VLJD 3L3IB 4QRPE 3TA3D 4QT5A 1UADC 4KUCF 5T1KD 1PKOA 3MLWH 3O41A 5JHLL 3MUY1 4U0QB 4YGVA 2HJFA 1BD2A 5JUEL 2NY7L 3CGTA 3PHSA 2WSKA 1TLKA 4JPWL 1CI5A 1AY1L 2DWDB 4QRPB 5AD0B 3KPLA 4IRSC 1R3HB 4WI9A 3HNVL 1OTTD 3P4OB 5EBMB 1MQKL 3DUUA 5L6YH 1RZKH 3H3BC 4E41E 2NR6C 5DJAA 1V3KA 3UBXB 2EC8A 4CADB 3DGGA 2DIJA 4ZS7L 4R4BA 1FPTH 3TIDA 5C07E 1JUFB 2LTQC 3FQRA 4NNXB 2YUWA 4JPVH 4E41B 1CXIA 3DRQA 2ZSWB 1B0RB 1K8IB 4HK3J 4CMHB 3HMXL 2FIKB 4BUGA 3DIFA 1FL5A 3I02B 3D0VB 2OR9H 3INUL 4S2SB 4CVZB 3QIWA 4DK6A 4DKAA 2ICWA 2XQYG 4LEOB 4L4VA 3V52H 4FTVE 4G80B 4U6XB 3MRKA 3TF7C 2YD5A 1MCNA 5ADOL 1H5BA 1SY6A 2YRLA 4OKDA 3JBG7 4FFVD 1BVLB 3HLAA 2J8UB 4YIQA 2LFGA 1F4YL 1OAKH 2YR3A 4W68A 1SVCP 4LKXB 4QRRA 1MY7A 3BIKA 4WFEE 4N0YH 3RX5A 1A7NL 4BSWA 4Y89A 2YA1A 3QG7L 5CILL 5A40E 3H0TB 2E9WA 1TZHB 3NCYS 3MRCA 1TNMA 3IYLW 3IGAB 1URLA 4IIQB 2JIXA 3KLDA 4YXHL 2WLYA 5FHAL 4XVJH 5HI5C 3EHBD 1IFHH 1IVLA 3DV4A 3E3QE 4XP1L 3MYJA 4MD0B 4UT6L 3UEZA 1MCWM 3MRJB 4YHNA 1PJ9A 1Z9MA 2X7LB 1RUQL 1W0VB 1L9MA 4C58B 2BSRA 3E6HA 2A9MH 1HN1A 4N5EC 4Y5XA 1P5UA 3H8NA 5EIVA 4YC2B 4IOFC 4MAYC 5GGQL 1MJUL 2Y7QA 3V4UH 1A1MB 1JYXA 1MI5E 4GMTH 1GZPB 5F70A 1KCSL 2DJUA 3MBEC 4FQ2H 4JFFA 4UZGA 5HYEA 2BZDA 2Z92A 3BP6A 4F7PA 4K9EL 3MACH 3DX9A 4OD3H 4Z95H 2YD6A 4QRSB 3UBXG 1J8HD 4IEFB 1WIUA 1MI5B 1RJLB 3MCKA 4K94L 1MRDH 4PJAE 1AXSA 3TJEH 2A6DB 3UYOD 3KJ6H 1O7VA 2QKIB 5IVXF 5ILTH 1T1YA 5I30L 1JPST 4H20H 3AU1A 3MLUL 2OZ4A 1P4IL 5FYKL 4MAUL 2IFGA 4YDVA 1BBDH 3OHXB 2DQUL 3PGDB 3MLSL 5MP6L 1AQDB 4HKJA 5HY9B 1A4JA 1INEH 2HKFH 4E0RA 5ACZA 5DD5H 4Q2ZB 3DI3B 4XPBH 5E5UB 3TJHC 3G6AA 4LLWB 1MWAL 5I71B 5JOFB 4X9IA 2R4RH 4RAVB 5MEOB 4HF5L 3OF6A 3M17B 3ZZ1A 5IR1B 1TVBA 5DT1H 2HN7A 5DHYA 1ZXQA 5IHUH 1NL0L 4I77H 4MX7B 3OJ2C 4DUXA 1N6QL 5CIPH 1NMBH 3HCVB 3ELAT 3WYRA 2FIRT 3W0WB 1X5YA 1ZLWH 3QPXH 5D70L 4HULB 4JJHA 1NGXA 2PW2B 3B9VA 3WS6A 5FKPB 2EDJA 5JZ7D 3IDYB 4Q9CA 5J11B 4ZFFB 5BO1H 1ZTXL 1IZKA 3QDME 2W9LA 2BRQA 1QVOB 5FDWB 3LY6A 5A16A 1O7SA 2YMXH 4P0DA 1OP9A 1PD6A 5ICXB 1UXSB 1GGCL 5J1TC 3ARWA 3H9YA 4YUEH 5FUZH 2C3WA 5JOPE 2F54A 2J5LB 1CS6A 4UIKH 2JELL 5KJRL 3QR2A 2B5IC 5I19H 2UZXB 2ICEA 3I2CH 4YE4H 1NLDH 2GSGA 3LEXA 4C54A 4OCRH 3ZDYF 4FMFA 2V17L 2G60L 2LE9A 2E9BA 4IDLA 3VFGL 1NCAL 1NUFA 5E6IA 2BNQD 2ILLA 4HFUL 1P2CB 4F7TA 2MHAB 4HXAL 1CWVA 3MLYH 3W39B 3CLEL 4WU5B 4ZPTA 3RWEB 3EDFA 3LQMA 5I1EH 5IBUB 4KI5E 3QWRA 5BOZG 4WENB 4RMQA 4P2QD 5MEPB 2VE6B 3V95A 5CWSA 3SPVB 3MBXH 2OTUA 1JHLL 4OZIE 2CR6A 3X12A 1ZGLP 2VXSH 3WFDH 1MOEA 4TVPL 4XMLH 3UTTE 1YEIL 3T0EC 2FYYB 3QJFB 4K2UL 3SHSA 2R56H 5F44A 3KR3L 1AD9A 5FOJA 3OKNA 1NBYA 1TQBB 4M6OL 2BERA 4DJMA 4HKZB 1T1XB 5E4IA 5MEND 2C1OB 3X3GH 1IEBA 5DJ2B 3FAXA 3QA3B 4LIQH 3WNKA 3BYYA 4GBXD 4OZGE 5IT2L 4M6NL 4LVNB 1QFWL 4B41A 5CZXC 3HZMB 4X6CE 1WEJH 5DRZA 3O3DB 1BOGB 3RWHB 4OZGB 4EOWL 5KVMC 3TBTB 4P23B 3FT2A 5IHBA 1YYLL 3EGSB 5D7JC 3HI1B 4HS6B 5E8EA 3RBSA 2Y36H 2GTZA 4WV1A 5IW6A 3RWDB 3RRQA 3TYFB 3A6CH 1C12A 1IKNC 4PJFE 4X9GA 4D8PA 3BI9X 1RK0A 5IMOA 1MHEA 2CLRB 2FGWH 4IRJD 3RWGA 2EKSA 3IVKB 3CXHK 1XCTA 1ZVYA 4Y5YB 2B4CH 4BK5A 5B39A 1QRKA