1MCHA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 38
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA02
1TQCB 1XF3B 1FO0H 1SY6L 4X98A 3VXOB 4K3EH 5DJAA 1IAOB 5JQ6L 1V8HA 2RIKA 1KPVB 1JF1A 5JTWA 5CEZE 7FABL 1U8MB 2EYTB 3MOAL 4M62L 3IDMB 4QT5A 2NW3A 1ZKAA 5I8CA 4H0IA 2Z92B 1LP9A 1MLBA 1T20A 1XZ0B 3WFBH 2DYPD 2Y07H 3WO4C 5MEQB 1S7TA 5D1ZC 2WLZA 5LWYL 2CKBA 4GUPB 4JFPB 4POZD 2EE3A 2Q8AH 1LNUA 1L6ZA 4QRTA 1OT1A 3QEHB 4BA8A 5AYUL 2R0ZH 3OXSA 2NXYD 4FQIH 4HWEH 4N9OB 2BVOB 1MI5A 5CGTA 2HFFA 2NY0C 4IS6A 3A6BH 2P24A 5EZOL 2FX9H 1DBMH 1ACZA 5IROA 1HSAB 3C60B 1HI6B 4OB5L 5C0CD 3CXDL 5IVXB 3AMKA 1BX2A 2JCCF 1KXQE 4NIKB 4PJEB 3PGDB 4MNQB 5IM7B 4ZUWA 2GI7A 2HTLC 4KK5D 5HHVH 1CL7H 2CPCA 3UP1A 4YK4C 4P2QE 3T0BA 1VGEL 3MBEC 4HLJA 4X7TA 4H5SB 1Z9SA 2AJYL 1NAKL 4N9GB 1IGJA 1WZMA 1CFVH 3SJVB 1QBML 1IILE 2F54B 5CZXC 3EO9L 4X99B 3B43A 2WP3O 3T3ME 4M61A 3S4SB 5GS1C 2BDNH 3LKNA 1EVTC 4JFOB 3GBNL 1GZPB 3P30H 4LDEB 4LFHG 3FT3B 4HMCA 2LU4A 2PKDA 3TYFB 4Z7NF 4LVNC 5FYKU 3TGXA 4X9FA 1T7ZA 4NQVB 3PL6A 4G6MH 3VFWA 4RMWA 2PW2B 4QRQB 2X42A 2GK2A 5GRUH 3HE7A 3EJYC 1BJ8A 3TBYB 1MJ8L 3V6ZB 1U8IB 4DKFL 2IPKA 5GSVB 3VXMB 2R0ZL 5KTEL 3KWWB 1B2WL 4HWEL 3CD4A 2O26U 3SKOB 3BDYL 3TNNB 1OWRM 4FQXA 4FQHA 3A6BL 4TVPL 3LEXB 3H3BC 4LSPL 4U31A 2VLJB 1DBML 2A9MH 2C9AA 2X89A 5IP4A 1KLUA 3TIDA 1N3NA 4G3YL 4PY7B 1R5IA 5I1IL 1QRKA 4HZAA 4LPUA 2CXGA 5TFSH 4GMSL 4N8CH 3KLHC 4CADB 1QOKA 2IC2A 1VGKB 3HR5A 4OM0H 1JN6A 5D1QD 2DQJL 3WUWB 1M6OA 2ZSWA 1CFVL 4MJ6A 4WEBL 4NCDA 1I1AC 1J12A 1HEZA 2EC9U 3FFCA 1EA9C 43C9A 3BJLA 4IRSA 1B9ZA 1MOEA 3KYMB 2BDNL 4KROD 3D69A 5F7EH 2XRAH 3QPXH 1FNSH 1IGYA 1K9TA 4UIKH 4R0LB 2CMRH 1OAZL 4NQSB 5I9QC 4LLYB 1DVFC 2ZSVB 3T0EB 4JKMA 1QTYT 1KTRL 2NY4C 3KPSD 4G6ML 4AM0A 4ISVB 3I3DA 3HZMB 3ALWA 1EERB 3QPQD 4KUCD 1XIWD 1T83C 1AQKL 3WYRA 1U3JA 5BO1L 4FXGB 3TPKA 2ZUSA 5ACZA 2Q8BH 3BOVA 4YX2L 4U1SA 3AB0B 3CLFL 3U0PB 4ALAL 3C09B 5F89A 4FFWC 4LHUA 1U8HA 3NCMA 4TRPH 3L95A 3Q0HA 2NR6C 2AEPL 2A9ML 4MDJA 2MCG1 3VXQB 5TF1L 5E7FA 5MEPB 1AC6A 2HVJA 3EKCA 1OTTD 2KQNA 1JFQH 4MS8D 1RZKC 4QTHA 2OQJA 5JORB 1RU9H 1NMBH 4KUCF 4LLMB 1PKQA 4S1SL 1FSKC 2BSED 3L3GB 3Q5OA 3B9KC 3K1KC 3VFVB 5TFSL 3AAZB 1QA9A 4DKAA 3QH3B 1NJ9A 4KY1L 4ZODA 3NIGE 4U1NA 4XXCA 5KSUA 1MHPL 3DSNA 3BKYL 1D3CA 4AIXA 3JTTA 2FBJH 1A5FH 4XBEH 5SWSA 3ARWA 1NLBH 2DWEB 1LE9B 3TO4B 4S11A 1INDH 1HHKB 4ZFFB 3MYZA 1CDJA 1FNSL 2VQUA 4UQ3B 3RZCA 1PZ5B 3BH8A 4DN4L 4XPHH 1MAMH 4LCYA 4XVTH 2ZUQB 4RAHA 1EX0A 1AKJA 1OAQH 2M2DA 1DQJB 1DANU 4Y4KD 3EOBA 5I17A 5IR1A 1OW0C 1KG0A 4LLDB 1S7RA 2X1OA 5DA0B 5DHYA 2EO9A 5ITBL 2VDQL 2YWYA 3CFEB 1KCUH 1KIQA 4PJ7F 4P0DA 4DZ8A 3OKOB 5HHOE 1Z6JT 2NY2D 4UT9L 5JHDA 4FFVC 3PJSB 4E9LA 3GHBH 3DIFB 2EICA 3HAEB 3O3EB 3S36X 4TRPL 4HFWA 3HMWH 4XWOC 4YAQA 2X70B 5JW3L 4HUVA 2JIXA 4NRXA 1JFQL 3TJEH 5EOQH 2DIAA 3U46B 3N1QC 5BZWB 3WHXA 2A6KA 2ZUXA 2CLZA 3BSZH 3ARZA 1ZOXA 4JFEE 4RDQG 3WEXA 1WIOA 1CGSH 4Y4FD 1S78C 5GIRA 1YQVL 2IH3B 4NO0A 4F57L 3O8XB 1RVFH 2DM7A 4NBZB 1XH3B 1HXYB 3G5XB 2VWEE 1IKFL 1PX3A 1EUUA 4RMRA 3QIUC 5F7KC 1CU4L 3ZDZF 2FBJL 4FFZH 5C09E 5D71L 5CBAA 2E6QA 5KSBE 2VDRH 2PTUA 3QJHB 3DBXA 1INDL 4UI2A 2B5IB 4P3DA 4N1CA 4DCQA 2R1XB 5IEHA 3MRMB 5CS7A 1OLZA 1DUZA 3SY0B 1OGAE 4YZFF 5BOZG 1WZKA 1WLHA 4KDTA 1VB9A 4HULB 2CKNA 1T3FB 1X5GA 4XVTL 4OF0A 5MENB 3QDMB 1KXTB 4WWKD 2VLKB 4HCRA 3UTSA 2AKRB 3IFNH 4WW2A 4KH2A 4M7KH 5DJ6A 4N0UA 4ONFH 5J12B 1YECL 5SV3A 1KCUL 5FUCC 4GS7B 5AWNH 4G8GD 1EHLL 1KB5H 2VL4A 2VZ1A 1CD1A 5I8OH 1SVCP 5IW1A 1CXEA 5IEKB 3GMPA 4DGIH 1ZHBA 5FYKH 1EEYA 5CGYD 5TDNA 2IEPA 1SJXA 5CD5C 4G9FB 3T77B 5IESL 3UC0H 3HNTL 4CMMA 2Q87A 4BQBA 3ARBA 4JPWL 1QZ1A 4X9HA 2VH5L 3KPNA 1LHZA 5EOQL 1FGNL 3WS6A 3KDMA 4LSTL 3VXRD 2XY2A 3RJQB 3NH7H 4G5ZH 5DMKA 1IVLA 4FNLL 2APFA 3BSZL 4ONOA 1B88A 5GXBB 3RVWC 4CL7A 4C4KT 4XB8A 1CGSL 4XHJC 1L0QA 1J1XH 1XCTA 2QTEA 3LSOB 5DLMH 3WKMH 1EO8L 3P9MB 1QRNA 4FN0A 4TNWK 5DJXB 3I3BA 3HE6A 1HDMA 3MUZ1 3O2WH 5I66A 4R97B 25C8L 1FVCA 4FFZL 1XR8A 1I9IL 4LNRA 2CK0H 1J1PL 1CFTA 1TZIA 3FO1A 1JYWA 3UPRB 3QEGH 1N2RB 2ZNXA 5CUSH 1FNHA 1DQMH 2B8OT 4NM8H 2QSCH 4GXUM 2MMXA 3IDYB 1T6VN 3B8SA 1MFDH 3DETC 1MCFA 3VW3H 3G6JE 5JOFA 3SEPA 4D9LH 5CJOL 1G7JA 2PXYA 3UYPA 3KJ4C 2OR8A 1IAKA 4CVWA 2XZQH 2AVGA 1P1ZB 4LGPB 3IFNL 3KPMB 3OKLB 2YKLH 1XF3A 3VE0B 4M7KL 4OQTL 3VXOA 1IZJA 2HKFL 1HIML 3DECA 1IAOA 2JJTC 2FECL 3BIKB 1KPVA 4S10A 4EDWL 1NEUA 5I8OL 4GLRH 2EYTA 4J8RB 1U58A 3IDMA 4DGIL 3F7QA 2Z92A 5FYKL 2XQYG 2C26A 1XZ0A 2LV4A 4EDXA 4LEOB 5MEQA 4F15C 4JKKA 3DYMA 1R0AH 4PG2C 1DLHB 4GUPA 1CF8H 4JFPA 1JNNH 3H9HB 3SE3C 1FYHB 3NH7L 3QEHA 4G5ZL 4F37F 2C4FU 4GW1B 4ACPA 1TQBC 4LPYA 3UMTA 3ROOB 1F42A 2UZYB 2YD7A 2BVOA 4HXAL 4NC1E 4P2RB 4XNZC 5DMGD 1CGUA 5DLML 4XHQA 1BQLL 4CW1B 4E42B 3J8F7 5BV7H 3O2WL 3TP4A 3ARRA 3RVTC 1JYNA 4LCWA 1HSAA 1F13A 3C60A 4RWYL 5IVXA 1NFKA 4TNVK 3WHE1 1T21B 4F9PC 4PJEA 3PGDA 4MNQA 3EFDH 5IM7A 4EI5D 4Z8FH 1RZ8B 2CO7B 2AEWA 2VN7A 4HQQH 2Q6WA 2AXJA 4O2EA 5GGTA 3ARQA 1MFDL 3VW3L 3BXNB 3K8MA 4D9LL 4MZ3A 4H5SA 4N9GA 2GFBB 3EBAA 4LAQH 3L3JB 3OJ2C 3SJVA 1TTFA 4WUUD 4UDUA 2BXYA 2EE6A 3KPRE 4NHCH 1OCWH 4X99A 2J88H 4DK3A 3N1PC 3S4SA 1NGYA 5LXGL 1GHFL 5I1AB 1GZPA 1UVQA 2HRLA 4LPCA 4KVCH 3FT3A 1BECA 4JRYE 3QFDB 1AO7B 1F3DH 1T1ZB 1XF5A 4PREB 3TFKC 4N68A 1MEXH 3KLAB 4Q2ZB 3P4NB 4NQVA 4HUWB 3C2SA 1GAFL 2RAMA 1FE8H 4PYHA 1Z3GL 1J5OH 3VA6A 2PW2A 3DSFH 4TTDC 1I7TB 3EOAB 4QRQA 4YHLL 1BP3B 3PDDA 1AGDA 4X6EB 2V5SA 1T1YB 3QCUH 2DWDB 3AREA 1U8IA 3IU3B 2NQCA 2E5EA 5GSVA 3VXMA 3MRIA 5F7WC 4G6JH 5SWZE 3KWWA 3CFKA 4IMKA 2WBJC 3FQTB 1F58L 1Y6KR 3SKOA 2VMFA 5K9KB 4LPVA 4HDIB 1LDPH 2NZ9C 3HMXL 3QT2A 3LEXA 4GW5B 5I74C 5BV7L 5JR1H 1OP3H 3FB6B 5I73B 4HJ0D 3GMMB 2E27L 4PY7A 3BRGC 3LS5H 5L8KB 1OP3K 3QDGE 1B6DA 3IETB 5D96B 4HQQL 4LCCC 4OD1L 3MZTA 4CADA 2I5YH 4R96A 4R4BB 4MXQC 1I3RB 3LB6D 2XTJC 4PGBB 1CFNB 3VD3A 2DF3A 3FN3A 3RNKB 1BQHA 4TSBH 4YXHH 5L7XL 2XICA 3PQYB 3O0RL 3WJLC 5GGSB 1VKXB 1QLRB 5B4MD 3KYMA 5F1SA 1IAMA 3QQNA 4KVCL 5E2UH 3IVKB 1DCLA 4L4TD 3UTQB 3LEYH 4NQSA 4LLYA 5EBLB 2ZSVA 4P46D 1XMWA 3T0EA 2FYYB 5J13B 4R4FH 1YY9C 4BH7B 4HWZB 5HI5C 4ISVA 4WJ5B 3HZMA 3DSFL 4XCNB 1VENA 5KJRL 3S97C 1BZ9B 4IIQB 4FXGA 3EFFB 1T7WA 5CD3B 4OLWL 5EPMB 2R4RL 4NC0B 4Y16B 1KN2H 2BP3A 4LEXL 5CWSB 3D3VE 3VDCA 3LAFA 4DOHE 4U2YA 1BFVH 4LHUG 5GS2D 5JR1L 4RIRB 4HUXA 1K4DB 3EJZD 2H2PD 1YEHH 1T66D 2WLYA 4GBXC 4APQC 3FOLB 5MEPA 1NFDF 5JORA 3U7YL 4LLMA 5JW5B 4HMEA 4K2UH 3H6JA 5FYJD 3P11H 3VFVA 3AAZA 2J6EL 4BQ9A 4M02A 1J8HB 1U8QB 3QH3A 3QQ4A 1T03H 3WE6B 5CLWA 2AERT 5ILTH 1QQDB 1ORQB 1A1OB 4YXHL 5E5RB 5I1JH 3OZ9H 3EUUA 4BQ8A 1LE9A 2DWEA 3TO4A 4I3RL 2W07A 4NZTH 5K9JH 5I71C 1RHHB 1UH2A 1HHKA 1E4XL 4ZFFA 1EXUB 3F8UB 4QHLB 2XN9D 4UQ3A 2MQCA 5E2UL 1YEIL 2P44B 1PZ5A 5ELIA 5DEFB 4P23D 4K7PH 2K7PA 2F74A 5IMLB 1QPPA 1BMGA 4ZS6C 1DQJA 1OAKH 4TOYH 4NC2B 5FOJA 1P5UA 3QFJD 1MCOH 2W1NA 3D85B 4QKXB 3DUSA 1A6VL 2X1XR 3CFEA 3F7VB 4WY7H 3IFOB 5FAAA 1KN2L 4XPAL 3DVNB 3IF1B 5IVOA 5I75B 3OKOA 3SOBL 1CDUA 4M1GH 3LIZH 2V6HA 1IM9B 3PJSA 5GISH 3DIFA 3HAEA 2K7QA 4YHYB 4NWTH 5F70A 2EXYC 2X70A 4YBLC 3VG9B 4EQ2A 3F58L 3U46A 4PJCF 5BZWA 2NX5D 4C59B 2EDLA 3B5TA 1RPQA 4K2UL 4XNMB 2A6DB 3ISWA 2D0HA 1A1NB 2WBKA 3H0TB 5DWUH 2V9QA 4H1LH 2XWBB 3TYGL 2IH3A 4P4RB 1GGUA 3O8XA 3WNKA 1HXYA 1XFPA 3BKML 3G5XA 1JP5A 3SDYH 1FL3B 4RWHA 4GXVL 1JWMB 3TZVB 1UJ3C 3MLYH 4I2XE 5BQ7B 3FQUA 5F9WC 1RUMH 2Y6SD 4WO4D 2R9HD 3QJHA 4LARH 1TCRB 2QKIB 4POZC 3VU2A 3C6LD 5D7LA 4MCZB 1IEBB 2R1XA 2Z91B 2X4QA 3L3OB 3GHEH 3MRMA 5E9DB 3F7RA 4M5ZL 4LLQA 4K7PL 2YUXA 3VWJD 1T3FA 1D9KB 5MENA 1MCIA 3QDMA 1IC7L 1C1EL 5D8JH 5AYQA 2VLKA 5TGBB 5IHUL 1V3LA 2V7NB 2AKRA 2NZIA 4YGVA 4YH6A 1CR9H 1G1CA 2I07B 3DURB 2CGRL 4J4PD 4PB0L 5T3ZH 5KVFL 1UXSB 4OLZL 1CQKA 2B1AH 3SGJC 4KK5C 1QFWI 5HJ3B 4AQ1B 3LIZL 5INCB 1E6OH 5IEKA 5E24E 2AJSH 1S7SB 1IGCH 5KSAC 4GRWE 5D7KD 4G9FA 3T77A 4OZFH 4HG4K 4JDVB 5KANI 3H2WA 5DS8B 3O9WB 1T04A 3H3PH 2MKWA 3ECBB 4LU5L 4L4VA 3HC3H 5DWUL 1H3PH 3S35H 3RGVD 5DJ8B 2R2BB 2P5WE 1N6VA 3LV3A 5DJXA 4PY8I 4E0RB 3MLYL 4PJ9D 1HZHL 4LARL 5JA8B 1OY3B 4IRZL 2FIKB 1NGZB 5IB2B 4QHKI 3N50A 1WBZB 2YPVH 5E5UB 3UPRA 1N2RA 5HY9B 3S98A 4XPTH 5I30L 1YMMA 3RDTD 1HINL 5BRZE 2BX5A 2EDNA 1NFIB 1R5VB 5D6DC 5TDPB 2FJHB 2JJVA 4KHXL 5BW7C 4FQPA 3HC4L 2ADJA 2XOTA 1EHXA 5INDB 1P1ZA 2LVCA 4WW1B 1CR9L 1FNEB 3KPMA 1MCDA 1UADC 3MV9E 1YN6A 4XP5L 5T3ZL 4RGND 3BIKA 4LLUB 3RY4A 1WWAX 1BZ7A 4J8RA 3NPSB 2QHRH 1YNLH 5E94B 4EQ3A 2BVQB 2ERJB 2DAVA 3SDCB 5D1QC 3QO0B 1OWWA 2HKHL 4RMTA 4LEOA 1MCPH 4IRJB 4WTZA 5JZ7D 2ZUVA 1DLHA 2NTSP 3IRPX 1IC5H 3H9HA 5BOPA 5E2VH 1INEH 4JRXE 4LSDA 3TN0D 4KROC 4GW1A 1MJ7H 2YXFA 5HDBE 3ROOA 3HC3L 4KI5D 1C5CH 1H3PL 3W5NA 1EGJH 4ZNEA 1RURL 4D9QE 2DL9A 5HGHB 4CW1A 4E42A 3GUTB 5EA0H 3PXJA 3HCVB 4XMPL 1VFAB 2B4CH 4GW4B 1YC8A 3MLVH 3MLZH 1F4YH 3X3FH 4G9DB 1TJHL 4FTVE 3N9GH 1G1YA 3QPQC 1XIWC 5CILH 3JV5A 3DJ9A 2CDFB 4KUZH 1YDPA 4XPTL 4NNYB 5ISZE 1NBQA 1I85C 2UWEF 3BXNA 5K9QG 1CDCA 4KI5F 2FDBP 1DQDH 4M8QB 4P5KA 3BKJH 3L3JA 2OMNA 4R2GB 5IVZB 1BREA 3QDHA 4LVHC 3VXUD 3WFEL 2GSIB 1IE5A 1YEGH 3DMMD 1PLGH 1G0YR 2N4IA 1TCMA 3S4SG 5I1AA 4MS8C 3WS3B 2W38A 1T89C 4LSRH 3RUGE 4PJBF 3L1OL 1QBLH 1UM6H 3QFDA 1AO7A 1UM4L 1T1ZA 3H9YA 4PREA 2QHRL 3GM0A 4JFHE 2OL3H 1DUYB 3NCCB 1JYXA 4O58H 1W72L 3KLAA 2KPNA 3P4NA 4NZUH 4Q2ZA 2H32H 2NXZB 4Z7WB 2HT2C 1MCPL 4FZ8H 1S9WB 4DGVH 1ITCA 3EOAA 4MJIE 4LBEB 5D5ME 4OZIF 1CGXA 3RBSA 1IC5L 5EUKB 4X6EA 1UEYA 4JY4B 2DWDA 3IU3A 3RTQD 3RZWA 1IAIL 1C5CL 1JZ8A 3ZSTA 3E2HC 3FQTA 4OD3L 2COQA 2VQ1B 1VERA 1OAYH 1VDGA 5K9KA 4HDIA 3SKJH 2AEIT 4GW5A 4K7PY 5EA0L 3K80A 3BPOB 1UKSA 3MV8B 3MJGX 3REWB 1M7XA 1RJYB 3FB6A 2B4CL 3GMMA 4Y4KC 5F1NB 5KVDH 1V5JA 4W68A 1DFBH 3GMRB 2MNUA 4LDOB 3W9EB 4RGOH 3OWEA 3IETA 3QIBD 4KUZL 1CCZA 4R26H 1T0NB 3IFPB 2NY2C 4FP8H 4HUMB 4BZ1H 4R3SB 1G9MH 1I3RA 3WUWG 5F9OH 1LE5B 4PGBA 1CFNA 4H88H 1LO2H 3MXWH 1YEKL 1MCSA 3KXFB 4N90E 4NQCD 1J86A 3OX8B 2IF7A 2DQTH 2D9CA 2HRPL 5FYKD 3MGAA 3PQYA 3NCEB 5GGSA 1VKXA 3AY4C 1K8IB 3O4LE 4KV5E 4C56D 3VFMB 4WHYH 1U42A 3WIHH 4LSRL 1MFEH 3LDBB 3IVKA 2YRLA 4YEEA 4ZNCD 3FQWB 4DQOH 3X17A 2ICCA 3T04D 5EBLA 1I8KB 1EEQA 4MD4B 2V17H 1F45A 5DMJB 2FYYA 1W0VB 4PV9B 1IZKA 5KS9E 1CGTA 1MFBH 3W2DH 4BH7A 4HWZA 5EWIH 4WJ5A 4AT6B 4FZ8L 1RY7B 3PWUB 4XCNA 2VAAA 4YIQA 2V5MA 4NYLB 1BZ9A 4IIQA 1KGCE 1W0YT 2Y25A 3GMOB 3QUKB 5ANME 3IKCB 1NGWB 5MEOB 5CD3A 5EPMA 2ARJQ 4Y16A 1BGXH 5T5NF 4GRLD 5D7IE 3QEQD 2X10A 3TA3D 2QJDA 1XCQB 2FO4B 4ONGH 5CWSA 4UZGA 3DROB 1CDHA 1BD2D 3T2NL 1RUPH 4JRWA 3SKJL 1KFAH 4NQDB 4PJGF 4RIRA 5FM8A 1K4DA 4JFDB 3PV6B 4AYFA 4WWKC 4TNWF 1GSMA 3L5WB 5HHNA 5FGCB 3FOLA 1B6UA 5IB5B 5FM5M 1W72B 5KVDL 3FFDA 3FTGB 5JW5A 1A0QH 2DLHA 3BYTA 4ODSH 3RGHA 1F4WH 3MLRL 4Z7UE 4J3VA 1NUFA 4S1DC 1FH5L 1NL0L 1WC7B 4R26L 2VZVA 4CN1A 1XGYH 4HX1A 3HUJE 1J8HA 4KTYA 5CJXA 1U8QA 2V7HB 3VCLB 1G9ML 3LKRB 5EO0B 1MRDH 1KYOK 5F9OL 3QUXA 5CGYC 4H88L 3HI6L 3MXWL 2IBZY 1ORQA 1A1OA 4RFOH 2JELL 5TH2B 4HBCH 1Q9OA 5SX4H 4Y4HB 1RHHA 3UXFA 2A2QT 1EXUA 1KTDB 2HWZH 2XWJB 5AD0A 2IANE 4QHLA 1G9NH 2FX7H 4PJXB 4WV1C 1MFEL 4HWBL 3VXTB 3C5ZB 3QZWB 4JFYB 4DQOL 5DEFA 3ESUF 4FMFA 2P8PB 1AGCB 1C08B 1JV5A 2W60B 4YUEL 5IMLA 2XZCL 1WJ3A 2WP3T 2DM2A 4JKPH 2EDKA 4OLXH 1TXKA 3BVNB 3QUML 2F5BH 4U7KA 5C07B 3G5VB 4M7LH 4GG8B 4PJAF 1B0RA 5E6YA 4KTEL 3F7VA 1MVUB 3IFOA 4M4PA 3DVNA 2C5DC 3IF1A 4NFCA 4JQVA 1NCWH 5JIHA 4ZO8A 1A4KA 2ZUTA 5DURD 3HAEG 1FNAA 3MX0A 1TPXB 3MLPA 4GMTH 5DJ0A 2V2XA 1UWEL 1OSZB 2ZPKH 1JVKA 3RNQB 3ULSB 1RFDL 4PJHB 3MUHL 3VRJB 4TNVF 1GOGA 1U8PB 1A0QL 1BQUA 5DD6B 4XNMA 1K3IA 2A6DA 2OM5A 3D0VB 4HWUA 1A1NA 3H0TA 3L6FB 5FA4B 3SDDB 2XWBA 1XGYL 2A6IB 1REIA 3NZ8A 1WAAF 4P4RA 2VIRB 4L3CA 2VZTA 1BEYL 2X89D 2EDEA 3WXVL 3QHFL 4MJ4A 1O7SA 1JWMA 4RFOL 2DDQL 5BQ7A 3GSNH 4JDZA 3IAPA 5FDWB 1YEJH 2J8UE 4XPFL 5EOCL 4QRPD 2DQCH 4HS8L 3WFCH 2FX7L 4P2YA 4XAWH 4MCZA 3S35X 3TBTA 1IEBA 1BVKB 2Z91A 3VFRB 5BMFH 3BPNB 3QNYA 4BZ2L 5E9DA 1JGLL 1NBZA 1D9KA 4PJFB 3LCYA 5DMGC 2JB6A 1XGUB 4M93B 1IQWH 2Z8RA 4JKPL 5TGBA 5I1LB 2VLRE 3OB8A 4AL8H 2V7NA 4IMLA 2CH8A 4WEMB 5K9QI 2I07A 1Q1JL 4O02L 5B38B 1URLA 4M7LL 2ESVB 4RGMC 4MLSA 1UXSA 4XP4H 5L2JB 4MNGE 4L3EB 4EI5C 2WUBH 3KYAA 3U4BL 3ARTA 3PDOB 2GTZB 1NKOA 4M6OH 5GSRB 5INCA 3DWTA 4JKWA 1S7SA 1NGPH 2IBGA 4HT1H 4L9LC 5DUPH 2HJLB 4RFEB 2BNQD 4U0RB 5DD3H 1CIUA 1ACYH 4NO2B 4WU7B 4JVUA 5DS8A 1G6VK 3EO0B 1CTNA 3RIFK 3BUTA 3ECBA 3QUMB 2XQBH 1TNNA 2R2HA 3LKOB 5DJ8A 1EFQA 3ZKQD 2BMKB 3D39D 5FYLH 4HK3J 4PUBH 1AIFA 2R2BA 3GIVB 5I1HH 5FKAA 1N6QH 3V79C 4E0RA 4Y5YC 2QQNH 2E8ZA 4AK1A 3GNMH 1YEJL 3IJSB 4MAUH 5CSZB 5IB2A 2FIKA 1NGZA 2DQCL 4PJIB 5D2LE 3ULVE 1WBZA 5HY9A 2VUOA 5GRXG 4TPRL 3CSGA 5DRNB 1NCBH 1WUNT 3G5YB 1FCCA 4HF5L 4XWGL 4JFZH 1NFIA 1R5VA 3ARGC 2XA3A 1ROWA 3RA7H 2FJHA 1IQWL 3B9EA 2PYED 2WIMA 2WUCH 4GG6F 5INDA 1MQKL 4KMLB 4AL8L 1FPTH 3MBXH 4WW1A 4BZYA 1BVLA 3GFUA 3VI4F 4YDJB 4YHIB 3MLUL 4OGAD 5TPWL 3MLTB 4HJ0C 4K8RH 1IM3B 2DM3A 3MUY1 4OZHE 2EYSB 4XP4L 3BQUC 5IG7B 4LLUA 1FIGL 3V6OA 2WUBL 3MROB 4H8WH 1PFCA 3RU8H 3KHOA 1UKTA 3G08B 4R8WH 2DQDH 3N0PB 5KVMC 4M6OL 4ZXBB 2R2EB 5E94A 2CR6A 2BVQA 3SO3B 1NGPL 5IFAH 3SDCA 4PJDB 3QO0A 1F3DJ 4URTB 3LB6C 1Q9LB 1A3RH 2ENYA 4PBWD 4GRMB 5EORH 4IRJA 5HHMD 3ZT7A 5JOPE 4EIGB 4WTZG 5F7UA 2B2XL 1ACYL 5L2KB 4NKDB 5JHDD 4YDLC 5B4MC 5ETUA 1NGXB 2NNAA 3EOYG 2XQBL 5B39A 1IGIH 1J9CT 4N0FB 4FQ1L 1FJ1B 1YYLH 3B4NA 3P9LB 1BFTA 4PGZA 4P46C 4PUBL 4OZGE 2AK4D 5HGHA 3GUTA 1AD0A 1JPST 5DVOA 4WHTB 4Y1AE 3HCVA 2RJMA 2G60L 2IQ9L 1N6QL 3P0VH 5C0BD 4Y8AA 4GW4A 2BC4B 2FJGB 2ZKHL 3P40A 2GTWB 3O4OB 4G9DA 4NZRH 1E6JH 3S88H 2W9EH 5GS0H 4OF3A 2CDFA 3RWFB 4HK0B 4NO0D 4NNYA 1F00I 1DL7H 1NCBL 1QSED 5EZIL 1AGFB 1KNOA 5DVMA 3ZYZA 3Q1SL 1ODAA 5CIPB 5HYIA 4JFZL 5ESAB 4M8QA 4YBQC 4PYGA 1AP2B 4Y0GA 3T3PF 3RA7L 5F7LB 4JQIH 3UROR 3IDXH 5F97E 4B50A 5IVZA 2FR4B 1RUKL 3QUZD 4F3FB 1L9NA 2H2PC 3N1MC 1OSPL 1T66C 5HYJE 4XH2B 4K8RL 4Q9QH 4WUKH 3PG2A 1KPUB 5FGBC 2IADB 2C1PB 5T3XE 2XZAH 4KQ3L 3RU8L 4NQED 3ARDB 3JWOH 2DQDL 5IHZB 2O5YL 4X6BA 2FEDD 5AZEH 4K3HA 1DUYA 4JEGB 1UB5B 4WDIB 5CEZL 1KULA 3UTSD 1YNTA 5DFTA 5ICZB 4Z7WA 1IFHL 1QFHA 1S9WA 4Y5VC 5IQ9B 4LBEA 3GZKA 4OTXH 3VFUB 2VNCA 5EUKA 4GO6B 4JY4A 3FN0H 2D0FA 4DTGH 1OPGH 4PRHB 4EVNB 5IGXH 4ELMF 1YYLL 2VQ1A 2J8HA 3LS4L 3ZYIA 5E00B 4LPWA 1MAKA 4FFYL 3WO4B 4NPYB 1GC1H 1UT9A 4HIEB 5D1ZB 3REWA 5JNYB 1RJYA 2GITA 2RR3A 1CG9B 1NPUA 5M95B 5F1NA 2O5XL 4P3CL 4NZRL 3S88L 3GMRA 3W9EA 2Y06H 4JRYA 4Z7OF 5GS0L 4PLJC 4BFBD 1ZSDA 4FQQB 5T3ZD 2DB8A 1T0NA 3IFPA 4R3SA 2NY0B 2DMBA 4QOKE 4NQXB 1LE5A 3IDXL 4S1QH 4J1UB 5IWLC 5C92A 1JTTA 3R1GH 4X6DF 2HJFB 3ZKMD 3OX8A 1UGNA 1PEWA 4KXZH 1CXKA 5LGHH 1FCGA 5T1KB 2EE2A 2FB4H 1MY7A 1IC4H 3VFMA 1L7TL 3TIEB 5B8CC 1BIIB 3WD5H 3QQ9D 4YK4B 3FQWA 4LRNL 4NN6B 2VTFA 4KJWC 2MCPL 5FGRA 4HLZG 1I8KA 3MBEB 5GRVK 2D0GA 2ICWJ 1W0VA 4PV9A 3MCG1 1C5DB 4AT6A 1K4CA 5DJZB 3RWIB 3PWUA 2BHUA 1WICA 4DEPC 4NYLA 3MV01 4ZPTB 3GMOA 3QUKA 2PF6A 5GS1B 5ACLA 2Y6SC 1NGWA 2OTUB 2R9HC 4WO4C 5MEOA 3C6LC 3AS1A 1I4FB 1XCQA 2FO4A 4EOWH 2D03L 1EO7A 2EDOA 3EYQD 3DROA 4FRWA 4LVNB 4QYOB 2P42B 1KACB 3LN4B 2HTKD 4MA1C 3VWJC 4NQDA 3W11D 1GC1L 4PPTA 4JFDA 3PV6A 4WI5A 1OHQA 3RVUC 4XCYA 1A21A 4G6AD 3TV3H 5IB5A 5C6WH 1W72A 4O5LL 2QV2A 3FTGA 3P0YL 1OP5H 5DR5H 2G75B 2P4AB 3TT1L 4HIHB 4UB0L 3UTTD 2ARJA 4ZUVB 2DIJA 3NZHL 4CN4A 5EU6D 5DEZA 3L5XH 3IJYB 4P57B 1AH1A 3DXAB 5FKPB 2V7HA 1OP5K 4M7JH 2R2CA 3VCLA 3LKRA 5EO0A 4LCWD 3BEVB 5GRYA 3AS2A 3SGKC 3VWKD 2CSPA 4FZEL 2KL6A 3R1GL 3U36A 5TH2A 3QQ3A 3RWHB 3O6FC 5D72H 4Y4HA 5GRVL 3C8KA 5C70A 3NACL 1KTDA 2V9TA 3TPUB 5IBLD 4OIIL 3DLQR 3VXTA 3O6MH 3C5ZA 2OLDA 4Q9CA 1UYWH 1C08A 3GKZA 3RGVC 3BN9C 1MLCB 4JREC 3V4VL 1H15A 2ITDA 1I1AB 4XT1C 3BVNA 5C07A 5DMYA 1A7NH 2D7TH 3G5VA 3H9SB 3MRGB 4GG8A 4MWFB 4PJ9C 3RJDA 4EN3A 1WVZA 2ZWLT 4R7DB 4JLRB 1MVUA 5FCUL 2YD2A 5C08E 4M43H 5CCKH 1BJMA 5E4EC 1JNHB 1WBXB 3JXAA 3QIWD 3CPLA 4YR6B 5I9QB 3U2SB 3CFBB 1A3QA 3OGCB 3RDTC 1P9MC 1GGIH 1IBGL 4XVJL 5BVJA 4YDKL 3RNQA 3ARED 3ULSA 2IGFH 4PJHA 3CK0H 5T1MB 5I1CH 5DR5L 1U8PA 1GVIA 5DD6A 5EN2B 4RGNC 3D0VA 5FA4A 3SDDA 4YHPA 1D5XB 2A6IA 4RMQA 2VIRA 2E7LC 2AQ2A 3CZFA 3GSOB 3MREB 4ZD3H 3SQOL 4JPVL 4DUWA 3K74B 5CJ8A 2ZCLH 5FDWA 3F12B 1RUAH 2QQKH 5JZ7C 3BWUC 3LHPL 3PWJB 4JM2D 4U49A 3KYNB 3B9KB 1BVKA 1WF5A 3VFRA 3QDJB 3TN0C 1GZQB 1KBGL 3MACH 3NCYP 2DJSA 4N8VB 2VISB 4Z77B 4JGMA 4KI5C 4WI7A 1ZEAH 1MPAL 4JHAL 5JIIA 4PJFA 3QI9A 2JJWA 1XGUA 4NJAL 5FOBB 2YK1H 4OM1L 5I1LA 2ADGB 3FT4A 4PJ5E 1RIUL 2I25N 5B38A 2OR7A 2D7TL 2ESVA 2FHCA 5I1GH 1TDQA 1OQXA 5L2JA 4UOJA 4L3EA 4HIJA 5CCKL 4JM2F 4NCC2 2HLAB 5DSCB 3PDOA 2GTZA 4QRRB 5IFHL 5GSRA 3KYKL 3FL7A 3MRFB 2Y5EA 5H37H 1KJ3H 2E9BA 2I26N 1PGRB 2HJLA 1M1SA 2I9LB 3QAZC 3SDXE 1AJ7H 4FG6D 2JLLA 1JPTH 2ENSA 4PTUB 4E41E 2IGFL 4WU7A 3RAJH 5I1CL 3DMMC 3EO0A 3BZ4B 3MNWB 1G0DA 1MQ8A 1LD9B 3CU1A 5EC2B 1IGFL 3IJHA 1JGUH 4ODTL 3LKOA 2P5EE 5F3HB 1HKLH 2BMKA 1TTUA 1OGTB 4X8JB 3STLB 1ZGLP 4ONHB 3VXNB 2P49B 5CFHA 1LP9E 1YPZE 1JI1A 3BUYB 3IJSA 5LBSL 4D9RD 2FGZA 5CSZA 2FECI 4PJIA 2XXCB 1LO5B 4QXGH 4MSWA 5DRNA 5IF0B 3RTQC 4NBXB 4MA7L 3G5YA 2EKSA 1M7DB 5IJKC 1F6FB 2YPLD 5FHBL 4TULH 4AMKH 1MI5E 2IPTL 5DRZB 1I1YA 1BWMA 4A6YH 4Z7VF 3BZEA 2EH8H 1JHLH 3GEWB 4YDJA 4AG4H 3FCTB 3MLTA 1IM3A 5I1GL 2EYSA 1K5NA 3OV6A 4XI5D 5IG7A 5IBUB 5ECJE 3MROA 1N4XH 3QIBC 3T0XA 3G08A 2ARWA 2XPGA 4OLVH 3K8LA 5E1AB 5E8DH 2AS5M 4ZXBA 1AE6H 2R2EA 4G7VH 4OCRH 4PJDA 4FS0A 1Q9LA 4GRMA 1AJ7L 1JPTL 4Y19B 2PYFB 2B1HL 5L2KA 5TQ0H 4NKDA 1G6RL 1DBJH 4LDLB 2VOTA 3GMNA 1NGXA 4UT7H 4O2CB 3MUJA 3M1BB 1S5HA 3MJ9H 4RZCB 4N0FA 1JHTB 5DVLA 1FJ1A 1A6ZA 5DJCA 3GB7B 4MD5B 1U3YA 4QXTB 4DVBB 3E3QE 4WHTA 3ZL4H 1ED3B 2OZ4L 1IEHA 4XB7A 1QSFD 1N59B 4DZBB 1I8MA 2BC4A 3OB0K 1PZUB 2HVKB 1Q72L 1EMTL 3FHQA 4J3SA 3HZYB 3RWFA 4HK0A 4GLRI 4GRLC 2HN7B 3TA3C 2PO6D 2CO6B 5DFVD 1F6LL 1OTUD 3PWVB 2FR4A 4QHMA 1CE1H 1AHWC 2QR0B 1MIEH 1JHLL 1P4LB 5EOTB 5TE6H 5D7LD 1Q8MA 5C7XH 4XH2A 3MRHA 2AV7B 2R1WB 1KPUA 5M94B 2J5LC 2IADA 2C1PA 2VE6B 4JAMB 3ARDA 3K0WA 1AE6L 1UB5A 4WDIA 3KJ4B 5F1KC 5ICZA 3UTPE 4WFEE 1JHKL 1I8IB 2A9NH 5IQ9A 1U8KB 3MLSL 4R4ND 2VZSA 4NRZB 3ALPA 3MXVL 1YNKH 3VFUA 2N7BA 5KSVB 2R4SH 2ZG1A 3FFCE 3MV7B 3MFFB 4YC2C 1FYTB 4PRHA 2GJ6D 3V4UL 4KZDL 4EVNA 3MOQA 4OLUH 2X40A 1S9XA 1FZKB 3T65B 2F53D 4NPYA 4F15B 2HFGH 1R6VA 4HIEA 4QRUB 3ZL4L 1KTLB 5D1ZA 1A7RH 2R29L 1NCDH 1QBBA 5JNYA 4DW2H 4KRLB 1CG9A 1A7BA 3NVQA 3IU4L 4QHUB 4L4VD 2UY6A 4M1DH 2CRZA 5C0AB 1NC4B 5BV7C 1TQBB 4FQQA 4TUOA 2I9TB 1AY1L 4CKVX 2IG2H 1KYOJ 3MTRA 3IDGB 1Z0NA 4XNZB 1X4ZA 3MRKB 1G6RB 3PABB 1HILB 4NQXA 3TESA 3PL6C 4NJ9L 1J10A 4MJIA 4J1UA 4MXWL 2HJFA 4HPOH 3O2VH 4O00A 4OCWH 3HG1D 5T1KA 3DUHA 1BZQK 4P9ML 1YMMD 3TIEA 4K23H 1BIIA 5EOCJ 3RWEB 3B6SA 3SCMD 5JDSB 4PB9H 5DJYB 1PKQE 5EIVA 3SDAD 1KLGB 3MBEA 3Q48A 5CJQL 2OR9H 4X83A 5B22A 3FAWA 2J3SA 4DKEH 1C5DA 4DVRH 1FG2A 5DJZA 5HTSA 3RWIA 2X1QA 3V4PH 1GGBH 2FATH 3QG6A 5FYLD 1YNKL 2BSRA 3MQIA 5GS1A 2OTUA 5SWSE 4GAGL 4AEHH 1RZGB 2OS7A 3RIFF 1Q94A 4F7MA 3D87B 4QYOA 4X9IA 4OLUL 5EZJB 3LN4A 2DQEH 4ORZC 1FLRL 4K3DH 4RNRB 4ETYA 1NAMB 5CZXD 1EZVY 1JGEB 3B2VL 3ES6B 5GZND 1NCDL 4DW2L 3RWGA 2R0WL 4IRSC 3VXSD 1E4XI 1HWGB 2I24N 5F21B 4UV4L 2G75A 1HYRC 4M1DL 5HGGS 2FZ3B 4HIHA 4ZUVA 4KPHL 4WFHE 4ZPVB 3IJYA 2WBJB 4K8RD 3DXAA 5FKPA 1WEJL 5GPRA 4Z95H 1HN1A 3WV0A 2VDMH 5I1DB 3V52L 2ZP0T 2BRQA 3KPQB 3BEVA 5I74B 3IDUA 3ZKND 3GO1H 2V2WB 4NGHH 3WSQL 5JXAH 5KZCB 2BY1A 4HPOL 3OL2A 5A16B 1J8KA 4YNYA 3RWHA 4HS6A 2YPKA 3TPUA 1MRCH 4MCYB 4OV6F 4K23L 4LCCB 3GRWL 2H6PA 5GGUB 4PB9L 3QZWG 2FSEB 1SM3L 2VXTL 4LSUL 5L9DH 4M7ZC 1D5IL 2XTJB 3WNPA 1MLCA 5EUOF 3BP4B 1ZS8A 1KT2B 2V5YA 4RAUB 4YHMH 4DVRL 1I1AA 4TSCL 2KQMA 1T4KB 2VXSL 2DIBA 3BWAB 3H9SA 4MWFA 3MRGA 4UQ2B 5FHAH 3BD3A 4UU9B 2Z35B 3HFMH 4JLRA 3GDBA 3IAQA 1KPRB 5EC1B 3IXAA 3ULUE 4Q0XH 1B0GA 5DMIH 3WFHB 1JNHA 2IPUK 2DQGL 4TSAH 4YR6A 3RVXD 2XWTB 3U2SA 4HGWB 3CFBA 4EZMA 5BCAA 3QA3B 4LK4A 3LH2L 2XI9A 5GS0D 2FX8H 1S8DB 1ZK9A 1P7QD 4K3DL 1KTKE 3T2OA 4F2MA 1T83A 1JZ6A 4P2QD 5T1MA 4NRYA 1NUNB 4OGAC 4RMSA 3CFIC 1IGML 2FWOA 5CKAA 3RZCC 1X5XA 5EN2A 4N0UE 4BK4A 3OKNB 4HKJA 2JKXA 4JFFB 3PWPB 3VFNA 1DVFD 1D5XA 1YY8B 4H26A 1A9BB 1QO3B 2NY4D 1HHGB 4UOW1 4PP2A 3GSOA 4JN1L 3MREA 4X6CB 4PBXA 5F96H 4APQB 4GBXB 4BFGA 3F12A 2AJUH 4IDJL 1A6AA 4X5WB 3PWJA 2EH7H 2ADIB 3VA2C 3ZHDA 1YYML 3B9KA 3P4LA 3MRDB 1LILA 5LGKA 1GZQA 5F7DA 1RJCA 4N8VA 1EBPA 4Z77A 2VYRE 5L9DL 5JUEL 4JZJC 5BS0B 2D4DA 2ADGA 3T3MF 2IH1B 4QCIA 5FUZL 4N1HB 5F88B 4F7PB 2ATKB 4WTWA 4O4YH 5I0DA 5B38G 1QRNE 4XGZB 5FHAL 4Z18A 1RULL 2D2OA 4Q0XL 4JFQB 2WAHA 3CVIH 3DX6B 3M8OH 3FO9B 2HLAA 4Q9RH 4RAVA 5IV2B 4QRRA 4XMLH 3MRFA 1KJ2H 4XNXH 4JHBA 2FHBA 3Q6FB 3TVMD 2FX8L 1F11B 4DFHA 4AEIH 4B7LA 4EUPH 2I9LA 3NFSH 1GYAA 3CVHL 4GRWH 1OW0A 4WCYL 4MA3B 5F7FA 3QUZC 4PTUA 2R1YB 2X4OB 1F4AA 4V1DB 4OCSL 5D93C 4FABH 2QSTA 3A6CL 3V95A 3O3BB 2OMBA 3MNWA 1LD9A 5EC2A 1QLEH 2X4TB 3C2AL 3NCJH 1QFWM 2W9DH 1TIUA 4KDTC 4MXVE 4E5XB 3EGSB 5FA3B 5F3HA 1JRHL 2FEDC 1OGTA 1RZFH 4X8JA 2RGSA 3STLA 4ONHA 4Z0XA 4KHTL 3GJFH 4NNXB 3VXNA 1YC7A 3BIBX 3KPOB 4YBLB 3I6GA 5BJTA 1MWAL 1CICD 4FQCL 1CZ8H 2X44D 3BUYA 3G6DL 4H25B 5FDYA 1CLYL 2IFFL 2B39A 5T1DH 3ROLB 3VFOB 2NTFA 3KJ6H 5ICXB 2EH7L 3GJFK 4UTAH 1LO5A 1MCWW 4GAYA 1KCRL 4P5TA 5KAQG 4X7SH 5FCSH 1J8HD 5IF0A 2ZOKB 3LKQB 3QUYA 5EG6C 1LQSR 1M7DA 3UO1H 3NPZB 3QUXD 4ZOBA 3W9DB 2ITCB 5EU5B 4XWOD 3CDGB 4N5UA 5FECB 3FB7B 2DYPB 4X4ZA 2EDQA 1OB1B 2JCCB 4ZTPH 2PNDA 4X7DC 2X4NB 3C6SB 1MHHA 5IVXE 2X09A 4OBSA 1B4JL 1ES0B 3IGAB 3MRJB 3TM6A 4PJEE 2C3VB 4XP1H 4MNQE 5E1AA 2NXYB 2WIIB 2AJ3A 2YXMA 4OGXH 1ETZB 4AJ0A 4D0CB 3QIUD 5GHWL 1OARL 4W4OC 2Z8WC 3NFSL 3QULB 5D2NC 4WU5B 4Y19A 5BXFB 5AZ2L 5AG9A 2PYFA 4YXKL 3DV6B 3FMGL 5C0CB 1AR1D 2R8SL 3SJVE 5D70H 3ZKMC 1IARB 5IB4B 1UACH 3GSUA 1QNZL 4O2CA 1R3IL 2A0LD 3M1BA 5HPOA 1LO3H 4RZCA 2EIDA 1JHTA 4MGXA 3QQ9C 2Y7QB 3G5ZB 2IALB 3GB7A 1F8TH 4QXTA 4DVBA 5EFIB 1H3UA 1ED3A 1VFBB 3QNZB 1N59A 1XGQB 4DZBA 1TQCC 3HI5L 3Q6GL 5E2JA 5E2WL 1FNFA 5IW3A 3ARFD 5T5FH 4WNQB 2HVKA 1FC2D 5DYOA 3X12B 3I6LE 4J12A 3HS0A 3LZFH 3PGCA 1O0VA 1NGQH 4X7SL 3NIGF 2AJZB 2HN7A 4LP5A 5ID1B 2Q20A 3VXME 3KPPA 4KRPD 3EYQC 3V8OA 3BP7A 4G7YH 4EEEA 3OJDB 2D7PA 5DT1L 3PWVA 4CRPA 3I75B 2HTKC 4P5MA 4N0CD 3W11C 3MRNB 1RV6X 5HHOD 4ZTPL 1NCCH 1P4LA 5EOTA 2UV3A 2VLJE 1HSBB 4G6AC 2AV7A 3QRGH 1D6EB 2EECA 5D7JA 1RD6A 2R1WA 4GSDH 1MREH 1IAII 1MWAB 1GGYA 3NABL 4NOFA 4XHJD 1U91B 4JAMA 5L6YL 4CVZB 2V5RA 3X3GH 4MHHI 4X4YB 1XGPA 3SHSA 5D6CB 4HIXL 4HZLB 3MZGB 4DJMA 1FQ9C 3K4ZA 1I8IA 5ENWB 1U8KA 3HZKB 4NRZA 4JFED 2P47B 4LSQL 1ZT1B 1AXTL 4J6RL 1MCRA 2GK0B 4I0PD 3EYUL 2JJTA 5F7NC 1QG3A 3MV7A 4XNUL 2AABL 3FZUD 3MFFA 1FYTA 1N0XL 3NGBB 3OAUH 4LPXA 5IBLC 5I2IB 2QSVA 5GGRB 3W0WA 5C09D 2Z93A 3MOBH 2OBGA 5E8EB 5D1QB 2YZ1A 4U6YB 4QRUA 1KTLA 3T0EE 1T5XB 1X5JA 5HVGB 5E56A 5T5FL 5ADOL 4XCFH 4LIQE 4KROB 3L5HA 1NGQL 3S37X 4PS4L 2RB8A 2X4PB 3GI9L 3PGFH 2I9TA 4F9LC 4KK6C 15C8L 2B4CC 3IDGA 5C8JA 3QIWC 3MRKA 1GPOL 4XP6H 2KKQA 5KSBF 5ALCL 4HJJH 3PHOB 3KPSB 4TUKH 1NCAH 2YUWA 5I16B 4NM4H 4OFYD 5EU7C 2YA0A 3WCYA 4HC1A 2K1MA 1HOCB 1XIWB 4F9PA 3AREC 4MJ5A 4NQTA 3QWQB 4XX1G 3QP3A 2R56H 3HPLB 3SE9H 5C2BH 3H3KA 4M03A 5F9JB 5JW4N 5JDSA 5DJYA 1F2XK 1LO0H 3ZE2E 3X3GL 2F5AL 1KEGH 5I6XC 1N0LA 4X5LA 5E70A 3WDHA 4I3GA 3BEWB 1FL5B 3RVTD 3U4AA 4LVHB 2VABB 4OJFH 1PG7X 4XCEB 1WT5A 3EZ8A 2EYRB 2ZZUT 2JJUA 1U36A 2R23B 5HGDB 3B83A 3LQMA 4JO2H 5DK2A 1RZGA 4LL9A 1MJUL 4JM2C 1C5BH 4HUUB 2K3TA 4JO3L 4TVPE 3QO1B 1M4KA 2WQRA 4WRLA 1OOAA 4L5FH 5EZJA 3SN6N 4ZOAA 4RNRA 5E8PB 1NAMA 4Y89A 3ES6A 1PAMA 3RY6A 5KG9B 4XZUB 2D4FA 4XPGL 4CUCA 3E6HB 4PJ7B 4DN3L 4KKLD 5H94B 3C08H 3PGFL 4ZPVA 1DQQB 4OBRA 3NOIA 1ZLVH 3T1FB 1JZ4A 3E2HB 2E6JA 2LAGB 4XP6L 4Z76B 2OK0H 5I1DA 2LABA 4ODHH 5IQ7H 3KPQA 3CGTA 3R4DA 3OTTA 4GQ9H 2V2WA 4Y5XC 2VXQL 1BFSA 3QR2A 1LK3L 4Y4KB 5A16A 4FG6C 3ZE0E 3TO2B 3B9AA 1ZT4B 4G43A 1G9MC 1U92A 2L7JA 5CINH 1XR9B 4HKXB 4MCYA 3PWLB 3G6JF 3C09C 4X80H 4LCCA 3LY6A 5GGUA 3HI1B 2X4UA 2NY2B 1CD0A 4S1RH 1S5IL 3IYLW 3THMH 3SE4C 2HT4C 4HK3N 2G2RB 2YMXH 4JPKH 1KEGL 1FAKT 2CJUH 1KT2A 3OF6A 2IFGA 2IQAA 2CLRB 3DTXB 1T4KA 3NN8A 3BWAA 2MQ0A 1KCKA 4U1HB 4UQ2A 1O5DT 4UU9A 4KMQA 1EDQA 2Z35A 3LRHA 2W0FA 3WJJC 2QQQA 5HBBA 4ZFZB 1C5BL 1SJVA 3WFHA 5HVHB 5IB3B 3A67H 2XWTA 4GKSB 5FGSA 4HGWA 4Y4FB 3S34L 4L5FL 2X41A 3QA3A 1S8DA 2EO1A 1X3DA 2UZIL 2RBLA 1I1CA 1SYSA 3FJTA 3FRUB 3LRSA 4JANB 5MENE 3QDME 2B0SL 1Q0XH 4M6AA 2VLKE 5F7HA 1WSST 1KELL 2WMPA 3HTLX 5F1IB 3GSVA 4GAJH 4U6VH 1CVRA 1PVHA 3IS1X 4EJ1C 1S7QB 4JFFA 3DPBA 3KPRD 3PWPA 4KKCD 4DGYL 4IHOB 1OD9A 1YY8A 1QO3A 3U1SH 1HHGA 2ZUQC 3RPKA 3KLSA 3BE1H 4ZS7L 4WWKB 3U7WL 3BT2L 4X6CA 1QFOA 3EYVB 4KMTL 4GBXA 1F4XL 4APQA 4JRYD 4G9FE 4X5WA 4M6MH 5CINL 2IAMD 2FGWH 2ADIA 3SKMB 4K7FB 1SBSL 3L3HB 3CJJA 4NNPH 4RX4A 4G8GB 2BSSB 4S1RL 2W0KA 3NIDE 4N8VG 3O3UN 2DLGA 4GKOA 3WUZA 2YMXL 4JPKL 3GMQB 3K46A 1M05B 3AVEA 3E0GA 5BS0A 2DM4A 1G9NC 1MY5A 4I18C 2IH1A 4NKIL 5F88A 4F7PA 2ATKA 1FL6B 3S36H 5SWZD 4QTIH 4XGZA 4JM4L 1XF4B 2AJVL 4YFDB 4M6NH 5E08H 3VXRB 4JFQA 4OCNC 3QHZL 1BBJB 1CYGA 4WV1B 4KKBD 3U4EB 3DX6A 4NWUL 1CBVL 2M8XA 5IV2A 3MMEB 5IB1B 5GJSL 3CSBA 3FO2B 3Q6FA 1FBIH 3BZDA 4PBVC 1YMME 4PV8B 5DFVC 4OCXL 2P43B 2Q7NA 3QDGD 2W65B 4K55A 1QEWB 2VXUL 4MA3A 3G9VA 3ME0A 2R1YA 2X4OA 3QJFA 3TBVB 4V1DA 3CFCH 3BGAA 5GS3A 5J1AB 5LG1A 4GAJL 1T22B 3ELAT 2X4TA 3BO8B 4CU7A 1KN4L 3G04B 5FA3A 4FHBD 4O9HL 3U1SL 2DD8L 4A2LA 1K85A 1FV1B 1TNMA 4NNXA 3KPOA 3ILPB 4I77H 4H25A 5J12C 1LEGB 2F8OA 4R4NC 5CP3A 3ROLA 4M6ML 3VFOA 1HYSD 1C7TA 5ICXA 1LO4H 1D5BB 4PRIB 4HH8A 4U3XA 3VI3F 4CMHC 2Z9TA 5SWQB 2JF1A 3ULVH 3BD4A 4K3JL 2X9XA 2ZOKA 4KVNH 2EC9T 4RBPH 4HV8A 3SDXA 5TE7L 3W9DA 2ITCA 3MCLL 3N85H 1VACB 3CDGA 5FECA 3FB7A 4ZNEE 2V5TA 4P2RE 2EXWD 2APBA 2DYPA 3FN9A 5E99H 1OB1A 5ALBH 2JCCA 4PLOB 3S36L 4RBPK 4HHAA 2DLFL 5FM4A 3D3VD 3UJIL 5GJTL 3C6SA 2X4NA 1CTOA 2P5EA 4AY0A 4POYA 1ES0A 1X5KA 3IGAA 3MRJA 5IBUG 2C3VA 1IC1A 3B5HA 4YE4H 4X9GA 2R0LH 2ID5A 5EB9A 1YPZA 3MNZB 3LEVH 3WDIA 4R97C 3QULA 2DJ4A 1CK0L 4WU5A 5BXFA 1PY9A 4I8DA 4EN3D 1G7QB 1MHEB 3JV4A 1QR1B 3WKNA 4RGMB 3GGWB 2J8OA 4NUGL 3RPIB 2BCKA 4YFLF 5IB4A 3S3JA 3OR7A 5CJBA 4EI5B 3SGJA 4Q58C 4OCYL 1FZJB 3SCMC 4Q6IC 2Y7QA 2Y36H 2P46B 4CN6A 3G5ZA 2IALA 3MGOB 4IOIB 3SDAC 3MRBA 4L9LB 2E9IA 1AO7E 5KN5B 1UA6H 5EFIA 5C9KA 2OXHA 1A9EB 1VFBA 4OSUL 3QNZA 1DBAH 1J1OH 1I8LA 1XGQA 4WUUB 5EBWA 3KPLB 5FO7B 1OM3L 4WNQA 2ZJSH 3X12A 3MLXH 2L4OA 4KQ4H 4WFFE 3I9GH 1E28B 4KJQD 3ULVL 1KCVH 2AJZA 5ID1A 1P69B 1BIHA 5KSAD 3OJDA 4YDVB 3U9PL 3N85L 3I75A 4G6FD 4Y5YB 2XKNB 2HYMA 3MRNA 4I3SH 1D6VH 5GZNC 5FYJL 3ZYJA 1INQA 1FO0L 1MIMH 1HSBA 1T7VA 4HKBB 4K3EL 1D6EA 3BKCH 1F4HA 3V0WH 4ZOCA 2BRRH 3ZTJG 3QISA 4OI9A 1DANT 2OP4H 5C0EA 7CGTA 4JE4B 1FVDA 3QI9D 4CVZA 5T3XH 4K8RC 3GK8H 5J1SC 2OYPA 5I1KH 5BW7A 2BK8A 1V3JA 4Y2DD 5D6CA 3CSYB 3WFBL 4G8IB 2Y07L 4H8WC 5ENWA 3ZKNC 4D2NA 1UFUA 5ERWB 3HZKA 2I60H 2YRZA 1ZT1A 4L3ED 2Q8AL 2GK0A 4ZTOH 4Y88A 5I0ZA 4OI7A 1WGOA 1X5AA 4PGCB 2GAZB 3PQYE 3EJJX 2W59A 3T2QA 4O51B 4XC1H 3LPGA 4HC1H 1H3XA 2IWGA 2OJEB 4FQIL 5GGRA 2Y36L 1YEEH 1EAPB 5IMKB 5D1QA 5E95B 1AXIB 1UA6L 3DVGB 4U6YA 1OD7A 2FX9L 2NY1D 4KDWA 1T5XA 3SQBA 1RZ7H 1MHCB 1JTOA 2NY5H 2ZJSL 4YDLB 3HNSH 4KQ4L 3I50H 1E4WH 2GJJA 5HHVL 1CL7L 1KCVL 1NDGB 1Q9WA 4NO3B 4L4TB 1T0MB 3RVXC 3EYOA 4P46B 3DI3B 4JO4H 5GS0C 2NMSA 3VFGH 4L8BB 3KPSA 5I16A 2EZ0D 4I3SL 1NFDB 4P4KB 3ZDXE 2ICEB 2LVEA 2Z31D 5L88H 1HOCA 1NLDH 3PDGA 4HIIB 1XIWA 5J3HC 1CFBA 4U05A 2BRRL 5HI4D 3P30L 1SJHB 2OP4L 3A0OA 1U8LA 2YD9A 3ZZ1A 1I85A 5AEAA 5T3XL 4H20H 3B9DA 2LU3A 3BEWA 1J8HE 2CRYA 2VABA 1P84J 3ARSA 1N7MH 1VEMA 4XCEA 1ONQB 3QCVH 5L0QC 3O6KH 3JWOC 2EYRA 5DGRA 1B3JA 3DNKA 4XRCB 2R23A 5GRUL 5HGDA 3DHMA 3VD9A 3FQNB 5HYFA 5J9PB 2DBJA 4UILH 2XXMB 1T89A 3O2DH 1KJVB 5F7YC 2YSSB 2FEEL 1NC2D 4K94H 4LLWB 4ZO6A 2P5WD 4HUUA 2GKIA 4GRWF 4XC1L 1A7PH 1FO0B 1ZMYA 2EDTA 3QG7H 1JE6A 1HQRA 4OFDA 4R9HA 4KWUA 1O7VA 3ARVA 3KYOB 5C0FB 5E8PA 3MUGB 4PLKD 4Y5VB 4LF3A 43CAA 3H7BB 4KXZI 4U1JB 1TENA 5F44A 5KG9A 2X7LB 4XMKH 3D9AH 4OAWB 2AXGB 1OQOA 1D5MB 5BRZD 3UBXG 3E6HA 3D48R 1RZJH 4PJ7A 3I50L 1GC1C 2XN9B 6CGTA 1DQQA 3T1FA 4N8CL 2ED7A 1ADQA 5HGAB 3MV9D 5MP6H 1NANH 4P23B 4OM0L 5KVGH 1H3VA 3QXUA 4LSSH 3TVMC 5F1OB 2HT2D 2X9YA 1EH9A 3TO2A 3GIZH 1ZT4A 4PJCB 5L88L 5A2IH 1CGWA 3QFJB 1IL1B 2ILLA 2CK2A 1TVHB 1XR9A 3DX9B 4HKXA 3PWLA 3WBDA 5F7EL 2XRAL 3QPXL 4C58B 3SGDI 3HI1A 4UIKL 1VFMA 2CMRL 4XAKD 1HXMB 1H5BC 2G2RA 5D1XD 2FJFB 3DRQB 4JRXD 3DTXA 1DBBH 3O6KL 2ATPB 5IW6B 4U1HA 2YHGA 1CICC 5CZVH 2A83A 3MODH 5DVNA 2FH8A 4D9QD 4LOUD 2NX5B 1MRFH 3DGCR 5B8CB 1XAUA 2Q8BL 4ZFZA 4N0YH 4NKOB 1FNGB 5DO2D 5F8RC 5IB3A 5DA4A 4LP4A 4JB9H 4Y4FA 1WV7T 2QL1A 3QUXC 4FTVD 5E9DE 1MCNA 5HVFB 2Y1VA 4D0DB 2C4FT 3FRUA 4JANA 4DEPB 3RQ3A 5ISZD 4KJPD 1QVOB 4OUUB 5HDBF 4WO4B 4PRHD 2FD6H 5F1IA 1RU9L 1NMBL 1NBYB 5C0ND 3C6LB 1S7QA 2Z8SA 5IK3B 5MP6L 1L6XA 4MA1B 1N8ZB 3ZT6A 3VWJB 1BOYA 4JQXA 4WWKA 5K59E 1A5FL 4XBEL 2M1KA 1NLBL 4NOBA 3I2CH 2DKUA 4JFHD 1AR1C 3SKMA 4K7FA 3B9VA 4F33A 4MDIB 3L3HA 3LKSB 2BSSA 3E1F1 4U6TA 2A0LC 4MJID 4NP4H 5LQBH 4XPHL 1MAML 3GMQA 1PSKH 1M05A 1A6TB 2Y9RT 2O61B 5A3ID 1C16A 4G8FB 1OAQL 4Z7QE 4X0KB 4Z5RA 1FL6A 1DBKH 5CZVL 1XF4A 4P3WA 3RUGF 1XEDA 2CUHA 3LN5B 4B7IA 3ARFC 1MRFL 4WV1A 3LRGA 1BBJA 4JHWH 4S1DD 4ZFOL 3JZ7A 3DVFA 4JR9H 5FUOH 5IB1A 4P2CG 3FO2A 3RGVB 5D5MF 4JREB 3GHBL 4KRPC 4PV8A 3WIIH 3HMWL 2W65A 1QEWA 3IRZA 5CEXB 4PJ9B 2PR4H 4N0CC 5DFWH 3TBVA 3TJEL 2YUZA 1WIPA 2FD6L 4JDTH 5J1AA 3ZDYE 4FXLA 1T22A 1TZGH 5E4EB 1N5AB 1NCTA 1H3GA 3G04A 4N90D 3RWJB 3K7UA 3RDTB 3V6OE 4YQXH 1RVFL 3MV11 3O4LD 1FV1A 1OF2B 2GY5A 4PRDA 2JJSC 1EHNA 2VDRL 4OD2B 3I2CL 1X4YA 4MQTB 1D5BA 2NLJB 4PRIA 1FP5A 4I0PC 4RGNB 3T4YA 3TEUA 3OPZH 1RZIA 5SWQA 3AM8A 4ZQKA 3FZUC 3ARUA 5I76B 2VWEC 3VFTB 2CKBH 5DD5H 2XQYK 3JWDH 5LQBL 1KGCD 1VACA 4CJ0A 5FFLA 4KV5F 2MQ3A 5AUMB 2VR4A 5J6HB 4ONFL 3L5IA 3K3QA 3TN0B 5AWNL 3X13B 2C3WA 3S3PA 2DLIA 2W0PA 1KB5L 3R06B 5HPMB 2UWEB 1QFPA 5KS9F 4O2FB 5FUOL 1CDIA 1U8MA 1S7VB 1YA5A 4YWGH 1IKNC 3MNZA 4AQOA 3OKKB 2PTVA 3WIIL 3UC0L 1G7QA 1MHEA 3SKUD 1QR1A 1MFCH 4PRNB 5JW4M 5D7IF 1DP0A 3GGWA 4BYHA 1NUDA 3TH4T 1BOGB 3ETBF 1UWGH 3QB7C 4FA8A 4PJBB 1ZE3C 1FZJA 3CX5K 1J1XL 3MGOA 4IOIA 1I9JH 4L9LA 1LK2B 3WKML 3HKFA 3MRQB 3QAZB 3BP6B 2IAND 4OV5B 2LFGA 3JBG7 1A9EA 3D5OF 1V3MA 4ZFOB 2GSGB 4WUUA 4OZIB 3FB8B 1QLFB 3KPLA 5FO7A 1HI6A 3VXUB 4Z7UF 4Z7WE 2CK0L 2WNGA 3DMMB 5E8OB 2KZ1B 3QEGL 3HUJF 2BNRB 3U6RB 3L7FB 5CUSL 3N06B 1DQML 4NM8L 2QSCL 3FAXA 2CKBL 4CVXB 3UBXI 3GI8H 3SDCC 4MJ2A 1BBDH 4YDVA 2E3VA 1AGBB 1ULVA 4IRJC 4XXDB 4ZMAT 4Y5YA 2F54A 2XKNA 2XZQL 1OP9A 3EOTH 5HYSB 4OKDA 1AQDB 5E6ID 2YKLL 3MV8E 4HKBA 4DUVA 2YD3A 2X05A 2MFNA 4JFOA 2CLVB 3RTQB 4RISH 4BM7A 3JUZA 4KKLC 2ZOLB 1FG9C 4NKMB 2QHLA 3TYFA 4B0MM 1HH6B 2X2YA 1JBJA 2Q76B 4YWGL 5KANG 3ESVF 4ZO7A 1Z0MA 4WVRA 3CSPA 1PQZB 3OKMB 4G8IA 1F2QA 1WZ1H 2YRPA 4KZEH 2H1PH 5ERWA 1R0AL 1SJEB 5EO9B 3WXWH 1CF8L 3KXFE 1JNNL 4FXKB 4JG1H 3TBYA 3V6ZA 4PGCA 2GAZA 5C0DB 4P9HH 3QIBB 3FRPA 4O51A 1SY6A 1X6NA 3ZTNH 1TETH 3ARGD 1EAPA 1I9JL 3TNNA 1UQSB 5J11C 1CLZH 1KB5B 2VLJA 2MPAH 2F58H 2QLVB 4NQCB 5GGVH 1L7IH 3BQUD 3EFDL 4NC1C 4C56B 4Z8FL 4U1KB 1FZOB 2VLRD 4L8CB 1NDGA 4EBQH 4NO3A 1TMCB 1T0MA 1H0DB 1VGKA 3HN3A 3PNWB 3VI3E 1A3LH 3GI8L 4P46A 3D18B 3HC0B 4PJGB 3WUWA 1TTGA 2P8MB 4LAQL 2C3HA 3CH1B 2J8UF 4JCMA 5DTFB 5IBTH 4NHCL 1OCWL 4LQ1A 1NFDA 4P4KA 4YHOH 5CGMA 4NQDE 2J88L 4JFDE 4P5TD 2VXVH 1OAXH 5C9JB 5FGCE 3QUYD 1U93B 4RISL 1SJHA 4GRLB 3QEQB 1ZVYA 4QT5B 3TA3B 2NW3B 4R0LA 4U6XB 1KCLA 1MLBB 4UBDD 4ZUTB 4KKCC 1BD2B 1A02N 1MEXL 2HH0H 3TNMB 3R0MA 1FE8L 1AHWB 1J5OL 1RIVH 1ONQA 2H1PL 2NYYC 1ADQH 1LNUB 2HP4A 2YN3A 4XRCA 4M9OA 2HJKB 3FQNA 5J9PA 4JG1L 5FGBA 3QCUL 1RJLB 4X4MA 4C83B 4LLWA 2IAMC 3F7PC 2Y4SA 1DTUA 1A6WH 4G6JL 4UAOB 3U0PA 1EEZB 4FQ2H 4PJXE 4IS6B 4YBQD 3CDCA 2P24B 2JB5H 3KYOA 3EYSH 3HB3D 5C0FA 1LDPL 3ULVD 2MTPA 4L8SB 1JZ5A 2BHYA 4Y5VA 1BX2B 3H7BA 1KLFA 3VXQA 4PJAB 4OAWA 2AXGA 1H3TA 5KOVC 1L7IL 3AMLA 3D2UD 1D5MA 3LS5L 5TE4H 2D7NA 2HT3D 5C07E 4YC2B 3L3GA 4F7CB 4UV7H 5I15H 2XN9A 4KKBC 4EBQL 2I5YL 5HGAA 4P23A 1S3KH 4J3WA 2VRAA 5GZOC 1LGVA 1QFUH 3CAFA 4L9DA 3ULVF 4OFVA 4TSBL 5D2LF 2WWMD 2AI0H 3T0AA 4YHOL 3IDNB 4PJCA 1HE7A 1KF9B 1IL1A 1TVHA 1N6UA 3DX9A 4X7FC 5BV7B 4PJHE 1KIRB 2GYSA 4M7LT 5JOPD 3MYJB 2EEDA 3LEYL 1HXMA 1WIUA 4RMUA 4LPTA 2FJFA 2AJXH 5DURB 1CWVA 2HH0L 3DRQA 1I9RH 4R4FL 5IWLA 2DKMA 3C5JB 5KW9H 3OKDB 1N64H 4OZHF 4D3CH 1BJ1H 5D7JD 1HHJB 2VLME 5IW6A 4LLDA 1RK1B 3OKYA 5FO9B 4LFHD 2IPKB 1CDYA 4PIRF 4PLJD 4R7NB 2NX5A 1HYSC 1JWUB 2AXHA 1FNGA 4NKOA 4Y1AD 1A6WL 3CLEH 1M7IB 3ULUH 1NSNH 1MF2H 4GXUN 1U3HD 5E5MB 12E8H 3IAGC 3LQAH 5JMOC 3VMPA 4QY8B 1BFVL 1YQ2A 3O3EA 1VPOH 4PJFE 2QQLH 1YEHL 5H2BB 1R5IB 4XBPB 2EXWC 4MQ7B 2VDPH 1UZ6E 5H35B 1QVOA 2PTTB 4OUUA 4TQEH 4X4XB 3JV0A 4WO4A 4YPJA 5TE4L 4QRPB 3DARA 1NBYA 5EH1A 4HCRH 3C6LA 1B90A 3W0WD 3ZE1E 4P2OD 2ESVE 4OUOA 3P11L 3D25B 4KJWD 4OZGF 1JN6B 2BFVH 2YBRB 5IK3A 4L3EE 4RQQB 1S3KL 5HYJD 2IMMA 1XH3A 1T03L 1CGVA 4MMZC 5ILTL 1NMAH 1GOHA 5T3XD 5I1JL 6FABH 3OZ9L 1Z2KA 4EN3C 5HDQH 3D69B 5HHXH 3KR3H 4J4PA 4NZTL 5K9JL 5HHPB 4ORGB 2VC2H 2YD5A 3L9RB 5KVEH 4MDIA 1MCWM 3LKSA 3SY0A 1Q0YH 3VD7A 5J6GB 2OI9C 3BGMB 4L4JA 1KEMH 1S7WB 4YHKH 1YJDC 3OJMB 4IOSD 4ZSOB 1A6TA 3SGKA 2O61A 5KW9L 4G8FA 3RVUD 1N64L 4X0KA 1OAKL 1N5YH 4TOYL 2BNQB 2RCSH 2P7TB 3ZSSA 3K81A 4B5EA 1A47A 2Z4QB 3LN5A 3OG6B 1MCOL 1FORH 2BJMH 1SEQH 3LPFA 4PRPB 2VDNH 1RI8A 4WY7L 3VGGA 4KJQC 4PJIE 5F89B 1JRHI 4YBHA 4M1GL 1U8HB 4M7ZB 1HK6A 3RGVA 1GGCH 4Z78B 1SMOA 3D39B 5GISL 1QD0A 4CDHA 3WN5C 4GG6B 1J18A 1RJZB 4NWTL 4J7RA 1M71B 2YWZA 1FAIH 5MI0B 3O6FD 2OQJB 4PJ9A 5F6IC 4LVOC 4OF6A 5I19H 4CU8A 1NMCC 2HAZA 4QOKD 3OQ3B 4HCRL 1N5AA 4EKXA 1GCFA 2DQUH 3RWJA 3RDTA 3VG0H 1R5WB 4JVPA 3BN9D 1PKOA 3QI9C 5T1LD 3LSOA 1FZMB 1AD9B 3P9MA 3SDYL 1NMAL 4Y2DC 2PYEB 4M48H 4I9WE 4PJDE 4Y8DC 1RUML 3BPLC 2FNBA 5IMOB 3LMJH 2VC2L 2NLJA 5KVEL 4UT6H 5L2KE 5I76A 3RL2B 3GHEL 4WI8A 2HMID 1T7YA 2VERN 3IFLH 2HA1A 4QGTA 1JPGB 4ZAKD 3CZJA 3EOBB 5I17B 5D8JL 3V7MA 4U0RC 5DD0H 1OLLA 3ARYA 5HHMB 3ZKXC 2NY1C 5DJDB 5DHYB 1DEDA 1FGVH 3OKLA 5J6HA 3VE0A 4HD9A 1KIQB 4DZ8B 2BJML 5GGVY 5JHDB 2V9RA 4KK9D 2B1AL 1KXVC 3X13A 4YJZL 2A1WH 2MSPA 5J89A 1MCJA 2ZNWA 3R06A 5HPMA 2UWEA 5J4MA 4O2FA 5JDJA 4U1GC 2VLLB 3OF6D 1DDHB 2OXGA 3RHWF 1E6OL 2FCBA 4HFWB 1MNUH 1QP1A 2AJSL 32C2B 1IGCL 3CUPB 4JZJB 3OKKA 5BVPH 5A2JH 2AK4B 1U8OB 2CDEB 2ICWB 4NRXB 5GGTH 4XAKE 1U3ZA 5C0BB 1IRAY 2EZ0C 4PRNA 5D9SB 2Z31C 1BOGA 4RSVA 3C8HA 3H3PL 4PJBA 1F6AB 4EIZC 5HI4C 4NO0B 2VN4A 1QSEB 1DLFH 2ZUUA 3S35L 1KB9K 4P2RA 1P4IH 3RIAK 2YD4A 1LK2A 3MRQA 2J4WH 3BP6A 4OV5A 4ZFOA 2GSGA 4OZIA 3FB8A 1QLFA 3QUZB 4HUNB 3VXUA 1KIPB 1SBBA 3T0DA 3LVEA 5DUMH 1ZV5A 2W0LA 4P3DB 5JO5B 4DCQB 4JY5H 1T21A 1U6AH 3QXTA 5IEHB 5I8KH 4AIZB 2YPVL 4LHJB 1DUZB 2BNRA 3L7FA 3U6RA 1RZ8A 4ELMB 1WWWX 4NQEB 2BY0A 3TJHC 5IHBA 4PRHE 4XNYH 2Q1EA 4MX7B 3UTSB 1AGBA 2GFBA 4XXDA 1P4BH 4H1LB 5C08D 1EFXD 4ZO9A 4PLKC 1Y6MR 1AQDA 5HI3D 1FGVL 2DJUA 1I3UA 2VZ3A 4J3OC 5A2KH 2CLVA 4IOFD 3RTQA 4RDQF 3MOAH 4D0BB 4PJ8D 2ZOLA 5IJKA 5GRWA 4NKMA 2CIIB 1YNLL 2Q76A 4M00A 4MAYD 4HUWA 5JIKA 3VGAC 3CFDB 1PQZA 4X6DB 3V7AG 4LRIC 5GGTL 5EO9A 1I7TA 1HCFX 3WDJA 4ELKB 4FMKA 5CAYB 2VB5A 5AYUH 5E2VL 4FXKA 1INEL 3A6OA 1T1YA 1G9EA 1IAIM 1XGTB 5C0DA 1MJ7L 2YR3A 3NMEA 4YLQT 1U0QA 4XX1E 3DX7B 3FRPG 4OQTA 2F15A 5B3JE 1EGJL 2FL5B 1IJ9A 5EZOH 3RX7A 3PP3H 1UQSA 5D1XC 5TF0A 4JG0H 5D2NB 1KB5A 4OB5H 3CXDH 5F72S 3BIAX 4NQCA 4MVBD 1UJTA 3BFOA 3MLVL 3MLZL 1F4YL 4HS3B 3SKNB 3X3FL 3N9GL 1U6AL 1U9KA 4OZFB 4OGYH 5CILL 4C56A 4LOUC 4U1KA 4XNQB 4LIQH 5JOFB 5DO2C 3BH9B 4PJ5D 3VGBA 2AJYH 4PLNC 3PNWA 1WZLA 1NAKH 4R4BA 1DQDL 4W81A 1V7NH 3D18A 3HC0A 1QBMH 4PJGA 2GQHA 5IMMB 2HFTA 3BKJL 2KDGA 3EO9H 5DTFA 3RNKA 1P4BL 5DI8B 4U6HB 3DHJA 4NN5C 4QXUH 1YEGL 3GBNH 1PLGL 1EV2E 4KJPC 1QLRA 1TJGH 1BVZA 5C9JA 2DQIH 2CUMA 3S3SA 1U93A 3T0WA 2VUYA 4GRLA 1U58B 3QEQA 3TA3A 5C0NC 3EIFA 1QBLL 1UM6L 4U6XA 1ZANH 3UTQA 5T33H 4ESKA 4E41D 4ZUTA 2OL3L 1BD2A 4EDXB 4O58L 4NZUL 1RMFH 3DXAE 2CRMA 1CFSB 3TNMA 2XY1A 5DQJB 1AHWA 5DDHB 4DGVL 1BQSA 5HYEA 1DEEB 3MJ7B 5JXEA 1MJ8H 2P5ED 2HJKA 3WFZA 4DKFH 2YUVA 3EFFA 1HHIB 1DQLH 3BMVA 1RJLA 5KTEH 4C83A 1B2WH 3UTTB 3OJVC 1EEZA 3BDYH 1TVBB 5EU6B 3K1DA 4XTRD 3SDXF 3REVB 1JL8A 4TVPH 4LSPH 1OAYL 3OAZH 3ZMRA 4JG0L 4LCWB 4L8SA 4J23A 1CVSC 3VWKB 4G3YH 5A3IC 3PHSA 5C0RH 2EIEA 4PJAA 5I1IH 3OAZK 1DFBL 2Q6WB 3H9SE 4OGYL 4O2EB 4GMSH 4RGOL 4F7CA 5E4IA 4NN6C 2ZUWA 3QNXB 1MI5D 4LIQL 2AK1H 4YXLH 2DQJH 2NY3D 2LU7A 2WSKA 4FP8L 4BZ1L 3FOMB 1LP9F 1YPZF 1V7NL 4WEBH 4UDUB 3T1WA 3WE6A 3AC0A 3RI5F 1QQDA 1LO2L 4WI6A 4WFGE 1NGYB 3IDNA 8FABB 2DQTL 1A6UH 4QXUL 3HAEH 1UVQB 1TJGL 2D7OA 3HMXA 2WW8A 2DQIL 3QWOB 3WIHL 1OAZH 2XT1B 1XF5B 1KIRA 5FB8B 3O11B 3OG4B 1WAAA 3MA7B 3QIWB 3BZFB 3MYJA 1L0YA 1ZANL 5T33L 3F62A 2V17L 2BOCB 3W39B 3UPCA 1RMFL 3W2DL 1MFBL 3C5JA 3OKDA 5EWIL 3SGEI 1J0KA 1AQKH 3UTZB 1HHJA 5BO1H 1AGDB 3JVGC 1RK1A 5FO9A 1DE4B 3AREB 4IDLA 1YN7B 2MKLC 4YX2H 3MRIB 4R7NA 3D85A 1DQLL 3CLFH 5HXMA 4ALAH 1BGXL 1JWUA 4YO0B 3CFKB 1CI5A 3DI2B 2AGJH 1M7IA 2VDOH 5HHQB 4ONGL 3P9WB 5E5MA 4NDMB 3QDJE 1IM9A 3PL6D 5I6XB 1RUPL 4QY8A 2AEPH 1PJ9A 1KFAL 3O41B 5TF1H 4JKLA 2DI9A 3M45A 5H2BA 3HE7D 4XBPA 2J12B 4MQ7A 5C0RL 2ED9A 5H35A 2PTTA 2OL3B 4S1SH 4X4XA 4QRPA 5E2TH 3NIFE 2H32B 4JM2B 4ODSL 2EDDA 1F4WL 2WZPD 2X4RB 4R96B 3D25A 2AK1L 4YXLL 4KY1H 2YBRA 4FQXD 4RQQA 5J56B 1MHPH 3BKYH 1MCKA 1MRDL 4QRRE 1BQHB 1FL3A 3SO5A 1HWHB 1J0JA 3TZVA 4HBCL 3VGHA 5D4QA 2QADD 1A6UL 3WIFB 1TCRA 2QKIA 5HHPA 4ORGA 3WNLA 2HWZL 3L9RA 1G9NL 3L3OA 4QF1B 3UTPD 4WFED 4DN4H 1P7HL 1JZ2A 3EDFA 5J6GA 4LSVH 3BGMA 4OKVB 1S7WA 2HG5B 4ZSOA 5K9OB 2YOCA 4Y5XB 3FFCD 1ZVHA 4OLXL 2J6EA 4IRSD 2BNQA 2F5BL 2P7TA 2CUIA 5LVEA 1QSVA 3DURA 2VDQH 5ITBH 5MHSE 2Z4QA 1NH6A 2XV6B 4PRPA 4UT9H 2D7MA 2AGJL 2VDOL 2EIZB 1W8NA 4J2XA 1NCWL 5HJ3A 4Z78A 1RSFA 3D39A 4HUXB 1Q9KB 5JW3H 4GG6A 1RJZA 4Z7VB 1M71A 4GMTL 2ZPKL 3V0VB 3WLBB 4JDVA 1RK0B 5JPNB 5E6IC 5E2TL 3O9WA 1IMHC 3BMWA 3CX5J 2O93L 1YQVH 3QQ4B 4LHUD 4F57H 2F8VA 1R5WA 1IKFH 1JI2A 2YPLB 1CU4H 3VD4A 1FZMA 2H41A 1AD9A 2VKWA 5D71H 4AZ8A 1YZZA 2PYEA 4BJLA 1WFUA 3GSNL 2CD0A 3RVVC 4EXPX 5IMOA 1P2CB 4Y19E 1AC0A 2H2SD 4LCIH 3WFCL 3OGOE 4XAWL 3R0NA 5BMFL 1HQ4B 4G6KH 3RL2A 5FUCE 3HPJB 1GIGH 2F74B 4F7EB 3MJ8B 4LSVL 5FK9B 5TDPA 1JPGA 1FFOB 4PP1D 5SWSD 1LEKB 3ZO0A 1YMHB 4K71C 1YECH 5DJDA 2FO1A 1FNEA 3EDEA 3DUSB 4PY8J 4I48B 3UYRH 4G80B 2OTPA 4OQ1A 3RZCD 1EHLH 3MPCA 2EDRA 2Q86B 4QHKJ 4HPYH 2VLLA 1DDHA 1AKJD 32C2A 3CUPA 4JZJA 4CBPA 5IESH 4HT1L 3HNTH 2AK4A 4I18B 1U8OA 5DUPL 2CDEA 2ICWA 2APTA 3IDIB 4JPWH 3L3IB 2GY7B 2VH5H 5F71A 1QSFB 1FGNH 4WFHD 2E9JA 5C0BA 4LSTH 5DD3L 5D9SA 2DICA 3I6KB 2YD1A 5ITFB 4FNLH 4ODBD 3OKEB 4P5TC 2W92A 1F6AA 4MQXD 4KK8D 4ZYKB 3QUYC 1T2QH 1QSEA 4BQCA 4JHZA 4R6UA 1EO8H 1R3LB 2PO6B 5FYLL 4UBDC 1I9EA 25C8H 3LKPB 2JIXD 5I1HL 1I9IH 3FQUB 5IIEB 1FNLA 1J1PH 3QUZA 2H9GB 2QQNL 1VFAA 4QNPE 1KIPA 4AEEA 3GNML 3EAKA 3WHE0 5D7LB 4MAUL 5JO5A 2X4QB 4KTDH 1LDSA 4LCIL 4AIZA 4LASH 1VEPA 4G6KL 4LLQB 4ELMA 1CD9B 4NQEA 5CJOH 3DOSA 1GIGL 3MV7E 1CD8A 1FYTE 4MX7A 4CGTA 1ZA3B 4YGVB 3W0WE 2UVEA 3HB3C 4WI3A 3ULUD 1OTSD 2WUCL 3M17B 3PWNB 4H1LA 4NBYB 3ULVC 4OQTH 1B4RA 4L1DA 1FPTL 3MBXL 1ZLWH 5TDOB 2SEBB 2HKFH 5HYSG 1HIMH 2GSIA 3FT2B 4C54A 1ND0B 2NY6D 3UYRL 2X1WL 4S0SD 1RHFA 4OIBA 1OT2A 2WM0A 3WS3A 5CSBA 4EDWH 1EEUA 4CMHB 2HT3C 4EXKA 4D0BA 3GSNB 1ZLWK 1H9VA 4H8WL 2GJ6B 1MELA 5C0AE 5A43C 4HPYL 4R8WL 2CIIA 2ZG3A 1SVZA 4QHNB 4L3AA 3CXHK 3EHBD 5IFAL 2C3GA 3CFDA 4X6DA 1A3RL 2F53B 4QRSB 1KJMB 3U83A 5C6PB 5EORL 1CLOH 3ULUF 4ELKA 3JUYA 5IJVB 1T80A 2WWMC 1T04B 1AI1H 4WTXA 2BVYA 4L4VB 1CL7I 1XGTA 4HXAH 1T2QL 3DX7A 1IGIL 2APVA 1BQLH 2FL5A 1WFOA 4PD4K 3LV3B 4W4OA 5D2NA 4RWYH 3ARBD 3P73B 3MV8A 4HLZH 3P0VL 4J3XA 2VSDA 1J05B 4WW2F 5D7JC 4HS3A 3SKNA 4U4BA 5JLZB 1E6JL 3HG1B 4KTDL 5T5NG 5H8DA 2W9EL 4OZFA 4CNIB 1EO5A 4MD0B 1YMMB 4LASL 4XNQA 1DL7L 3SCMB 4Q6IB 3BH9A 3SDAB 2VL5B 1QRND 2ADJB 3HE6D 5IMMA 1U3HC 3GBMH 3VFPB 4JQIL 2FIRT 2VITB 1YN6B 5C0GB 3KXFA 5DI8A 4U6HA 5LXGH 1GHFH 4PRID 1KUMA 3RKDC 1A4JB 4Q9QL 2FEEI 4WUKL 1K8IA 5JW4R 2HFEB 1BM3H 2DTSA 3RWCB 1BZ7B 5ICYB 4CVUA 3T08A 3RX5A 2XZAL 3E8UH 4P2OC 3JWOL 2PXYD 5AZEL 3P77B 4MD4A 1L0XA 3IXTB 1GAFH 2E7BA 1Z3GH 1NCUA 3Q3GB 1CFSA 5DQJA 5DDHA 4YHLH 4JN2B 1CFQB 1CLOL 1DEEA 4HJGB 1WWBX 3MJ7A 3MO1B 4OTXL 1AI1L