1MCHA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 38
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mchA02
1WIUA 2IPTL 4WW2C 3K2MC 1QRNB 2P43B 4EI6B 3NABL 4LKXA 3OR6A 5E6IB 3GO1L 4HGMA 5DJCA 3QIUC 4XNZB 2FJHA 3T0DA 4YHIA 3IXTB 4N90D 4N8VG 2I9TA 1KJMA 5ID0A 3O8XA 1FRGL 4OZFG 4J3XA 2O5XL 2GY7B 1A1NA 3WIIH 3G5VA 4I5BA 3BPOC 2LABA 4WTXA 2NYYD 1OAXH 1JGLH 3KXFE 3TNMA 1R3IH 5IMMB 3LCYA 3QDAA 5MEPB 1WCBA 3BZFB 2MNUA 3BGFC 4PJ7A 3RPKA 4CNIA 1ZHLA 1QSFE 1ZT1B 3X3GH 5D6CA 2XT1B 2NY4C 3U7WL 1QYGH 5D7LE 4LPCA 3MRFB 3OKDA 1N4XH 3VRLE 5FDWA 4ZTOH 3O4LB 3QDGB 4ODSH 4U7SA 3C60B 1JFQL 2XY1A 5KSBB 4O51A 4PJDE 4X5LA 1CVRA 1BF2A 3WNKA 2FX9L 2VRAA 3SDDA 2F5BL 2HN7B 4HC1L 2FEDD 1T5XA 4J4PA 1DFBH 4AZ8A 4PUBH 4X9GA 5HJ3B 4DZ8A 1RK0A 2XKNA 3SDAA 4MNQB 4XXDA 2NTFB 3TO4A 4DKDC 3CSGA 3LVEA 4IOSD 1ZA3B 3FQUA 1JGVH 5IWLC 1J1OL 3HCVB 3QBTB 3HAEB 3H9SD 2VXVL 1OM3H 1OP5K 4FP8H 1RFDL 3MLVL 3H2WA 3BD5A 3HI6L 1S7RA 4DTGL 1W72A 1A6UL 1AR2A 3QNZB 5DJXB 4QTHB 2IGFH 5I16A 5H35B 5J9PB 5JO5B 4Y4KC 1GPOH 3C5ZB 4YWGL 1UJ3A 2H1PL 1FZMA 2QADC 1RHHA 2VNCA 3H9YA 2Q8AH 3I9GH 4P4KB 2ZSWB 3TBTB 1WZ1L 1UM6L 3BKYH 3IFLH 3ARTA 4LLVA 3UTSB 1FL3A 1YNLH 4E41D 2CRMA 2NW2B 4JQVA 1HINL 1HI6A 1BREA 1SYSA 1KLGA 4WTWA 5CZVH 3DECA 1K2DB 4XI5C 3PGDB 4Y8DC 5J1AA 5A3ID 1MHCB 2C4FT 3BQUC 4DOHE 2NXYD 2RFXA 3KJ6L 2HFEA 4NNPH 2H2PD 3C5JB 2HH0H 1HDMA 4YAQB 1V7NH 3RWFA 4JFFA 2OM5A 4G8IB 5MEQB 1DLFH 2BXZA 4ZFZA 4Z0BH 5KW9L 3MR9A 1P6FA 3V5HB 2DTMH 2YD4A 4Y4HD 1RZ7H 4HW6A 1ZS8B 2N7BA 4UT9L 5DEFA 3A6BL 4WO4B 2NW3B 4YBLB 5JHLL 3STZA 3GMLA 1TZHA 4DFHA 2EDJA 4JY4B 2WM0A 4AL8H 4N8CH 4XBEL 3QNYB 4I18A 5JHDB 1N7ML 5F88A 1C7SA 5E2WL 5EU7C 4DZBB 2XQYK 1DE4A 5FYJE 1V7ML 3PWPB 4MAUL 4OZHE 4IHOA 3AU1A 1NEZG 2A77L 3HN3A 4TPRL 4LQ1A 2O93L 1JWMA 4O58L 2OR7A 1IEAB 4LLDB 5F9AC 4UOJA 2PTTB 4XT1C 4N0UE 3THML 5J3HD 4LASH 3V52H 3OPZH 1AGCB 5FKAB 3VXSE 2W0FB 4K3HA 1Q72H 1A6TA 3JV4A 5I1AA 4OM0H 5DJYA 1CXLA 3G6AB 1NMCB 3R06A 1BBDL 4LCIL 1KF9B 4L9LA 5HGGS 4J3OC 3F6IA 3V5DA 3RWJB 1KTDA 4APQD 4QXGL 1MQ8A 2GIYA 4PR5A 5GGTA 3VDCA 4OF7A 2XY2A 2VR9A 1GGIH 3WFDH 1N2RA 3QJHB 3BP6B 4H25A 2F54D 1NUNB 1I9JH 4QRUA 1ORQA 4BSWB 1UZ8B 4BQBA 4OIIH 1B0GB 5HVHB 1FNHA 1XR9A 1CWVA 3GB7B 1VERA 4UZGA 3T08A 3MRDB 2VLJE 2JJVA 1ZLWK 1FFOB 1IGFH 1NBYB 4F33B 3TYGH 1FJ1B 1RUQH 2VLMD 3VMPA 8FABA 3DO3A 3JWOL 3ZYJA 2H9GB 2V2TB 3U7AA 1ZLVK 4DKEL 2HRPH 3WUWG 4EN3A 5D1XD 3AFLA 5CINH 4DUXA 1VKXB 3U9PH 3MRKB 1U8PA 3OAYH 1J8HA 2HMID 2EH7H 1S7WB 3V5KA 4ZS6D 3TA3C 5T3XH 1F3DJ 3WHE1 1IGIH 2NX5B 4KUCD 3T0AA 4OQTA 4ZYKA 1OSZB 2G9HA 5FO8A 3WIIL 3MA7B 1EO8H 3RL2B 1KJ2A 4N0RA 4KKCD 2FSEB 1OAXL 1JGEA 4ZDHB 1U3JA 5HHNA 5FOJA 2W0PA 5D7LB 5KZCB 5CUSL 1ZLUK 3X3GL 3NMEA 4JG1H 2X4QA 1CK0H 1DBJH 4PJIB 1CGSL 4YHNB 2FD6L 4PJDB 1ZHKB 3NPZB 4X5XA 1CDBA 2GITB 1LMKA 1LQSR 3PWLA 3GHEL 2FGWH 2VLRB 2RIKA 3FFCA 5HYJA 4GRWF 5DZOA 1IGYA 1DFBL 4XVTH 1MLBB 4PUBL 4EI5A 4MXVF 5I8OH 1QSEA 4ODWA 1KIRA 1Z9OA 4PGJA 3LN5B 4GLRI 1LP9A 2VITB 3WDHA 2Q7YA 3BP7B 3RJQB 3B3IA 4PPTA 2R1XA 4KTEH 1OM3L 4HEPG 4KAQL 4FP8L 4PJGF 1A47A 3MV8A 1NFDE 1P7HL 4P46A 3OL2A 4GSDL 2X4UA 2ZUUA 3SY0B 1QR1B 1HHIA 4XTRD 2IGFL 4Q0XH 2DDQL 1HN1A 4B0MM 3GJFH 1JWSB 4OB5H 2BOBA 3KGRA 2FO1A 5K33A 2ATKA 2BNQD 4P0DA 5E6IC 5I1EL 3PDOA 3TN0C 4NQDE 4XNZC 4QRRD 1VADB 3KYOB 4QHMB 5TE7L 1A1OA 1F45A 1WJ3A 4NC2B 4OLEA 3S4SG 4U6YB 1EBAA 1NUFA 2EH8L 1H15B 4P2QD 3VFUB 1YMME 2B8OT 3UTQB 4X0KB 3IFLL 1R0AH 2AJ3B 1INDH 2NY0B 5I2IB 2VZSA 4X6CE 4PJ9B 1FGVH 2C4XA 5DC0A 5B8CA 5KVDH 4H5SB 5LXGH 4YXKL 3B5HA 5HYSG 1F3JA 4RFEA 3Q5OA 3TBYB 2W0LA 5GISH 3WN5A 4DOHB 2F8VA 3UTPD 1RZIB 3L5XH 2XZQL 3TZVA 5KSVB 4AH2B 5F7WC 2OQJA 3LKQB 1KNOB 3C60C 2OX5A 2EE9A 1I75A 1V7NL 1IC5H 1T2QL 3QI9D 1DLFL 4WW1B 1JK8B 2WLZA 1BEYH 3MO1B 4Z0BL 1Q9WB 2DI8A 1TDQA 2XTJD 3BP4A 4U1MB 2WLYA 5D6DA 4LLWA 5JW3H 3BO8A 2DYPD 2DWDA 3RVXD 2Q7NA 2YUWA 4M7JH 5C0CB 1AHWC 1OGAD 5ACZB 4WENB 3QUXA 1MHEB 4L8CA 3T65A 5BQ7A 4Y4FC 3UZQA 4X4YB 3HLAA 2FX7H 4AIZB 4GG6E 1FLTX 4G6AC 1T21A 4K71C 2UZXB 3VI4E 1U92B 3QUMB 2ZCHL 2VUOA 3OX8A 3UDWA 5C2UB 4CU6A 5IBTH 2FX8L 1UM5L 1HHHA 4NCDA 1S9KC 3IJHB 4N0UB 3FQTB 2E7HA 3LQZA 3W5MA 3VXSB 5DJDB 3HTLX 1HXMA 1MFDH 4LASL 1YPZA 4KK8C 3HB3D 4HKZA 4MJ2A 3UZVB 4XP9L 1AGDB 3QJFB 4KHXH 4R3SB 1Q72L 1JIBA 4JRWA 4OM0L 5ANMA 4IOIA 4RMRA 3PHQA 4N1CA 5FYKD 1PBYA 5J1SC 1WC7A 2GT9A 3QQ3B 1T5WA 1UB5B 4ZFOA 4HWZB 3VFPA 4PJ7E 1BECA 1BWWA 3BKCL 3MXWL 5K93A 2XNAB 4NJ9H 2NR6D 4KRMB 3HA0A 1KIPA 1P4BL 3Q6GH 5EPMA 5ESAB 5HDLA 1ZA6B 4Z7OE 2H6PA 4OIIL 4GBXA 2H45A 4I13B 4U1JB 1HQ4B 3SHSA 3VXMD 3FB7A 3SGKC 2DIJA 4RBPK 4GG8A 2R0LH 1NAKL 2R2HA 5TQ0L 3CC5A 5BZWB 4N0YH 3B43A 1RUQL 4M7KH 3SDYH 3RU8H 4YC2B 2A0LC 3OKEB 5LGHL 5FHBH 5T5FH 2LFGA 1M05B 2BSSB 1NAMB 2CLRA 5D7JB 5DDHB 2W92A 2HRPL 4JFYA 3MLYH 4LLMA 5CINL 5A2LH 4ETYA 5F7MC 1U95A 4RGNB 4RISL 1B0RA 4M8QA 4UQ2B 3HR6A 4TNVK 4Z76B 2V7NB 4L3EA 4PB0H 1IGIL 1DLHA 3RY6C 4Y16B 5EBMB 5L2KD 2LVEA 2OJEB 5FYKL 1JZ6A 4TRPH 4JPWH 4OGAC 4U7KA 3D85A 1S7XA 4PBXA 4IRJD 4M48H 5M95B 1MAMH 4AMKH 5CSBA 3Q1SH 1CK0L 1YUHB 2FECI 1DBJL 3GDBA 1OP9A 1QBAA 3SCMC 4X4MA 1OARH 1NMCC 2EEAA 2EYTA 3ALXA 4XCEB 5ERWA 2NY2D 4TYUA 3BHBB 4WV1C 1G1YA 4XVTL 4X6EB 5C0RL 2GJ6A 5ISZD 3BH9B 1LVEA 3EFDL 3ZT7A 4FA8A 3OG6B 5DHVA 3C8DA 5TDOB 4K3DL 1QVOB 5C0BD 2PKDA 3MJ8A 3QIBB 1ZVHA 5DMGC 3OKKB 1NFDB 5FF6B 1S7QA 4F7CA 4GKNB 4JFFE 2FO4A 4U1KB 1JYWA 1CT8B 5TGBA 1CGTA 1PEZA 3BH8A 4S1QH 4JM2D 4JQIH 4FQHB 1X5LA 3F12B 4L5FH 3KWWA 2F5AL 5L88H 1EUUA 4Q0XL 3L3HA 4NQDB 1UXSB 4OB5L 4LPXA 2V2XB 3AMLA 2E6PA 3ARGD 5GIRA 1YMMB 3I6KB 4XCYB 4ENED 4KROD 1R0AL 5F1NB 4I48A 1INDL 1I7ZB 5C09B 5E5MA 1FGVL 5CBEB 1D5MB 3P11H 3ZE1F 5KVDL 1SJEA 5LXGL 2J5LB 2X09A 4FN0A 4D0CB 3W11C 5GISL 5KG9B 4NQEA 2VWEC 5E94A 4YK4C 4NRYA 4XBGB 1NL0L 3HKFA 3L5XL 3MBEA 1KCVH 1XIWA 3LEVH 5E7FA 4OLXL 3Q6FA 1KLUB 1KPUB 3I6LE 4Y19A 1IC5L 5I74B 4ZAKA 3SDCC 2AGJL 1JYNA 4HKXB 3FQRB 4N68A 4A6YA 3LN4A 1QRND 5JOFA 4MA7L 1OY3B 3MGTB 4HT1L 1CLYH 5JW3L 4Z7VB 5C0GA 3T4AA 3PP3H 2HJFB 3QDMA 4XPFH 3WLWD 1JHLH 3C6LB 1RV6X 4M7JL 4FFVC 4CL7A 4BYHA 4X4XB 2AI0H 4UOW0 4GG6B 2X05A 2OR9L 1E6JH 4MB4A 4BUGA 5J6HA 3L3DB 4P2YA 4R26H 2AXFA 4BM7A 3H8NA 3DX9A 3DBXB 2RAMA 1MAKA 4HMEA 1QKZH 4PRNB 3V6BR 4PS4H 4MJIB 4GMSL 3FO0L 1U36A 3O4LD 4J3WA 5I8EA 5IBTL 3G6DH 3QDGD 4AENA 4NHUA 3KYKH 2F74B 4LKXB 3CUPB 4EQ2A 1F5WA 5J6GA 1YQ2A 3P0YL 4YHIB 3WBDA 3AM8C 4LPVA 2I9TB 4PJEF 3O8XB 1KB9K 5JLZA 1J8HE 1RMFH 4P2RD 4MNQD 2YUVA 5FHAL 1E4XH 2YD5A 4PP2A 5ESVA 4RCAA 1A4KA 2ZUSA 4PJ7B 1GGBH 4RZCB 1A7BA 2Z35A 5CBAA 3C09C 5DJ2B 3ARZA 2YD8A 3S5LB 1XT5A 5C86A 1ZANH 3NFPA 5IMKA 4NJ9L 2Y23A 5A40E 4S1SH 4JFHE 4WCYL 4O51B 4U1HA 2XWTA 5ADOH 1KJ3L 1T5XB 2BMKA 5C07A 1YYMH 4DZ8B 4U6XA 4NYLA 2DQTH 3C5ZD 2PN5A 3SKUD 2XKNB 5HYJE 3SDAB 5D1ZD 4HBCH 3ZL4H 3LKOA 4P9HL 4H1LA 4N0YL 2A9MH 3RU8L 4UU9A 1QSEE 4P4KD 4PRIB 2WWKT 2PTUA 3FQUB 5FHBL 5T5FL 1T66D 3HAEG 5DTFA 3UTSD 2HYMA 3VD7A 1LP9E 3PL6B 5BS0B 5HI5C 1HWHB 4L1HA 1PY9A 3KLAA 1NANH 3JTTB 4NN7B 2X9YA 5AD0B 4CVXB 4JZOB 3I84A 4K7PL 4RQQA 3ZYZA 5DHYA 4DWHA 5BW7C 1DQDH 4XPHH 1KSRA 1W72B 4DVBA 2VL4A 2D3VA 4F58H 3FO9B 3EDDA 4WHTB 1EA9C 2AXHA 1ACZA 3LMJH 1DVFA 1HYSC 3CXHK 4D9QE 1U8LB 1FZMB 2EDRA 2VN7A 1RHHB 2W1NA 3HUJA 2HJLA 1MAML 2APBA 3B9DA 1L4IA 1LEGA 4JO4H 15C8H 4J3VA 4AMKL 2VDKH 3Q1SL 5LBSH 5HHQB 5JW4N 5DFVD 4IOFD 3PXJA 1Q38A 4HKJA 3ESVF 2B4CC 1AGFB 3ARRA 1JGDA 3QUYB 1A14H 3CFJA 4WO4D 1T7YA 4ODXB 3BGMB 2V7HA 2UWEA 4KK9D 5JHDD 4HK0A 4Q6IA 4MSWB 5IHZB 3ROOA 2DBLH 3U4AA 3PWPD 3RPIA 3LRSB 3FQXA 5GGQL 4O9HH 1K6QH 1SMAA 1U41A 4ZFZB 5TE4H 2AXGA 3TBSA 5E95B 3RAJH 1FHGA 4TSCH 1EHXA 3O3BA 4S1QL 4F2MA 1P4LA 1EZVY 2DKUA 5E00B 4PRDA 3PWUB 2IBZY 1OP3H 4MQ7A 2CLZB 4JQXA 3QPQC 5D1QD 4LLUB 1I8IA 5F88B 1D5XA 4YNYA 3BIKA 4RGNC 1MEXL 2EDKA 4MNGE 3MRCB 4OV6F 3DROA 4R96B 4IHOB 3F65A 3AU1B 5CIPB 5DJ8B 3KPSB 4Y16C 4BZ1H 4P23C 3P11L 2EDDA 1T04B 3UTZB 3TEUA 3PV7A 1F58H 1MJJA 2XXCB 2CKBA 3RP1A 1KEMH 5LGJA 5FYJH 3KYAA 3MA9H 1BIIA 4GW1A 4Y5YA 4XMPL 1FG2B 2ARJA 1TQBB 2CRYA 2YPLA 1KCVL 3LEVL 3QH3B 2OL3B 4WGVB 1YPZE 4M5ZH 3JV4B 3MV7A 3NIDF 3KG5A 1ITBB 1QTYT 5HTSA 1AI1H 1EZVX 2N1KA 3R06B 4LRIA 2UVEA 4YQXL 5L9DL 4LRNL 5ANME 3X13A 3QQ9D 4M03A 3WMSA 4OF5A 3NCYS 1KTDB 3GKWH 3MLZH 4PR5B 1N2RB 3U30C 1CLYL 4RA0C 4XXCC 4H25B 1HXYA 2ZWLT 4QRUB 1KPRA 1OSPH 2DM2A 4OM1H 2ED8A 4XPFL 1KPVB 3MC0A 3ILQC 1JHLL 2B1HL 2X4PB 5EZLA 4XMKH 3L3OA 1CU4H 1WFOA 4JZNB 4OIBA 2C1PA 1D9KB 4G9FA 1E6JL 1ZK9A 1IM9A 4JRYA 4MS8D 4ISVA 5D7LD 5ICZA 1A9BA 2YPKB 2MWCA 4ODHL 3RIAK 3IYLW 4PS4L 8FABB 1YZZA 3P4MB 4ZO7A 2C3VA 4LPYA 2XRAH 3REWA 1DCLA 5FCUL 3UP1A 1KIQA 5C6TL 4DKAA 1M7XA 3LHPL 2IFFL 4ONHA 1BQLL 5TH2A 2VLRD 3RIFF 3V5KB 1UA6H 1KGCE 2BOCB 5L7XL 4LAQH 2OXGA 2UZIH 1IEBA 1CQKA 1RMFL 4NKIH 1KJ2B 2JELH 3NACL 1RPQA 4L3EE 1E4XL 4HH9B 3U0PB 3VJ6B 4QRSB 5GS2H 2A9NL 1GGBL 3P0GB 1SEQL 3VD3A 1G84A 4JKWA 4MB5A 1CF8H 3JWDL 1LEIB 1JN6B 1K4DA 5MERA 1BX2A 1YNTA 5CKGA 3O11A 5JIHA 1ZANL 1NCTA 5EO9B 2DBJA 4S1SL 3WFHA 4X5XB 1FFNA 2VC2L 4M1CD 1KB5B 2PXYB 3ZTNH 1T03L 5FA3A 3EGSB 3R0MA 1U2CA 4XBPA 5HYJB 1IGYB 4U1LB 5I1GH 2NY5C 5GGSA 1MI5A 1YYML 5FYKU 3SJVE 4TUJB 3QWRD 3MJ9H 5E0QA 2YC1B 2DQTL 1WGOA 3ARDA 3VD9A 4ZFFA 4FG6D 4NBZB 4M62H 3ZL4L 3QDHA 1VGKA 1KTLB 1S9WA 5CEZE 1LP9B 4CDHA 3N0PB 4YE4L 3PP4H 4PD4J 2JE8A 1T83C 3MRJA 2NY0D 3AXLA 4PJ9D 4WU7A 4NC1E 3F5WA 1KYOJ 1RZGB 5AEAA 2YWYA 3WDIA 3MNWB 1PLGL 4MJ5B 3TCXA 3MUGA 4F58L 1HHIB 1XGTA 5HDBE 2HG5A 1BLNB 1CD0A 3KDMB 4KJWC 4CJ0A 3HZKB 2P8MA 3IS0X 4OFIA 2VDMH 1HCVA 5DYOB 3MRHB 4JO4L 3O2DA 1CICA 1HHGA 2EE6A 1W8NA 2C3WA 5LBSL 1GOFA 5F89B 4CMMA 1R3KA 1UADC 3M8OL 3C08H 43C9B 3KPQA 1N6VA 4MD5A 4HLZH 4PP1D 4NZTH 5SV3A 2YS4A 3RI5F 4CGTA 3I02A 2Q3AA 5C0CD 2KPNA 4YHZL 2KQNA 3P3YA 2CKNA 4GFTB 3WN5B 4J3TA 4MAYB 4P5TA 4WWKB 5EOCJ 4YLQT 5FYJD 4G7VH 3TZVB 4JEGB 5B22A 4NQEE 1AR1C 2DBLL 4DGVH 3KLDA 1NDMA 4QNPF 1AE6L 4D3CH 2D7PA 2GAZA 5IB1A 4Z5RA 4O9HL 5KVEH 5KAQF 4QGTA 4Y19E 4MWFB 4UNVA 4R97C 3RAJL 3EKCA 2R2CA 4MD4A 4M3JA 3VXSD 1H0DB 4LLWB 4PG2A 3F7VB 2EIBA 4F37F 5I30H 1P7QA 4PV9A 4RWHA 3X11A 1DBAH 1T80A 4BZ2H 4S0SD 2VQTA 4JN2A 3ZO0A 4YDKH 4C58B 3QNXA 4K8RH 3TNNA 4NO0A 3T65B 4MNGB 1FFRA 3VXNA 1I3RA 3VRIA 2ADGA 3EO0B 4NOFA 1VCAA 5EUOF 4JHAH 3D2UA 2G75B 4G80A 3DYOA 5JXED 1BAFL 3IDIA 3NIFF 4F7EB 1PAMA 4BZ1L 4ELKA 1DBBH 3FZUD 4QXWA 4P59H 4JN1H 4ORGA 3PHSA 4JFPB 3VFWB 1AC6A 4UAOC 5CJBA 5FYJL 3MA9L 2EDOA 1MCIA 2B2XH 3TC9A 3LPGA 2PO6A 5I15H 3MRLA 2MHAA 4M5ZL 5IQ9A 1PKQA 4IOIB 1TQCC 5DA4A 4G8EA 4HUVA 1RJYB 5F3BA 1FGNL 2GT9B 5FUOL 4BJLA 3T0WA 4QXUH 4Q58C 5D7JD 1YDPA 4O00A 3CSYB 3QZWB 1DDHB 4YUEH 1CDUA 5EPMB 1D6VH 2R9HD 2XIDA 5T1KA 1OSPL 2YUXA 3BP5A 3U46B 3MNVA 3IJSA 4GBXB 3D39A 4UB0H 5C6PB 5JW4R 4CADB 4KKAC 4NQSB 4WUUB 3CVHH 4M7LH 3FB7B 2FHCA 4UINL 5DA0B 4OGYL 2ITCB 4N9GA 1CU4L 4E0RA 2A6JB 4NP4L 5D70H 3O2VH 3QEQA 3E6FB 5C07E 4YHYB 1WFTA 4Y5VB 4Y7MA 3CC5B 4XNMA 2BVOA 4Z0XA 5C0ND 4JR9H 1OVZA 4KTDH 3U82B 3DSFH 3RNKB 3FRPG 2XRAL 3FL7A 4G8GB 4YZFF 1I9RH 1UCTA 1A0QL 4UQ3A 1U95B 5L8JB 4JDZB 2CMRH 4JFXA 1DEEB 3QUZA 3MFFA 4IDJL 2G5RA 1NANI 4LAQL 4JGJA 4L3EB 2UZIL 2YK1H 3LD8B 2VISA 2DN7A 2R0KH 1PKOA 4NKIL 1KBGL 1Z9MA 3L95B 3TGXA 1ZSDA 2JELL 1MQKH 1QBLL 4JG0H 3D85B 1JNNL 4R0LA 4A2LA 3MLTA 1NAML 4W4OC 1HEZA 4NKQB 2BRQA 2R2EB 1MLCA 3CFEA 3QIBD 5E7BA 1H3XA 1RUPH 2BVEA 1WSST 2AERT 3GGWA 5IF0B 3HUJE 1EIBA 1TQBC 3G5XA 3LKSB 4GAYB 1BZ9A 1W72H 3O6FD 4NZJA 3VH8A 3DMMC 1O0VA 2FJFB 3BPLB 4H0HB 3SJVB 5B21A 5H94A 2JCCA 3GRWA 4F3FB 5GSVB 3UTTE 4ONGH 5JPNA 5I1GL 1F4XH 2HLFD 4NQDD 1I1RA 1A6AA 4P3DB 1PG7H 5CP7B 1OTTD 2LU4A 1I1FA 1W0YT 1YMMD 3G5ZB 2YA2A 3OXSA 1LDPH 4UV4L 3EJZD 3QI9C 4B7LA 5D7IF 4UDTA 3H3BC 3MJGX 3MJ8B 4P2OA 2ICWA 3DURA 2JIXA 3DPBA 4JFZH 1VFAB 5GS0H 4LSVL 4JFEA 5D9SB 2FNBA 2QKIA 4LP4A 4YIQA 1MCDA 4JKKA 4U4BA 1AP2A 3KPMA 4EOWH 1SVZA 3D3VB 3KAAA 3GMOA 25C8H 5EN2A 5LG1A 4JPIB 5E1AB 5F9OH 4YXHH 4M9OA 3KPRA 5D7KE 1ZVSB 3HC0A 4DGYH 4K8RD 4X7DC 5E8NA 5KS9A 1L0QA 3T2PA 4PRBB 1D6EA 1V3LA 5D2NA 1JCKA 5C0EA 4I1NB 4OCXH 1NGZB 4W4NA 2IJ0C 3QEHB 4I48B 3MUJA 2K7QA 4YXLH 4U6TA 2E27H 5F9WB 1FAIH 1SJEB 1SM3H 3DTXA 3C6LD 3RHWF 4I0CC 4QF1A 2PYEE 4UDUA 1MSPA 4OGXH 1JHTA 1PX4A 3MBEB 3MRPA 5EBLB 3MV01 1F2XK 3VWJB 5I0ZA 3D0LA 3H9HA 4PJ8A 4FXKB 2R2BA 3GZKA 4QHUB 3QO1A 4Y19B 4D3CL 4CKVX 3RVVD 3MV7E 4ZAKB 1IAIH 1M4KA 4FABH 4A6YB 5I9QB 4LVNC 4QCIB 1JWUA 4KRPD 2A83B 1BM3H 5JOFB 5IG7A 1UKSA 3RGVA 5I71B 3VGFA 4QRTA 5EC1A 4KV5F 2WW8A 3QULA 1IEHA 3O8XD 2BJMH 5E8PA 4BZ2L 2YSSB 3L1OL 3LKPB 2A73A 1A5FL 2VDRH 4K8RL 3IJYA 3OJ2C 4GRWB 5I8CA 2UYLA 1X7QA 4HSQA 1YY8B 2CQVA 3R4DA 5GHWL 3DX9B 4QRPA 5F3HB 2AJZA 4G9FE 1K8IB 4J1UA 5KSAA 1MCCA 4NHCL 4JHAL 4MCYA 4Z95H 5HDQH 1O7VA 5I8EB 1I7TA 3VFGL 5I1KH 4G6MH 1DBBL 3HPJB 4P59L 4JN1L 5J6GB 3LB6C 4J4PD 1LILA 3UBXI 4HWUA 1RIVH 2YD7A 3RVWD 1QR4A 5JLZB 4C56E 3CD4A 3MXVH 2F19L 1PX3A 3NCJH 5I15L 3SDAD 5C70A 4UIKL 3PV6B 5D72L 2DQCH 1LNUA 4JCMA 3EZ8A 2Z35B 4M1DL 5CJXA 1F2QA 2AK4A 3E3QC 4QXUL 4DUWA 2IQAA 4JANA 3PL6D 4KY1H 3SDXA 3S5LG 1Q0YL 1A6VH 1FLRL 3ORJA 5E4EC 3U4BL 4O4YH 4ODTL 5J4MA 4OQTH 1XGYH 3AREC 3BEVA 4GRMB 1KJ2H 5DT1L 5C0AB 2OJZL 4UB0L 4PGZA 2XWTB 3KLHC 5EUKB 2BMKB 5C07B 5DRNA 4U6XB 2C7UA 3CX2A 4L8DA 5D70L 1U3HA 2WINA 4NKOB 1MI5E 3S9DB 2VLLB 4WI9A 2EZ0D 3HI1A 4H1LB 3DI3B 1CFBA 3O3EB 2AEPH 4UU9B 2P24B 1FZKB 4KTDL 3DSFL 3VXPB 2WMPA 4C57C 5HHOA 5DTFB 2DLEA 2V5YA 4L8SA 4B50A 5E99H 4LCUA 1I9RL 2ATPA 3QUYD 4KJQD 2GW5A 1R6VA 2CMRL 4KJPD 4DGIL 1G7QA 2VL5B 5DVOA 2LV4A 5DI8B 1I8MA 2MKWA 1IL1A 4LU5L 4XC3H 5KN5B 2R0KL 4MVBD 2B39A 3RTQB 4QY8B 1DVFB 3U9UB 3K1DA 2XI9A 4JFFD 3MV11 4ENEC 5IOPB 3K80A 4DN4L 3HUJB 5EIIB 3FO2A 3RZCB 3DVGA 4QXTB 4X5WB 1RUPL 1J0HA 4OI9A 2UVFA 5H37G 3MGOB 5D2LF 3JV0A 3RUGF 3ZT5A 5EU4A 1W72L 5HVGB 2GFBA 2APXA 2DKSA 3UTTB 4PTTA 4HUXA 4B5EA 2GTWB 4PGDA 5JZ7D 3UYPA 2DL9A 1RUKH 1CN4A 1I9EA 2YZ1A 3QA3A 3RWGA 5DQJB 3IFNH 1PG7L 2PF6A 1CFTA 4Q6IB 2UZYB 1W0WA 4X9BA 1OB1B 4KQ4L 3ROOB 2QHLA 4HIIB 1AQDB 1OD7A 4AM0A 3FQXB 5JDSA 4M93B 1GIGH 3JXAA 2AXGB 5GRVL 3TBSB 5JXAL 5FOBA 3PQYA 5IGXH 3O4OB 1J87A 2YBRB 1FG9C 2P8PA 3V0AC 1NCNA 3VFNA 1ADQA 5TJWK 4J6RH 2AV7A 3ET9F 4PRDB 3M45A 1UKQA 3I6LD 5F9OL 4YXHL 4DCQA 4R90H 2XACC 3RVTD 1DR9A 3TCLA 1A22B 5GGRA 4U05A 4U1GB 2X7LA 4HDIA 1D5XB 4YNYB 4DGYL 5FO7A 4G9DA 1A21A 3TBVA 3ROLB 4BQ9A 2DICA 1H8SA 3JUYA 1IQDA 1QG3A 5DD1H 4WW2F 5F1IA 2FATL 3N1PC 1RIHL 2J8OA 3P4NB 2E27L 2PYEB 3ULVE 5ALBH 1R5WA 5F6HI 2I5YH 3MCLL 3TVMA 1MJJB 4NM4H 4PJFF 3U79A 5CSZB 4Y5YB 1D9KD 5LQBH 4X8JA 1X5GA 5ETUA 3MRRB 2X6MA 4JY6B 3MV7B 1QPXA 1B4JH 1FN4B 3ARFB 1PKQE 5D96C 1IAIL 4UIMA 4FABL 1YY9C 2WWMC 3K2UL 5GJTL 4HZLA 4YGAB 3EOAB 1BM3L 3DLQR 4N8VA 3VMOA 5E6ZA 1XGRA 1J8HD 1YNKL 2CDGA 1HXYB 4OZFA 2E6QA 2NNAA 2F53A 2K1MA 1G9MH 3RY4A 2BSTA 2Q8BH 3MZGB 1SQ2N 3T0EB 3RX8A 4WEBH 3MROB 3D39E 3V7MA 1F4WH 3S96B 2BNRA 2QTEA 4JO3L 5DK0B 3SO5A 1IM9B 2YA1A 1MRFH 3HE7B 5GGTL 5KVGH 2YD6A 3KYMA 2D4FA 1GZQA 1RZJH 4JREB 4HIJB 3QEQE 1AO7A 3ZT6A 1Y18B 2DIBA 3EOTH 4JFHD 5DR5H 4ZO8A 5DJ0B 1BVLB 3K1KC 5I1KL 2HT4C 3QHFH 5A2JH 4WEMB 3SN6N 3U2SB 2PXYD 3HR5B 4ONHB 4MDJA 4S1RH 4C56B 5HYJD 3SKMA 2ZUXA 2R1YA 1M6OB 3MXVL 4LLAA 5IEHB 1U91A 1B88A 1G6VK 1QSED 2EEDA 1E4KC 2BP3A 3OTTA 3MRMB 3GM8A 1XCQA 3KNBA 3NZ8B 5C0JA 4PJXF 4B41A 3MODH 3D9AH 3HZMA 4UBDC 4N1HB 3O11B 1ZKAA 5HXMA 1LK2A 2VR5A 3SKNA 1A6VL 1FFPA 5HBBA 3WFEH 4LMQI 3VWJC 5HYIA 4P46D 5CEYA 4UT6H 1A64A 1KJ2L 3QHZL 2J6EL 4NZRH 4D9QD 4XBPB 1KFAH 5GGSB 1TJHH 4CN6A 4O2FA 2JCCE 2P7TA 3GUTA 4NZUL 2Z31C 2W91A 3QPXL 3LKRB 2AQ3A 3RY5A 3U0WH 2AEPL 3QEGL 1TVHA 3B8SA 2ADJA 4PJ5A 4WI6A 2EDLA 2EXWD 2PUQT 3AXLB 3VI3E 1P84K 1XGUB 3HE6A 3WS6C 1OP5H 2GUOA 2ICEA 3GNML 2SEBB 2YMXL 4DTGH 4EDXA 5J13B 3TFKD 2ERJB 4JFEE 5CEZH 1HCFX 1YQVL 2A6KB 5H2BB 3X12A 1CL7H 1A9EB 4C83A 3FQWB 4MAYD 1U8IA 4XC3L 4WWKD 1NBZA 1HNGA 3TZVD 2CXGA 1GC1H 5DHVH 5BJTA 2RHEA 1G7MA 3T2NH 1DTUA 1T20A 2RB8A 3VFRB 2P8MB 3QIWC 3KPRE 5CZXC 1RHFA 1UZ6F 1CICB 3GIVB 4E41A 4FS0A 5IMLA 5KS9E 5F44A 5FK9A 3ZDZF 2CIKB 5D2NE 3KPQB 1CDJA 2IADB 5EU5A 1C5CH 4K94H 1H3VA 1YEDA 4LARL 4JY5H 1MREL 2Q76A 4Z7NF 3QG6B 3QXUA 5KVFH 3CFIC 1CLOL 4P5TB 4PJEB 3MX0A 3UROR 5I73C 3PGCA 2NY3C 3BX7C 2PR4L 5DZNA 5IW1B 1WLHA 1TVDA 1NDMB 2X4OA 1A7RL 3LQAH 2DQDL 1NEZA 4Z5RB 3IU4H 1VFMA 2VAAA 4Y4HA 4TUKH 1UWXH 1IAII 3ZZ1A 5IGXL 4ETQB 4MD4B 4P49A 4NQCE 1E27B 3KYNA 4PV9B 1KTKE 2WBJC 1AD9B 3FAXA 3CXDH 5EOTB 4R90L 4R4BB 2X1WL 1DSFH 4EDWL 4U1SB 3DWTA 2EICA 3TNNB 2FR4A 2FL5A 2R69L 3TLRA 3VRIB 2CDEA 1S7VB 1C5BH 1B0WA 3S3SA 3ZHDA 1T1XA 3OWEA 4CMHC 5CEXB 1FCGA 3P77B 1ROWA 1ETZB 2W9EL 3IDIB 5DD1L 3L9RB 4UILH 5SWZE 5SV4A 4X6BA 1MCSA 4ZXBA 3RTQC 5F9JB 3CFBA 3LRHA 5DSCA 1LO0H 2G2RA 1U6AH 4ORGB 4GBXD 1HSAA 1Q1JL 3FTGA 1H5BA 3FT2A 1EHNA 4XCFH 4WRLA 4QT5A 5LQBL 1HKLH 2PO6B 5FYLE 3P30L 1Z5LA 2MHAB 3S98A 1I1AB 1PKQB 1T4KA 4MCZA 1MJ8L 3DUSB 1EAPB 4O2EA 5F3BB 2H26A 2MKLC 1A7NL 3WUWA 2V5TA 4G8GD 3RDTC 3QZWG 1KGCD 1BMGA 2AK4E 3GI9H 2MQ3A 3SDXE 3B5TA 2OZ4A 3V0WL 3BP5B 4L3ED 1G9ML 1BFSA 1OHQA 3ILPA 4HJJH 1S3KH 1P1ZA 3D87B 3QSKB 2Q8BL 3GSWA 4JLRA 1AXSB 1ZLWH 1HH9A 3D85D 4ZFOL 1OLZA 4NC0B 4XPGL 3O4OC 5KVGL 1U8MB 4RAUA 4XNMB 4XNXH 2BVOB 3O9WA 2KBGA 1RZJL 5D1XA 4Z8FL 2W9DH 2VLKA 3QHFL 5K9QI 5CJOH 4M6AA 3ZSTA 3SJVD 2ADIA 1IGCH 1G7PA 1T1ZA 3QEUA 1SMOA 1TLKA 3BD3A 3PWJB 4G5ZH 3OXRB 3LPFA 1WBZB 1F90H 4H1LH 3UPAA 5BV7H 5CEZD 1H3UA 2DQHH 5DO2C 5D5MF 4R0LB 2A74A 1G9EA 1XGQA 1PSKH 2JB6A 2G60L 3O3AA 2ZP0T 4CN4A 4F7TA 1M7IA 5ELIA 1N3NB 1JZ4A 3D9AL 4MHHG 3R8QA 1Q94B 4PP1C 2CPCA 1BZ9B 1CS6A 2ZKHH 4NIKB 1WCQA 2B5IC 4KKBC 4MLSA 3B9EA 3WIHA 2BC4B 4UT6L 5H8DA 3NA9H 4IRZH 4PLKD 1G7JB 2HTKD 3ARFC 3MPCA 5H94B 2JCCB 1SY6L 4NZRL 1LEKB 1HQRA 3MLUH 3QCTH 1KFAL 3TIEA 1D5BA 1FDLH 1TJHL 5INCA 1OAQH 3LV3A 1MFNA 1NMAH 2QQNL 2D7TH 3S4SA 1EO5A 1I1FB 3S37L 1YECH 2CK0L 4WHDA 2XQBH 4WHCA 4U7MA 2ICWB 3DURB 3T0EC 4QHLB 5HYSA 1KELL 4UTAH 1Y6KR 1EEYB 4M6ML 1SJVA 4NBXB 4NN6B 2CR6A 4JGMA 2CGRL 2F58H 3FN0H 3PQYE 4JFQA 4NO2B 4NQED 5F7KC 2BFVH 3ZE2F 4JGUA 4JREC 3GMOB 3RGHA 4NQXA 5EN2B 3MBED 4IMLB 1XIWD 2EIZA 4ZUWA 1GC1L 4GKSA 1CXFA 3KPRB 3T2NL 4YDVA 4QRRA 2WIIA 3VXOA 3ARQA 2DTSA 4Y19D 3HC0B 2DKMA 5EDXA 2W65A 4ZAKD 4P2QA 5E8NB 5KS9B 2AS5M 3OB0K 1D6EB 1YEIH 4OLWL 5C0EB 4JO2H 4X99A 3IGAA 3V4VH 4AQ1B 3FO1B 3QHTC 1G6RA 5IWLA 5C08A 4M43H 2OSLA 2Z8SA 1NCAL 2PETA 4K94L 1N26A 4O2CA 5ICYA 4H0IA 4QF1B 1CGXA 4Z6AT 3EHBC 5KVFL 1EMTH 1A7OL 5F71A 3V6FB 1DJSA 1IFHL 3N9GH 3MRPB 5F7HA 3D0VA 4TSAL 4OF6A 2FLBT 5A2IH 3D0LB 5HHXH 4Y4KA 4BQCA 3LQAL 4P57B 1U58A 2IALB 4JO1H 4TUKL 2CKBH 4NQCB 5CCKL 1MFAH 3BPNB 1A02N 3Q0HA 1M1SA 1NSNH 1Q8MA 1SJHB 4QRTB 3TJHC 4FMKA 5DFTA 3L3KB 1IC1A 4K7PX 4I4WA 2AVGA 2A73B 4KHTH 3CXDL 1LE9A 2F53E 3CU7A 4F80A 2EKSA 3FFDA 3MOQA 5I8CB 3OR7A 5JW4Q 1GCFA 1C08B 3DUUA 4JHBA 4A6YL 4XGZA 2AJZB 2O5YH 3BQUA 5DUMH 2ERJC 5GSRB 4Q2ZB 5SWZB 3WUZA 1UKTA 1EERB 4MCYB 2UY6A 1NC4B 1VFBB 5LCVL 2W07A 4KMTL 1AO7E 2VKWA 4BK5A 2VIRA 5IJKC 2VDNH 4NGHH 1LO0L 4HZAA 5D7IE 5C0AD 1T7VA 1QLFA 4I8DA 1CZ8H 3GBNH 2QSQA 4LIQH 4KZDH 5C07D 1U8KA 4XCFL 4LF3A 1HKLL 3W82A 1QA9B 3WO4B 2FBJL 2R1WB 1PYWA 5GPRA 4CVWA 5DK2B 4KFZC 1AIFA 4QYOA 3PNWA 3GSRA 3T3PE 1DUYA 1HHKB 2AK4B 5DVMA 5IKCA 3C2SA 4JANB 5J06A 1P7KA 3O6FC 3O6MH 2HTLC 3M17A 1LO5B 3A6CL 3T3MF 3VXMA 3NH7H 4R8WL 2P8LA 1JYVA 4HJJL 1S3KL 4IJ3B 2ZG2A 4RMUA 2Y6SC 5DRNB 5BXFA 1DVFD 2D7QA 1C7TA 3EYOA 4MJ6A 2WINB 1L9MA 2HJKA 1B90A 2V5RA 3RZCD 5K9JH 3DIFB 3MUY1 2XN9B 3G6JA 4OD1L 1TCRB 5B3NA 2W9DL 3TO2A 1VA9A 2IANE 4LCUB 3UTTD 4PJ5E 5DF0A 5SX5K 2H8PB 3BZEB 1BF8A 1G7QB 4OLYH 2FIRT 4FTVA 4M00A 3IDNB 1IAIM 2BVPB 5IUSA 4L8BA 2MQCA 2Q6WA 5IROC 1CL7I 2BXYA 3V6OC 4JKMA 4RIRA 3MNZA 3VGAC 5B39B 2H3NA 2EDWA 3FO2B 5FB8A 2X9WA 3DVGB 2CLVB 1L7IH 4JFOB 1YEHH 5EUOB 1OAYH 5F1OB 4XCCH 5FFLA 3VXUB 3U0TA 2AKRA 3F58H 3GSQB 2ZKHL 4V1DB 3S36H 1I1AC 2E7LC 3FMGH 2BVQA 4PTTB 3UAJC 4XP1H 3I85A 5D7KD 4PGDB 5IBUG 4H8WL 43CAB 4PTUB 3QCTL 2VXUH 3QA3B 4OCNC 3RWGB 2IMMA 3TA3A 5ESQA 1ZMYA 3Q2CA 1NMAL 4FFYH 1CFTB 4KI5F 2EXYD 3BI9X 2F8XC 4K3JH 3CPLA 4I0KA 4WDIB 4XVJL 5C0BA 1G7LA 4NJAH 1YECL 4BSVB 5MENB 4HIHA 3V6ZA 3I2CH 3ABZA 2PYED 2NZIA 3PQYB 5B3JE 4UTAL 1AFVL 2MOVA 5T3ZH 2NMSA 2P8PB 3VE0B 3FN0L 1JPFB 2BFVL 4NQVB 1IM3B 4AJ0A 5I76A 3L6FA 3MRIB 5FO9A 4DCQB 3MV7D 1JZ3A 1HNFA 4DK6A 2X7LB 1EXUA 3CZFA 2CDFB 2X1PA 2YEZA 3STLA 4L3CA 1XFPA 1YEIL 1KTRL 3QDJA 3V0VA 4JO2L 1OL0A 2O5ZL 4ZS7H 1CIUA 1DN2A 2O61B 1R24A 4PBWD 2YD3A 4MA8L 3SEPA 1DUZA 3SDDC 4M43L 2Z93A 5TDNB 1G9NL 1QO3A 4R6UA 4RMTA 4K3EL 4OZGF 4G6JH 5FIEA 1BD2B 3TO4C 1EMTL 3NPSB 3T09A 3HNTL 4G9FD 3N9GL 3QRGH 2AJSH 1IM9D 5ETUB 3HE7D 4LSPL 3RWHA 1BOGA 1JI2A 5HHXL 3JWNC 3ULVH 4XPTH 1QRNA 3F8UB 3B2UC 1QLRB 2H2SC 4EI6A 1NUDA 1ND0B 1OT2A 5E6IA 1WF5A 2CKBL 3QXTA 1MFAL 3O6KH 4FOMA 1I4FB 3B6SB 2FB4L 2OTWA 5D93C 4C56D 4F9PC 1JF5A 4GQPH 3ULUH 2F53B 2FIKB 2PTVA 4JM4H 4ZUUA 3ZKMC 1SHMA 5IMMA 2CK2A 5MEPA 2Y72A 3HRZB 1JBJA 1ZT1A 1BBJA 3LOWA 5IVXA 4TTDD 5T5NF 4NN6C 1GZQB 3O4LA 2O5YL 3CFDB 3B2VH 3QDGA 1AO7B 3C60A 5DGQA 4MYWB 2OP4H 1EK3A 1AY1H 1JJUA 5KSBA 5D7IB 1TETH 4DW2L 5GS0C 4Z9KB 2V5SA 1F11B 2VDNL 2BY1A 4NGHL 3E8UL 4HK3J 1BHGA 2VLKE 4MQXC 3L3JB 5IMOB 4YDJB 1EGJL 4MNQA 4YH6A 4N5UA 4RGMC 2NTFA 4OI7A 3ARDD 3WD5H 4KK6C 2QL1A 4OCMC 1UGNA 2RCSL 1XCQB 5GXBB 3KNBB 4OCWH 3HCVA 3HAEA 5BRZB 2ITDB 4Q9RH 4Y4FA 5AWNH 1NCBL 3H7BB 3BKMH 4PJBE 1QFUH 4ZTPH 4RFNB 1LK2B 3SKNB 2ZUWA 1FFPB 1IQWH 4JHWL 1XF3B 5JQ6H 4ONOA 4QTHA 5DJXA 4D0DA 5H35A 1MCLA 1HILB 1UYWL 5J9PA 3RWIA 5I1CH 1WTLA 4U49A 4I18C 2ZOLB 1YC7A 1J11A 2WUCL 5E8EA 4O2FB 1T3FA 3GUTB 4OV5B 1F4YL 1YEFL 5A2FA 2ZSWA 4WY7H 3TBTA 2IC2A 3EYQD 3UTSA 3CIQA 5D71L 1CICD 2IANB 1TVHB 2NW2A 1KCRH 1CTOA 5DUBB 5BOZG 4PJ5B 1K2DA 3GRWH 2WP3T 3HE6B 2GUOB 2ICEB 4F7MA 3LIZL 4QLRA 3PGDA 1JPSH 3S6CA 5IVNA 4OLYL 3X12B 2P45B 1WFNA 1KIUA 3ARBB 4PRHE 2XA8H 1MCOH 2AK1H 4P5TD 1NBZB 1N0LA 3N1QC 3C5JA 2BZDA 4YAQA 4L9LC 4YFDB 1K4CA 4G8IA 3ZDYF 5BJTB 4NRZB 2ED9A 3OB8A 2JJSA 1UACL 3V5HA 4S11A 3RNQB 1GVIA 1GAFH 3MOBL 1ZS8A 2QJDA 5IMLB 4P2QE 3ZDXE 2NCMA 1FO0B 5JA9A 4RX4A 5FK9B 1YEJH 4QRQB 3K8LA 3FMGL 1DBMH 3UMTA 1P7QD 2ORBH 4JY4A 4S1DD 4D9RD 1KULA 1YEDB 1J12A 2VSDA 3QNYA 5C08E 5JHDA 3EJJX 1PEWA 2QSCL 4HS3B 4JFDA 2VXUL 3RWCB 4CVZB 4DZBA 4TVPE 4PJHF 1RJCA 4FFYL 3O2DL 3PWPA 2X4TB 3RY6A 1FNEB 3PGCB 4K55A 4Z7QF 3X17A 4NJAL 1RZ8B 4EN3C 3D2UD 4PLJC 1QHOA 3ULVD 1JNHB 2DQUL 5E8DH 3UJJH 1IEAA 3I2CL 2PTTA 1C8PA 3QCUH 5K59E 2XTJE 3B9KB 5CD3A 5L8KB 4XH2A 1AGCA 5FKAA 1PQZB 5IBLC 2I9LB 2UV3A 4LQFH 2W0FA 4ESKA 1TVBB 1J86A 5CP3A 2B20A 3LKNA 2QQLH 2PO6D 3G6AA 2VXTL 2E7BA 1B9ZA 1NLBH 5JOPD 4WV1A 2EIDA 3BWUC 2FR4B 3RWJA 1J05B 4IMKC 5DEGB 1FNGB 2HKHH 5HHPB 1UG9A 3QJHA 1BFTA 3BP6A 2EYRA 1PGRB 3IAPA 4ZS7L 4BSWA 1HOCB 35C8H 1OLLA 2VDOL 3CFBB 2X70B 3GB7A 1G0XA 3MRDA 5DSCB 3QYCA 4OCYH 1FFOA 4EI5C 3D39D 4GRLB 1NBYA 3FTGB 1CR9H 1RJZB 5CGYD 4F33A 3FHQA 1FJ1A 4FQIL 1TFHA 3IDYC 5DD3L 3MUZ1 4QT5B 1BFVL 3WNNA 2AJSL 3QEQD 1Z5LB 5F7UA 1F00I 3C87A 4OAWB 3L5IA 3ULVL 2H9GA 5E24E 2V2TA 1NGWA 1JV5B 4Y8AA 2WAHA 5I6XB 2O26U 2XPGA 1TZIB 3MRKA 3SOBH 1E28B 2DMKA 4UTBH 1WICA 4UT7H 4JE4B 1S7WA 5EU7E 5I1DB 3ETBF 2NX5A 4Y2OA 3WFBH 1OSZA 4KUZH 4WU5B 3MA7A 3RL2A 4JM4L 2FSEA 2X1OA 3DX7A 2DRUA 4POUB 1P1ZB 4FFZH 1IC4H 3GSWB 4JLRB 1WFUA 1HH9B 1ZV5A 4XWOC 1ZEAL 4PJIA 3OAUH 4YHNA 3O9WB 1ZHKA 3BDYL 3MLRH 2OP4L 1AY1L 2GITA 3AS0A 4EJ1C 1TETL 3SDCA 2VLRA 5DRWA 4H88L 3G6JE 4HJ0C 5F96L 1MLBA 3QEUB 4P5KB 4NBYB 5GQBA 3GI8H 2YWZA 3UC0H 3WYRA 2JTDA 2NY6D 3FT3A 3WD5L 4FTVE 1NEUA 3BP7A 3DETC 4G7YH 3N85H 3F7RA 1NGPH 2A74B 1F13A 5CD5D 2R0ZH 4PJBB 1RURL 1IGMH 4P2OD 4F7TB 1M7IB 2JIXD 2CIIA 5FGCE 5J8OA 2Z91B 4JFED 4ZTPL 4ZUSA 1IQWL 3EYSL 3SY0A 1QR1A 4WW2B 5JQ6L 5IVZA 4OZIF 2OR8A 2AJUH 1U9KA 5I1CL 1JWSA 3NCFB 3QUXC 3PWNB 1ZLSH 4S0TD 3QIUB 2W60B 4M61A 5I19H 3TIEB 3AM8A 4OCRL 3KPRD 4PJFB 5DK3A 1IMHC 4HGKC 1QLEH 4QHMA 1J5OL 1TJIH 3S4SB 1H15A 3VFUA 3UDWC 4X0KA 4OI8A 3BPOB 4LOUC 4Y0GA 2C1OB 3ZHLA 5I2IA 4WIQA 5CGTA 4PJ9A 3BGFB 1A3QA 4XB7A 5EBGA 5JMRA 5I18L 5KANG 3WKMH 4KVCH 1CYGA 5HYSB 5IB2B 4H0GA 4ZPVB 4PRHB 1GOGA 4N5ED 3W9EB 3RWEB 5KSVA 4AH2A 3LKQA 1KNOA 2XA8L 5HI3D 1MCOL 2AK1L 4NQXB 3X3FL 4ZUWB 1OQXA 3BRDA 2A6DB 4YDVB 3CSBA 2WIIB 3BIBX 3TJEH 3VXOB 5HHVH 1ZHNB 3T2QA 3NA4A 1JK8A 3BN9C 3MO1A 1Q9WA 1RUMH 4U1MA 4NQTA 5HPMA 5EU6E 2AAVA 4NQCD 5I1HH 1U3YA 1ADQH 1YEJL 2DWEA 3WJLA 3QDJE 1QHPA 5C0CA 1KN2H 1A3RL 2ORBL 4KUCF 4YHMH 5DMIH 4ZO6A 5ACZA 2DQEH 4POZC 4O2CB 1MHEA 4HAFA 4X4YA 4AIZA 3C6SB 1U92A 3QUMA 3DVNB 4NPYB 5J12C 1ULVA 2PYFB 1TNMA 4LBEB 5SWZD 5KSAD 4Y4KB 4BH8B 1NC4D 1P5UA 3IJHA 3NABH 1U58B 2QADB 3FQTA 4PJXB 5E8DL 3UJJL 5DJDA 1FVCB 3TP4A 5ITFA 2J1KA 2O5XH 5FYLD 3QJFA 3EFFB 3OKMB 4R3SA 4O5LH 4I4WB 3BOVA 1Y6NR 2DJUA 4XZUB 4ZUVA 1NLBL 4KK5D 4RMSA 1NQBA 1B6UA 3QQ3A 4X9HA 1UB5A 4BQ6A 3U7WH 1NLDL 4LEOB 5E2TH 4NQUA 2VTFA 3NN8A 2AK4D 3BQUB 2XNAA 3L5WB 4MXWL 5IVXE 4OZFH 1JFQH 1ZA6A 1NC2B 3O4LE 3QDGE 35C8L 2FX9H 4U1JA 3OAYK 2F5BH 1HQ4A 3WSQH 4OCYL 5JA8B 4RMWA 4X7TB 4PG9A 5BZWA 4PJAF 1GC1C 1U3HD 4MNQE 1M05A 4FQCL 1PG7X 1J1OH 2BSSA 5FM4A 2YPVL 3TH2T 1NAMA 2VXVH 5DDHA 2BCKB 3FRPA 4QYOB 2XN9D 4KQ3L 1QFWH 3GSRB 1RFDH 1T6WA 1JZ7A 4NNXA 4UTBL 4UQ2A 1T1WA 4DQOH 5FYLL 4ACPA 4Z76A 2AQ2A 3OZ9L 2V7NA 1ERNA 4X7CC 1HKFA 3Q5YA 4JJ5A 3WFBL 2P5EA 4KUZL 4Y16A 5EBMA 2OJEA 3H3PL 4Z7UF 2E8ZA 1A6WH 4FFZL 4FQXB 4JZJC 5SX4H 4QHKI 1CDYA 1X5KA 3V4UH 1YUHA 3OAUL 3UJIL 3ZE0E 1RU9L 2FWOB 3LQAC 1MFCH 1AGEB 3VXUD 2BDNH 3UTSE 5IR1B 5DQ9B 3TO2B 1CD8A 4XCEA 4PGCB 5E5RB 5KAQG 5C1MB 4Y1AE 3VDBA 2YN3A 5GRJL 3AUVA 3VWKC 4LVOC 4X6EA 3U36B 4XVUD 1AH1A 4XXCA 2J8UE 4FTVB 3BH9A 4PRPA 3UC0L 3KJ6H 2GEEA 2VSCA 5E56A 5TDOA 3N85L 2JJWA 3OKKA 1BQHG 1NFDA 1IC7L 3FB6B 4HF5H 4MXQD 4XNUH 4GKNA 5B39G 4Q74A 5MEND 5FGCB 3TF7C 1CGVA 5FB8B 1IGML 1CT8A 5LJYH 4FQHA 3F12A 4M4PA 2C3XA 4UT9H 3PQYD 2QBWA 4X6FB 1NCDL 3U0TB 1QP1A 4TSBL 3GSVB 2AJUL 4M4RA 1F6AB 1KCUL 4NCC1 3SKOB 3IVKB 1MFBL 1QSZA 4NQDA 1UXSA 2V2XA 1ZLSL 2I60L 1N7MH 4H20H 4IRSB 1C16B 3F7YB 3TA3B 3I6KA 2NZ9C 3NIGF 3ECBB 4XCYA 3D69B 3QISA 4JFDE 3CPLB 2Q87A 4Z18A 5F1NA 2Z9TA 3O0RL 1I7ZA 4HV8A 5C09A 3RX7A 1U8QB 4TPRH 4MDIA 2EDHA 3PE9A 1F3RB 3UCRA 2Y06L 3WKML 4KVCL 1IKNC 4D0CA 2D7OA 1RIUL 4CUCA 3TVMD 4FNLH 1MWAB 3AS2A 4I3RH 3VGBA 1EUTA 1KLUA 1RK1B 4HPOL 1BBDH 5FO9B 3ZKNC 1KG0B 4D0BB 4HKXA 3FQRA 3TJEL 5EU6B 5HHVL 1EXUB 4QXGH 4Y2DC 3HZVA 4MD0A 3RVUD 2YEZB 1I1YB 3CDCA 1RUML 1H8NA 1GJIA 1CXEA 2EDBA 3V0VB 4Z7VA 5I1HL 2HJFA 1ADQL 3EYFA 4TN9A 1DUZB 2IH3B 3C6LA 3DUHA 2F53D 1OPGL 1KN2L 3QWOB 4YHML 2DQEL 4GG6A 4LL9A 1TITA 3PDDA 5C0DB 5EC2B 4RRPG 3L3DA 4LDEB 3DBXA 5F7LB 5BV7C 1MHPL 5C9JA 4PRNA 1OW0A 1ZE3C 2HT2C 4MJIA 1UB6B 1KEGH 1BOGB 4U6VH 4XP5H 4DKFH 1BJ1H 1AO7D 1WUNT 4DKEH 3OGCA 5CJQH 3TPUB 5FUCC 2F74A 3CUPA 3TN0B 4ZNEA 1P4IL 1BVZA 2OTWB 4HG4J 4NWUL 3VW3H 4ZUUB 5JPMB 4C54A 4O5LL 2NX5E 3ARVA 4OLUL 4YFEA 1V05A 4RZCA 1MH5B 2VDLH 5CUSH 5C71A 5DJ2A 2RR3A 1T7ZA 1BBJB 5IVXB 1QBML 1UC6A 1CGSH 2FD6H 5E2TL 3S5LA 5E03A 1GHFH 4PJIE 1PDKA 4XCNA 3GHEH 3GKZA 4JM2F 5J11B 4XMLL 4HUMB 3WSQL 1MJ7H 4MNHB 2Y4SA 2VLRE 5BVPH 2DQIL 3QFDB 3RQ3A 1T22B 1X44A 5JTWA 5IESL 2FH8A 4MZ2A 4PRIA 4CVUA 1AHWB 1JHKH 3PWVB 4LCWA 4F9LA 3EDEA 1II4E 4X7FC 1CD1B 2IAND 4KAQH 3PL6A 5BS0A 4Y4FB 1QFWL 2Y36L 4PJ5D 3JTTA 3K81A 5AD0A 4CVXA 4JZOA 2IG2H 3HE6D 4K71B 4GSDH 4DQOL 3OSKA 4YX2H 1OAUH 2M1KA 5FUZH 3FO9A 4D0DB 2DDQH 2E9WA 2X41A 3ARBD 4WHTA 1EAJA 3RWIB 1LO4H 3AMKA 1A6WL 1BOYA 2OMNA 5ITBH 1U8LA 2NLJB 5I1EH 5E8EB 1T3FB 5TE7H 1U42A 2R0WL 1JRHH 4FHBD 2EH8H 3V4UL 5HHQA 3S34L 1L6ZA 5D7SL 1MFCL 4Y1AB 1AGFA 3WIHH 3QUYA 2BDNL 2ZNXA 5EIQA 4YXKH 1S5IH 4RSVA 1FYHB 4ODXA 1RULL 4ELMA 2J8UB 3BGMA 4F7MB 1W2KT 3I3EA 5BO1L 2XZQH 4MSWA 4WFHE 5IHZA 1SYVA 1JPGB 4OIAA 1K4CB 3LRSA 4OUOA 1T2QH 4HF5L 4XNUL 2BSRB 2VDPL 3V7AG 3I50L 3F6LA 1WBYA 5HD8D 4QTIL 3PIQB 1S78C 1CXKA 4HEME 1MCJA 3JBG7 3B9KD 1LK3L 12E8H 5E00A 3MYZA 4YDIH 3PWUA 4OQ1A 1NBVH 2CLZA 3CGTA 5GGUA 1IGTB 3BXNA 5J0BA 2IH1B 1CFQB 5C0CE 4LLUA 2ZUQC 4N0CD 4XVSH 4H20L 2XFXB 4JFDB 1QUNA 2DB8A 1CIDA 2L7JA 5IFJB 3MRCA 3RBGA 2NQCA 4OFDA 4R96A 2ZCHH 2NXZC 4KVNH 5CIPA 5DJ8A 2FX8H 1UM5H 3KPSA 5DJZB 4RAHA 2PCPB 1P5VA 4YBQD 1G6RH 1I8KB 4W4OA 1T04A 2AEWA 3CCHB 3UTZA 4FQXC 4ZXBD 4WVRA 1D5IH 3PP3K 5CD3B 1EHAA 4GRLD 4XH2B 1FG2A 1XEDA 1N6UA 4XP9H 5DMKB 2K3TA 4FNLL 3QH3A 2OL3A 3E6HB 3BVNB 4I3RL 3SCMB 3LKNB 1PZ5B 5F9DC 2M2DA 4WV1B 4PJCA 1WAAA 3BKCH 3P4LA 4DFIA 3MXWH 3WFCH 1C5DA 1CXHA 5I66B 2X89A 1P4BH 1N59B 3RKDD 2EYRB 4X9IA 5MI0C 1A6ZA 1KPVA 3U6RA 5HI4C 2Q1EA 3VG9B 2QQQA 3RWDB 2X4PA 4PGEA 3FOLA 4JZNA 1D9KA 1NAKH 5TQ0H 4EIGB 2D7NA 2YPKA 1XMWA 5LGHH 3P4MA 32C2B 1KEGL 3O9WD 3EAKA 1J1PH 5DLML 4U6VL 4XP5L 4DKFL 1NGWB 4EUPH 5E2JA 3S37X 5CJQL 2XPGB 4RISH 2VLKD 4IRSC 4EZMA 1B2WL 4XHJD 1SBSL 2VERN 2Z0BA 2BOCA 3GMRB 2EKJA 1R5IA 4RGNE 5IFAL 1G7IB 5FGRA 2V9TA 3VW3L 5FYKH 3SKJH 3DX7B 4HH9A 2J6EA 4OLVH 3I6GA 4OGZA 2P5EE 5EZJB 3VJ6A 3U0PA 4QRSA 3VA2C 3CMGA 3FAWA 3CX5J 2WIMA 2VDLL 4HFUH 6FABH 4YK4B 1LEIA 3KS0H 5HGAA 1JN6A 3SPVB 1JNJA 3LZFL 2F9BT 3VXQB 1GHFL 5F97E 3GJEB 5JUEH 5EO9A 3TBWA 3ISWA 4GS7C 2OZ4L 2FEEL 4YDLC 1KB5A 2PXYA 1XZ0B 3SDCB 3EGSA 5DRWB 3RFZC 5IP4A 1MJ7L 4U1LA 4NM8L 4TUJA 5E5UB 2YC1A 4ZFGH 5BVPL 3U7YH 5C0RH 3QIUD 2GK0B 3EFDH 4Z7WF 2JKXA 1KTLA 1DZBA 3FT3B 4YFLI 3HC4L 4K3DH 4PRPE 3HMWH 3FB5B 1JHKL 3EO1B 3T8XA 2D0FA 3CDGB 5CSGA 3SE4A 1RZGA 2CIIB 1GL4B 1FORL 4TVSa 2IG2L 1RVFH 2NY4D 2ZG1A 4YX2L 4ZUSB 4PRHD 1OAUL 3FCTB 3MNWA 2F5AH 4MJ5A 1A7PL 5FUZL 5IVZB 5M7QA 3GSNB 3GK8H 4WNQB 1LO4L 1BLNA 5ITBL 4NRXB 3KDMA 3LN9A 1T89C 3CLFL 4M61B 2D9QB 3HZKA 3IU3B 1RZKL 4WI3A 5DYOA 3MRHA 4YHKH 5FGBC 1JRHL 5L6YL 1CFSB 5F89A 1UH4A 1N8ZA 2VXSH 43C9A 1BVKB 5INDB 3WIHL 3KLSA 4JRXB 1AXTL 1S5IL 3C09B 4NO3A 5C09E 5C08D 1OCWL 1P2CB 4KPHH 3BT2H 2FLRT 4MAYA 4TVPD 1NL0H 4WWKA 1XF4B 3ULUC 1ZT4A 3S88L 3DVFA 2VZ1A 4OLXH 3AREA 2HVJB 1VEPA 4EXPX 3VG0L 2HKFL 3VRLF 5M94B 2AGJH 1DBKH 2ENYA 5J11C 1CDIA 3GMQA 4Y4KD 4MWFA 2VQ1B 2Z8RA 1U8HB 4Q9QL 4MA7H 4PJDF 2QADD 1UENA 2E6JA 5HPMB 4HT1H 1OF2B 4I0PB 1H0DA 2M26A 2R39A 2EEBA 3JTSB 3WXVL 1PZUB 5I1IL 3F7VA 12E8L 4HWEL 5F72S 4YDIL 2DWEB 5AZEL 4Z7VE 4J8RB 2XYCA 1NBVL 5IB4A 4AYFA 2OR9H 2X4NB 3IDJA 4MNGA 4XVSL 5DWUL 3EO0A 3WL9B 5GJSL 4RMQA 4XI5D 3T0VA 3PXHA 2FHBA 2MMXA 2G75A 4GMSH 3FO0H 4KVNL 1EVUA 3BQUD 4F7EA 2R4SH 3QG7L 1G6RL 1WWWX 4MJIE 4Y5XB 1I85A 4C55A 3QUZC 3P0YH 4JFPA 4WJ5B 4TVPL 3VFWA 5IM7B 1D5IL 1DQLL 3V8OA 5ITFB 4ZNEE 3SE8L 3AROA 2N4IA 4U1IB 5FHAH 1EJOH 5FM5M 1IARB 5AG8A 2X4RB 3DRTB 2Z92A 4ZUVB 1RJYA 3BFOA 3DNKA 2QSVA 5C7XH 5GRWA 1BWMA 4HS8L 3V79C 4OKVB 3JV5A 4M7LT 3WFCL 5FA4B 3CSYA 3NN8B 3QZWA 1DDHA 2HT3C 2E7CA 4PIRF 2X2YA 3QO0A 1J0ZA 2WUBH 4WCYH 3U46A 5IEKA 4CADA 4WUUA 4NQSA 1KJ3H 4LSQH 1ONQB 2ITCA 3GSUB 2A6JA 4HXAL 3CFCH 3E6FA 2BVTA 4Y5VA 4P9HH 4PG9B 3BYYA 4WFFE 3WO3B 2R4RL 4IIQC 1FFQA 3EOBB 1J1PL 3RNKA 3OKNB 1N0XH 4G8GA 4PRIE 4LCWE 4GXUM 5T33H 4NNXB 4JDZA 3KJ4C 4K7PH 1UVQA 1DEEA 4BK4A 2D03L 5BS0E 1T1WB 4JJ5B 3AY4C 2Y9RT 2P5EB 3BEWB 4P23B 2ZCLH 3L95A 3MFGB 4FTVD 3SKJL 4OLVL 1SY6A 5CFHA 5LAXA 3HAEH 3MRQB 4R4NC 4OZHF 3CDYA 4HFUL 2R2EA 5BVJA 6FABL 3VGDA 5IF0A 4GAYA 3LKSA 1CLZH 4P5MB 3TV3H 5JUEL 3QFJB 1NMBH 2D9CA 4RMVA 5HDOA 5DGRA 2FJFA 3SJVA 1S9VA 3LH2H 4IDLA 3DSNA 4G42B 4F3FA 2ARWA 4HIXH 5GSVA 5TPWH 4R2GC 4P3DA 4ZFGL 3U7YL 5GZNC 4PB9H 4J2XA 5CP7A 3U30B 4ELME 4PRPB 5TDPB 4PJ8C 3G5ZA 4P99A 3E2HC 3TA3D 4KI1A 5GS1C 2H32B 5AAWA 3HMWL 3VG9C 5GGQH 1NJ9B 5I1LB 3LS5L 5GZOC 1B3JA 1VFAA 3BDXA 3RGVC 2BNUB 4M5YL 5D9SA 3WIFB 1EBPA 1TCMA 3MRNB 3H9SB 1RVFL 3C8HA 1J0IA 1CE6B 3GSOA 3D3VA 4JPIA 5E1AA 3GK8L 2JJTC 3Q48A 2APFA 1ZVSA 3R1GH 4N0FB 2AW2A 7CGTA 1H9VA 1JZ8A 1MEXH 3V95A 4KGJA 1N5AB 4J12A 4PRBA 5EU6D 4OUUB 2QHRL 4YHKL 5CILL 1NGZA 1OTSC 2VXSL 3QEHA 2IWGA 3FN3A 3QDJD 4U2ZA 4HV8B 4LFHD 4K9EC 3U4EA 4MDIB 1WIOA 3MGAA 3KPSE 4HUNB 2WK2A 3GMNB 1NPUA 3DXAE 4L1DA 4Q97A 4QWWC 4BZYA 1C12B 4KPHL 3BT2L 4XMPH 1FNLA 1L7TL 3VDAA 4U6HB 3HS0B 5EBLA 4ZUTB 4KI5C 3VWJA 1FZOB 4FXKA 4IS6A 2C3HA 4QHUA 2VH5H 4JPKL 2YHGA 4YQXH 5L9DH 1UQSA 4LRNH 1DBKL 5TFSL 4ODBD 4QCIA 2A83A 4PREA 3HZVB 4MD0B 3WFZA 4U3XA 5E6ID 1DQQB 2F15A 4PJCE 3VMNA 1WAAE 4LFHG 5TF0A 1T6VN 5CP3H 3WNLA 1MWAL 4NSKB 3EYFB 2YSSA 3LKPA 1BFOB 2B1HH 5B4MC 2ZPKL 1S7TA 1YY8A 2Y1VA 4CN1A 4TQEL 3ARPA 5F3HA 2ESVE 5C9JB 4NFCA 5C0IA 1K8IA 4ODHH 1W0VA 4NOBA 1I3GL 4YO0B 1FE8H 1NFDF 2R4SL 3WCYA 5FCUH 1VDGA 3C60D 5C6TH 3OGCB 5E08H 3HPJA 2IAMC 3LHPH 2IFFH 3K7UA 1BQLH 2HAZA 5A2KH 1YEGH 4PJGA 2WSKA 5L7XH 1UWEH 4X7SH 3P4OA 4L4VE 4HJGB 2AP2A 3HZYB 5CJ8A 5IB5B 4X6DE 3PV6A 3NACH 1QQDB 4KKLC 1EJOL 4GAJL 4FQQA 4OZIB 1F97A 2EDNA 5SWSE 4I2XA 4PLNC 2A9NH 1SEQH 2HWZH 3JWDH 5C7XL 4X6CF 4R9HA 3P9MA 4HHAB 4Y4FD 5IK3B 5T3XE 3V8CA 4G6AD 3EJYC 1CD9B 1MFEL 3NIGE 2VC2H 4GRMA 4APQB 4KRLB 2WUBL 3QXAA 4XCNB 5C0AA 1FC1A 3T0XA 4YEFA 3O45B 1T03H 3CNKA 3O41B 4LSQL 2F54B 5EUKA 5AUMB 2FDBP 3H7LA 1Z0MA 3S36X 4R97B 1ZHBB 3CFCL 4NKOA 1RUAL 4ONFL 5F7YC 5I1JL 2VLLA 1DP0A 3IFOB 4I0PC 5TF1L 4KK8D 3O3EA 1MCFA 2P24A 1FZKA 3VXPA 4LCWB 4HIEB 4OCLC 4YE4H 1N0XL 4Y1AD 3IF1B 2JB5L 5T33L 2VL5A 4LSDA 4GKOA 5EORH 1QBBA 4JAMB 1NGYB 5DI8A 1PLGH 5KN5A 5EZIL 5LVEA 1RZFL 4GW4B 4JKPH 2ZCLL 3RTQA 5IVOA 4HH8A 4QY8A 3MRBB 3U9UA 3VI4F 4Y5XC 3BAEH 4FMFA 5IOPA 4U1NB 1WT5C 1WVZA 4UAOB 5EIIA 5C9KA 5HYQB 1FSKC 3RZCA 4QXTA 3QT2A 4X5WA 3BW9B 5DJAB 1UCBH 2AJXH 2APWA 3LDBB 1IRAY 3MGOA 1CLZL 3TV3L 2DQJH 3M8OH 1OWWA 1NMBL 1TQCB 3UTTA 1EPFA 1MVUA 2A0LD 4PV8A 2P4AB 1T0MB 3IAQA 3QXWA 4RX4D 3ARUA 5AYUH 2GTWA 4R7NB 4PD4K 3LH2L 1TZGH 4HIXL 4YHZH 4DVRL 4ELMB 1UEMA 3RDTA 4HD9A 5SX5H 5TPWL 5DQJA 1KYOK 3ZKXC 1J1XH 2IEPA 3E3QE 4PB9L 2X44D 1E0OB 4JFDD 3J8F7 1SYVB 1OB1A 1O7SA 1EVTC 4PJ7F 1AE6H 4HIIA 1AQDA 4LHUB 1DEDA 1FH5H 3L7FA 1S9YA 1JTTA 4OGAD 4Z7OF 3RIFK 1UWGL 5LKNA 1FIGH 2YBRA 2NY1C 1WBYB 4CBPA 2FZ3B 4ZOEA 1Q9OB 2E8YA 3DGGA 3M1BB 1JPTL 1LD9B 2P44B 2X4SA 3P40A 5GGUB 5J89A 1VFOA 3BXNB 4LVEA 3R1GL 4NNYB 5F6HJ 1T0NB 3MCKB 1ZGLM 3ROLA 1R5VB 1BAFH 4U0RC 2L0DA 1X5HA 4LEXL 3DXAB 4HBQA 3P4NA 4HUWA 2PYEA 1ITCA 4XRCB 4R7DB 5DMGD 3DV6B 4DN3L 2NYYC 1ZWIB 5CSZA 1JF1B 3MRRA 3QUMH 4JY6A 3DMMB 4HKBA 1FN4A 2VH5L 3ARFA 3KR3L 4Z7UB 1K3ZA 1FGNH 1OD9A 5FUOH 4ZOAA 4PJCB 3U1SL 2AJYL 4YHPB 3EOAA 1C5DB 1HHJB 4HGWB 3QI9B 2FEDC 1T0PB 1A6ZB 1ZT7B 2NX5D 3U6RB 2R15A 1JNLH 2AJVH 2WANA 4UINH 4L4TA 4OGYH 3T0EA 4M7ZC 4PGEB 3FOLB 3MROA 2ESVB 2Q3ZA 3IT8D 4WUUE 4NP4H 3S96A 5DK0A 1EGJA 4M8VA 3HE7A 4LDLB 3W11D 5KZCD 4C4KT 1LWRA 3DVIA 4HIJA 1FE8L 1Y18A 3TYFA 5DJ0A 1BVLA 2BX5A 3AS1A 3RI5K 5E08L 5C92A 1CG9A 5EOQL 1A0QH 2XWJB 2AEQH 3U2SA 3HR5A 3PHOB 2VO5A 4L4VB 3SDCD 5BMFL 3DGCR 1YEGL 4G8GE 4LSRH 4C56A 4IDJH 4X6DB 1UWEL 4X7SL 5E2UH 1R5IB 2VJXA 1M6OA 4UOW1 4WUKL 3CLEL 5IEHA 1K5NB 1KBGH 5SWSB 4Z77A 4QHNA 5HGBB 5EBWB 1QBLH 2I25N 3MRMA 3I6GB 4A2MA 5T1LA 1JNNH 1VPOH 3NZ8A 1NAMH 2HWZL 4FFVD 5FV2A 1G0DA 2ZCKH 4N8PA 5HGAB 3PJSB 3IB4A 3MOAL 3NGBC 4ERSH 5DD5H 1R3HB 4F37K 3TBWB 4UUJA 1QD0A 5ACMA 1U8JB 4AT6B 3W9DA 5A3IC 4LVNB 2NXYC 5HY9B 2H2PC 2J88H 3LKRA 3U83A 4UV4H 5AZ2H 3FRUA 3T8XB 5ENWB 3MJ9A 4Y4HC 4LSVH 1I8LA 1XGUA 2ZUVA 2GHWB 2HLAB 4P4RB 4X7EC 1WQVT 4JRXD 5GS3A 4MX7A 4MA1C 1F8TH 1S8DB 2SEBA 3FQNA 1Z3GL 3S35L 1BPVA 5EORL 2Y5TB 2A6KA 5H2BA 1T2JA 4WFHD 4XPAH 1A9EA 3FQWA 4ZPTA 4JKPL 3W81A 4XAWL 3T4YA 5IJKA 3D3VE 1VEOA 3BAEL 3PG2A 3JVGA 4GLRH 1KN4L 3NVQA 3VFRA 4LCCC 1BQSA 4OD3H 1UCBL 2AJXL 3GIVA 3JWOC 4RDQF 3ES6A 3GJFB 1N8ZB 2DQJL 5ILTL 3MRGA 2CIKA 4R4FH 1HIML 3IKCB 2HVKB 2IADA 5J3HC 1X5YA 5AYUL 4FXLA 5I0DA 4JCLA 5IJVA 4NO3B 1H5BC 1TZGL 1EFQA 4LLYB 4NN5C 3JV6B 4OTXH 3QG6A 5HI5D 1I9IL 5DD6A 4PJEA 1J1XL 2EDXA 5E4EB 1ZT4B 4G3YH 3K0WA 3AREB 4JVPA 5IW1A 1L9NA 4RAVB 1OGTB 5JNYB 3DHMA 4APQC 2D0HA 4XNYL 1FH5L 3BWAB 3GMQB 1QACA 1ZVYA 4D8PA 1HYSD 4UMGA 3H42H 2KQMA 3D6GA 4ETQA 5T5NG 1FIGL 1E27A 1IZKA 3IXAB 2VZVA 5HGHB 3HNVL 4LVHC 3L1OH 1AD9A 5EOTA 1A5FH 2YXFA 4JM2B 1I1CA 1FNSH 4R4BA 1T1YB 4C59B 5IB4B 4U1SA 4I9WE 3IDJB 2VKXA 4ODUB 1IGJB 5DRZB 4W6WB 5GHWH 1S7VA 3RA7L 5FECB 4GRWE 5MHSE 1LP9F 3NCBB 4NHCH 5D1XC 4MXVE 4URTB 3WE6B 5CEXA 4PY8J 3GHBL 2D31A 3P77A 1ETZA 4OFKA 5IROA 2OLDA 1H3PH 3L9RA 3VFGH 2HMIC 4M6NH 5F9JA 3NBNA 5CMAB 4ZS6C 2ADFL 3LEXA 3MYJA 1X3DA 4KKCC 1V3KA 1VSCA 5GRZA 3LDBC 2F19H 4PJGE 4TNWF 2VMFA 4UIKH 1AD0B 3QUML 1I1AA 5D72H 3WHE0 4KMQA 3DUSA 4JPVL 2Z92B 1EAPA 4F15C 5L0QC 1E4XI 5F6IC 4M1DH 4I2XE 3QPQD 1Q0YH 1YMHB 3GM0A 5F1KC 5ICXA 1FLRH 1NGQH 4RGND 3U4BH 4ODTH 4I77L 5KSUB 3QO0B 4CU7A 5I17B 4RFOH 3D1MC 5DT1H 1FPTL 2OJZH 5IEKB 2DLIA 2B4CL 4KJYB 2P5ED 1JNLL 2AJVL 3CDFA 4Y16D 4P23D 3VU2A 5C0AE 5EA0H 2Z8VC 1AXSA 5DS8B 4LCYB 1KT2B 1FP5A 1K8DB 1U8MA 4KMLB 2X40A 5A16B 3CVHA 1TJGL 3SGJC 3C5SB 4MB3A 3QFJD 3O3DB 1BGXH 3VXTA 1X5AA 3RHWK 2AEQL 1F02I 2AV1A 1YN6A 4DGIH 3WXWH 1UVQB 4LSRL 4X98A 4XTRC 5GGRY 3PWJA 3OXRA 5E2UL 4LU5H 1WBZA 1ACYL 1CVSC 5E1HB 4PRPD 1Z6JT 3SBWA 2EO9A 1VPOL 5LAXB 3ILQD 1WK0A 4DN4H 4P2RB 5FDYA 5BVJB 2ZCKL 4BFEA 1N3NA 4TTGA 3GMPB 1Q94A 2PW1B 2EC9T 4X80H 2HFFB 4G6KL 5DD5L 4ERSL 4P3WA 2YD1A 3K8MA 2BC4A 4MQTB 4BKLB 5D96B 1S9VB 1G7JA 4FQJL 4K07A 1LEKA 5KJRH 1YPZF 4LSUL 3E0GA 1XGPA 5GRUH 5IB3B 1AKJA 2J88L 4YGVA 5EWIH 4F9PA 1L6XA 2N56A 2P5WE 4KQ4H 3FT4B 5H37H 2GSGA 5AZ2L 3QWQB 3L3IA 2YA0A 5EO0B 5D1ZB 2XTJC 2CH8A 4K23L 2DM7A 5C09D 1XF5B 3SQOH 5JXAH 4QHLA 2VZOA 1HH6B 1EEYA 3RVXC 1JGUL 1F8TL 4DUVA 4NO2A 1MCKA 4XPAL 1XAUA 4BH7B 4HUUB 3GSOB 4WHYG 3REVA 3ZKSD 4IMLA 5E2VH 3NZHH 5C6WH 3G04B 2CO6B 5CLWA 4ZSOA 5K9KB 3CK0H 3RBSA 1FVDB 4JVWA 4XPBH 4OD3L 2AXJA 3HPLB 1X5IA 1Z9SA 2FATH 1RIHH 3FO1A 2ID5A 4R4FL 5L2JB 4QOKA 5B38B 4F7PA 3U4EB 1UWXK 4ODVH 1EEQA 3HB3C 3MCLH 1EV2E 2A6IA 3AVEA 4OTXL 3V6FA 1S9XB 3IDXH 4G3YL 2R23B 1NGXB 3I75B 4IS6B 3EIFA 1HE7A 3AAZA 5CIPH 4OT1H 4MJID 1LGVA 4P57A 1UQSB 4LSTH 2IALA 2NR6C 5BOPA 5DXWA 3K2UH 4PREB 5GJTH 4KJWD 4NQCA 2Z31B 3H42L 4M9PA 4RWYL 1SJHA 1YNKH 3W39B 1DQJB 2P42B 1DANT 2OL3H 3L3KA 2GJZB 3BN3B 4AEIL 3NTCL 1U3ZA 2ZJSH 2F8OA 1A2YB 1FNSL 2C26A 4KZEL 1C08A 1S7TB 2NY5L 4JO3H 2GTZB 4JB9H 4L4TE 3T0EE 3CFKB 5GGTH 3LS4L 3ULSB 5C0IB 5SWZA 5GSRA 3MSPA 4Q2ZA 1W0VB 3WHXB 1J18A 4Z7WB 5D1QB 4XP4H 1NC4A 1VFBA 3KPLB 3MJ7B 1AR1D 1H3PL 4OFYA 4M6NL 1IBGL 4Z78B 5CLTA 1DQMH 3QIWB 4LNRB 4PJGB 5HDBF 2DMBA 4W70A 5C8JB 4GKZB 5DQDL 3P0VH 5JORA 3P4OB 5BCAA 1QA9A 2DLGA 4WFFD 4IRJC 2R1WA 4FQQB 4U3CA 5FXCH 1U8NA 1UH2A 5DK2A 4I2XB 4PRID 4LCWD 1HHKA 4L29B 4NO5B 5BS0D 2IPKB 3P9MB 5I73B 1NGQL 2NY3B 1LO5A 2NY2C 2X9XA 1OOAA 3QXAB 4RFOL 2A2QT 3QHZH 4PLOB 2J6EH 2GK2A 2GCYB 2CRZA 5EA0L 3ZE1E 4QGYA 3KXFB 4NZUH 3QPXH 1TTFA 5SWQB 2Y7QB 3DIFA 1JGLL 1R3IL 4X8XA 1QSFB 3QEGH 1L0YA 3TT1H 2WBJB 2OXHA 2XN9A 4E5XB 3D5OF 1TCRA 2R29H 1KB5H 3G5YB 3O2WH 4JM2C 4WI4A 4IMKA 1BGXL 2OI9C 3NCCB 1QYGL 2H8PA 3BZEA 3GNMH 1N4XL 4ZTOL 2YMXH 2ZOKA 3WXWL 4ODSL 1QOKA 1YQVH 3FB8A 5D8JH 1JZ2A 4CMHB 3CH8A 3IDNA 3QR2A 4XX1G 5TQ2H 2BVPA 3ARGC 4LHQB 2LU3A 5AAMA 1A8JH 2X5PA 3HG1E 1BQHA 4KKAD 5B39A 4LHUD 4KROC 5HGDB 2CLVA 4JFOA 1R3LA 3FKUS 3L5HA 5EUOA 4X80L 3CH1A 3VXUA 3WLBB 3GSQA 1JGVL 1YC8A 3TWCH 2Y07H 4V1DA 4J7RA 1MVUB 4PV8B 2EDYA 43CAA 4LARH 4PTUA 5IBUB 5KJRL 1MREH 3RDTB 2P5WB 1CLOH 3MREB 5GRUL 3NCYP 4GW5B 5EWIL 4D94A 2PR4H 4WDIA 4PJEE 5BZDA 1GPOL 4BSVA 2YN5A 1ED3B 3P9LB 1A7RH 4LHUG 5MENA 2DQDH 3L7FB 2FECL 1S9YB 3KPSD 1U2HA 3DXAD 3SQOL 2Q8AL 3I9GL 5ADPH 3IDGB 2MFNA 3WLWC 4XB8A 1DN0B 3BKYL 3VE0A 2HFTA 4GJTB 1YNLL 1JPFA 4NQVA 3DGGB 1IM3A 3QUKB 2E9IA 4KWUA 5E2VL 3NZHL 5CZVL 2EO1A 3MRIA 1ZAGA 2YD2A 2X4SB 4D9RE 3DMMD 4EDWH 3CK0L 2EYSB 2R69H 4XPBL 4P9HC 2CDFA 3RX5A 2P1YA 4LPWA 4NCC2 4NNPL 1WTGT 2HH0L 2W9EH 2O61A 3FHAA 2X89D 4LHJB 3GIZH 4HUWB 4ODVL 4ZQKB 5TDNA 3V6OE 1MIMH 1Q1JH 3ARXA 2HP4A 2DTML 2DM3A 1RZ7L 4RRPA 1BD2A 3K4ZA 4YR6B 4PY7B 2ESVD 3IDXL 3P30H 2B5IB 3VXRE 1FYTA 4HKBB 1MJ8H 1H3TA 4ZODA 4AL8L 4OT1L 4N8CL 3HUJF 3UPCA 1QLRA 5JOPE 4LGSB 1A7NH 3NAAH 1ND0A 4LSTL 2XTLA 3L3GB 4OZHB 1D5ZB 4AEFA 1I4FA 1P6AB 3B6SA 4L4VD 1MOEA 2FIKA 2OL3L 3OMZA 3V0WH 2ZJSL 3C5ZC 4L3AA 5SWSD 5D1ZC 3CAFA 4L4TB 3FOMB 3HRZA 2UWEF 3KHOA 3V52L 1S5HB 3OPZL 3GMMB 3DV4B 4JB9L 4P4KC 3EW3B 4XPGH 3IRPX 5T3XD 1T66C 4HFWB 1IKFH 2HA1A 3CFDA 1GGYA 1IJ9A 4XP4L 4Z8FH 5D7IA 2J7LA 3TYFB 1F11A 5HVWA 3LSOB 1CG9B 3UPRA 4P3CH 1DQML 2GSIB 3MBXH 1GGIL 5IMOA 3L3JA 3WFDL 5FF6A 4YDJA 5FCSH 1MHHB 1I9JL 2KL6A 3P0VL 4FQ2H 4OFPA 4EUPG 2VLJB 4FXGA 4Z77B 4QHNB 1FV1B 4TOYH 3UBXB 1IT9H 3K74B 1CDCA 5T1LB 5BRZA 2ITDA 1IGFL 2JJSC 2Q20A 2WBWB 4V2CB 3TYGL 2G60H 5DFVC 4IOFC 3H7BA