1L6XA

Fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION
publication title Mapping of the C1q binding site on rituxan, a chimeric antibody with a human IgG1 Fc.
pubmed rcsb
source organism Homo sapiens
total genus 40
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA01
4HKZA 4MDJB 3VXTB 3VXNA 3X12A 5TPWL 1RK1B 1LO5A 3RIFF 4Z78A 4D0BA 2F54B 4L8DA 2DJUA 4H0GA 4PRAA 2XZAL 1MJJB 2D7NA 2FZ3B 4F7PB 1V3LA 4X4XB 4PJAE 1BFSA 1QFWI 3H9HB 3RDTC 1FYTD 2VDNH 1FVDB 1XFPA 3KWWB 3NZHL 4GMTL 5DRWB 4ZUTB 4MD0B 4UT6L 1CFTB 5JTWA 3LEXB 2ESVA 4YXKL 4OT1H 4NNXA 2AJZB 3BPCB 5EZJA 2JCCB 4HUMB 4Q6IC 1MHCA 3WLBA 1DEEA 5DVNA 4YHLH 5DQDL 4BZ1H 2QSQA 2Z4QA 4XCCH 3HZMB 4FXKA 4R26L 1OT1A 5F1OB 1GOFA 1JFQH 1U58A 4HG4K 1W0YT 4E41E 4WCYH 2AABL 4R2GD 5F1NA 5D1XA 5IQ9B 2EIZB 4QXWA 4B7LA 2B5IC 4U4BA 5ANMB 1F13A 4P49A 2O61B 4XMKL 1NBVH 3PDGA 1HE7A 2KH2B 4RMTA 1TPXC 1DBMH 4A6YH 3VXUB 1ZOXA 5INDA 3QUMH 3W9DA 4ZS6C 5GSRB 1FCCA 5HI4C 1ZLUH 1KTRL 1UYWL 1G7MB 4X4YB 5IROA 4DVRH 4CU8A 2ZUTA 4K2UH 2IH1A 1QFWL 3DSFH 3EIFA 4PJXA 4M3KB 1J1PH 4F9LA 1FV1A 1S9WA 3VWJB 2F58L 4NM8L 3SGKA 2V17H 1MFDL 5FM5O 1I3GL 1KTDB 2DLIA 2F8OA 4OLXL 4F2MA 4NM4L 4RFNC 4KXZH 2OXGA 3B5HA 1AC6A 5DMKA 3PHSA 3EDJA 4ZNCD 2Y9RT 4NGHL 4HGWB 1T1ZA 3BJLA 4KJYB 5I1HH 4PJ7A 3C09B 5LAXA 3O45B 1IM3A 1RIVH 1QO3A 2Q86A 2R2HB 1NUFA 4OF7A 1WBXB 3BQUA 4G8EA 3VMPA 4BFBD 4YXHH 1YA5A 4HGKC 4X9HA 1M05A 4K55A 2DQIL 1U8PB 3UJTL 5TDNA 1I7TB 1N6VA 2YD2A 4I0PC 5IM7B 3ULVE 5BS0A 3T4AB 3V7AE 1A1OA 1EFXB 2P48B 3DTXA 4LKCB 3CLEH 3RVXD 5JIHA 4F7CB 4JFZL 3BDYH 1FNSL 1S7VA 3SGEH 2QQNH 4M93B 3ZKMD 5HYJB 2MHAA 4U1GB 1CFNB 4NNYA 4OCMC 4Y4KB 3UX9B 2CGRH 3SE9L 2NY3C 3RWHA 3W82A 3IRPX 4Y4HC 4CMHB 2X09A 1B6UA 4ZUWB 5FO8A 4ZTOL 1KJVA 4JDTH 2NXYC 3LQMA 4Z95H 5D5ME 2R0KH 4IRJA 5DT1H 4U0RB 1M6OB 1AGCB 2GITB 1YEGL 5GGQL 2G5RA 4CVUA 3EFDL 3L5XL 5I9QC 2I9TA 4LHUG 2GFBA 4PUBH 1ZLSL 1OW0A 1LK3L 5E94A 1CXFA 3TBYB 4QRSA 2VLJE 3BKML 4LCWA 1NCNA 2F53A 1F97A 1JUFA 5K9KA 4M1GH 4JCMA 1RFDL 4JO3L 4CADB 2NY0C 3QWOA 2DBJA 3AMLA 2NY1B 3O6FA 4DKAA 3UBXA 3CLFH 3W39A 3H3KA 3O9WA 3H9YA 3ECBB 1J12A 1ROWA 5E9DA 1IRAY 2FYYA 2AVGA 2IGFL 5JQHC 4QRPE 2VWEC 1FNFA 1KIQB 2CQVA 3CVHH 4N5UA 4N8VB 2R9HD 3ARGD 1U92B 4X6CA 3GO1H 2EE9A 4PRDB 5BO1H 1WVZA 5JHDE 3RL1A 12E8H 4JO2L 1CFSA 5D7IB 3EW3B 4Y5VC 3TJHC 2VH5L 4JQVA 1RULH 2KPNA 4V1DB 3ESUF 3B9EA 3NIDE 4BSWB 1SHMA 1N2RB 1IQWH 1Z3GH 2XNAA 2NY2D 3R0NA 4JN1L 4P3CL 2ADFL 4D8PB 4BK4A 1PQZA 1NDGB 4X99B 3DXAE 1JTTA 3TN0B 4P2OA 1LP9E 3ZLQC 2VZOA 3RX7A 4KJPC 1U8JB 2ADJB 5T3ZL 3WBDA 1T1YA 2BHUA 2IAMA 2YA0A 3JSSA 4LBEA 4TSCL 1Q9LA 4NKMB 5IJKC 1YN6B 2C3VA 2VDKL 3LV3A 4X5XB 3LPWA 1NCCL 2X70A 1SY6L 5E8EB 1YNKL 5FYKD 2HT4D 3NN8A 1OTUC 3W9EB 5TE4H 4Y8AA 3VXRA 1ETZB 4Z5RA 1Q9WB 3B9KD 2ZPKL 4ODTL 3O3BB 1BFVL 2XXMB 4ZS7L 4DVBA 4F7MA 3C5ZA 3HC4H 5B3NA 1XR9B 5FOBB 5A16A 1KPVB 5T1MA 1KACB 2HG5A 3PNWB 4GT7A 4N1CA 5AYUH 3MUZ1 5SWZD 3WIIL 3HZYA 1CQKA 2YD8A 5KW9L 2OLDA 5F6IB 1VB9A 3VFNA 1LWRA 4FQ1L 3JV4B 1XEDA 5D7JD 3GSNA 4GG6E 1ZGLP 2FJGA 1H3WM 4P9HL 3V6BR 5IW3A 1HILB 3PWLB 4OCYH 3SPVA 3T04D 1NC2D 3RTQD 5SWSA 3L3OB 4HMCA 5A43C 1BQSA 3T3MF 4ODHL 4H1LG 4MNHA 7CGTA 4TSAL 2VE6A 3QPQC 2OMNA 3V8OA 4PJ5D 1TMCB 1OAZL 3FFCA 3L3IA 3MRJB 2VUOA 3KPRA 4R96A 4YHPA 5FYJD 4M00A 3OMZA 4KK5C 4XCYB 5C0RH 4M43H 3TPKA 1CF8L 4WENB 2VO5A 1NL0L 1IGFH 1TJGH 3GMQA 4N5ED 1RZJH 5L6YL 1FN4A 3U4BH 4KK8D 1GGTA 1BQLH 1LNUB 3L3JB 4NBYB 2JJTC 4NPYA 4CW1B 1U8OB 3V5HA 1QACA 4P46D 5FKAB 1R5WA 3TO2B 4DTGH 4Z7WF 3TCLA 3MNWB 4OSUH 5CEYB 3RVVD 3MCKB 4YBLC 1PYWA 4IMKC 4Z7VE 2EYSA 1R5IA 1NC4A 1MFBL 2AK4D 2LQRA 2UZIL 4JM4L 3OB8A 3CFBB 2B0SH 2AK1L 1S7RA 5GGVH 3IXTB 4ENEC 2PKDA 3H7LA 3DX7B 4M62H 3GKZA 3TC9A 3UROR 3FRUB 3JWOH 4WUUD 5CP7B 1AGEB 1CLYL 4R4FH 4LSVH 5HI5C 4P2QE 1VCAA 1HCVA 2NY7H 5J56B 4M7LH 1J8HD 1RVFH 3O4OC 5HYQA 3ZT5A 3OR7A 1CGVA 1A6UH 4U1JA 1INDL 1XGUA 5L9DL 4MDJA 3VXTA 3DBXB 3P9WB 5EUOF 1RK1A 4PJBF 1R3IL 4XAWH 3CPLA 2F54A 3IFPB 5JHLL 1B4JL 5C0AE 5FFLA 1MJJA 2FZ3A 1T3FB 1PBYA 4F7PA 5CD5D 3UTPD 4X4XA 3H9HA 3MBXL 1ZTXH 3WFHB 3I75B 4BELD 1FVDA 4JM2F 3KWWA 5DRWA 3F7VA 4ZUTA 4MD0A 1CFTA 1RUKL 3LEXA 5A1AA 2E7BA 3MFGB 3DYPA 3BPCA 4K8RD 3AB0B 2JCCA 2R0LL 3GJFA 3VCLB 4UUJB 1CLCA 2OR9L 3BWUC 3QXAB 3HZMA 1OT2A 4OCXL 3TV3H 5TH2B 4WFFE 2QLVB 3RRQA 3VXQA 5IQ9A 4HJGB 2EIZA 2RBLA 2YWYA 4LAJH 4Q74A 3U79A 3NFNB 3QWRD 5GS0H 2O61A 4OF5A 2DJ4A 4U1SA 5D6DA 1YC7A 3VXUA 1GGCH 5I1EH 4AT6B 3MA7A 5E2TH 4HXBH 3V79C 4B53A 4Z0BH 1T0MB 3X11B 1FIGL 4FQXD 5GRVL 3L5HA 4LDLB 5AWNL 2CDEB 3WO4B 4X4YA 3S3SA 4IDJL 4JHBA 5DK0B 1SJEB 1G1CA 4KMTL 3HI6L 4FQ2L 4GRLD 2CK0L 1WWBX 2XG4A 3NH7H 5CEZL 3RPKA 1A3LH 2V6HA 1AH1A 2BY3A 5DSCB 2V2WB 4K3EL 2PTUA 3I6KA 2DQDL 5KVGH 4KTEL 3J8F7 1TNMA 2H1PH 3H7BB 1TFHA 3PQYE 4S1QL 4YHOL 1SEQL 1MSPA 1QBML 1YMHB 3KLHC 1E6JL 3BW9B 3UCRA 4P3DB 7FABL 4M6MH 3O45A 2IBZX 4F37F 5KVFH 2R2HA 1NCWL 1U6AL 1QFUH 2HFGH 4KHXL 3P2TA 4HUVB 4H5SB 1GGBH 4ZXBB 4C4KT 3T0AA 1NGPL 4HIXH 1I7TA 5EU7E 4KWUA 3QPXH 4MB3A 4KHTL 2AJXL 5LBSL 4TN9A 5B39G 4LKCA 1YY9D 3W0WA 4F7CA 4YX2L 2O5ZL 1HOCB 3ULSA 4K3JH 2DQTH 2WBJA 5JQ6L 1A1NB 3OR6B 4Y4KA 1QLFB 5D1XD 4DN4H 3N1QC 2ZSWA 4ZUWA 2OJZL 4UQ2B 4XPBL 1PG7L 3QIWD 1G7HB 3LVEA 1YECL 2NY4D 2UYLB 4OD1L 4BQ8A 1AGCA 1BM3H 4H1LB 3EFFB 1G9ML 3DI3B 1MF2L 5I6XC 1OCWH 3IAQA 5IEHB 1GPOH 4XNYH 1JJUA 1FE8H 2CRMA 3TBYA 3I2CL 4LOUD 1YEIH 4OD2B 5IFAH 3W2DL 2X7LB 2YPVL 5C8JB 3LN5A 4XC1H 1WQVT 2VXQH 4M61B 1FZMB 1ZV5A 2BDNH 2NY5L 2PXYB 3HFMH 1IM9B 4ERSH 2H9GB 4ZYKB 4U3HA 2VDOH 3FKUS 5FYLH 1IEAB 2VLLB 3C87A 1E4WH 3MV7A 5FM4A 3ECBA 3KNBA 1IC1A 4X7SL 5J1AA 1BJ1H 4CBPA 4L4JA 3Q1SL 1T7WA 3HNVH 3H9SA 1RIHH 4N8VA 3Q3GB 4M1DL 1U92A 3BQUD 2VXSL 2GJZB 5K93A 3ZZ1A 2JJWA 4MX7B 5D7IA 3RNQB 5HVHC 3NA9H 2EDYA 4IIQC 3BD3A 4NRZB 4BSWA 5KS9B 5BS0D 1FAIH 3UPCA 1M71B 1ZHBB 1L6XA 5HVFB 1NDGA 2B20A 4X99A 3TN0A 4YDJB 4TPRH 1UKSA 5MEOB 1B90A 4OM1L 1EIBA 5ILTH 1T1WB 1KJ3H 4LSTL 1Q9KA 1UB5B 3D85B 3E3QC 4UIKH 4YBHA 3ARDB 5L8LB 1J0YA 5E8EA 4XNQB 2VMFA 4JKPL 3W9EA 2C7UB 4QO1A 4NO3B 1LEKA 2PYFA 4IRJD 3O3BA 4OLUL 1J0KA 5I15L 3DUUB 1G0DA 1XR9A 5FOBA 1INEH 1KPVA 1OM3L 2XY1A 1Y6MR 5ENWA 3T3ME 3D0LB 1MI5B 3GNMH 1Y18B 2F53D 2NX5B 5HXMA 1HILA 1QP1A 4XP6L 1F6LL 4WDIB 1KULA 1BFTA 4QHUB 3O6FD 4KK6D 3L3OA 1WCBB 4PJEF 5DURD 1OTSC 4YHNA 1DLHA 2OYPA 1C12B 4JZOB 5I1GL 1FIEA 3O9WD 3UZEA 4AEHL 4LASL 4U31A 2J8UE 4LDOB 2IPKB 3MRJA 1QLEL 2J6EL 3GB7B 5E9DD 1FSKC 5AAMA 3IFNL 2X4SB 3N0PB 4OIIH 4XCYA 1YMME 5I1IL 4C59B 1MCHA 4Q9RH 3H3PH 3TH3T 3ET9F 3L3JA 4CW1A 1U8OA 5FKAA 5DEFB 3MNWA 4R7DB 3SKOB 5CEYA 5KN5A 3WXWL 4J6RL 3LEVH 1HKLH 4KPHL 3HG1B 4L4TE 1DL7L 4NJAH 4TNWF 3SDAA 3CFBA 1N3NB 5T5FH 3IXTA 1EDQA 4YBLB 5C07E 4K3DH 1WZ1L 3UYPA 3MRFB 5EUOE 2A74B 1MY5A 4PJBE 5EIQA 3FRUA 3NZ8B 5CP7A 1UM4H 1M7XA 1AGEA 1RZJC 3PWPB 4G3YL 2BXYA 5ID0B 2M26A 3K81A 4L5FL 3A6BL 2QSCL 4DK6A 1GJIA 5TQ2H 2HAZA 3KPSB 3OKOB 4L3CA 2CPCA 2HT2C 3DBXA 4ORGB 5JW3H 4UMGA 5HYSG 3VE0B 4C83B 3IFPA 3C5ZD 4BM7A 3CFDB 5AG8A 4PJFF 4XVUC 3V0VB 5EOTB 3MV01 1FYTE 5LWYL 4YDVB 1T3FA 4RMVA 4NDMA 1E28A 4LSPL 3QO0B 4W68A 1VADB 4GRWB 3LKOB 2WWKT 3WFHA 3I75A 3VWKC 3SDXE 3QO1B 1FPTL 4MCZB 5ITFA 3JWOC 5D2LA 5CD3A 4PV9B 2VLKB 4LSDA 1OP5K 3V5KA 4UUJA 3FQWB 3VCLA 4UT7L 4PGBB 3FFCD 3QXAA 1P2CB 3KPRD 3STLB 4LHUA 5CILL 2AV7A 1ZMYA 5TH2A 2XTJD 1KCUH 2FX9H 3QFJD 1PKQE 2AJUL 4HJGA 1ZT7B 1U93B 2FRGP 2YC1B 3WIHA 4ZODA 3KYKH 1A02N 2UY7A 3AVEA 3G6JB 3REVB 1PSKL 3MXWL 1B0GB 5CJQL 5F88B 4AT6A 2J8HA 3BXNB 5J3HD 1G7JB 5EH1A 1T0MA 4NP4L 3VG0L 5D93C 1ZT1B 4CGTA 5TPWH 3IRZA 4BA8A 5TE6L 3QUKB 4S1DC 2CDEA 2VQUA 1W72L 5DK0A 2XZAH 4WI5A 4KK9C 2CIKB 3GSWB 1N8ZA 4G8IB 1IGTB 4WI7A 4FFYL 1IAOB 2P8MA 4GLRH 5ESVA 5IMLA 3MLVH 4OM0H 3BWAA 4OZGE 3IS1X 3D3VB 4HLJA 5CP3A 4ZUUA 5T1KD 4GMTH 5AZEL 2EDWA 4UT6H 4QTIL 4F58L 2V2WA 4YXKH 5GS0C 2V7NA 1OQXA 4FXGA 1JL8A 2H45A 3QB7C 2RQ8A 3L3GA 3UAJD 3H7BA 3MOBL 5I8OH 5DO2C 2UWEF 5DQDH 5IVOA 1GH7A 3BW9A 4PJDA 4P3DA 2BP3A 2F54D 4R26H 5A3IC 2APXA 3K74B 1D6EA 4HS6A 2AABH 1BQHG 4A6YB 4PLJC 3EKCA 4H5SA 5D7LE 4U7MA 5DFWH 4OBSA 5IHBA 4ZXBA 4G5ZL 2IALB 1TJIH 4LPYA 4XMKH 3TBVB 1PGRB 5IB1A 3ZYIA 4F57H 4NZTL 1FP5A 5CWSB 4N0CC 4R7NB 3DX6A 3MGOA 5HHQB 1WFUA 2MJWA 4EJ1C 1QLRB 3U6RB 5EBWB 1MJUL 1HOCA 4MXQC 1EAPB 3BGAA 1QFWH 5E8OB 4R6UA 1A1NA 3CMGA 2BOBB 2F58H 3OB0K 3K4AA 1MFDH 2NY6B 1VSCA 4OLXH 5C3LD 2WBJC 4NM4H 2IEPA 1Z6JT 3OG4B 1V7ML 2UYLA 4FN0A 3VXUD 2RCSH 3EOYG 4NGHH 4H1LA 5IEHA 2QSVA 1I85A 1KCVL 2AGJL 4YUEL 1OSZA 4OD2A 3L5IA 3I3BA 5HD8D 2X7LA 3LSOB 3VWJD 3DX8A 1WUNT 5C8JA 5I6XB 4M61A 3BZEB 2PXYA 3RAJL 1IM9A 1PW3A 1X5LA 2ICWI 4PJXF 2DQIH 2H9GA 1TLKA 5AUMB 4JRWA 5I18L 4Q7DA 1IEAA 2VLLA 1JZ7A 4GRMB 4JANB 5HBBA 2YEZA 1NBZA 2XZCH 1JK8B 1EX0A 2ILLA 4JFZH 1FNSH 4H88L 2VQTA 4ZFOB 2JK5B 4UAOB 3BPOC 3DO3A 4LU5H 5DK3A 4JKLA 3FFDB 4D3CH 4YC2B 5HI3C 4LLYB 2RB8A 4PJ7F 2WMPA 4NNPL 3SE9H 5IBLD 5F71A 4MX7A 3RVTD 3RNQA 5JXEA 4RFOL 3ROOA 1N5YL 4ZTOH 2MWCA 1CTOA 4WJ5B 1FG2B 2ZSVA 2V9RA 4QXGL 3RIAK 1YEGH 5GGQH 1T20B 3SDCC 1EFXD 2YOCA 5HYSB 1ZHBA 1D5BB 2V7HB 3L5XH 3MMEB 4X83A 5HVHB 1I8LA 1CR9L 4IMLB 1W2KT 5DTFB 3ULVL 3QQ3A 3NCCB 5MEOA 4GW1B 5HYJD 5E6ZA 3BKMH 1YPZB 3NIFF 1T1WA 4Y4KD 4RMUA 2ED9A 1UB5A 2DMCA 5DRZB 5E99L 1BHGA 1RFDH 4JO3H 4GKZB 1K2DB 3AAZA 3OB0H 2F8VA 5IMMA 3OKKB 2C7UA 5C0FB 4NO3A 3B9VA 4Q9CA 4OI8A 3GI8L 1KIRB 4BYHA 2XKUA 3DUUA 3CVHB 1W0WB 5C0DB 1NFKA 4PJEE 3QWQB 3MV8B 2IGFH 2R15A 3I6LE 1LE5B 3U0TB 2DQHL 3D0LA 1A21A 2HTLC 4N68A 4W6YB 1Y18A 1NSNL 5EDXA 1XR8B 1MWAB 4RA0C 2WWMD 5SV4A 2YD6A 5C0BB 2NX5A 5GGTA 4JO2H 4WDIA 3NPSC 1EZVY 4PJ5E 2VH5H 2NY1D 4QHUA 4QOKD 5CIPB 5J8OA 2JJUA 1WCBA 2AJVL 3QBTB 2F5BL 4JZOA 1CLZL 4ZOAA 3S35L 3MYZA 2EO1A 2IPKA 4NO5B 3PGFL 3GB7A 4JN1H 2ADFH 2X4SA 3CNKA 4WHYG 4PIRF 5D2NC 1CICA 3ABZA 4HF5L 3GMLB 4HUKB 4TSCH 2NNAB 2P5WB 2A9NL 2VDKH 5DEFA 4L9LC 4R7DA 1NCCH 1FSKB 3EHBD 1SY6H 4LP5A 4RWYH 1NCDL 2AK4E 3AGVA 1P7QD 5D7KE 4V1DD 3HG1A 3D2UD 2DWDB 2ZPKH 4ODTH 4IOSD 5KAQG 4XHQA 1BFVH 1SBBA 4ZS7H 5GGUB 4OGAD 1TJHL 3K7UA 1N3NA 5HDOA 3WIIH 4K7FA 3TN0D 1HYSD 5KW9H 2ZUSA 3FB7B 4AIXA 1T2XA 1RUQH 4G8GB 4FQ1H 2A74A 4OZFH 1J8HE 2BNRB 1TIUA 2JJSC 1BQHB 4RZCB 1U3HA 1SY6A 3V4VL 1EO7A 4P9HH 4PJFE 4HULB 3O4LE 3PWPA 2FL5B 5F70A 4NN5C 3FN3A 3ZT6A 3UEZA 4WI2A 5ID0A 3VD4A 1NMBL 3D1MC 5TGBB 1A64A 1TXKA 3KPSA 4OZHA 3CX5K 4RBPK 4ORGA 4J8RB 5B39A 2Z8VC 4PG2A 1OAZH 1Z2KA 1KLGB 3UTPE 4C83A 1QSFE 3CFDA 2XI9A 4GH7B 3AS0A 2C3HA 1CF8H 1NL0H 1X5HA 5L6YH 3KVQA 1MUJB 3X3GL 2OTWA 1J1XL 2HFTA 5DDHB 2MMXA 5L8JB 5BJTA 2G5BB 3QQ4B 4MCZA 1QNZL 1QKZL 4LLQA 4XP9L 4BH8B 3VU2A 5ACZA 3FQWA 2QJDA 1ZGLM 1U8NB 4PGBA 1KPRB 1MFBH 2UZIH 4JM4H 4QWWC 5JO5B 3STLA 1QRKA 2BX5A 4OF6A 2AK1H 4OKVB 5GGRB 1IGJB 2AJ3B 4HUNB 1U93A 4PLOB 1CLYH 8CGTA 2YC1A 1F3DH 3TVMC 3G6JA 3REVA 3RX8A 1J7VR 3T3PF 3MBEC 1B0GA 1T22B 2YPLB 2Z93B 4PRHD 5F88A 2J5LC 3CH8A 1INDH 2VAJA 5L9DH 1ZT1A 5JW4R 1R3IH 3U0PB 1RAMA 3QUKA 2BERA 3RVWC 5JHLH 3QDGB 1B4JH 4H0IA 5LXGL 2CIKA 3GSWA 4G8IA 1IGTA 3H8NA 1IAOA 1F4HA 4I2XB 4JRXD 1QG3A 3MBXH 3TBWB 3VRLF 2UWEE 3OKDB 3D3VA 5CSGA 3C5SB 5CGYD 3TLRA 2W59A 1LILA 1RUKH 4PB0H 2DL9A 1E4KC 1V3JA 4Z77B 3P9LB 4MAUH 1QA9B 3S37H 1GC1L 2R0LH 4NFBA 3GMMB 2EDBA 4JQIL 4LAQL 2OS7A 4LLMA 1GIGL 2OR9H 3FQXB 5CLTA 1QYGL 4YR6A 4XXCA 3Q5YA 4OCXH 2NTSP 3RGVC 2FLRT 1PEZA 1ACYL 3MRRB 4HWEL 5C0NC 2YSSA 1YNLL 2ESVE 1DFBH 1NKRA 4YWGH 4XMLL 1CVRA 1E6OL 2EDKA 1P9MA 2IALA 2X4OB 1VA9A 3TBVA 1AGDB 4PJCF 1Z9OA 3FO2B 3MUGB 2N7AA 3FOMA 4LL9A 4ZDHB 1C5CH 1PY4A 1FIGH 4R7NA 1RZ7L 3RY6C 5C3TA 1P4LB 5AWNH 1BZ7B 3U6RA 5DI8A 5EBWA 4UTBL 1EAPA 4IDJH 4FG6C 5E8OA 3KPMB 3WJJA 3R8QA 4KMTH 2BOBA 3HI6H 5CKAA 5B38B 1B0WA 1XAUA 5CEZH 4OLWL 1EFQA 4IRSC 3SOBH 4DKEL 5HYIA 5KOVC 2DQDH 3BN9C 4ZAKC 4KTEH 3JV6B 4O51B 4S1QH 1ZS8A 2V9TA 1SEQH 4U1KB 4YHOH 2EH7H 1XIWC 4PJXE 5F7EL 5F9OL 4OFYA 2ZG3A 4GBXB 7FABH 1FNHA 3QEHB 4HMDA 1NCWH 1U6AH 3LY6A 5DR5L 1MJ7L 2QBWA 2GTWA 4KHXH 3BZEA 3U30B 1X5JA 1KXQE 4PJHB 5HI4D 5FA4B 4A2LA 1NGPH 2MQ3A 1ULVA 1X5ZA 5GPRA 4PJ7E 4N90D 4KHTH 2AJXH 3PJSB 3D5OF 5LBSH 4XAKD 4GRMA 1FC1A 2ZNWA 4JANA 5E6IA 3INUH 1JK8A 4YX2H 2O5ZH 4ZFOA 2XV6B 2JK5A 1JGDB 1J0ZA 3FFDA 4CVXB 3D39A 4LLYA 2B2XL 3UZQA 4AY0A 2DLGA 4WEBH 4LPUA 2MTPA 5DUML 4ZXBD 5BS0E 5HHPB 3DWTA 4XPBH 1ZHLB 3LDBB 1PG7H 5FF6B 2YUXA 3QI9A 3H3BC 1QTYT 5D1ZC 4HC1A 3ARBC 5GZOC 3C9NA 3W81A 1MF2H 5F3HA 1UH2A 1QSEB 1I1YA 1EH9A 1R3LB 5HYSA 1D5BA 2V7HA 5CBEB 5KANI 2MQ0A 4ZQKB 4NQDA 1OQOA 4IMLA 5DTFA 3KPOB 3ARXA 3RHWF 1FGNL 3BEWB 3I2CH 4GW1A 1OAXL 5EZLB 3W2DH 2YPVH 4P4KB 3SDCB 4HZAA 5FUOL 2NY5H 3TNMB 4GKZA 1P4BH 1K2DA 4LCCC 4XNZB 4HH8A 1HINH 3OKKA 4ELKB 4DCQB 2KKQA 5T1DL 5C0FA 2W0KA 4PYGA 1UWGL 3QQ9C 3T8XB 1KIRA 1F00I 2WUBH 4X4ZA 3TCXA 1MH5A 1NEUA 1KTLB 3OGCB 2D7PA 5E5UB 1W0WA 2I25N 5C0DA 5IMKB 2IFFH 4LCWE 4X7SH 4G6JH 1JPGA 3MV8A 2F53E 5B4MD 2XPGA 5GRJL 4G6FB 3U0TA 5JPMB 1S7TB 3B3IA 2YUVA 4NRXB 1XR8A 1MWAA 1A1MB 4M1DH 4Y2DA 2VXSH 5C0BA 3ZYZA 2PXYD 1IM9D 2B7DT 3M17B 5CIPA 4DN3L 4UU9B 5E9DE 5J6GB 1F11B 4LPXA 3O8XC 3DARA 4O2CB 4NO5A 3GMRB 2V9QA 1JV5B 3KPLA 2Z35B 4WWKC 4X6CE 3GMLA 5EU6B 2DS4A 4G43B 4OM1H 5E6YA 1VACB 5E2WL 2NNAA 2P5WA 4LSTH 3Q0HA 4LGRB 4U2ZA 1CI5A 2FR4B 4Q9QH 3GGWB 3F58L 1YDPB 2QQKL 3JZ7A 5JXED 4RGNB 4MA7L 2HTKC 3DVIA 4LLWA 4JKPH 3QYCA 5KBNC 2DWDA 4N8CL 5I1CL 4RNRB 2FLBT 5F7FA 4TRPH 5D7IF 4MZ2A 5GGUA 4KJWC 4NUJB 5IFJB 3FB7A 4G8GA 5KSUB 2BNRA 1U8MA 4RZCA 1BQHA 5FUCC 4RWHA 1CBVL 3D85D 4L8SC 1TCRB 2FL5A 1KBGL 4XP6H 3VXRE 1WWCA 3DHJA 5J06A 2A6IB 4XNXL 3ARDD 3BAEL 4R3SB 1WFNA 4RGOL 4DW2H 4KJPD 3OKNA 5TGBA 1XMWA 4WEMB 4J8RA 4MVBC 2P47B 4AEHH 4LASH 1KLGA 1T83C 3HB3C 1QLEH 2J6EH 1H0DB 4NN5B 4HH9B 1F2XK 4PJ9C 5I1IH 4HCRL 3CSYA 4Y5YC 5FA3B 3K46A 3OAYH 1MI5D 4QHKJ 1MUJA 1JF6A 4QRTA 3FT2B 3BKCH 5DDHA 4F8TA 4ISVB 3KPPB 4HW6A 2YMXL 5SWSE 4NQVB 2NX5D 3QQ4A 3WL9B 1F3RB 4P9HC 3WXWH 5JR1L 3FFCE 4J6RH 3KPRE 2E7CA 3UDWA 3MJ7B 4OUUB 3UPRB 2Y5TA 3EYUL 5E4IA 3FL7A 3CGTA 2X9WA 2XTJE 2W65B 1D5IH 4BH8A 2X9YA 1KB5L 1S3KH 1U8NA 2VOTA 1J8KA 3OJDB 1EJOL 1KPRA 4E9LA 5JO5A 2BNQA 2Q7NA 3WXVL 4GO6B 4HFWB 3MLSL 3I02B 3MV9B 1WZ1H 2QTEA 1IGJA 1QPPA 3HE6A 1OAKL 2AJ3A 2AERT 1IEBB 2E7MA 3QPQD 1FO0H 4PY7A 5GIRB 5JW5B 4F9PA 4G3YH 5I16B 1B3JA 3GFUA 4L5FH 3A6BH 1T22A 2QSCH 2D7TL 2YPLA 2Z93A 4WVRA 4X8XA 5F3BB 1UQSB 3HG1D 5F9DC 2NW2A 3LKPB 4HDIB 3U0PA 1MVUA 2UVEA 4RDQF 2FDBP 3QDGA 3TVMB 4BUGA 3B6SB 2R1YB 5LWYH 1S8DB 1N64H 4JG0L 4MDIB 1N5AB 5D1QB 3WEXB 5HY9B 4TUKL 4LSPH 4AENB 4LIQE 3TBWA 4JN2A 1RJZB 1VPOL 4FNLL 1EGJA 2W0LA 1FPTH 3PWPD 4NC0B 3EDDA 3T65A 4Z77A 1AFVL 1BVLA 3P9LA 2F54E 1I1RA 4EN3B 5DMGC 3B8YA 3MRIB 3KPSD 1D5MA 3GMMA 1Z9MA 3MJGX 4G9DB 4UT7H 3FQXA 5F72S 1S5IL 5GQBA 4YHIB 3WKNA 1ADQL 3WO3B 4X9FA 5CGMA 3PWJB 4MCYB 1UADC 3SY0B 3A6CL 4U7KA 2EKSA 2AJUH 1GXEA 1DSFL 4RMWA 4XVSH 5DUPL 3WUWG 2JCCE 3RGVB 1PSKH 3MXWH 2HLFC 3MLYH 1H8NA 5CJQH 2HRLA 2VLKD 4X6DB 4ZDHA 3SO5A 3U0WL 3VG0H 2GI7A 4F15C 1GZQA 1P9MC 5D2LF 2BK8A 1BZ7A 1F6AB 1W72H 1UB6B 4MD5A 4UB0H 4AL8L 3KPMA 5GS1C 4FFYH 1KELL 2A6JB 4EEEA 4V2CB 2J1KA 4JDZA 3QJHB 4UOJA 1ZXQA 4N8PA 3VXUE 4B50A 2LTQC 1VKXB 1I75A 4FQIL 5AZEH 2B1HH 5KANG 3IDNB 4QTIH 4F58H 8FABB 1Y6KR 4D94A 3HI1B 2BVTA 4FFZL 3RY4A 2GSGB 3SJVB 2EXWD 4O51A 1HHHB 3QNZB 3MOBH 4U1KA 1U8QB 5IR1B 5FHBL 3HC3H 4GBXA 1K8IB 3BH8B 5C08B 1FRGL 2R8SL 3VI4E 3R0MA 5C6TL 4EI5B 1I8IB 5TF0A 1Q9OB 1QR1B 1DBKL 5CKGA 5IF0B 5A2FA 2WINB 4L4VA 1XIWB 4KKCC 1X7QB 4PJHA 5TF1L 1IL1B 3NIGF 4G5ZH 4HWBA 3S36L 3V0WL 4NHCL 2WP3O 2A77L 3E2HC 2W1NA 3PJSA 1CK0L 1L9NA 3LQZB 2Y72A 4Z7QE 1T1XA 5ERWA 3FTGB 2X4NB 4FQPA 1MJUH 1JGDA 4CVXA 2CK2A 2VDRL 4JB9L 4S11A 1FDLL 4PJDF 4WW2B 1QFPA 3FOLB 1WEJH 1FVCB 4UT9L 4BFEA 1ZHLA 3DETC 5FF6A 3SEPA 3TJEL 3QIBC 1QBLL 1V7MH 3W0WE 2XZQH 4LQFL 2VDPH 4MHHI 1BD2B 3ARTA 3CDYA 5DJ2A 2G9HA 1EJ6A 1R3LA 5CBEA 2Q7YB 4ZQKA 1KCVH 1JPFA 3KPOA 4YUEH 4KI5D 4NC1E 3BEWA 4JFYB 3MRLB 5IMOB 5EZLA 1S5HB 5IT2L 1TENA 4P4KA 3A67L 3ILQC 2NY6D 3WDHA 1LD9B 4I5BB 3RAJH 5C0CA 4GW4B 3LMJL 1A6VL 3VDAA 2XIDA 4F7EA 2VTFA 3IU4L 5GS2H 4ELKA 4DCQA 5HSFA 1KEML 1DBBH 2H3NB 2R4RL 3F62A 4JGUA 1UVQA 4LVOC 1KTLA 3OGCA 3BMVA 5IMKA 1UEYA 4ODVL 4OFYD 3QG7L 4FFVD 4LMQI 2IPTH 4H88H 1I7RA 5AZ2L 5JPMA 1S7TA 5IHUH 4CJ0A 1MEXH 3MLUL 1A1MA 3DYOA 5IVXF 4NNPH 2G2RB 3ZL4H 1QUNA 1A6AB 5MEQA 3IXAB 3M17A 1F02I 2EKJA 3VFMB 4RFOH 4IOIB 1N5YH 3MV7E 2NY5C 5DEZA 3ZO0A 4C58B 5J89A 3Q6GL 5J6GA 3WFEH 1KB9J 3C8KB 4Y2DC 1F11A 3OTTA 4QXGH 4YFLI 3CMOH 2A73B 3I6GB 1N0LA 3MV11 1F2QA 3GMRA 4EDXB 4PP1C 3H9SE 1JV5A 3VH8B 1DLFL 1CR9H 2Z35A 4P59L 3E8UL 4XBGB 3ULVH 2E7LA 5EU6A 4G43A 5D7IE 1VACA 5C0GB 2Z8SA 4AEFA 1J10A 1WAAA 3FAWA 5E99H 5IG7B 2FR4A 1YDPA 2YZ8A 3WLWC 2OI9C 5DD1H 4RNRA 3UXFA 3GI8H 1K6QL 4LARH 4AQ1B 4PGCB 4K94L 1A0QH 5LKNA 1IFHL 2XYCA 4NUJA 5IFJA 2DQHH 2NPLX 3IAGC 4FQQB 3H2WA 4G6KL 5KSUA 1KT2B 2V5RA 4XWOD 3MA9L 4WGWB 3TEUA 2NXZB 1PEWA 1TCRA 4DGIH 3QULB 1FNLA 4PFEA 4QXTB 4QLRA 2A6IA 4PJIB 4R3SA 3CFEB 1NMCC 3MFFB 2E9JA 2P7TB 2OL3L 2F5BH 5FYKL 3FN0H 1T66D 3R8BB 3S35H 4L8SB 3PGFH 2NW3B 3LKRB 5A40E 2AS5M 1H0DA 4HH9A 5JORB 4P23B 5HHXL 1SYVB 3MV8D 4HF5H 5FA3A 4DOHB 4RRPG 3FT2A 1V3MA 4ISVA 3KS0J 3KPPA 2A9NH 4NQVA 5L2KA 3WL9A 4KKBC 3CCHB 3U36B 2VXTL 4KV5F 2D4DA 2IPUG 3NABL 3FB8B 4NCC1 1EBAA 1OP3K 3VDBA 3UPRA 2LFGA 2W65A 3WFBL 4DEPC 3OJDA 1TJHH 3KJ6L 5DJCA 3EOBA 5HJ3B 3L3DB 3V4UL 3VG9C 2HRPL 3BPNC 4HFWA 4P2CG 2ZUQC 1VEPA 3MV9A 3I02A 5FYJL 3SE8L 2WQ8A 3L7EA 2COQA 1IEBA 3HZVB 4O00A 3ALPA 4DKFL 1HH9B 1RJYB 2P5WD 4HKBB 5I30L 3LIZL 2WM0A 4LCIL 5GIRA 5JW5A 3HE6C 5I16A 2RFXA 1EEZA 4P5TA 3CH1B 1NMBH 1UQSA 1J1OH 5C9JA 4PRPB 3LKPA 5IV2B 4FQHA 4HDIA 4Q6YA 3VJ6A 3RNKB 2I60L 3NOIA 3K3QA 4K07A 5FCSH 2R1YA 1S8DA 5D1QA 1CGTA 4MDIA 1N5AA 4OB5L 4UZGA 3WEXA 1F3JB 3JV5A 1J1XH 1LO3H 2BNRD 1JWSB 1A9EA 1RJZA 3BGMB 3M1BA 4IOFD 4Y16C 5E7BA 1QNZH 4BQ6A 3S6CA 2OSLB 1DDHB 1WT5A 4LLUB 3C5JB 4EN3A 2BRRL 4EKXA 4XP9H 5JNYB 3D87B 4G9DA 1QEWB 4HT1H 4HWNA 3VMNA 1RURL 2HJFB 2VZVA 3ILPB 2NZ9C 4OZHF 5GRZA 2UVFA 3PWJA 4JHWL 3SY0A 1I8KB 4K7PL 3PWNB 2L4OA 5D2LE 2HT2D 1DVFB 2J88L 4QF1B 1A6WL 1OWRM 3LS5L 1X5XA 3QISA 3GZKA 2BY1A 1U8IA 2DKMA 3QNYB 1HWHB 4MA1C 4YZFF 5FV1L 5DC0A 4K8RL 1OP3H 1G6RL 1F6AA 2FGWL 1UB6A 4XHJC 2P45B 2A6JA 3B83A 1H3TA 1PZ5B 5INCB 5E8DL 4P57B 5AG9A 3L5WA 1AXSB 5I66A 5I8KL 3AS2A 4XVTH 2FBOJ 8FABA 3HI1A 4XRCB 2HMIC 2VISB 2GSGA 2AXHA 3SJVA 2YPLD 5EORH 1HHHA 4XPFL 1U8QA 1YQVL 5I1DB 3NIGE 4HAFA 5IR1A 4JQIH 3G6JF 4LAQH 1GIGH 1K8IA 3E0GA 1QYGH 3BH8A 3V4PL 5C08A 5EN2B 4L1DA 1A22B 4ZPTA 1I8IA 4EI5A 1Q9OA 3K8MA 1QR1A 3OF6A 4KKLC 1ACYH 5BZDA 5IF0A 2WINA 4HBCL 2Y7QA 4UV7L 3OX8B 3CSBA 4OJFH 1YNLH 3QUZB 4AH2B 4S1DD 4X4MA 1MFCL 4KK9D 4XWGH 4NKOB 6FABL 1TITA 2X1PA 4FOMA 1A14H 3LQZA 1RZ7H 3JVGC 3IB4A 3S98A 1JYXA 5EA0H 3FTGA 2X4NA 4PV8B 2PTVA 4JY6B 4HG4J 2JE8A 1MCWW 2I07B 5D7SL 3E2HB 1KYOK 1UJTA 3DRQB 2DLFL 4WW2A 3ALXA 2NTFB 4I8DA 5FYKU 4KTYA 4WNQB 5IOPB 2HVKB 4OLWH 3FOLA 2UY6A 1IARB 3B43A 4MXWH 1YYLL 5BW7C 4WO4A 1BD2A 2ORBL 2P42B 2OCFD 4QTHB 3D69A 5F7EH 5F9OH 3QH3B 2Q7YA 4F7TB 2VLRB 2JB5L 5EFIA 3KHQA 2DF3A 3MRLA 5IMOA 4JQXC 5DK2A 4FHBD 3LH2L 5B3JF 3PGDB 1XF4B 1F90L 1CVSC 1MPAL 1RQ5A 3QNXA 5H35A 4JR9L 3LOWA 2HKFL 3V6ZA 3NCJL 4U6YB 4Y2OA 2H3NA 1N26A 1YJDL 3C60B 5DFVC 5FYJU 3FQTB 3IJHB 1EHNA 2X1WL 4XP5L 3GSVB 4GBXD 1FNAA 5D9SB 3TH2T 3EAKA 3T0BA 4LLAA 2B2XH 3L7FB 3MPCA 1KF9B 3ZKNC 1A6AA 3V6OA 5IJVA 3IXAA 4HD9A 4J1UB 2O5YL 4UINL 4EQ3A 2UUDH 4IOIA 5DUMH 1H5BA 3DIFA 4YHKL 4UQ3B 4ZO6A 4X5LA 1ZANL 3RQ3A 4L1HA 3C8KA 4U6XA 4HQQL 5DEGB 2A73A 3I6GA 2CO6B 3O3EA 2C4XA 4OCWL 1LDSA 4BQBA 3KYOB 1Q1JH 4EDXA 4ZD3L 4S1SL 1A4KA 3ME0A 1JN6B 5L0QC 4XBGA 1FGNH 2C1OB 1RUPL 2CUHA 2WV3A 2MKLC 3SDDB 3OJVC 4ZFFA 3OGOE 4HGMA 2DB8A 3RWEB 4PGDB 4CUCA 3BSZL 3MYJB 2GK2A 5I71B 1WIPA 2FIRT 4DAGL 4X80L 5DUBB 3U1SH 2FD6L 2BVEA 2ZCLL 4PY8I 4PGCA 1OGTB 1QSED 4TVPD 3UBXI 4WV1B 5HDQH 2QL1A 2LVCA 4GQPH 1AQKL 3DMMC 5GRJH 4XNUL 3MRPB 2VLMD 1FZOB 1O7VA 4HWZB 1IKFH 2EE3A 1KT2A 1NCBL 2OXHA 3QEQB 3MRDA 1P4IL 2MOVA 1YEHL 3ULVC 4I18A 2A6KB 4P4KD 3SDCD 4GFTB 3QULA 4M8QB 3WUWA 1TQCC 4RX4A 4KVNL 3NFSH 4RAVB 3MFFA 4X7FC 4DN3H 4EIGB 1I9JL 2P7TA 3L95A 1JPSH 3QIUB 2B4CL 4APQC 3S34L 1NGWB 3ESVF 2D31A 5JORA 4P23A 1SYVA 4GKNB 4LCYB 4CMMA 5IEKB 1I3UA 2NX5E 4G6FD 4NWTL 2CH8A 2MPAL 3RZCC 1IAIM 4WFGE 3CCHA 4PP2B 4UDUB 1FFOB 2EO9A 5CJXA 2VXUL 4MA7H 2VZTA 1V3KA 3FB8A 4OUOA 3GI9L 1KGCD 4M7JH 4N8CH 5DQJB 5I1CH 4U3XA 1DZBA 2CKBB 1CL7I 2IANB 3T0VA 5HJ3A 1VENA 4Q2ZB 3L3DA 1WBZB 2Q87A 5HHMB 4LGSB 3PP4L 1RMFL 5K9JL 3F6LA 4PJGF 5EU6D 3FN9A 2HFEB 3WN5C 1T4KB 3HZVA 3DOSA 4GQ9H 4HEME 5E5MA 4K23L 4DEPB 4HKBA 5A2IH 1CBVH 2NR6D 1KBGH 3HG1E 2GJ6B 4RGND 2PCPA 4IRZL 4XNXH 3VG9B 3BPNB 3BAEH 4RGOH 1TVBB 3AM8C 2KZ1B 2EDEA 4KKAC 5DD6B 4NWUL 4PRPA 2GCYB 4Y1AB 5T3ZE 1UZ6E 5IV2A 3IDIB 3BD4A 1JHLL 2MCG1 3TZVA 3ZTJH 1CFVL 3UMTA 5CZXD 1N0XH 3S37X 4HCRH 1WZKA 4WRLA 3IDJB 3PWPE 5EZOL 2X1QA 2Z8RA 1JWSA 3BGMA 3DUSB 2YMXH 3G08B 2R1XB 3KPSE 4OZHE 1OARL 2OSLA 1T6VN 3OKLB 3TO4A 5SX5H 1W0VB 3C5JA 3HAEH 4HPOL 3FMGL 3EYUH 5JNYA 1KB5H 1G84A 3MLTB 1EJOH 2D9QB 4JFHD 2HJFA 3CZJA 1A5FL 3WXVH 1FO0B 3ILPA 4XZUB 1DUZB 3MLSH 5IESL 1I8KA 1BAFL 4RAHA 4YDKL 4YZFE 2DRUA 3HMXH 1DVFA 1MCFA 2PW2A 2DYPB 5EO9A 3GSNL 1NC2B 4M3JA 4E42B 5T33L 4MQSB 2D7TH 3QNYA 4NRYB 4BJLA 5EU5B 1BZ9B 2BVUA 2H8PB 4K7PY 3AREB 3WSQL 2E9WA 1S9KC 1D6VL 3SQOL 1NAMB 1NLBH 1Q72L 3EUUA 1DQTA 1D9KB 3FQUB 1J5OL 2D03H 4OI9A 3GMOB 3P30L 4KQ3H 4JY5L 4JG0H 3MV9D 3TWCH 1OL0A 1AHWB 2VXVL 3C6LB 4WFHE 4MA1B 3U7WL 1PZ5A 5INCA 1U91B 3G6JE 4P57A 2BY0A 4U1IB 1VPOH 4FNLH 1AXSA 1Q0XL 2X4QA 4QWWD 4O5LL 1YEKH 2ZG2A 2IQAB 3P0YL 3EJZC 5GHWL 1IGIL 5D6CB 3HE7C 2VISA 1U3ZA 5GGSY 4F37K 2JELH 3GJEA 4GS7C 4L3EB 1N4XL 2AXFB 4Y4FC 1ZLVH 2DLHA 3IJSB 1S5IH 5EN2A 3TVMD 3CFJA 1ADQH 4JFQB 3D3VE 5D72L 5DFTA 5E70A 4IJ3C 3RKDC 3EYOA 4AIZB 3EZ8A 3A6CH 3HN3A 2R4SL 3ULUD 1DSFH 3QUZA 5DHYB 5DUPH 5C86A 4AH2A 5C7XL 2Z31B 3RVWD 4PTTB 1OF2B 2WUCL 4NKOA 5F1IB 4M5YL 4GSDL 4KY1H 3U0WH 2OJEB 4AG4L 2VB5A 3BPLC 4M8VA 2CDFB 5F44A 1DQQA 1TETL 4PV8A 3VXPB 4ODUB 4QXUL 2KL6A 4JY6A 2DIAA 1GGYA 4AL8H 2E6QA 3RP1A 1TQBC 3C8DA 2I07A 1KELH 1CDBA 3DRQA 1G7LA 4XGZB 3VFVB 4Y19B 3QR2A 3PXJA 4I3RH 2NTFA 1U0QA 3PHQA 4WNQA 5IOPA 3WYRA 1CLOH 4J3OC 4M1CD 3LB6D 3RGVD 5B3JE 4FFZH 3DSNA 2QKIB 1LE9B 5BV7H 4KQ4L 5FHBH 4YFDB 3QH3A 4F7TA 4WHTB 1HWGB 1XGPB 4O58L 2VLRA 4ZNEA 4HV8A 1XF3B 5TFSL 4D9LL 1TZHB 5J57B 2P43B 2AAVA 4Z18A 1DBKH 2WP3T 5AYQA 1FGVL 2EC9T 2FATL 3PGDA 4URTB 4RRPA 1XF4A 4NZUL 4O4YL 2FEEI 3ZE1F 1KC5L 1G0XA 5TF1H 5E4EC 1ZHNB 3V0WH 5C0JA 1PKQA 5BVJB 4NHCH 2A77H 2Y36H 3C60A 3SJVD 3RVUC 1CK0H 1BJ1J 3FQTA 3IJHA 3MRHB 3T0EB 3WD5L 4R4BA 3VXSB 5IVZB 1V5JA 4NUGL 5DVKA 3WNMA 5F1SA 5C08D 1BGXH 5ETUB 3LPFA 2P24B 4MAYC 4EI5D 3OF6D 2IADA 4HMEA 3EYQD 4JB9H 3BN9D 1FDLH 3EOTH 3I84A 1AP2B 5J13B 1RIUH 2J2ZA 3UC0L 4J1UA 1XIWD 4MJ6A 2AEQL 4UT9H 2GUOB 1OTTD 1EEQA 3PL6B 1OPGL 5DA4A 2AQ1A 3TJEH 4XNMB 1QBLH 4ZOCA 2ITDB 4LQFH 5DEGA 1ND0A 4H8WL 3KYOA 1DBAL 3BEVB 3D39E 3MOAH 2GT9A 4FFWD 1JN6A 4P0DA 3BE1H 3ARUA 1Q94A 4HUWB 4BH7B 5KAQF 2FEEL 4D2NA 2JTDA 4NYLB 5IT2H 2R1WB 3OZ9L 3PV7A 3SDDA 3VFWA 3MJ9L 3A67H 3RWEA 2OQJB 4PGDA 1CGSH 3LPGA 3FO9B 3LMJH 1A6VH 3WJLA 3IU4H 3KLSA 1KEMH 4PS4H 2R4RH 1MLBB 4DGYL 5DQ9A 3U46B 2FO4B 1CE6B 3MRCB 1C5BH 5I8CB 2XWTB 4NQDE 2FGZA 1BD2D 4OV5B 4PJAF 1OGTA 3TIDB 4WV1A 4ODVH 5CSBA 3QG7H 1CU4L 1VFAA 2L0DA 1A9BB 3ARPA 3TFKD 2J12B 3QEQA 5EU7C 3MLUH 4JFXB 5J12B 5C71A 5BRZB 5EUKB 3G04A 1T89A 2W91A 4N0UA 1G7QB 1IT9H 2C9AA 3W5NA 5ADOL 3Q6GH 4I18C 2X6MA 2IBGA 3NGBC 4JRYB 3QIUA 3MV8E 4H0HB 2PUQT 3OXSA 3GSQB 1NGWA 1JNHB 1DLFH 5IEKA 4P59H 1N59B 5C0BE 3E8UH 2WLYA 1NBQA 5TJWK 5TDOB 2J3SA 1SJVA 4LPVA 1AY1L 4M4RA 1MRDL 1MCIA 4W4OA 3QDAA 3OBAA 1IGCL 5CJ8A 4JZNB 3FCTB 1WK0A 4LVHB 4OCSL 4UDUA 1FFOA 3WS6A 1B6DA 1MRCL 1EK3A 3AS1A 5DQJA 3RZCB 1KIPA 2BHYA 1K6QH 2CKBA 2IBBA 1PD6A 4K94H 2IANA 4JG1L 3BESR 4YDIH 1Q38A 1WBZA 1JF1B 2P5WE 3U4AA 4JAMA 2AEPH 4G6KH 3ARGA 4HUXA 1L0XA 1K8DB 1I1AC 3MA9H 1DN2A 3O8XD 4EOWL 2GJ6A 3BUYB 2BSTB 2YUWA 3QAZC 1TVBA 1WAAF 1JRHI 2OL3H 2GCYA 4Y1AA 1VFUA 3IDIA 4PBXA 5JIIA 3DURB 4OD3L 4G8GE 3BGFC 3NCYP 2BNRE 4X6FB 5HHXH 3L3HB 4BKLB 3GSRA 4NQSB 1CGWA 3ULVF 2K7QA 3DUSA 4DK3A 3BO8B 1HI6B 3G08A 2R1XA 4C57C 4HJJH 4NN7C 4X9IA 3FB5B 4R9HA 2VXTH 4YHZL 4RX4D 1W0VA 4NN6C 5BZWA 3NABH 1J05B 4Q0XH 2A0LC 2EDRA 3ARFC 2AKRB 1MCWM 1JZ6A 3MLTA 3KJ6H 4P48A 4EDWL 5SWZA 1HN1A 1QZ1A 5EO0A 4P23D 5HGAB 3V4UH 2DM2A 2LU4A 3SE8H 3VFUB 3DXAB 3IVKB 5DHVH 5D7JA 5D5MF 1JVKA 1CT8A 5IWLC 1FZJA 4MVBD 2DYPA 3VFGL 2OZ4L 1JRHL 4LCIH 3S88H 1NC2A 2P49B 3TF7C 4E42A 4KMQA 1LK2B 3GIZL 4EUPG 3QUXC 5FO9A 5EU5A 4FS0A 4XTRC 3QXWA 4ZFGL 2YBRB 2H8PA 2O93L 3AREA 1MOEA 2WANA 2ZCKH 3RWJB 4P5KB 1NAMA 1AR1D 2I60H 1ZGLA 5H94B 1D9KA 3FQUA 3OKMB 2W0FB 4HAGA 3DVGB 1AHWA 2VL5B 1MCPL 4P46A 2PTTB 1JWUB 4U1IA 4WUKL 2FX8L 5IHZA 2YPLE 2HN7B 1K3IA 5DJ8A 4GG6B 2IQAA 4IDLA 5LGJB 2ZNXA 1IAKA 1ZEAH 5D6CA 5DVOA 1SMOA 4PB9L 3QDGE 2BRRH 4PRPD 1WC7B 1A47A 4MQXD 5BMFH 1DBJL 1HHGB 1KJ2B 2AXFA 2EEDA 3IJSA 2PETA 1R3JB 1RURH 3G5YA 4PG9B 3RZWA 1CE1H 4JFQA 3Q48A 1MVFA 3HE7B 4JHWH 3QEUB 4K7PH 3RA7L 3G5ZA 3MSPA 4WUUA 4OCNC 4AM0B 1WGOA 3FONB 1B9ZA 1EUTA 3SKJH 2C1PB 2J88H 5DHYA 4KMLB 1UM5H 4FMKA 5C0EA 2ZUVA 1A6WH 2Z31A 3LS5H 1RZIB 4PTTA 4KDTC 1OF2A 3P73A 5F1IA 3U2SB 1LP9F 4XBPB 4OZIB 1BVZA 2OJEA 2CRYA 4LSRL 3DGGB 3W11C 4TTDC 3KXFD 4K8RH 2CDFA 5J7CC 5DVLA 1G6RH 2FGWH 4ODUA 3NCBB 3L9RB 3JV0A 2X89A 1IC4L 2BVPB 4XGZA 5BCAA 4Y19A 1MHEB 2Q8AL 2FHFA 5DMGD 5EU3B 5E8DH 5F9AC 5C0IB 1DVFD 1V7NL 3MUY1 1KN4H 4JM2C 5T1LB 1MCJA 1P53A 3GSXA 3AXLA 1YNTA 1TQBB 1I1CA 4TUJA 1I3RB 4WW1A 1LE9A 1EEYA 4JPWL 1RUML 1YQVH 2HLAB 5LJYH 3OKEB 4WHTA 1XGPA 1K5NA 3MODH 1MHHA 1TZHA 5F9WC 1KG0B 3NA4A 5I0DA 4F8QA 2X5PA 4UV7H 5M95B 2X42A 5FGBC 1YUHB 4EZMA 4RSVA 1P7HL 4YK4C 4OCLC 1UEMA 4J4PC 1ZHNA 3ARZA 5BVJA 4R2GC 4BFIB 5I1KL 3ZMRA 1MFCH 6FABH 1FFNA 2FHBA 2AQ2A 1ZLUK 2H2SD 1GOHA 1U42A 4Y5XA 4UDTA 1TVDA 3KLAA 3T0EA 4XMPH 3VXSA 5KJRH 3SE4A 3MJ6A 3VGAC 3V5DB 1T04B 4JVUA 3QP3A 5BV7C 3BRGC 2VR9A 3I50L 2P24A 2CLVA 4PJHE 5D7SH 4GRLA 4N8VG 5I8EB 2DLFH 4LQ1A 1T6WA 3IFLL 3QUYC 1AP2A 4Z7VF 4YHYC 5I76B 5JIPA 2FEDC 3BVNA 3QUZD 5T1KB 4O9HL 1PX3A 4XBEL 3TP4A 5AD0B 2GUOA 3QFDB 1UACL 3PL6A 3I9GH 4XNMA 2ITDA 1YYLH 4WU7B 3R1GL 4X5WB 2ORBH 2PN5A 4QRRB 2DBLL 3FT4B 3BEVA 1JGVL 4B0MM 1A7BA 3TT1L 3GDBA 3ORJA 3RJDA 1SYSB 3B2UD 1HHKB 3UJJL 1QOKA 2VQ1B 1FLTX 3LH2H 4WFED 4XPHL 2QR0B 1FL6A 4R90L 3VGDA 4JR9H 5ESAB 4YPGB 3NCFB 2KQMA 2HKFH 3NCJH 3T77B 4TVPE 3MLZL 1IC5H 1MLBA 3BP6B 3U46A 2D0FA 3HLAA 1CE6A 1YJDH 4ODWB 2XWTA 4OV5A 2FIKA 2XZZA 4ZO9A 4WU5B 1IAII 4XP5H 5H37G 2VLRD 3IGAB 3KAAA 3SCMC 4LCUA 2W60B 2Q76A 1Z0NA 2HWZL 5C0CE 3QIBD 2H32B 3RVXC 2F19L 5HTSA 4RMSA 2EXYD 4QYOB 4JFXA 3G5XA 1VESA 5J0BA 1ZLWK 5BRZA 3BZDA 5EC2B 2A9MH 3SBWA 3EOAA 4JKMA 1G7QA 4X7DC 4YHKH 3QIWA 1MELA 2F74A 1A8JH 1ZANH 5CGTA 4EUPB 3BIKA 1XGYL 1AGBA 3O2VH 3C60D 4JRYA 5K59E 1X9QA 3CJJA 4OCWH 3N1FC 5EBMB 4OKDA 4U6VL 4ZD3H 4S1SH 2WLZA 4YXLL 3RY5A 2KZWA 1CD8A 1G1YA 2C4FU 4FZEH 1RUPH 2ZOLB 1EO8L 4QHLA 3ZE2E 4NQCB 5ITBL 2IFGA 1KGCE 1XGTB 3WNOA 1VHPA 3BSZH 3RKPA 1HNFA 5E0QA 1MCLA 3MRKA 4DAGH 15C8L 4X80H 4LEOA 1IAIL 1VFMA 4W4OC 2FD6H 2ZCLH 2PO6B 1UA6H 4GUPB 3HZKA 4K71C 3WS6C 5EU6E 5J1SC 4MA3A 3DO7B 4RMQA 5GJSL 1JF1A 1WAAE 4OQTA 1AQKH 4XNUH 5F7MC 3OKYA 4BZYA 5ISZB 1NCBH 1K8DA 1YEHH 2GEEA 4QNPF 3SDDD 4XB7A 5E5RB 5TE7L 3N1PC 3GK8H 1C08B 4HS3A 2R9HC 2R69L 4JFEB 1FHGA 1I9JH 1CXIA 2A38A 3K4ZA 3O81A 2B4CH 1BEYH 1R3HB 3BX7C 3TGXA 3DURA 4YAQB 4HZLA 3S34H 5IP4A 2K9UA 4X6FA 2R2BB 3L3HA 5HGHA 4K94C 3WLWD 4HUUB 4NQSA 4KFZC 4NWTH 4UIMA 2CRIA 2MPAH 2X1OA 2NY2C 3NVQA 4NHUB 5J9PB 1KCLA 3QEQD 4R4ND 4J3UA 1HI6A 5F7UA 3AY4C 2VITA 1NFIA 3FB5A 4JPIB 2VXUH 1ZLWH 4JFOA 4JFHE 1NGZB 3GI9H 1AXIB 1FQ9C 2ZUXA 1X5GA 1UJ3C 4R0LB 3QIUD 3SE3C 5I2IB 1JE6A 2XRAL 2HT4C 1QFHA 5KSAC 4JHZA 5ICXB 2WIMA 1RJLA 3B9KC 3ARVA 2DWEA 1RMFH 3PP4H 4QGYA 4NN6B 5L2KE 3FAXA 1IKNC 3IVKA 1F3DJ 3MQIA 2CRZA 1AD9B 3FO0L 4CVWA 3WCYA 1N7MH 5CMAA 5ALBL 3TNNB 3GMPA 3LD8C 1DCLA 3VRJB 5IGXL 4QOKB 5MI0B 5GGTL 4IRZH 1LK2A 3M8OL 5D7JC 4LRIC 3RU8L 4NIKB 3PP3K 3QCVL 4NWUH 5I73B 2YBRA 3WNLA 4GJTB 5DRNA 1JHLH 1X5KA 3MV9E 1DN0A 3RWJA 3UYOD 4P5KA 3RTQC 2DKSA 2Y6SC 1CFVH 2IAND 5H94A 3RIAF 3OKMA 2W0FA 2OP4H 3FZUC 5HHMD 2Y23A 3DVGA 4MS8C 3VGBA 4E5XB 1GZPA 2VL5A 1MCOL 5EZOH 2PTTA 3V2AR 1AE6L 2R2EB 1KXVC 2HN7A 5JUEL 3GRWA 4N5EC 3VXMB 4JDVB 1OARH 2GJ6D 4WHCA 1P7QB 2Q3AA 3CX5J 4P46C 3D2UB 4HPOH 4OLYH 3RI5F 1CL7H 3CFIC 1WC7A 1M7IB 4Y1AD 1HHGA 1KJ2A 3RVVC 1Q8MA 4OF8A 4BZ2L 1T03L 3OAZH 4Z7WB 5KZCD 4NZDA 3ULUE 4DZBB 3S5LB 1A5FH 1X5AA 2XWBB 2N1KA 2DMKA 5IESH 4YDKH 2EDFA 3QEUA 4NBZB 3N1GC 4UNUA 4AM0A 3FONA 2ITCA 3BZFB 2FSEB 2G60L 5B22A 3QXUA 3GSNH 4LVNB 1IBGL 3DVFA 1SMAA 5I75C 3U2SA 4JZJB 4XBPA 5IKCB 3RL2B 4OZIA 1YEFL 3DGGA 3GJFK 1RZ8A 4CU7A 1NCAH 3WSQH 2YWZA 2LU3A 1D6VH 1A3RL 3SQOH 4Y16D 4KJQC 4TQEL 43CAB 3L9RA 2ERJB 3T1FA 1J5OH 3HMWL 3VGEA 3P30H 2FBJL 4G9FD 2BVPA 5C07B 4RIRB 2VXVH 1MHEA 1UXSA 2E7HA 5F7DB 3U7WH 4X6EB 5EU3A 5EUOB 5C0IA 3WFCL 4PJBB 1PG7W 5T1LA 2DYPD 2EE6A 5JZ7D 3AU1B 4LLVB 2OTUB 3P0YH 4I9WD 1IGIH 4YE4H 3T2PA 3DX9B 3O3DB 4PGZA 4GKSB 1N4XH 3OKEA 3ARED 5GJTL 3PP3H 5LGHH 4I3SL 4C56B 3TA3B 4K8RC 1EPFA 2N56A 4KUCD 1D9KD 4MWFB 3QFJA 4WI6A 3ZSTA 3D6GA 3C6LD 2R4SH 1S9VB 1YUHA 2GKIA 5E03A 4D9RE 5DC9B 3MRGB 4HJ0D 1BOYA 3SJVE 1BIIB 2J8UF 2GSIB 5EBLB 3PABB 4XCEB 4M5ZH 4BFIA 2WUCH 4PRHB 4LIQH 4M5YH 1PDKA 5C08E 3WV0A 4AG4H 4PRBB 4R97B 3ZKXC 4L3ED 2V5MA 3D48R 1LMKA 1A7QL 5B8CA 1TETH 1T04A 3IYLW 3NMEA 5AEAA 3V5DA 4QXUH 1ZSDA 1QBBA 4GXVL 1G6VK 1UCBH 3P4LA 4FQXC 4JRXB 5I8EA 2HMID 3ES6A 5DZLA 3SE4C 2R2CA 4X4ME 3VFPB 5I76A 2BCKB 2APTA 3STZA 1HXYB 4K3GA 5T1KA 1MFEL 1J0HA 3GMNB 2E6JA 5AD0A 5IB4B 1L0YA 5BV7B 5ADPH 3QFDA 2Z31D 3L5JA 4GRLC 5MEPB 2QHLA 2WZPD 1Y0LB 1F4XL 4WU7A 5FOJA 2DDQL 3QUYB 4QRRA 4XCCL 4KQ4H 5F7HA 4PJ8C 4O58H 2Y06H 1JFQL 25C8H 5IB5B 1CXLA 5TFSH 4JREC 3P11L 2P46B 3GJFH 3FQRB 3MCG1 5DZNA 1HHKA 3QA3B 1IAMA 2X89D 2VQ1A 1FGVH 4YGVB 4NSKB 2FATH 4G42B 5LGKA 4Y19D 5DD0H 2QR0A 4NZUH 4OV6F 5ESAA 4YPGA 4A6YL 1BD2E 3NPZB 2C4FT 3U4EB 4Z7OE 2R56H 1SVZA 3BP6A 2AJZA 4TYUA 4ODWA 2YD9A 1S7UB 3RDTB 5J11C 1BVKB 3WD5H 2NZIA 4J3VA 2EZ0D 2HT3C 4P9ML 3IGAA 4NUGH 2Z92B 1J1PL 3SDXF 3O6KL 4ZG1A 5CSZB 2W60A 2V17L 4S0TD 3L3KB 35C8L 4QYOA 4Q6IB 3IKKA 4LRNL 3UC0H 5ANMA 5EC2A 2QQQA 2ZKHH 2AEQH 3P77B 5D7LB 3SCMB 2VN7A 5D1XC 2I26N 1OPGH 4EUPA 1OWWA 2DM3A 3IDMB 1I9RL 5DC4B 1MCEA 1ZE3C 3MRMB 3T0ED 5GSRA 3VXSD 5HHOB 2B5IB 1ZVHA 1YJDC 5EBMA 2VNCA 1J86A 1G7MA 4OLEA 1UT9A 2NY4C 1DEDA 4I4WB 5ICYB 1TPXB 4Z7NF 1R3KB 3V6OE 2VC2L 1RZKH 3VWJA 2ZOLA 1EHAA 2AEWA 3CXHJ 3MJ9H 1KTDA 1OAUL 5IROC 3U9UB 4O2FB 1NUNB 4LOUC 1SJHB 1X5YA 1QFWM 4F9LC 4I48B 3EDFA 1I7ZB 5EPMB 3SGKC 3PL6D 1KCSL 4MSWB 4DGYH 4QNPE 3CLEL 4HGWA 3PF2A 3B8SA 4QT5B 1BBJB 1S7XB 2PO6A 3BDYL 3ZKND 1TVHB 4KJYA 4OZGF 4S1RL 3SKNB 3TBSB 1CU4H 4YDLC 4RFNB 1NLDL 3MJ9A 2G75B 1WBXA 5ISZA 4ZFOL 3GKWH 5GS2D 3KYNB 1KUMA 1UXWB 2DI8A 1F8TH 4M9OA 4W81A 5KVEL 1C08A 1U8PA 5DT1L 2N7BA 4JFEA 3BQUC 5ADOH 5IM7A 4KVCL 3UTOA 3RGHA 3T4AA 1BOGB 1EFXA 4M6OH 1GGUA 1R3HA 3QG6B 4YAQA 4HC1L 1DJSA 2GY7B 2BVQB 2R2BA 2VYRE 1TCMA 4MB4A 5FGCB 1XGQB 4HUUA 5HYJA 1HKFA 4I0PB 1CFNA 1BJMA 3WHXB 5C2UB 4NHUA 5J9PA 1C16B 1AY1H 4Q9BA 1MRDH 1GYAA 1IGCH 3ZSSA 5BRZD 3ZDZF 1MRCH 1J87A 3DMMD 1NGZA 5K33A 3JWNC 1M6OA 2GITA 4R0LA 1DANU 1IQDB 4JRYD 2P8PB 3WFZA 1KLUB 5I2IA 2NY3B 2YA2A 2AJYH 4Y4HB 4DOHE 3FJTA 3U82B 3D0VB 5ICXA 2B4CC 1LEIB 4MJIB 2XY2A 4IRJC 4HLZG 2NXYB 1CD1B 1IZKA 5E2JA 1GVIA 1AD9A 1H8SA 5FK9B 1BQUA 1UJ3B 4POUB 4CADA 4G6AD 1OW0C 3TNNA 5I9QB 1MWAL 1U8LB 5KSAB 1E4XI 3VRJA 4EOWH 4KRPC 3OWEA 4QOKA 4JVPA 1T7XA 1IQWL 1ES0B 3RZCD 1L7TL 5JOFB 3IDYC 3WFDL 3O6FC 1WFOA 4KK6C 3S4SB 4B7IA 2NY0B 3IF1B 4EI6B 4P2RB 1SBSH 5CZKA 3O9WC 1OLLA 1MJ8L 4ONFL 1KIQA 2FB4L 4PRDA 1Z9LA 5E7FA 2R2EA 5F1KC 3PHOB 1H3PL 3VXMA 4JDVA 4PRPE 3EYFB 1I9IL 5TE4L 4YHZH 1HEZB 4NT6B 1P7QA 2X4PB 3PGCB 4V1DA 5GSVB 3D2UA 1ZHKB 5E95B 1M7IA 1N2RA 2ZUYA 1JCKA 4JQVC 4D8PA 1WV7T 1EVUA 4Z7WA 4Y5VB 4EDWH 2EIBA 2XWBA 5IK3B 1U8JA 4PD4K 1QVOB 2ADJA 4G7VL 5T5NG 4ELMB 3B5GA 1MLCB 3IDGB 3OL2A 1O5DT 1E4XL 2HFFB 4NKMA 3GUTB 4OCYL 1YN6A 4X5XA 3BZFA 5MP6L 2FSEA 3VFGH 1F42A 4P2OC 1NGQH 3TBTB 5K9OB 2IAMC 2VIRB 3DNKA 3GIZH 3MCLL 4QHNB 4JZJA 1ETZA 5EOCJ 5IKCA 1AIFB 1Q9WA 3RL2A 4YFLF 4ZFGH 1BF2A 3D25B 2XT1B 4ACPA 5C0RL 2MFNA 1SVCP 2FJHB 4G7YL 2I5YH 43CAA 3PNWA 1A2YB 3U4BL 5FAAA 5I1AB 3EDKA 3O2DA 1T2QH 5I75B 3DXAD 5E8NB 3PWUB 5F7DA 3JV4A 4X6EA 3C5ZC 2VUYA 2OZ4A 3KHOA 1MCPH 1RSFA 5C70A 3L6FB 4WUKH 2FX8H 2D3VA 1YQ2A 5JW4M 3PWLA 3AU1A 4LLVA 2OTUA 5F7WC 5TQ0L 3DX9A 3O3DA 3N1MC 4GKSA 4PB9H 4I0CC 3PE9A 1JGLL 1DBJH 2YXFA 1KCRH 3CSPA 4C56A 4M62L 5CUSL 3TA3A 1QSFB 4MWFA 4P2YA 1LNUA 1S9VA 4R4FL 3RA7H 4XXDB 4M7LL 3TO2A 2D9CA 2XTJC 1J0JA 1BIIA 2GSIA 3PABA 4XCEA 3CIQA 5D96C 3MCKA 2DTML 1OB1B 4WGVB 4PRHA 2FH6A 1PY9A 1UWXK 2FWOB 3J7HA 4XAWL 5GGSB 4KKNA 4LSRH 4ZPVB 4PRBA 3TPUB 4Z7UB 4HPYL 1MCBA 3CU7A 1FNEB 3QXVA 4KDWA 1IJ9A 5J3HC 3EJZD 5FCUL 4B41A 1T0PB 3DX7A 4JRXA 3HE7D 2EDHA 1ZTXL 1QSZA 3VFPA 5B8CC 3FB6B 4LFHG 1HXYA 3GMNA 5ABDE 1QD0A 4Y4FD 3C6SB 5IB4A 4MXVF 5MEPA 1Y0LA 1EGJL 2IMNA 1JWMB 3OJMB 1AO7B 3ROLB 4HFUH 4JPWH 2FCBA 4LEXL 4LSQH 5IB5A 4WFEE 4JO1L 1ZA6B 3UAJC 3O4OB 2GAZB 1EUUA 3QA3A 3BIBX 2NQCA 2C3WA 4NSKA 4G42A 5KVMC 1CDJA 1AR2A 2I27N 4HIEB 5T1LD 2VERN 4GAFB 5I1EL 3U4EA 4P2QD 4Z0BL 3WIHH 1CXEA 3VXNB 1JZ4A 2VLRE 4ZNEE 4XI5D 2VDQL 1S7UA 1BVKA 2ICEB 3OV6A 1OAYL 1VEMA 3VRIB 3P4NB 3I50H 5CSZA 3L3KA 3IFLH 3NFNA 4KGJA 1FH5L 2ESVB 3QSKB 3P77A 4Z7NE 4M4PA 4NNXB 1UACH 5CP3H 1RU9H 1C1EL 4HKJB 3IDMA 3NCMA 4WTXA 3X11A 3R1GH 2DBLH 4FXKB 5HHOA 1WWWX 1UWXH 4FTVB 2ICWJ 5D6DC 3TT1H 5KVFL 5ICYA 5F1NB 1QQDB 1R3KA 1SJEA 2BVYA 3UJJH 1WITA 4X9BA 5JW4Q 1Y6NR 4WFFD 1ZA3B 3RVUD 1S7WB 4O2FA 4AZ8A 1U3YA 3NZHH 1SJHA 5KOMC 5DSCA 5HD8C 5EPMA 1I7ZA 3S9DB 3MLZH 4HWBL 4MSWA 3LZFL 4ETQB 2YRPA 4QT5A 1BBJA 1VGKB 1Z0MA 4QRRD 1YMHA 1TVHA 1CTNA 3SKNA 3TBSA 1S78D 4PJXB 4IEFB 1FV1B 4DN4L 4J7RA 2G75A 1WWAX 2HWZH 2PR4L 4WI3A 4KU1A 3N85L 3KYNA 3C09C 4HUVA 1RZKC 1UXWA 3VFOB 1HDMB 3QUMB 3HKFA 4M48L 4YDLB 4FQCL 5HGBB 1BM3L 3MUJA 1FAKT 5IBLC 1T1ZB 3MJ8B 1XGYH 3RVTC 1BOGA 3V7MA 4PJ7B 3ZDZE 3QG6A 4OTXL 2PNDA 5HDBF 3PQYD 1IM3B 4H1LH 1UYWH 4X6BB 3QEQE 2ZP0T 1YEIL 4TVPL 4YXLH 4FABL 2Q86B 4KRNA 5IFAL 1XGQA 3MRNB 4G8EB 4I0PA 2D7OA 3WHXA 3OR6A 5LQBL 4JGJA 1QLFA 1EO8H 1C16A 4NM8H 4OFVA 2RIKA 4N0UE 4ERSL 1M05B 1I3GH 2JKXA 4M93C 2VDOL 1MCRA 5IBUG 4UQ2A 4NFDA 4U1GC 1NUDA 4KZEL 1MQKL 2X44D 4P99A 4Y4KC 4NQTA 1G7HA 4MQ7B 4NC1C 3DTXB 3EFFA 4HEPG 4LSUL 1IQDA 4CMHC 2P8PA 3T1WA 1KLUA 3HA0A 1S7VB 4Y4HA 4GAJL 4QKXB 5DVMA 1LEIA 4MJIA 4U05A 2MHAB 5GJSH 1YEDB 4U0RC 3ZHLA 5M7QA 3QDHA 3PUCA 2ZZUT 2K3TA 3CDCA 4NQCD 2DQEL 5FO8B 1FZMA 1KJVB 4Y7MA 2EEBA 1U8LA 3H6JA 4ZYKA 4D0CB 3UJTH 2R69H 2X4TB 4DQOL 2WWMC 4MMZC 1K9TA 2IANE 2P4AB 1ES0A 3QQNA 1U8KB 5HHME 4X7TB 1AKJB 2I9TB 5FIEA 2GFBB 2PO6D 1LDPL 2JF1A 3HI5L 5GZNC 4TPRL 5E94B 3FHAA 4YJZL 2X2YA 4KRPB 4EI6A 5ILTL 4LCWB 3KYMB 1Q0YL 1P5UA 4P2RA 4BFGA 4ONGL 5JA8B 3Q3GA 2GJ6E 5ISZD 2GJZA 2ZUWA 1NGXB 5C92A 1AC0A 3PHOA 3IDYB 2FO1A 4LMQE 4Y1AE 3S97C 2K1MA 1HEZA 4NT6A 4JFED 1QSVA 4NRZA 5GSVA 2F5AL 5DJ6B 1JF5A 4RA3A 5KS9A 3C8HA 1INEL 1MCNA 1M71A 3EHBC 3QDMB 4K3HA 3U7AA 2XRAH 3EFDH 4Y5VA 3GNML 4YDJA 1ZLSH 4IIQB 1LK3H 1QVOA 4ELMA 5I74C 3O0RL 3IDGA 3HHRB 3ZT7A 3FO0H 2HFFA 5FYKE 3D85A 3VFSB 2P1YA 3TN0C 4KI1A 5ALBH 4CU6A 4TVSa 5IGXH 2V5SA 3ARDA 2EDTA 3JXAA 4XNQA 5GGTH 5K9OA 2VIRA 4WY7L 4CN6A 1ONQB 3RU8H 1A7OL 3QCVH 3SKUD 5SWZE 3D25A 5HPOA 2DKUA 2DQJL 1PQZB 4P2OB 4NQEB 5EWIL 1HSBB 4HHAB 5I1AA 2VKWA 5EBGA 3S3JA 3EJYD 4KUZL 3X3FL 1MI5A 5E8NA 1Q9LB 3NACL 3LV3B 1MCOH 5B38G 4I9WE 3LKNB 2WQRA 2DJSA 1AE6H 2X70B 4L3AA 5JUEH 5F6IC 4KGLA 1HKLL 2ENYA 4NJAL 4UBDC 1PKOA 3OSKA 5FYJE 1C12A 4F7MB 3MC0A 1CGYA 5A16B 5T1MB 2HG5B 4P3CH 4BZ2H 1T03H 3HZYB 3VFNB 1EHXA 1X4YA 1UM4L 3ZTNL 5T3ZH 3GSNB 3S3PA 1I8MB 2DIJA 2G60H 2W38A 3SKOA 3DHMA 5SWSB 3VXMD 5TQ2L 1YNKH 4X6CF 5C6PB 1A6TB 2FWOA 3UZVB 1YEFH 1NKOA 2AEIT 4TULL 2JJTA 4ZPVA 4R96B 3TPUA 4YHPB 4Z7UA 4KDVA 3THML 1TTUA 1FNEA 4XCFL 1QBAA 4MXVE 1A3RH 4TQEH 4WUUE 1DUYB 1FN4B 3HMWH 4IMKA 2DQFB 1YMMD 4GLRI 3MRFA 1JTOA 3SDAC 3NZ8A 3SKMB 3FB6A 5EC1B 4OF0A 3WFCH 3ULUL 3T4YB 5ESQB 4WEUD 5I0ZA 3WDIA 3LRSB 1NAKL 1F4AA 1JWMA 1AO7A 3BP7B 2BXZA 3GHEL 3ROLA 3OKOA 1NC4B 4ODHH 4LDEB 4TSAH 3M07A 4OIBA 3VE0A 4MA8L 1W8OA 2GTZB 5GJTH 2VAAB 4MJ4A 1SM3L 4Y19E 5EOTA 3V0VA 1ZA6A 4YDVA 1RHFA 2GAZA 3ZHKA 3GSOB 5C07D 3QO0A 1VADA 3LKOA 4NZRL 3KYKL 4TTDD 1V8HA 3C2AL 4OCRL 3QO1A 4HIEA 5IBUB 4PV9A 3BP5B 5GRVK 3IFOB 2VLKA 4ZO8A 2HH0L 3T2NL 1G9EA 2NYYD 3CPLB 2PF6A 2ICEA 3VWKB 1A7QH 1FL3B 1P2CA 4JM2D 3V95A 3VRIA 3MLVL 1UKTA 3P4NA 4OM0L 4C56D 3TA3D 4GXVH 2Y5EA 3AB0C 1YY8B 4PJCB 5K9QG 4F80A 5B21A 1ZT7A 3F7VB 2DL2A 4I1NB 1MFEH 1JZ2A 3T0EE 3VXSE 4X98B 1F4XH 5LCVL 5I8OL 1CIUA 3BXNA 1G7JA 1JPTL 3GJFB 4HKJA 5GS3A 4AEEA 2DDQH 1LO2L 1YYML 3OHXB 4UOW1 1VERA 4FTVA 3QCTL 4J4PD 3P11H 3VXQB 1QQDA 1KYOJ 1ZA3A 1O7SA 5D93B 3WO4C 1RJCA 1TJIL 1S7WA 2BFVL 4U1SB 4F57L 4DKDC 1T80A 3MA7B 3FRPG 4TUOB 4ETQA 1VGKA 1CDYA 2XQYK 3QUYD 3HC0B 5BXFB 2FEDD 4MD4B 1GL4B 1JGEB 2IQ9L 4P9MH 3O6KH 3MRBB 3EYVB 1UWEL 1INQB 35C8H 3MR9B 2APWA 4A6YA 3GBLA 5HDBE 2MQCA 1HDMA 3VFOA 3QUMA 4LRNH 3V9FA 4M7LT 5HVGB 4RDQG 2D7QA 3T0XA 3I6KB 1PLGL 2RCSL 5HGBA 2DTSA 3MJ8A 2EECA 5CWSA 2W9DL 1I9RH 3ALWA 1XGRB 3ZKQD 4ZXBC 1XF1A 2XQBL 3RDTD 5F6HI 5HHQA 1QLRA 4X6BA 2DQCL 3MRNA 4FXLA 5IHLB 2JCCF 4FRWA 5BRZE 2VC2H 2ATPB 3MNVB 3BT2L 4FQ2H 1B2WL 1I3VA 2CK0H 2L7JA 3VFTB 1OAUH 2EEAA 4JRYE 3MLXL 4TNVF 5D7LD 3SCMD 3K1DA 4K3EH 4MQ7A 1FBIL 1KCSH 1E4JA 2XZCL 3W0WB 4MNGB 4NJ9L 1QBMH 4OFPA 5EOQL 4S1RH 5HHOD 3ULSB 1E6JH 4LU5L 2KUTA 3KJ4C 4D3CL 4XH2B 2WBJB 1YEDA 1NLDH 5HVWA 2E8YA 3HR5B 3LSOA 1BPVA 2ZSWB 1F45A 3WKML 1I85C 4YIQB 5B4MC 4ZS6D 1LO0L 1FORL 3BH9B 5KVEH 4D0CA 2N4IA 2X4TA 5AUMA 3VI4F 2W07A 4MQTB 4KVCH 4LKXB 3VXOB 2PXYC 4EXKA 1U8KA 4X7TA 1AKJA 1BLNB 4HC1H 3ZE0F 3TYFB 5DHXB 3KYMA 1MAML 3C08L 3LAFA 1VFBB 5JQ6H 3LN5B 4JCLA 3SO3C 1NGXA 3CX2A 3CXHK 2J8OA 2CUIA 4Z7QF 2OJZH 4JKKA 3BISA 3BPOB 1MRFL 2WSKA 4MGXA 4WJ5A 3MV7B 1FG2A 1YECH 4LSSL 4OD1H 5DJ6A 3GSUB 3KNBB 1G9MH 1T20A 5J1AB 5JXEC 4BK5A 3QDMA 2ID5A 1X6LA 4JPKL 3MMEA 4QRQB 2L7UA 1H9VA 4IIQA 3H9SB 2QQLL 1S7SB 1NJ9B 4I0PD 1YPZA 2VDLL 3UP1A 2EE2A 5T3XD 4N9GB 2DOCA 4M03A 5DRZA 3VFSA 1I8LC 2WAHA 1L0QA 4L9DA 3A6OA 1MWAH 2CLRB 4U1HB 2CMRL 1MQ8A 1VGEL 4U1NB 4UILL 1ONQA 5I74B 3UTZB 2E6PA 5CIPH 3SDYL 1L7TH 5HPMB 3ARDC 4CN4A 3CVHA 3WFDH 2NY3D 4Y4HD 3OAYK 4NQEA 1U2HA 1HSBA 4HHAA 4MJID 2ARJB 1LE5A 3RUGB 2NXYD 3Q1SH 1MJ8H 3GBNL 1BFOB 4ONFH 1Q9KB 2FB4H 2FJFB 1PAMA 2HKHL 5DZOA 3LKNA 4YLQT 3TM6A 4UTAL 1NFDB 1H3PH 2D7MA 3EYSL 4RWYL 5KSAD 1I9IH 1LEKB 1X3DA 2PYFB 4LLDB 4ZO7A 4UOW0 2OR7A 1LO4L 3K2MC 4XX1G 2H6PB 3GM8A 2XG5A 4HX1B 3NPSB 2NY0D 2YRZA 5ENWB 3O41B 1RUQL 4P2RD 4G7VH 1I8MA 3I6LD 4KZDL 1E4XH 3U7YL 1KNOB 5MP6H 1CICC 5E24E 2YD3A 2Y6SD 5D2NB 4RCAA 4YHNB 2Q6WB 1DLHB 3FZUD 3MCLH 1A6TA 1GOGA 4MS8D 1P84J 4DWHA 1G7PB 4OLUH 4PBWD 4ZUSB 5I15H 1U8HB 4L9LB 4G7YH 3TJHD 1DUYA 1OM3H 4OIAA 2DQFA 4LVEA 4NKIL 3BFOA 3SKMA 5EC1A 5KN5B 3T4YA 5ESQA 4OZIE 2QHRL 2IJ0C 4H26B 5JXAL 5TQ0H 3LRSA 4PYHA 3BP7A 1U3HC 1TZGL 2KQNA 5DJAB 3SDAB 5I1GH 2YZ1A 5D7KD 1JGLH 1FFPB 1ORQB 2EDNA 2GTZA 1EV2E 2VAAA 3IFNH 2A6DB 5CUSH 3R4DA 1SJXA 3EO1B 3O2WL 1OTUD 5DLML 3GSOA 4PG2C 2VDML 2G5BA 1HSAB 4HKXB 4UV4L 4XT1C 4KJQD 3O4LD 5F8RC 2DTMH 3BP5A 4L3CB 3IFOA 4JFFB 4KPHH 1DL7H 3ISWA 5ACLA 3PDOB 4NCDA 3QFJE 4HPYH 3VWKA 1JZ3A 1CDIA 1FL3A 5JW4N 2H26B 4OKVA 4NDMB 3JUYA 4BSVB 1E28B 1QSFD 4PJCA 1YY8A 5FCUH 5GGRA 3LCYA 1HQRB 1NCTA 3EO0B 5ITFB 4U0QB 4PB0L 5D2LB 5CD3B 4AK1A 4MAUL 4KK5D 3S37L 3UYRL 3W5MA 4X98A 1EGJH 3WMSA 2VABB 3V5KB 4U3CA 1UH4A 3OHXA 4LHUB 4ZFZB 4LEXH 2AV7B 3VH8G 5ID1B 1GCFA 5IW6B 2EXWC 4JO1H 4PLKC 3MBEB 1DFBL 4I2XA 4YWGL 2J5LB 1YC8A 4RMRA 3OKDA 3C5SA 1FYHB 2K7PA 3BUTA 4QRRE 5A2KH 3K1KC 4ENED 5BOZG 1C5CL 4PRIB 3RFZC 3MZGB 1QA9A 4TUOA 1AO7D 2VDQH 2BJML 3MROB 1CDGA 3HC0A 2PYEB 5BXFA 4MD4A 1JGEA 5HI5D 1N8ZB 1OAYH 4ZMAT 5ESVB 2P8MB 5IMLB 5CILH 2VZ1A 3MRBA 3EYVA 3BWAB 3MRRA 1LQSR 3MACL 1INQA 3O6LL 3VD9A 3MR9A 5F97E 4GAYB 4ZUUB 1F4WL 3SOBL 4XXCC 1RUAL 1FH5H 4C55A 2V7NB 2X4OA 4PJ8D 4FXGB 1AGDA 3LS4L 2Z91B 3FO2A 3L3GB 3MUGA 1IVLA 2EH7L 1PZUB 1C1EH 3WS3B 1XGRA 4NP4H 3BJ91 4PJDB 3ZHDA 1P4LA 5CZVL 1DQLL 5TE6H 3AFLA 1D6EB 1A3QA 4HS6B 5ANME 2ATPA 3MNVA 4WHYH 1AD0B 5E1AB 5B38A 3VFTA 3WNPA 4KI5C 5IB1B 2CSPA 4CRPA 2ESVD 2B1AL 3ARWA 2HT3D 3DROB 3WJJC 2AI0L