1L6XA

Fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION
publication title Mapping of the C1q binding site on rituxan, a chimeric antibody with a human IgG1 Fc.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA01
4X6DE 4XBPA 4JZJA 3BUYA 5IVNA 4HWNA 3QUYD 5GGUA 1BPVA 4Q9RH 1V3MA 4NN6B 4U1IB 3FRPG 1I9EA 4KWUA 5EBMB 5LQBH 1LD9B 2RB8A 3S88L 5J0BA 4MA7L 3C9NB 4GRWE 1T83C 4ODTL 5ERWA 3BKYL 5F7KC 1F3JA 2JB6B 4XGZB 4ODWA 4RZCA 4QTIH 4Y1AB 1K8IB 1S7XB 4AENB 4NQDE 1JGEA 2DLGA 1MJ8L 4O2CA 4OCMC 3G04B 4G6AD 5ADOL 5GRUH 4Q2ZB 3QZWB 4GQPH 5D2NA 4I18A 3C5JA 5ITFA 4KROB 4ZAKD 3CK0H 5FA4A 3HUJE 3I6GA 4QHMB 1HHGA 3F62A 2PO6C 4R90H 5HGAB 3QA3A 5F9OH 5KSBE 2APFA 6FABL 3G08A 5JW3L 3EO9L 4Z0XA 5FUZL 4HC1A 4X7TA 3PXHA 4PJGB 4NKOB 4JFYA 5AAWA 3KLHC 5DJCA 4Y5VA 4XPBH 3SE9H 5TF1H 5IWLA 4ISVA 3ZKMC 3H0TA 1QACA 4NM4H 3QJHB 5CZKA 3H3PH 1KIUA 4JFDE 5DUBB 5BVJA 1EJOH 2VQTA 3JBG7 4PJ9D 2VJXA 3BRGC 3MV8B 2CIKB 1VESA 3E8UL 4R4BB 2P8PA 2BK8A 4XCEA 1VDGA 35C8L 3JV6A 3QIUC 1KXVC 3STZB 2DYPA 2I07B 1D5MB 1S5HB 4GAGL 2MCG1 2E8YA 5B3JE 1GHFL 3FQUB 1KSRA 1J0HA 2XWBB 1PZUB 2PXYA 2DIAA 1BHGA 1R3JA 5IF0A 5MERA 2VZ1A 5HYSG 2A1WL 1CGVA 1DN2A 4JCLA 4YX2H 2H1PL 1JGLH 3W0WD 3ZLQC 2B0SH 4H20L 4WVRA 4F2MA 3FO1B 2H26A 4LVEA 3QFDB 4QF1A 1REIA 3CMOL 4PV8A 5AAMA 4G8GB 5DRXA 3FB6A 3R1GL 3QH3A 3S34L 2Q6WB 1RJZA 4UILL 3UYRL 3MJ9A 1VFUA 3FMGH 4RX4A 1DBBH 1P84J 5F1IA 4ZD3L 2CLZA 3KYNB 2GKIA 4N8VB 5FKPB 3MJ8B 1TZIB 1R5WA 3HS0A 3QDME 3VXRE 2NXZC 3WEXA 2HLAA 3AS1A 5DVMA 2DQTL 1OP3K 3CCHA 1AGEB 2AJ3A 4LASL 1ORQA 3D3VE 1EFXA 5F3BB 3Q6GH 1KJ2L 1MVUB 2XFXB 4NPYB 1JF5A 3GI9L 1AQKL 5J6GB 1QD0A 4PG2A 5DD5L 1NPUA 3FRPA 2G9HA 2IH3B 3IAPA 2P5ED 4K94L 3HAEH 4JFHD 4MMZC 4XCNA 4PJ8B 4I77L 2YUWA 3U79A 1V3LA 5K9OB 5HHXL 2VAAA 4PJDA 2OZ4L 5A16B 3ULVH 3MLWL 1G1YA 1PW3A 3Q1SL 3QG6A 4NQEE 4OSUH 3V4UL 1MRDL 1C1EL 3BGMA 4WU7B 4LKCA 4KI5E 1B0GB 1U6AL 12E8L 2VLJA 3DV6B 3SDXE 3QIWA 1W72B 3MLVL 4WHYH 4X4YA 1OF2A 4HG4J 1W0VB 2NY3D 4LLUB 5AZ2H 1IT9H 2BFVH 4O2EA 5IHLB 3F5WB 3VXMA 2AI0L 1BQHB 4PRID 4GW4B 4Z7UB 1TENA 1L7IH 2VITA 1G7HB 4RFNC 3WIFB 2P47B 1TPXC 2ZZUT 1P4IH 3UZVB 1N0LA 2HAZA 4Y4KD 1IGCL 4QOKA 4RGMB 4NNYA 4PG9B 5BVPH 4Y2DD 1PD6A 2E27L 5K9QI 5T1LD 3WHXA 1OD9A 1YMMD 3VFMA 2IPTL 4WWID 3QB7C 2V9TA 1LMKA 1Q38A 3VFTB 1J0KA 1JE6A 4U3XA 2GK0A 4L9LC 4NKMB 1AP2B 2Z92B 5B39A 2C7UB 3PGDB 3FFCD 1UWGL 3RDTC 3EYOA 3LEXB 3MYZA 2JJVA 1MJJA 1WIUA 3NVQA 5EFIB 3HG1E 3O2VH 2UVEA 3HB3D 3WE6A 4R7DA 4ZSOA 3B2UD 1MCOH 4LNVA 2GJ6D 2AS5M 4HUNB 1NCCH 4P2QB 3U7YL 5HYSA 4ZS7L 4BA8A 2A38A 4Z0BL 3IDMB 2EIBA 4CGTA 1EH9A 4TUOA 5IOPA 2RHEA 4GG8B 2IFGA 5L88L 3DSNA 5HJ3A 1D6VL 1H0DB 2VDRH 4NKIL 1PQZB 2HN7B 3EYSH 1VB9A 1VFAA 3NACH 4P46B 4UUJB 2HKHL 3BQUA 5EU3B 2D0FA 5HGDA 2BERA 3LQAL 3V6OC 2P24B 1R6VA 4I1NB 4BZ2L 1T04A 5D7IA 3H3BC 1S9YB 2CJUH 5GRZA 4IRSA 1OB1A 3TWCL 4Z76B 1W8NA 3RWFB 2XQYG 2SEBA 3C2AL 4KVCL 4JM4H 4D9RD 4S1QH 5DVKA 4HULB 4MWFB 4P4RA 4HKJA 5IP4A 1YEKL 3TM6A 4J4PD 5IJKC 3UTPD 4QHLA 4AM0A 3RVUD 2FR4B 4UTAH 2Y07L 4XXCA 3K46A 4CW1A 5EU6E 3LVEA 5JXEA 5TE7L 2WNGA 3LRGA 2KQMA 3QUKB 4XNUL 4MCYB 4F7MB 2BRRL 2DMKA 4JDZA 5IVXF 3ET9F 1Q94B 2VR4A 3K8KA 5IQ7L 2C1OB 3O4LB 5DLML 1CZ8H 1F4WL 2VXVL 5JDSA 4DGVL 2ICEB 1CXLA 1C12B 3QWOB 3WDHA 3HHRB 4GXUM 1PBYA 2C3GA 1P6FA 3CFDA 4AH2A 3EYFB 4U1LA 4ERSH 3ZE1F 1KV3A 3LKPA 3BP4A 5EU7E 2C1PA 4XH2A 4C55A 1NFKA 4QRTA 4XNYH 2IALB 1SY6L 1C5BH 3L3DA 4G43B 1TZHB 5HDQL 5I1CH 3EAKA 4FTVB 4PRHE 1AD9A 4FABL 1BVKA 4QTHB 4I0PD 5EUKB 3SJVE 3HKFA 3QEQA 4KFZC 3X17A 1JI1A 1DBKH 2WM0A 3G5YA 1FO0H 4WEBH 2H9GA 4PJFF 2DN7A 3O2DL 1MREL 2J6EA 2QBWA 3ULVD 3BFOA 1WISA 4PRDB 4FQQB 1M71B 1YA5A 2R1XA 5C09D 1K8DB 4JDVA 4JRXD 3VXUE 2YD2A 2I5YH 2VR9A 4F15B 3V0VB 2DAVA 1PSKH 2VXQH 1UA6L 2QTEA 4OI7A 3GEWB 5ICXB 1DL7H 4ZFFB 5E8OB 2MQCA 3CDFA 4Z77B 2Z35B 3MRPB 4R4NC 2W65A 2NTSP 1A7PL 4OD2B 2UWEB 4YXHL 4V1DE 2XRAH 1A6UL 3U9UA 4EJ1C 3C5ZC 5IG7B 4WFGD 5C0CD 2WANA 1MFDH 1MRCL 3RRQA 5EOQL 5IMKA 5SV4A 4JN2B 2WIIB 3HCVA 1QSFA 1X44A 4YZFF 5FDWA 3KLAA 4LPTA 3BPNB 3S96A 3OTTA 1JPST 4QRRE 3RZCB 5EBWA 3SDCC 3K80A 2E7MA 2P49B 1PX4A 3LV3A 1J0YA 2DBLL 4R26H 5E03A 4MB4A 5J12C 3KWWA 4TSBH 4HUKB 4P3CL 1GGBL 3WBDA 4DOHE 2WP3T 3P11L 2VL5B 5I76A 2A9ML 2BXZA 3SKOB 2BCKB 4WI5A 5L2KB 1RQ5A 1L0YA 5HHPB 3IDXH 1IC7H 5IKCA 1P5UA 3HNSL 3T0EE 2DD8H 3STLA 4AQOA 2MHAA 2BNQE 2FH6A 4WENB 4H88H 2VISA 5CBAA 5KVDL 3M17A 4ONFL 4OZGE 4Q6IA 3QT2A 2VLKB 1YDPB 3LN5A 4N0YH 4M7LH 4QHUA 4X8JA 1S9KC 3L3OA 4N8VG 3LS4L 4XP5H 1DLHB 1CFBA 2FGWL 4Y4FD 2MCPL 1RZJH 5GQBA 1ULVA 3UPCA 5BXFB 3E1F1 3ARVA 3P9LA 1HEZA 3I9GH 4OZHE 1FZJA 1CL7I 1S7VB 2W38A 4OLXH 3L1OH 3LSOB 2X4QA 2Q3ZA 4XPFH 5DQ9A 3IU3B 5EZIH 1U3HD 5L6YL 5GZND 3NCYS 1FAIL 2VQ1A 3DI3B 4WO4B 4LSSL 2R23A 3PF2A 4HGKC 1WIOA 4OD3H 2DI8A 3DRQA 2R69L 3QCVL 1I9IH 1KJMA 2NCMA 2HRPL 4TSCH 1BJ1J 1P7KB 2QQLH 2WUBL 5HGBB 4NQVA 5AZEL 5K9JL 2FO1A 4ZS6C 1O5DT 4GLRH 1CL7L 1EO8H 1NMBL 3GMNA 1MWAB 1IGIL 4JZOA 4MQXC 5F44A 3NGBB 1BQHG 1FG9C 1P7QB 5E95B 1F11B 3GSUA 4PRPB 4MAYC 4QO1A 2R2BB 4UT6L 5GRYA 3MRKA 5SX4H 3WNKA 2DICA 5E6YA 5TQ2L 1WT5A 5E94B 1GJIA 4YHNB 3NAAH 4NWTH 3HC0A 2V7HA 4FQXA 1U8IB 1DP0A 3DXAB 5C0AA 4JKKA 4HV8A 5CZVH 1NC2A 2DQDH 1RJCA 1CE1H 3DYPA 3NFPA 3AM8C 4GMTH 1U93A 4FQJL 3CFIC 3BIKA 3QI9C 5MENA 4UBDD 7FABL 2ZKHL 3V8CA 4YHZL 5C0IA 2BDNH 2F15A 1NLDL 1PKQE 3AROA 2HWZH 1MJUL 4F58H 3D87B 4PJDF 2FJGA 2WMPA 1FGVL 1NEZA 1OT1A 4I4WA 5EBLA 2OI9C 3O3AB 4WHTB 2NQCA 4WJ5A 3AREA 3H2WA 4XZUB 1HQRB 4YDIL 4KK8C 4MD4B 2R0WH 1D5XA 5SWZA 1TNMA 4J3OC 4YAQB 4OKVA 4QXWA 5LXGH 3V5HB 1DVFA 3NFNA 1ZSDA 4G6FD 2L4OA 5CEXA 1A6AA 2EEDA 3RVTC 2Q76B 2HLFC 2X40A 4PJCB 3WFDL 4CBPA 3MNVB 5D7JD 3QUZB 3WFEL 1OSPH 3B2VL 1O7VA 1MUJB 3WS3A 3MROA 3MRHB 1V3KA 1F4AA 4H1LB 3IKCA 2EXYC 4NQCA 4E41A 5SWSA 4EQ3A 2YOCA 4RFEB 2R8SL 2HVJA 1G7QA 2HG5A 1AGEA 5CWSB 4HS3B 2NR6D 1MVUA 1CD1B 1MCBA 1BJMA 1KN2L 3S88H 3VWKD 5LBSL 4MA7H 5CZXC 3TO2A 4JM2B 1UXSB 1ZT7B 4KZEL 5D5ME 4ODTH 4QCIA 3BKYH 3HPJB 4G9FD 2DM3A 2X70A 2ZSVB 1Y18B 1J0IA 1XGQA 4Z6AT 5IFHL 2YPKB 1QUNA 1MJ8H 2KKQA 3T04D 2OTWA 2RFXA 3A67L 1S7QA 5ADOH 2H2SC 2Q8BL 1ACYL 1QVOB 1S7SA 1DUZB 1EVTC 4LCWB 1X7QB 5ESAB 6CGTA 3HZVB 3DYOA 3EJZC 4YK4C 3EO9H 4EEEA 5FUZH 3NN8B 1QG3A 2NY7L 2R4RL 1CDGA 4JFQA 3E0GA 3OKMA 1G7LA 3WIFA 3I02B 4M02A 4ZNCD 1HH9B 5D7IF 4YQXL 5CIPH 3F7YB 1NANI 5ALCH 3AAZB 2RCSL 5CJOH 3V8OA 3E8UH 1BFSA 1YZZA 4NHUB 1A7BA 3IKKA 35C8H 1U8LB 2BNRD 1NBYB 2O5XL 3VGGA 4IMKC 1YY8B 4GAGH 4PV9A 3UMTA 2H45A 1BZ7A 2EE3A 1GHFH 4UNVA 2DQJL 4J6RL 4UAOB 1UCTA 3O9WD 4X6DB 3N06B 4LLQB 1GOHA 4R97B 5IFAL 2A1WH 2YS4A 3EYUL 4J3WA 5EWIL 2H1PH 2YK1L 3QQ3B 4MXQC 4H20H 4Y4KC 3I50L 3P73A 5INDB 1OT2A 3CMOH 4TVPD 1G6RH 1B6DA 4MZ3A 5CEZL 3HTLX 1W2KT 2ERJC 3R1GH 3SO5A 4UQ3B 3IU4L 4P5KA 3MA9L 2CK2A 3S34H 4UILH 4LRIA 1ES0B 3UYRH 4PTTA 4APQA 4GRWB 4ZD3H 3GRWL 4GO6B 4NQXA 3HZYB 4DQOL 1Z5LB 5IMOA 1NGWB 4GMSL 1MCPL 4QNPE 3EOBB 4MQTB 4UUJA 4P46A 2DQTH 2MNUA 2LV4A 1KNOA 4U1NA 3QJFA 1OGAA 4NQDB 5C0FA 4XAKD 5M94B 2VABB 3W11D 4LASH 3DX7A 1KJ2H 5GS2H 1RZ7L 3CFKB 3GI9H 1AQKH 3D0LA 3FB7A 2AQ1A 3RHWK 4S10A 3ZT5A 1B0RA 4JFXB 5DD5H 3OB0K 3V52L 2QEJA 4IMLB 4RMSA 3EJYC 4Z76A 5KSBB 4K94H 1F97A 3C09B 4QRUA 3VMNA 4F9PA 1CLYL 3TPUA 4I77H 3MRJA 1ADQA 2YRLA 2D0GA 2P7TB 3WYRA 5HHXH 2FX9L 5C2BL 2CMRL 3DMMD 1R5IA 4ZOCA 1H15A 2OZ4H 4FP8L 4O02L 5FDYA 3MLWH 2JB5L 5IMMB 4XXDA 1SEQL 2HJKB 3MYJA 3ARDA 1QBLL 1MRDH 4JLRA 4WWKA 3V4UH 1K4DA 1C1EH 4UU9A 1TNNA 5DJ2B 5TDOA 1U6AH 4JFDB 4LCUB 12E8H 3MRDB 3MLVH 4CU7A 1ZGLP 3ZHDA 4N0FB 5E6ID 1T3FA 2GTZA 3W2DL 4YDKL 1HIML 4ZOAA 1IM9A 1UWXH 4QHNB 4K7FA 4HIXL 1T1ZB 3JWDC 3FQNA 1IKNA 3K1DA 3JVGA 3NTCL 3H9SA 1IGCH 3EFFA 2GW5A 1DJSA 3X13B 3CDGA 2E27H 4U3CA 2E7LA 3QIBB 3DIFA 2I9TB 3AC0A 4OAWA 2IPTH 3MRIB 1L7TL 4NHCL 3MGTB 4PJIA 3SDDC 2J8OA 4HDIA 1N5AB 3O0RL 3BDBA 5A3IC 2JKXA 1UWGH 2AJZA 5I8EB 2NXYC 3TZVD 1EZVX 3T77A 4FQ1L 4WTWA 3WN5B 1FFQA 3QDMB 4G42B 3VXRB 3TJHD 2J2ZA 1XGRA 3BPLC 4K9EL 5I75B 1JPFB 4PRDA 4QRPE 4LPYA 1M71A 4NKDB 2ADIA 1HHHA 3D3VB 4EN3D 3U7YH 4ZS7H 2NY1D 4Z0BH 3CH1A 3LKOA 5J13B 3MRQA 2V2TA 1J10A 3GMPA 1QFOA 2PTTA 4LLMA 2H32H 2J1KA 4D8PA 1KEML 4WV1C 4AL8L 5L88H 1D6VH 2R2EA 1AKJB 4NKIH 1AGFB 4OIAA 5D96B 3ZKXC 2HKHH 3W39A 2BSSA 1LILA 3TO4D 1ZMYA 4JQVC 4U2ZA 2Q1EA 3LQAH 1A4JB 1ND0B 2Z91B 2H41A 3VGFA 1JZ4A 2VKXA 4NQEB 4BZ2H 1GZQB 4WEMB 4ONGL 2ATPB 4LCYB 3ARGD 1OTSC 4M43L 3SDXB 3MA7B 3TWCH 2BVPA 4L8BA 1KYOJ 1TJIL 2P45B 2PYFA 5CSZB 4PGBB 2YBRB 4KVCH 5ISZA 2OXHA 2NLJA 1T1WA 3NZ8B 4Y19D 4U7SA 1YEKH 2GFBB 4PJ5E 2Y07H 2ESVA 1IAOA 3SKOA 5DQJA 1NGXA 4M1DL 2Z4QB 3FB5A 1UJ3B 3PHSA 1OD7A 2QV2A 4M9PA 1J18A 1RFDL 3OKEB 3RU8L 1J0ZA 1J1PL 3E6FB 4XNUH 5HVHC 1JV5A 2BRRH 2KL6A 1ZLUK 3VGHA 3GSRA 4L3EE 1N6UA 5IQ9A 4OM0L 5IQ7H 4LFHD 5FYLE 4IHOB 5DLMH 1F4WH 2VXVH 2DIBA 3N0PB 4DZBB 4DGVH 1GL4B 3MCLL 5GRXG 3BZDA 4JPIB 4NQSA 4KKNA 1FFNA 2UY6A 2D7OA 4EXKA 4WU5A 2CO7B 4U1JA 1OAZL 2EO9A 2AEIT 2R0LL 4LVNB 1LEIB 1XIWB 2C3WA 3HG1B 5EULV 5KVGL 4ZUUB 3X14A 4ZO6A 3RPKA 1SY6H 5HDQH 3ILQD 4FABH 4P5TC 4D9QE 4QLRA 1CGYA 3F65A 4X6BB 5DMGC 3VWJA 3EGSA 3ISWA 4X4ME 3QDJA 5GS1A 2ADJA 2CO6B 4DUXA 3VFVB 3AMKA 1MHEA 3O2DH 1MREH 3KPTA 3SE8L 1CVSC 3PWNA 1QEWB 3WXVL 1J8HD 4P5MA 3B6SA 2AK4E 4U1SB 4TTDD 4X6CA 4G8IA 2R0ZL 1UA6H 5IVZB 4RA0C 4S2SA 1I3UA 1RIUL 2XN9A 4Y4HC 1WZLA 2A6JB 1C08B 2HFEA 2X44D 3BP6B 5ESQB 1AJ7L 1A7PH 2YR3A 3ECBB 3VRLE 2J5LC 1M05B 2XT1B 2Z0BA 4YXHH 3EO1A 3T3PE 3WNMA 4XMPL 5HDLA 3SKUD 4EUPB 1MRCH 4KDVA 5EOQH 1F11A 4KTDL 2A83A 1FCGA 5K93A 5LAXA 5T1KD 4K9EC 3QEHB 4LSDA 2I26N 3ALXA 5EU6B 2LFGA 3LPGA 3IJYB 5DDHB 3TN0B 1YN7B 4OLEA 2DBLH 5HYQA 2EDRA 3IVKA 3TBYB 4YHYB 5SX5H 4LF3A 1HQ4A 4S11A 2AERT 3L9RA 4P3CH 1GGBH 3NZHL 5TDNA 3GMMB 3P11H 5JR1L 4L29B 4RQQB 2OQJA 1G7JB 4PJAA 4AZ8A 1AO7E 3OJVC 2FCBA 5GSVA 4XWOD 5D1XB 1UWEL 4C54A 1I85A 2Y5EA 3HNSH 3KGRA 3X11B 3PV6A 1CD9B 1C16B 3M07A 1IC5L 5KVDH 1QRND 4ONFH 4PRHB 4UIMA 5HPMB 4JFFA 2H6PB 1E27A 2FBJL 4MCZA 4X7FC 4POZC 3S5LB 3SJVB 3TBVA 5I1IL 4RMQA 2OS7A 3LS4H 2MCPH 2FGWH 4YHML 4NJ9L 4GRLD 5KAQF 5FECA 2YUVA 4L4JA 5CD5C 1NLBL 1EHLL 3KDMB 4K3EL 1WTLA 4M6ML 3U0PA 4Z78B 1A1NB 3VXUB 5D7LD 5AYUL 4QXTA 2FEDC 1LP9A 4CMMA 5I73B 2YPLE 1VSCA 1JBJA 5L6YH 3L7EB 5ILTL 2HT4D 4YFDB 3H9HA 2WWKO 1FAIH 4Y16A 2ARWA 2KBGA 3RQ3A 2NY4D 1BGXL 4WFHE 4O9HL 5ELIA 3RPIA 1CD1A 4EDXA 4LSSH 4LCCC 5FK9B 5JW4Q 4V1DB 3ULUL 1MLCB 1I8IB 2Y9RT 1XF4B 3MUGB 2ZUYA 1D9KA 5HHQA 2R15A 2R69H 4BFEA 2RBLA 1KIPA 2HRPH 1JWSB 1T5XA 2YRPA 3DX9A 3QAZB 2WUBH 3UAJC 1G9NC 4QRRB 5D93B 3MLSL 5AZEH 3UC0L 5JZ7D 5K9JH 2NY2C 3ARSA 2BVYA 1OAXH 3BEWA 2A73A 5CJ5A 25C8H 1CL7H 5MEOA 1MH5B 1NMBH 4JB9L 3BEVB 3UXFA 1IGIH 3OKDB 3FT4A 5E7BA 4DOHB 4JY4B 3NIGE 2CRMA 1LGVA 3K1KC 4UT6H 2IAMD 3VH8G 2DQUL 3ARFA 3GZKA 5L9DL 4ODUA 1X5GA 5TQ2H 3G6AA 1WF5A 5F71A 2UVFA 1E28B 2YC1A 1ZHKA 2GTWA 3UJTL 3T0EB 2VXTL 1I3VA 2BNQB 1UM5L 3VGDA 5DRNB 4XNQA 1UENA 1UH2A 4HJGB 4OZGB 4ZMAT 4FQJH 4HH8A 1ED3B 4WW2A 2FH8A 1AI1L 2BJML 5HYJA 1FV1B 7FABH 3EYQC 4QY8A 2ZKHH 4HCRA 4YHZH 1NLDH 4FQPA 5MEPB 1JRHI 4U0RB 1TCMA 1RJYB 3RVXD 4E5XA 5F88A 3AFLA 4JFED 1FGVH 4OZHB 5F6IB 3GIZL 1HILB 5CJBA 1U8PB 4YDIH 5DR5L 4GJTB 4RMWA 4XC1L 2G2RB 3OAYK 1DE4B 4PY7B 2UZXB 5HDOA 5JIPA 1HSAB 4J3SA 1OGTB 1HKLL 3SCMC 2FIKA 1EAPB 5GRWA 3QG7H 3RWDB 3WFDH 2WSKA 4DTGL 3UPRA 1A22B 1QSEA 4EBQL 1IEAA 3B2VH 3V6OE 4M5YL 4UINL 5F7DB 5ENWA 1FL6B 4ETQA 2H8PB 1I7ZB 3O11B 2ZNWA 2GIYA 3MXWL 4X99B 3F7VA 43C9A 4EI6A 4LLWB 5DVNA 3B9KC 4EXPX 3ZKNC 3WJJA 5I66B 2LTQC 5E9DE 2R8SH 3AU1B 5DJAB 4FFYL 4JPKL 4PJIF 2CLRB 5I8OL 4NO3A 4HIJB 1BJ8A 1KN2H 5LBSH 4KHXL 1AGDA 2GT9A 3C8DA 3HUJA 5DHYA 4KZEH 1BREA 4Y5XA 3ZSSA 3KJ6L 4HX1A 1FN4B 4U7MA 4NN7B 1DFBL 5IFHH 1DN0A 2CH8A 3HE7B 5C0NC 3A67H 3GJFA 1SVCP 1AGBA 5CAYB 1ZHLA 5HI5C 1BZ9B 5IMMA 1NDGB 3KPLA 4HUXA 2Q8BH 1ACYH 4HUVB 4WRLA 3DVGB 4PJ7F 5E2JA 3WMSA 4DKEL 4KQ3L 5BZDA 1HYSD 4R2GB 5FUOL 4JJ5B 2B4CL 3VFUB 3ULUC 1QLRA 3MRLB 4KMLB 1MFBL 3U0TB 4I2XA 3O8XC 4TNVK 2X42A 5D1ZD 1PKQB 2NY7H 4LVHB 2R4RH 4MNGE 5E4IA 5K33A 4WUUD 1N59A 3KXFA 3OR6A 1XH3A 3CFJA 3TNNA 2NNAB 3VH8A 2DJSA 2ADGB 4FXKB 3TIDA 4RAVB 1Q72L 4YQXH 4N68A 1RHFA 1W72L 4UDUA 8FABB 1PGRB 1QO3B 3UDWA 5IHZA 5HXMA 2RCSH 4I0CC 4RGNE 4ENED 4P4KC 1CGWA 1BWWA 2R4SL 3S3SA 1C7TA 3MGTA 2O5XH 4P23A 5T33L 4GBXB 1WZMA 2DQJH 4UIKH 4J6RH 4KJYB 2ED7A 4PRNA 5DA0B 3T09A 5EDXA 5IFAH 3I6LD 4PP1D 4E42B 3EYUH 5EWIH 3PL6D 2YK1H 3NBNA 1V7NL 2NZ9C 3ZE2E 2XQYK 1IZKA 3MREA 2GJJA 1UZ6E 5CEZH 1UZ8B 3IU4H 4PD4J 1CDYA 3MA9H 3QXDA 4OZIA 3VXTA 4D0CB 1NANH 4EUPG 1KTDB 3OX8A 4ALAL 3GRWH 2AXFA 5JUEL 1FC1A 5D5MB 1EK3A 3QQ9C 3ROOB 2PTVA 4DQOH 4GMSH 4OLWL 1MCPH 4LL9A 4YGAB 4FFZL 3MOQA 2PETA 3QO1A 4P49A 4NO5A 1S9XA 1RZ7H 4MSWA 5DFWH 2NX5D 43CAB 3NCBB 4HUUB 4HUWA 4OF3A 2HH0L 2BVOA 1F4HA 1VGEL 3MBEA 3V52H 4C56E 4HEME 1WZKA 4OT1H 3TA3B 1WCBA 3LQZA 1CLYH 3VD9A 1JGDB 3HE6B 4WFFD 1XCQA 5I1KL 4X6CF 4PBVC 1L4IA 2FX9H 1QTYT 5C2BH 3VD5A 2CMRH 4ZDHA 4G7YL 3MJGX 4FP8H 4YDLB 1TETL 4U6HA 1PYWA 2EZ0C 4O02H 4EI5A 4FXGA 2JB5H 1JI2A 3I85A 4LPXA 1SEQH 2HJLB 1HOCB 1QBLH 2PYEE 3KPSA 4PR5A 2ZCKL 3OKEA 5IK3A 1IGFL 5CCKL 5CJXA 4BSJA 3S5LG 2HJFB 2W0FA 3NIDE 1AFVL 3W2DH 3QUXA 4LGSB 5C08E 4YDKH 1HIMH 1UKTA 2ZCHL 5J9PA 4W4OC 5HHOD 2LAAA 4HIXH 1G0XA 1WZ1L 5GGTA 2VN4A 5EU5B 5HHVL 4KXZI 4MDIB 4LPUA 5T1MA 3LY6A 2MKWA 3NTCH 3GSOA 5C0BD 5EPMB 3FAWA 4ELKA 1LEIA 3CXHJ 3VCLA 2O5YL 4ZUVB 2P5WE 1L7TH 5E6ZA 4WI9A 4DKAA 4NHCH 2PW2A 3CSYA 4TN9A 4DZ8B 4PJ8C 1IAKA 2B4CC 3T4YB 3O0RH 3T3PF 1KLUA 3ARBB 4DFIA 5TPWL 4ZXBC 4ZOEA 2LQRA 1IKFL 3O6KL 4OQTA 4N1EA 1A1OB 3ULSB 3BJ91 4K9EH 1YJDL 2EDXA 2YD5A 4HWBA 2G5BB 3N1FC 3IDGA 2NW2B 4LLYB 2DM2A 1I7UA 1WFTA 4RMTA 1S9WB 3BD3A 5IVOA 4XRCB 3T2PA 5H35A 1ERNA 5EU4A 5J06A 1DDHB 1VERA 4G8EA 1KEMH 2FZ3A 4A6YB 4AL8H 3SDAA 4HKXB 2EXWD 4HKZB 3TEUA 3BP5A 3RTQC 5IFJA 3RUGA 2CRYA 2VDML 4ZPTA 1U8HA 3C08L 4M8QB 1RZIA 3C60D 4RGMC 1YNLL 3NCFB 1HXMB 1P84K 5FYKL 1MI5E 4MNQD 3QUYA 5FO8B 4O51A 1IGTB 2FECI 4JFOA 3TVMB 4PBWD 3SKNB 5HYEA 2PCPA 1QRKA 4X9BA 3B8YA 4ONGH 3BH9A 5H8DA 1ZV5A 4M43H 1AHWB 1YN7A 5GZOD 1FIEA 2A6DA 4N0UE 1TJIH 5KJRL 4BZYA 2CDFB 1BX2A 3HFML 2C26A 1AY1L 5FF6B 2W9EL 1AQDA 3B5TA 5JORA 4AG4L 1AC0A 5BS0D 3QULA 4M1DH 4P2OC 3X3GL 2OX5A 1RFDH 1T0MB 2DYPD 3RU8H 5CEZD 1NBQA 3CVHB 1HHIB 1BFVL 4IRJA 4OM0H 3VE0A 4ELME 2GSGB 2A6KB 4JJHA 5HPMA 4E0RB 3IFOA 1EXUB 3MCLH 4HG4K 2OR8A 5T5NG 5T5FL 2C9AA 1LK2B 4M03A 1OAZH 4OZFA 4AEHL 2R0LH 4HWZB 3H6JA 4AY0A 1HXYA 4KK9C 1I3RB 3ZKQD 1SBSL 5KVGH 5F1SA 4KV5F 4QRPB 3BWAA 4RX4D 4W6WB 5H37H 2J88H 4IS6A 5DC0A 2Q86A 3MTRA 4WW2F 1TQBB 5E8EA 5JW5A 1KCKA 1U8JA 2BHZA 4YHLL 3KYAA 1CDUA 4KMTL 5D8JL 4LEOB 3SE8H 4IJ3B 3WXVH 1QZ1A 2WBJC 3ZHLA 3OAZK 1Q9LB 1UXWA 3SEPA 4PGEA 4BKLB 1M7IA 3W0WA 2R0ZH 4HWEL 1T2JA 4MGXA 4OZ4B 5EO9A 4DVBA 1U8QB 1L9NA 1RIUH 4M7ZB 2K9UA 3SBWA 2FB4L 1AJ7H 3P9MA 5DXWA 4TTGA 4L8CB 4X5XA 1FFPA 4Z7VE 3G6JE 1CU4H 2YXMA 4Q0XL 3TCXA 3OKDA 4XMPH 1XF3A 4MJIE 3TCLB 3RGVC 4TNWF 4KTDH 2VLJD 4H0IA 1T5WB 3QPQD 4PJ5B 1T66C 2XTLA 3CUPA 1YJDC 3EHBC 1XR9B 1YEJL 1EUUA 3PWPE 3IJHB 2NYYC 4NIKB 4Z7QF 3VXMD 4KKCC 4CVWA 1MWAL 4K71B 2FO4A 1ZLSL 1YQ2A 3QDGE 3OKOA 4L3EB 1ZHNB 3NZHH 4QOKD 3RWEA 4J8RB 5JR1H 4OZGA 2P5EA 1I1YB 3T8XA 3DHJA 2C3VA 1CQYA 1JTPA 1XEDA 1G7IA 1VENA 1JGUL 3CFBB 3WIHL 1UWEH 1MHCA 4NT6B 5IW1A 4F15C 3BYTA 5D1QC 5KSAD 1YMME 1CICB 1PVHA 2ED8A 3DBXA 5C3LD 3P40A 1IC5H 2EECA 1LVEA 5CGYD 3UJJL 2RQ8A 1XGYL 2FBJH 3PDOA 4YHKL 4ZUWB 3O6FD 5I1IH 4PRIA 1YUHA 4YHMH 3THML 3RVVD 4NJ9H 2NW3A 4R7NA 1C5DB 1NLBH 4X8XA 1EHLH 4K3EH 4M6MH 3I6KA 2GJ6E 3RZCC 2AK4B 5HHMD 4ODHH 2CXKA 3TIEB 1B90A 1YPZE 4NZUL 4Y2DA 5DGRA 3BIAX 2QADB 5AYUH 2PO6B 2IFFL 5T1LA 2XA3A 4GG6E 4O2FA 5DMKA 1ZHBB 2GUOA 3HAEG 4OJFL 2P44B 2FX7L 5ILTH 1G1CA 5EZLA 1NCDL 1A6WL 1BGXH 3GSQB 4O9HH 4L8DA 3WSQH 4NRXB 1JZ3A 4MVBD 4I13B 3FFCA 3U2SA 3ULUH 1X5LA 3LKNB 2Q7NA 4JKLA 4MJ2A 4PY8J 3VA2C 4F33B 4P0DA 3UPAA 4G80B 4YO0B 4IRSD 5LCVL 4WHYG 3WCYA 2QSCL 2CD0A 1ZT1A 1T22B 3CPLB 4PUBL 1MVFA 3MLSH 3UC0H 3G5XA 3QIUB 4J3XA 4TPRL 4YDVB 4AIZB 1Z9SA 4MLSA 1DBML 1GC1L 15C8L 4JB9H 4HPYL 3KPMB 4OZIF 5AWNL 5F9JA 2R9HD 4L4VA 5DMIL 1LO5B 1RV6X 2FJFB 3GMLB 4S0SD 4JJ5A 5KW9L 2HMID 1KG0A 1QFWI 2DQUH 1AO7B 5LWYL 5EA0L 3OZ9H 2B1AL 3HMWL 1OSZA 3MO1B 1ZXQA 2EIZA 4KRNA 5DJ8A 5TFSL 4F7TA 1KULA 5I15L 1J12A 3DPBA 3UJTH 2VXTH 2C5DC 1P1ZB 1Z9OA 4KDTA 1YEIH 2N7AA 1BQSA 4QT5A 5TH2A 1UM5H 1KXQE 1HCFX 1AC6A 3QNYA 4WO4C 3RI5K 3C5SB 3VA6A 1QO3A 4HFWB 3NPSB 2O5ZL 2NXZB 1AI1H 2BJMH 1GIGL 3ZTNL 2K3TA 2I25N 4KHTL 3DURB 1X5AA 4J4PA 1VPOL 3QISA 4GFTB 4LRNL 3MCKB 3ZL4L 1K5NB 2DQFB 2BC4B 4OBSA 3QEQD 3TT1L 4LLVA 3GIZH 4JEGB 4I9WD 4YEEA 1QR1A 3CJJA 4KH2A 5CEYB 5DR5H 1QFWL 4XC1H 1XGTA 2YPLB 3UTZA 4DJMA 3VXNA 1JN6B 3BW9B 5HGHA 1HKLH 3U4AA 2B2XL 2D4DA 4DTGH 3V6FA 5A40E 3R0NA 3BP7B 4U1MB 4EBQH 4ZFOB 4M5YH 4UINH 4M61B 1KJVB 2X4UA 4JRXE 3VFRA 1G7PB 1IGML 4OCXL 3ROOA 4F9LC 3MXWH 1HNFA 5F1NA 5ACMA 4YBQC 4FFWC 4WFEE 2F58L 1K85A 2IANE 1Q9OB 2D7NA 4FFYH 4QWWD 2X4TA 4JPKH 4WDIA 4RDQF 2WLZA 4I0PA 2WW8A 1QSFD 1SYVA 3HAEA 3EYVA 4RFNB 2OJEA 4KHXH 4WFGE 1TPXB 4J12A 3LB6C 5HHNA 3KJ6H 1HZHL 1HN1A 2B39A 4NN5B 5C6TL 1DFBH 4BH7A 3RNQA 1RZGA 5C6PB 5C09A 2F8VA 2LU7A 1R3IL 2W60A 3QXAB 4XPHL 1P4LB 4OCYL 3AGVA 3BPCA 1CLOL 1X5ZA 3R8BB 4U6YA 2OSLA 1EJ6A 4DKEH 4XI5C 3BI9X 1X6LA 4KQ3H 5FUOH 3ZKSD 3RUGF 5E5MA 2B4CH 3UTQA 4NCC1 3EKCA 1PFCA 3KPPA 5GPRA 1MFBH 3IJSB 5C0CA 3LRSA 2F53A 2B5IB 2IBZX 4KK5C 2FHBA 1GRWA 4QRSA 1XZ0B 5HD8D 3VGBA 3HPLB 4LNRA 1RK0B 3ARWA 5DJDA 4TUJA 1DQDL 1Q72H 3AS2A 1LEGB 1W72H 2A74B 1TVHA 1G0DA 1KT2A 4OD1L 1GC1C 1FL3B 4KZDL 2QR0B 1QKZH 2R4SH 1GH7A 3REWB 5I1JL 5T33H 4JO4L 3BZEA 1H5BA 3T4YA 1YEHL 1X5XA 1KACB 4HIEA 2DM4A 5IEKB 3L6FA 1G6RB 3QYCA 3TBSA 1URLA 2F5BL 5D9SA 4QXGL 1V7NH 3IDJA 4MJ6B 2B8OT 5ICYA 3OAZH 2CKBB 5E9DB 4RRPG 2PTUA 3AUVA 5HVGB 3DTXA 3MSPA 3MQIA 1BQUA 1JNHA 2FIRT 2H3NA 3DUUA 3IFLL 4Y1AD 1DDHA 3IF1B 5D6CA 3BN9D 2H2PD 4ALAH 4K8RC 1NC4A 5JUEH 1LE5B 3KYOB 4KKLC 4UB0L 4OLWH 2YN5A 2XTJD 3DX6B 4KROD 1FE8L 4GKNA 1HXMA 4LPVA 4X6FB 2V17L 3CX2A 2ZOKA 3JTTB 3DARA 4ZUSA 1U3HA 2RGSA 1R3HA 4QXUL 1L0XA 5B21A 2HH0H 3D18B 1VGEH 4ODVL 3I2CL 3ESVF 4ELMF 3L7FA 4UAOC 2R56L 2P4AB 1CVRA 4JDTL 4IM8A 5C0AD 5I1KH 3D0VB 4MNGB 5HI3D 5D2NC 4I18C 4G7YH 3H7BB 4GRMB 5BZWA 1TETH 4RIRB 4DKDC 5MEND 3ZYOA 1AIFB 3MV8D 2XWJA 4PJEE 1SYSB 3V6ZB 1FYTE 2ZCKH 1H3TA 1IGFH 3WIIL 5CCKH 1FZMA 1N3NA 5E0QA 3HNTL 3K74B 4RGNB 3MLYL 1AFVH 4KJQD 4HIHB 3ARED 1F8TL 2ZCHH 4FQ2L 5BRZA 3WXWL 5SWZD 1VACA 5DEZA 3TNMA 5IWLC 1WZ1H 5TE6L 1BP3B 1FG2A 5HHVH 1DVFD 2GCYA 1I1AA 4K07A 2DLTA 1N7ML 1F58L 4G8GD 2O5YH 5SWQB 4X4XA 1E0OB 1ONQA 4XCYA 3C5ZB 2ITCB 3UTTE 1ITCA 3RL1A 1FO0A 2PXYC 4NQCD 2EE2A 4JFPA 1MCNA 1ZS8B 3MGOA 5SWSD 3B5GA 2R1YA 4XHJC 5TPWH 1IKFH 3O6KH 2JTDA 3OJMB 2ZUQB 3MLRL 3SDCB 1XR8B 3QFJE 5IEHB 1FVDB 1YJDH 3BHBB 3UBXG 1AR1D 1OWWA 5J12B 1KOAA 3FFDB 1Q0YL 5CLWA 2Y23A 3GSNA 4PLJD 2YXFA 5C0DB 1JNLL 1KCSL 4C56B 4RRPA 1QBAA 3M1BA 1DEEB 5C8JB 1GXEA 5D7JA 2VDMH 3C08H 4U1GC 5ESVA 1YNLH 1HI6A 2F19L 3FCTA 3MV01 4ZUTB 3DV4A 5FYKH 4PTUA 5AD0A 3MRFB 1YEDA 3SE4C 4HHAB 1S9VA 4MDJA 4WI6A 2L0DA 1ZGLM 3V5KB 3SKJL 2PYEB 2AV1B 4OLUL 4I5BA 3VWKA 5KJRH 4XP4L 4XBGB 3HFMH 4OGYL 3VGAC 1AY1H 4EIGB 1G0YR 2W9DL 3WN5C 5C08B 3VXQA 4G9FA 2W9EH 5EIVA 3WNLA 5I75C 4AG4H 2DWDB 5JTWA 4DFHA 1J87A 1XGUB 5FOBB 1YPZF 3QIWC 3EO0A 2FBOJ 2JIXB 3P4LA 3PWVA 2DWEA 1E4XI 5BJTA 3U6RA 1BFVH 5TGBB 2P5WB 3ZE0E 5IB4A 4JO2L 5EC2A 3HZKB 1WC7B 4PYGA 5KS9E 3IXTA 4MB3A 4HXBL 1PZ5B 2F9BT 2D2OA 5T5FH 1MCWW 5H94B 2AABL 2XQBL 4AEHH 1IM3A 4PJXA 3DGGA 1RUML 1SBSH 4KJPD 4APQD 4TVPE 4YNYA 1EIBA 1BVLB 2G75B 3AB0B 1JK8B 1OP9A 3BN3B 4WEUD 1T21B 4MAYB 4PP2B 3TF7C 2A6IB 4Y8AA 4P46D 2E6PA 4AK1A 2BNRA 3GO1L 3M45A 4YHLH 1KPUB 3KPRE 4KMTH 3PGCA 3RKDC 1E4XL 5D8JH 4RNRA 4LDEB 5BQ7A 2VLRA 4P48A 4NC0B 3WL9A 1ZTXH 1AGCB 1UJ3C 4NBZB 4S0TD 3O9WA 4XAKE 3FQTB 1EBPA 4J7RA 5DYOA 1MI5B 2X7LB 5HPOA 1ZT4A 5DZNA 5EUOE 4HWEH 3GSVB 4ZAKB 4Q74A 4GKZA 3QI9B 3UBXA 4UOW1 3TYGL 2FB4H 4N0UB 5JPNA 3BQUC 3OF6D 4Q0XH 3ARDD 4WWKD 5I8CB 2OI9B 3U4EB 4P3DB 4ZNEE 1NBZA 2F54E 4JHBA 3GMLA 3QCUL 3RP1A 4JAMB 3FN0L 1AO7A 2NTFA 1YEJH 1WBZA 2A2QT 5CMAA 3D85B 4IRSC 3P3YA 5E1AA 1CFSB 1XCTA 5J89A 4PJ9B 3DNKA 3F7QA 1MWAH 3MRBA 3HC4L 1FL5A 1ZLSH 4HK0A 2VMFA 5JOFB 4HPOL 4ELMB 3H9SD 1CK0L 4XXCC 4HFWA 2EDDA 1KYOK 1NCTA 1OLLA 4Z7NF 1G7MB 3ULVF 3CLEL 5DMYA 5JXEC 1JGUH 3WIHH 5HVFB 3DMMA 4FTVD 2R2CA 1CGTA 3HR5B 4DW2L 1OTTC 2AV7A 3GKZA 1O0VA 5DI8B 4CU8A 3BD4A 4WY7L 3BIBX 3KPNA 4YDJB 3UJJH 4E9LA 5FB8A 1XGYH 3DUHA 3V2AR 1KTLA 4YHKH 3VXPB 4CVXB 3G5ZA 3BSZL 1SJEB 4NUJB 4MA1C 4W6XB 3RY5A 4K2UL 1BD2A 3THMH 3MJ6A 3SPVA 1FNEA 4N0CC 4G8FA 3MFFB 3O45B 4F7CB 1VKXA 5ABDE 3KLSA 5L2JA 4NZUH 4UDTB 3U9PL 1P2CB 5KVFL 4PGDA 2Z8VC 3SQOL 4YHYC 3REVA 1I7TB 4OJFH 1T6WA 5B4MC 2FX7H 2OMBA 1DUYB 1JNNL 3ROLA 1NCDH 4YK4B 1A6WH 1DQML 3A0OA 1H8OA 3PQYE 1U3ZA 1CN4A 5DZOA 3O3BA 4Z7VB 3G6JB 1J05A 2PN5A 2OM5A 3HI5L 1QA9B 4U6XB 3FONA 3UTSE 4MJIB 4H1LH 1UB6B 1D5BB 2DQGL 4Y5YA 3UX9B 3VFWB 5LCVH 4I3SL 2QSCH 3IFPB 3SOBH 5MEQA 5DD1L 1N2RB 5ISZD 3PWPB 4PUBH 1NCWL 2DL9A 1A0QL 1WITA 1A21A 5DEFA 2IQAA 4TPRH 1W0WB 1MPAL 1ZWIB 4L9LA 4BH8B 1GC1H 2NY3B 4QTIL 15C8H 4HPYH 5CP7A 5AWNH 5FO9A 3D39A 3QDGB 5L2KD 3RDTA 5DMIH 5D71L 1T1XB 3BO8A 4JANB 5CKAA 5DHVB 5KW9H 2Z31C 3PHQB 2EDEA 4M6AA 5EA0H 2R1WB 5LWYH 2B1AH 3HMWH 2Z93A 4Y4KB 4QKXB 4DCQB 2Q8AL 1EHNA 4HAFA 4XVJL 5TFSH 4PJBA 3MRRA 5CIPA 5I15H 5D2LE 1XZ0A 1YMMB 2ERJB 2VLKD 1U8MA 5F8QC 3V95A 5T3XD 2EDTA 3RZWA 3TC9A 2DLHA 4DK6A 4PRBA 2O5ZH 5DRWB 2XWTB 3PWJB 1U95B 3AS0A 4X5WB 4WIQA 3PV7A 5FA3A 1GIGH 2VZ3A 4Y19A 3ZTNH 1X5JA 5J3HD 4KHTH 4NP4L 5FKAA 1WAAA 3TFKD 1VPOH 4NO0B 2PW1A 4LRNH 2V9QA 1JUFB 3ZL4H 2YSSB 1PKOA 2GJ6B 3TT1H 1PG7X 4OIIL 3VWJD 1YPZB 3JXAA 2HTKC 3QDJD 4KPHL 4Q6IC 3RX5A 1CDCA 5DD6A 1QFWH 2BOCA 4GG6B 1VFBA 4M8VA 2X4SB 4UOJA 1QYGL 5E5RB 4WW1B 5E9DA 3LN4A 4PS4L 3ZDZF 4HXAL 2B2XH 4GAJL 2E7HA 2XI9A 3L5JA 3ES6A 4D9LH 4ORGB 1J8HE 4CKVX 5K59F 2XN9D 4Q58C 4M1CC 5CUSL 2GAZA 1IMHC 1NJ9A 1IGMH 4OCXH 4CN1A 3O41B 1KJ2A 4NDMA 5DFVD 2F58H 3NA9L 3QDHA 1HDMA 2ZPKL 4PRPD 4N9GB 1I8KA 3ZZ1A 2EEBA 5JW4R 4GOSA 3W9EB 3QP3A 1JYVA 1OVZA 1NFIA 5E2TH 2COQA 2R2HB 3TBWB 1EHAA 3LKRB 1HZHH 5JXAL 4IIQA 2OZ4A 3DRTA 2ZSWA 5C6TH 3DXAD 1M6OA 1T7WA 1CE6B 1G84A 4RAHA 1SEBB 1R3IH 3D0VA 4XPHH 2A0LC 4OCYH 3O3EA 1FFRA 3DECA 2P8LA 1YNTA 3GIVB 1CLOH 3B43A 1OOAA 1YQVL 1JPGB 5I1AB 1ZA6A 2IADA 2NXYB 3ZYZA 3P4MB 4KQ4L 1UQSA 5DK0A 2JCCA 3QWRA 3BPLB 2LVCA 4OV5A 2YD9A 1M7DA 4XTRC 8CGTA 1LE9B 4FQXC 4JFFD 4WI7A 4MQ7B 5EB9A 3QRGL 5HI3C 1T89A 3QNXA 4J1UB 1DQDH 1QRNE 1B4JL 3BDYL 4B50A 3VXSE 4PRAB 2V2XA 2V7NA 4OD1H 1I8MB 3P4NA 4KZDH 3GGWA 3QUZD 1TIUA 3ZKXB 3C5ZA 1KBGL 3O2WL 4LSQL 5I1JH 4JO4H 2WK2A 1MIML 5I1LA 1W8OA 1I1RA 1YEHH 3HE7C 3WLBA 2VLME 4MA3B 5BV7B 3D69B 4JRXB 4Y16D 4FZEL 1JL8A 5GSRB 2PUQT 3EW3B 2F5BH 4QXGH 4GW5A 2EE6A 4CJ1A 3GNML 1A6TA 4JKMA 2H32A 2IQ9L 3CAFA 4K7PY 1D9KD 4OI8A 3BT2L 4HW6A 4U1KB 1PDKA 1HWHB 3DUSA 3IFLH 4NZTH 3MV9E 3O6ML 3O3DB 4PB9L 1Z6JT 4GRLA 4OF5A 3S9DB 4UB0H 5EIIA 4L1DA 4CAGA 3QR2A 1CIDA 3L5WB 5HVHB 2WQ8A 4NGHL 3Q5YA 1FE8H 4YFLI 3RWCA 5D7LA 1T7VA 2V17H 3VJ6B 5DVLA 2E7BA 4OLZH 5J4MA 2D0HA 1I8LC 2BVQB 3FB8B 4QXUH 4A6YL 1D6EB 3LEVL 3ZE0F 2GITA 1IGYA 3I2CH 4ODVH 3Q6FA 4GBXC 4GUPB 5JHDA 2R56H 4I3GA 4Z5RA 4JDTH 3IS1X 4QYOA 2UZIL 4YH6A 3DX8B 2CJUL 5FYJL 3S4SB 1J86A 3DVNA 3P77B 1I1FA 4P5TB 2ZNXA 3JWNC 4JM4L 4S1SL 3MRGA 4W70A 3SY0A 5IIEB 3WIIH 3GSXA 2E8ZA 3VFOB 1ZANL 3HNTH 1MHHB 3RWIA 3MLYH 4XCCL 3PWUA 4HD9A 4Y4FB 5J7CC 3HZKA 2OL3L 1F8TH 4FQ2H 3WXWH 1S8DA 1RAMA 4KK6C 2VQUA 2N7BA 1KB5B 1Y0LB 3GB7B 4U49A 5TE6H 1JTTA 3ME0A 3L95B 4Y4HB 1N7MH 3U36B 2Y4SA 1F58H 4U31A 2FJHB 4AIXA 3CVHL 2XY1A 5DUPL 3BZFA 5EUOF 1HCVA 4POUB 4D0BB 3RFZC 3T0WA 5EO1B 5C0GA 4NNXA 4NO2B 5DK3A 3TA3C 3CH8A 1A9EB 2HFFA 4ERSL 3FO9A 3O2DA 1FNGB 4YHIA 4CADA 3VFSB 3W9DA 1UGNA 1JNJA 5C1MB 4AQ1B 4NQDD 1VGKB 3L5XL 4YDLC 3MLRH 3O81A 1R5VA 4LOUD 1S7TA 3GSWA 1XF2A 4JFEA 2YZ8A 1UB5A 1FIGH 2YD6A 1A02N 2EDWA 1QLFA 1UH4A 3QO0A 2IC2A 4MJ5B 1CS6A 1Q0YH 1KTKE 4LRIC 1VADB 5JNYB 1NCUA 4Z7WA 1ZVSA 3MV7E 2FYYB 4PJHA 1FFOB 1JNLH 1KCSH 3V7AE 4BFIB 2F8XC 1Q9KA 5L8LB 3DO7A 2EKJA 4GKSB 4BQ6A 1JP5A 3B3IB 2F74A 2D7TL 1BAFL 1T1YB 2F19H 5GRVL 4P99A 4FFVC 4JFDD 1DQJB 5FM8A 2Y25A 1S7WB 3L3HB 4DUWA 1NFDE 1OAYL 1BBJB 5ID1B 3IGAA 4PJEB 3WKNA 3SKJH 4DGYL 5C0JB 1IAMA 4KKAC 2VIRA 4L3CA 4OLUH 1FYTB 4F9PC 1CFTA 4HBQA 3RWJA 2Y6SD 5I17B 2AEWA 4XP4H 4EUPH 3VXOB 3CD4A 4OGYH 2W9DH 4YIQB 5C70A 3PIQB 4WUUE 1ETZA 3MACL 3L3JB 3KPQA 4U1HB 4R26L 1CFQA 3QIBD 5CJ8A 5IM7B 1G7MA 1HH6A 4HKBA 4XVUD 2VLLB 3V79C 3CNKA 1G9ML 4YHPA 2DQHL 3WNNA 4PREA 4GW1A 4P23D 3CLFL 3EDEA 4BQCA 4POYA 5DF0A 2Y7QB 2V5RA 4ETYA 3F12B 4G6FB 4LCCB 2FWOB 5E8PB 2MPAH 2NMSA 4NRZA 5FYLL 5F7UA 5DO2C 4CDHA 3FZUD 1I4FA 3UTTB 4HXBH 2J6EH 3HNVH 3RVWD 4FQLL 5IV2B 3JVGC 1T20A 4NUJA 1JWMA 1U8KB 5F89B 1CTOA 5E08L 5D1ZA 4A2LA 3WFHB 2AABH 2XQBH 2E7LC 4PJBF 1X9QA 1E6OL 1PLGL 2NY2B 1R3KA 1RUMH 3DROB 3OKNB 1F6AA 3GBNL 3QFJB 4IOFC 5A2LH 2YEZA 3SE3A 4U6VH 3K4DA 5C0EA 2VYRE 5ADPL 1KCVL 3MZTA 2IEPA 4NM8L 1NGYB 1AKJD 3CXHK 3G6DL 3RWHA 4F7EB 4GLRI 3F6IA 3GO1H 3EOAB 3UBXI 1WAAF 2JJSA 1E4XH 3IETA 1L6ZA 2O61A 1WBYA 1B0WA 5I16A 1OAUL 1BFOB 5IVXE 3FTGA 4NQED 4OTXL 4EVNA 5SX4I 2FL5A 2MTPA 2WINA 4BSVB 5C9JB 5E7FA 4KI5D 2XKNA 4P2RE 2NX5E 3ARZA 1XF5A 5JIKA 3T0AA 1A2YB 3WHE1 1ODAA 1RHHB 1CFNA 4OD3L 3OKKB 1BOGB 3TYGH 4L4TE 3ZE1E 4IMKA 4WI8A 1F42A 1I9IL 1P53A 4EI5D 1A6ZA 5HY9B 2HVKB 4P57A 3T4AA 3X12A 4TQEL 4LGPB 3JTSA 3JV4B 3V5DB 2BSED 3D2UB 3KYMB 4M7JL 4X98B 3QCUH 1R3LB 2EYTB 2F8OA 1TVBB 3BZ4A 3FN0H 3T2QA 1SJHB 5F7EL 5KN5A 5GGVY 2Z8WC 4PJFE 3SCMB 1U8NB 5HDBF 1TQBC 3ARYA 5INCA 3MX0A 1S7RB 3HC4H 4U6TA 4UTBL 4HPOH 5KS9B 1CK0H 1U36A 4HZLB 1XIWD 1UYWL 3OL2A 3HG1D 3CLEH 1WFUA 4FQCL 2DQDL 4HMEA 5C0BE 3LKQB 2ADFL 2QQKL 3RL2B 4X7CC 2EDQA 3ARTA 4DW2H 4NRYA 4M48L 5CLTA 4WY7H 3QEUB 3DHMA 2WUCH 5IJVA 4WTZA 5DK2B 1CD0A 1SJVA 4YZFE 4LIQE 1IBGL 2V2WB 3LCYA 1FLRL 3GJEB 4UI2A 2VDKL 3BSZH 3AY4C 3VRJB 5JO5B 4K2UH 3KPRB 4X6EB 3T3MF 5HHOA 2QLVB 1CYGA 5M7QA 3WFBH 4OFDA 1G9MC 3RIAK 1NAMB 5LGKA 3U9PH 5KVFH 4CVZB 3SQOH 1HHKB 5CKGA 4LMQE 3CZFA 1Z0NA 3KNBB 5DQDL 5EUOB 3C8KA 1I7RA 5IB1A 5GS1C 1KIRA 1JNNH 4ZTOL 3GMRA 3HZMA 1S78D 3UROR 1DQMH 5EORL 2UY7A 3HI6L 3O8XB 3O3UN 4L8SA 3UCRA 3D6GA 4GT7A 1FVCB 5D2NE 2CLVB 1HKFA 4ZFOL 3T65B 4ZQKA 3HI5H 3NABL 5DSCA 3Q3GB 3S4SG 2DQGH 2IG2L 2F54B 5F3HB 2ZOLB 1CICC 3TN0D 5AUMB 4I3SH 1PEWA 1GPOL 3Q2CA 1F13A 4FNLH 1ACZA 2UYLB 2AKRA 5DD1H 1A6VL 3CFEA 1G9EA 1SEBA 4P4KB 1NCWH 1A0QH 1NGZA 5DFVC 4OUUB 3SDDA 1MPAH 2PNDA 1CT8B 3D25B 5M95B 3QQ4B 5E6IB 4M5ZL 1EEYB 3MLTA 3U46A 5I1AA 5D1XD 5GRVK 5D71H 5DC9B 5E4EC 5EBGA 2GJZB 3E2HB 4OLVL 5B22A 5K9KA 4OGZA 1FZKA 4CNIB 3C60A 2YHGA 2YWYA 4AIOA 4NZDA 1MAJA 4IRJD 5IW6A 3N1QC 2Q8AH 5DMJB 2QADC 3F7RA 1KPVB 4MNQA 4XVJH 5EC1B 2P8MB 5GS0L 4PRHD 4BSWB 5ID0B 2HT2D 1K3IA 3SJVD 4ZFZB 1GGCL 2X4NB 2XY2A 3GMOB 4R3SA 4WV1A 4TSAL 5H2BA 5DS8B 2Q7YA 1D5ZB 4YR6B 4PGCA 5DD0L 3IAQA 3TZVB 3PGFL 2M26A 1I85C 5E8NA 3PG2A 4NP4H 3AXLB 2IPKA 5ALCL 2MWCA 4HZAA 1LO2L 5BS0A 2FDBP 3BDXA 1OP5H 5IBLC 3HI1B 5FEBA 5CJOL 4JREC 4OIIH 3UJIL 4KPHH 3BMVA 4WNQB 3ETBF 3GUTA 1H3XA 3NCMA 1BLNB 4OCNC 1QYGH 5GISL 1ROWA 4V1DD 2IANA 3MRCA 4PS4H 1OWRM 3GRWA 4GAJH 4HXAH 2BSTB 3PQYB 1ORSA 3P4OA 1A3RL 1YMHA 3FO2A 3UTSB 2NY5C 3TO4B 1G6RL 1T0NA 2DIJA 5CUSH 5CD3A 4WCYL 2XACC 2HTLC 4ORZC 5DJZA 5DZLA 4N5EC 5JPMA 4Z7OF 2CKBL 3NA9H 4W81A 2MOVA 3QSKB 3ARGB 1U92A 2OTUA 2ZPKH 3NPSC 4PJDE 2IPUG 3OHXB 4S1DC 4F8TA 4IOIB 1N8ZA 2XNAB 2X4PB 4OFKA 5IB2B 2VLJE 5JXAH 3MRNA 3T0ED 4C4KO 1F02I 3VXME 4I48A 3SN6N 4JO1L 5FUCC 4N90D 3LKSB 2X4OA 1KFAL 5D2LB 3PJSB 4Q7DA 3N50A 1YQVH 4LLDA 4PJHF 4QOKE 4ZXBB 3HRZA 5ETUA 2CRZA 2B1HL 4KQ4H 3ARFC 1FSKB 4XMLL 4JGJA 2APVA 4ZFGL 1EEZA 3IDNA 3WLWC 3MR9B 1D5IL 1U58B 2YD8A 3ZDYE 5H37G 4X0KB 1RUPL 3G9VA 4RFOL 5EN2A 2AQ2A 5I1DA 3I75B 4W68A 3S37L 3QRGH 4RWYH 1A7RL 1B4JH 2AJVL 2X4RA 3BDYH 1T4KB 4WW2C 4MHHI 1NCAL 3RTQB 3CVIL 4A2MA 5I2IB 4ZSOE 4JHWL 4JZNB 4Q9BA 4HIIA 4JQXC 1WJ3A 4ODXA 5J6HA 4RWHA 4M7LT 1KBGH 3O2WH 4M4PA 4LSQH 4NN5C 2ATKA 2XKUA 1MIMH 1J8HB 4HGWB 3TYFA 3W81A 2BMKA 4JY6B 3QDAA 3DJ9A 4F7PB 3IXAB 2FX8L 4UV4L 5GS0C 1DTUA 5KSAA 4FZEH 5IB3B 1RIHL 2DKUA 1NFDF 3GNMH 5ACZA 5CSBA 2IQ9H 4KTYA 4UQ2A 1OTUC 4H26A 1BWMA 3I3DA 4LKXA 4LQ1A 2BSRA 2EYRA 4RBPK 3BT2H 5B38B 4HFUL 5I19L 3FOLB 1K2DA 1K4CA 2DQIL 3O6FA 4LBEB 1JHTA 2B5IC 3O6MH 4NZJA 2EDLA 5D7IE 4FMKA 4P2OB 3CFCL 4JG0L 4PB9H 5T1KB 3C6SA 5ICZB 2IH1A 2QSTA 3WJJC 3B3IA 4NGHH 3PWLB 4L4VD 3SGEI 1DBAL 5C71A 4FG6C 4R2GD 4EZMA 5J1AA 3RHWF 4A6YH 3LEVH 4PJEA 2UUDH 4Y5XC 5C0JA 2XG4A 4ZPVA 4XPGH 3CC5A 5C07A 4AMKL 3RNKA 2UZIH 3M8OL 3FQRA 1IEBA 3PIQA 3BXNA 2VDOL 3OGCB 5FYJH 3MFGB 4V2CB 1FRGH 3FQWB 4OCLC 1TMCB 1Q8MA 4RGOL 2QL1A 3RY6C 2G60L 4S1SH 1NKOA 1QRNB 1CXIA 4ZYKB 1BBDL 2EIDA 3VXSB 1CR9L 1TTFA 1UH3A 4X80L 4U0QB 1ZANH 3HN3A 4OCSL 4QGYA 4XCCH 4I3RL 2KPNA 2OL3H 2WBJB 4FZ8H 4HH9B 4K23L 1GYAA 2GYSA 5ANMA 5JLZB 3C6LC 3QEQE 3FQXA 3VD3A 4WI3A 5DJXA 4I9WE 4F3FA 4R0LC 2NY6C 3FOMB 3CVHH 1IGJB 1CWVA 1QNZL 5DUPH 3MNWA 2DOCA 2LVEA 5KANI 3L3KB 1NEUA 2BVUA 5HI4C 2X89D 4JY5L 3OXSB 1JWUB 2NY4B 2RAMA 1WBXB 3S98A 1S7UA 4TNWK 3RGVB 2ARJA 4MNHA 4C83B 1NDMB 5CHNB 3MV9B 4BQ9A 5HBBA 5D7KE 1Q1JH 3L5XH 2DKSA 3PABB 4JRYA 1YNKL 3BJLA 2XIDA 1FVEB 1ZA3B 2GSIB 1TCRB 1WCQA 2ITDB 4OGAD 3FRUA 2VE6A 1KLGA 1QSFE 4RGNC 3G5VA 2OCFD 2HT3D 1S5IL 2YKLL 3HE6D 1Q9WA 2J8UA 5B8CA 3MNZB 3QZWG 3TBTA 4DAGL 2BNUA 5D1QB 2IAMB 4XX1E 4BUHA 3E6HA 4H25B 3LDBC 3WUWB 1KPRB 2D7TH 5IR1A 5IBTL 5HY9A 1BAFH 2D31B 1MELA 2BOBA 1DQQB 1A4KB 3R06A 5DTFB 4LCIL 5EIQA 3MBEC 4G9DB 1OAYH 2FGZA 4NSKA 4DGYH 2DKMA 2F53D 1KC5H 2EDNA 5E8DL 1AXSB 5KG9B 2FLRT 4P59L 4MX7A 1L6XA 1UM4L 4HK3J 5IBUB 2ZUQC 3IFNH 2CIIB 3MV11 3MACH 1A9BA 1E4WH 5GIRA 4L3AA 2CPCA 2QHLA 4JO3L 4GS7C 1G9MH 2QKIA 3B9KA 2DQHH 1KIQA 5IB5B 4DEPC 4EQ2A 3CLFH 1RJLB 3RAJL 5E00A 5IUSA 2EKSB 3QUXC 3HLAB 3OKLA 1JF1A 3ARBD 3VFPA 1U42A 5FYLH 1PG7L 3OR7A 1JFQL 3T1FB 1UVQB 3WJLC 4FQLH 4KRPD 2JK5B 3ARRA 4XVSL 3MJ7B 5E08H 5CJQL 4CVUA 2I9LB 3L3GA 1ZEAL 1E6OH 1PLGH 4HAGA 1UWXK 1QBBA 3VDAA 5CBEB 1SM3L 1IAIM 2J4WL 3GBNH 1YEFL 1X4ZA 3IDIA 1NC4D 2APTA 2EC8A 3AMLA 3SKMB 4HJJL 5ADPH 1KCVH 4NM8H 4XP1L 4PLKD 3KNBA 5LGJA 3G6DH 5BCAA 1AD0A 1E4KA 4O5LL 3B9VA 3MV7B 4Z95L 2AXGB 3RWGB 4F57L 5FHBL 3DETD 2X10A 3HC3L 5TQ0L 4M1GH 1FBIH 2XTJE 5GRJL 1FVCA 3RBSA 4KJWC 4U1IA 1OAUH 3TVMD 4OTXH 1TQCB 4ZNEA 3R8QA 5EBMA 5EH1A 3IAGC 4HLZH 1LD9A 5DD3L 1MCSA 1NFDB 2V6HA 1A1MB 4CN6A 1LNUB 3C9NA 3SDAC 4D0DB 5EOTB 2JB6A 1AXIB 4H0HB 4XGZA 3HA0A 1QR4A 3K4ZA 5C0AE 4Y1AA 1K8IA 1A3LL 1S7XA 4JR9L 4AENA 4KUZL 2ORBL 3QUYC 4TQEH 1WVZA 1FCCA 2ZUXA 3G04A 2EO1A 4WUUB 1OAXL 4M7JH 1ZKAA 4Q2ZA 3QZWA 5C6WH 1XGPB 25C8L 4RAUB 5MENE 5F7EH 3AB0C 1EFQA 4QHMA 5HGAA 4U2YA 1YECL 4KUCD 3B9AA 1KB9J 5BRZD 5KSVB 1MCKA 5FCUL 3ABZA 5DURB 1FJ1B 1KCRL 2KUTA 1I1AD 4YPGB 4UTBH 1UEYA 3FO0L 4RMUA 5SWZE 4YGVB 4PJGA 4NKOA 3DGCR 1FZOB 5FIEA 4KVNH 1UYWH 5TDPB 2EYSB 3EOYG 1RK1B 4G6AC 4H5SB 1H8SA 4QRPD 4FQCH 3QJHA 2ADFH 5DUBA 3PL6B 2QQKH 1BIHA 4Y0GA 4ZAKC 5MHSD 3ALWA 4TULL 4ACPA 3Q0HA 4M48H 4MZ2A 3MV8A 2CIKA 4LSRL 4R4BA 5GGRB 1RULL 3STZA 2I07A 1INQB 1D5MA 1S5HA 3QCTL 3BVNB 5F7WC 3N85L 4NQCE 1IBGH 5B38G 1WQVT 4E41E 3FQUA 4X7EC 1FLRH 1MQKL 2VDKH 2XWBA 5SWSE 5F97E 5GGSB 1WIPA 2EDHA 2MFNA 3S6CA 5IMLB 1V5JA 3QUMB 1FC2D 4KC3B 2NY0D 3MC0A 4RBPH 2OP4L 1GZPB 2BSTA 5KSUB 2Z8SA 3PNWB 5AEAA 3FO1A 1I75A 5IVXB 3QFDA 1ZGLB 3KPOB 4G8GA 1U8OB 4PJ9C 1MCEA 1QQDB 4P2RB 2NX5B 3QG7L 4XPTL 5DQDH 5FO7B 2Q6WA 2ICWB 5LGHL 4ZTOH 1A7OL 2FSEB 3KYNA 4N8VA 1I1CA 5FKPA 3MJ8A 5EORH 3S3JA 1TZIA 2E7CA 3HI6H 2DLIA 4L4TB 4W4OA 2ICWJ 3NABH 3VRIB 4UV7L 3ZDYF 5F3BA 2IG2H 4MD5B 2XFXA 4NPYA 1GPOH 3JUYA 3K7UA 4K3HA 5J6GA 1A6VH 3SBWC 1RUQL 4OB5L 4PJFB 5KZCB 2CDEB 2IH3A 5FYLD 1MLBB 5DRZB 32C2B 4PJ8A 3JWDL 4M5ZH 1CG9B 5K9OA 1EV2E 1KCUH 5D7SL 1MEXL 2P43B 3DVFA 4FQHB 4LU5L 5A16A 4OLVH 2FHCA 3F6LA 4HS6B 4WU7A 5GS0H 1B0GA 3W5NA 5C0BB 2XPGB 3AVEA 2Y5TB 4X0KA 3DV6A 1U91B 1OARL 1W72A 2AXHA 1W0VA 4LLUA 4B7LA 2ZWLT 3F5WA 2GEEA 1GGCH 2EDOA 4DUVA 1H9VA 5CS7A 1BQHA 4GW4A 4Z7UA 4TSAH 5GGUB 3UZQA 1G7HA 3RTQA 5DD0H 3PGFH 5SX5K 4TYUA 4PG9A 5IROC 4Y7MA 1LO2H 2PO6D 5KTEL 3R0MA 1MJ7L 1QFUL 4WI2A 3VFTA 3UJIH 5ERWB 3NA4A 4NKMA 1AP2A 4NBYB 2NY3C 4MXWL 4ODWB 5T1DL 5EG6C 2EDYA 2VLRD 4RZCB 2Z92A 4UIKL 1NGPL 2C7UA 3PGDA 3KLHD 3IS0X 5GISH 3SGKC 1OGAE 1JGEB 2YA0A 3LEXA 4O2CB 1QP1A 3QQNA 3ZKMD 1I3GH 5EFIA 2QSQA 1A3RH 5D2NB 2AEPL 4I18B 3WUWG 3C5JB 4V2BA 5ITFB 4LBEA 4DKFL 5BV7L 1QSVA 4Y2DC 5FA4B 3I6GB 3GJFH 1HHGB 4WCYH 2LABA 4P2QA 3QA3B 3AS3A 1CI5A 3IDMA 3G08B 3JZ7A 2CKBH 4Z0XB 4GG8A 1LWRA 4X7TB 1UEMA 4JFYB 1C7SA 1QLEL 1H0DA 4Y5VB 1EMTL 1PQZA 2E9IA 2HN7A 1VEPA 3VMOA 3CGTA 5GGQL 4XNZC 1AO7D 5IBUG 3H0TB 1B6UA 3LD8B 5EU3A 2X1QA 1A5FL 5BVJB 3HB3C 3B2UC 2P24A 2XV6B 4O00A 1JHLL 2P8PB 3IDUA 4XCEB 5DJ0B 3JV6B 1S9YA 2Y72A 4JO1H 1F90L 4OGXL 4OT1L 1J8KA 1KFAH 3RWFA 2PXYB 1KELL 2NXZD 3EOTL 1R3JB 5IF0B 5MERB 1J88A 3H9SE 4MWFA 3F8UB 2B1HH 5FYJE 2FR4A 4XMLH 3OF6A 4F2MB 1IQWL 2H26B 4QF1B 4ZFGH 4PV8B 1BM3L 3GMQB 1D5IH 4TNVF 4PJIE 1EDQA 5DRXB 3U82B 3FB6B 1RUPH 1ZK9A 4KDTC 4RFOH 3QUKA 4MCYA 3QH3B 4F7MA 4JG1H 3S37H 2YPLD 2JE8A 5F1IB 2CLZB 1A7RH 1Q94A 2AJVH 1MFNA 1R24B 1H3VA 2C1OA 3O4LA 1BD2D 1R5WB 3HS0B 1BZQK 4WFHD 3WEXB 2DLEA 1NCAH 2ICEA 2HLAB 3CVIH 3VW3L 1C12A 3QWOA 4JHWH 2AJYL 3CCHB 4J4PC 4JVPA 4U1GB 2AJ3B 1ORQB 4JQIL 1JZ6A 3RVUC 1EFXB 1B88A 3BPOB 3EYFA 1KB5L 4XP6L 4Q9CA 3GDBA 2IALA 2FX8H 4G43A 1TZHA 4UV4H 1YEGL 2G9HB 4PJ7E 4FTVA 2OK0L 4LVOC 4ZO8A 4JPWL 4QTHA 4MXVF 4JGMA 1RIHH 4KMQA 5EUKA 3VGAB 2VAAB 4PJDB 4TRPL 4HFUH 5I19H 4YFEA 4BJLA 2DQIH 3QG6B 4FQQA 3BGMB 2VXUL 3CFCH 4JG0H 3S3PA 4LKCB 4F37F 1K8DA 2VLJB 4NFDA 3QIWB 3SGJC 3V0VA 5D1QA 4X4YB 1OF2B 5ISZE 4O2EB 5ICXA 3VXMB 4ZFFA 3D39D 2D31A 5E8OA 3RDTD 4Z77A 3MRPA 2Z35A 3CSBA 4I0PC 2XZZA 1DBAH 4OD2A 4UZGA 2AGJL 1NBVL 1PY9A 2AW2A 2UWEA 2VITB 4YBLC 2ESVE 2MSPA 1C8PA 3ULUF 3IRPX 3EDDA 4OGAC 5IG7A 5MP6L 1FHGA 4QOKB 4NNYB 3KHQA 2V5TA 4JN2A 1FLTX 2WIIA 3ULVC 5KG9A 3WHXB 4AMKH 3VFMB 3M8OH 5BV7C 2BP3A 3RZCA 4W6YB 2GK0B 4HMDA 1BEYL 2VDOH 4JFZL 2M8XA 5GJSL 2CGRL 5B39B 3MZGB 5T3XE 3C87A 3ARQA 4RGOH 2G60H 1MJJB 1BBDH 1CR9H 1HE7A 2VL5A 4X80H 2DMCA 2BCKA 3WE6B 5IESL 4OCSH 4R7DB 4ZSOB 5L2KA 4HS8L 1KUMA 3SGEH 5HHPA 4I3RH 2AQ3A 4K23H 5HYSB 1J1OL 5IOPB 5J1SC 2JK5A 5ACLA 3QDJE 4P9ML 3ARPA 5E9DD 2L7JA 2FLBT 3PP4L 5HJ3B 3J8F7 5CGTA 2VLKA 5CBEA 2YD3A 1YDPA 1QNZH 1VFAB 1WWAX 2BY0A 3OXRB 3BQUB 4JY5H 4X6CE 3BYYA 2YMXL 4H1LG 1DLHA 4N1CA 5HGDB 2QJDA 1H5BC 4PJGF 5BXFA 3FT3B 2R0KL 5GS2D 2I27N 2A9NL 2XN9E 1T04B 1Z9MA 3LN9A 3VDBA 5D7IB 1S7VA 1G9NL 5FM5O 4YWGL 2J88L 5J1TC 2DBJA 4URTB 4IRSB 2K1MA 3LSOA 1OB1B 3LEYL 1YNKH 5E56A 3IU3A 2SEBB 4GXVL 4P4RB 3BWUC 4OBRA 4WO4A 4QHLB 5FGSA 4AM0B 2P48B 1S5IH 4CW1B 2YKLH 4Y4FC 2C4FU 3KG5A 3U0WL 4DAGH 3B4NA 4JDZB 1IZJA 1P7KA 5IBTH 5HGBA 4J2XA 5E99L 5JDSB 1U3HC 2AJXL 5GZNC 1CU4L 4LCIH 4Z8FL 3KJ4B 1MWAA 3QWRD 4M93B 4MA1B 1P7QA 4G6JL 3CFDB 4AH2B 5E8DH 4PRPA 4U1LB 5F9AC 4P59H 2R2BA 3LKPB 3BP4B 3PXJA 4MMXC 3NCCB 2C1PB 1UM4H 4XH2B 4QRTB 3F58L 3L3DB 3WV0A 5E94A 3WIHA 4YHNA 1AD9B 4JFFE 1BVKB 2DQEL 4R4ND 4F9LA 1A7QL 1U8IA 3DXAA 3QEQB 4H5SA 4JO3H 3ALPA 3G5YB 2H9GB 3STBA 3C5ZD 1V7ML 3RAJH 2IBBA 1VFOA 3WS6A 1TITA 1PG7H 2R1XB 1JFQH 4JDVB 4FOMA 1LP9E 1I1AC 3O3AA 2J8HA 4WHTA 2X05A 4XVSH 4XZUA 5CJQH 1HQRA 1XF1A 4MD4A 4YAQA 1NH6A 1ZEAH 1TDQA 2KH2B 1SM3H 2J4WH 3V5HA 4TVPL 4X9HA 1YEFH 3K0WA 2Q76A 5IMKB 4HJJH 4Z7UF 3HCVB 4XP1H 1QSFB 4UBDC 4PJCA 3D5OF 3MNVA 1RIVL 3KLAB 5FDWB 3QUZA 2Z31B 1MUJA 4O5LH 4ODHL 3MRHA 4Z95H 5EBWB 4F57H 5FHBH 4H1LA 3HC3H 4XCFL 5TQ0H 3LV3B 2K7PA 5FUCE 3NIFF 5GRJH 1FNSH 5FOJA 3KWWB 2YN3A 1NAML 1TVDA 3OBAA 4RFEA 2PYED 3VRIA 3HMXL 5CWSA 4HS3A 4UMGA 2IMNA 3WSQL 5I76B 5JHDD 1F00I 5DD3H 1MCQA 4JM2A 1UXSA 5IKCB 1ZT7A 3HPJA 5D7JC 4FXLA 2ZSVA 1Y18A 3STLB 2MHAB 4KV5E 3Q5TA 1A3LH 2YPKA 4JR9H 1F3RB 4KUZH 2VISB 2ORBH 4JE4B 3M17B 4Q6IB 3LN5B 2NZIA 2CUHA 1DLFL 5FFLA 5HYJE 1RURL 4QHUB 4X8JB 5ITBL 3L3OB 2NR6C 1QVOA 1SHMA 3S8WA 1YECH 1DUZA 4LCWA 3VWKC 1X7QA 5ESAA 3HZVA 5FCUH 3P9LB 1HEZB 1LK3L 1FZJB 1KCRH 3OZ9L 2E5EA 3NN8A 3FO0H 3H8NA 3K2MC 2X4QB 3U1SL 5DHVH 5DQ9B 4ZS6D 1YEIL 3I02A 4BK4A 1HH9A 2VQ1B 3F7YA 3OSKA 4MQXD 3BAEL 4TULH 2VAJA 1QSEE 3AAZA 2IPUK 1UCBL 4MAYD 2R23B 4LSRH 4NHUA 1RULH 1U8LA 3DRQB 5FYKU 1NBYA 1RZJC 3TP4A 4WGWB 3PDDA 1YY8A 3QCTH 4GXUN 3N85H 1KJMB 1MQKH 1WWBX 3PP3K 4X6DA 2Z8RA 4Z7QE 4LLQA 4NQVB 3VU2A 2R39A 3MUZ1 2OP4H 1NSNL 1MI5D 2XTJB 3QQ3A 2N56A 3GMNB 4JZOB 5INDA 3QI9D 3SO3B 1G6VK 3GSUB 4UQ3A 1JPSL 4XPTH 3MRKB 1ES0A 5LGHH 5LKNA 1CQKA 1DQLL 1A7OH 1MFEL 3HZYA 1UM6L 1Z5LA 1NGWA 4KK8D 3HC0B 2V7HB 3O9WC 4FQXB 5C0AB 2AK1L 3ARUA 3EOBA 4HV8B 4NQDA 1NC2B 3CU1A 2VABA 1P4BL 3D85D 3VG9C 3NFPB 4UV7H 1U93B 3U30C 5B39G 3BIKB 3CFKA 3RVTD 5MENB 2HLFD 5E2UL 4JFXA 2VN7A 4I2XE 1RUQH 5DJ0A 5DWUL 4OB5H 5C0IB 4IRZL 4IMLA 5FHAL 3KXFE 2FJGB 5KSBA 2EXYD 1NEZB 3JWDH 4I4WB 5D6DC 5EBLB 4WJ5B 3AREB 2CSPA 2P7TA 5D7SH 1D5XB 5SWZB 1MEXH 3B83A 4OKVB 4LU5H 5IHUL 1QHOA 5T3ZE 1DVFB 3NFNB 3W11C 1ZSDB 2HJKA 4LSPL 5CEXB 3GMQA 1BIIB 1A6AB 5DJ2A 5CZXD 4JFDA 4LCUA 3MRDA 1OARH 2VZOA 1KGCE 2UWEF 1EA9C 4J23A 3WS3B 4N0FA 3MROB 1HINL 3QPXL 3RI5F 1R24A 1YEEL 3IKCB 1CGUA 4QHNA 4NQCB 4E41B 1T1ZA 1WV7T 5SWSB 1JYWA 2HVJB 3DMMC 1G7QB 2HG5B 2H2SD 3X13A 4ODSL 3NMEA 3QIBA 1OQOA 3EZJB 5KTEH 2I9TA 3SE4A 4OZIE 3MRIA 5DC4B 2XYCA 1QKZL 4IOSD 4JN1L 1MJ7H 3TO2B 1MY7A 3EJZD 1QFUH 4F80A 1JMZA 2D7QA 4PLOB 3IDYB 3CSGA 4QCIB 2X70B 4MXWH 5T1DH 5F6HJ 3P9WB 2HKFL 2QSVA 5E6IC 3VD4A 1NGPH 5MI0C 2CUIA 1N5AA 1XGQB 1JGVL 5I8EA 4MJID 4KY1L 2OTWB 2RFXB 4PFEA 3WN5A 1S7QB 3E2HC 5C3TA 3QDMA 4G42A 3VXRA 2WBKA 2AEPH 2VNCA 5IGXL 1JPFA 5EZJB 4DKFH 5BV7H 4O58L 3PWPD 1S7SB 4NKDA 3D3VA 1CGSL 1UACL 2XICA 4JCMA 5JOPE 4L5FL 9CGTA 3QDGD 5D70L 1QLEH 3P30L 3VMPA 1GCFA 1EMTH 1AKJA 4CUCA 1AGFA 4JFQB 5DFTA 3QXVA 3GM8A 3OKMB 1D3CA 1G7LB 3TZVC 5GGQH 4TVSa 4Y88A 4MXQD 3KPSE 4Y5YC 3TJHC 4U3HA 1A5FH 1A4JA 1JCKA 1ND0A 2Z91A 2EDBA 1JMXA 1MIEL 4GKOA 4NQEA 1JHLH 4EN3C 1GZQA 3T0VA 2NY1C 1DSFL 2ATPA 1F90H 4OGXH 4LCYA 4PV9B 3SDXA 3MA7A 1BZ7B 1I9JL 3OGOE 5CSZA 4PGBA 4XNXH 2YBRA 4HGMA 1KELH 3EOTH 4YEFA 5EZOL 3QEGL 4JKWA 3NZ8A 2B20A 2GFBA 4NO0D 5J8OA 4G5ZL 3P73B 3TO4C 1IQWH 2Z4QA 1UJ3A 1BM3H 2IF7A 1N6QL 2ICCA 4NUGL 2DTSA 5FGRA 4P5KB 3NCJL 3E6FA 3EJYD 4MA8L 4PTTB 3RY4A 4APQB 3ARGC 1IILE 4NQXB 4IHOA 1A3QA 2W92A 5IMOB 3OKYA 3RIFK 3OWEA 3EZ8A 4YHOL 4DZBA 1MCLA 2BVEA 3VW3H 4JPIA 1KNOB 2FNBA 2AJYH 1EERB 1OGAB 3OXRA 3QJFB 4U1NB 5C0FB 4WUKH 2AXJA 1Z0MA 4JQIH 3DX7B 4D94A 1XIWA 4XX1G 1EBAA 1KB5H 2FATL 3FT3A 4XP6H 3HG1A 3D0LB 3FB7B 4ZUUA 1B0RB 1YYLL 5FGBC 1V3JA 1YEGH 2OK0H 4M00A 3RUGE 4JPWH 2GHWB 4QRUB 4PJAF 4X6BA 3FN9A 3CXDH 3TPUB 2B7DT 3MRJB 2EDKA 1R5IB 1H15B 1FSKC 3VFVA 3LZFL 4TRPH 1QEWA 4XXDB 1X5HA 1F4XL 3ARDB 3MYJB 4WWKB 3WD5L 4JLRB 5A2IH 4U1SA 1K4DB 4UU9B 2VXUH 2D03H 4P2YA 5TDOB 1INDL 2BHYA 3SDDD 4EIZC 5IVZA 1C5CL 1T3FB 2GTZB 3ILQC 2A6JA 5A3ID 1C08A 1IM9B 3BP6A 4NC2B 5ESQA 2NXYD 3ECBA 4K7FB 4K94C 2BXYA 2AGJH 1NBVH 1M05A 4PJCF 3SGDH 1FNAA 3MUY1 3FQNB 2VDQL 5MP6H 4EUPA 3H9SB 1QHPA 3EFFB 4AT6B 3CDGB 4KKBD 4IIQC 3DIFB 1LP9F 3QEHA 4TTDC 4OAWB 1UKSA 4PB0L 5EU6A 2OJZL 1H3PL 4UOW0 4PJIB 1T80A 3IJYA 1BEYH 3WFCL 4JFZH 5DDHA 3TN0A 3UO1L 5GJSH 3T1WA 4HDIB 2CGRH 1X5IA 3TBYA 2AJZB 4JM2F 3T77B 1XAUA 2VZSA 3GMMA 2VO5A 2E6QA 2OL3B 4L29A 1UG9A 1IARB 4RQQA 2VERN 1G7JA 4LSTL 1XGRB 4U4BA 1JHKL 5IESH 4KGJA 4HS8H 3K4AA 3S7GA 1OCWL 1A14L 5D1XA 2ADIB 1HHHB 2VB5A 3X11A 1J1OH 3CH1B 3LKOB 5I71C 1RVFL 3MRQB 3PP3H 2V2TB 1OTSD 4NFCA 1C16A 1T89C 3FHAA 3GMPB 4LLMB 2PTTB 1IC1A 1U3YA 4WFED 4D8PB 5TF0A 2IAND 4P9MH 2DF3A 4PJ7B 1HYRC 3PP4H 4PRHA 3GSNH 2R2EB 2H6PA 2IMMA 4K3JH 3S5LA 3SJVA 3W39B 2BSSB 2YMXH 2W07A 3W0WE 5E2WH 2Y06L 1RU9L 1F3DH 3KDMA 2R0KH 1GOFA 4XWOC 2Z31A 2A9NH 2XA8L 2W1NA 4GSDL 4C4KT 4Z78A 1A1NA 1PJ9A 1G9NH 2APWA 4YWGH 1F2XK 3VXUA 2BVPB 4L8BB 2PYFB 4OQ1A 3LEYH 3QHFL 3NFSL 5ISZB 2NLJB 1T1WB 3L7EA 4GXVH 2W59A 2D9QB 4NFBA 3G9AB 2IGFL 4YUEL 1ZTXL 2ESVB 1IAOB 1NEZG 5DQJB 4V1DA 2QHRH 5FK9A 5GXBB 3T0DA 1NGXB 3CMGA 3FB5B 4Q9QL 1PX3A 1MLCA 1I8IA 4X6DF 1XF4A 3U0WH 4GRLC 3MOAL 3MUGA 4U33A 2X1WL 1EO5A 3LQAC 5AYQA 1JV5B 2VUYA 1JWSA 4P5TD 3GSRB 5IQ9B 4QRRA 4N90E 5DMGD 5E99H 3ZTJH 2P5EE 4JFHE 1INEL 2AJXH 5E1HB 4PBXA 4Z8FH 1MH5A 2HT4C 4NQSB 1FFNB 3BEVA 4LP5A 2NY4C 4GRWF 4WU5B 4U1JB 4G6JH 4JY4A 1CDIA 1CXHA 1P9MA 3H9YA 3X14B 2MKLC 3F58H