1L6XA

Fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION
publication title Mapping of the C1q binding site on rituxan, a chimeric antibody with a human IgG1 Fc.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6xA01
1L0XA 4GS7C 3L5XL 2X4PA 4LLUB 4RCAA 3WSQL 4GBXA 1QUNA 1NEUA 1I4FA 5BW7A 1JPSL 1M7IA 4I77H 5EFIB 4EN3A 5ESVB 4WUUD 3RDTA 3IVKB 3RL2A 3HMXH 5I1AB 5LQBL 4UTBH 3TBYB 1LP9A 4KV5F 5EZOL 4Z77B 2B4CC 5JW5A 4I77L 2DQFB 5EU4A 1BZ7B 4CNIA 4JN1H 1U8NA 3DMMA 4JFEB 2AEWA 1G7IB 3HMXL 1LO5A 3BKJL 1QBAA 2AK4B 3BEWB 4UTBL 4NM4H 2H2SC 5ID0B 4KRMB 2P5EA 4X9IA 5MEPB 3JTSA 3MXWL 2D4DA 2QEJA 2Q8AL 4JVUA 5IVZA 3S36H 1GCFA 2FLBT 2ENSA 3QXUA 1S9KC 1S9YA 3QULA 1A3QA 3MNZA 3V8OA 2DM4A 2IC2A 3HG1A 5FUCC 1MRDL 4HHAA 4BFIB 1BD2D 4W68A 4J8RB 3S36L 5JOPE 1BVKA 2GCYB 4HIEB 2VYRE 1ACZA 4XNZB 3UX9B 4QHMB 4ZSOE 2HLFD 2YXMA 5C0IB 3RWJB 2ADIB 4KI5D 4LLUA 5H94B 2FWOB 5HBBA 2FJFB 1A7PL 4Z7QF 3GHBH 1C7SA 2DM7A 2CKNA 2OXHA 5ENWB 8FABB 4KUCD 5J13C 5EFIA 4ODXA 5ESVA 3K46A 1WWBX 4EIGB 3IVKA 3V6OA 3KS0J 4RMTA 4LGSB 3RVVC 3RZWA 3WN5C 4L4TD 5I1AA 1KIRB 3TBYA 2GSGB 4JREB 2YBRA 4R2GB 4Z77A 1A6UH 2PETA 2DQFA 4ZQKB 1BZ7A 1NUFA 3ALWA 4OKDA 3JWNC 2CR6A 4XNUL 3L3DB 1B6DA 2LE9A 5HI5C 2P46B 4JFEA 4ZG1A 1G7IA 3OPZH 2J88H 4RFNB 2AK4A 3BEWA 5ID0A 1BBJB 3EYQD 2BVUA 1SEQH 3L3JB 3C2SA 3TH4T 4HLJA 1A6UL 3ULVE 5D2NB 5IHZB 5MEPA 2RAMA 4ZS7H 2W9LA 2DLHA 2J88L 4DKDC 2YD7A 2OMNA 2Z0BA 5EO9B 1G9NL 2QHLA 4GRWE 4LP4A 2JK5B 1QFWM 2N7BA 5GXBB 5GGQL 4BFIA 4ZS7L 3KHOA 2P8PB 5HHOB 4J8RA 3RIAF 2GCYA 2NY6C 4K3EH 4HIEA 1IGTB 3BHBB 4QHMA 3VGEA 2DBLH 5C0IA 3RWJA 2ADIA 3ARXA 5H94A 2FWOA 4M9PA 2FJFA 4ZO6A 4DFHA 2DWEB 4K3EL 4H20H 8FABA 5ENWA 3TO4B 4MMZC 4EOWH 4ZUTB 2DBLL 5E9DA 4P9HH 1I9RL 1JFQH 4NO3B 3FO1B 1J0YA 4X9GA 5D7JC 5JORB 1CBVH 4Y16C 2VWEE 1KIRA 2AQ1A 2GSGA 1YQ2A 3MBEC 4G9FB 4PTUB 4ELMF 4P9HL 4ZQKA 2FD6L 3IXTB 3L3DA 4ZAKD 3UJTL 2BDNH 1CBVL 4HBQA 4KGJA 1BBJA 3L3JA 5CP7B 1I7RB 1PY9A 5D2NA 5IHZA 3HCVB 3S97C 4NC0B 2HKFL 4ZO7A 5F70A 4I48B 2BDNL 1KB5A 3TN0D 3HNTH 2X6MA 2GFBA 2VERN 4JO2L 1J10A 1UB5B 5EO9A 1OWWA 4MD5B 4KROD 4FQLH 2JK5A 1DTUA 4TOYH 1NANI 4MS8C 2P8PA 3RWFB 5HHOA 5HYEA 1IGTA 4AIXA 1HHIB 4XWGH 1X4XA 3FL7A 1QFOA 3BHBA 3NH7L 4FQLL 1T7WA 4TOYL 4PD4K 4JLRB 3OB8A 4YHMH 2DWEA 2VL5B 4HLZH 1ZANL 3TO4A 4XX1E 1NBQA 5F71A 4ZUTA 4LOUD 4JFFB 3FJTA 4NO3A 3CXDH 3FO1A 2YUXA 4RZCB 3UTPD 3LRHA 5JORA 5BS0B 4YHML 5K9QI 3QG7H 2NR6C 2GKIA 1ZLUH 2DKSA 4G9FA 4PTUA 3IRZA 2QJDA 3LKOB 5KSAB 3BP6B 1UWXK 1FNFA 3IXTA 2VC2H 2X5PA 5EU3B 4M00A 3TH3T 2YR3A 5IV2B 1I8IB 5FYKH 1XF5B 4LP5A 5JUEL 5CP7A 1I7RA 5M95B 3BKYH 3HCVA 1VERA 4NWTH 5CKGA 2VC2L 1B2WH 3ARBB 4I48A 4KAQH 2R1XB 3VXMB 1MFAH 2DKUA 5TE6H 1D9KD 2YD8A 1UB5A 5HVWA 4MD5A 2VXTH 4JFQB 4NWTL 1GZPB 3OJMB 3HAEB 2MCG1 1B2WL 3RWFA 4WI8A 4M48L 4WO4C 5TE6L 1MCRA 1HHIA 2ERJB 1G9NC 5DK2B 3D0LB 1SMAA 3HC3H 5JO5B 1UXWB 3DHMA 4PS4L 2VXTL 1EHAA 4LARL 3DECA 1EH9A 2XTJB 4JLRA 3T65B 1G6RB 1QQDB 3FCTB 2VL5A 3O0RL 4UV4L 4WUUE 1IBGH 3VMOA 4R26H 4AEFA 5B8CB 3HC3L 1QVOB 4JZJC 3CSGA 3TA3C 3AREB 4JFFA 4MXVF 4Z9KB 1SY6A 5FGBA 4RZCA 2DMKA 3UBXB 5CILH 5BS0A 4N8VG 1IBGL 1FGVH 3O2WH 4EEEA 2OK0L 4R26L 1NMCC 5C09D 4K3JL 1F4HA 1ODAA 4N1HB 3TVMB 4V2BA 2F8XC 1ZA6A 3IDMB 3P0GB 5IB2B 2VN7A 3HNVH 1GGUA 3LKOA 3BP6A 5KSAA 1W8OA 5CILL 5DT1H 5EU3A 4LSVL 1FGVL 3O2WL 5IV2A 1I8IA 4RRPG 1XF5A 3U4AA 3EDFA 4P9HC 3RTQC 3HNVL 2VXQH 3GRWA 3VDAA 2GY7B 5DT1L 3KPTA 3ARBA 3VXMA 2R1XA 4LRNH 5D6CB 3C6LB 3B9AA 1BD2E 1B3JA 2CMRH 2EEAA 1YDPB 3VRIB 4IMKA 4JFQA 4LSQH 1JWSB 1GZPA 4BUHA 2VXQL 3HAEA 2XN9D 3O41B 3QNYB 1TETH 2EDFA 2VKWA 4AQOA 1MVFA 4J4PC 5FUZL 1UWXH 4KI5E 4IHOB 4PJAB 1KCVH 5DK2A 3D0LA 5BV7H 5JO5A 2RQ8A 4M1DH 4XPFL 4LSQL 3WEXB 2ZOLB 2YXFA 5DK3A 1TETL 3RIFF 3T65A 1G6RA 1QQDA 3BJ91 3FCTA 2Z8WC 3MV11 3OAZK 3V0WH 3EOYG 5B8CA 3SGDH 1QVOA 1MJJB 5E6ZA 4M1DL 5GRUH 3MRHB 1J9CT 4NCDA 3UBXA 3QUXB 2ZNWA 3MLRL 6FABL 3TVMA 3ILPB 5GRUL 3IDMA 4GG6B 5F1OB 1UACH 5IB2A 4NQDE 5KANG 5DFVD 3UAJD 1CQYA 4N0CD 1FAKT 1Z2KA 3MRPB 2CUMA 4HMDA 4MA8H 2XKSA 2RJMA 4I18C 1MPAH 1T1ZB 3D5OF 4HWBL 3V5DB 1UACL 3RGVB 2A6IB 1PBYA 5D6CA 1SBSL 3SY0B 4EUPB 3BD3A 4ZOEA 5FGCB 2FZ3B 1YDPA 2Q86B 3VRIA 4MB4A 1JWSA 1WUNT 3O41A 3QNYA 4R96B 3AS2A 3OSKA 4DUVA 4IHOA 4PJAA 1J0IA 3C09B 2DQGH 1X5XA 1LK3H 3WEXA 3OR6B 1NJ9B 2ZOLA 3HB3C 3VRLF 1G7PB 3PWLB 1L6ZA 15C8H 3K2MC 4F7TB 1QFUH 1WFNA 2K7QA 2A9ML 2L7UA 2DQGL 4ODWB 1HCFX 1MJJA 3BGMB 1KB9K 4BJLA 1KLUB 3MRHA 4N9GB 3RKDC 3QUXA 3GI9H 5T3ZL 3T2NH 2WBJC 1RK1B 3ARGB 3ILPA 4GG6A 4UNVA 4H8WL 1PAMA 1FSKB 4PG2A 4HULB 3MRPA 3QYCA 3BDYH 5IOPB 3GI9L 3FONB 3BPCB 2E6JA 4JVPA 3QWRD 3OAZH 3GSWB 1T1ZA 4BFEA 4XZUB 3V5DA 2Z31C 5F3HB 1NAKH 3RGVA 2A6IA 4L4JA 1KJ2H 1EO5A 3BDYL 4MAUH 3ARVA 3SY0A 4EUPA 1F3JB 4HXBH 2FZ3A 1AC6A 2PR4H 3RWEB 2Q86A 3WIIH 2NNAB 4GRLB 4MJIB 1KJ2L 1DN2A 4R96A 4GKNB 5IK3B 5JIHA 2BY0A 4KK9C 4R6UA 4GMSH 5B3JF 1NMBH 2PR4L 4DK6A 3WIIL 3OR6A 1NJ9A 5IG7B 3H3PL 4FABH 1G7PA 3PWLA 4EDWL 4F7TA 1WBYB 3UTPE 4GMSL 4ODWA 1NMBL 4K71C 1KLUA 4N9GA 1P4BH 4FABL 4HFUL 3C5ZC 4Q58C 2HMIC 5T1LB 2YN3A 4ZNCD 1K5NB 3ARGA 4F9PA 3MOBH 1KYOK 4ZXBC 1P4BL 3CSYB 5HYQB 1DR9A 2Q8BL 4WDIB 5IOPA 3FONA 3LRGA 3BPCA 4P3WA 2I24N 5IBTH 4XBEH 5JXEC 1MIEL 3VCLB 3WS3B 5LVEA 4G8IB 3GSWA 3OHXB 4XZUA 5F3HA 2WQ8A 4IDJL 1P6FA 4CW1B 3ULUD 2NY0D 5IW6B 2OSLB 3LKQB 4WUKH 5I1JH 3ULVH 1F3JA 4XBEL 3GJFH 3C60D 1DQQB 3RWEA 1F97A 1OCWH 4NNYB 5FDYA 4G8GD 2NNAA 4GRLA 1J87A 1FZJB 4MJIA 3BDXA 3O3AB 1NGXB 4GKNA 4WUKL 5IK3A 4APQC 3ULVL 4GRWH 1CICB 4X6DE 1YEEH 3MMEB 2L4OA 4U3CA 1XF2B 2FEEI 1OCWL 5IG7A 3EFFB 3CH8A 4V1DD 1TJGH 5I71C 4YGVB 3K4ZA 1WBYA 1T4KB 1YEEL 5D96C 5E4EC 3V79C 4RBPH 2DTSA 1U8OB 4KKBC 5C6PB 5C09E 3JTTB 4HCRA 2CDEB 3ROLB 3VWKB 3O6KH 5EDXA 3RVUC 2VB5A 5T1LA 4FQIH 1WZ1H 5DD6B 3ARPA 1K5NA 3UTZB 4OGZA 1DCLA 1K4DB 3CSYA 3P11H 5HYQA 4WDIA 1GGBH 4FQIL 5DHVB 2X10A 3PGDB 4AJ0A 3LPFA 3VCLA 3WS3A 4AEHH 4G8IA 3OHXA 1RIUH 4WHYH 4CW1A 4H8WC 3P11L 1ROWA 5IW6A 2OSLA 1GGBL 1RURH 3LKQA 4QRRB 3OR7B 2C3HA 4PGJA 5D72L 4AEHL 1B9ZA 3WE6B 1DQQA 2IFFL 4NNYA 3P4LA 3VH8B 1EEUA 5HHME 1FC1A 2P42B 1FZJA 4R97C 2BOCB 4S2SB 3RBGA 3O3AA 1RURL 4N1CA 2E27H 1CICA 2H2PD 2ZUUA 3MYZA 3MMEA 3G04B 1XF2A 5D1XB 3EFFA 1DSFL 2RR3A 1HNGA 3H42L 1ULVA 4YGVA 4N8PA 5FEBA 4ZOCA 1IEBB 2ED7A 4MCYB 3SEPA 1T4KA 4DN3H 1HDMB 1J18A 4KMQA 1BOYA 3OKDB 1JHTB 3MQIA 5DVKA 1U8OA 4ZUVB 3JTTA 2CDEA 3ROLA 3VWKA 5DD6A 3JUYA 4R8WH 1NAML 3U82B 3UTZA 3M07A 4GJTB 2OTWB 2ZUTA 1C16B 3PL6D 4JKWA 3EBAA 4FQXC 2ZSWB 1K4DA 5L2KD 2D7MA 4RGOH 2VZOA 5DHVA 4KVNL 4KJWC 4LASH 2A38A 3PGDA 4R8WL 3WDIA 3FFDB 4K3HA 2NXYD 2BSED 1H3UA 1YC8A 2F8OA 3EOTH 3K1DA 2M26A 4E0RB 3UPAA 4B0MM 3VFRB 4HKXB 5E8DH 2HTLC 1X5GA 4AIOA 1A7RH 4QRRA 1EFXB 3OR7A 4LASL 1FE8H 5CBAB 3SE4A 4NQXB 3D9AL 4M5YH 5BOPA 3WE6A 3OV6A 4D94A 3MRLB 3VH8A 4PJXB 2X4SB 5E8DL 2BOCA 4S2SA 4XCFH 1A7RL 3DUUB 3AY4C 4HF5H 1QG3A 1D5IH 1EJOH 4L9LB 2EH8L 2Y5EA 3G04A 4WGWB 2DDQH 5D1XA 4JVWA 4Y1AB 4L5FH 1WEJH 1U3YA 1ZHNB 4HJJL 4XCFL 3WFDH 1IEBA 4MCYA 3ULVC 1D5IL 1EJOL 1HDMA 2YEZB 3OKDA 1JHTA 2ICCA 4L5FL 3ZYOA 4L4VB 2NY2C 4ZUVA 3QNXB 1KTLB 3ZKXB 4LL9A 3E0GA 4WI6A 3WFDL 1FYTE 4KJQD 2YS4A 3S37L 4Y2DD 2AK1H 3QIUB 4KVCL 3BT2L 1GJIA 4BQ8A 2OTWA 1C16A 3TJHC 1HH6B 2ZSWA 5FM8A 1ZOXA 4OLWH 3O3EB 5FM5M 3FFDA 4HAGA 2EDLA 4XMPL 4I2XB 5E6YA 4I8DA 3VFVB 4C56A 4E0RA 4XP4H 1TLKA 1RZ7L 3VFRA 4DKFL 4HKXA 3EDDA 1B0GB 4OLWL 1EFXA 3BD4A 1MLBB 5HI3C 5CBAA 2ESVB 4NQXA 1XF4B 2NXZC 3MRLA 4OM1L 3IB4A 2X4SA 3B6SB 4NKDB 2VWEC 2J6EL 1MCIA 4MA7H 3DUUA 1HYSC 5HVFB 2QADD 1YZZA 4TRPH 4L9LA 2R2EB 4HXAL 2BHYA 4Y1AA 5GS0D 3I2CH 4UU9B 1CFNA 4X4YB 1HILB 3QXWA 1ZHNA 2BNQD 4X9HA 3OQ3B 4TRPL 1A1NB 3O2DH 4Y88A 5T33H 2YEZA 3QHZL 4L4VA 3QNXA 1CCZA 1X4ZA 1KTLA 3O45B 2VMFA 4R4NC 2R29H 3PWPE 3O2DL 5E0QA 4FNLL 3QIUA 1WT5A 3BDBA 5T33L 5J3HD 1WITA 2P5WE 1XFPA 4KHTH 2E7LA 2BJMH 3I6KB 1KPVB 1HH6A 1HINH 1EHXA 3IAQA 1P84J 4P3CH 2LABA 2R29L 3ULUE 4I2XA 3VFVA 3HZMB 5CJOL 4KHTL 2BJML 1HINL 4LSTH 4P3CL 3ARTA 5TDOB 4JRWA 4X6CF 1B0GA 4OCNC 1MLBA 5CJ8A 5D4QA 1X5AA 2ESVA 1XF4A 2IAMC 1BEYL 4ZTPH 2GK0B 3B6SA 1TTFA 4NZRH 3ROOB 4NKDA 4LSTL 2P48B 1L7IH 1DQLL 1NFDB 5JIIA 4KJPC 3I3DA 2R2EA 2DTML 1FNAA 1JUFB 1EBAA 4ZTPL 3SDDB 2UWEE 3MLYL 4NZRL 4UU9A 4X4YA 1HILA 3UTSD 12E8H 3E8UH 2C9AA 5L2JB 3HZKB 2FGWL 5BVPL 1JRHH 5I8KH 1A1NA 1CQKA 2X7LB 4XBGB 2Y06L 1BQLH 4GT7A 1T22B 4JM2C 4DN4L 4IJ3C 3O45A 2ZWLT 3QFJE 4PRDB 1JTOA 4OLXH 5C08D 5GGRB 3VGAB 5SWQB 3RUGF 1BQLL 4HQQH 3IKCB 1FFNB 3I6KA 4Q0XH 1KPVA 3GSOB 3KS0H 1BZQK 1JZ5A 3HLAB 5F88B 4TSAH 2QHRH 5I1DB 5JZ7D 4UT7L 4TN9A 2DQEH 4U1LB 1Q0YH 3I9GL 2D0HA 3HZMA 4DGYH 4Q0XL 5CWSB 2WWMC 2JB5H 4P99A 2DRUA 5E94B 2HVKB 2X89A 4TSAL 2QHRL 1KN2H 4OCWH 2DQEL 4PB9H 3ZMRA 3HE6B 4NRZB 3EYUL 2ZUVA 3PHSA 3ZHLA 2GK0A 3ROOA 4IIQB 2X41A 2EO9A 3TEUA 4KK8D 2MSPA 3P2TA 1NFDA 1KN2L 1NLDH 1T83C 1CLCA 1QD0A 4PB9L 4KDTC 4ONGH 2A73B 4F15B 1JUFA 2X1XR 3SDDA 3PP3H 5KVGH 4F3FB 1T66D 3J8F7 3G9VA 5L2JA 4RAVB 3HZKA 4FQCH 3SKUD 1NLDL 2PKDA 4ONGL 4HS6B 2X7LA 4XBGA 2X2YA 5E6ID 1T22A 4MYWB 2R69H 4IEFB 3F65A 4PRDA 1FO0B 4FQCL 2LVEA 5SWQA 5GGRA 3I84A 4JFPB 3IKCA 1FFNA 5H35B 3GSOA 4GAJH 4DOHB 3H7LA 4RDQG 1BIIB 2R69L 4P0DA 3HLAA 1FG2B 2XXMB 5F88A 5I1DA 4U1LA 4TPRL 4X9BA 1LE9B 3FN3A 2YOCA 4GLRI 3QR2A 4GAJL 5CWSA 3MJ7B 5FM5O 1A3LL 2OLDA 5E94A 2HVKA 5L88H 4NO0D 3TBTB 5DMGC 4NKIH 1KB5L 1T03L 4NRZA 4NT6B 3VXSB 4JDZB 1EZVX 2CD0A 4CMMB 5LBSH 1H8NA 4IIQA 2EEBA 4U0RB 3S98A 3WUWB 5IHLB 5L88L 1EERB 2IAND 4B7LA 4CJ1A 4HZLB 4P4KC 5I1KH 1YEHH 1DQMH 2A73A 1GHFH 5LBSL 2E7BA 4F3FA 3O3UN 3QIBB 3KYNB 4RAVA 3IT8D 4HS6A 5IQ7H 1YEHL 1GHFL 4HJ0D 2W65B 5A2JH 1WC7B 2J5LC 5D1QD 2QR0B 3QUMH 3D2UB 3UPCA 1RJLB 3ARDB 3L7EB 5C07B 4Q9CA 1FO0A 3HI1B 2ATKB 3Q6GH 5JA9A 3WIHH 5AG8A 5BO1H 3ULVF 4JFPA 2CR3A 5H35A 3QUML 4C54A 1XR8B 1BIIA 1BX2B 3HNSH 3N1MC 4RGNB 1T3FB 2AXHA 1FG2A 1A3RH 3V6OC 5DRZB 3QA3B 3Q6GL 4HIJB 3WIHL 1LE9A 2ZG2A 4U1NB 2SEBB 4PJ8D 5KG9B 3SE3A 3VFOB 4U7SA 1R24B 4NT6A 3VXSA 1FNGB 1AGCB 1F90H 1YEIH 4JDZA 4CMMA 3LKPB 5C3TA 3MZGB 3O6FD 4ALAH 3WUWA 4HUKB 2D7PA 3CDCA 4ZAKC 5F1IB 5CJXA 2CO6B 2VIRB 2XKUA 2NYYD 4HZLA 3OG4B 1ZLSL 2VDKH 1YEIL 3PNWB 3MRCB 1YECH 3QIBA 1PVHA 3KYNA 3MJ9A 3TN0C 2PXYD 2VDKL 2W65A 1WC7A 5F6HI 4HUMB 1T21B 3D2UA 1RJLA 3DXAD 4KROC 3ARDA 3L7EA 5D7IE 4U49A 4LU5L 5C07A 5K9KB 4LCWD 3HI1A 3O2VL 2ATKA 4FQPA 5BXFB 1T89A 4PJBB 3DWTA 1LO4L 1XR8A 4ZFZB 3VI3F 2EC9T 1T3FA 1CYGA 3D3VB 3UYRH 3FN0H 4KKNA 5DRZA 3QA3A 4AZ8A 2VLMD 4HIJA 1PKOA 1IILE 3LMJL 3C8KB 3WXWH 4R2GC 3AVEA 3H3KA 4U1NA 2SEBA 2FDBP 4QXWA 1AGBB 3FN0L 3UYRL 1RUQH 4GQ9H 3X17A 2HP4A 3VFOA 3T0EE 1R24A 1VESA 3VXUD 1FNGA 1AGCA 3LKPA 1A7NH 5I8CB 4U6HB 2YRPA 2XQBH 3QDJB 5F1IA 4GQ9L 2VIRA 4Q7DA 4XCCH 2BXYA 3UTSE 1QLEH 5J57B 2CIIB 2DLEA 2O5XH 4HIHB 4YGAB 3PNWA 3MRCA 1JCKA 4U33A 4ODVH 3VFGH 4FTVE 4Q6IC 2Y72A 1M1SA 2B20A 1D9KC 1Y6MR 1I8LA 3HAEG 1JPFB 3A67L 5C08E 1CD0A 4ODVL 1K6QL 5K9KA 3BIBX 3VFGL 3RDTD 3N85H 5BXFA 3GBML 5IESL 4UOJA 35C8H 1CR9L 4PJBA 2KH2B 3L3GB 4ZFZA 3U30C 4XAWH 4NUGH 4P2OD 4JM2F 4YFEA 3D3VA 5I75C 3N85L 4HS8H 5GGSB 35C8L 4F7PB 5C2BH 3ALPA 3C8KA 3T2QA 4NUGL 4PY8J 2P5ED 4WV1C 1U8PB 1AGBA 1A6WL 4HUNB 3EYSL 4N8CH 4HS8L 5TDNB 5FCUL 5DD5H 5C2BL 2AJXH 4JRXB 2BCKB 2DQCL 1KBGH 3RQ3A 5I8CA 4U6HA 3VFTB 3QDJA 3FN9A 5FB8B 5MEOB 3T2PA 2AJXL 2CIIA 2WP3T 4HIHA 3D6GA 5KZCB 1NGPL 5B3NA 1U3HD 1N8ZB 3KPSB 4NN6B 4XNQB 5F1NB 4E41D 5E1AB 4QOKD 4O5LL 1JPFA 5HGHB 2EH7H 1F00I 1Z6JT 5TFSH 2EC9U 3CFIC 3CFCH 3KR3H 5DJ0B 3R8BB 2IG2H 1I1YB 3L3GA 4B5EA 2X1PA 3L5WB 1OAXL 2W07A 2EH7L 4JJ5B 3D0VB 4YBQD 2EEDA 5GGRY 4E42B 1UH3A 4RMSA 2XZZA 3CFCL 5KSUB 3KR3L 4BK4A 5GGSA 5CD5D 1VKXB 2IG2L 1OY3B 4PJ7B 4F7PA 2HH0H 4JFHE 4KU1A 5EUOE 5D2LB 1F4AA 1DEEB 5C0CB 1U8PA 2BVOB 4PJ9D 3ULUH 1ZWIB 2F58H 5KSAC 4KI5F 5TDNA 1ITCA 4Z18A 1T04B 2ZCHL 4JRXA 2BCKA 2IANE 4PJGB 3INUL 1LP9F 4OZFB 3F58H 4O00A 3ULUL 5DFVC 4KUCF 3UAJC 3VFTA 5FB8A 4IOFD 5MEOA 1N5YH 3U2SB 2IPTH 3BGFC 1CXKA 2D31B 5AG9A 1BJ8A 3A6CL 1A0QH 3F58L 3KPQB 4IMKC 1JPTH 3BZDA 2EDBA 1N8ZA 3KPSA 1P9MC 4TVSa 5D1ZB 4XNQA 3TC9A 5F1NA 5E1AA 5LCVH 1EBPA 1UENA 2IPTL 5DEGB 4LIQE 5HGHA 1W72B 4DGVH 1A0QL 1JGVH 3WFBH 1JPTL 5SWZE 4N0FB 1UQSB 5DJ0A 5LCVL 4MAYD 4EDXB 4UOW1 1I1YA 3NBNA 1RZFL 1G9EA 4LCYB 4H0HB 1MELA 4RMUA 1IL1B 3L5WA 4DGVL 1DUYB 4JJ5A 3D0VA 4LSPH 3BPLC 3WFBL 1IT9H 4E42A 5IMOB 4AENB 4K7FB 4OB5H 2V17H 3SDCB 4ENEC 5KSUA 1LD9B 1QSFB 4OCRH 1VKXA 4PJ7A 3FRPA 3NA4A 5GRJL 1KELH 4Y8AA 5D2LA 4LSPL 5C0CA 1DEEA 1FBIL 4OB5L 2V17L 2BVOA 4S1DD 4XMLH 1ZWIA 3L6FB 5KVDL 4OCRL 5L0QB 5GIRB 4UMGA 4OLYH 3V7AG 1KELL 3B9KD 1T04A 4PJGA 4MQTB 2IMMA 4OZFA 5DMYA 2BVYA 4R9HA 1Q38A 3NCEB 3BP4B 3BX7C 3U2SA 1FGNH 1NGWB 2D31A 3S4SB 3WLBB 5KVFH 3ETBF 4GAFB 1MJ7H 1WK0A 3KPQA 1BVLB 4K7PL 1DQJB 3P4NB 2DQHH 1IEAA 5D1ZA 1JIBA 3DXAE 3LVEA 4HX1B 4MA3B 3ZKMC 5DEGA 5KVFL 3S88H 1W72A 1X7QB 4HUXB 3WNPA 1TITA 4CDHA 4N0FA 5CBEB 1J1OH 1UQSA 2DQHL 4WFHE 5K9QG 3GM8A 4EDXA 3DTXB 4LCYA 4PV9B 3WCYA 5J0BA 1IL1A 3S88L 3NPSC 1DUYA 3DVFA 5E2JA 1N5AB 1OD9A 5IMOA 4AENA 4K7FA 1WZMA 3SDCA 1J1OL 4EZMA 1LD9A 1QSFA 3LQAL 5I16B 1VACB 3QUXC 2A6DB 4LPXA 4FA8A 1LDPL 3PHOB 4YLQT 4YFDB 5F7YC 1WISA 2DIBA 3LB6D 3HE7D 4LMQI 2FH8A 3VXUE 2CXGA 2H3NB 4W4OC 4JANB 5GIRA 3CD4A 1FAIH 4ZUWB 1B0RB 3GIZH 5DZNA 3I6LD 1RIHH 3OKMB 2DM2A 5KSBF 3BPOC 4C57C 3BP4A 4HBCL 2C4FU 1FAIL 2HT4D 3PGCB 1NGWA 3S4SA 3WLBA 3EOBB 4NQCB 4RA0C 3ULUC 4PJ5B 1BVLA 1FRGH 1DQJA 3P4NA 3DOSA 4PP2B 5D7LB 4HX1A 4MA3A 5CFHA 3FO9B 1YY8B 3C60C 4XVJH 1QRNB 1X7QA 4HUXA 4YHNB 3W0WD 2FB4H 1LO2H 1FRGL 5CBEA 2UUDH 4WCYH 3DTXA 4PV9A 4OAWB 3I6GB 4XVJL 5DMKB 1N5AA 1DVFD 3ARUA 1FNLA 2FB4L 1LO2L 4NZJA 1ZS8B 2EE9A 1BM3H 4WCYL 4JR9L 3CNKA 4OCLC 2UYLB 4UINL 5I16A 1VACA 1CWVA 2A6DA 2P5EE 3PHOA 1SYSB 4PRID 1OL0A 2BHUA 4NRYB 2H3NA 4JANA 1FPTL 1UFUA 5HTSA 3OTTA 3K8KA 4ZUWA 1BBDH 1B0RA 3HG1E 5MP6L 1S5HB 3JWDL 5MHSD 3GMPB 2E8YA 3EDEA 4HD9A 3NN8B 3DGGB 1RZJH 4DQOH 3OKMA 5HY9B 1KIQB 3PP4H 4X9FA 1QSZA 3PGCA 5B39G 3RPIB 2QSQA 2HLAB 3NIFF 3V7MA 3EOBA 1WTLA 4NQCA 4E41E 1PG7X 4DFIA 5GS0H 3JBG7 3PGFH 4PJ5A 4U31A 3BMVA 1RZJL 5MENB 5DD3L 4PP2A 5D7LA 4HGWB 4LSDA 2VISB 3PP4L 3QUYD 3VH8G 4U0QB 3FO9A 1YY8A 4G80B 5FA4B 1QRNA 4YHNA 5GS0L 3PGFL 4Y4HD 4NN7B 1RUMH 3ARED 1OP5K 1JTPA 1ZVHA 3MA7B 5CZKA 3QZWB 4G6MH 3I6GA 1FL6B 4OAWA 2H2PC 1UXSB 3T0XA 3CPLB 3NZ8B 5DMKA 4UTAH 2DI8A 1ZS8A 4JFEE 2VLJA 2XG4A 2AK4E 2IBGA 4LFHD 2UYLA 1JYXA 4PREB 2W59A 4XVTH 2D03H 3WNLA 4G6ML 5GGSY 2WUBH 2XRAH 1CD8A 4WWID 1SYSA 2YC1B 1XGPB 3T0VA 4Z7VF 3TBVB 4NRYA 1CK0H 3LQAC 3HI6H 4XVTL 3KPRB 2J1KA 1UM4L 2WUBL 3BJLA 3C6LD 1S5HA 4X8XA 3GMPA 1NLBL 5EU5B 3PL6C 3NN8A 3MLXH 3DGGA 1CK0L 5HY9A 1KIQA 4XB7A 3RAJH 1T0PB 3JV4B 4J3VA 3VW3H 3RPIA 2NXYC 5TE7L 1WWWX 3KHQA 2HLAA 3AUVA 1GL4B 4WWKB 1MWAH 3MLXL 5B22A 5MENA 4HGWA 3BISA 3EOAB 3RAJL 5FO7B 2WNGA 3GBNL 1I9JH 4G80A 5FA4A 1D3CA 3BZEB 3CX2A 1MWAL 5H37G 1CFQB 1K9TA 1KSRA 1BWWA 4HW6A 2I26N 1K2DB 3MA7A 1HEZB 3QZWA 3IFOB 3FO0L 1FL6A 1SJEB 1UXSA 3CPLA 3NZ8A 3X13B 2ITDA 3EDJA 4FQHB 2ZCKL 2EDEA 3WFEH 4PYHA 4PREA 4QGTA 2WZPD 1MCKA 5I0DA 5LGKA 5D2NE 2BMKB 3SJVD 2VSDA 4JHAL 2YC1A 1XGPA 1P7QD 3X11B 4NQEB 3TBVA 4ELMB 4M7ZC 2AVGA 3WFEL 4NKQB 1AE6H 4U1MB 2A74B 1OP5H 1XZ0B 3KPRA 3QXVA 1BVZA 2Y1VA 4HMEA 4QF1B 5J6HB 4YAQB 2B1AH 4Y2DC 1Z5LB 5EU5A 3VXTB 2FX7L 3LKSB 1XIWD 5HHOE 2Q6WB 5ISZB 4FP8H 2R0LH 3JV4A 1RIVL 1Z9SA 1R3LB 1VCAA 2VNCA 1CXFA 2B1AL 3H6JA 3JWDC 4WWKA 2J8HA 3IRPX 3EOAA 3LOWA 4FP8L 5FO7A 3MFFB 2R0LL 1FZOB 1AR1D 1E4WL 2QQLH 4BSWB 3BZEA 2IWGA 1AJ7H 1CFQA 3MRRB 5CSZB 1RZJC 2IQAB 2A1WL 1HWHB 1K2DA 5K33A 4MNQB 1RJCA 3FB6B 2AABH 3O4LB 1HEZA 3OAUH 3IFOA 2QADC 1MQKL 5TE4H 1SJEA 1ZT4A 1BMGA 4OBSA 3X13A 3T3PE 2ZUQC 1Y6KR 5GS0C 1OTTD 3ARGD 1S3KH 2WUCH 3CFEB 1YNKH 2G9HB 4FQHA 5I8OL 2AABL 2E9IA 4PY7B 43C9B 1LVEA 1F6LL 3T04D 1EFQA 4U2YA 2NLJB 1UWGL 2BMKA 4ZOBA 2OI9B 1CLYH 1P7HL 3X11A 2XNAB 4NQEA 4ELMA 1S3KL 2WUCL 2VJXA 2KPNA 1YJDH 4U1MA 2A74A 1XZ0A 2OL3B 3I6LE 4QF1A 5JXAH 4YAQA 2DICA 1KCUH 5IIEB 1Z5LA 4P2QA 3VXTA 3LKSA 2YD3A 1CS6A 4P2RB 2Q6WA 1HSBB 4PRPB 5IFAH 3WKNA 5ISZA 4CN6A 5DR5H 2AJVH 5EUKB 1R3LA 1CZ8L 2BERA 1E4XH 2JE8A 2LVCA 1A1MB 2EIDA 5AD0B 5F9WB 5GRWA 4XP6H 3TYFB 5DHYB 4ODHL 5IFAL 1KJMB 1UKSA 4XT1C 3MFFA 3F8UB 3W0WE 2AJVL 1FZOA 4OQTL 4R90H 2G5BB 3LDBC 1TJIH 3SDAB 4BSWA 1T1XB 4MNHB 1U41A 1KOAA 3MRRA 5CSZA 2IQAA 3BPNB 1JPST 4MNQA 3FB6A 3O4LA 3ULUF 5GQBA 2CLRA 5E8EB 2YPLB 4DK3A 4R90L 4ETYA 4Y5YB 2X40A 3ZL4H 4TYUA 2YUVA 4N1EA 1JJUA 2F53B 2PNDA 1GH7A 3CFEA 5D70L 2G9HA 1V05A 2W92A 3QO0B 1MHPH 4PY7A 4PRIE 43C9A 4GS7B 2NLJA 1EA9C 5E5UB 3VGDA 3VXME 2XNAA 3WLWD 3LS4H 4F57H 5MHSE 1MHPL 1C12B 2YWYA 4I4WB 2OL3A 1U8LB 1S7SB 5IIEA 1QSED 3SCMD 5LJYH 3RX8A 3J7HA 1U42A 4P2RA 1HSBA 4PRPA 3RWGB 3LS4L 4RMWA 2R2BA 3OF6A 1IM9B 5JZ7C 1UEYA 4U1SB 1Q0XH 1S78C 1UJTA 5EUKA 5CINH 2W38A 3B2UC 2AAVA 5DVOA 1A1MA 3BP5A 3LZFL 2ZG1A 2XTJE 4XP9H 5AD0A 4DGIH 3VMNA 2DLIA 2NY7H 1IZKA 3TYFA 5DHYA 1KJMA 4JDTH 1EO7A 5GHWL 2O26U 2G5BA 3MROB 3SDAA 5CINL 3FRUB 1T1XA 4MNHA 5J12C 1N4XH 4DGIL 2NY7L 4BZYA 4KK8C 4JDTL 5IJKC 3KPMB 1B4JH 1ZSDB 5E8EA 2YPLA 4PJEE 4Y5YA 1SHMA 3BW9B 4KUZH 2F53A 1N4XL 4X4XB 1IEHA 3QO0A 1ZLVK 3UP1A 5E6IC 1MCQA 5E2TH 3WJJA 1F8TH 2EDTA 1C12A 1LHZA 2FBJH 5J13B 3PQYD 4I4WA 1E27B 2V5MA 1U8LA 1S7SA 2HRPL 1EGJA 3WYRA 2DJUA 1DQDH 3SKOB 5E2TL 4NHUB 3RWGA 1IM9A 1F58L 3RNQB 2FBJL 4U1SA 4YWGH 3NIGE 4KZDH 2YZ8A 3NIDF 5FYJD 2R8SH 5INDB 5TQ2H 3U4BH 2P49B 3ZDXE 3V5HB 4QTHB 3RVTC 3NTCH 4YWGL 3E3QC 5C0RH 5J11B 4KZDL 2O5YH 4H0GA 3FRUA 3B9VA 1MRFH 4OF7A 3MV8B 5DMJB 4U6XB 3KPMA 3DX7B 1ZSDA 5C0RL 2O5YL 4GG6E 5T5NG 3BW9A 2YD5A 5CLTA 1MRFL 2NY6B 3KJ6H 4HMCA 4P48A 4X4XA 2OR9H 3SJVE 2QSCL 2DQDL 2E9JA 1FCGA 3CVHB 2NX5A 2YPVH 5I6XC 3LKRB 4HJ0C 3H0TB 3SKMB 3VGAC 3KJ6L 3NMEA 2OR9L 1T2XA 3ZYJA 2Y5TB 5T1MB 4NFBA 5FGCE 1E27A 5B4MD 2YPVL 4GKOA 2D3VA 1XH3B 3OZ9H 3SKOA 1J0HA 2NY1B 4NHUA 3QCVL 1ONQB 3MBEB 1GAFH 1FJ1B 3RNQA 3E6HB 3U7YH 2XZCH 2DLFH 2GTZB 4OFDA 3OZ9L 5INDA 1R6VA 1AIFB 3V5HA 4QTHA 1GAFL 4IIQC 3WNMA 1X5FA 2DLFL 1MNUL 1MJUH 5F7FA 3MV8A 3DVGB 3SOBH 4U6XA 3O6FC 1HYRC 5DYOB 4KTYA 2EDHA 3DYOA 3DX7A 5I1GH 2NYYC 2VXSH 3V7AE 5F9OH 2CUHA 1DANT 3Q2CA 5KAQG 1MJUL 1S8DB 1RHHB 1A6VH 1NCDL 2ORBH 2Q7NA 5IT2H 2AKRB 4Y4FB 3CVHA 2A9NH 2DQIH 2VXSL 3DBXB 4KPHL 2PXYC 3LKRA 5JW4R 3H0TA 3SKMA 1M05B 3OKYA 5F3BB 2ORBL 2Y5TA 4QRPD 5ESQB 5T1MA 5FDWB 4QWWD 3VD5A 5FYLD 2A9NL 2DQIL 2CUIA 3STBA 4U4BA 1MLCB 1XH3A 3QNZB 3AROA 3TV3L 1S7RB 1ONQA 3MBEA 2WM0A 1FJ1A 3E6HA 1QFHA 4M6OH 3LAFA 5I18H 2GTZA 5L8KB 2V7HB 4XVUD 1CVRA 4Y19B 4KKAD 3I3EA 5D7IF 4OD3H 5LAXB 1MCWW 1AIFA 4DCQB 5B38B 2ITCB 4U1GB 1K3IA 2ZPKL 4M6OL 5I18L 1OAQL 2HVJB 3GHEL 4HPOH 3HMXA 2GJ6D 2DIJA 2ADFL 1Y6NR 3CFJB 3K2UH 3DVGA 1TZIA 1L0YA 2BFVH 2FX9H 5DYOA 3ZLQC 2RBLA 2DN7A 2RGSA 3QJFB 3T0DA 3W9DB 1NUNB 4CKVX 1S8DA 1RHHA 1OVZA 4WO4B 5HYSG 1FVCB 3GEWB 1KJ3H 2KKQA 3GGWB 2AKRA 4Y4FA 4CU6A 4TSBH 1T7VA 3DBXA 1R3HB 3GMOB 1T89C 3EW3B 1KLFA 1U8IB 3MV9B 4HEPG 4K3DH 3ZO0A 1M05A 2Y25A 4TUOB 1KJ3L 1T2QH 4LSUL 5F3BA 3OJDB 5L6YH 4JZJB 5ESQA 5FDWA 3TA3B 3F7RA 4TSBL 1QFWI 4U1KB 3MSPA 4R7DB 5DD0L 4UIMB 1MLCA 3G6DH 3QNZA 1EO8L 1HHGB 3CZJA 2HT2C 2NY5L 1S7RA 1MJ8L 1NMCB 2FIKB 5L6YL 4P2OC 5IVOA 3SGKC 2VXUH 2E7HA 2AJ3B 1JZ7A 4OZIE 1DE4A 2K1MA 3MGOB 3QQ9D 1H3XA 2V7HA 4Y19A 3G6DL 1CFVL 2J2ZA 4D3CH 5LAXA 2G5RA 1VPOH 5DJZB 4DCQA 5B38A 1TENA 2ITCA 2VXUL 5SX4I 4HKZB 5F7EL 4POYA 4ZFOL 5J56B 3F5WB 4M7KH 3RTQB 1OARL 2HVJA 1DANU 3OXSB 2PO6B 4KI1A 1PY4A 4LVOC 5E2WH 3CFJA 1FORL 1UVQB 1VPOL 4G6KH 1YEKL 4PJFF 3QJFA 1N3NB 3O8XB 3W9DA 4J12A 4M6AA 1A22B 2IMNA 4N0UE 4XHJD 5TF0A 1I8LC 4WO4A 5A2LH 2XV6B 1U9KA 1FVCA 2V9RA 4PRHB 1IAIM 1NPUA 4OCSH 4NPYB 3GGWA 5EN2B 3SKNB 1R3HA 3GMOA 3IS0X 2UZXB 3TLRA 1U8IA 3MCLH 3MV9A 3PQYE 2VUOA 4TUOA 3VI4F 3CFDB 1BP3B 1U95B 4WHDA 3OJDA 4JZJA 5SWSB 3TA3A 3WFCL 5DEFB 5IMKB 5JHLL 5GS1C 3L3IB 4U1KA 4R7DA 1D5ZB 4HKJB 4UIMA 3MCLL 1HHGA 4YBQC 3HE6D 2ICWI 2MKWA 4RIRB 2FIKA 4M8VA 3SPVB 1K8DB 2R0WH 2AJ3A 1BJ1H 2EDNA 5F8QC 5FGSA 1TQBB 3MGOA 3VGFA 1KNOB 4IRZL 1AKJB 4LDOB 5DJZA 4PJ9C 3REWB 4HKZA 2O61B 3F5WA 4M62L 3RTQA 1MFDL 2PO6A 3OXSA 5CD3B 4DKAA 5HHVL 1UVQA 1W72L 2XWBB 3OKNB 4M1GH 4YPJA 1N3NA 1SY6H 4LVEA 3O8XA 5EUOF 3EZJB 3W39B 2XQYG 4PRHA 5KTEH 4NYLB 2Y07H 5CIPH 5EN2A 2XY2A 3SKNA 5T1KB 1ZA3B 2V9QA 3WO3B 1J11A 1X5ZA 2YRZA 1TIUA 4NKOB 3CFDA 1ACYH 1NH6A 1U95A 5SWSA 5DEFA 5IMKA 3UPRB 1I7TB 1RY7B 3L3IA 5BOZG 4LAQH 2VITB 1DBMH 2EICA 3GRWH 1D5ZA 4HKJA 4PJXE 2WSKA 3OAYK 5ESAA 1DN0B 2XKNB 1QKZH 1ACYL 1ZT7B 4RIRA 2WP3O 2R0KH 2X1OA 3BUTA 3SPVA 1K8DA 2IBZY 2FEDD 4LAQL 1DBML 3HAEH 4Y1AE 3RFZC 3V4UL 1KNOA 1BOGB 3GKWH 3D39B 4RMRA 2NY5C 1AKJA 4OUOA 2R0KL 3U9PH 2O61A 3GBLA 1T0MB 2Z31B 5GZND 5DURD 2ZSVB 4L4VE 3QUZD 3B9KC 1G6RH 3MNWB 5CD3A 3GKWL 2XWBA 3OKNA 1YPZA 4OIIH 1VGEH 5GPRA 3SE9L 3MV7B 1E6OH 5DLML 2XTLA 3W39A 4P2CG 2D7TH 2R23B 1PG7L 4NYLA 4I2XE 1H9VA 2E8ZA 1VGEL 5T1KA 1ZA3A 2W1NA 4QRPE 1E6OL 2WMPA 4NKOA 5BQ7A 2D7TL 1U2CA 1EIBA 3X3GL 4Z8FL 3Q0HA 2X9WA 3L5JA 1Q9WB 2ESVE 3QEQD 4K71B 3UPRA 1I7TA 3BN3B 2VITA 3CAFA 1JNNH 3C5ZB 3MACL 2KL6A 1DN0A 2F15A 2XKNA 3I85A 1C8PA 5BV7B 1QYGL 1ZT7A 3QDMD 1AC0A 4ZXBB 1RPQA 4MJ5B 2LV4A 4X6CB 1XGUB 3EJJX 4ODSH 3DIFB 3OKKB 3NFSL 1BOGA 3D39A 1IQWH 2JLLA 3HE7C 3HZVB 1URLA 2GJ6E 1T0MA 2Z31A 4KQ3L 1IQDB 3MLVL 4JQIH 2MOVA 1NFIB 3MNWA 4P46D 4FFVD 1IQWL 1IGIL 1AXIB 1KEMH 4LPCA 3KJ4B 2CRZA 4YFLF 7CGTA 5D1ZC 1T5WB 2PW1B 4KRLB 3MV7A 1UM5H 1EVUA 3GKZA 5JW3H 1JN6B 4YDJB 4APQB 1S7QB 1H3WM 1F42A 2R23A 5AWNL 1DQTA 3AMKA 1PYWB 3RZCB 1RQ5A 4WIQA 1J1XH 1AFVH 2J8UA 3FQWB 5I71B 1BFTA 2V5RA 5IMLB 4L8SB 2BRQA 3QFDA 3V6BR 2I9LB 3QHFL 3RUGB 1OW0C 4JQVC 4QTIL 1AI1H 5D96B 5E4EB 3V95A 1Q9WA 4W6WB 4F7CB 5A40E 1M7XA 1UG9A 4JRYD 3C5ZA 1IAKB 4M5ZL 2AV1B 1F4YH 1NFDE 1DVFC 1IC5H 1F3DH 3OBAA 1OT1A 4ZXBA 2KQMA 4MJ5A 4X6CA 1XGUA 3EYOB 3DIFA 3OKKA 1QNZL 1X3DA 4FG6C 2Q7YB 1MCJA 1F4YL 4HAFA 3S34H 3PXHA 3N06B 2EDRA 1IC5L 3HZVA 5CAYB 5CSGA 2AQ2A 4LCUB 1MEXH 5CP3H 1IQDA 2WLYA 5D6DC 3SQOH 1NFIA 5KBNC 3PHQB 1OAZH 3S34L 1FNEB 1KC5H 5JPMA 2ZOKB 4AMKH 2CDGB 4Z7WF 4HWBA 1MEXL 2Z92B 1IAIL 1VA9A 4R97B 1T5WA 4NN5C 4P4RB 4EBQH 2PW1A 2QTEA 4F2MB 4JE4B 1OAZL 5DRWB 3DV6B 1JN6A 4YDJA 3FZUC 4APQA 2ZJSH 1KC5L 1S7QA 4NHCH 1WWCA 4R7NB 1PYWA 3RZCA 1P5UA 1JVKA 1ND0B 2ICWB 3QUYC 5FF6B 3QAZC 3FQWA 1KJ2B 4EBQL 1C08B 1PSKH 4L8SA 4WHCA 2NTFB 2I9LA 3RUGA 2BRRH 1NANH 4Y4HC 3QZWG 2N4IA 4F7CA 2K3TA 1I9EA 3MOAH 2HFGH 3S8WA 2CK0L 1IAKA 3QI9D 2AV1A 2X9XA 4BQ6A 1QO3B 1PLGL 4LAJH 4WJ5B 5CCKL 5D93C 2V2WB 4K23H 5KJRH 3MOAL 4FQXB 1NBZB 2QSVA 3NCCB 1R5IB 4KK6D 4WTZG 3EYOA 2Q7YA 4ZUUB 3EHBD 4ZSOB 3NCFB 1HZHH 4PGDB 1NGQH 2YD6A 5KJRL 4LCUA 4BSJA 2FGZA 2EC8A 4G6FD 3PHQA 1KTKE 4I1NB 4R4FH 1FNEA 1HZHL 5HPOA 1MAKA 1NGQL 2ZOKA 2CDGA 1K85A 5I15H 2Z92A 3SDYH 2PF6A 4P4RA 4DOHE 4F2MA 5DRWA 2VLLB 3DV6A 4R4FL 2A6JB 1IFHL 2P43B 3AMLA 4R7NA 5I15L 1ND0A 2ICWA 3SDYL 1CGVA 3DARA 1ZK9A 2L7JA 2WINB 3WJLA 5FF6A 1KJ2A 5JMRA 1C08A 2NTFA 3GJFB 1X6LA 1A14H 1RI8A 4KJYB 1CGTA 1L6XA 2NY2B 5CEZE 2Z93B 2VLKB 2V5YA 4G43B 2W0PA 1QO3A 4XTRD 4RDQF 3FQRB 4M7JH 4WJ5A 2V2WA 4OFKA 3UCRA 4XMKH 3ARFD 4FQXA 5GJTH 1GC1C 1R5IA 1JZ4A 2HA1A 5GRYA 4ZUUA 4ZSOA 4Z7NE 4IRJD 4PGDA 4M7JL 1AXSB 5D7SH 2DI7A 4PJDF 4XMKL 5GJTL 1ADQH 4QNPF 2MCPH 5DFTA 4LCIH 4PB0H 3GMMB 5ECJE 4JFOB 4S0SD 1XIWC 4LLAA 4OFIA 1WAAF 5D7SL 4FFWC 3VWJD 4CN1A 1F3RB 4YDKH 3IDYC 2NZIA 5HD8D 4AT6B 4FOMA 1AO7D 1ADQL 4CVUA 2NQCA 3E6FB 3IDJB 4ISVB 4LCIL 2MCPL 3ILQD 4GSDL 1NQBA 2VLLA 4RGNE 3AY4A 3QEHB 4HGMA 3EGSB 3ME0A 4FQ1H 4LPWA 2VZSA 1EMTH 4WENB 5E5MB 3GI8H 5FAAA 3AGVA 2WINA 1AR1C 4M93C 2DF3A 3GJFA 4FQ1L 2OTUB 4X5LA 1W0VA 4KJYA 3GI8L 3BQUD 4NBXB 1EX0A 2HRLA 2Z93A 3GO1H 4MNGE 1FL3B 2VLKA 1VENA 2FJGB 3H9YA 5IVXE 5HYJD 4G43A 5DUML 4KKCD 3FQRA 4TULH 1OTTC 4P59H 5C0BB 1T2JA 1MI5B 3VXRD 3I50H 4LRIA 3GO1L 4HC1L 4ONHB 1CE1H 1CFSB 1GRWA 1YNLH 4MWFB 1G7MB 2V7NB 4TULL 1NAMB 2R4SL 4NOFA 4P59L 3IFLH 1AXSA 7FABH 1NCTA 3QP3A 1MH5B 2UZYB 3I50L 5ALBH 5GGTH 5C0ND 1EJ6A 3GMMA 4JFOA 5FYJL 1GGIH 3IFLL 4PRNB 7FABL 2EDXA 5C0GB 5LKNA 4PJBE 4AT6A 3IDIB 2AJSH 1QLFB 5ALBL 5GGTL 3P40A 3E6FA 3IDJA 4ISVA 4DVRH 2HTKD 1TNMA 3BMWA 2AJUH 3EGSA 5JQ6L 1WTGT 4OFYA 5E5MA 3QIWD 2VDNH 3WHE0 1C7TA 1LDSA 2AJSL 4CU7A 4R3SB 4DVRL 3Q3GB 2Y4SA 1NCAH 2AJUL 4JRYE 4XPAH 2VZVA 4Q9BA 2OTUA 2YWZA 2XZAH 5J06A 5CUSH 4F58H 1ITBB 4JM2B 4IJ3B 5I19H 1FL3A 5HGAB 2KDGA 3AS1A 1J8HD 4PLOB 3M17B 2FJGA 2J4WH 3GK8H 4XPAL 5C0BA 1FIGL 2XZAL 1IRAY 5CUSL 3EJZD 3DUSB 4MX7B 4F58L 4H88L 1MI5A 4QHLB 4ACPA 5JTWA 4ONHA 4WFED 2J4WL 4KFZC 2ZUXA 1CFSA 3MLWH 3LN9A 4MWFA 3GK8L 1G7MA 1T7XA 2V7NA 1NAMA 4QCIB 4OBRA 1MH5A 3W5NA 5ERWB 2COQA 3MJ6A 4WUUB 2LU4A 3DO7B 3MLWL 3G5XB 3SCMC 4X0KB 1JYNA 3MRGB 4PRNA 4EI5D 1V3MA 5C0GA 3IDIA 2DMBA 1QLFA 2GJZB 5AYUL 3W82A 4OJFL 4A6YH 1NFKA 4NM8H 5DGRA 1LQSR 4DZBB 1XGYH 1Q94B 2MHAB 4YX2H 5K93A 5FKPB 4R3SA 1KTDB 1S7UB 4A6YL 3Q3GA 4NM8L 2AEPH 4LF3B 3UDWC 1J1PH 1DL7H 5F9DC 3MLZH 4LSSH 4YX2L 4JM2A 5IP4A 3NAAH 1QBLH 5ICZB 5HGAA 3M17A 2AEPL 1BD2B 1G7QB 5EOTB 1KPRB 2NW2B 3S3SA 1DL7L 3DUSA 4MX7A 3MLZL 1U2HA 4QHLA 4AL8H 4HUVB 3SDXF 3TJEH 5FYLL 4PJIE 4NWUH 5DFWH 2JELH 3KPSE 4QCIA 5HDLA 1F4WH 2DOCA 3WS6C 5ERWA 1F4XH 4PJEF 4WUUA 5E8OB 1EEZB 4MJ4A 2HT3D 1CIDA 3DO7A 3G5XA 4S1QH 4X0KA 4TSCH 4L4TB 5E2VH 1RUKH 3MRGA 4L8BB 4M9OA 1F4WL 1A9EB 5EZIH 1F4XL 1MCOH 2GJZA 1S9VB 4DZBA 4S1QL 1T83A 1XF1A 3L3KB 4TSCL 3FB8B 4GKZB 1RUKL 4P4KB 4JDVB 3BFOA 1ZEAH 1Q94A 1Q72L 2EDDA 2MHAA 5FKPA 1KTDA 1S7UA 2J6EA 3CJJA 4Z5RB 2YZ1A 5CJBA 4LF3A 5L9DH 4JO4H 1NC4D 1I9IL 4G7YH 4LVHB 1DJSA 1ZEAL 5BZWB 2J5LB 3QPXH 3ZT7A 1I3UA 5CZXD 3ZE1E 4XXCC 5ICZA 1BD2A 4LPTA 5L9DL 1G7QA 1NBVH 1KPRA 4JO4L 2NW2A 3NCJL 4ZODA 5EOTA 4G7YL 1N0LA 5IBUB 2P8MB 3WJJC 1JHLH 3CSPA 4XNMB 4E9LA 4HUVA 1CGYA 1NGZB 2XWTB 3RA7H 3JXAA 4ODXB 3O2DA 2VDPH 3U6RB 2ZNXA 5I30H 2YBRB 3RA7L 5E8OA 5B4MC 1EEZA 5JIPA 1SQ2N 1AO7E 2P45B 4DTGH 4L4TA 2VDPL 4L8BA 5IR1B 1A9EA 3G5VB 4MZ3A 3UBXI 5A1AA 2JJSC 3U7WH 1JE6A 4RAUB 3QEGH 2YD1A 1S9VA 3T3ME 4JN1L 4ZAKB 2E6PA 3L3KA 2EZ0D 1H3GA 3FB8A 4DTGL 3DPBA 4GKZA 1QTYT 4P4KA 4JDVA 4NM4L 1HE7A 2Y6SD 3MRMB 3U7WL 5D71H 5K59E 3QEGL 1IMHC 2BZDA 1NCCH 4Z5RA 1WBZB 1T1WB 4MB3A 4TNVK 3TN0B 5EOQH 3RVWD 1LNUB 1GPOH 1F6AB 5HYJE 5BZWA 4M4RA 4PRAB 4PJCE 4KROB 5D71L 2R9HD 2LAGB 3TH2T 1KCLA 4WFGD 3L1OH 3LCYA 2V2TB 1NCCL 3PDDA 2IEPA 3VXRE 2FLRT 2HKHH 5ID1B 2H8PB 3GSRB 2P8MA 4XNMA 4X7EC 3JWOH 4OLUH 3O9WD 5E9DB 1NGZA 1NL0H 5L8LB 2XWTA 3FO2B 3BIKB 5HGGS 2CRMA 4XRCB 1CXHA 2HKHL 2DLTA 3GHBL 3MXVH 3U6RA 1R3JB 3JWOL 3CLFH 3IDXH 1NL0L 5KSBB 2XXCB 4JJHA 3RU8H 4N5UA 4RWHA 3MXVL 4I3SH 4NQDD 5IR1A 3CLFL 3G5VA 4UV7H 3IDXL 4OF5A 5EBWB 5C2UB 4RAUA 4CVZB 3S7GA 5J11C 4ZAKA 5B38G 1IKFH 4KKAC 1KB5B 3OPZL 3BRDA 2GFBB 3SO5A 4LPUA 4QXTB 4UV7L 1I1AD 1SEQL 3L95B 3MRMA 2Q3ZA 4LDLB 1WBZA 3S3JA 2P24B 4Q6IB 1T1WA 1IKFL 3TN0A 5CHNB 3DVNB 1LNUA 1D9KB 1J8HE 1F6AA 1ZLUK 2FO4B 3I3BA 4V2CB 4PRAA 3P77B 3QRGH 2D7OA 4RX4D 2V2TA 1G1CA 3ARSA 5J1SC 3ABZA 3V52H 4K94H 4BQBA 1LMKA 5ID1A 2H8PA 4WFEE 4K8RD 5CEZH 3GSRA 4XCNB 3ULSB 2YA1A 3U30B 4XNYH 3QRGL 3FO2A 3BIKA 1EK3A 4JFXB 1CXEA 2HG5B 5I75B 4XRCA 4Z6AT 4Z78B 3V52L 2NY1C 1CGSH 1R3JA 2FHCA 2X1WL 4H20L 4M02A 5AZEH 3QUMB 4EOWL 4NO5B 4NZUH 4NZTH 4Y5XC 1JFQL 5KSBA 4WV1B 2PCPB 2QQKH 1NCNA 4QY8B 3MJ9H 5HI4C 4LEOB 3IGAB 4O2FB 5C09B 5AZEL 4NZUL 5EBWA 3WMSA 3PV7A 3HC0A 4CVZA 2VZ1A 2QQKL 3QQ9C 5ADPH 3EYVB 4HWEH 3S5LG 4LHJB 1ZGLP 4P5KB 4QXTA 1RSFA 1HXMB 3L95A 1TQCC 4DJMA 4OLEA 4OZHE 4M61B 2ILLA 5ADPL 5J1AB 2P24A 4Q6IA 2ZZUT 1RZKH 3HNTL 4UNUA 3DVNA 5CHNA 1D9KA 4QHUB 1CT8B 5F21B 2FO4A 2E9WA 4OZIF 4OI7A 1CGUA 1OTUD 3P77A 4Y4FC 5DJXA 3MRKB 2XN9B 2RFXB 1RZKL 4UBDD 3RY5A 4XCNA 4XWGL 3ULSA 4Z7VB 3M8OH 3IJYB 4QGYA 5H2BB 4XB8A 4JFXA 2HG5A 1T80A 4Z78A 5CGYC 5IVNA 3SE8H 5EB9A 2VLRD 3QUMA 3OKEB 4NO5A 2UY6A 3MYJB 2H2SD 3M8OL 4NC1E 1ZA6B 3PV6B 3CXDL 4WV1A 2PCPA 4HT1H 1L7TH 4IRSD 4QY8A 3O6MH 4LEOA 3IGAA 3WIHA 3SE8L 3QG7L 2IH3A 4O2FA 5C09A 4I0KA 4KH2A 2GK2A 4U1GC 4HT1L 4X7SH 1L7TL 2F5BH 4QHNA 3O6ML 3EYVA 2ARWA 3MUGB 2BSTB 1NKRA 4P5KA 1KG0B 3BGFB 4QHKJ 3V0AC 5FYKL 2LU3A 1HXMA 2EYRB 3VD4A 3BKYL 3MBXH 4M61A 4X7SL 1KGCD 3PWNB 4ZPVB 5J1AA 2F5BL 4KAQL 2IBBA 2EYTB 1MFAL 2MQCA 4QHUA 1CT8A 5DUPH 3KPRE 4X6BB 4KK5D 4EXPX 1N6UA 3MBXL 3MRKA 4YXKH 2XN9A 2YD2A 2RFXA 5DJDB 3RVVD 4ELKB 3IFNH 1JK8B 4Z7VA 2VAAB 3BPLB 1KV3A 1MCEA 3IJYA 4D0CB 5H2BA 4UQ3B 4BSVB 1OSPH 5FA3B 3HUJF 5HI5D 4Q6YA 3IFNL 3LPWA 3FAXA 3OKEA 2V5TA 3MYJA 4Z7UE 3T1WA 4CL7A 1XR9B 3PV6A 1KCKA 1OSPL 1X44A 2RIKA 3HFMH 3O4OC 3CFBB 5HPMB 5AZ2H 1CD1B 1MCBA 2XG5A 1N6QH 3OJ2C 2VDOH 5EG6C 2VR9A 3GUTB 3MLSH 3TT3H 1WF5A 2YN5A 4H1LG 1GOGA 2PO6C 2BC4B 3MUGA 1JZ2A 2BSTA 3S35X 3MRQB 1KG0A 4MVBC 5HHXH 1U8JB 1U3JA 2EYRA 1OWRM 4XXDB 5GZNC 4DEPC 2VDOL 4NJ9H 4MDJB 3F7VB 4U6TA 3O8XC 3MLSL 3TT3L 4ZPVA 3PWNA 4CADB 1P9MA 4NQEE 5ICXB 1ZV5A 1TDQA 2EYTA 3B43A 4LRNL 3P30H 4WFGE 3BH8B 4LHQB 5HHMD 1R5WB 2CMRL 4X6BA 1AP2B 1FVEB 2XQYK 4NJ9L 4LQ1A 1JZ8A 2AXFB 2FECI 3VFNB 5D7JD 3P30L 2WK2A 1S9XB 2RHEA 1KENH 5DJDA 4I3RH 1KCVL 4ELKA 5C7XH 1JK8A 3NPSB 4Y16D 5BV7L 1IC4H 4U1HB 1UH4A 3N50A 2VAAA 4I0PD 4D0CA 5ACLA 2GT9B 4UQ3A 4BSVA 3AM8C 5F7DB 1RZKC 2D4FA 5FA3A 4YEFA 5CLWA 3WV0A 3V0WL 4I3RL 1GZQB 5C7XL 3GMLB 1X5LA 1XR9A 4JB9H 4L1HA 1TQBC 2H45A 4LLVA 3KPLB 3EO0B 4MNQE 3CFBA 4YZFE 1NDMB 4X6EB 4LMQE 5HPMA 3BGAA 4P23C 4RGMC 1CD1A 5DEZA 2YSSB 4JB9L 4ZNEE 3G5YB 3FTGB 2OBGA 3GUTA 1A7QH 3BPOB 1Z9MA 3SO3C 2BC4A 3QDHA 4MA8L 4MXWH 4FQJH 5DQDH 1CLOH 3MRQA 4DAGH 1JWMB 4Y5VC 1U8JA 1MPAL 4XXDA 4PLNC 5C92A 3WXVH 4MDJA 3F7VA 5ILTH 2NY0B 4CADA 5ICXA 3RI5K 1XT5A 4FFVC 4FQJL 3BH8A 3H7BB 4DAGL 1R5WA 3C60B 2XICA 1AP2A 4G8GB 1FVEA 3WXVL 2E5EA 3DRTB 3IAGC 2AXFA 5JA8B 4R4BB 1TVDA 3KXFD 3TPKA 3VFNA 3SGJC 1S9XA 3F62A 3QEUB 4XP5H 4PYGA 3ZT5A 3T0AA 1MCNA 2HWZH 4U1HA 1LK3L 4FZEH 5ACZB 4V1DB 2GT9A 2H26B 3CGTA 2C5DC 5F7DA 15C8L 3FT3B 3GJFK 1QFUL 4Y19D 1DBAH 1GZQA 4XP5L 3EDKA 3GMLA 1NEZG 1YMMD 1FYTD 3EJYD 4FZEL 4W4OA 1RHFA 5IMMB 3KPLA 5DD1H 1UKTA 2X4QB 3EO0A 3T2NL 1NDMA 4X6EA 1DBAL 2YPLE 4UQ2B 2VRAA 3U0TB 2VDQH 1BF8A 3FFCD 2YSSA 3G5YA 3MR9B 3FTGA 3QUKB 5DD1L 4MXVE 2GTWB 2HYMA 1JWMA 4RBPK 2VDQL 4PV8B 2I9TB 3ZZ1A 2NY4D 1NAKL 4J23A 4HH8A 4MAUL 2JKXA 2YUZA 2IQ9H 3H7BA 4U1JB 5TQ0H 3WBDA 3C60A 4HXBL 4G8GA 1FC2D 2OQJB 3TA3D 2BXZA 3DRTA 1A6AB 4KHXH 4R4BA 2CSPA 1BQHG 1TZHB 3QXTA 5TDPB 3QEUA 2I07B 2B5IC 2D2OA 4UDTB 5ACZA 4N8VB 4V1DA 2VLRE 3MA9H 2H26A 2W0FB 2N1KA 4PGEB 4KHXL 3FT3A 3MC0A 3CIQA 4X7DC 5EULV 1N7MH 1S7XB 5BV7C 1MAJA 3KDMB 5EA0H 2KBGA 1VDGA 3PWPD 1MFBH 2XWJB 5IMMA 3QI9C 5MERB 4JHWH 4ONOA 1INEH 2P5WD 2X4QA 2F5AH 1IGCH 1A4KB 1BREA 1HQ4B 4UQ2A 5FUCE 3U0TA 3PL6B 5L7XH 3MOBL 1CGWA 4KK6C 3MR9A 5L2KB 1C5BH 3LSOB 4UB0H 3QUKA 2F5AL 1IGCL 2M2DA 2GTWA 4J4PD 4PFEA 1CL7H 1KGCE 2NXYB 5IBTL 2X4NB 4Z0BH 4PV8A 2MFNA 3KJ4C 2I9TA 1JGEB 5KW9H 2FX8H 1BECA 4RAHA 4P5TD 4LHUB 5I1JL 4LNVA 4U1JA 1CL7L 2VR4A 4UT6H 3IDGB 3RZCC 2OP4H 2OQJA 1N59B 1A6PA 1OP3K 1A6AA 4JQXA 5HDBF 1EPFA 1WJ3A 4L8SC 3TBSB 1TZHA 4G42B 4U3XA 4UT6L 5TDPA 2J12B 2I07A 1FV1B 4UDTA 4BYHA 4N8VA 2OP4L 5DJ6B 1TJGL 2W0FA 4IOIB 4PGEA 3B9DA 1Y18B 4PBWD 1S7XA 3HRZB 5TF1H 2LTQB 3ZSTA 3AB0B 3QFJD 3KDMA 1FN4B 4OZ4B 4JFZH 2XWJA 4M7ZB 2MNUA 3K4DA 3O6KL 4RRPA 5MERA 3B3IB 1F2QA 4XTRC 1WZ1L 1A4KA 4F8TA 4Y2DB 1HQ4A 3MUHL 3U1SH 2V2XB 3PL6A 1BFVH 3ARFC 4Y4KC 1F2XK 3VGBA 5L2KA 3LSOA 4YHOH 5D9SB 4IRJC 2PYED 1U8QB 2NMSA 1R3IH 2X4NA 3NGBB 3U1SL 3W2DH 1JGEA 1RIUL 2ATPA 5HVGB 5GISH 2EDWA 1OLLA 4LCCB 4LHUA 3LY6A 5I73C 1G9MH 5HJ3B 1REIA 4MB5A 3IDGA 1R3IL 2C3XA 3P9WB 4TNVF 3P9LB 2OYPA 4FMKA 5DWUH 3W2DL 5HD8C 4X4ME 1KF9B 1N59A 5GISL 3WJLC 3ILQC 3RKDD 2QADB 3TBSA 4JZNB 2A2QT 2E27L 4G42A 4QYOB 1FV1A 3PDOB 3Q5OA 5DWUL 2WBJD 2ZUQB 3W81A 4F7MB 2CKBH 2WV3A 4YBLC 5DJ6A 1WCBB 1TZGH 2MPAH 2BNQB 5DMIH 3S96B 3O81A 5BMFH 4IOIA 2Q76B 2E3VA 1Y18A 3U0WH 1OQOA 1RJZB 4X4ZA 4DN3L 3HRZA 5INCB 3BIAX 3DSNA 3BQUC 3ESUF 3FHQA 4YC2C 5LXGH 4OZ4A 1FN4A 2DJSA 2MPAL 5DMIL 5BMFL 5FO8B 4OF0A 2YK1H 1WIUA 3MRFB 3B3IA 1JV5B 3DSFH 1OP3H 3U0WL 3MCKB 3GSNH 2VZTA 4LSRH 4YNYB 5D7IB 4Y2DA 3NCYP 1D6VH 5JR1H 4KKLC 4E5XB 2V2XA 4C56B 4XPBH 1UYWH 5LXGL 4GAYB 3DLQR 5AAMA 2WQRA 3I02B 1MCSA 4RGOL 4YDLC 3DSFL 5D9SA 3TFKD 3KPPB 3GSNL 4LSRL 1U8QA 5JR1L 3QG6B 1O0VA 5SX5H 3EOTL 3TNNB 1UYWL 4LPVA 2OJZH 1IC1A 4KY1H 3ZKSD 5IVXF 5C0NC 3NOIA 1MIMH 4LCCA 1KCSH 2W91A 5HJ3A 3LDBB 1FE8L 3UYPA 4M5YL 3P9LA 3KXFE 2OJZL 4KY1L 1CFNB 1YPZF 2W9DH 2GITB 2HTKC 4JZNA 4HF5L 3UTTD 4QYOA 2ZUWA 3QIWC 3PDOA 1MWAB 2DDQL 4F7MA 1ORSB 1KT2B 4Y19E 3UTSB 4B53A 1WCBA 4HG4J 3S96A 4OM0H 2BNQA 1FDLH 1WEJL 1YMME 3TGXA 1J88A 1I3VA 2Q76A 4WI4A 1RJZA 5INCA 4HSQA 3EO9H 3HRPA 5JXED 4LRIC 3ZKQD 4OM0L 4LLYB 1NCBH 4OD2B 2BVTA 4RWYH 5FO8A 3FFCE 3A6BH 3MRFA 1JV5A 3MCKA 4YNYA 1CTOA 5D7IA 5C08B 3EJZC 3G6JE 4E5XA 4M6NH 2AK1L 1PKQB 3FQUB 4GAYA 4G8FB 1JMXA 2O5ZH 3I02A 3A6BL 1PJ9A 3KPPA 1I7ZB 3QG6A 2WWKO 1DFBH 3TNNA 4XP4L 3E2HC 3MV9E 5DHXB 4PJFB 3GSQB 3CZFB 3PUCA 3VGGA 3DYMA 2VE6B 4HUWB 2B0SH 5FV2A 3H3BC 1T6WA 4ZD3H 5J12B 1TMCB 5C0AD 3RY4A 1QR4A 2EXYD 2GITA 4KKBD 2NW3B 4K07A 4MA7L 3SGEI 1IAMA 2IADB 3TZVD 2B0SL 1MWAA 4ZD3L 4F33B 1ORSA 3I2CL 1KT2A 3UTSA 1F6FB 5IWLC 1C5CH 1EHNA 3D87B 4PGZA 2JTDA 5IF0B 2J8UF 1CDGA 4CMHB 5I0ZA 4YXHH 4IOSD 1A8JH 4UI2A 3F7PC 5E6IB 4O02H 1M71B 3OXRB 4JAMB 4LLYA 1C5CL 4OD2A 1J5OH 1A6ZB 4GUPA 5C08A 4YXHL 4RFOH 3PP3K 1QEWB 1PKQA 3FQUA 3PE9A 4M3KB 3CUPB 3VFMB 4G8FA 4HS3B 1J5OL 4LEXH 2FNBA 1I7ZA 5D5ME 4RFOL 2QSTA 1PFCA 2IGFH 4Z7OF 3DETD 1MHHB 4PJFA 1R3KB 3GSQA 4QXGH 4UAOB 3CZFA 1Z9OA 3T0ED 4NO0B 5EUOB 5SWSE 1AQDB 1VFUA 4RFEB 2VE6A 5C9KA 1JTTA 4HUWA 4TTGA 3HZYB 2IGFL 1S7VB 4PJIF 4BQ9A 4IM8A 5IJKA 1L7IL 4K7PY 2NW3A 3UJIH 3KNBB 4K2UH 2IANB 2OL3H 4ZS6D 2IADA 5IROC 3ISWA 1F45A 4K8RH 5AYQA 4F33A 4Z0XB 4FTVD 1IGJB 1WFUA 12E8L 1OF2B 3E8UL 3O11B 4FQXD 4M4PA 3UJIL 5IF0A 4PY8I 4K2UL 5DRXB 1HN1A 1JRHL 5I6XB 4POZD 5I8KL 4J3WA 3U9UB 4K8RL 5D1QB 2VR5A 5E6IA 1JF1B 1M71A 4LDEB 3OXRA 4JAMA 1U36A 4MHHI 1A7OH 1H3VA 1V7MH 2VXVH 2XYCA 2HTLD 4JG1H 1A6ZA 4OCXH 1JHKH 4N0RA 4OLXL 4EJ1C 1QEWA 1X4YA 4HQQL 2NY3D 1E4KC 4HWZB 3CUPA 3ECBB 2XT1B 2PYEE 4I9WE 3VFMA 4X7CC 4HS3A 4JY5H 1MCLA 1V7ML 2VXVL 3BXNB 3RWCB 5DDHB 4QRQB 1Q0YL 1CDHA 4CN4A 3ZE1F 4DGYL 5F1SA 1MHHA 2JB5L 1R3KA 1R0AH 4JY5L 4PJ8B 1J0JA 4MA1C 4NO0A 5EUOA 1AQDA 4OCWL 4JO3H 4EQ2A 4RFEA 4L3ED 2H6PB 1UCBH 2JIXD 1AGDB 4KGLA 4B41A 4YHKH 3HZYA 4TQEH 1S7VA 4O4YH 2B7DT 5ABDE 3O6FB 3BO8B 1R0AL 4OI9A 4JFYB 3LH2H 5JDJA 3KNBA 4XC3H 4OQTA 2IANA 4JO3L 1F02I 2VLKD 1UCBL 3V4VH 4S0TD 1EGJH 1QSVA 1SEBB 3LS5H 1NC2D 4Q2ZB 4TQEL 4YO0B 2MQ0A 2F74B 2Y6SC 4Z0XA 5KVGL 1IGJA 4JG0H 1OF2A 3TJHD 2C4XA 3O11A 4U6VH 3HTLX 5DRXA 2PXYB 3CLEH 3V4VL 3LS5L 5FUOH 3U9UA 3VE0B 3IYLW 5D1QA 2F54D 1JF1A 3T3MF 2HLFC 2R9HC 5HHQB 1RFDH 4OI8A 3SBWC 2I25N 4KI5C 4U6VL 4LCWB 2OM5A 3BN9D 3CLEL 5FUOL 4GW4B 5IW3A 5HI3D 4JPWH 5K59F 4HWZA 2CRIA 2NXZD 3ECBA 5CJQH 3HR5B 1RFDL 3BKCH 1T7YA 4JFDD 4X83A 2R0ZH 1FP5A 4OZGE 1U8KB 3BXNA 4JFHD 3NA9H 2R1WB 2DLGA 3K0WA 3RWCA 3H2WA 5DDHA 4QRQA 1HYSD 4PJCF 3AU1B 4JHZA 1BFSA 1UZ6E 3D85D 5CJQL 1JZ6A 4KRPD 2R0ZL 5EBLB 3N1PC 5CEXB 4PJ8A 5CMAB 2H6PA 4NKIL 5F7MC 3ARWA 5C0DB 1AGDA 3IETB 4ZTOH 3RI5F 3VXUB 3WIFB 3EYQC 4MQXD 5DS8B 4GRMB 1NGYB 3O6FA 3BO8A 5E8PB 3UTTE 3TIDB 1FNSH 4JFYA 3ALXA 5KN5B 3WD5H 1HHKB 1OGAD 2GEEA 4KC3B 4R4ND 1SEBA 1DQML 4ZTOL 5I1KL 4LVHC 4Q2ZA 5DZLA 1I1AC 4YO0A 2F74A 4JO1H 3QDGD 2E7MA 5K9JH 1TPXC 4O2EB 1ZGLB 5BVJA 3WNOA 3WO4B 3QJHB 1CN4A 4FFZH 3BRFA 2PXYA 5IQ7L 2W60B 3VE0A 5SWZD 1S5IH 4JO1L 4ZUSB 5HHQA 1BPVA 3H9SD 3PWJB 4LCWA 4P49A 4ODTH 5EORH 3M45A 4GW4A 5BO1L 4NC2B 4GRWF 1X5JA 2IAMD 3HR5A 3HNSL 4P2OB 2JJTA 5JIKA 1U8KA 1A3RL 2DWDA 4WI3A 5EORL 2R1WA 1WFOA 4KJPD 5JHDD 3AU1A 4U6YB 4Z7WB 1FVDB 5E08H 5CEXA 5EBLA 5CMAA 2OS7A 2D0GA 4AG4H 5C0AE 4NCC1 4GMTH 5FM4A 5C0DA 3VMPA 1WCQA 3IETA 3VXUA 4LVOB 3WIFA 1PDKA 1MF2H 1K4CB 5DS8A 3S35H 1F90L 2AS5M 3BD5A 1NGYA 4GRMA 4PRBB 5ICYB 5E08L 5E8PA 4ALAL 3F7YB 5F7WC 3TIDA 1BWMA 5KN5A 4AG4L 1GVIA 5BRZD 1HHKA 4GMTL 3O3DB 2EYSB 1MF2L 1JZ3A 3S35L 5EU6D 1X5YA 5T3ZE 1YECL 1U3HB 1JPSH 4O2EA 1ZGLA 2CIKB 3NCMA 3QJHA 1JP5A 1UJ3B 4JGUA 3TO2B 4E41B 5BCAA 4QOKB 4XNXH 3VJ6B 1O7VA 3CU7A 2W60A 4AEIH 5LQBH 1OTUC 4ZUSA 4WFHD 5EZOH 2WWMD 3PWJA 4MJ6B 1VEMA 5GS1B 4UBDC 4XNXL 4XP1H 3BKJH 3KVQA 4AEIL 4PJHE 4OZHF 4LOUC 2UZIH 4P2OA 3SGKA 3QO1B 5HYIA 4KXZI 2EIZB 3MXWH 4RSVA 2Q8AH 3Q1SH 4XP1L 3FB7B 3TF7C 4PLJD 1FLTX 1TCMA 4U6YA 1LE5B 3QXAB 4G5ZH 3WXWL 4Z7WA 1FVDA 3OJVC 2UZIL 3DI2B 4J1UB 4PJ9B 1RUQL 4IRSC 2JCCE 1C1EH 1MRDH 3Q1SL 5I8EB 2BVEA 2ICEB 5HHNB 5F1KC 4NSKB 4G5ZL 1K4CA 4NZDA 2OX5A 4PRBA 5DQJB 5ICYA 3F7YA 1A7NL 3T8XB 2H9GB 2N7AA 2FJHB 5EIQA 2PTUA 2XQBL 4G8EB 2FRGP 1C1EL 5F6IC 4XCCL 2AGJH 2KQNA 5J1TC 1A7PH 1QLEL 2EYSA 3O3DA 3NFNB 1CXLA 4GBXD 2O5XL 4YUEH 3MX0A 5I9QC 1AH1A 2X1QA 1U3HA 2CIKA 4DUXA 1UJ3A 3TO2A 4EN3D 3G08B 2YPKB 4E41A 4QOKA 2AGJL 3VJ6A 1FFOB 4YUEL 4KK5C 4AEEA 4MJ6A 3DHJA 4BK5A 5GS1A 4MAYB 4XNUH 4MGXA 5DMGD 3DMMD 1CGXA 2DL9A 3UBXG 2EKSB 4PJDB 4XAWL 1TVHB 3LKNB 3QO1A 2EIZA 1MREH 3FB7A 3W9EB 1LE5A 4P4KD 4PBXA 3QXAA 3RRQA 4L3EE 3OX8B 3FQTB 1AGEB 1G9NH 3SQBA 4J1UA 2J3SA 4PJ9A 3DJ9A 1MREL 4N8CL 3HG1D 1D6EB 5GGQH 4G9DB 5I8EA 2ICEA 5DD5L 5HHNA 3B9KB 3KLSA 1JBJA 4NSKA 2VLKE 1KBGL 5DQJA 3HMWH 3T8XA 2H9GA 3FB5B 2FJHA 4ZFOB 2K9UA 5I74C 4G8EA 4OTXH 4WFFD 5TJWK 4Z7UF 3NFNA 3RX5A 3RX7A 1CI5A 1WLHA 3HMWL 2AXGB 5T3XD 2F54E 1I9RH 3VXQB 1EZVY 3G08A 2YPKA 4OTXL 4DVBB 1LWRA 1DZBA 4NFCA 1GIGH 1FFOA 3CX5J 3QWOB 5TFSL 3G6AB 4ODUB 2FD6H 4MAYA 5DA0B 4JFDE 3UJTH 3BESR 4JFED 2MMXA 1GIGL 2AK4D 1IAII 2EKSA 1GOHA 4I0PC 1RD6A 4PJDA 4WTWA 4MZ2A 4YHIB 5I1HH 1TVHA 3LKNA 2FHFA 3UZEA 5JW4N 3OMZA 2HKFH 2AP2A 5KS9E 2HH0L 4JO2H 3W9EA 1WAAA 2ENYA 2ED8A 3HE7B 3FQTA 3OX8A 4J3SA 1AGEA 1A64A 3NABH 5I1HL 1MQ8A 1T0NB 4KRNA 2F58L 1HH9B 4N0CC 3ZTJG 3VI3E 1D6EA 4HFWB 1XGTB 4G9DA 3AC0A 3B9KA 4Y8DC 3B5TA 1OGAE 4HH9B 1EUUA 3WKMH 3NABL 3T2OA 1II4E 3FB5A 4ZDHB 4ZFOA 3NH7H 5C0BE 4EUPG 1HI6B 1E6JH 1IEAB 4QKXB 3QDGE 4XH2B 1MI5E 1N5YL 2O93L 1ZANH 5B21A 3WKML 2GW5A 2AXGA 3AXLB 5E9DD 4YZFF 3VXQA 1E6JL 5C1MB 4JPIB 4DVBA 5MEQB 1RZ8B 5DUBB 3H9SE 3JVGC 1SJVA 3W0WB 4KTDH 1JGVL 4NQSB 1X5HA 3QWOA 4R2GD 3ET9F 3G6AA 4ODUA 1PEZA 3ZDZE 1BQSA 1N2RB 1LILA 5E70A 2BNUB 1DVFB 4KTDL 3BWAB 5JHDE 5JUEH 1IT9L 4YHIA 3QQ4B 5CIPB 2DL2A 1NBYB 1XCQB 5GGVH 2X42A 4PGCB 4CAGA 1BJ1J 3ZHKA 2UY7A 1I7UB 3K74B 3HE7A 4PRIB 3EJYC 2UUDK 1I1RA 1T0NA 4XMLL 5I76B 2P8LB 1HH9A 1U8MB 3MRNB 4HFWA 5GGVL 1XGTA 4OLYL 4M48H 5HHOD 1EAPB 5BRZE 4HH9A 1KACB 3BP7B 1WVZA 1YNTB 4GXVH 4H5SB 4PS4H 4ZDHA 4LARH 4F9LC 1HI6A 5EU6E 4XH2A 1MCFA 4NN5B 1FGNL 4UIKH 4ZO8A 4UV4H 3O0RH 5EIIB 5T5FH 1OSZB 3IDNB 2NY4C 3TO4D 1OAYH 1MJ7L 2Z4QB 4GXVL 4BUGA 1JGLH 1T20B 3AXLA 1IARB 3QUYB 4JPIA 5MEQA 1RZ8A 3QAZB 5DUBA 1VFBB 4UIKL 1IZJA 3IDUA 1QRKA 3MLPA 3OWEA 5ANME 5T5FL 1OW0A 2OK0H 4JQVA 1B4RA 5FHAH 4K3JH 3W0WA 4Y4HB 4N68A 1OAYL 5F89B 4NQSA 3V6ZB 4H1LH 4C59B 1JGLL 1ZXQA 4G9FD 3SDXB 5HXMA 2X4TB 4W6XB 1N2RA 4LSVH 2BNUA 4BH7B 4WI2A 5FHAL 1DVFA 2VAJA 1YEFH 3BWAA 5D93B 3QQ4A 4PJEB 5CIPA 1MCDA 2LU7A 3B5GA 2N56A 1NBYA 4MD0B 1XCQA 5DRNB 4PGCA 5LWYH 4ZMAT 1I7UA 3JSSA 3WHE1 5EOCJ 4YE4H 3VXPB 4PRIA 1YEFL 3DRQB 3DX6B 5LGJB 1W2KT 3V2AR 5CJ5A 5I76A 2E7CA 2P8LA 1U8MA 3MRNA 5D6DA 4HG4K 1Q9OB 1EAPA 5FUZH 1SVCP 5LWYL 4MJ2A 4I5BB 4YE4L 1FFQA 3QT2A 3BP7A 1YNTA 3GIZL 4H5SA 1RIHL 4XPFH 2NY0C 3AS3A 1LK2B 2Y23A 5CGTA 3RWHB 3ZT6A 5EIIA 3SN6N 1OSZA 3IDNA 4LHUG 1IJ9A 2Z4QA 1UXWA 1Q9KB 1T20A 4BZ1H 4P5TC 3JV6B 4JFFD 1X9QA 3QUYA 1LP9E 1BFOB 3CVIH 1VFBA 1UA6H 4JKKA 5BS0D 4LKXB 3MLRH 6FABH 1C5DB 4Y4HA 5F89A 3V6ZA 5GSVB 3AREA 3SDXA 1N26A 2VLJB 4L4TE 2X4TA 4BZ1L 1HKFA 2QQQA 5KSAD 3ARRA 3CVIL 1UA6L 1BAFH 4BH7A 2VQ1B 4J3UA 4PJEA 1BM3L 4HWBH 3VG0H 4MD0A 5DRNA 4X6DF 3ARBD 3SJVB 3VXMD 1QFWH 1BAFL 1SBSH 1P7QB 3VXPA 3DRQA 5M7QA 3DX6A 5LGJA 2V9TA 4BZ2H 2DB8A 1ZTXH 4AK1A 3VG0L 1BGXH 2Z91B 2X4RB 1Q9OA 5A16B 2UVFA 3C6LA 1QFWL 1BBDL 1IAOB 4I5BA 4WFFE 1XIWB 3ZE2E 1EDQA 4OLVH 3IDYB 4BZ2L 1D5BB 4DQOL 1ZTXL 5DJYB 1LK2A 1BGXL 2GYSA 3RWHA 4OIAA 2XA8H 2XTJD 2JJUA 5T3XE 5SX4H 2A9MH 3NCBB 3V6OE 2EO1A 1JF5A 4NP4H 4OLVL 1Q9KA 3B5HA 4NQVB 3JV6A 1J0KA 4JQXC 4ENED 1BFOA 2XA8L 4Y89A 4M93B 5T3ZH 4LKXA 3UMTA 3U4EB 4R0LC 4K9EH 1C5DA 4NP4L 2ITDB 5GSVA 4FFYH 1RUML 3TVMD 3QWQB 1INDH 1YYLH 4H8WH 3TCXA 4MXQD 4MDIB 1OLZA 5IFJB 3DV4B 5CGMA 2VQ1A 2WBKA 4HKBB 4UTAL 4K9EL 5J89A 4FFYL 1AHWC 1WIOA 2QKIB 5I66B 1INDL 1YYLL 2IF7A 4AYFA 1F3DJ 4L9DA 2D03L 1KTRL 2OZ4H 4W4NA 3SJVA 1ZE3C 2XRAL 5CSBA 1P7QA 1VFOA 3KLDA 3VDBA 2ARJB 2KZWA 2LAAA 3HI6L 2Z91A 2X4RA 2OZ4L 3RPKA