5CSZA

Crystal structure of gantenerumab fab fragment in complex with abeta 1-11
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
212
Chain Sequence
VELVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINASGTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGKGYVRYFDVWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GANTENERUMAB FAB FRAGMENT HEAVY CHAIN
publication title Gantenerumab: a novel human anti-Abeta antibody demonstrates sustained cerebral amyloid-Beta binding and elicits cell-mediated removal of human amyloid-Beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 212
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cszA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cszA01
5DJ2A 2A9NL 5EO1A 3MROA 5EO0A 1IGYB 1LO4H 2XG5A 1G9NH 3HMWL 5F7NC 2AK4D 1U8IB 1XCQB 5EU3B 4OQ1A 4P4KD 1S9KC 5MENA 1PW3A 3MRJA 4K23H 4G6KH 4LIQH 4LKCA 5T5FL 2W9LA 4OGAC 2Q87A 5C6PB 4DCQB 1KYOJ 1FC1A 1D5MB 4N1EA 4ALAL 4F15B 3HE6C 1G7QB 3AB0B 1MWAA 1MFEL 5C3LD 4OD3L 1KTDA 3S4SA 1BD2B 5EBLA 3PQYD 4HBCL 1J88A 2DYPD 1YEKH 4ACPA 1UJ3A 2HFFA 1GGIL 3IXTB 4YHNA 3WIIL 1FNSH 1HOCB 4XT1C 1T1YB 43C9A 5ID0A 4IRJA 2VUOA 3TNMB 3EO9L 5KVMC 1AIFB 2R2BB 4FQJL 4H0HB 1AXSA 3E6FA 5GHWH 5JW4N 3AUVA 3P73B 3FT3B 5DZNA 4XNZB 5TE4L 1WC7B 4KK8C 4Q58C 4A2LA 4DN3L 4XXCA 4U3XA 4ODUA 4XCYB 1C12B 5EC1A 2F58H 4JFOB 2BZDA 1KGCD 1P6AB 3HAEH 5I71B 3O0RH 3PNWA 1JNHB 2GY5A 3IDYB 2LU3A 3I3EA 5JHLH 1VEOA 2A0LC 1BJ1J 1EGJA 2XXCB 2R2EB 1XR9B 4HDIB 1JZ4A 1CS6A 4UDUA 1G7HA 4IDLA 3CAFA 4DKFH 4NT6B 5JO5A 5CGMA 2EXWC 3UTSE 3CLEL 4I77L 4F3FA 2MCPL 1OB1B 1DSFH 1JUFB 3S35L 3CUPA 4K7PX 3PL6D 2XRAH 1X6NA 4MNGE 1N6UA 4ZOAA 4YIQB 3VFMB 1YJDH 2WP3T 3DLQR 4OCSH 3QEHA 1BX2B 2GTZB 5D7KE 1S7TB 2I07B 4PP2A 4N9OB 3QJHB 5EG6C 3ZDYF 3LIZH 4RQQB 5I30H 4TNWK 4F15C 1EHLH 3F7VB 1CD0A 2F54B 2F5AH 5HPOA 1KCVL 4Z7UA 4LLYA 4OLZL 1TPXC 5KSBE 3SGDI 2HLAB 2XZCL 3HRZB 1JF5A 2EICA 4P59H 5EB9A 3OJDA 3TPUA 2AKRA 3RVWD 3V79C 4XC3H 4HX1B 1FYTA 4I4WA 3NCJH 1MF2L 4NPYB 4QGTA 2IJ0C 4PGCA 5HYSG 1NCUA 1NDGA 1NCDH 4DGVH 3SE4A 5D70L 2IBZY 1QFHA 4KUCF 4WY7H 1HQ4A 4XNZC 2FIRT 5D5MB 4X6DF 5IB1B 4UU9A 5ALBH 3UPAA 4QT5B 1HYSC 4O9HH 1QKZL 5ITFB 4JFDB 4CVZB 1B0GB 2VLJD 5FA4B 2UWEF 1CXKA 1FG2A 2ZSVB 3QDMA 4U6YB 5I71C 1NBYA 3IDYC 2GSIA 1KT2A 4L4VA 1NLDL 4PBXA 2EH7H 3MRRB 4B53A 2DLTA 3ARFD 3DOSA 1XFPA 3X12A 3DYMA 4KRMB 3LS4H 5DJ0B 2PNDA 1LHZA 2VAJA 4HK0A 4JHWL 4P5MB 3GSVB 5SV3A 1ZLSL 3MV9D 1A7NH 1CGYA 1A2YB 2YPLD 4PJ8B 3MRFA 5IF0B 4G8EA 4TSAH 5C86A 4ONFH 4PRBA 4NKMB 5EO9A 3UTTA 5B38A 3L3OB 4OZGA 4Z7WA 1EFXA 4OSUH 3RFZC 1IBGL 3C6SA 1TITA 1U8PA 2PF6A 1BMGA 1B9ZA 1G7MA 1ACYH 2OJZL 3EYOA 1GVIA 4FMKA 1BECA 3Q6FA 4QXGH 3BWAB 4NNPL 2CUHA 4UAOB 4R8WL 4Q9QH 1CICA 4GG6B 1Z6JT 1HDMA 4WFFE 4BKLA 3QIBD 2CKBB 1I7TB 4K7PH 1YPZF 4NQXB 3KJ6L 1K8IA 1JZ2A 3OKMB 5AWNH 4MD4B 4PJDB 3ZYIA 4YHKL 2I9TB 2NZ9D 1NFKA 4PRIE 5IW3A 3WHE0 1MCDA 4S2SB 1LDPH 3S6CA 1KXQE 4M7LH 3MGAA 1W2KT 1KJ2H 2IADB 2LAGB 4ZAKD 3W11C 5KZCD 3OB0K 1YEDA 1PKQA 3FRPG 4BSVA 2H41A 1XF2B 2NXZB 2DQTH 1H3WM 1M6OA 3SOBL 4XPGH 5JLZB 4DGIH 5C09E 4M7LT 1OM3H 4AM0B 1OGAD 1UZ8B 1DZBA 2ZP0T 1NGYB 4MA1B 4NGHH 4JFFA 3V6ZB 4PJ8C 3SGDH 2Z92A 4XHQA 2VDOH 2EDXA 2AGJH 3M1BA 2R1WA 4HPOL 5BS0A 5TQ2L 1TZHA 4OLWH 4PJIF 1NFIB 3OGCA 3JWOH 4FMFA 3MC0A 4IOSD 4QTIH 3X3FH 4KAQL 4CJ0A 1U8KB 1FNAA 4PRIB 1I8LA 4BH8A 1QBLL 3ORJA 2A73A 1E6OH 3CLFL 1EXUA 1FVCA 2AV1B 3EYVB 2GUOB 4UAOC 2P5ED 4R0LA 5CHNB 2DQUH 3QRGL 4Y1AE 1BF2A 1AP2A 1EHAA 3H9SD 1MY5A 2APFA 4HJJL 3MRIB 4GKSB 5C0IA 4F7CA 3CVIL 1LNUB 3BUYA 5KVFH 2J8UF 4JREB 4E41B 4YDVA 5DC0A 1VKXA 2CRYA 4X7FC 3SKJL 2KDGA 4DOHB 2OLDA 3THML 5TGBB 2NXZC 3QUXA 3O8XB 5FCUL 5HGHA 5E7FA 2FSEA 3ARBA 2IMNA 1FDLH 2BC4A 2PO6A 3DSNA 5A43C 5I1DB 1CZ8L 3KXFA 2A6IB 4G7VH 5DK3A 3VD4A 4C83A 1KEML 4MA1C 3ZKXB 4JM2B 1I7UB 1JN6A 3VXME 3MTRA 1R5VB 1LP9E 5IB5B 2AJ3B 2Z31D 4XPBL 1TCMA 3MA7A 2VQTA 4NDMA 2HKHL 4GMTH 4DN4L 4ELMB 3RVTD 3B2VL 3CH1A 4L8BA 2ZJSH 4R9HA 2Y7QB 2EECA 4YXHH 3PP4L 3PWVA 2JK5A 4GUPA 4W81A 1QNZH 3ZKND 1LO5B 3IDMA 3NZHH 2RGSA 3O2DL 1EEYB 2XIDA 4Z7VB 4EXPX 1P53A 4OUUB 5HYJB 4MXWL 1NPUA 2FHFA 4WU5A 5FYJD 3VI3E 3JWDC 4RRPG 4X6DA 3W9DB 1Z9OA 3V6OA 5E6ID 2HT4D 1AY1L 1T04A 4ZO6A 4JREC 4XRCA 1AGCA 4YHYB 1AH1A 2YC1B 1ZA3B 4WU7A 3VXMB 2V9RA 2UWEA 3CZFB 2QSQA 1ZK9A 3VFSA 5A1AA 4LPXA 3O8XC 2ZCHH 4W70A 3TT3H 1V7ML 1E6JH 2AXGA 4N0CC 1A14L 2FNBA 4PG9B 1HHGB 4PGDA 1A5FL 5HHOA 4MQSB 1QR4A 4LSQL 1KENL 4DEPB 1MCWW 4YDLB 4I13B 2JE8A 3BGMA 4L8DA 3WO3B 3ZKXC 4JM2C 4U2ZA 2IAND 1I3GL 2V5RA 1T4KA 3O4LA 3D2UA 3QDJB 1AXIB 3F7RA 3H2WA 4P48A 5HGDB 5K9QG 4LHUD 4P2QE 5EZLA 2HAZA 3HAEB 2QBWA 2YZ1A 3FFCB 4KMTH 2R4SL 3N1QC 1PD6A 4X0KB 5K93A 5IFJB 4WHTA 1BQSA 4CADB 2YD9A 2BY3A 3G08B 5DMKB 1UACH 5CJOH 4Q0XH 1ADQH 2E3VA 3KPSA 3MR9A 1H0DB 5SWQB 3TA3B 2XZAH 1G9NC 5DFTA 4M6NH 4WWKA 5KSVA 4EI6A 5HPMB 1BQHA 1KF9B 2CKBL 3AGVA 1YPZA 4M1GL 2VTFA 1S9XB 4ONHB 1NGZB 4X6EA 1NJ9B 3DXAB 2AEQL 5BOZG 4R7DB 2HRLA 3MX0A 4Y4HD 5LCVL 5HI3C 4PD4J 4YHYC 1RULL 2W60A 4X80L 3WN5A 2IQAA 1ZT1B 4WGVB 5DJXA 3RX7A 3G6JB 2DRUA 1UM6L 3MLWL 1YY8A 5GRVL 3NAAH 2VZ1A 4TSCL 3HUJB 3C5ZB 3RL2A 4WFHE 4RA3A 3VFWA 1VENA 4D3CH 1JGLL 4KJQD 5DWUL 4W6XB 1VFBA 1HH9B 4YC2B 3EJZC 1UEYA 5DD5H 4DEPC 3ARVA 4YDLC 3IS0X 4LCWE 4JLRB 1HHIB 3WHXA 4F7EB 4LSRH 1F8TL 2R56L 2M8XA 3MV8D 3Q3GB 2BJML 5T3ZD 4TNWF 5JHDB 5EORL 3RU8H 1FFNB 1MI5E 3BZDA 3F7QA 4PJIA 5BXFA 4FABL 4ZTOL 2VDQL 4DGYH 5GZOD 3T1WA 1CTNA 1MVUA 4KRNA 1DCLA 3QDGE 1IM3B 5HHPB 3C5JA 3TA3C 2OX5A 3W9EA 2XFXB 3WKNA 1W0YT 2VDNH 2OQJB 5J6HB 1OAZL 1G6RH 2VQ1B 5KN5A 2O5XH 3UYPA 5T1KB 1YJDC 3QEQA 1XCTA 5ABDE 3REVB 1R24A 2B4CL 5DK0B 4JPIA 4FNLH 4OLUH 4PGJA 5I1GH 5D6CB 4IMLA 3TT1H 1KCUH 3V4VL 1M05B 2X4PA 2JCCF 2BVPB 5H94A 4P23B 2CLZB 2J8UA 3DTXB 1S7SB 3STZA 3WO4B 3ZDXF 1GHFL 4PJCF 4BM7A 2H6PB 2NW3A 3HC3H 4Y4KD 2ZCLL 3MJ9L 3DUHA 4K3HA 1A1NA 4HJ0D 4MJIE 1TCRB 1AR1D 1T22A 4XP5L 2R0LL 2VL4A 3C5ZC 5KS9F 1RY7B 3NOIA 4HF5H 3ISWA 3U79A 4IMKA 4D9RD 1MI5B 1RJLA 5GS0L 1G1CA 1AGEA 4I0PB 1UB5A 2J88L 4FTVD 4ETQB 4L8SA 4Z0BH 5I1IL 2B1AL 1YY9C 1QYGH 3LV3A 1K4DB 4B7IA 1ZHNB 3B83A 5A40E 1EEQA 3GUTB 1QHPA 1KB5A 1KJ2B 4KRPD 4HUMB 3TJEH 2E7BA 3SQBA 4LDLB 5FUZL 4MS8C 1UWGH 5I8OH 4M6AA 1IGMH 5I6XB 4GKNB 5E08H 2Q3ZA 1S3KH 2K7PA 3KPPA 2Y07H 5ESAB 4G3YH 4JDZA 5ESQA 3KYMA 3VA6A 1OAKL 4ZNEE 4FHBD 2FJFB 4PJXE 3V5HB 3T65B 5E99L 5HVFB 3D3VD 3G6AB 1LO4L 4OAWB 4YBLC 1WFNA 5HD8D 5AD0A 3W0WE 4HCRH 3VWJA 2GK0B 4KHTH 1IGJB 4PV9B 1WEJL 1FGNH 4NM8L 5HGAA 1A6AA 2CDGA 2VB5A 5GGSA 4NNXB 2OR8A 1L4IA 2LU7A 4P23C 3VXRD 2H26B 2HJFA 4JDVB 3WO4C 5GGRA 1J1XH 1K9TA 1D9KB 3GMLB 2A6DA 3TBYB 4ODWA 3LRGA 5I1CH 5EOCH 3CDGB 2ZPKL 1XGQA 5ICXB 1I9IH 3K7UA 3LPFA 2FATL 3H7BB 5TDNA 3N1FC 5LKNA 1P7QB 3VXQA 4AENA 5FO7B 5DD1H 1X44A 4YR6B 5E00A 1ZT4B 2EEDA 5CLWA 1NCWH 4I0PC 3L3DA 1EEUA 4ZOCA 1KCRL 2CMRL 4HMDA 5I1LB 2VRAA 3IXAB 1N2RB 1U8NA 3C60A 4QXTB 3OAYK 1U0QA 1Z3GL 1Q9OA 1KC5H 3DRTB 2VZUA 4JFQA 2D0HA 1R5WA 4RGMB 5E5MA 4M6OH 3MRBA 5MEND 3TVMA 2YPVH 4JE4B 2WLZA 3W0WB 3DVFA 3HPJB 3EIFA 4NRXB 1J0HA 2BY0A 1U3ZA 1HHJA 4RWHA 5IBLC 4MNHB 4IDJL 1XGTA 2F8OA 3GHBH 5CWSA 2X4OA 3PHSA 3C5SA 1IM9A 3SDCB 4OZIB 4NQCA 1JV5B 2V6HA 3WS6A 2AJUL 4CGTA 5EZOH 1DTUA 3FFDB 2CJUH 3DX8B 3KYNA 4ZPTA 1RUAL 1P4LA 5D1QB 4IRJD 1BJ8A 3WIFA 1T5XB 3FT4A 4LARL 3CSYB 1UXSB 1NBVH 3JWOC 1S7RB 2AXFA 3GMOB 1CLYL 1KN2H 1EPFA 1J0YA 2DM7A 3MLYH 4Y4FB 1EHLL 3STLA 1X5JA 2YN3A 4BSWA 1D9KC 4RMRA 5HI4C 5I66A 4M7JL 2EDYA 2CR6A 1JI2A 1E4XI 2JIXB 3TV3H 4GG8B 3JTTA 5GISH 5DD6A 4BQBA 1MEXH 5HVWA 3NCJL 4YBHA 5IW1A 5T1LA 3S9DB 3QIUA 4MB5A 4V1DA 4AT6B 4M7ZB 4O9HL 4RGMC 2VMFA 3BVNB 1TVBB 3FQXA 1OSZA 5EC2A 4PGEB 2EDRA 1I1RA 2V7NA 2F74A 1XF5A 3SDXE 2V2XB 3OAZH 1BLNA 1YN7B 4BZ1H 4PRPB 3TZVB 3WDIA 2G9HA 5TPWL 4OCXH 4Z95H 4LCCB 2NY4B 4Q2ZB 3SDCC 1H8SA 2IF7A 5DJ6B 2NNAB 4G6FB 3LS4L 4O2EA 2ATKB 5EWIL 1PSKH 3TH4T 5IVXB 5DJDA 2YBRA 2EYSA 4ZOEA 2ED7A 5IESH 4GH7B 1ZVSB 5D1QC 1FYTD 1A7NL 1FJ1A 4L4TB 5IROA 4Z5RA 4RMWA 4XPHL 5E1AA 3CCHA 2CXGA 2ZWLT 4UOW0 3VI4F 4PJBF 3BPCB 4GOSA 2R15A 3D69B 1FFOB 2V5YA 1ZLUK 5L2JA 5I76A 2HTKD 2EC9U 1ZEAH 4MDIA 5DUBA 5E95B 5ID1B 2IPUG 4FXGB 2JCCA 8CGTA 5JIIA 4Y4FC 4OZFH 3OTTA 3T2NL 4C4KO 1UB6A 4KK6C 1XZ0A 1BHGA 2BHYA 4L9LB 1PX3A 4PJCA 3MRQB 3GI9L 1MREH 4BSJA 5I15H 1YNTB 5JQ6H 1I4FB 2CQVA 1KNOB 1KXTB 3HC0B 1WUNT 2R9HD 3X3GL 5KS9A 2VL5B 3TJHC 1I7ZB 2Q86B 1RZKL 1FNGB 3FCTA 3KYKH 1DBAH 4FQCH 2E5EA 1A6PA 4LHQB 1EJOH 4JRYA 3OKDB 3QJFA 3FTGB 4GW4A 1LDPL 4M7ZC 3TO4A 4OQTL 3WDHA 3QPXH 4M7LL 1QR1A 1CDGA 5E2WH 5GJTL 2CDEA 1A4JB 1N59A 5IT2L 1OOAA 3UTTD 1TTFA 3RVXD 5F7EH 3TZVC 3AXLA 5HHNB 1YN6B 1EFXD 1KPUA 5F1IB 4FQLH 4ZG1A 3HAEG 3DGGB 2ZOKA 2E9WA 2IGFH 3VH8B 1IGIL 4LCCC 2NY4C 2XKNA 3P4NA 3V0VA 1N8ZB 1RSFA 1U6AH 3LMJL 2B1HH 3IVKA 1QLFB 3MUGB 2IEPA 5KVDL 1JNNH 2DLGA 1CICD 4EI5D 1MRDH 2P7TA 1E4XH 5D7LE 2VDOL 2X40A 4YE4H 2DJ4A 1KLGB 4GRWF 5IB3B 4M1CC 4S1RL 3AAZB 5CAYB 1UJTA 3UPRB 3W2DH 4KROD 4UINH 4TOYL 4R4FL 5TE7L 4X8XA 3R0MA 4Z77B 2DWDA 4WTXA 1IEBB 4L9LC 4XHJC 4DQOL 1DUZB 2OZ4L 4TVPD 4Z7QF 4CN4A 1IAKA 3L7EA 5DR5H 1G6RB 3REWB 5GXBB 4K3GA 4LSUH 3H9HA 1ZXQA 2VXQH 3DV6B 3PUCA 4PP1D 1UC6A 2CK0H 1HQRB 3V6FB 2BFVH 4LSPL 5GGTA 5C07E 1RZJL 4WW1A 4JFFD 5KVFL 2FWOA 2NW2B 2VDKL 2VLKE 4OF7A 1LEGB 3ULVH 1Q0YL 5D7IE 1CE6A 4KHXH 1AGBA 5BS0D 3CK0L 3K4AA 5TH2B 3U4BH 1X5LA 2C7UB 4JRXB 4RNRB 4N68A 3ZE2E 2NR6C 3T3PE 2J6EL 2PKDA 1MVFA 1RUQH 3JTSB 2Y5TB 2VC2L 3I85A 3SCMA 2ICEA 2DQFB 4AEFA 5ICYA 1NBZB 1T6VN 1LE5A 4G5ZH 4JFEA 3OKEB 1MAKA 5KAQG 4ODSH 1JGDB 5GRVK 4EBQH 2D7OA 3T0EE 2YKLH 3L7FA 5DFVC 3M8OH 3HKFA 2ZNWA 4KZEH 5EU6E 4GMTL 1RIUL 1TZGL 4JO1H 4YHOH 1P69B 3FT2B 3QEUB 2HMID 4X5XB 5IMMB 2V5TA 4Q7DA 2JELL 5FUCC 3WJJA 1B0RA 3C08L 3N1GC 5C07B 2ZJSL 1INDL 1RZFH 3BKJL 3VWKA 2VLKB 1REIA 1OWRM 4LAJH 4JZNA 3NZHL 1K6QL 5D7IB 3QUXD 2A83A 5CBEA 4X4MA 1RJYB 4HMEA 3EO0B 3ARBD 4HAFA 2FO1A 4C56A 3EW3B 2PO6D 3KXFD 1S78C 4BYHA 1FL6B 5DMGC 3G04A 3NIGF 5MHSE 4HJGA 3T2PA 3QQNA 1OPGL 4TULH 3N1PC 5SWZA 3KR3L 3BD3A 3G9AB 3I75B 3OKOA 1NDMA 1AE6H 4XAKE 1R3LA 2GJ6B 4S1SH 3QO1B 2W9EH 3FQRB 4P9HL 2BSRA 2ZCHL 5KTEL 3MO1A 4PJFB 2XT1B 2KPNA 3NCBB 4JY5H 2X9YA 3ECBA 1XGRA 5DA4A 1JTTA 3AS3A 4FQXB 4WFGE 5BRZE 3HZKA 5TFSH 4JAMB 1AGDB 3Q5TA 1P2CA 5BVPH 5IJKC 3HG1A 1MH5B 3IU3B 4P2CG 1UM5H 3UC0L 4PJBA 2XA3A 2V17H 4FRWA 3V4PH 3Q5OA 3ROOA 4EOWH 2R0WL 2P24A 4NC2B 3V95A 3ALPA 1BFTA 4JG0H 5BW7C 4YUEL 3GMRB 2GCYB 4L5FH 1GL4B 3BH8B 2X7LA 3GKWH 2FJHA 3B4NA 3T0VA 1ZGLA 5T3XH 1ZS8A 3ARPA 3WD5L 3BZEA 5F93C 2CRIA 2EC9T 4ESKA 1OTSC 3QQ9D 4MD0B 5E9DA 3FZUC 3S96A 5CEZH 1UEMA 1YEFH 3VG9C 3DECA 4RGNE 2A2QT 1RZ8A 3FN9A 5EU5A 4OLEA 1KOAA 5IIEA 3O6MH 4FS0A 5CD3A 5GS3A 4LRIC 5F3HA 1JF6A 5HYSA 4GAGH 4MAUH 3WLBB 3KDMB 1XGUA 4U3HA 5JW5A 4F7PB 1DLFL 3D2UD 2GAZA 3TNNA 1T1XA 2AABH 4KK9C 4MD5B 5FHBH 5JQHC 3S88H 4XX1E 1DBJH 1U95A 4XNQB 2DLHA 5FUOL 3GI8H 3O3EA 2YPKB 4R26H 4Y7MA 2BK8A 5DUPL 4D3CL 2VLRA 4HD9A 2ITDA 3KVQA 4Y5YA 3KPSD 4D9QE 3ABZA 4XMKH 4FQXC 5ISZE 1H15A 4WI5A 2VWEC 3QUZB 4WWKD 1Q8MA 4UIMA 4YJZL 2WINA 5J3HD 1HKFA 4ZSOA 5IEKB 5JW4R 3AM8A 3WNKA 5B8CB 2J3SA 4NC1E 1BIIB 3LY6A 4O58H 3N85H 3LS5H 1P5UA 4P3WA 5F7WC 4EDWH 2C3WA 1EAPA 5A3ID 4OZ4A 3VXTA 2C3VA 3KPMA 5IJVA 3RPIB 2VDNL 4OT1H 4NWTL 4XMPL 1BBJA 4OBRA 2R23B 4WW2C 3RX5A 1N5AB 4O51A 5T1DH 2O5XL 1M7DB 4PS4L 1MFDL 4FNLL 4HIHB 1N6QH 4OLUL 4AH2B 4XVSH 2NY5L 4PRHB 1HXYA 2FEEL 4G8FB 4NQEE 4FQQA 4OZFB 4QF1A 3EOAB 3GM0A 3PF2A 2V7HB 3QR2A 2YK1H 1IGFH 1YDPB 4WFFD 2DDQH 1CLZL 2MHAA 5ERWA 1K4CA 4OCWH 5IV2A 4GXVL 4XC1H 4LPVA 1RUPL 1Q1JH 1C7TA 3FRPA 2I25N 5DA0B 3BDBA 5D7JD 1L0QA 4YHIA 5L9DL 1E27A 3QUZC 3CVHA 3RQ3A 1X5KA 4KDTA 5IR1A 4AG4L 5JW3H 3PHOA 4F7MB 2BOBB 3TJEL 5KSUA 1T0NB 1FLRL 2V5MA 1JYXA 3HI1A 1F2XK 1TVHB 5B8CC 2IFGA 1CDHA 5LAXA 1OD7A 1Q0XL 5HJ3B 5GGUB 4QRRE 4QYOB 5A2IH 4U1LA 1SYSB 2WUCH 3HNVL 4QRUB 1KBGL 1R3HB 2E6PA 4JPKH 1VEPA 3SY0B 5IGXH 3RL1B 1LEIA 2X89A 2HN7A 3U9UB 3TLRA 3RWFB 5GS0D 4NKOB 2FX9L 5FYLE 5HDBE 1NAKH 4KHTL 5GSVB 4R7NA 5CD5C 4X6CB 2OL3A 4I3GA 3QWRD 4NO0D 2EDNA 3MLXH 5I8CB 5DRNA 2MPAH 1N4XH 2XPGB 3OZ9H 3SKNA 1TJGH 2PYEB 2V2TB 3BP6B 1RURL 4XI5D 3OKLA 1GOGA 1AJ7L 4DK3A 3IFPA 4QRQA 1GYAA 2XQBL 3VGDA 1JP5A 5F3BA 2IPKB 3MBEB 2X1QA 4YDIH 3NIDE 3NCFB 5DT1L 5I8EB 5D5MF 1QO3A 3RDTB 4JN2A 4K3JL 4P2YA 3UAJD 1ZHBA 1XF4B 1YEEL 1HILB 2BSTB 4LHJB 3OAUH 3VH8G 1DLHA 3O6FB 3MCKB 2MTPA 4JM4L 1GIGH 4GT7A 4LPTA 1TETH 3RWCA 5GZND 3FB6A 4LSTL 4XCCL 4XPAH 3MOBL 3VWJD 4M6OL 4XNUL 3NFSH 4KJWC 4IBLT 3D85A 4F7TB 4NYLA 1J18A 1IC5H 3QXUA 5D72H 1N0XH 1S5IH 1EBPA 4LCIL 5F1SA 3MJ6A 3DROA 3QUMA 3S8WA 2DI9A 3FO9A 5DURB 1V8HA 2IG2H 4PJ7E 2FGZA 4KKCC 3RUGE 1K8DA 2N56A 1SJVA 4DAGL 1MSPA 1WCBA 5MEOB 1DEEB 1CXEA 1QPPA 4DKEH 1QSFA 1XGPB 3HE6A 4NRZB 3U0PB 3WFHB 3KLAB 2XN9A 2B2XL 4CKVX 2NX5A 3WFCL 1IQDB 2BVEA 3QPQD 1NBVL 4WNQB 3BRFA 2Z8SA 4P2RB 4GG6F 4UB0H 3HZYB 4D8PB 5LGKA 4UQ2A 1T7YA 2EDKA 1UXWA 1FYHB 3MBEC 1OQOA 4PJDF 2A38A 4ZXBC 3TVMD 3TBSA 3ZSSA 3MOAH 3QFJB 1BAFL 2PN5A 5D7SL 5JPNB 1NGQL 3MRDA 3PWNB 5IHUL 3IDXH 4ZFGH 2ZOLA 3RDTC 3BKYL 4WUUA 3HNSH 2CIIA 4HIXH 1SM3H 2HJKA 3GK8H 1BFVL 4HPYH 4NQCD 3RWGB 3O6FC 4JQIH 4QRPE 1IAIM 5FGSA 1R3IH 4LLDA 3DETC 1C16B 1GZQA 4KQ3H 3RY4A 2H45A 5DQJA 3D1MC 4Q9BA 3WEXB 5J8OA 2CLRA 4HGWB 4L29A 1KCSL 4XB8A 3ULVC 4NQSB 4KGLA 3F5WB 4ZDHB 1V7NH 3G5XA 2AI0L 2VERN 5KG9A 5CEZE 1QFWM 3BEVA 2QTEA 2ZKHH 3HI5L 2UZIL 1FV1B 4AEHL 1IGYA 2OS7A 3IDUA 3ZYJA 5FA3B 3X17A 5JTWA 3VA2C 1U8IA 4EQ3A 1XCQA 5EU3A 2R1YB 3HZVB 3GRWL 5HGBB 4Z8FH 6FABH 1ZE3C 1EX0A 1MCFA 3DNKA 4G80B 3SGKC 4X4YB 4FQPA 4DCQA 1G0YR 1D5MA 1NFDE 5GQBA 2O5YL 1MCEA 1G7QA 3SE9L 1BD2A 1INEL 1IEAB 3H42L 4KTEH 5FV1L 2Y36L 2K9UA 1ZEAL 5T1LD 3DSFH 3QIUD 1OAXH 3B9EA 1CR9H 1MCQA 3IXTA 4V1DD 3ARGD 1T1YA 3BKCL 2EYTB 5C0AB 3PABB 4ZFZB 3TNMA 4NKDB 3EYFB 1JMZA 4UV4H 3ZHDA 1AIFA 4XGZB 2R2BA 1LK2B 2UVEA 4J6RL 2FIKB 4MQXD 1EV2E 1E0OB 3FT3A 4XVTL 3SDDB 5CP3A 1WC7A 4UNUA 2NY7L 5E7BA 5D2LE 3F65A 4R3SB 1ULVA 4Q97A 3QA3B 5JR1L 2VDPH 4OB5L 1C12A 4XCYA 4GW1B 2ADJB 3CSGA 4JFOA 4OIIH 1NANI 3UTPD 5C1MB 2P5WE 3NCYP 3S3JA 1T7XA 3STBA 1V3KA 3NVQA 2R2EA 1XR9A 1IL1B 1D6VL 4HDIA 3BEWB 5F8RC 1MCPL 1P5VA 3P4OB 4JDTH 4WI3A 1G7PB 4YNYA 2GJJA 4NT6A 2AK1L 3WFEL 3S36L 3S98A 1OB1A 1JUFA 4JM2F 3VW3H 3Q5YA 1VFMA 3N06B 5DQDL 4YIQA 1WISA 3VFMA 1S7UB 4WTWA 2EDTA 5FGBC 4YHZH 1JFQH 1BX2A 2HWZL 2GTZA 4HH9B 4QOKA 2I07A 4ELMF 3MUHL 3QJHA 1RU9H 5L2KE 1IZKA 1MRDL 4RQQA 5CIPH 5JA9A 3F7VA 3MNVB 5ITBL 2F54A 4YBQC 4OUOA 3HTLX 3OHXB 12E8L 2HLAA 3QWQB 4MXQC 4BZ2H 5K9OB 5D2LB 3O11B 3QDGD 2JB6B 4WEUD 3C2AH 4LLVB 1QRKA 4HX1A 4OCNC 4Z7VF 3MACH 4TVSa 3TO4D 1CK0L 3ZE1E 1QEWB 5EU4B 4NPYA 1JZ3A 4N0UE 1FZMB 1JRHL 2E8YA 3BIKB 3SDDC 2CUIA 4K9EL 5D5MA 1RUMH 5IB1A 4QT5A 2W91A 1TNMA 3PP3K 1MOEA 2JJUA 3DO3A 4JFDA 2WIIB 2XZQL 4CVZA 1B0GA 1QRNB 5FA4A 2ZSVA 4U6YA 1QSZA 2VITB 1I9JL 4YFLI 3SJVB 1SYVB 5AZ2H 1KLUB 3BE1L 5J7CC 1LD9B 1M71B 1NUGA 4FP8H 1P4IL 5C08E 3BN9D 3MRRA 3F7PC 3X11A 4XMLH 2BVTA 5DJ0A 5HVGB 1QPXA 3CMOL 3GBMH 2DBJA 5FYLL 4P5MA 1MFBH 2OTPA 3GSVA 3L3GB 3VFGH 1A2YA 4PJ8A 5F7DB 4Z78B 1F3RB 1RUQL 5T33L 3KYAA 4J4PC 4CU7A 5IF0A 4UILH 4HC1H 4JKMA 4NKMA 4I9WD 5JPMA 3L3OA 3FONB 3RVVC 4GRLB 3BO8B 4DVRL 1IGTA 5HHQB 2CK2A 4APQC 2Y6SC 2XKSA 1NCAH 3VI3F 4RGOH 1LWRA 2RB8A 2IQ9L 3P77B 2VN4A 4WTZG 3QSKB 2OXHA 3BWAA 4HG4J 3DV4B 4GG6A 1I7TA 4JG1L 3Q0HA 4NQXA 4OZFG 4PJDA 1ACZA 1NANH 2NPLX 3DRQB 4O2CB 5B22A 3VGGA 4B0MM 2I9TA 2NCMA 1N5YH 1NEZB 4S2SA 1OTUC 3ZHKA 1T66D 1F4XH 4URTB 1BBDH 1I1FB 5DUMH 4XVJL 1BZQK 1S9VB 1CDIA 4LRNH 2IADA 1T7WA 3G6JF 4PJGE 1YMME 2KH2B 2QQQA 2WSKA 1EMTL 5DYOB 1PQZB 3WCYA 1XF2A 3HUJF 2AJVH 4JFED 4HK3N 4LSSH 3EYUL 4D9LH 3RA7H 4TRPH 1AE6L 3IFLL 2MJWA 5J4MA 1WT5C 3TYGH 1GXEA 1SEBB 4AM0A 1UZ8A 2A9MH 4WO4B 3WS3B 1BEYL 1NGYA 3V6ZA 3WIHH 5I1KL 3TIEB 4KZDH 2LVEA 5CZVH 1BQLH 3VWKD 3BZFB 3ARTA 2DBLL 4GRLC 1NFIA 5ACZB 3PGCB 1U8KA 1UM5L 2I60H 4Z7NE 3IJHA 4KUZL 3EYVA 2GUOA 3CU7A 4XP9L 4C56D 1R3KB 4PJ5E 3SE8L 4JG0L 5CHNA 5KAQF 1YMMB 3CFBA 3V8OA 4H1LH 5SWZD 2XYCA 3PGFH 3LQZB 4JHAL 4HIJB 5IFHH 3C8KB 3MRIA 4KI5E 1JIBA 4GKSA 5FYKD 3U82B 4ZPVB 5GRJH 4LU5L 4ORZC 5CEZL 1U8MB 1MNUL 1OL0A 1J8HE 2H2PD 4E41A 3SBWC 3OR7B 2P44B 1YNLH 1YMHB 3O6ML 4MZ3A 5I1EH 5TGBA 5EA0L 3RIAK 3VFUB 1JGVH 4YWGH 3O8XA 3HG1D 3G5YA 4MCZB 1WVZA 2ATPB 3QNXA 4LVEA 2DKMA 4U1IB 5FHBL 5I1DA 4ZS6C 1MRFL 2A6IA 4ZYKB 4CL7A 4WO4C 5SV4A 1OAUH 5EUOB 4PUBL 4JM2A 1I7UA 5I8KL 2FBJH 2NYYC 1NAMH 1R5VA 1A7RH 5IB5A 5FIEA 3SDYL 4M48L 2AJ3A 2K3TA 4HS3B 3T2OA 4OLVH 4OV6F 4ELMA 1U36A 1F2QA 2KKQA 3QO0A 2DLIA 4NO2B 1NCCL 2WUBH 5FYJU 2Y7QA 3BDYH 2P4AB 3JV0A 2A77L 5F9JB 3GSWB 1J8HB 4KJYA 1SEQH 2YD1A 2OTWB 1QBAA 5TDPB 1LO5A 2H8PB 4XP4H 1EEYA 4Z7VA 2XTJC 5A16B 4OUUA 3INUL 2HT2C 5DMIH 3RWJB 1Z5LB 5HYJA 4Y19D 4PRAB 4XXDB 1KUMA 2BNQB 3FQNB 3K1DA 4OF6A 3W9DA 2HT3C 2BNRE 1ZSDB 3PJSB 2C1OB 5IOPB 2VLRD 5CMAB 2FD6L 3UJIH 1DL7L 2YC1A 1ZA3A 4BA8A 4U4BA 3F12B 1DQLL 3IDIB 2KQNA 2EE2A 3FB7B 1MCRA 4EZMA 4FZ8H 2RJMA 1AFVH 2AJSL 4HV8B 4PG9A 4P99A 1A3LH 4QXUH 2QV2A 1K2DB 1Q72L 1MCNA 1CIUA 4G8GE 3UX9B 2DQJH 5IHZB 1VEMA 5GGVY 3QDJA 5HGDA 4LVNC 1DUYA 3HAEA 3FFCA 5I1JL 1IC4H 1CE1H 4UT9H 4X0KA 1UADC 1KTRL 5IFJA 5D6DC 5IEHB 3PHQA 3G08A 5DMKA 4OZIF 2BNRB 1H0DA 1HCFX 5SWQA 3TA3A 3U0TB 2V5SA 4ZO8A 2XKUA 2R4RL 3MLVH 4Y5XB 4MNQE 5HPMA 3JV6B 2E27H 5I2IB 4Z0XB 4PJHE 4AMKH 4HWBL 1S9XA 4ONHA 2NY1D 1MAJA 1NGZA 4IOFC 5J13B 5D7LD 1NJ9A 5MP6L 3DXAA 4JY4B 4R7DA 3IKKA 5CIPB 1J0JA 1J05B 5KJRL 4KDWA 1KIUA 3UTOA 4P2OB 3RY6A 3EDFA 3S3PA 3MRLB 1ITBB 1ZT1A 4Y2DD 3G6JA 2A74B 5B4MC 1FAIL 3MCLH 4ONGL 1MPAL 1AQKL 1TJGL 5M95B 1JF1B 2R0KL 3HUJA 5FHAH 1JHTB 1H5BB 3C5ZA 5DRXB 1T2QH 2EO9A 4PJAE 1N3NB 1HH9A 4WCYL 2FR4B 3WFDL 4NUGH 4JLRA 1HHIA 4HGMA 4F7EA 2VNCA 1W72L 3VG0H 3BYTA 3Q3GA 3QDHA 2QQKL 5JHDA 2YD4A 1P4BH 2YD3A 3HLAB 5ETUB 1FFNA 2G2RB 3ZKMC 2PYFB 2X89D 5C0CE 4ORGA 2P47B 1C5CH 4JVPA 2N4IA 1IM3A 5HHPA 1CFSB 2CIKB 2IH3B 2AK4E 2XFXA 1B88A 2EDEA 4PREB 5JA8B 2VJXA 4S11A 5IVXF 1GZPB 3CC5B 2VXVL 3QUKB 2OQJA 1N0XL 5J6HA 4FG6D 5ADPL 2VQ1A 2JJWA 4PY8J 5T1KA 3GIZH 2VSDA 1SMAA 4NBYB 5DK0A 5J13C 1G0DA 5KSAD 2AEPL 4O2FB 5D6CA 1YEHH 2FHCA 1M05A 3PDOB 4P23A 5E2UL 2CLZA 4P2OC 3GSNL 2DQHL 2GHWB 3PQYE 3DTXA 1S7SA 2H6PA 1B6DA 4M43H 3TO2A 4UIKL 3E6HB 3MRKB 5EPMB 3AFLA 5C6TH 1WZKA 3TCXA 1H5BC 4PPTA 5KW9H 1EO7A 2I27N 3BMWA 1DQQB 1W0WB 4KRLB 1PLGH 4ODXB 3VDBA 4U7SA 4FXLA 4I0PA 1JPTH 3BT2H 3IJYB 4RAUB 4HXAH 4ETQA 3D85D 5C9JB 1K4DA 1YZZA 2C5DC 1ZHNA 1GOFA 4KC3B 5F9OL 5D2NB 4HIXL 1KGCE 3GUTA 1KJ2A 2F8VA 1RVFL 3L5XH 3ZZ1A 3HNTH 4X7TB 4LCUB 5KOMC 1RZIB 4I18C 4ODBD 4F9PC 4GKNA 4OGAD 4JGMA 3NIFE 1OARL 5JOFB 5ESAA 1HIMH 3HE6D 4OCYH 1BWMA 2XN9D 3V5HA 3T65A 4NZJA 1BJ1H 2NX5D 3ULUH 5GGSY 2AP2A 4K2UH 4OAWA 3G6AA 2J8OA 1BP3B 1GPOL 1QFOA 1UWEL 4JKLA 5GGRY 1ZVHA 3SKOB 2GK0A 1IGJA 3BXNB 4PV9A 4TPRH 3TBTB 4OZHB 5C2BH 5EIIA 4NNXA 3BZ4B 3OB0H 1GOHA 4YQXL 4WUUD 3ELAT 4JDVA 4KK8D 2COQA 4XPTH 1D9KA 3GMLA 1NEZG 4MX7B 3TBYA 1YQVL 2HVJA 5GRXG 1X5FA 5L7XH 4KTEL 1QSEB 1J5OH 4I3RL 5ICXA 1CXLA 4UV7L 3H7BA 1HKLH 1P7QA 4H1LB 4UI2A 5FGCE 2X4NB 5FO7A 2A0LD 2G60H 4YR6A 1ZT4A 4UV4L 5I1LA 3IXAA 4ZD3H 2GT9A 1N2RA 1FO0A 3LQAH 4QXTA 5EDXA 1K5NA 3NCYS 1DP0A 2EXWD 3DRTA 2A1WH 5D2NC 2PTUA 1CG9A 2MKLC 5DJCB 5KOVC 1NGWB 3OKNB 4H0GA 1S7WB 4LBEB 3TYFB 3HPJA 3LKOB 3VMOA 5HHVH 5IBTL 3WL9B 1EZVX 3GSUB 1D5XB 5I19L 1JL8A 1A7OL 1MHPL 4MNHA 5D8JL 3ARDB 2ADIB 1WJ3A 3SDCA 3RX8A 4OZIA 1BD2D 3MV9E 1JV5A 4JDTL 3GMNA 2VUYA 1FC2D 2YPLE 4NM4H 2GK2A 4N90D 3FFDA 3DX8A 3E3QE 3RI5K 3NA4A 4P3DB 5ISZD 4HUVB 5D1QA 3SDAD 1NAMB 4LGPB 1F42A 4TSBH 2FHBA 2HTLC 3CSYA 3ZL4L 4QXWA 4ODTH 3GMOA 3LHPH 3VU2A 5ILTL 3HE7D 3MZTA 1ZTXL 4Y4FA 2QQLL 4X6FB 3KPLB 1HYSD 1KACB 2P45B 3CDYA 2VLJB 1TDQA 4N0FB 2OSLB 2JIXA 2UY6A 4BZ2L 2J4WL 4YZFE 4GG8A 2Y25A 4QHMB 5D7IF 5ANME 3MACL 3TCLB 3ARFB 4CVXB 1GGUA 2DF3A 4HQQH 5JORB 2VABB 2JTDA 1T7ZA 4H88H 2Q8AH 2PTVA 1U3HB 2VO5A 1RUKL 2V2WB 4MXVF 3MV9B 4Z7OF 3HA0A 4AT6A 2YPLB 2F19H 2BXZA 3BVNA 3ZDZF 1TVBA 5DTFB 3C8DA 1A6WL 4PGEA 2DWEB 4CAGA 1EEZB 2IAMD 4ODHH 5DRWA 2V2XA 3U6RB 1YN7A 3R1GL 4PRPA 4QOKD 3BKML 3TZVA 5SWSB 5D71L 3UZQA 5JXAH 2FGWH 4CMMB 9CGTA 3ARDC 4PJFF 2FX7L 1OGAE 4AY0A 4LCCA 2NLJB 2F54D 5DJ6A 2NNAA 3S3SA 1JNLH 1PEWA 2ATKA 1EVTC 5AG9A 1Z0MA 2DQIL 3FQUB 4M5YL 1TMCB 5IVXA 3QIBB 1ZVSA 4L4TA 4GQ9H 3UJJL 3GIVB 3BPCA 4HKXA 3G5VB 1Z2KA 3D69A 3K0WA 5DF0A 4YPJA 4UILL 3Q6GL 2C4FU 4XCEB 2JB5L 3GMQB 2HFGH 1CFVL 2EH8H 2ERJB 4FXGA 4L3CB 2VR4A 3QNYA 2P5EE 5IVZB 3IAQA 1ADQA 4L9LA 4JFDD 3MRQA 3D25B 3W11D 5CBAB 2ZUQC 1YNTA 1I4FA 1KNOA 2YA1A 3HC0A 4UTAH 2RR3A 3H9SE 5FV2A 4WW2F 2VL5A 4JPVL 3LCYA 2CSPA 1I7ZA 2Q86A 3QXAB 5ENWB 3VE0B 5TQ0H 5GRUH 3BPOB 1W0VA 3RWHB 1U3HC 3OKDA 1OGAB 5IM7B 3FTGA 5I75B 3RZCB 4LOUD 4PJ8D 3MGOA 3MUZ1 1AO7B 2WWKO 4UQ3A 5B39B 1NCTA 1KULA 1A4JA 1KIPB 3MRCB 2WWMC 3DX7B 1WAAF 5D96B 5C0BB 3S35X 3FOLB 5HHNA 4OV5A 4QNPE 2XOTA 4BQCA 1YN6A 1YEGH 4LSSL 5F1IA 1JJUA 3I6KA 3DGGA 3RA7L 4MQTB 3VH8A 1D5IL 2JJSC 1CTOA 1N8ZA 2ESVB 1Y6KR 3TYGL 1QLFA 2HRPL 1ONQB 3MUGA 1IJ9A 4L3AA 4PBVC 3WE6B 3RWIB 1DBBH 4F33B 3OJVC 4PLJC 5IBUB 1UCBH 2CRZA 1F6LL 1OSPL 5CJ8A 5E8DL 4LNRB 5F88B 4I3SH 4KZDL 2HH0H 2VSCA 1KLGA 3ESVF 1AR2A 2I26N 2A9NH 5IB3A 2ERJC 3CGTA 3AAZA 2RCSL 3HMWH 3GO1L 3UPRA 3JSSA 3DWTA 1DBKH 1IAII 4Z77A 1WWWX 3HMXL 1IEBA 4JO4L 1DUZA 5HHME 3IRZA 1ZGLM 4RFOL 5T5FH 3H3KA 1CXIA 1G6RA 1OQXA 3REWA 2NXZD 4ALAH 3C6LB 3CFCL 1MFEH 3DV6A 3NZ8A 5FYJE 3TEUA 5LWYL 3D39A 5KVEL 2BVQB 5DVMA 1HQRA 3BPOC 3V6FA 5IFHL 2H1PL 4N1CA 4HBCH 3BESR 2DJUA 4MSWB 5FM8A 1GGIH 3WIIH 4OKDA 1RJCA 5I75C 3RZCC 2NW2A 1A1MB 3EO9H 3D0VB 3OSKA 1LEGA 4FQJH 2Z31B 4IS6B 5D96C 4S1DC 3AVEA 5TH2A 4LF3B 5TE4H 2C7UA 4M93B 4JRXA 4OD2B 3PDDA 4RNRA 3T2QA 4DN3H 4GW5A 2WBKA 3CSBA 5C6WH 5I0DA 3JTSA 2Y5TA 4YEFA 1BGXL 5JMOC 2DQFA 2DQDL 1OAUL 5CJ5A 3BPLB 4PGBB 4QRPD 2NY6B 2DLFL 3OKEA 5IJKA 2CXKA 1EGJH 5DVOA 5HDLA 4XBEH 1JGDA 1L6ZA 3U36B 4HFWB 3HR6A 2APVA 3CLEH 4I77H 1L9MA 4BZYA 5JW4M 3FT2A 3QEUA 3S35H 3TIDB 5BW7A 4X5XA 3UYRL 5IMMA 1H3TA 3CPLB 4WV1B 3BRDA 3B2UD 4ZTPL 4E41D 3BDYL 2QHRH 3U4AA 3DUUA 1RJZB 2BRRL 2HVKB 3C6LC 4HCRA 3MUY1 3O8XD 4JB9L 5E2VL 1A7PL 4KVNL 1KCVH 1RJYA 2IC2A 4N0CD 1INQB 4L3EE 3EO0A 4OLZH 4X6CF 2XZCH 4PJ9D 4TQEL 3U4EB 1C8PA 1FL6A 5HI5C 2WWKT 2IANB 4CDHA 4N8CL 4LRIA 4JM2D 5IVOA 5I74B 4EN3B 1MF2H 5LXGL 1DN2A 5HDOA 3MA9L 3FN3A 3I75A 4LHUB 2F5BL 4LFHG 5D70H 1CIDA 1G7LB 2GJ6A 3NPSB 3QO1A 3NN8B 1H8NA 3FQRA 3U0WL 5IHBA 2GSGB 3WXVH 1QVOB 4MGXA 4PJFA 1QKZH 4OI8A 1A3LL 1MAML 1AD9B 1A9BB 4X99B 3MV8E 4PGZA 4FQXA 3F6LA 5T3ZE 1IAIH 1A3RL 3BPLC 4JAMA 1AGDA 1NLDH 3MRPB 2NY6C 3NCCB 4UTBL 4HWNA 3ULVF 4EVNB 3IU3A 1W8NA 3NABL 1S7QB 4JN1L 5HYJD 1SY6L 4LASL 2H32H 5DSCA 1Q94B 4JHWH 3LRSB 3FAXA 3WNOA 1ZLSH 4PJEE 5BMFH 4PRDB 4MA7H 1S9YB 3S37L 2WQRA 3GMRA 1FCCA 3TBWB 2MOVA 3BH8A 5HI3D 1MCIA 4EXKA 5KANI 3ULUC 5IMOB 4MLIA 2C4FT 5IB2B 4YHPB 4JY6B 5E1HB 3S34L 1TQBB 2J7LA 4EKXA 1HNFA 5DDHB 3W81A 1MJ7L 2EIEA 1IBGH 4LLWB 4MD0A 3AC0A 4WW2A 3OAYH 2YD8A 2OJZH 3WSQL 4WI2A 4H1LG 4NNPH 3EJZD 3WDJA 2BSSB 4XNMA 1U8QB 2QEJA 3BQUB 5I74C 4EN3C 4MAYB 3KDMA 3WLBA 1AI1L 2W38A 3SEPA 3J8F7 1PJ9A 2EDOA 3KWWB 4QHUB 3GSRB 4F7PA 1X3DA 4MCYB 4YHKH 2L0DA 2CD0A 4MD5A 1WAAA 1HK6A 3NPSC 3QHFL 4NKIL 3FFCD 4XNQA 4FTVE 2YPKA 4YFDB 4Y0GA 4J1UB 1HXMB 4DFIA 1XGYL 3LQAC 3TA3D 1FCGA 3D6GA 2FCBA 3QUZA 1FH5H 3SOBH 3BJLA 5IEKA 2F53E 3HZMA 5IQ7L 3MBXL 2DMBA 4FQIL 3OPZL 3DXAD 5B8CA 3QIWD 4PR5B 1BIIA 3FQWB 3G5ZB 2EDLA 5GS2H 3IU4L 4J3OC 3C87A 5CEYB 1Q9KB 4LL9A 1VESA 3D3VE 3CXHK 5IQ9B 4GSDL 4Y4KB 4HPOH 4YDKL 1FQ9C 3RPIA 1PGRB 1TQBC 2ICCA 3EO1B 2XV6B 2YEZB 5C0GB 2N7BA 3BW9B 2R23A 1N5AA 3C5ZD 4KAQH 4WTZA 5JNYB 1M7DA 4JCLA 5LJYH 1QBLH 5INCB 3CLFH 5GS1B 2DKUA 3RZWA 3VFVB 4HIHA 2B0SL 3VXRE 4NHUB 4AH2A 1YY9D 4PRHA 1A1OB 4G8FA 3QRGH 4GAYB 3BQUC 4OZFA 4ZQKB 3KJ4B 1MJ8L 4MAYC 4TN9A 1CF8L 3EOAA 4PG2C 5E56A 4S0TD 3EFFB 2V7HA 4NQUA 3ZT6A 1YDPA 5JHDD 4HJJH 2G75B 4OFVA 1HHKB 4MS8D 2BRQA 3CVIH 4OFIA 2WIMA 3ZKSD 2BVOB 1X7QB 4GKZB 3SKJH 1O0VA 2NXYC 1RHFA 3V6BR 1MFCL 1ZLUH 5MENE 4JHZA 4H25A 3AS0A 3N0PB 4F7MA 1VERA 2BOBA 3HCVB 1T0NA 3GBNH 4WRLA 3QG6B 4I48B 1TVHA 1XT5A 5FYJL 2VDMH 1KEMH 1NC4B 4J12A 2I24N 2E7LC 3V7AG 5HJ3A 5GGUA 1FN4B 4QYOA 3MJ8B 4P23D 1SYSA 5JUEL 2ARJQ 2EEBA 3KS0J 2Q1EA 4QRUA 4I2XB 4XPBH 1KIRA 4HJ0C 3SY0A 2BDNL 3T3MF 1AR1C 1LILA 2HKHH 3RL1A 1RIHL 2ENYA 3B2VH 4FFWC 2FEDC 3U9UA 4X9HA 2WM0A 3RWFA 1R0AL 3QH3B 1FRGL 5GSVA 1G6VK 4TUOB 5GS1C 3KPNB 4X6CA 3PP4H 4I0PD 2VISB 4N9GB 1B0WA 2VKWA 3CNKA 5D2LF 2OK0H 4YDJB 2PYEA 1I3RB 3O2DH 3KJ4C 5BJTB 2V2TA 3BP6A 2WQ8A 3B9DA 4XPTL 5FCSH 3EFDL 5MENB 1VDGA 2IPKA 3MBEA 4ZXBA 5B39G 5I8EA 1Z0NA 3RDTA 1AY1H 5IBLD 1XF4A 1HILA 2BSTA 2Q8BL 5EFIB 4ZD3L 3A6BL 1O7VA 3RNQB 3O6FA 3RP1A 3MCKA 3LPWA 3LKSB 4JGJA 4ZS7L 1ORSB 2A1WL 1UJ3B 1V7MH 3CDFA 3Q1SL 1DBML 3QRFM 3VGFA 1A14H 3J7HA 1VACA 1A5FH 2WAHA 4F7TA 4LSQH 1HSBA 1KENH 4Y8AA 5EU7C 2VQUA 4QRTB 3QCTH 3A6OA 1GGBL 5LG1A 4Z7UE 3T08A 1I3GH 2EDDA 4U31A 4XTRD 1D9KD 5HI4D 4MMZC 5H2BB 5J56B 1FYTE 1F4YL 2VXSL 2R4SH 3PNWB 1CT8A 4AIOA 5MEOA 3SGKA 1DEEA 4OM0L 4QY8B 1P7QD 2H9GB 4R2GD 1T89C 1XGPA 3GJEB 1AQDB 4NRZA 3U0PA 3WFHA 5GGVH 2C3HA 3KLAA 3CJJA 3MV7B 1D5ZB 2FLRT 3OBAA 1IQDA 4WNQA 7FABL 1CGVA 2QADB 4P2RA 1JHLL 2CO7B 3QDME 4D8PA 1S8DB 4F37K 4M1GH 3RKPA 3D0LB 5T3ZL 5GRWA 4L4VE 2AEQH 3QFJA 2X2YA 4ONOA 1OP3H 3PWNA 5LCVH 2MQCA 3IFNL 2VLLB 3K1KC 4G9FA 4NOFA 2X4RB 5EBMB 2R0ZL 1RULH 4X80H 4PRNA 3SDCD 2W07A 3QCVL 3MLWH 3RWGA 5CJBA 4JCMA 4TSCH 1C16A 1CYGA 3PWLB 5H37G 4U1NB 3WEXA 4HGWA 2F19L 3UTTE 5D1QD 1EVUA 4NQSA 1UKTA 1JGLH 4OZGE 5DWUH 3WNLA 3F5WA 4ZDHA 4Z7WE 1X6LA 1SBSL 2R29L 3QQ4B 2OP4H 4ZFFB 3ZE0E 1I1CA 5LVEA 3N1MC 5DHYB 2KQMA 1TJIL 1FV1A 1F8TH 5BZWA 2R1XB 3WBDA 4Y4FD 3P0YH 5F96L 2BJMH 2R1YA 5HBBA 4N1HB 4JQXC 3HZVA 4KK6D 5EORH 5HGBA 4F2MB 1FG2B 1XEDA 5F21B 2JIXD 3ILQC 5FGBA 4ZTOH 4LPYA 4FABH 2VDQH 4G80A 4JFHD 4X4YA 2LAAA 4HAGA 1L9NA 2DM2A 3TJHD 4MVBC 4MJ2A 2H32B 5FGRA 1IEAA 1VFUA 5E24E 3FOMB 1OAZH 2QADC 4TVPE 1CVSC 4FFZL 1JVKA 2EYTA 1PKQE 5C0AA 1N6VA 3PABA 4F8QA 1PZUB 4NKDA 3EYFA 2B4CH 1I7RB 1K3ZA 4NZDA 4G8EB 4XGZA 1LK2A 4NCDA 2ICWJ 3DX6B 3WFZA 2FIKA 3V4VH 2PR4H 4LQFL 4Z7WB 4UTAL 4PRPD 3SDDA 3TZVD 4ZFOL 4MHHI 1J7VR 5CUSH 4JVWA 1GHFH 4R3SA 3BN3B 2NY4D 3QA3A 2ZCLH 4WHCA 3MJ9H 1BVLB 3Q6FB 4JFFE 3BWUC 5GRUL 4G6FD 4GW1A 2ADJA 5K9JL 1O5DT 4Z18A 2R0LH 4P5KB 4EI5B 3GDBA 1RHHA 5BS0E 4L4TD 5GS0H 1IL1A 3BEWA 2J88H 3P4OA 3BUTA 5I1IH 1G7PA 2B1AH 2HTKC 2YUXA 2ZG1A 2J8HA 5EUOF 1YEGL 4U1GB 4KROB 4I1NB 3AROA 4J4PA 3MLUL 1S7UA 4KPHH 4NJ9L 5EZJB 5TDOA 3VFNB 3L3HB 4HH9A 1JHKL 1F3JB 1F4WH 4QWWC 4X5WB 1WCQA 5D1XB 3VFRB 4L1DA 4APQA 3MNVA 1OAKH 2VR9A 3OHXA 5E99H 3RIFF 5K9OA 3O11A 2DICA 5H35B 2JB6A 2AQ2A 3HI6L 4LLVA 1UM4L 4JFFB 2G5RA 4P49A 2XQYK 1DBKL 5EU4A 5MI0B 1QBML 1BM3L 3OV6A 1WEJH 4NM8H 2NY2B 1MFNA 3BIKA 2VR5A 1UQSB 3IGAB 1A7BA 2IH1B 3TN0B 3BPNB 4JFZL 3KXFE 1WITA 2NR6D 1MWAL 2WIIA 2ZPKH 1H3UA 1QRNA 4OLXH 1T21B 4R0LB 3VFPB 3SJVA 2FATH 3ZTJH 4EI5C 4RMUA 1SYVA 5AUMB 3CMGA 3JUYA 1DR9A 1KLUA 1LD9A 5DVNA 4KV5F 4U1HB 2VDLH 5L8LB 1KCRH 2CMRH 1GCFA 3ZDYE 4JPWL 5EZIL 2EDJA 1WT5A 5DFVD 4HFUH 1Z3GH 2HLFC 4LPCA 4U1GC 4KROC 3L3GA 5I1AB 4X8JB 2VDRL 5J1SC 4JFPB 4R90L 2QSVA 4QCIA 1GGYA 1WZ1H 8FABB 3H3PL 3K8MA 3P9LB 3JWNC 4O4YL 3FONA 4GRLA 5D1XC 1FE8L 3KHOA 3BO8A 1K85A 4IDJH 1G1YA 1CGWA 1OCWL 5HHQA 2P49B 1EGJL 1KN4L 4XBEL 4J3XA 3D39D 2M26A 4L9DA 4X6DE 2PO6B 3P77A 3KXFB 3V6OE 1NMCB 2AJUH 5E70A 4NWUL 4UT6L 4AJ0A 4C83B 1S78D 3FN0L 3DV4A 4X7DC 3IETB 1RUAH 4HS6A 5HXMA 3ARXA 2UWEE 4X83A 2D31A 5MI0C 5C8JA 5M94B 4ZUUB 2NY2C 1G9ML 1F3DJ 1ORQB 2QHRL 4LARH 1BVKB 3G6DL 4O2CA 1VCAA 4DJMA 2R2HB 1CLYH 2N1KA 2X05A 3RTQB 4DKAA 4NFBA 1NEZA 3TN0C 3O3BA 3BPNC 4JRXD 3AB0C 5HHOE 3VXPA 5B3JE 3CH1B 1I1FA 3MLZH 1S9VA 3GMMB 4M7JH 5DJ8A 4LLAA 3SBWA 4WUKH 1DFBL 5SX4I 3RJDA 5DYOA 1PQZA 3O4LE 2G5BB 3JV4B 3SO5A 1FPTL 4M9OA 4WJ5B 1MQKL 2XACC 4IIQB 4KTDH 3ZYZA 1SEBA 1OLLA 5I9QB 5TE6L 4R97B 4WO4A 1BVZA 3WS3A 3KPSE 4ZUTB 2BMKB 3WXVL 3P30L 4K3EL 3TIEA 3UTSB 3P11L 2GFBA 3A6CL 4JQVC 3MRGB 3V4UL 4MNGB 3BZFA 1YPZE 1IAIL 5HDQL 1OTSD 5TPWH 3FZUD 1KYOK 5FYKU 2KUTA 5CGTA 5ACZA 1CDCA 4PGDB 5EWIH 1QFWL 1NMCC 2P48B 1B90A 4M3JA 3O9WB 4HK3J 4IRSB 5BMFL 5KSBB 4IM8A 4MA7L 4XPHH 3LQZA 4XBPB 5E0QA 1CDUA 4HIJA 3C8KA 4KK9D 1DJSA 3GJFK 3RTQC 1NCBH 1T03L 1G7JB 3T2NH 3FHQA 1U8MA 4G6AD 2YUWA 1I3VA 3LZFL 3BFOA 3GI9H 3KPSB 3T09A 3VD9A 5DZLA 2DM3A 3OR7A 1YMHA 4FQXD 3X3GH 3DHMA 6CGTA 1RZKH 1OLZA 4A2MA 1X5YA 4IIQC 4MCZA 4M5ZL 4PJIE 5ALCL 2ATPA 1FL5B 2HP4A 3U46B 3T0BA 4U1IA 2XI9A 1M4KA 5I9QC 4ZYKA 4R97C 2UYLB 4D0CB 5EUOA 3U83A 1JZ7A 4OQTH 4RISL 5JIHA 5GJTH 1OAQL 1CFBA 3I02B 4LDOB 1KB9J 5IT2H 4PLKC 4TVPL 4OTXL 4OD1L 2CR3A 1A22B 4HS3A 1YY8B 2X4QB 1HYRC 1FH5L 3VFWB 1IGIH 4YHML 4NO2A 5D6DA 5DHVH 4GJTB 4P9ML 4MWFB 3T77B 3LMJH 2IBBA 3MLTB 5KVDH 5E5RB 3GSWA 2J8UE 5F9JA 3O9WC 2OTWA 4IRSC 4U2YA 5AZEL 5TDPA 3LSOB 2H8PA 3PV7A 1A7QH 3OKKB 5EOTB 3B6SB 5A16A 5SX4H 3EKCA 1Z5LA 2XNAB 4FN0A 1AGFB 4OZHF 4KMQA 4PRAA 4S1RH 4D0DB 1NGPL 2BNQA 3FQNA 4TOYH 4R4FH 5F9AC 1IRAY 5TE7H 1RZ7L 1ZSDA 3PJSA 5IOPA 4DQOH 1JGEB 3IAGC 1H8OA 5CMAA 1NLBL 2OZ4H 5D7JB 4XVUC 3LD8B 1MHEB 3ZHLA 1CDJA 1LK3L 3TWCL 4H8WL 2OM5A 3F12A 3IDIA 3OQ3B 5LGHL 3FB7A 4BFEA 3F62A 4BELD 4YFLF 1MCCA 4NBZB 3FMGL 4HV8A 4X6BB 1Z9SA 2X70B 4LSPH 3MLSL 4CBPA 3QFDA 1KV3A 2DQCH 2ED8A 1K2DA 1QSVA 1RZJH 2W65B 1YYML 1JI1A 5C09B 1FZKB 2VDKH 3RWDB 1CD9B 3RVUC 4AQOA 4ELKB 2DD8L 1Q0YH 3UYOD 2Z8WC 3QT2A 3CK0H 4GXUM 4MB4A 3OXRB 5F7HA 4M02A 4LAQL 1GH7A 1KELL 5IEHA 4U1MB 2J6EH 1RJLB 3QQ3B 4HMCA 2AW2A 4F58L 3GBNL 2VC2H 2EZ0C 2BNRA 4NO0B 3K8LA 3U0TA 4NN5B 2VLMD 4NP4L 2D9CA 2VDML 4XNXL 1BJMA 1TTGA 2FL5B 4PRHD 2AXHA 3IFOB 2XWTB 3JV6A 3C09B 3DURB 3ULSB 4Z0XA 5I2IA 1IQWL 2EDHA 3WKML 4Y1AB 5CSGA 1A8JH 3NFPB 1V3JA 4G6ML 3VRLF 4JY4A 1RIUH 1TZGH 1UG9A 4M6MH 2JELH 5CIPA 1J05A 3C08H 4P2OA 5FFLA 4ZUVB 1INDH 1ZLWH 5C71A 2X4UB 3BKJH 3MRLA 4HKZB 3ZT7A 5D7JC 2A74A 3T8XB 3LD8C 1KB9K 2OK0L 1CDYA 4TTDC 3L9RB 2E8ZA 4K55A 1JF1A 1K6QH 1VADB 4NQVA 1H5BA 5HHMD 3TF7C 5AD0B 5DRXA 3V7AE 2B4CC 1FBIL 4V2CB 1N3NA 3ZLQC 1WTGT 4XCFL 3UPCA 1DQDH 5HGAB 2CDGB 4KJWD 2FR4A 1ZKAA 1F11B 4NQCE 1YC7A 1OPGH 3GNML 3W82A 3VGAB 3KR3H 1F90L 4DZBB 4EJ1C 2V9TA 4MQ7A 4KKCD 1LP9B 1NC2A 2Y06L 3HLAA 3MCG1 5ETUA 2G2RA 3P0VL 4P9HH 2PYFA 4I18A 5DQ9B 4F9PA 5KTEH 5GS0C 4J3TA 2FEEI 3VJ6B 4DKDC 4LSVL 1CFSA 2CIKA 4DVBB 2IH3A 5I1HL 4PREA 1SQ2N 3QCTL 4O5LL 1GZPA 3CC5A 2PYED 4IOIB 1CQKA 3NGBB 3C09C 2BCKB 1FZOB 3IKCB 3UC0H 5F6HJ 3LDBB 4HC1A 4NO3B 3RJQB 2E9JA 4R4BA 3PP3H 2R0WH 3MBED 3P40A 4ZXBD 4J3SA 3HRPA 3EUUA 4YUEH 3PDOA 3E8UL 3RDTD 4K7PY 4HEME 1FIGL 4MJ5B 4AIZB 1MLCB 2CGRH 1WBYB 4ERSL 5GGVL 4NQCB 3WD5H 1JGUL 4V1DE 5GGQL 3O6FD 2X44D 4GBXD 3MRKA 5EPMA 2OR9L 5FF6B 4F57H 3DETD 3KYNB 1SHMA 1DQQA 3MSPA 1W0WA 3ULVD 4ODXA 4PB9H 4YFEA 2AV7B 1V05A 5T5NG 3O41B 5CSZB 3NACL 3VRIB 3IJYA 4RAUA 2NY3D 3C8HA 4LLUB 4M1DL 5C9JA 4L3ED 2AXFB 4N0YL 5DMYA 1FZJB 5INDB 3BP5B 3VGAC 1VHPA 5D2NA 1DLFH 3T4YB 3UTPE 3FRUB 4U6VL 4X7TA 3K81A 4LCUA 3FB8B 5FUOH 2EDBA 5A2LH 3JTTB 1RZIA 3RNKB 1KJ3L 4P2QB 5DO2D 3OB8A 4HULB 5DUPH 5JOFA 3V8CA 5KANG 1T83C 3MOQA 4W4NA 3VXUA 4AL8L 2OP4L 2JCCE 2YXFA 4HT1L 3ZDXE 1LVEA 4PJCE 3WIHA 4P2RD 4OF3A 3NGBC 4V1DB 3ARGB 3GSQB 2MFNA 3P0YL 2HFTA 3EGSB 3SKOA 3BXNA 4S1QL 3TBTA 1ND0B 5KS9E 2M2DA 4OZHA 2F74B 2D7PA 2QR0B 3QFJD 2FJGB 3V5DB 1JPST 1MRCL 4G9FD 4JRYE 2EYRB 2VE6B 4MX7A 5IK3B 5F89B 1QSEA 4NWTH 4XMPH 3VFTB 5BV7L 5E2JA 3LQMA 3MZGB 1FJ1B 1KTKE 2YN5A 1WZLA 3QXDB 4H1LA 5I17A 2X4NA 4PS4H 5EBWB 1MFDH 4LVHB 4O02L 5SX5H 2PR4L 1T2JA 2NY5H 4MDIB 4AZ8A 1JK8B 1ZA6B 3SPVB 4LMQE 5CUSL 1C7SA 4XP6L 3RY6C 4LCWB 5DJCA 2C1PB 2MMXA 1CLZH 1S7WA 4LBEA 2XY2A 3LKOA 3WL9A 3GSUA 4GXVH 1D5XA 1FVDB 1PEZA 1RUPH 4PTUB 3ARDA 3FCTB 4GMSL 4YC2C 1OAYL 1WTLA 3I6LD 2E7MA 2DQGL 5D1ZB 1KJVB 1QD0A 1F4AA 3QDGB 5L9DH 4MXQD 4U6TA 3L5HA 4GW4B 4JKPL 5AYUL 3ARGC 4AG4H 4P3DA 4HUVA 4I9WE 5L88L 4XZUB 1UZ6F 4M4PA 1NAMA 5C0AD 3WUZA 1HEZB 3EJJX 3MYZA 1FLRH 1KB5L 5FB8B 5T3XD 4KPHL 5D93B 1LO3H 1MQ8A 1HH6A 4OF5A 2F53D 4U05A 3SDDD 1F4WL 1Q0XH 2GKIA 4HKJB 5DHVB 2X1WL 4X6FA 3HNVH 4B7LA 4PD4K 1KBGH 2VLJA 2YWYA 2BNUB 4N0FA 3ULUF 3RPKA 2OSLA 3IVKB 1IC7L 4QHMA 3IDJB 4KU1A 4MJIB 5E5UB 5DK2B 2FX9H 3TCLA 4HUNB 3ARFA 4CVXA 5AG8A 5JORA 1ZANL 3WJLC 2VABA 4LVHC 1IAOB 5JZ7C 2I9LB 5K9QI 3QEGL 4HUKB 1MCHA 1I8IB 1U3HA 3FHAA 3LEVL 1GAFL 1RURH 1WFTA 2V2WA 1AJ7H 3WYRA 3EOTL 2ADFL 2XQBH 3RGVB 4OKVB 5DTFA 5MEPB 1DQMH 4JFEE 1F5WA 2L4OA 1UWXK 2DWEA 4YHLL 4OLXL 1EEZA 3U6RA 2OR7A 1WFUA 5DT1H 1IAKB 1MIEL 4MDJB 5SWSA 1RZKC 4JZOB 3RVVD 4K3JH 2IFFL 1YEEH 5F7YC 1N7ML 4APQD 2VDLL 2Y6SD 1H9VA 2NLJA 2JJSA 4KY1L 5D1ZC 5J0BA 4KMLB 4HFUL 4JM4H 3FQUA 4PJXB 2XICA 5TF1H 3QIBA 4NFCA 5FK9B 1VPOL 4LSTH 4XCCH 3RHWK 4W4OC 3MOBH 4XNUH 3G5VA 1WZ1L 4XCEA 5I6XC 4X4ME 3GMQA 3IAPA 4LCIH 5E2TL 4L3CA 1DQJB 4C56E 1OTUD 1QFPA 2QKIB 5IVZA 4OJFL 3QUYB 3D25A 5DHXB 5CBAA 1QRND 4HS8L 4DAGH 5SWZE 3SJVD 5DJAB 4UBDC 4JFEB 1NUFA 3WXWL 4X7SL 5FYKE 1VFAB 5T1MB 2WZPD 4GKOA 5ESVB 3QXAA 5ENWA 5CGYD 4OGYL 2YHGA 3VE0A 1I9EA 2B2XH 43CAB 3WFCH 1FFPB 4UOJA 3PWJB 3RWHA 5IM7A 4NQDA 3UTQA 3RZCA 1AO7A 3MLZL 3RGVC 5B39A 1EO8L 1E4KC 1KIPA 2Q20A 1WWCA 3K46A 1BAFH 3DX7A 3HG1E 4WUKL 5D7SH 5C0BA 3B9AA 3S36X 1NGQH 5IHUH 3VI4E 2D7MA 3FOLA 4PJBE 4GRLD 2UVFA 3BKYH 3E0GA 5CINH 1BFVH 3QCUL 2ESVA 5DI8B 4C56B 2ITCB 3TBVB 1RZJC 4KTDL 3WE6A 2L7JA 1A6UL 1JRHI 1KCSH 2AI0H 4LNRA 5F88A 5F8QC 2FLBT 4ZUWB 3BGAA 5E9DE 2R8SL 3HI5H 2UZIH 4AEHH 2J2ZA 1GGTA 5ADOH 3BSZH 4PBWD 3DHJA 3V2AR 1QFUL 3MO1B 3QUYC 3GRWH 5HY9B 1C1EL 3ECBB 3ZTNL 4E42B 3WHE1 4W68A 4LPUA 4Y5VB 4Y19E 4J2XA 1NL0L 2O5YH 3C6LA 3SE9H 1I9RL 4RWYL 1B4JL 1INEH 2BVQA 3H42H 2Y36H 3GBLA 3U30B 4LGRB 4ZS6D 4CMHB 2VLRE 1NCBL 2XWJB 4MSWA 5KBNC 4WO4D 1RIVL 1CFNA 3ZKQD 3BKCH 4LDEB 3PV6B 5EN2B 1A1MA 3MRMB 3D0VA 5EIQA 1X5ZA 3JUZA 2NYYD 4PB0L 3QDMD 4IS6A 4J6RH 5ICZB 4XVTH 4WEMB 4LF3A 4ZSOE 3SE3C 2K7QA 3DVGA 4OD2A 3SDXB 4L4VD 4M9PA 2NY7H 4GO6B 5F70A 4GRWE 1JMXA 5JR1H 4OB5H 4KH2A 4Z7QE 2BY1A 4PGBA 1XGUB 4FQ1L 1D6VH 1UGNA 2XTJD 1MCPH 2GAZB 2HT2D 4Y19B 3U36A 2APTA 3MJ7B 4HFWA 1OGTB 4P9HC 3VXSA 2AK1H 3L5WB 1R5IB 1OTTC 3WFEH 2O26U 4HKBB 3S36H 5IG7B 1KEGL 3TIDA 4WV1A 5JDJA 2H2PC 5BZDB 5DQDH 2ITDB 3V5KB 1V3MA 2HWZH 2AEIT 4Y5VC 4W6YB 1J11A 3DPBA 3LH2L 1RJZA 4JR9L 4MHHG 1A7QL 2DL2A 32C2B 1T6WA 2HVKA 1CD1B 5ITBH 3S5LB 1C5BL 4H20L 1INQA 1R6VA 5K59F 12E8H 4M8QB 3U30C 4NHCL 4CMHC 3U4EA 4P57B 1CGSH 1ETZB 2IANA 1CK0H 1FAKT 1PYWB 4EN3A 1LE9B 2YS4A 4GXUN 2NTFB 2WW8A 3AMLA 1JRHH 3SN6N 4CW1B 1BBJB 1G7LA 3HB3C 2X9XA 4CJ1A 4K9EH 2VXUL 3QI9B 2GSGA 1QVOA 4R6UA 3HS0B 2XZQH 2EE9A 1AD9A 1A9BA 4X99A 5FM4A 2IBZX 1I9JH 5L6YL 2DQCL 5GGTL 1CBVL 4FQQB 2IMMA 3BE1H 4L8CB 4GAJL 3MRPA 1P4IH 5JIPA 4JO3L 2ZCKL 5D7LB 3CMOH 3D9AL 4AYFA 1Q94A 1F6AB 5FYLH 1PFCA 3T04D 3LRSA 1PZ5B 3I84A 2BNQD 3IJSB 5DD3L 1S9YA 2F8XC 3TBWA 4KFZC 5T33H 1OP3K 4YXKL 3NIGE 4Y2DB 5IMOA 3CXDL 5IB2A 3U9PL 4Q6YA 1UA6L 4LSDA 4YHPA 4QTHA 5B4MD 4JY6A 4H5SB 5DDHA 3IDNB 4LLWA 4DVRH 1XIWB 3PDGA 5IMLB 1RMFH 3BH9B 2IQ9H 1OY3B 1OT1A 2BSSA 4C4KT 2JKXA 3RAJL 4M6ML 2EIZB 4M61B 3BQUA 5FO9B 4JG1H 4MAYA 4FXKB 2JF1A 4PG2A 4QHUA 4XCNB 3GSRA 4HEPG 4MCYA 5D4QA 1KTLB 4WIQA 4OLYL 5I18H 4W6WB 3CH8A 5HYQB 3ZKMD 3QI9C 4P46B 4RMTA 3O3DA 3L3KB 3LEXB 4XVJH 1HXMA 3TFKC 1RK0B 3D18B 1DQDL 2NY5C 4IRZL 1EMTH 2VZVA 4DZ8B 5I16A 2YD2A 3EYUH 3PWPA 2QQNL 1QG3A 2H2SC 4X4XB 5LQBL 4LLMB 5E8PB 3IFLH 5KSAB 1A6TA 5FYKL 1QSFE 1UCTA 2Z8VC 4PR5A 1BEYH 3FQWA 3G5ZA 5I1KH 3T0EB 5IMKB 2XN9E 2HG5B 4NUJB 2E7LA 2B20A 5DEGB 5CEYA 1Q9KA 2NX5E 5EU6B 3L1OL 3ZT5A 3L5JA 4P2OD 4D0BA 4Y2DC 5IQ9A 5K9KB 3X13B 1U2HA 2DBLH 3BIBX 1A6ZB 3EO1A 2YEZA 5C0GA 3BW9A 1XIWC 1XH3A 5JNYA 1WZMA 2RFXB 5INCA 5GS1A 4KUZH 3T1FA 4HWEL 4XP9H 3UTZB 3VFVA 4WUUE 4CRPA 3SE8H 1RQ5A 4NHUA 4KUCD 1A1OA 4UDTB 3MLPA 4ZQKA 4GAYA 4BK4A 3O6LL 3FO9B 4K8RL 3QZWB 3EFFA 2CGRL 4JHAH 4FFVC 2G75A 3NTCL 2DI7A 1HHKA 1W8OA 1LEKA 1NC2D 4Z7WF 4LU5H 4LK4A 3MMEA 1ZOXA 4F57L 4P46C 4BQ9A 1KFAH 2BVOA 1MNUH 5IHLB 3DYPA 4PB9L 3R06B 4GKZA 3U48A 5HHOD 3VXNB 3F7YB 4HXBL 2D4DA 2W9DH 4RCAA 1QLRB 5EA0H 4KQ4L 5BRZB 3O4LD 3HCVA 5CLTA 3KG5A 3SGEI 5KSAC 2JJTC 1MRFH 3QG6A 4I48A 4HIIB 3MRDB 1WBZA 1NC4A 4PUBH 3T0EC 4J3VA 1BD2E 5I8KH 4DWHA 3L3IB 1FN4A 3MJ8A 1JPSL 1CGUA 3DIFB 4N90E 3SDYH 3L5IA 4M48H 4I2XA 2VXTL 2DIJA 5FKAA 2DKSA 4E5XB 5DQJB 4L29B 1NCCH 1J0ZA 3QH3A 1T89A 2DQEL 4TUOA 5KG9B 1DDHB 3KPNA 2A77H 2VISA 4N9GA 3K4ZA 4RGNB 4UUJB 4YDJA 2PTTB 3UCRA 1I3RA 3ES6B 5BJTA 1JNJA 4JFXB 5CJQH 4OIBA 4LFHD 2Q76B 3INUH 5E94B 3LN4B 1NGXB 1P7KB 3B5HA 5CCKL 3GMPB 3GHEL 4OGXH 2YA2A 2C3GA 5C0DB 3U1SL 1DN0A 4DTGL 5DEZA 4B41A 1QQDB 4HBQA 4R4ND 1ZT7B 4YGAB 2FD6H 1DL7H 1YEJL 3VXUD 4P5TB 5JW4Q 2XWBB 5EFIA 1TPXB 4LVOB 3RNQA 5F1OB 3LKSA 1DQLH 1ORSA 5T5NF 5ISZB 3SDAB 3AREB 1KPRB 1ZLVK 3B9KB 4QOKE 2AJSH 4WVRA 2BVUA 5JMRA 4WI8A 2XTLA 4QRTA 2HTLD 1Q72H 2F54E 3HE7B 2ZUUA 1U8OB 1GSMA 4MA8L 5E8EB 2AJZB 4JQXA 5H2BA 1RD6A 3HN3A 4KK5C 1QSED 1L0XA 5CP7A 5I1JH 3W5NA 2Z35B 3CVHL 2P8MB 4QY8A 1RV6X 2DS4A 4F8TA 2H9GA 3BX7C 4AIXA 3GJEA 3QEQD 1A3QA 1AQDA 3GSOB 3MXWL 5D5ME 1OF2B 4YNYB 1LO3L 4NQTA 3MV7A 4QHNB 4RGNC 1D5ZA 4RAVB 2R4RH 4JFDE 4GFTB 5ECJE 4U6XB 3S7GA 2X4TB 1S8DA 4HWBH 4NQEB 3D0LA 2AJYL 2IAMB 2P8PB 5MP6H 2KZWA 4QOKB 1CVRA 2VLLA 5KJRH 3SGEH 5DRZB 2X4RA 3R4DA 5EBMA 1ZHKB 1L7TL 3ARDD 4Y16B 1I8KB 1T0PB 4P5TC 5LGJB 2OL3L 1FAIH 4LVOC 1EK3A 4ONGH 1MPAH 1AQKH 2QLVB 5F7LB 2R0KH 4POZC 2W92A 3PWLA 3SDAC 4KJPC 4U1NA 3AREC 1K3IA 3B9KC 2XY1A 2YMXL 1I8MB 1DQML 3QQ4A 4WCYH 3K2UL 4JKKA 3WFDH 4ZFFA 2A6KB 5DHYA 1GGCL 2PXYB 1C08B 3O2VL 4U0QB 2WLYA 3E1F1 4FZEH 1MIMH 3HE7C 4E0RB 1ITCA 1U93B 5J6GB 2R1XA 4NC1C 1W72H 2NY0B 4XAWL 4ZUSB 1MHHB 2QQKH 4GG6E 4QRRB 3TC9A 4F2MA 5J57B 3T0WA 4HUWB 2EE6A 2IALB 4N8VB 5TF1L 1D6EB 4PJDE 3TGXA 1EFQA 3BGFB 2YXMA 1WIPA 3QULB 3OMZA 1BZ9A 1F58L 1AKJB 3MFGB 1E4WL 4I0CC 3X11B 2DTML 4I5BA 2H32A 4LP5A 5B3JF 2BHUA 3S5LG 3FOMA 2VXVH 4K94L 1U3HD 5ADPH 5KSBF 3B3IB 2WBJB 2GIYA 4NRYB 1T5WA 2Z93B 3QUML 3B8YA 3EYQC 1WWAX 1I7RA 2IAMC 1M7IB 4M7KL 3DX6A 3KPRA 1N64H 2AEPH 5JPMB 2WWMD 1Y0LB 3NA9L 5SWSD 1IGTB 5E2UH 3GSNH 2DQHH 1Q9LB 4RBPK 4Y16C 3DMMB 4M62L 2GTWB 1DVFB 3M17B 1U91A 4H0IA 1BVLA 3JXAA 3C60D 3HFML 4UIKH 1FORL 3QHZL 4GRMB 4HLZH 4P5KA 4EI5A 1YNKL 3KYOB 4PLJD 4DK6A 2ED9A 5EOQL 3EDDA 4PLNC 3A67L 15C8L 2GITA 3LKQB 1SJHA 1J1OL 4K9EC 2PXYC 2Q7YB 5F9OH 1O7SA 4UOW1 5CINL 2NY0C 2E9BA 1IM9D 1RVFH 4YX2L 3CU1A 5EZJA 3VFNA 3L3HA 4N5ED 4PJ7B 3K4DA 5J9PB 1YUHB 4JO2L 2Y4SA 2VN7A 1F3JA 3RUGB 5JOPE 4X5WA 3BGFC 1URLA 4NN7B 5D1XA 1OARH 2MWCA 3VFRA 4BQ6A 3MGTA 2QHLA 1H3PL 3MRHB 3PE9A 3QG7L 2OJEB 2YD5A 3LB6C 4CUCA 3B9VA 5H35A 5ADOL 3BSZL 2Z91B 4E41E 1GPOH 1U8LB 1UWEH 2WBJC 4LOUC 4NQDD 2B8OT 5EUKB 4RIRB 4I0KA 5IVNA 3I6GB 3RZCD 2FECL 4DOHE 1BZ7B 1AO7D 4QLRA 2CLVB 2SEBB 4J8RB 3ESUF 3VDAA 3DJ9A 1NSNL 5C0BD 2X4SB 1UQSA 4S1DD 3IGAA 1CQYA 5C0NC 4YQXH 2IH1A 1C5DB 2IPTH 3TN0A 3UJTL 5FM5M 3DMMC 4RMQA 1YQVH 1DVFC 5FDWB 3U7AA 3IJHB 3P3YA 4I3RH 2ESVD 1QZ1A 2EEAA 5C0FB 4UV7H 3LKPB 1CLOL 1T21A 4LP4A 3VFPA 1EH9A 5AUMA 3DI3B 1HOCA 4K71B 1MUJB 4QRPB 3RWEB 3CFBB 4UZGA 4U1HA 4ETYA 4WDIB 3UMTA 4ELME 4NZRL 4JANB 3RKDC 3PG2A 2XG4A 3ETBF 3P73A 4ENED 1IFHL 1MCLA 1FO0H 4NZTL 3HHRB 4LKXB 3ME0A 3SGJC 5I1AA 4X8JA 4JFPA 1OW0C 3WNMA 2Z8RA 2V9QA 4KKLC 1OD9A 4JQVA 4S0SD 1QHOA 8FABA 4Z7VE 3P9LA 1IT9L 5IBTH 2RAMA 1JNHA 5C7XL 2UUDK 4F80A 5I19H 4OCRL 1ZLWK 2DOCA 5HYJE 4NN7C 1A7OH 1MHPH 5D8JH 3TM6A 1HZHL 5J1TC 4LIQE 3C6LD 3G5YB 3FO1B 4LEOB 2YD6A 3QNXB 5BO1L 2LU4A 4PJ9B 1NFDB 3QP3A 3GSXB 1YYLL 5TF0A 2YUZA 4K3DL 3IETA 5HI5D 2YR3A 1A4KB 5DVKA 4ZUUA 1NQBA 1XR8B 1ORQA 7CGTA 1BVKA 3ZL4H 2MCG1 1OP5H 3C9NB 2E9IA 3QZWG 4TUKL 1S7TA 2R2HA 3RTQA 5ILTH 1CI5A 4UT7L 3ARSA 1ZTXH 3A0OA 2QQLH 2X42A 3QO0B 3MYJB 4CDGC 2LV4A 2D3VA 3GMMA 4KKBC 4U1JB 5C2UB 4XPFL 1A0QH 3MREB 3HRZA 4JRYD 4Y2OA 2J4WH 3SKMB 4KJYB 1CGSL 3O2DA 2G5BA 3QDJE 3JV4A 4K71C 3I9GL 2NY6D 4WJ5A 3KNBB 3FFCE 2P5WB 4IIQA 1FGVL 5L0QB 2RQ8A 3MRNB 3VXSD 1RUKH 1LDSA 4UNTA 4MYWB 4ZUTA 2BMKA 4RDQF 2Y23A 3CFEB 3B2UC 4FQ2L 3UTSA 2FH8A 5ITFA 1A6WH 4OCLC 3MRGA 1IE5A 1AXTL 2EKSB 4U1KB 3ULUD 1EERB 4MNGA 3R1GH 1LP9F 5DD0L 1A21A 3U7YH 3BKMH 5D71H 5IWLC 3GZKA 2FX7H 3DXAE 4JJHA 5DJZB 3TPKA 3DVIA 5L2KB 3WLWC 3KPOB 4PJ9C 3V0AC 2PUQT 2DQIH 4M5YH 4QHKJ 3O9WA 3BDXA 3KAAA 4IRSA 5KSBA 3G6JE 4XNYL 3UJJH 4EDXB 1JZ6A 4EN3D 5JXEC 3PWUB 3ARWA 3HUJE 3Q6GH 4XBPA 1QLEL 2JB5H 2MKWA 1KPVB 2ORBL 4CN1A 1DUYB 4NJAL 1CFVH 1WF5A 4N0UB 35C8L 1G7JA 5IB4B 3PHQB 1RMFL 4FQHB 4XX1G 3B5GA 2AERT 1PG7L 2DL9A 1UYWL 4A6YH 2Q3AA 5FO8B 5JHDE 4JPVH 4LEXL 2CKBA 4Y88A 3M45A 4LGSB 4WI7A 3OKMA 3MNZB 4MD4A 3KHQA 1FL5A 3U46A 1NUNB 5L0QC 4G7YL 1UKQA 1FNHA 5C08B 5I18L 1HINL 3QIWB 4X9BA 1B2WL 1I1AB 2UYLA 4D0CA 5C0JB 4QHLB 1WSST 3VRJB 1YECL 1JWMB 3I02A 3TESA 4NNYB 3S97C 1CU4L 3SCMD 2X4QA 3MJGX 3CDCA 5BCAA 4G43B 1J1PL 1U3YA 1R3JB 3JVGC 4MA3B 4EUPH 3O6KL 1D5IH 3UO1H 1IVLA 4NSKB 4MWFA 3T77A 2LQRA 5C0RL 5JLZA 2YSSB 2HRPH 3MLTA 3WFBL 3LSOA 1W72B 3OKKA 3BQUD 5EOTA 1OSPH 3B6SA 4MAYD