5CSZA

Crystal structure of gantenerumab fab fragment in complex with abeta 1-11
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
212
Chain Sequence
VELVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINASGTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGKGYVRYFDVWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gantenerumab: a novel human anti-Abeta antibody demonstrates sustained cerebral amyloid-Beta binding and elicits cell-mediated removal of human amyloid-Beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GANTENERUMAB FAB FRAGMENT HEAVY CHAIN
total genus 44
structure length 212
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cszA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cszA01
4U1IB 5GGTH 2WUBH 1U41A 1S9VB 1FDLL 3TH4T 5J12B 1LWRA 4P5TC 6FABH 2Q1EA 1OAQL 1KCRH 5A16A 1S9VA 1QFUL 4F7CA 4PRPE 3IKCB 1A9BB 3MFFA 4OSUH 5ALCH 4ACPA 3VFVB 3S3PA 3K2UL 4Z76A 4NN5C 3BW9B 4M7ZC 2FGZA 4D3CH 3UTSE 3IDXL 1AO7E 1GC1L 3GSNA 4QGTA 1YMHB 3NABH 4OLYH 5F72S 1ED3B 2XFXA 3H42L 3HCVB 2IPKB 1CLOH 4JN2A 5JW3H 1JNLH 2VQUA 2YA1A 3PWUA 4N8VA 4LRIA 5CJOH 2XN9B 1P69B 1N0XH 1ZE3C 3O6KH 3L95B 1R3LB 4Q7DA 5DWUH 3FQWB 4H0IA 1JGDB 1F4HA 1ZK9A 2GCYA 3P9MA 4UUJB 3OKEA 1KTLA 4FHBD 2MFNA 1KG0B 2NCMA 1ZHBB 2HAZA 4KZEL 4JO4L 1F4YH 5L88L 4OM0L 3ZYZA 1ND0B 1IGCH 5K9KA 2XYCA 1T22B 1DQDL 4U6YA 5KSBE 2OMBA 3P77B 4D9RE 3BKCL 3L3IA 3RUGF 3H8NA 4R3SA 4K7PH 1MHEA 3T1FA 5FOJA 5D2LE 2V6HA 5FM8A 1NGQL 2WWKO 1SJXA 4MWFB 3VD7A 1FJ1B 2ICWA 4W6XB 1NANI 2ZCLH 4CU6A 2AXGB 4BK4A 2WP3O 1BOYA 4LHJB 2UY6A 4EVNA 3KPOA 1MCDA 4JFEE 2UVEA 4ZFGL 5E8OA 4L9DA 1QLEH 2VKXA 5BQ7A 4K71C 2LFGA 1RK1B 3HTLX 4EVNB 5I1KH 3MPCA 4FZEL 1A3RL 3I3BA 3OB0H 4OZHB 4HK0B 4WW2A 1A6WH 4G6JL 2FHCA 5CEYA 4U1LB 1H5BA 1Q0YH 5DJ6A 3E3QC 5ACZA 1AHWA 3VFNB 1J12A 3INUL 4S1DD 5M95B 1Z9OA 1TENA 5ICXA 3BZ4B 4U1LA 4BK5A 1I1RA 3GMNB 2XTJD 2Z91A 1IL1A 4WEBL 1T20A 4D0DB 1U0QA 1ZKAA 1E4XL 4QRPB 5D2LF 3IDYB 1NCBH 4LEOB 3WO4C 1I7TB 4M9OA 1IGYB 5GGUB 3UX9B 1UZ6F 2BNQE 4N8VG 4DKFH 1FLTX 1DUYA 2AGJH 2V5SA 1CE6A 4XRCB 4GRMB 1MVUA 2AJXL 1KPUA 1UXSB 3TO4D 1CXKA 3OAUL 4TNWK 4L3CA 4OB5H 1KTRL 1M7DA 3VG0L 1Z9MA 2H9GA 3S96A 4LSSH 2OR8A 2O5YH 3QZWB 4JE4B 1UXWA 4Q2ZB 2MKLC 3B3IB 3AMLA 2E9IA 1G7HB 1RV6X 1UA6H 1IKNA 2AABH 4KROD 1BD2A 4ALAL 2OJZH 1YEHH 1TVHA 2YKLL 4HS6B 1KPRA 1ZLWH 3G6DL 4AH2A 1GZQB 3TIDA 4LSSL 5JA8B 2NY0B 3KLSA 4YH6A 1KACB 3BEWA 1FZMB 1NGPH 4YXLH 5EO0B 1HI6A 2AW2A 5F44A 3E6HA 1ZVHA 3GBNL 4P3WA 3VJ6B 1YN7A 2DTMH 4V1DE 2YXMA 1TZIB 3CCHA 1GZPB 2QTEA 5TH2A 2IBBA 1KC5L 2VIRA 2Y6SC 3O6FD 5GS1C 1IGTA 5L0QB 1PY4A 4QTHB 2DQIL 2QSQA 2HFGH 3UBXB 4X4YB 4ZXBA 5J57B 5ID0B 3H3KA 2VDMH 4HUMB 3VWKA 3I6LD 5BO1L 1JZ2A 1KJVB 4YAQB 3KPQA 3DWTA 3PXJA 2R2CA 4OFPA 4HWNA 2CDEB 4WI3A 2OJEB 4HS3B 2IH3A 1XR9B 3NIFF 5D2NB 1AE6L 4XVTL 1ORSB 1E4WL 3PGCA 3BI9X 5CP7B 1WCBA 5DD6B 4TUOB 2ARJB 4Z7OF 2IH3B 2BOBB 3QQ3A 2NY2B 1CG9A 5J6GB 5E8PA 2JJTA 5HYJB 2RJMA 2NXZD 3QUZA 4OD1H 4TUOA 3TWCH 1IAKA 3TVMB 4DKAA 4E0RB 4F7TA 1DBML 5DJCA 2BK8A 1XGYH 3SDXF 4NJ9L 2YPLE 3W0WA 4JQXA 2KL6A 1QSFE 1E4XI 1CXIA 1U3JA 2VXSH 3BIBX 4ZFOL 5I74B 4O9HL 4Y16A 4BUGA 4LCYA 4ELKA 3O11B 3D5OF 1CU4L 2NYYD 5BXFB 4JFDA 4NGHL 3KPNA 4G5ZH 4JHWL 3OKYA 1YNLL 2DWEB 4HIEB 3IDMB 2DBLH 1B4JH 2IAMD 3GJFH 2X1QA 3UP1A 4KQ3H 1NGQH 4R4BB 2F5BL 3F12B 5GGSB 1XGQB 3RVTC 1OP5H 3BGFC 5A16B 1SEBA 1CFTB 3V95A 3AS3A 3K3QA 3JUYA 3CZFA 3QCVH 1TQBC 5FOBA 5IBLC 1P4LB 2CRYA 5HHXL 1SEBB 4AEFA 4HD9A 4JQXC 3U82B 3NFPB 5MEOA 3C8HA 4KHTH 1MNUH 2BC4A 4OUUA 4YC2B 1Z5LB 2DM4A 5FOBB 1PBYA 4U1MB 4YQXH 1PLGL 3U1SL 1T5XB 2EE9A 2NY7H 5CJQL 1MFBL 1YUHA 1R3IH 4M5YH 5F9WC 3DMMB 3MNVA 2R1YA 1AR2A 3S5LA 2R4RH 1T83A 2M26A 3GMQB 4WU7B 5F7LB 4ZAKC 1LGVA 4J23A 1DBAL 4KTDL 4PBXA 1ND0A 3WLWC 3DSNA 2BVEA 5D6DC 5TE4H 2EC8A 1KV3A 5C2UB 2PXYB 2UY7A 3ECBA 3VWKC 1W8OA 1FAIH 1IILE 1CD1B 4NKMA 3MNWB 3QJFB 3SKOB 1J1PL 1JPTH 3CSPA 1G7IA 3BPOC 1UEYA 3OKNB 5J13C 3L3JA 5CIPB 2ZUVA 1DQDH 4ZNEE 1M05A 5HGDB 3C6LB 5C0BE 4DUVA 2Y25A 3QIBC 4WWKA 3MRQA 5ISZA 1ZLWK 4RRPG 5I1CL 4NQUA 4X6CF 3QUXA 5FYJU 1UYWH 2F54D 3GKWL 3RHWF 3QUYB 2R0LL 4HCRA 4JFPB 1ZT4A 1A7RL 1QPPA 2DQFA 3HRPA 5A2KH 3QUXB 4UNUA 5DQDH 3MSPA 4WFEE 4X7SL 3RUGB 5GSRB 1LO4L 3W9EB 3BUYB 4HQQH 1OAXL 4OJFH 1MY7A 5ACZB 2DQFB 2JB6B 1D9KC 1BJ1H 4GQ9H 4QY8A 2CKBH 2WK2A 3OR7A 2CJUL 2XPGB 2NXYD 4EDXB 3KXFD 1ZA6A 1R3JA 4D9LL 3LH2H 3AAZB 1H3UA 3SE8L 4H1LH 3RDTB 2DF3A 4WWID 1S3KL 3C5ZB 3Q0HA 1NAKL 3CSBA 2H32H 5FF6A 1KJ3L 1U8HB 1OY3B 1JNNH 2G75A 4LPWA 1XIWC 4PV8B 1IQDA 2V17L 2VAAB 1AD9A 1DUYB 1TCRA 1JN6B 1RZ8B 3BRFA 4M5ZH 5ESQA 4R90H 1ZT7A 2IALB 3VXME 3KYKL 3B5HA 1E0OB 3CSYB 3GIVB 1HSBA 2DQTH 2GTZA 4R2GD 3WIIL 3BYYA 5JDSB 4BH7B 2CR3A 1RURH 4P2OA 1XGUA 1MCLA 5IM7A 2YUXA 2ZJSL 3HG1A 1NMAL 4IOSD 4GJTB 4L3EA 5HVWA 3WEXB 2Q8AL 3O3BA 2B4CH 3PHOB 4I18A 2P5WE 4BSJA 1HQ4A 1AO7B 4FFYH 4I2XB 2A83B 5E2TH 1TZHB 4WJ5B 3HS0A 1WZ1H 4L8CB 3HPLA 4TSCH 3WHXB 3TBSA 1YEKL 1H3TA 5FK9B 2G9HB 3CSGA 1JMXA 3NCMA 2NLJA 3NCJH 3MZGB 1J8HA 5IMMA 5ERWB 3O3AA 5EO0A 1LHZA 3HPLB 3FHAA 43C9B 4YGVB 4P2QB 1YN7B 3V52L 1R3HB 3Q5OA 2GJ6E 4M6AA 4P46A 3O3AB 3S6CA 1X5AA 4NDMB 4X8JA 2PO6D 4G9FB 5GGRY 5C0ND 3A6BH 2FBJL 5D1QB 3NCYS 1R3HA 2F8OA 4P2OC 1XZ0B 2FWOB 2QSCH 5F7FA 3T0EA 1T03L 1IZJA 5D1QA 2VNCA 1BX2B 1ZS8B 4UQ2A 2V7HA 5DA0B 4PJDB 1B2WL 1P4IH 1PG7W 3BKML 4OJFL 4HFUL 4NQDD 4D0BA 5BZDB 3RU8H 4N8CH 2GJ6B 3PJSA 4XP4H 1IAMA 3MBXL 1RU9L 4DTGH 1EGJA 2ZZUT 4LGPB 2XWBA 4U0RC 2GJ6A 3MMEB 3VE0A 3MRCA 1WJ3A 2AVGA 4LARL 3E6FB 4NZUL 4IRJA 4M8QA 5F7MC 4KK5D 3WN5C 3ULVL 4YPGA 1QOKA 1T83C 3JWOH 3G5ZA 4YHIB 2YZ1A 1IEBB 3DXAA 2UWEA 1LO3H 3QG6A 4PRIB 5HI3C 5HHOA 4HXAH 1U8NA 4LCYB 4ELKB 1PSKH 5F96L 3UTPD 3WXVH 4F8QA 1ITBB 5IMOB 3OB0K 2DJUA 2FSEB 5BVJA 4KY1L 4Y19B 4YGAB 4XHJD 1CWVA 1MCKA 2VLKD 1RK0B 1T21A 4XTRD 2FSEA 2W60A 1CFVL 12E8H 1AGEA 2OSLA 5I2IA 1RZ7L 3LS5H 2DL2A 4AYFA 4YFEA 1I8MB 1LE9A 1DDHB 1OGAA 3FCTB 3HPJA 5CJOL 5CAYB 3I6KA 1ZEAH 3WN5B 1R24A 1D5BB 2DLFL 4X98A 3EYOA 4LKCA 5BRZA 4I0CC 4Y1AE 3QUKA 3IAQA 1F2XK 3TNNA 5DK0B 3I6KB 5MP6H 2XA8H 4HV8B 4JFED 3ZL4H 3OPZH 4ZMAT 4ODWA 5DMKB 1PY9A 3Q6GL 1HKFA 3WV0A 3GMRB 4PJ7F 3X12B 4JPVH 3GSRB 5FYJD 5GJSH 3TO4C 3SE4C 4PTTA 5GS0C 2NPLX 3NTCL 3MLYH 4POZC 3ZKND 1TTGA 1DN2A 3ZMRA 2HFGL 4WFGD 3ULVE 1PZUB 3IJHB 1J0IA 3MCG1 4HCRH 5KVGL 3L7FB 3S36X 2C4FU 1EHLL 3DVFA 4JFXB 3SGEI 4I0KA 1QQDB 5AYQA 5B22A 3FB7B 4KK9C 3CUPB 3MLVL 1QFWH 1D6EA 1LVEA 3PL6A 5D93B 2JELH 3CFBA 5F7UA 2WMPA 5IHUL 4N8CL 1AD0B 3QNYA 3X14B 2DBJA 4HHAB 4UT9L 5DJ2A 1MFDL 3V5DA 4N5UA 1Q9KA 4WHYH 5C0JB 3L5XL 4DN4H 3CVHB 4Z7WB 1F13A 3BMWA 5EZIL 2FL5B 1FZJB 2G5BA 1OAUH 4MNHA 1G7JA 5EOCH 4OKVB 4GQPH 1MAJA 3O6FB 4N0YL 5DJYB 3UJTH 1KELL 2X70B 2X41A 4JHAH 4XPGH 3S4SA 4FMKA 2BY1A 1NDMB 4XBGB 5BV7L 1S7WB 5A2LH 3R4DA 1F90L 3QFJE 4IIQB 2UZIL 1IRAY 2NR6D 1H15A 2KZ1B 3FO0H 4NGHH 5E9DE 5FYLL 1XCTB 3MV8D 3OHXA 4P5MB 3QDJD 4V1DA 2Q87A 1F3RB 1VADA 3SGJA 2P8MB 5DLMH 4ONFH 3VXNB 3MV01 2HTKC 4PJCA 4LMQI 4TN9A 1UWGL 1J0YA 5CUSH 1JZ6A 1CGYA 4OM0H 5DA4A 3UROR 3ZLQC 1TJHH 1NMAH 4HS6A 3ILQD 3IXAB 4M7LT 3L3DB 4RGND 3F62A 5B3NA 5C09E 2D7QA 4A2LA 3SBWC 4OIIL 5FV2A 3UZVB 5I8EA 1K3ZA 1E4WH 4X5WA 1ZT7B 1FL6A 2IALA 4JM2B 4URTB 3VFGL 2AJSH 2JIXB 4HUNB 3R0NA 4RZCA 5GRJH 2YK1H 3G6AB 4M43H 2ERJC 4Y2OA 1JJUA 5DC9B 1QA9A 3H3BC 5ID0A 2VN7A 5D7KD 3ULUC 5FHAL 5D5ME 1NGYB 1EEYA 3UTOA 4GBXD 1SM3H 4I1NB 3ZTNL 5I15H 1TJIL 1F02I 4AT6B 1QSFB 2CSPA 4DN3L 4KHXL 4M8VA 2OTWA 1JYWA 2W65B 3QIUC 4NUGH 4KTEH 1ODAA 2VXUL 2Z92A 4PJBE 3T0XA 3EOBA 3QEUA 4DJMA 5J1AA 3BJLA 5F9DC 1QHOA 1C7SA 1NH6A 2WIIB 4N8PA 1MI5B 4JHWH 2DDQH 4WI8A 4MXWH 4E0RA 3PF2A 4YZFF 3B9VA 5E99H 4WEBH 3BVNA 5JUEL 1E27A 1UFUA 3ZTNH 5I15L 5ICYA 4OD2B 5GS1B 5DEFB 4EDWH 1NGWB 1A7RH 3K1KC 4HUXA 2CKBA 4TULH 4PPTA 3REWA 5J0BA 3HNTH 4NM4L 4P2CG 1NCAH 1L4IA 5GRXG 1TZGL 2CR6A 1QNZL 3QXDB 1Q0YL 4ZO7A 1E4JA 4L8SA 1A47A 1YEEH 3ARGA 1O0VA 2A6IA 3MRRB 3VWJC 2YD6A 4OFDA 1K4DA 4NCDA 3HNTL 3MC0A 1KB5H 3PP3K 3IKCA 3MFFB 2WW8A 3FKUS 1WISA 2XA3A 2HLAA 3K2UH 1FH5H 4NWUH 1KLGA 5EBLA 3BW9A 1EFQA 3HZMA 4WNQA 3PP4H 4K94L 4IRZL 4BZ2L 1A1MB 5DHYA 4KUZL 3UPRB 5IMKB 4X9HA 1VFBA 4JQVC 4RGOH 1UWGH 4KWUA 4JY5H 1KNOA 2LTQC 4RAUA 4Q9QL 2AQ1A 2GYSA 4F33B 3PWPE 3FRUA 5C0NC 3JVGA 4PJXE 1W2KT 3EDEA 5ENWA 3F5WB 2PW2A 4FS0A 4PGZA 2X4PA 1C5DB 2EECA 4YWGH 5D1ZD 4JM2F 2GW5A 1C5BL 3NA9L 1HXMB 4KKLC 2VLRE 3IF1A 1W8NA 4PY8I 2XWTB 3OB8A 2NY5H 3BH9A 4KC3B 3UCRA 5IFAH 3L3GB 4UILL 1TETL 2EE6A 2EO9A 4LP4A 4M6OH 2GSGA 4X6BB 4XMLH 1HQRA 1LE9B 3IDNA 1W72L 2IANE 2VABB 1BVLA 2CDGA 1RUML 1FL5A 2A9NH 1AP2B 4RGNE 5D1XD 1MLCB 2J8OA 4G80B 3DYPA 2AEQL 4ZFZA 4N68A 1QSED 1NUGA 4KDWA 2RFXA 3LPWA 4W4OC 3CMOH 4Y89A 4YC2C 1G6RA 4H20H 2R1XB 5CMAB 1UCBL 4ONGH 2OQJB 3IFNL 4G9FD 2VL5B 3KS0H 1VACA 1LNUB 4PRBA 2HT2C 3OJ2C 5DVLA 1MFCL 5CMAA 5IHZB 1D6VH 4W81A 5J89A 1KXTB 4MYWB 1JWSA 1NQBA 5DRWB 3PQYB 2NR6C 1HHKB 1T7VA 4EI6A 1F4YL 1N6QH 1VGEH 3QUYA 3WLWD 4UB0H 4WHDA 3ZHDA 4MDJA 1F6AA 4NN7B 5DRWA 4NM8H 3EFDL 4I3SH 4CL7A 4M9PA 1CXFA 1A3LL 1HH9B 4Q58C 5SWZB 2J7LA 5JIIA 4LK4A 3OKOB 4GBXC 3QI9B 1UEMA 3TCLB 1D5MA 2ICWJ 1L6ZA 1VESA 3HR5B 3PL6B 2Q3AA 4FQ2H 4S0SD 5D1XB 3OKOA 3MRBA 4QT5B 4PJHB 1C16B 3MJ7A 4LIQH 4WY7H 2BOCA 4MB3A 1CTNA 3MYJB 1D9KD 1G7PB 3WL9B 5M94B 4XAWL 5EH1A 4HLJA 1U58B 2Z8SA 1GL4B 4EBQH 2IMNA 3O9WD 4OZIB 3I3EA 4RGNC 1PKOA 3OR6A 5LQBH 1FPTL 1MCPL 4NRYA 4PV8A 3R06B 2SEBA 3B2VH 3QEGH 4KAQH 4KUCD 2DS4A 5KS9A 1D9KB 5AZ2H 5KSAA 3O2VH 3OZ9H 4JFYA 5DO2C 1U8OB 5GQBA 4PG9B 3P0YH 5AWNH 2XN9E 3N85L 4HF5L 5DJDB 1N64L 1N7ML 5C0GB 4CUCA 1H0DA 3HAEB 4NO2B 3CAFA 4AH2B 1T5WA 2E7MA 4LSUH 1IT9L 4RMUA 3ARVA 4JKPL 3NAAL 1K6QL 4PD4J 1FH5L 1NCCH 4RQQB 1RUMH 1IGCL 3AGVA 4FOMA 1RUKH 4RGNB 4GKSB 4F80A 5GZOD 1PAMA 1L7TH 5DFWH 5D5MA 3PWVB 2ENYA 4DGYH 1RIVH 5MP6L 3EOAA 5IGXL 4Z76B 4QF1A 4GKSA 3RNQA 4JO1H 2ITCA 43C9A 3BN3B 3MV7B 4JM2A 4NNXA 2ZCHL 1CD9B 1PEZA 4Q9RH 1IT9H 5EZLB 4HZLA 1SVCP 3MV9D 5I71B 4HX1A 1R5VA 1NEZA 5IB5A 4X6CE 1FVDB 4ZUUA 5ABDE 2R39A 5T3XL 2GY7B 5L8JB 1R3LA 1C7TA 1NGYA 1EEYB 4FFWC 5JW4N 1R5VB 1X6NA 3ULUH 4ZUSA 1JF6A 3T04D 5TE4L 3CFDA 3PP4L 3MACL 5D7IE 3K4AA 2EEBA 2Z31D 2CLRA 2VC2H 3MRJB 1R0AL 4OZHF 1T2XA 1DQQB 4EUPA 3B8SA 4LGSB 4WHYG 3HC0A 5F9JA 1JZ7A 3MRCB 3BVNB 4NZRH 3I6GB 4DCQA 2YSSA 1DVFC 2P49B 4NN5B 1NGWA 1RUQL 3ALXA 2C3HA 4OCNC 3RWEB 1BQLL 3KPPB 4JFDB 3MRDB 3IETB 2R0LH 3V6OE 3L5XH 2FYYA 4JFHE 4JO2H 3K80A 1NDGB 4GAYB 4E5XA 1RJYA 4PJFB 4Z0XA 3FMGL 1SBBA 3OKKB 2PYEE 3MRDA 1ITCA 5DQ9B 2BSSA 1WTGT 3FOMA 3TO2A 5DJ6B 5CD3A 4ZFFB 2ZUYA 3RIFK 2Y5TA 3ORJA 5KVDL 1EFXA 4YEFA 5ELIA 1YDPA 3K8MA 4HJ0D 2ZPKL 1MOEA 4YK4C 3QUYD 3RPIB 5CD3B 4R8WL 2BC4B 4K7FA 4K55A 5SX4H 5CHNA 4H88L 2P4AB 5TF0A 4GW5A 4NWUL 5D7JC 4YHLL 1FNFA 3MBEC 2ZUQB 2H6PB 1G9NL 5C0CB 2GI7A 1NGXB 4LHUB 3MNVB 2HMID 4HC1H 1YEKH 3CMOL 3IXTA 3KXFB 1UG9A 2AV7B 1HNGA 3K74B 1F90H 3QHZL 4J4PC 5DJ8A 4JHBA 4Y4KA 3MLXH 1XT5A 4G3YH 4YDVB 1KENH 2VITA 3W11D 5F1SA 2X4SA 1JI1A 1DQTA 3MV9B 3PHSA 2J4WL 5GJTH 2ZOKB 5F89A 1BVLB 5D72H 2X4SB 2OL3L 1UQSB 2YC1B 5CUSL 5F3HB 4FN0A 2B2XH 3U4EA 1MCWW 1R5WA 5E2VH 4YEEA 2HFEA 2NY4B 3EDDA 1TPXB 1VACB 2VC2L 5F3HA 3TC9A 3O3DB 2KH2B 4NJAH 5E1AA 5IEKB 1A02N 5HGAB 2DDQL 3CMGA 4JANA 4X7TB 1ZT4B 5DMJB 1VERA 4HDIB 4FQ1L 1HHKA 4TVPE 4MJIB 1BQSA 3DSFH 2Z35B 3GMMA 4MNHB 2FX9L 2FECI 1JWMA 4O58L 2AQ3A 1FNLA 5EBGA 1D5XB 5FYJE 3FN9A 2HT3C 3TF7C 4Z95H 4LVOC 3QI9A 3MX0A 4EQ2A 1WZMA 3JV5A 3HUJB 2RQ8A 5D7LE 2OYPA 3GMOA 5T5FL 5ESAA 2NY0C 4XAWH 4JFFA 5I66A 4YHZL 3ESUF 5FEBA 4KQ4H 3BE1H 4GAJL 3RWCA 4XP4L 4C57C 1VADB 1V3KA 4M61A 1H9VA 3RU8L 1Y18B 2PO6B 4LHUD 5FF6B 2X7LB 2R0KL 1ZLVK 2BHUA 3VXNA 3QWQB 4L4JA 2X1WL 4FP8L 4OLUL 1MEXH 3LPFA 2XXMB 5JR1L 4HIXL 4XPHL 1IAKB 3TVMA 3RVVC 3FQNA 5E1HB 4K2UL 5JHDE 1JFQL 5EO9B 4JRXB 3VGFA 1G0YR 1NKOA 5INCB 3T0EE 5C9JB 4BM7A 4D9QD 4YDIH 4JO3L 5DVOA 3EDJA 3KLDA 1KIRA 4IIQC 1YMME 3IDJA 4OTXH 4OCSL 1MPAH 1IBGH 2VXQH 3OKLB 5LCVH 5I1IH 4FA8A 2AEPH 1U2CA 5DJDA 4L9LB 2I9TB 5EU6E 1QD0A 2QEJA 4ODHH 2E7BA 3MRIA 1G7QB 4M00A 3D0LB 5DJZA 4MSWA 3VRJA 1CK0H 4ZFOA 3KHOA 2XZQL 5GGSA 1MCHA 3BGAA 1T7WA 4JZOA 1G7QA 2D2OA 1I7ZB 5D2LB 5I74C 4M6OL 4CNIA 1BAFH 5ID1A 1IKFL 5JOEA 1IKNC 2ADGB 2GSIB 4P2QA 3PQYD 5DZOA 2H8PA 3EOBB 2FX7H 4JPKH 5L2JA 4PGDB 1OGAE 3RL1A 3ZKMD 3D48R 2FH6A 1XGPA 1T0PB 3V5KA 1BF2A 4Y19E 3RVUD 3S35H 3BGFB 3LKOA 1FNGA 2HH0L 2DQCH 5EU4A 4UB0L 1CD8A 2CK0L 5HHME 5KVGH 4RDQF 1S7SB 4JFFD 2GAZB 3MRPB 4KUZH 1WZ1L 9CGTA 3GRWA 3VGGA 3VGEA 3QA3A 4PS4H 5DC0A 4PJ5A 4QRTA 3VXRD 3BP5A 3OSKA 1LDPL 4QRRB 3GSNH 2F9BT 3L5IA 3D9AH 2VE6A 3V4PH 5HY9B 1NC2A 1ADQH 3VFOA 1JHKL 2J5LC 2DYPB 2W38A 2YA2A 4NN6C 1XGRB 1OAYL 4J3TA 3D69A 3SE4A 1SEQL 5JXAH 1XGYL 4J4PA 4WW1A 3I6GA 1QYGL 2IF7A 3J8F7 3OKNA 1XGRA 3NABL 4DZBA 3T3PF 4GS7B 2XZAH 1KUMA 5B39A 2J8UA 1ADQL 5DMIH 5J6HA 4MNGE 1Y6NR 5I1JH 2R2EA 1ZA3A 1QR1B 1YNKL 2MQCA 1L7IH 4WO4C 1RIUL 3O3EB 3O4OB 5DQ9A 3HMWL 5IR1B 4HEME 4OAWA 2O61A 1CL7L 1GGBL 2JB6A 3KGRA 3LRSB 1HSAA 4QOKB 4YFLF 4FQXD 4UQ3B 3WJJC 3PNWB 2ZSWB 1KXQE 3M1BA 1BIIB 1QG3A 4LSVL 3OJDB 3O0RL 3SKNA 2H45A 3O2VL 4KMQA 4UDTB 5HXMA 1GYAA 3SE3A 4RFEB 3QUZD 2JK5A 4IMKC 4MDIB 5BRZB 3HUJF 1AP2A 1R3IL 3HMWH 2WBJD 3B5GA 1RIUH 5CGTA 1WAAA 4BSWB 1MLBA 2YMXL 2XQYG 4OM1H 5D7IA 3EO1A 3RWHB 1CICD 2OK0H 3GGWB 1ZVSB 4OQTH 4PRBB 4KI1A 2YPLD 2CDFA 4PRPA 3HZKA 4MJ6B 3C08H 3OXRB 1JN6A 1B0GB 4WFED 4MXWL 2V9RA 4HC1L 3TESA 1JNHB 2H9GB 4EI6B 1J1XL 4PB9H 4KHTL 3VXUE 3QUXC 4R96B 5C0AB 2AEPL 2DMCA 5GIRA 4HFUH 5HI4C 1CFNB 2HTKD 4I48A 1U8PB 4GRWB 3PGDA 1MCJA 2B20A 3CFCL 2MTPA 4OLXL 4DEPB 1KPRB 1D5MB 2HYMA 3HG1B 3NAAH 4MA7H 1R5WB 4GSDL 5DYOB 3DRTB 4Q9CA 3D3VB 5L2KB 4N90D 1YQVL 3QQ9C 4LLDB 1MCRA 5EU3B 3C6LD 2CGRH 4QRRD 2MMXA 5ADPL 4DOHB 3QO0A 1IKFH 3WHE1 5EOTA 4EUPG 5DR5L 3ILPA 4U1JB 2DQDL 2E9WA 2UUDK 5EU5B 4OKVA 3QJHB 1QSEE 5EN2B 3FTGB 5HYQA 1MH5B 2MWCA 1GHFH 1YEFL 5EOTB 2VDQH 1ACYL 1S7WA 1ZOXA 1BQLH 4YFDB 5C2BL 4NRYB 2FJFA 3UJIH 3ARGC 1YMMB 3HE7A 5TGBB 2EKSA 3MRHB 4F58H 2AXFB 2CDEA 4JKMA 1E6JH 4M5YL 4RMQA 4QHKI 4X6DB 4J6RL 1KGCE 5E7BA 35C8L 4LLWA 2VDOH 4DEPC 4FXGB 4XC3L 1JGVL 1TDQA 3PL6C 4UT9H 2CPCA 5JIPA 4K7PX 1I8KB 3FO2A 4PJCB 2EXYC 1P7QD 4K8RD 4HJJH 4ETQA 1Y18A 2PO6A 1UJ3B 2VXQL 1R5IA 4XPBL 3GSNL 1MRCH 1U3HB 4UU9B 4HKJB 4W68A 1A9EA 5IF0A 1KN2L 2DM2A 4PJFF 1EX0A 1S7VB 4J3SA 3L3DA 2VB5A 4OTXL 3MMEA 3VE0B 4WI7A 1QVOB 2MQ0A 2AJYH 4NQCA 3P0VH 2NXYC 2VN4A 1FV1B 4PJ9B 3ALPA 4JY5L 3VDBA 1DBBL 1SY6H 4KRLB 1CDBA 5F8RC 3UTZB 3GSNB 2OZ4A 1AIFB 3DXAB 5GGRB 2UWEB 2I24N 5F7DB 1BQHB 1U91B 2YRLA 5A3ID 2YPKB 3LKNB 1EA9C 1YNTA 5FECB 3ULUE 5EBWB 5DF0A 3TFKD 3P9LB 4HLZG 4S1DC 4YBQC 1JWUB 4MSWB 3NIDE 2Y7QA 4KDVA 3STLA 5I1AB 5C0CD 3CVHH 1G7MA 1CFTA 1MHHB 1EV2E 1Z3GH 4G6KL 4ZPVA 4ELME 4AM0A 2W60B 4BQCA 1I1AC 4WV1C 2KPNA 1EVTC 1BFOA 1T22A 4Z78A 5MEOB 3NFPA 2VLJA 2A0LD 1F2QA 3HMXL 1CK0L 3JWDH 5K9QG 2YR3A 2BRQA 4AM0B 1HZHL 1LEGA 2BVYA 3V7AG 5D7IF 1AFVL 1I3GL 2BVTA 2VLJB 4OF3A 3VWKD 5ACMA 3MUJA 4X0KA 3ZHKA 4QRQA 4PJAF 4QXTA 3DTXA 2ZUWA 3PABA 3GHEL 4RMRA 1INEH 5EU4B 3U0WL 2VWEE 1T04B 2PCPA 2PR4L 3UTQB 5LQBL 4L8DA 1V3JA 1OW0A 3U36A 3JV6B 2KKQA 4K3JH 2R0ZL 5CEYB 5TDPA 1IEAA 3ZTJH 1YZZA 3IJHA 4LVHB 1S7TB 1DBMH 1DQLL 2PYED 4JM4L 1YEJL 2PW1B 5I1KL 4EOWL 1FYTD 2EH7H 4XNUH 1KTKE 1A7NH 5T1DL 3TT3L 2K9UA 3TNMB 3OQ3B 4P3DA 4OV6F 2XQYK 3SDAC 3UBXI 4FQ2L 3WUWG 1U8KA 5D8JL 1WV7T 1RPQA 1JBJA 4PJGA 5D1ZC 2E27H 1BVKA 2AEIT 1KPVB 2DKUA 4NWTH 5C07D 2PYEA 5D2NE 3FT3B 2V5RA 4LEOA 4OFVA 4JFPA 32C2B 1XF2B 4H1LB 3W2DH 3UTSD 2PYEB 4ISVA 1DFBH 4KVNL 3F7YA 4LHUG 4GUPA 3RNKA 43CAA 5M7QA 5CCKH 1BP3B 1X4XA 2NYYC 1EDQA 5F93C 4F2MA 3KLHC 5T3XE 2XWTA 2IPUG 2C3WA 2FEEI 3B2VL 5E9DD 4OAWB 1URLA 3BO8A 1PDKA 4TUKL 3S3JA 5D1ZA 1HSAB 3NH7L 4QOKA 1U8JB 5HDBE 4KVNH 3QZWA 4M7JL 4P5TB 1KSRA 1WVZA 3P4NA 4FQLL 2BXZA 1MI5D 1JNLL 1BFTA 3ZDZE 1N0LA 4FXLA 3CK0H 3V6FB 1FFPB 4XNYL 1PQZB 1IM9A 1TVDA 1MWAB 5T1LA 1SM3L 1LO5B 3GUTA 2AS5M 3STZB 3LIZL 2HFEB 5K9OA 4DGYL 2Z31A 5F9AC 5D7IB 4WW2F 4XPAH 2FEEL 3V2AR 3VU2A 1RUKL 1S5HA 2Z93B 4LSPL 1RSFA 3IXAA 2CDFB 1K8IA 4J6RH 5HYEA 3V5HB 4JJ5B 3DVNB 1JGLH 2W59A 4FRWA 3BPLC 2FB4H 3VD5A 3MJGX 4OF5A 5FUOL 2HRLA 3O6FC 5ICZA 4R96A 4X6DE 1QACA 3DYMA 1G6RL 3PGFH 4WUKH 3QG7L 5TQ0H 3FT2A 5FB8B 5KVEH 4XPFL 4MAYA 1NCBL 4OI7A 3ZE0E 3MJ8B 5DR5H 3MJ7B 2GKIA 3GMOB 5H37H 4EIGB 3WFBL 4JFFB 1CGUA 3A67H 5TQ2H 5BO1H 2NY1B 3RVXC 3WXWH 1QBLH 1XR8A 2FIRT 3G5VA 2NTSP 1CLCA 4PIRF 2YUWA 4JN1H 4LPUA 4MNQA 1EEUA 4RISH 4IDJL 4POYA 2PYFA 2D03L 5FHBL 1KGCD 2NY6B 3WFDH 1QEWB 3ILPB 4MQXC 4U1JA 2Z92B 3HNVL 3A0OA 2OX5A 4JAMB 2JTDA 1Q1JH 1CIUA 3BPLB 1UWXK 4K8RL 1QEWA 3ARDA 4EI5A 1DEEB 4OD1L 1E6OH 1L0XA 3WIIH 3HA0A 4ZSOB 1I75A 3HE7B 2X1PA 1KXVC 1MFAH 1M7IB 4XB7A 5C3TA 4D3CL 3WFHB 4PG9A 3QIUB 2NNAB 3DXAD 1GHFL 1YEFH 2VLKE 1KCKA 5FO7A 4GKZB 3MRLA 4AK1A 3C09C 4PJEF 3TT1L 3FN3A 4JY6B 5DUPL 2IPTL 3D39A 4RX4A 2HJKB 1CGVA 4U0QB 4Z7OE 4NUJB 2WNGA 1BOGB 2OP4L 4OF6A 1JNNL 4MD5A 4RQQA 1EERB 4ZOCA 4IRZH 5DI8B 4KV5E 2VXVL 4K3HA 2OL3H 4LDLB 1HIMH 4MD4B 2F58L 2XTJC 5D2LA 5HGHA 1A21A 1SBSL 1FYTA 3X3GH 2X89A 3HC3L 5DRXB 4G6FB 2IPTH 3CXDL 5GRVL 5SWZE 4HZLB 2I5YH 4PYGA 1MWAH 3VFGH 3GO1H 3RL1B 4UDUA 2CH8A 4QOKE 4F33A 1A4JB 2GCYB 2Q8AH 3P9MB 5C07E 3CZJA 2BVQA 5EFIB 4X6CA 4FFZH 3LKOB 1RI8A 4L9LC 1GRWA 5CBEB 1A3LH 2A77H 2IAND 25C8H 2Q7YA 5I2IB 3VRLF 5DURB 1XF5A 2ICEB 2NW3B 3L3IB 4KI5F 4FQXB 4NQVA 1WIPA 4GKOA 1RMFH 1YPZE 4U1KB 1A6WL 3BDXA 1KG0A 1DQQA 2XTJB 4P2RA 3C2AL 4QRTB 2IAMC 1RZKL 1FGVH 4NHUB 5ADPH 3HG1D 3JWOL 2IANB 3DX7B 3NZHL 1B0RB 5EU7C 4B53A 2VL5A 4QXTB 4MD0A 3WS6C 1KLUA 5D8JH 3GMPA 3QEGL 3SCMD 2VLRB 3DROB 2HRPL 4W6YB 5IEHB 5BCAA 4IOFD 1E6OL 1Z6JT 5FGBC 1CVSC 5HGGS 3KPRB 4TRPH 1RHFA 5EG6C 1IGIL 4P57B 5CZVH 2NXZC 1EO8L 3GMNA 4DK6A 2EDNA 3PV6B 2O61B 2GK0A 2X4QA 5F7NC 2IAMB 4D94A 2HP4A 4XMPL 3ROLB 1ORQB 2NX5A 1BZ9B 4PJGB 3WXWL 4YNYA 2X4QB 5DJXA 1IGYA 4ORZC 4LHQB 1A7QL 2B0SL 4GW5B 1MI5E 4QRRE 3H42H 1D5IL 5C0JA 4TPRL 1DP0A 1C5CH 4NO3A 4YNYB 4FFVC 3RAJL 1K8DA 1T20B 1YC7A 4HBCH 4HKZB 2EDKA 4LBEA 4QTIL 4OZGB 3QEQE 4TUKH 2VLMD 4U1HA 4XPHH 4B50A 5HHMB 3MLYL 3WNMA 4LVNB 4EJ1C 2YWZA 3OR6B 4KUCF 4GBXA 1FORL 2C1OA 1GXEA 5FYKU 3S35L 4UZGA 5GS0H 4DVBB 5EU6B 5IUSA 3IFOA 2BVUA 3OG6B 1NUFA 2D9QB 3WDJA 4I13B 5J11C 4Q2ZA 3QRGL 5BJTB 5I16B 2D31A 5T33H 1EAPB 4CVZB 1T1XA 2GFBB 4NM4H 5HYSG 4NN7C 1UXSA 4PJBA 5D7KE 5F21B 1RJLB 2E7LA 4XCFL 4LAQL 4LMQE 1DE4B 3QI9C 1T1XB 3IGAB 2F54E 4NC0B 4B7LA 1BD2E 2GHWB 3BEWB 5LBSL 2HFTA 2XZQH 5CILL 3UTSA 2GTWA 3P0VL 1FYTE 3QR2A 1Q9WA 1UYWL 3GKWH 4XMKL 3VFRB 3NOIA 3UTTE 1SBSH 3O6MH 1ETZB 4P23A 4HK3N 5IBUG 4M7KH 5FCSH 1KB5A 4XGZA 1A6AB 3MXWH 3QJHA 5EN2A 2D03H 2KQNA 5IBTH 1P9MC 1ETZA 3C5JB 2WWMD 3KPQB 4Z7NE 4CADB 3LKPB 1BEYH 5D7LB 3T4AA 1QBLL 5JNYA 3QIWD 2VR4A 3D39E 4N0UB 1QFHA 1EJ6A 2BVPA 5C0AD 2B2XL 1FIGL 3T0EB 4OT1L 2EKSB 3MRHA 4JPWH 1LD9B 3S98A 4X7FC 4M7KL 2FNBA 4PJIA 3MODL 3VWKB 1FN4A 2VRAA 3O6ML 3NZ8A 1HH6B 1L7IL 3AXLA 1IQWH 2YA0A 5DQDL 3QEUB 4JVUA 3TCXA 3BPOB 1NMCB 2EDBA 3ZDYE 3FZUC 2P5EB 4HUVA 5C6PB 4UU9A 4AEHL 3VFMA 4JM4H 4CMMA 4WFFD 2VAJA 2AJSL 1JK8A 3SDCD 1CFQA 4MNQE 2WAHA 3E2HB 5DJCB 1IC1A 4YE4H 3D85A 4PGEB 4Y4HB 3NPSB 3N9GH 4QTIH 3IFLL 4MAYD 4KGJA 1NEUA 4WTWA 5C92A 3MXVL 1UZ8A 5DLML 1EHXA 1ZLVH 1A2YA 2YD9A 3D39B 4OBRA 1GOGA 2YPVL 1PZ5B 1J05A 5EPMB 3L5WA 3TBTA 5IT2L 1LDSA 2IQAB 3KXFE 1YNLH 4DQOH 4Z7QE 2R8SL 1DSFH 3O2WL 1KLGB 5EBLB 3CLEH 3FQTB 2L0DA 3OX8A 3B6SB 4E42A 5L88H 4F9PC 3FAWA 1GCFA 5E95B 1ACZA 2GUOA 4J3OC 5BRZD 4ZODA 3JZ7A 3QHFL 5B21A 5E08H 3RHWK 3P30H 3CZFB 3WS3A 4FQHA 2EIEA 3VH8B 4KTYA 4Y4HC 5CGYD 1WBXA 1IGFH 1MNUL 1JGEA 2PXYD 2JB5L 1ZEAL 1P4IL 4OUUB 2A73B 5GSVB 3U46A 2EDJA 1IGIH 3QUMB 3MNZA 2COQA 2H26B 3QIBA 4GH7B 4YLQT 2XN9A 3L95A 4C83B 1T2JA 5EUKB 3ROOA 3U6RA 3KXFA 4Y5XB 5C2BH 3MNZB 5GGQL 4U1SB 2DJ4A 2R1YB 2PCPB 3U6RB 3V52H 3NTCH 4M7ZB 3MBEB 3ZDZF 1LQSR 3QDMA 5GGVY 1HHGB 4MVBD 2DYPA 1AKJA 3U9UA 5I1HL 4AEEA 1WEJL 4MWFA 4WW1B 1I3UA 5ETUA 4PJAA 1DBKL 3TNMA 2XZAL 2HN7A 4WFHD 2VISB 3RZCD 2WUCL 2ZG1A 4AJ0A 4NCC1 1BVKB 4ZO9A 4MD0B 3O3DA 2HN7B 4PP1C 4Y4KC 3F6LA 1QBML 3Q3GA 1OPGL 4PJFE 1QO3B 3DX8B 1OARL 3QFDB 1CF8H 4Y5XC 1NLDH 4PP2B 1OD7A 5H35A 1UJTA 3O3EA 1YYMH 1U42A 5MENB 1HHJB 2FIKB 1ACYH 1OGTA 3PHQA 4Z77A 4UIMB 4Y5YC 3BD3A 2XT1B 1NAMB 4UOW0 3IDXH 4PP1D 3OJDA 3BUYA 1CN4A 4UAOB 3QDAA 6FABL 1NAMA 4P2YA 3MV7E 4HXAL 1FBIH 2VLME 3SQOH 2DAVA 1RAMA 4PJ7A 3O45B 1NC4B 3R1GL 3QQ4B 4P2QE 3ZE1F 4M48L 1D6VL 4PG2A 1BZ7A 3QULA 4JDVB 2DLHA 1JE6A 2VO5A 3AY4C 5AUMA 5F7EH 3RVWD 2Z8VC 4U7SA 1TPXC 5DGQA 1A1NB 4NKDB 1BAFL 3QH3B 1B88A 1C5CL 3O8XA 2C1OB 3GJFK 2CK2A 5LWYH 4UTBL 3LRGA 3RVVD 2VAAA 4WFFE 4RSVA 4Y4FB 4XXDB 2JJVA 1A7PH 1MFEH 1CR9L 3O8XB 3GBNH 5IJVA 1N5YL 3EO9H 3MA7B 4R0LC 4FG6D 2FO1A 1ZHLA 3BZFA 3DX6A 1I1AA 4LRIC 2XZCL 2I9TA 4GLRH 4XNXL 3U2SB 3MLWH 1LDPH 5KS9E 4L8CA 1X5ZA 5EU3A 5LWYL 3D0LA 1CGSL 5I75C 1UZ6E 4HGWB 4MX7B 3QO0B 4L3EE 4YXKL 3N1FC 3PGFL 4O2FA 4WUKL 1SYVB 1QTYT 2B4CC 1FZMA 2XWJA 3EJZC 3UAJD 5BV7C 2Q76A 4M6ML 3EJYC 5HHQA 5KG9A 3FO0L 1D3CA 2K7PA 3QO1A 5KVFL 5DDHB 2HH0H 5CSBA 2HVKB 4FNLH 4X4MA 3VXMA 3MRGA 3EFDH 4I3SL 3C5JA 4Y2DC 2H3NA 5LKNA 1DN0B 2ENSA 1QLFA 4KXZI 3DUSB 3BP4B 4FZ8L 4GSDH 4YBLB 5D7SH 3WFHA 1FVEA 2K3TA 3JSSA 4PJIB 1K5NA 2DQGH 4JRWA 2B4CL 3QSKB 3O6KL 4L8SB 2J8HA 4QHLA 4PJ8B 2VR5A 3BT2L 3PQYE 1DUZA 2D3VA 4HKJA 3D1MC 4M02A 4U3HA 5IF0B 4N0RA 5SWZD 1X5YA 4JHAL 4XPGL 3DSFL 5CJ8A 4EOWH 2VL4A 3JBG7 4KGLA 3JTSA 4PJHE 4R7DA 2J3SA 3C8DA 4QRSB 2ZOLB 4NO0B 1FV1A 5ALCL 2CUMA 4R90L 1J0JA 5DVKA 1UH2A 1P9MA 1CFQB 4L4TE 1W0YT 4QRSA 4HPOL 2UZYB 2ZKHL 3ZE1E 2ORBL 3HE7C 5BVJB 5J1SC 1GIGL 2D7TL 3W2DL 3ZKQD 1NDGA 5EZJB 1ED3A 2BNRA 4G8FB 4XZUA 1H3PH 3CFKB 4OLUH 4YXLL 5EPMA 5EC2B 4NT6A 3I75B 1WK0A 3IDUA 1MHHA 5I30H 1YDPB 4PJAE 2BVOB 4WHCA 2EEDA 4KKBD 5EC2A 5SWSA 3T2PA 1WITA 5AYUL 4G8GE 2BVOA 1S7XB 4G80A 4ZFZB 1DL7H 2WINB 2N7AA 4R3SB 3KYMA 3TVMD 4U6VH 4IDJH 4HG4K 1YYML 2OZ4H 1F00I 3VCLA 1JGEB 4ODHL 4KKCD 4YHNB 3D2UB 1YEEL 1VGKA 4X83A 3MLUH 1XAUA 1UM5L 5CZXC 3VFTA 3KYOB 2XG4A 4PS4L 4L8DB 5AYUH 3GMPB 2YD1A 4AEIL 3M17A 5I8OL 4DKFL 3FQUB 4JFXA 5TDPB 5D96B 2YS4A 1I7UA 5IEHA 2YD8A 2E8ZA 5MENE 2A38A 2R23B 4KDTC 3EYVA 4JG0L 1AXSA 1AGCB 1HEZB 4LPCA 2Z31C 4EUPH 3FOLA 5HVGB 8CGTA 5SX5H 2BCKB 1U8KB 3WSQL 5ICXB 1WTLA 1XIWA 4J8RB 4P59L 5JORA 1RUQH 5F9WB 3SJVD 3WE6B 1ZHKA 1MCWM 4JFQB 4YPJA 1S9YB 3B43A 3TEUA 3FHQA 5IVXF 3FT4B 5DT1H 1MFDH 5I18H 4NO0D 3DGGB 3QQNA 2W92A 4PP2A 5GHWL 5CLWA 2I27N 5GGUA 5C71A 1HE7A 5IB1B 5E2JA 2F53A 4XMLL 5DMGC 5E6IB 1X5LA 4PREA 5CWSA 1DQLH 5EOQH 3OHXB 3PV7A 1CDJA 2IWGA 3SDDA 2NXZB 1TJHL 1CVRA 4OZ4B 5IVXA 4P5TA 3NCCB 3KLAA 3NVQA 5KSUB 3AC0A 1INQB 4HW6A 3V6FA 1H0DB 2DM7A 4F3FA 2X7LA 4PJBB 1FNSL 5IFJB 1XH3B 2AQ2A 5AEAA 3MXWL 4RA3A 3Q6GH 2VLJE 1BJ1J 5IFJA 2JJSA 4Q97A 2LTQB 1IGJB 1PG7H 1CCZA 2NY3C 3DVGA 5CEXB 2BSED 3D87B 4ZD3L 3QDME 1XEDA 2Z8RA 5L6YH 1QRNA 3BH8A 4Y4FD 3B9EA 3ARFC 1FVCB 3CDCA 1FFOA 1AKJD 2I5YL 4YDKL 1HSBB 3KJ4B 2HT4D 5F1OB 3RDTC 2PTTA 2WV3A 5E2WL 3LN4B 3DX6B 1YY9D 5IM7B 4Q6IC 2VDML 2UYLA 3V0AC 4KQ4L 4NSKB 3Q1SL 2WWKT 3BP6B 1E4KA 3HE6D 3DYOA 3RGVD 1MQ8A 2UWEE 4LLYB 3PDDA 2NXYB 3FFDB 3GB7A 3K7UA 5HJ3A 3TP4A 2XI9A 2Y7QB 4QRUB 4Z7WE 1ZGLB 1TTFA 1LE5B 4O2CB 1WWWX 1OWWA 1SYVA 4Z7VB 2BOBA 4G8GB 4QRUA 3C2AH 5F7HA 4HK3J 5ALBL 2Z9TA 4EUPB 5JHLL 1JFQH 3T1WA 2VXUH 2EXWC 3ZSSA 2DBLL 5DDHA 4QNPE 5CS7A 4Z7VA 3G5YB 4P9HH 3VXSB 5F1KC 5J9PA 1WSST 3MTRA 5E9DB 4B5EA 3OAYH 2BY2A 2ZSVA 2ADIB 2PNDA 3G6JF 3WIHL 5CCKL 5HI4D 3B4NA 3QNZA 1QRKA 3HRZA 3TN0C 1H3XA 4OCXL 4OD2A 2BNQA 1EPFA 5HDOA 3ARQA 3VG0H 1QBMH 3DLQR 1JGUL 3C08L 4K3DL 2FLRT 3QNZB 1K4DB 3RY4A 1LP9B 2JE8A 4OLYL 4NUJA 3G6JE 5DC4B 1A1OB 1DLFH 5FHBH 2NY0D 5D1XC 4L4TB 5LGHH 4U2ZA 1NC2B 1NMCC 3KHQA 4I9WE 3DNKA 5SWQA 1A1MA 5DHYB 3UPRA 4CVXB 5BS0E 4X7DC 3CLFL 4LLMB 1AY1H 4FTVA 5D6DA 5F1IA 2AEWA 5DRXA 5HVFB 4WV1B 4DOHE 5H94A 4NNYB 4UIKH 4UOJA 3E2HC 2NMSA 4FQQA 4NFCA 2C1PA 2F54B 1F6FB 3WS3B 3AREC 4XT1C 1TVBA 1GGYA 2X4NA 4JFDD 3HG1E 5FDYA 3FQWA 3KJ6L 2ZWLT 3EUUA 4BFIA 4WWKC 1NSNL 1TVBB 1KOAA 4OIBA 3L3GA 1N26A 3LN5A 4W70A 4D9RD 1N59B 1YEDB 1HDMA 1YY9C 3ZDYF 1SMAA 1RK0A 1T21B 3CPLB 4NBZB 1UCBH 3N06B 4HMCA 5C1MB 1TQCB 4XCCL 2CXGA 2ZSWA 3PNWA 4U1SA 1OP9A 5T5NG 1JHKH 4HEPG 4Z7UF 5KSAD 5I9QC 1OSPH 5E2WH 4QCIB 2HJLA 3HN3A 3IF1B 3ZYJA 4XNYH 1KENL 2FX8H 3T1FB 3UTTA 4KPHL 4CU8A 5ILTH 3GBLA 1UQSA 4IRSD 1HQRB 1BLNA 4RISL 1C1EL 1MAKA 1RJZB 3F58L 3TNNB 2RCSH 3CU1A 3K81A 1NBVH 3O9WA 4LPYA 4NM8L 3U7WL 4WI2A 2AXGA 1OLLA 3EYUL 3L3JB 4UI2A 2BRRH 5CIPA 5FUZL 5I1EH 3SDXB 3SGKA 5E1AB 2CRIA 4PRPB 3HZKB 2FZ3A 4YHYC 5J3HC 4LLVB 4I0PC 1QFUH 4O9HH 2GJZB 2OR7A 3QDJE 5C70A 1W0VB 3SPVA 2ZPKH 4HUWB 3GMMB 4L4TD 1DBBH 1SY6L 1TQCC 3EYUH 3RZCB 5K9QI 1CL7H 4YIQA 5F7WC 4KJWD 4BQ9A 1W0VA 3SPVB 3PV6A 4XBPA 3H9YA 3X3FL 4I3RH 3MLWL 3QXVA 2VDOL 2AEQH 3QAZB 1AR1C 3V6OA 3RVUC 1NPUA 1UH3A 1HH9A 3WNKA 4XWGL 3LMJH 3ZKSD 2XPGA 4J8RA 5JORB 2IH1A 1IQWL 2NTFB 2VSDA 5DSCA 3U4AA 1YN6A 4UINH 3W9DB 1WBYB 2XTLA 3AAZA 2OTUB 2VDKH 5E8DL 1CICA 2C3XA 4Z7WA 1I9IL 1BJMA 5MEPB 2X9XA 3MA9L 4C55A 4TRPL 5IB1A 2F53B 5C0RH 2VQ1A 1RUAL 5DJYA 3D6GA 4X9BA 5E00A 3DI3B 2P45B 5CBAA 5TDNB 3P73B 3ULVD 5KZCB 5JW4R 3QDJB 4LKXB 4OLXH 1T0NA 4WI5A 1S7RA 1NLBL 1QKZL 2JJTC 3LQZA 4HWEL 5IV2A 3O41A 2GTZB 1L6XA 1DLHB 4JFZL 4EKXA 1KFAL 4XPTH 2VLLA 2FRGP 2P8MA 2CKNA 4HZAA 2P5WD 4UMGA 3IJYB 3WO4B 1RUAH 5JPMB 1M1SA 3LPGA 1QBBA 4GT7A 4MQSB 2H41A 2HJKA 1DLHA 5C0GA 3P4LA 4NP4L 5I8KH 3WUZA 3GIZH 4XH2B 3W0WD 4PLOB 1CQKA 3PWJA 4XNMB 5F7KC 4LU5L 1GC1C 3TT3H 4JDZB 4WIQA 8FABA 3WHXA 5TE6L 4YR6B 2HJFA 2Y72A 2H8PB 4ODBD 3CCHB 1I1AD 2NY6C 3I50L 4JFOA 4L4VB 4FFZL 1FL6B 4HX1B 1WWBX 3I9GH 3BGMB 2RGSA 3VXMB 1QLRA 5HSFA 5BW7A 2ITCB 4LAQH 1F6LL 2XY2A 3U0WH 3LCYA 3UTPE 4NJAL 3SJVE 1QLRB 1OCWL 4KI5D 4LQFL 3QIWC 3GMLB 5JUEH 5DD3L 1REIA 2Z0BA 3T77B 1G0DA 4U3CA 1ES0A 2APVA 4MB4A 4O00A 1X5XA 3DI2B 1P6AB 4U1NA 5IK3A 1A3QA 4X4ZA 2AV1A 2FDBP 3BP5B 5GZNC 1QZ1A 1GIGH 1OGAD 1WEJH 5DD1H 3PJSB 2ITDB 4M3JA 3VFPA 4U33A 3H3PL 1J87A 3CC5A 5DK2A 4ELMF 1U3ZA 1FO0A 5EDXA 5BW7C 2EZ0D 4BKLB 3G08A 3VFPB 3SDAA 5F6HI 3MUHL 4NHCH 4E41B 2C3GA 5EA0L 3DX7A 3IETA 5DEFA 1KIPA 1LO4H 3O4LE 5KOVC 4BKLA 3BZEB 2ZCKL 3UJTL 5AG9A 4P49A 2QL1A 4ZDHB 3EOTH 3SGDH 3AS2A 4OLEA 5J06A 4LVOB 4S1RL 3HUJE 5T1MA 3QDGE 2XY1A 5ITBL 2Q8BL 5I1GH 1MFBH 1NEZG 2H1PL 2O5ZH 3C6SA 4WTZG 2R8SH 3CFKA 2Q86B 3KPRA 4PJ8C 2LU7A 4YWGL 3HI6L 3P11L 3U7YH 3OGCA 4YDJB 4MCZB 3RJDA 1S9XB 3RIFF 5FUCC 3GI8H 1FFNA 1RHHB 2VOTA 3SKNB 3H7BA 1RZFL 3HLAA 4G9DA 5HPOA 3H9HA 1DDHA 3EJYD 3ROLA 2MOVA 3WFBH 2E7CA 4JHZA 3N9GL 4PGCB 1T4KA 1CD0A 1OSZA 4F8TA 3P2TA 4M48H 4XMKH 1T3FA 5GRYA 3TBVA 3QQ9D 5GSVA 4NO3B 3JTTA 5GGVL 1OSZB 5FGBA 4YXKH 2X4PB 1T3FB 3RKDC 4HXBH 5DRZA 3ROOB 1VFAB 4G7YL 3VI4F 1HOCA 3G04B 4QXUH 3QYCA 4N0UE 5C7XH 2D7OA 3OKDA 3MV9A 3I50H 2J88H 3NFSL 2OK0L 3BH9B 3SY0B 4WGWB 3EZJB 2BSTB 4BH8B 3X11A 4MA3A 2PXYA 4ZXBC 4HFWA 5JOFA 3NMEA 4V2BA 1YEJH 1N5AB 3FFCD 3IDNB 3BESR 3ULSB 1J7VR 2AK1H 1I9EA 4HJGA 2GY5A 2V7NB 1J10A 1UXWB 4G7YH 2ZOKA 5ITFB 5I19H 3L3KA 2R9HC 4PRHA 4OCRH 3KLHD 5HGAA 1V7NH 5EZOL 2YOCA 2NZ9D 1S5HB 3WE6A 1ZAGA 3QNYB 3X14A 4M6NL 2DQUH 2X4UB 2RBLA 4PRHB 1IC4L 1W0WA 3TA3B 2YN3A 1VSCA 1IFHH 1VCAA 5BOPA 3VMOA 5HYQB 4UNTA 2VDNL 1MHCB 1Q8MA 4ORGB 1OAZL 2DB8A 3GSVA 4P4KB 4TUJB 4IS6B 1GOFA 2MKWA 3DVIA 5E6IA 5JTWA 4EBQL 2AXFA 5D9SB 4RDQG 2YPLB 2X44D 1BBDH 3N1GC 4LIQE 4PD4K 3SDDB 1PYWA 3QEQB 5J13B 4YAQA 4M61B 3HR5A 3OMZA 4Y4KD 1FC1A 4QHNA 4OM1L 5IWLC 3RDTA 3SN6N 2IH1B 4PLJC 1UB6A 3WUWB 1J1OH 1EJOL 3QUMH 3KVQA 1G9NH 5HDBF 1OAZH 1FZOA 3BE1L 4GAJH 3AXLB 3WL9A 1A9EB 3TA3C 4OGXL 4W4NA 3IS0X 4HH9B 3WDHA 4MHHI 3T0EC 3GI9L 4OZFA 3SCMC 4S1SH 1MRCL 4MLSA 3KPTA 3T65B 1CT8A 4IOIB 3IDJB 3R06A 2A1WL 3IRPX 4Y4FA 5E6IC 4NKIH 4NBYB 3BWUC 1G6VK 1FO0H 5D6CA 4N9GA 5GS0L 3LKQA 1KC5H 5C9JA 5JDSA 1UWXH 4ZUVB 3TPUA 4N9GB 3MRIB 3TO4A 4Y16B 4XPFH 5IWLA 1BQHA 1U91A 1UM6H 1KIRB 2D4FA 4JGMA 2C26A 2D7MA 1DBAH 4KTDH 4RRPA 2XKNA 2Y4SA 3OKLA 5AZEH 1BGXL 3ULVF 4GKNA 4O02H 4I77H 1QSZA 2OI9C 2H2SD 4LL9A 1CE1L 1JMZA 2FECL 3C9NA 3TLRA 5ID1B 4KPHH 1MIEL 4MD4A 2VDLH 4AT6A 3MV11 5E4EB 3W5NA 4ODUA 5C09A 3UJIL 4PLNC 4YR6A 4PBVC 3BD5A 1D5ZA 3V5KB 4LCWE 4IRSB 5SX4I 4RCAA 2XFXB 2WIIA 3HCVA 3MV7A 4NNXB 1Z5LA 1QLFB 1ZV5A 4MA7L 2BVQB 2HTLC 4I5BB 2KZWA 2W0PA 5DUMH 1FVEB 2CGRL 4POUB 2HRPH 4UQ2B 3VD9A 1DBJL 1BREA 2H32B 4XX1G 3S5LB 3QA3B 3AM8C 3LS4L 3V9FA 1FNGB 1YMMD 3Q48A 4YHMH 4NQVB 2E9JA 2ZNXA 4RMWA 1LILA 4JRYE 1FBIL 3PXHA 5ESVA 1CBVL 5I1JL 3LEVH 1BIHA 3F58H 3GSOA 3CC5B 5DK2B 3NIGF 4OZIE 1CYGA 2EYRB 5EORL 4C4KT 5KAQF 4K23L 2EO1A 4CW1B 3IFPA 1S9WB 3VFSB 5B8CA 5I1GL 4WV1A 3TN0A 1KIPB 2IC2A 4RAHA 1VFMA 2F19L 2QADC 2OR9L 4QXWA 3BXNB 2EYTA 1J0HA 4LSVH 4ZNCD 3DOSA 5F6HJ 3FRUB 2E8YA 3TN0B 5JA9A 3F7YB 4GUPB 43CAB 5C0AE 5C3LD 3QPXH 1H5BB 4ONHA 4Z0XB 2VXVH 1ZANH 4NQEE 1OAKL 1U2HA 4WUUD 1B3JA 1DR9A 3BZ4A 4JRYD 1PEWA 3KPSE 5CSGA 1LMKA 5HHVL 2NX5B 1BZ9A 3AFLA 1AJ7L 5E94A 4ZS7L 1UJ3C 4NUGL 2VZUA 3HZYA 1T7ZA 2PUQT 4GMTH 4ZPTB 1OTSD 3RGVC 3EYOB 4LKCB 5KANG 1HYRC 3BOVA 1FL5B 5DFTA 1ZLUK 4XVJH 1FFPA 3O45A 4JB9H 1EO7A 5FYKL 1J11A 5DMIL 5IGXH 4JRYB 5SV3A 1CIDA 4A2MA 2I60H 4MXVF 3OXRA 5EBMA 2G75B 4HIIB 2FR4B 3DPBA 1JYVA 3MRMB 2A2QT 4LFHG 5HI5C 4PB0H 1AD9B 4Y4KB 3QWRA 1HWGB 1ZLSH 1I8IA 3SDYL 3SY0A 1FNHA 1I9JL 1KCSL 3L3OA 3MRMA 2NY3D 1CFNA 1T03H 2XICA 5F70A 4WEMB 1FQ9C 1UM6L 4PJXA 1DTUA 3RGVA 3OG4B 4XBPB 3IGAA 1CGXA 5DEZA 3OZ9L 1I1AB 3FN0L 3ELAT 5I8KL 2EDLA 1QSVA 2IGFH 4PJEA 1E28A 2O5XL 1WC7B 3S37L 1DFBL 1GZQA 2XNAA 3I6LE 5EU7E 1HINH 1YN6B 3VFRA 2X4UA 3EFFB 3O81A 2K7QA 2XNAB 3DIFB 3QWOB 2A0LC 5E5MB 3ULVH 1G7JB 4V1DD 1CU4H 2X9WA 1TZIA 4K7PY 4PREB 5CWSB 1CZ8L 4OD3L 4P4KA 1JP5A 4YE4L 3FTGA 3LQAC 5C0DB 4NNPH 4TVPH 4U6HB 4Z5RB 3WNLA 2YD3A 5D93C 4TSAL 2IMMA 3P73A 3KNBA 1BBJB 4P3CH 3FO9B 5E8EB 3O8XC 4MNGA 4F3FB 2GITB 3FL7A 2BJMH 4UBDC 1LO2L 2Q6WA 2XN9D 2WBJC 2C5DC 5DZLA 5IW1A 2X4RB 4OZFH 2YRPA 1DUZB 4J2XA 2I9LA 3DRQA 3OKMA 2EDYA 1JRHL 2Y06L 4UTBH 2X4RA 1I9RH 1VA9A 3LV3B 4D0CB 1BFVH 3IKKA 4XNMA 4NO0A 3AB0B 1BEYL 1TNNA 1J1XH 4IRJB 4UOW1 5CEZL 4PJ5E 3AS0A 4JCMA 2RCSL 1KN4H 5BV7B 1VGEL 3LKQB 4GRLB 1P7QA 1MRFH 3L9RB 1YNTB 4Y5YA 2PTTB 2PKDA 2CKBL 3CFCH 1U8NB 4KMTH 2CQVA 2APXA 1KCVL 3L7EA 3LZFH 3L5WB 2HG5A 2HFFB 5HYSB 2XZCH 3GSXB 4G8FA 2R2HB 1F45A 3WIFB 5LBSH 2J88L 4M1CC 4KKBC 4XAKD 1S9KC 2Z4QB 1AHWC 3LEYH 2W1NA 5GRWA 3T2OA 5HDQL 5I1CH 4GMTL 1FP5A 5C09B 4LCUA 4NBXB 1G7MB 3HNVH 1NFKA 4QRPD 3VXOB 2D0HA 1J0ZA 1MI5A 5FYLE 1VPOL 1WLHA 2LE9A 4I0PA 2EH7L 1DBKH 3ZYOA 5J9PB 1AE6H 4XVTH 1V7ML 2E6JA 5EOCJ 2BSRA 5DJAA 3RY5A 2EDHA 5DEGB 3REWB 5K59E 1FIGH 5CEZE 2BSRB 2E3VA 1OB1A 4ODWB 3FB8A 5DMKA 2J1KA 1NCWL 3VFTB 3L5HA 3DXAE 5DTFB 3PABB 4M03A 2BNUB 3MJ6A 4TNWF 3KDMA 5FYLH 1JHLH 4NZUH 4POZD 3ZKNC 3MGAA 4UT6L 2BXYA 5C6TH 2HA1A 1YPZF 1AKJB 5CGYC 3U9UB 3C6SB 1G0XA 1BPVA 4XP5H 5T3ZE 1IEAB 3PUCA 4CMHB 1V3MA 4MCZA 4MQXD 3LKSB 3HI1B 5AAMA 3FOLB 1F11B 3G6DH 4FQCH 5DD5L 5ANMA 3MLXL 1NAMH 4F7MA 5FGCB 4F15C 3WMSA 4J1UB 4KY1H 5DD0L 4YDLB 3RWGB 4OIIH 4QHMA 5DK3A 5F88A 3BX7C 5KVMC 1AXIB 5JLZA 1JGUH 4HKZA 4YHLH 3T09A 4JQIL 4M7JH 2AKRA 1PG7L 3AM8A 3DHMA 4MJ4A 1NGXA 4LHUA 5IT2H 1N59A 1U8MA 3BKCH 1OGTB 2QQNH 2V2WB 4JEGB 4YO0A 4D8PB 1JV5A 4FQ1H 3AU1A 2YEZB 4DVBA 4ZTOL 2FO4A 3EGSB 3P40A 4PLKC 1S5IL 4HS8H 4IIQA 1PG7X 4OCMC 5DXWA 3UTTB 4BH8A 5DS8A 3R8QA 4NQSA 3KR3L 1GPOH 3EGSA 2X4OB 5T1LB 3GUTB 3EAKA 2BY3A 3H9SD 4PY7B 1LEIB 3RTQB 5C08B 2F53D 4XX1E 4LARH 3C5ZA 5L7XL 2Z31B 4TTDC 3BRGC 1A7OH 2UUDH 4CN4A 2XKUA 3RKPA 3IAPA 2DTSA 2C7UB 3KYNB 3D3VE 4G6JH 3V79C 4XCFH 4WO4B 1PD6A 3RJQB 2DWDA 4NJ9H 3AROA 5E24E 3V6BR 4WGVB 1OQXA 2EH8L 1W0WB 3PIQA 5ESQB 3CDGA 4JZJA 1CICC 1ZWIA 3RX5A 4JKWA 2DQDH 5TH2B 3SKUD 3JUZA 2XOTA 1I3RA 2W0FA 3RVWC 4Q9QH 4ZXBB 4X4YA 2VDQL 3TCLA 4WFGE 4KK8C 4JFDE 3RY6C 4NQCD 4N0FB 1F4XH 4IHOB 4OCSH 5DD3H 5DYOA 1HH6A 4CU7A 3MYJA 3QXWA 2ARWA 2PTUA 4HWZB 4IMLA 5GXBB 1KELH 4ZUTB 3IU3A 1UVQA 3OF6D 1ZGLA 4Z9KB 1NGZA 2BJML 4WO4D 3O3UN 2Q7NA 5I18L 3RI5K 2BMKB 4HIXH 4P3CL 3WFDL 2QSVA 4M1DL 4R4NC 4NC1C 2IFFL 3G5YA 2BMKA 3S8WA 3IDGB 4CJ0A 1ZVYA 5KSAB 4DUXA 3HZVB 1CS6A 1N2RB 4X9GA 5I17B 3WFCL 3O41B 5HYJD 4X6EA 4MNGB 1AO7D 1NJ9B 3VH8G 3QIUA 1UZ8B 5CEZD 1MJ8H 4V2CB 1KJ2L 3VFUB 1MRFL 3BIKB 1VFOA 4N90E 1WCQA 5SX5K 3QISA 5BVPH 3S88L 3LOWA 3STLB 5CEZH 4FQIH 3GZKA 5BMFL 2I9LB 3IVKA 5HGHB 5D7JA 2JF1A 5IB3B 3QPQD 3BQUB 4NPYA 2AK1L 3RFZC 4M6MH 4P4KD 4IRJD 5DMGD 3RNQB 4G6MH 3D18B 4W4OA 5FYJL 3QDHA 2YD7A 2OR9H 3T8XB 3GSUA 5LGJB 3VDAA 2ED9A 4LIQL 2YBRB 5EZOH 2W9DH 5EZLA 1AIFA 4RBPH 3U0TB 5CBEA 4PYHA 2YXFA 2A73A 5C7XL 3QPXL 3ULUD 2EH8H 4X7SH 1NUDA 3FQRB 3U7AA 1XCQB 2PW2B 1O7SA 1V8HA 3WJLC 1VFUA 1U3HC 3GMLA 3QEHB 5D72L 3CX5J 3UEZA 4UDUB 1SEQH 5JXAL 4ZUSB 3RIAF 3MJ9L 2CLZB 4U1NB 1EBPA 1JHTB 3KWWB 3GHBL 2NX5D 5CSZA 1OGAB 1T1WB 1I4FA 2FBJH 1EEQA 4LOUD 3ISWA 4QCIA 4FNLL 5K33A 5MEND 5FDWA 4I3RL 1A6ZB 1WT5A 3LB6C 1T1WA 3QIBD 3KYMB 3P0GB 5ESVB 4WENB 3MCLL 1ZHNA 3ARZA 5D2NC 4E41A 3WKMH 1RZKH 1Q9OB 5IB2A 5DJAB 2P8PB 1MJ7L 4IDLA 5F7YC 2O5XH 3S37H 4XNZB 2VLRA 4X0KB 3ARFA 5CJ5A 1TIUA 4P48A 3PL6D 5B8CB 1A7QH 4NQEB 1OB1B 4DZBB 3SDXA 3SE8H 5MHSE 4S2SB 5I73C 4WW2B 4LCIL 1KB5L 3U30C 3MUZ1 3AREB 5DTFA 1RZJH 4NQEA 3GJEB 4YHZH 4QXGH 3ZZ1A 4H5SB 3U7YL 1UT9A 4HUWA 5IROC 4MDJB 4UIMA 4XXCC 2V5YA 2DIBA 2VERN 2QQLL 3BQUD 3U1SH 2J8UE 4MCYA 3G5XB 4RAVA 1L0QA 4KMLB 1VEOA 1X5GA 4EDXA 1F11A 5AZEL 1H3WM 5C0BA 3F6IA 4JFEA 4HUKB 1S5IH 3VXQA 4J1UA 2NTFA 3GNML 4M3KB 3SKJL 3IT8D 5C0BB 3MXVH 4JFFE 4YDIL 4G42A 2FL5A 1FZJA 3E8UL 1KBGH 3U30B 1HOCB 2WWMC 3G04A 1AQDA 5HYFA 1EO5A 4G42B 5LCVL 5I1IL 3RBSA 3BYTA 2EC9T 1VKXB 1MQKL 1RZ8A 4OF8A 4MA3B 3DO7B 4ODTH 4K8RC 3WFCH 5TDNA 2P7TA 5D1ZB 1BWWA 5IW6A 4MJID 1CI5A 3DMMC 2CJUH 3VXSE 5JPNB 4WCYL 4FQJH 3ME0A 3QT2A 5FAAA 4PJXB 3RGVB 4AENA 3S96B 3LVEA 2QJDA 1OPGH 1T7XA 3ET9F 3T0AA 4G43B 4W6WB 1U3HD 4KRMB 4LCWA 1IM9B 1AO7A 1J18A 5GS3A 2QKIB 4K3JL 2GJJA 4G43A 4Q6YA 3CJJA 1GGTA 5IG7B 3EYQC 4G6ML 5FYJH 2QKIA 4UV4H 3CFEB 1I7RA 5C0FB 1IGTB 1XF1A 2GJ6D 2Z35A 1JPFA 2BDNH 2R29H 2HJFB 4OZFG 4R8WH 1C5BH 1QHPA 3N1QC 4IS6A 1KCRL 3C6LC 5D7JD 4FFWD 1T66D 3LD8C 4K9EC 5C0DA 4OFKA 4DGIL 1XF4B 3ARBB 4Q74A 2NY4C 2R29L 3QUYC 1BJ8A 1ZS8A 4GMSL 35C8H 3RWCB 4QWWC 1QSFA 3VGHA 1K85A 5LAXA 3VWJD 4KV5F 2CRMA 1N8ZA 5HYJA 4YFLI 4UINL 4O4YL 4IMLB 4MQ7A 4HMEA 3EYQD 2X09A 3NZ8B 3WFZA 4OFYD 3PGCB 5CP7A 1WIUA 5HHNB 1UJ3A 1ZLUH 4L29B 5GZOC 1NC4D 3OKMB 1I9IH 1YJDC 3DECA 3CLEL 4HGMA 5D6CB 4YPGB 3HB3C 4HLZH 5FKAB 4RFNC 4HXBL 3C8KA 3EOYG 3P4MA 2CKBB 3QNXA 4NKQB 4O4YH 4WHTA 1MY5A 1OP3K 4JY4A 1N2RA 3BZEA 3ARBC 1JTPA 4LEXH 1LP9A 4Y5YB 4P46C 2A6IB 4JY4B 2PO6C 1IM9D 3TJEL 5I6XC 4X80H 3L7EB 1CXLA 3BWAB 3DV4B 1IM3B 4R0LA 4UAOC 1YJDL 4O5LL 5IB4A 1BMGA 2AAVA 5LGKA 3ZHLA 3X13A 1NFIB 1MCCA 5A2JH 2GUOB 4WUUE 5C0IB 1F4WL 3SCMA 1Y6KR 3VI3E 3HPJB 4NQED 1FFNB 1RHHA 2AK4B 1K3IA 1Z0MA 3HI5H 1MCOH 2F5AL 1D5BA 2L7UA 3AB0C 3QUMA 4JR9H 1EVUA 4U4BA 4YBHA 5F71A 3S34H 3C09B 3ZTJG 3HC4H 3MR9A 4HV8A 3D0VB 5EOCL 4KK6C 4BQBA 1LEKB 2JELL 4XNUL 4I8DA 3A6CL 1M71B 3MGTA 1VGKB 3ILQC 1FSKC 4QNPF 3LN5B 2G60L 3ES6A 2YZ8A 4WTXA 5D7SL 1TFHA 4Z18A 2J6EA 3IXTB 4R4FH 4K3EL 3WNOA 7CGTA 4EN3D 5I1DB 1CDGA 4M7LL 5EUKA 3MCLH 1I7UB 2MHAA 4Y1AA 2BNUA 1CDHA 1I4FB 1YQVH 2QHRL 1NAKH 3VXRE 5JZ7D 5CP3A 1UM4H 1HHHA 1EXUB 4PLKD 2A6KA 4H1LG 3J7HA 1P6FA 3VFOB 3FB7A 4X5XA 3EDFA 4U49A 3HE6B 1OM3H 3S3SA 4HKBB 1FPTH 1MCPH 4OFIA 1JPGA 4X5XB 1GGBH 2DQJH 4KQ3L 5J7CC 4HHAA 4PJCE 5DJ2B 3QJFA 3SKOA 1Z9LA 2MCPL 1A7BA 4PJAB 4Y19D 4Q9RL 4NRZB 4S2SA 4MMZC 4YHPA 5BQ7B 2G5BB 4FQCL 2VDRH 4L8BA 1IEHA 4HG4J 2EE2A 4HK0A 4IM8A 4EN3B 5KJRH 1UWEH 3GSVB 4LSUL 4PJIE 1MFNA 2R69L 1RULH 2GK2A 3N0PB 1CL7I 1QSEB 2MQ3A 4KK9D 2O5YL 1A6TA 4JRXD 1MQKH 4CBPA 3BRDA 4JFZH 4MA8H 5H8DA 3RVXD 4QY8B 1JZ8A 1K9TA 4JFEB 1AXTH 5I66B 3FQXB 4GS7C 5C0BD 3S36H 1KJ2A 3NIGE 4OZIF 5I1LB 1MJ8L 1S8DA 1UB6B 4MAYC 3OAYK 3WUWA 4P4KC 5EB9A 4JRYA 3EO1B 3RWHA 5FHAH 4QYOA 3QPQC 1LO5A 1JRHH 1S8DB 5IQ9B 1ERNA 3DVGB 1BZ7B 3QULB 4JDVA 1KULA 1VENA 4WO4A 1SYSA 4PJHF 4QYOB 3OF6A 4H25B 4BFBD 1CE6B 4KTEL 4EN3C 5KS9B 3HB3D 3U9PL 3OWEA 4BH7A 2A9MH 5TE7L 4MGXA 3LQZB 2QR0A 3C5SA 5IMLA 4P23C 1X5IA 3TA3D 1A3RH 1A6UL 3U2SA 2NY1D 3SGEH 3O3BB 2Q3ZA 3G9VA 3LN4A 4KK6D 4P5KB 4ZUWA 3HAEA 4NO2A 2HMIC 4L9LA 3D9AL 4DZ8B 4ODTL 3IB4A 1YY8B 4MAYB 3WFEL 4GG6B 4ZUWB 5JHDA 2P5WA 4G8EA 5BRZE 3MBED 4L3EB 3VWJA 2EIZB 3VA2C 2XRAL 1DQJB 1UGNA 1HQ4B 4ODUB 1NCNA 2B1AL 4YHOH 4CNIB 2E6QA 1KYOK 1IVLA 3E1F1 2Y6SD 2HKFH 3GSWB 4U6HA 2WSKA 4RMSA 4PRDA 1CDUA 2V5MA 1NCUA 2XRAH 5D7LA 4JQIH 3T4AB 1L9MA 1VEPA 3BP7A 2IQ9L 5D96C 2D0GA 3ARBD 4PJDA 5T1LD 3RX8A 5FO9A 4LLWB 3TZVA 1DVFA 5KVDH 1FNEA 4I5BA 4DFHA 3TV3H 1LD9A 1CDYA 5I8CB 3MOBL 5DT1L 2UV3A 1ES0B 5JR1H 2V2TA 2W07A 3TBWA 4HMDA 5FO7B 4OGXH 4ZYKA 1N8ZB 2W91A 5KJRL 1EEZA 3CH1A 3MLTA 4GXVH 2IADA 4QOKD 4LCWD 5H37G 1U3HA 3P4OB 1GJIA 25C8L 4MQ7B 3DX9B 3RWFB 2W9DL 3S97C 2VDPL 3KR3H 2DQTL 2ADJA 2Y5EA 5E8PB 5BZWA 5KANI 1IGMH 5DFVD 4D0BB 5BZDA 3C87A 3HC0B 2OI9B 3S9DB 3DX9A 3RWFA 2DLGA 2JKXA 1I8LC 4X4ME 1HYSD 2W9EH 2X89D 1I85C 3HZMB 1MPAL 2FHBA 2YSSB 5E4EC 5CGMA 5K93A 4DQOL 4I2XE 4GRWH 2UZXB 3RWEA 2IJ0C 1S9WA 5GISL 3RKDD 3DUUA 4MJ5A 1T7YA 1N6QL 2CUHA 1UH4A 4LFHD 4NT6B 5FM5M 4G6AC 4DN3H 2HG5B 1KB9K 3DURA 3D39D 5CIPH 4DWHA 4H8WL 1KIUA 5F1NB 3UYPA 3WD5L 1A2YB 4D9QE 1UWEL 5MI0C 4YDJA 3LY6A 5IB4B 3SDXE 1BM3L 4UUJA 5K59F 2FEDC 4LLUA 5KN5B 4JQVA 3UTTD 1F5WA 5IIEA 1HYSC 1I1CA 3FQTA 3OX8B 4FP8H 1VEMA 4JVWA 1AGEB 3BQUC 1MLCA 4U1KA 5L9DL 3HZYB 4GQ9L 4LSPH 4FQJL 2NY3B 4X9FA 2Q20A 1OAXH 1TZGH 4TULL 2QBWA 4TNVF 4WUUA 4Y16D 4K8RH 3DTXB 2ICCA 1YEGL 5C08E 3NIDF 3ARFB 3UTQA 4DKDC 4YDVA 4LDOB 4YHKL 1UKTA 1LK3L 1CLYH 4HWBA 4HAFA 5KBNC 2BSTA 1AH1A 1LP9E 1RJCA 4XP1L 3DROA 3BHBA 2WANA 5T1KA 1B0GA 3VI4E 3A67L 5TQ2L 5IVZB 1N64H 1N7MH 5GGSY 3Q6FB 3QXUA 1IAOA 1MJJA 4R4FL 3GM8A 4OI9A 1BF8A 2AJUH 4NYLA 3NFNA 3TZVC 2RIKA 4I9WD 1MEXL 5ITFA 4GAFB 2AJ3A 4XCEB 5JO5A 2JCCF 3VD4A 1AY1L 2CIIA 2GIYA 3LDBB 4JFQA 4I48B 4F7MB 2FJGB 2R23A 3EYVB 3MRBB 4XMPH 3QUML 4WTZA 4QGYA 3FT4A 2VISA 3RWGA 1M05B 5HGDA 1WBYA 5F88B 3CFBB 5DJXB 2MPAL 3ARSA 4F7PB 3MOAL 4WI9A 2BHYA 1U58A 3QDGA 4QXUL 3WNNA 4NNPL 4XBGA 4WW2C 2XXCB 2V2WA 2NY7L 1GGCH 4P23D 1AQDB 4LVHC 2KQMA 3LIZH 2YHGA 3C60C 1D5XA 4L5FH 2IFFH 5F9OH 2RB8A 3MRFB 2QV2A 3CFJA 4GRMA 4PRNA 2VZ3A 1X44A 4LDEB 1G7LB 1XH3A 5CZKA 4X6DA 4ZD3H 1YJDH 1IAIM 3FONA 3LS4H 1H15B 3JWDC 3MOQA 4MB5A 2GFBA 5IKCB 1JUFB 1G7LA 5HI3D 5IBTL 4OCRL 3EIFA 3IJYA 2OM5A 3KYNA 1P1ZA 2P5EE 3F65A 1DE4A 3TJEH 3PWNB 4ETQB 5F9OL 2HKFL 1D7FA 3QUXD 4XH2A 3DRQB 2AK4E 1XGTA 8FABB 2N1KA 3C60B 1OTTC 5DGRA 1FFOB 5CEXA 1I7RB 5T3ZD 3UXFA 1YC8A 4XXDA 3EDKA 2G60H 1V3LA 1P7KB 1K4CB 1P7QB 1JI2A 5GGRA 3T0WA 3BZFB 1HXYA 4N0FA 3O4LD 2QSTA 4TTGA 5F6IC 5FYKH 4MQTB 4PFEA 5I9QB 4N0UA 3QZWG 3VXSD 4UTAH 3BDYH 4GG6A 4AQOA 4IRJC 2OJEA 4HS3A 4NQCE 5JQ6L 1OAQH 5J1AB 1TZHA 5IK3B 3BP6A 4DAGL 2PYFB 2FHFA 4GRLC 2X40A 3L6FA 5GISH 3GRWL 5FO8A 4LCUB 5E6ID 4S1SL 5A40E 2MNUA 5FYLD 1B0WA 3TH3T 4AG4H 5F9JB 4OIAA 4NOBA 1E4XH 4Z8FH 3MJ9A 1YNKH 4PJGE 3QP3A 4LPXA 2A74A 1P7HL 3MO1B 3HAEH 1SQ2N 2CD0A 2R0KH 4YHKH 5JW4Q 1W72B 3BEVB 2GAZA 4LLQA 3FB8B 1JWUA 1K5NB 2NY1C 5EA0H 3ARPA 1NCCL 2R69H 3CH1B 3MLTB 3BEVA 4LLQB 4PRID 2HLAB 5EO1A 1Q9LA 2DI8A 5DI8A 1RIVL 1PZ5A 1J05B 2AJZB 1KT2B 5EULV 1R6VA 2WBWB 1CZ8H 1R3KB 4X7EC 4PJ5D 2OLDA 3KPMA 1DQML 1KT2A 4NNYA 3D18A 3V0WL 1SJEB 4L1DA 1F3DJ 3VXTB 4E42B 1EBAA 2YBRA 4M7LH 1FORH 1CFSA 5J6HB 2IPKA 3DUUB 5T3XH 1IE5A 2EDTA 4BFIB 5C8JB 4JLRB 4JKKA 4X6CB 5JLZB 1ZA3B 1YPZB 3IDIA 4O51B 2APWA 3GHEH 4CMHC 4KRPB 3LQAL 2WIMA 4XC3H 4Y0GA 3SJVA 3LSOB 5E5RB 2E7LC 1Y0LA 4XCYA 4MXQC 1F8TL 4ENED 4KJPC 3U7WH 5HHPA 4UQ3A 4GO6B 1S7QB 4HFWB 4G8GD 5F8QC 4RGMC 3QIWA 5C07B 5TE7H 5I71C 1LK2A 2JLLA 2R0WH 1DANU 2I07A 1FJ1A 2ICWB 2HVJB 5JIHA 5CZVL 4PTUB 4DTGL 1MJ7H 5FIEA 1Q9OA 2F5BH 3ZT6A 2BERA 3MROB 3CVIH 1ZXQA 1G7IB 1PQZA 1F8TH 4YHNA 2I26N 1FFQA 3ARXA 4TTDD 3RA7L 1NBQA 4I4WA 2ZUTA 4LCIH 3EZ8A 2BP3A 3C6LA 3MROA 4FXKB 1FSKB 1WZLA 4YDLC 3X12A 3MLZL 3IFLH 2AJUL 3WJLA 3SQOL 3TJHD 3MV8E 1RY7B 4H5SA 5H2BB 2FZ3B 1FDLH 5MERA 3QIUD 1OVZA 3V0VA 3P11H 1LK3H 2VLKB 5ICZB 2B39A 3CNKA 3RZCA 1C16A 3L1OL 1BZQK 5HHOE 3TBYB 5DJ0B 1MCIA 3HKFA 5KAQG 2ED7A 2HTLD 2CIIB 4PJ7E 4G8IB 5EOQL 3C2SA 4KZEH 3HE6C 4M1CD 5EIIA 1TXKA 2I60L 3OTTA 1CICB 1ZHKB 4F57H 3X3GL 2QLVB 4PJ7B 3JV0A 4OF7A 1N0XL 5INDA 2CO7B 1JPSH 3REVB 1RZJC 1FE8L 4OZFB 4KH2A 5KW9H 4JG1L 1JZ5A 1MVUB 4ONOA 2IQ9H 4JPIA 3VGAB 1QLEL 4U1GB 3DO7A 3MCKA 4ZFGH 4NP4H 3CFJB 3GI9H 1M7DB 4ZSOA 4ZUVA 1XCTA 2SEBB 5JMRA 2P46B 4ZOEA 1G6RH 3S88H 1AGDA 3NACH 1EGJL 4CVUA 2B1AH 3PWLA 3QDJA 4LKXA 4YHOL 4DW2H 2FGWH 4HT1L 4K3EH 1NJ9A 1NBVL 1QKZH 5I19L 5GRUL 1SJHB 2V9QA 4PGJA 5IV2B 3UTSB 4ZFOB 5JZ7C 3TIDB 3VGDA 5JPMA 2NW2B 2NQCA 3VMPA 3V6ZB 4WJ5A 3HS0B 4JFOB 4L4VA 3GKZA 2FH8A 1A9BA 1P5VA 4Z0BH 3VXMD 3VRIA 3HI5L 4J4PD 1NLDL 4CN6A 1I9JH 1KCSH 4CADA 1FVCA 3VRIB 1YMHA 4OGAC 4XTRC 5FECA 4KU1A 3U0TA 2M1KA 2VDRL 3O2DH 1A4JA 3BGMA 4XHJC 3BP7B 3WIHH 3KYAA 1XCQA 1M6OB 3I2CH