1QNZH

Nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYSDDTNYNEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHYGSAYAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 0.5B ANTIBODY (HEAVY CHAIN)
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qnzH00
1CT8A 3HE7B 3L3HB 1QSFA 5EOCL 3MRPA 1W72H 5HHOA 4GKZA 4ODSH 5EU7E 1F3RB 4U1LA 3Q0HA 4H26A 2JJTA 5GJSL 1UJ3B 1ZT7B 2EDQA 5KTEH 5IBUG 1NCCL 5ILTL 3KPPB 3RTQB 2JJSC 4C56A 4FMKA 4FG6C 3VXQA 5IVXA 1WZKA 3D48R 5CGTA 4N8CL 3WJJC 1FGVL 3LS5H 4IEFB 5CJ5A 1M05A 1HH6B 3V4UL 3IJHB 3T3ME 3TCXA 5CAYB 2BOCB 1N8ZB 3F5WA 3JTSB 4OF6A 2WWKT 3CH1B 4POZD 4HUMB 2G75B 1FVCA 4GBXC 3KPSB 5F1OB 5I1KL 4XPFL 3FCTA 5ALCL 3WHXB 3GMOA 3O6ML 1T22B 3WFBH 3KLHD 2QLVB 5C2UB 1HCFX 2CDEB 5C0DA 5JMOC 1I9RH 1NLBL 3I6KB 4NJ9L 3VGFA 4YXKH 4LVNC 1MHPL 2FNBA 2R9HD 2OSLA 3G04B 1DBKL 1T5XA 5T3XE 4H5SB 3WIHA 3MMEA 5EU5A 3IJSB 1IKFL 3V4VH 5EZOL 3CFKA 1AR1D 2IWGA 1WFUA 5DK2A 5ELIA 1VKXB 2KZ1B 3ZDYE 3ULUE 2AJVL 2CRZA 1MWAB 2FX8L 2VRAA 4JHBA 4HT1H 4S1SH 5DD6B 5DD5H 3ZE1F 1MLCA 2WUBH 3O2DA 4LKCB 3NPSC 4WWKD 4KAQH 1LO3L 3TPUB 4BSVA 2ZG1A 4O00A 3EO9L 4JFXA 1J1XH 5GJTH 4YBLB 4QY8B 3L5WA 1YEHH 3GRWH 3STBA 1CDUA 2CMRH 4U1JB 1LO5B 2AJVH 3NCYS 5CP3H 1XGPB 4WV1A 4WHDA 5F44A 4LVEA 5C9JB 5FYKH 4NBYB 5INCB 2NY5L 5C0RL 3MLUH 1YDPB 4ZS7L 3SKNA 3CXHJ 1U91B 3B2VL 1JUFA 1DBAH 4XMLL 5DUBA 4ISVB 2ICES 5L2KD 2R0KL 3M17A 4TUOA 1CFVL 3P0YH 4KK9C 4P9HC 1I8LC 1GSMA 5K9QI 4NHUB 2NXYD 1G7HB 2BC4A 5T3XH 5I76B 1IGIL 4M7ZC 3CMGA 4F7MA 4K7FA 1UT9A 4GG6F 2JELH 2ZNXA 5IMKA 1JYVA 4D8PB 3FO1B 1BREA 2YBRA 1DJSA 3MRIB 2Y5TA 1VGEL 4HIXL 2XKNB 1N8ZA 5E00B 5ICYB 4HLZH 1BJ1H 4KUCD 1BMGA 5DO2D 3ROLB 1NL0L 1BZ9A 3ARRA 4Y5YA 3SGJA 4BA8A 2H9GB 2GKIA 3EYQD 4KI5E 4CUCA 4Y16A 3D25B 3P30H 2VXTH 5DJAB 2R2EA 2VDRH 3MA7B 4U1HB 3HNVL 4RZCB 1GOFA 2IH3A 1MFAH 4YXLH 1BAFL 3P9MA 4R4NC 3F65A 3TF7C 4PJ9B 1ROWA 4LASL 5I1AB 4OD2B 3N85H 3BDBA 5I74C 5I1LB 1FDLH 3RDTB 1T89C 2YPKB 4FMFA 3CZJA 4KH2A 4GAGH 3S35L 3TM6A 1KB5A 5E7BA 4U7SA 2VITB 1ITCA 3VGDA 3RZCA 3SDAC 1NH6A 3FT4B 5ALBL 5BMFH 4LQFL 1IQWL 1CD8A 4PGCA 4XP5H 4ZDHA 3GSXB 2ICEA 4PRNB 3ARGA 3DRTB 5D8JH 1OGAA 4U7KA 3L9RA 1N7ML 2LQRA 3MLYL 4GG6E 2VAJA 3MROA 1PAMA 4F80A 4OCXL 4XPAH 5CILL 1L0XA 3ZYZA 4Y89A 3IDMB 1WQVT 4ZUUA 3IDYB 1WEJH 1WVZA 3TPKA 1P5UA 4P2OC 3MLTB 3OB0K 1GAFH 4R97B 1KJ2L 2PTUA 3GM8A 3D0LA 1PEWA 1NKRA 1KTDA 4MB3A 3EGSA 3GKZA 1Q0YL 1G1YA 1T7WA 1U91A 3JXAA 4RA3A 4OD3H 4PR5A 4PJFF 4Z76A 3U0TA 5KVDL 3VFTA 3V4PH 3RPIB 4KRPD 1K5NB 4DVRL 1BZ7A 3MODH 4U6XB 4WI9A 3O8XD 1JYXA 1PQZA 4L1DA 1OOAA 1ADQA 3OJVC 2XKNA 4KROC 1I1FB 1TVBB 1SMOA 2WWMC 1BQHG 3UTQB 2DI7A 2GYSA 3VXSE 1NUFA 2C3VA 5CEZL 3AROA 2CLVB 4ZXBA 5HD8C 3D9AH 3MSPA 5JUEH 2IADB 3GHBH 3PGCB 5I8CB 4I77H 2O5ZH 4EVNB 4RMQA 1MCRA 5T3ZE 2VZ3A 1JZ5A 2DLEA 4S0SD 1NCUA 4LP5A 1AJ7L 1NPUA 2BNUA 4NHCL 3MV8D 1K6QL 4K3JL 3SKOB 8CGTA 5IBLC 3DETD 2EXWD 1LO2H 1YEFL 3NA9H 4QRUA 5EA0H 3X14A 1L4IA 3SQOL 5GRUH 5CCKH 1ZOXA 3RBGA 3INUL 1JF6A 1OSZA 2GTWA 1MVUB 5D96C 4N9GA 4PS4L 1NBZA 4Q58C 1J10A 2NY7H 4MS8C 2V6HA 3IFLH 4P57B 1DQLH 4RGNB 3EFFA 4X6BA 3RX5A 3I75A 1TJIL 3QIWB 3MGAA 4V1DB 4HXAH 2BFVH 5DMJB 1F3JA 1SJVA 1MFDL 5DUPL 3P9MB 1FFOB 4K7FB 4YE4H 4Z6AT 1YN7A 3QUKB 1DL7H 1F42A 5I8KL 3S8WA 5C0GA 1FNEB 2NY6C 1L0YA 3QIBA 5EUOA 1GOHA 3VFNB 4IHOA 1XGYL 5C0BD 3GBNL 4YHYC 1MJUH 4U1IA 5D72L 3BKJH 3LKPA 2ESVB 4XRCA 2MOVA 4JO1L 3W0WB 3C2SA 1AO7D 3HI5L 1T1WB 3HC3L 3WJLA 4PYHA 3FN3A 4Z8FH 4ZQKA 1DLHA 2WINA 1T04B 3KNBB 3LKRA 4UTAH 3WCYA 3H9YA 4LSUH 1JI1A 4LCWD 1CU4L 3ZL4H 5E2TL 2V9RA 3LHPL 2LV4A 3PWJA 5FK9B 2W07A 4BQ9A 4JREB 4NCC2 3RNQA 3MYZA 4MAUH 1CG9B 3M8OL 4K7PH 5F9WB 3ARDB 1U6AH 4P3WA 3BKYH 2ZKHL 1P84J 5SWZA 4P48A 5CZKA 3HC3H 5LCVH 2ZNWA 2RFXB 2NX5A 1RZ7L 3S34L 1Z6JT 3ALPA 4M6MH 4WW2F 1UM6L 5J6GA 1FLTX 4FFVC 3VFUB 2NMSA 1IKNC 1CYGA 4P2QB 5EIQA 1V3MA 4P4KD 5I74B 4ZUSB 3S37L 2NX5D 1M7XA 1EEYB 1QLFA 1II4E 1UCTA 1BIHA 4Y1AA 3VXUB 5LJYH 3C6SA 3DPBA 2NY1C 3QNYA 5HDBE 1G9MC 3V9FA 2LU4A 5JIIA 3UAJD 5IR1B 3BW9A 1MIMH 3FB6B 3ARUA 4JDZB 3OKKB 3MXWL 4NRZA 3QHFH 1EIBA 1HINH 2AXGA 4M43H 3KPLB 5D9SB 2R23A 5F7DB 3CAFA 4HIHB 4QRRE 1DQLL 1BBDL 3KJ6L 4ZO7A 4U1KA 2Z31B 4K3EH 4HZAA 2P8MA 2W9EL 4DZ8A 3X12A 4HKJB 5DQDL 5BXFB 4QEGA 2XZCH 4ERSH 3MCLH 4HS3A 4NKIL 4J3TA 1LP9E 3BO8A 4ZD3H 2IGFL 2RIKA 4OLZL 5IJKC 1YEEL 3S36L 1EFXB 5JNYA 1RQ5A 3DIFB 4KI5C 5BJTA 1E4KA 1RUAL 2WUCL 5BZWA 4A6YA 4PJ5B 1OL0A 5GSVB 2JLLA 4ODUB 1AXSB 2J88L 1BWWA 4PRHD 4WI7A 4X4XB 4QRPE 3RI5K 4XWGH 5ABDE 4JFDE 4U3CA 2RHEA 1OTTC 2PYEE 4PRBB 5FUOH 1FRGL 1QPPA 4PG9B 4ZSOA 1HKLL 1BVLA 4LARL 2GQHA 3DUSB 1GXEA 5CIPH 3ESVF 3O6KL 1YY8A 2XWJA 4NQCE 3MV01 3QI9D 4JRYA 3LZFH 4Z7VE 3TVMA 1HQ4B 1YY9C 5C0EA 1ZTXL 4I5BA 1DBJL 3MCG1 2NX5B 2VR5A 1A02N 4Q9QH 3IYLW 4P99A 1EDQA 3T77B 4H8WL 2JCCE 3VMPA 1RZKH 1EVUA 3I02A 3I50L 1MCOL 3AUVA 1AE6L 2EYRB 5DI8A 2PN5A 3HMXH 4ZFGL 5F7LB 1SEBA 3SY0A 1S9YB 3KPQB 4NZUL 5IKCA 4LCYB 3SCMB 1MCWW 1KCLA 4OCLC 1BF2A 4LCIH 3WS3B 4XP1L 3JWDL 4HD9A 3ME0A 1NCBH 3EJYC 3A6CL 3S6CA 5KOVC 5DD6A 4YZFE 1CFBA 2DQTH 1CN4A 3KDMB 1LMKA 1RUPL 5HHOB 1FNLA 2J6EA 2WLYA 3CLEL 5D6CB 4XVJH 1R3LA 3QCUL 1LHZA 2VUYA 3H9HA 5F7KC 2P5EB 1YEJL 4HV8A 2VSCA 3H42H 5H35A 4PJ8B 3NCEB 4LP4A 5D7KE 2LU3A 1J1OH 2Q20A 4MHHG 1JGVH 4D9QD 1G7PB 5TE6L 1MAJA 3ULVC 4P4KC 4DOHE 5FYKD 3O0RL 3BWAB 4Q0XL 1FORH 3GMRB 1T0MA 3CSBA 5HYEA 2Y07H 3IGAA 1KLGA 3T0ED 3MLXH 2F5AL 3G6JF 1ND0B 4LCCB 1EO8L 5IVOA 2DM4A 2HKHH 4DZ8B 1WIOA 4GH7B 1U3HA 1K4DA 4ELKB 4G8EA 4KXZI 1D6VL 1VFAA 1F3DH 2QSCL 2MSPA 4K3GA 4B53A 4XNMA 3GSRB 4U2ZA 1ZT4A 1HH9A 3GI9H 3RU8L 5BVPL 43CAA 1PGRB 2PYED 5I1GL 5IF0B 1T6VN 3DMMB 3U9PH 2BY3A 2UY7A 1DFBL 1ES0B 4K71C 5AZEH 1BLNA 2X4UB 2CDGB 4UTBH 5D7LB 3AREC 4E42B 5JHDD 3HI6L 1A4JA 1WIUA 2HFEA 3CLFL 1J0IA 5T1MB 3KYAA 4PJCA 3W82A 3G5XB 1A47A 2DQFA 3O45A 4DTGH 5I1JL 4M4RA 1B2WL 1IFHL 1YQ2A 1ONQA 4PYGA 5JOFA 2X5PA 2CIIB 4U0RC 4WCYL 5J13B 4WU7B 4J4PA 4U1GC 1NBQA 2ADGA 5LGJB 3PWPB 4G5ZL 3RVUD 4DTGL 5I1JH 3IKKA 3QH3A 4UILL 1WZLA 3BH9B 3QG7H 3OV6A 1AFVL 4TSCL 1BQSA 2OR9H 2VLRA 5IB4B 3S4SA 5GGRB 3R8BB 1Z2KA 4OCSL 2V7HA 2I24N 3A0OA 2Z35A 1J11A 3UTOA 4PLKC 3V6FA 1J1OL 5FDYA 2ZCKH 4XXDB 3B9EA 2EDLA 3PV6B 4XWOD 5L6YH 1HILA 3G6AB 4GRLD 4PJAA 3CSGA 3BKCH 4KK8C 1B0RB 5BO1H 4Q2ZB 4LSSL 3N1MC 1QBML 1EGJA 2Z31A 35C8H 1DTUA 3RJQB 2ZUSA 4BK5A 1KCRH 3MJ8B 3LS4H 4WUUD 3PWNA 3IDYC 2HJFA 4NPYA 2EDFA 4HK3J 4PJEA 5CSBA 1S7WA 1YMMA 2ERJC 4WFED 2F5AH 4ZFOA 4MQSB 1GGYA 1NMAH 3CZFA 4Y16B 2XQYG 3UYRL 2R8SH 4U6TA 5E4EB 4MDIA 1UWGH 3F7QA 1UCBH 3MRJB 5FCUL 2YD1A 1GGCL 1BPVA 4ODVL 4G6FD 3O8XB 3SQBA 2FYYA 3ULUL 2A73B 4HX1A 1JZ4A 5DJYB 3RY4A 4UINH 1FL5B 1I1AD 3BGAA 3FT3A 5J6HB 2XTJE 4JN1L 1H3GA 3OTTA 5KVEH 4UU9B 2FX7L 1BQLH 4GRWF 4O51B 4WWID 1A4JB 2O5YL 4AY0A 2JJWA 3QZWG 1P4BL 4KJWD 1HI6B 1AGCB 1T5WA 3LQZB 1WBZA 4MMXC 2XKUA 3HC0A 1A7OL 1NBZB 3P77A 3U1SL 5ENWA 2DQDH 4HKXB 2C3GA 2HG5A 5L0QC 1PG7H 1XGQA 4KHXL 4QOKE 1I7ZA 4XP4L 2LTQC 1OGAE 1ZT7A 1QKZL 3MJ7A 4OF3A 3BP5A 3QCTL 4QRPD 4X80H 2OMBA 3F58L 3LIZH 1V05A 1NBYA 4OLWH 4FABH 3EOAB 4G5ZH 5IJVB 3VD4A 5T1LA 2IPUK 2NCMA 4PJIA 4JZJC 1TVHB 2UWEF 4FQ2L 5HGBA 3RY5A 1IAMA 3FAXA 5J57B 1MELA 1S7VA 2A74B 1P53A 1NEZA 1AIFA 1WBXB 3RKDC 4ETYA 2EDEA 4EIGB 5C08D 1NMCC 2ESVA 4M5ZL 2FHCA 4PJ5D 1TFHA 3T4YA 4E5XB 3NGBC 4UDUB 4R90H 3QUYA 3ARED 2CDEA 3BSZH 1MHHA 1QLRA 2ICWA 3FMGH 5CD3A 1OSPL 3E2HB 2IFFL 2I9TB 2YD6A 4NZJA 4OZFH 3AAZB 3KLAA 3DJ9A 3DX7B 2B7DT 5HVHC 3M1BA 3SN6N 4KY1L 1A6VH 3A6BL 3QG6B 2CK2A 3F12A 4NQVA 3VXSA 5ACZB 1D6VH 1JE6A 3WNMA 2BVQA 4ZPTB 5ITFB 1QRNB 1J12A 5F96H 1LEGA 5A3ID 4OCWH 5HHVH 5IMOA 4XVSH 4HJJH 2IQAB 4KK6C 3MLPA 4PJBB 4NQCB 3MPCA 5I8EA 3EOBB 4R3SA 1ZLSL 5JIKA 2PYEA 3F7VA 4JY5H 5ESQB 1SMAA 1H5BB 4GAJL 5I18H 3D69A 5T33L 5D5ME 1UEYA 5K9OA 5KVFL 1JRHL 2Y36L 1LDPL 4GJTB 3IDJB 4E41B 5DQDH 1OP9A 3L5WB 3DOSA 4D0DA 4GW1A 3HPLB 4UU9A 2KL6A 4RAUB 1AO7E 2V5YA 4NJAH 5F7YC 3TV3H 1JWMA 3PL6B 4RMSA 3LSOA 3OPZL 3S98A 1LP9A 3FHAA 4JPVH 5DS8A 1TTUA 3QHFL 3MXWH 5DWUH 1HHIA 1WCBA 3CDCA 1YNKH 4NBZB 4XBGA 4JPIB 1O5DT 2VR4A 2FL5A 1D5MB 3CCHB 2WIIB 4FQCH 4S0TD 1IVLA 4MAYA 1JGEB 3EAKA 4Y0GA 3WFZA 1FL6A 4QRPA 1NGPH 2DQJL 2AJZB 1DBBL 3QDME 2P46B 4K3HA 4XPTH 1Q0XH 3UTSB 1JPTH 4Y5XB 5DHYA 3SDCD 1AI1L 1NCBL 2XZQL 4LLAA 3T4AA 1VDGA 3QA3B 4M5ZH 1LDSA 4EN3C 3QDJA 3DHMA 4M6OH 3OL2A 3MGTA 4Y1AE 4U1SA 3EYOA 1I1AC 1RMFL 1F4WH 2MCPL 5DK3A 4X6CE 4DN3L 1DUYA 1RJZB 3W2DH 2QQNL 3HI1A 3LKQB 3JUYA 4DGYL 5J56B 2E6JA 3LEVH 3VW3H 1QSFE 3BZFA 3V2AR 3L6FA 4PGBB 4ZAKD 2QKIB 2B1AL 2Z92B 4OLWL 3VWKD 3LV3B 4PJBF 1MJ7H 2HP4A 4KMLB 2R15A 3FB8A 3PHOA 4XPTL 4D9QE 1D5ZA 1DUZA 4ODTL 2AJUH 1S9VB 3GEWB 1LE5B 3AY4A 4S2SA 2BOBB 5TE7H 1U42A 1AGEB 1F45A 1MCPH 4B41A 5F7FA 4NPYB 1T7VA 4OM0L 1UB5A 4G6ML 1A4KA 3SJVA 3VD7A 3QDGA 2Y23A 1KXTB 4YNYA 4HUVB 4BM7A 3RTQD 5CMAA 3NTCL 5J3HC 5F1SA 2BJML 1U8IB 3D39E 4MZ2A 1BOGB 1YC7A 2R4RH 5K9JH 2ZOLA 1IGYB 4PJGA 4EDXB 1W8OA 3JWOL 2WBJC 4KGJA 5KZCB 4TOYL 5D5MB 1VPOL 4TUOB 4WJ5B 3HG1B 3HC4L 5JUEL 3RGHA 1DN0B 4AIOA 1P7QD 4PIRF 2NNAA 4JDZA 4QOKD 3GMMA 3D18A 3R06A 5E08L 5EU6B 2OJZH 3F7VB 4U1JA 3M07A 4K9EL 1L6XA 2BVUA 3C6LC 4XNYL 4HPOL 3E1F1 3QIBC 4B7LA 1U58B 4P4RB 5DK0B 3HC0B 3JSSA 1BM3H 1KIQA 4M6NL 1JPSL 1D6EA 1W0WB 2EIZA 4IRJB 1ORQA 5EO1A 4Y5YC 1AP2A 2GIYA 5EUKA 1KG0B 2MQCA 2KKQA 1X3DA 4KVNH 3AGVA 1DQJA 1CGVA 2IH3B 3K4AA 4NHCH 4MD4B 1C8PA 5TF1H 3BP4B 1MHCB 3MRNB 4A2MA 4Y19E 3TN0B 4BUGA 4C56D 5B8CA 1OAQL 3N50A 2XZQH 1R3IH 1KOAA 2X9XA 4MGXA 1ETZB 1SJHA 3KR3H 1A1NB 1DVFB 4K23L 5GS0H 4D2NA 1PG7L 1HN1A 3EBAA 1BGXL 1HWHB 1Q9KB 1U36A 1WZ1L 4LCCA 4NZDA 1KIUA 5D2NB 5DD0L 3EO0A 4CU8A 1DSFH 4NKOA 3N1QC 5EZLB 1CFQA 1CLYL 1QKZH 1RJZA 2XTLA 2FJGA 5DJXA 4EUPG 2D7TH 4P23B 1PLGL 3VXQB 2E7HA 5EO0B 5LWYL 1GAFL 4OGAC 1M05B 1CS6A 1KJMB 1ITBB 2X41A 1RSFA 4QF1B 4W4OC 5BVPH 4JR9H 1EUTA 2UYLB 3QA3A 4U2YA 5ANMB 2APVA 4JN2A 2XZAL 1UWXK 3MRCA 1FZOB 3IETB 4JY5L 1KPUB 4YHLH 2VTFA 4RDQF 4EUPH 4OM1H 2BY1A 2R1XB 2Y6SD 1RJLA 3P4MB 4R26L 2CIIA 4HIXH 4ZUUB 2V5MA 4Q0XH 2AJ3B 2R0LH 2FJHA 5E70A 3CVHL 2HAZA 1I9JH 1MRDL 4WY7L 3SGKC 2P7TB 3U0PB 3A6BH 4JZNA 3QNZB 4GKOA 5J12B 1Y6MR 1JZ6A 4G3YH 1U3ZA 3TT1L 5IP4A 2FWOB 1G6RH 3ZDZF 3X3FL 4AK1A 2OXHA 4HEME 4BSWB 8FABB 2P1YA 1CFVH 3S35H 4H5SA 3SJVD 4Z0BH 4RX4A 1DBAL 2YPLD 4MYWB 1ZGLA 1XF4B 3LPGA 1CL7H 2YPLB 5D70H 1BAFH 1MCHA 4TQEH 4G8FA 1FN4B 3CD4A 2RB8A 3FQUB 4NN7B 3EDEA 3QQ3A 4M61B 2ICWI 3W5MA 3UTZB 4PJHF 3IJYA 3C5JA 1WZ1H 4MNHA 4ZAKA 1QYGL 5HI5C 1NL0H 2X4OB 3JTSA 5D7IE 2DM2A 3MRHA 5F1IB 5GS0L 4F33A 5E9DE 1LO3H 4I3SH 2G75A 1AFVH 4P57A 3QEQE 1DE4A 3VGAC 5BVJB 1DVFA 1XR8B 4HWUA 3VG9B 3MFFB 2JJTC 1G6RA 1OD9A 4XXCC 4NM4H 3MTRA 4MJ2A 2FIRT 1E4WL 4KTYA 4YDKH 4U05A 4YDIH 1CDGA 2P8LB 4X5LA 1J8HA 3QUMB 4HPYL 5E8EB 1RZJL 3X14B 1Q9LA 2LVEA 5AWNL 1PY4A 2D9CA 3FZUD 1KCSL 3FB8B 2WWKO 2EDYA 1T7ZA 3VDCA 3V4PL 4F7MB 2FD6L 1TMCB 3MREA 4XBEH 5F7WC 4EI5C 3WMSA 1N59B 3TBYB 5A16A 3MGOA 4Z7WA 3P11H 4X7SL 3GSOA 2VERN 3X12B 3SDCB 1EO8H 3RGVC 4EJ1C 3W11D 1D5BB 3OAYK 4LSVH 3KPTA 1T21B 3SE8H 5BRZB 1JGLH 5TQ0H 3VGHA 4OCXH 4MJ5A 1A5FH 4KHTL 4I8DA 5LBSL 1FO0H 5CP7B 3QI9A 2E6QA 4MQTB 1WC7A 1T03H 4OM1L 4FQJH 1Q8MA 5DEZA 3ZZ1A 3GBMH 5JXAH 1S7VB 2A74A 2DM3A 35C8L 1OY3B 5CLTA 5E95B 3O4LD 1QLEH 4PP2B 4ERSL 3T65A 5ID0A 2NY4D 1U8LA 1MCPL 4PTTA 3VXUE 3BIAX 4ENEC 4DEPC 5J6GB 3WFBL 1KCUL 3G04A 3CLEH 4CADB 2FECI 5FYJL 2EE6A 5MEQA 3N85L 3MV9E 1I8IB 2Z31C 3V0WL 1W72A 3QQ4A 1XGPA 1UQSB 3JWOC 2NQCA 3BEWB 2EDXA 4BZ1H 3QXUA 5TGBB 1WJ3A 1ZVSB 2EE9A 3V0VA 3SE3C 3UBXA 1RY7B 4DQOL 2F53B 4AENB 3BRFA 1BGXH 4NZUH 3B8SA 4OJFL 1AE6H 3RWDA 4G8GA 4K8RH 1G6VK 4QT5A 5J6HA 3HG1D 3B4NA 3TN0C 5BOZG 3JV5A 3CFCL 1NCCH 3RDTA 2QR0B 1LK3L 1I3UA 1FH5H 4JLRA 1RZ7H 5I1CH 3HAEH 3HI6H 2YRLA 3PGFH 3K1KC 2C4FT 3S97C 3VXPB 1G9NL 3T1WA 1MCIA 3V5HB 2VQ1A 4LHUD 3HPLA 1EAPA 4P9ML 4ZTPL 3VXMB 5EPMA 1T4KA 5L9DH 2LABA 1ZGLB 5I2IA 4FQLH 5I17B 4H1LH 3NPZB 4K7PL 4JFDD 1QR1B 2FATL 3C6LB 3F8UB 2NY0D 5C07B 3T0EB 5HHOE 5HGBB 4UUJA 4MAYB 4R7NB 2A1WL 5D7IF 4G43B 2CSPA 4MNHB 2V2TA 3ROOA 1UXSB 5K59F 3EYQC 1LEIA 4Y8AA 3G5ZB 4OUUA 4F7PB 3VFPA 1T3FA 1HHKA 4ELMA 3KPMA 1I3RA 2BP3A 1QQDA 1INEL 1U93A 1AGBA 5BOPA 2DLIA 4UOJA 3QUYD 3ARGB 3OKYA 4FQPA 4HUWB 4RZCA 3RTQC 1R0AL 4X98B 5I18L 1K85A 4X9GA 4CW1B 3W9DA 1JYWA 3FQTA 5M95B 5TDNA 2F5BL 5JORA 4GSDL 5SWSE 1U9KA 1EXUA 5ITBL 3SDCC 3GSNL 4G8IB 1YEJH 3PJSB 2NTFB 1K3ZA 4MLIA 5ICXA 2WIMA 5AG8A 3V95A 2ZUQC 1YYLL 4B5EA 3QEQD 1E6OL 1KUMA 4DZBB 3IRZA 1ZA6B 4HUUA 4LSTH 1CFTA 3QXDA 2P47B 4GW5A 4HH8A 1NSNH 2I26N 1RIHL 3ZLQC 1ZEAH 3QNXA 3BJ91 5GRUL 2AJXL 3EYVB 1D9KA 3QWRD 4LPCA 4N1CA 2EH7H 4XP6L 4JREC 1UQSA 2HT3C 5LCVL 3BGMB 3UCRA 5FYJU 5IVNA 2EKSB 4MCYB 2HKFH 3B6SB 2R1WA 3HS0B 2V2XA 4IOFD 1G9EA 4LAQH 2BVPA 4QHNA 4XCCH 3TZVD 3GGWB 3PG2A 3A67L 4YXHH 4S10A 5IB1B 3RWJA 1QFWL 1YNTA 3LIZL 4EUPB 4QT5B 1W72L 4MD0A 2WNGA 2K3TA 2AAVA 3GMLB 4HFUH 4C59B 5MP6H 3OHXB 2CUIA 4FP8H 3RQ3A 4QYOB 3MBXH 1U6AL 4G7VL 4YHYB 3S35X 2HA1A 4GRWB 4GRMB 3DV4A 1KPVB 1IAIM 3P4OA 4F58L 3N1PC 5HPOA 3RUGB 4P46A 3KS0H 3PL6C 1VESA 3U9UA 5IMLB 3OKDA 5J12C 4WEBL 2WANA 4KDTA 1U8QB 2Z8WC 1W2KT 1NEUA 1I3RB 1ZLVH 1MCJA 3PXHA 1DBMH 4OZIA 3NH7L 5D71H 4M3JA 3WXWH 1Z5LA 1ZGLM 1PW3A 5HYSG 3UC0L 1I9EA 4RFOH 5F7EH 1OCWL 1K4CB 1UKQA 4NQDE 3MCLL 1WEJL 5D1XB 3FTGA 1FYTE 1PX3A 1KB5L 4YWGL 3HE7A 1RK0B 3VXRB 1KLGB 2NY2D 1A3LL 3DBXA 3MLZH 5TPWH 4YPGA 2BFVL 3MLYH 2BVEA 2R1YA 1XF2B 3HR5A 2BOBA 2ORBL 4MD5B 3WFEH 5I19L 4OFDA 4XNMB 2HRPL 4PRDB 5F96L 1DL7L 3IFLL 3O9WD 3ZKSD 1C5CL 4U1MA 2CJUH 3NCYP 2OI9B 1MIML 4LOUD 3KPSD 2X7LA 1A6VL 2GJZB 4LSSH 4X6DE 3MYJB 1JNNL 5EOQH 2ADGB 1RUQL 3TA3C 3L3IB 3VJ6B 2ZZUT 4JM4H 3QUMH 2XQBL 4X4MA 5CBEA 2AV1A 3BQUA 3TNMA 2ZOLB 1NC4D 3MOBL 1AGFA 2NZIA 5GS0D 5KS9B 4JRYE 3TVMD 1UM4L 3JZ7A 5IW1B 4KROB 5E4EC 2YN3A 3O3DB 4FZ8L 4ZFFA 3QEQB 4QHLA 3Q5TA 4JG1H 2I5YL 3U30B 3NACH 2FJFA 4I77L 1I9IH 1LEKB 4U6VL 3RWDB 4N8VA 5FGCB 2UYLA 1G9ML 3ZDXF 5A2FA 3BFOA 5F97E 3VG0H 4LHUB 5GGRY 2K7PA 5E2WL 3PWUA 4X98A 1AJ7H 4LKXB 1HHGB 1JWSA 5C0AA 1H9VA 5KVGL 5ADPL 4JKMA 4KJPD 4WU5B 3UBXI 2XACC 4NRXA 4FFZH 4RISH 3BX7C 5J1AA 1T0NB 3BIBX 2BSRA 2W91A 3D9AL 1YY9D 5DJZB 4FTVE 4XB8A 5IB5A 1U8OA 4YQXL 2XIDA 1ZAGA 3LHPH 4PRPE 4CMHB 3CC5B 5TDPA 2GEEA 2VLJB 2FO4A 2LE9A 1QD0A 1I8KB 4OF5A 3P0GB 2H1PH 3NA4A 4PJBE 1TQBB 4JJHA 1SEQH 5DJ2A 1FJ1B 4MNQB 4MA7H 1TTFA 3BGFC 4YDLC 4KKLC 1KN4L 3BKMH 5IKCB 4AYFA 1EGJH 2X4PB 3QNXB 4P59L 4QRSB 5KJRH 1H8NA 3P9LA 3B5TA 3AXLA 4M48H 3JWDC 3DV4B 1ZV5A 2DM7A 3RGVD 3O9WB 4LGRB 2OI9C 5BW7C 2ENYA 1YPZB 4XC3H 4NDMB 3EO0B 4LQFH 1CGSH 4ONFL 4Y1AD 1RV6X 5H37G 1TETH 1TQBC 4XAWL 1P2CB 4NQDA 3TJEH 2AJYH 4M03A 1EHLL 4PJXA 1YY8B 3OXSA 4PFEA 1UA6H 4X6EA 2HLAA 3VH8A 5T1LB 3RY6C 2NTFA 4JKPH 2X1WL 4HUKB 4OD2A 1WCQA 2OXGA 2EDDA 3LS4L 4WO4A 2R69H 3ZKMC 2E27H 1BBJB 3C8DA 3UTPE 4L4VE 5CIPB 5SWZE 3THML 5C0CB 3HAEB 4KRPC 1I3GL 5FDWA 4YFLF 3FOMA 2P5WD 4KI5D 1WBYB 3BMVA 2CXGA 4Q74A 1EX0A 1FNHA 4F9PC 2AJ3A 3ABZA 2PCPB 4MQ7A 4LRNL 1QTYT 2BNRD 1H0DA 3BT2L 3FTGB 2D0GA 3TNMB 2BSRB 1T6WA 4N0FB 3TYGL 3WUWA 2V2XB 1BVZA 3VCLB 3C87A 1U8MA 2G60L 3IAPA 1ES0A 1X5YA 5J0BA 3SY0B 1NDGB 2X9WA 3MCKB 1BLNB 2X4UA 3MOQA 2NYYC 4DVRH 2BHZA 2X4NA 3GMQB 4PLJD 3RVVC 1DBJH 4Q7DA 3DLQR 4UT9L 2XT1B 3T4YB 4UNTA 3C2AH 2GK0B 2DQGL 4UNUA 3B3IA 2KQMA 1FLRH 4M62L 2V17L 2R56L 3MBEB 2J8OA 3ARBA 4RMVA 1FAIH 3FAWA 4OAWA 1MI5B 3V6OE 1AR2A 3D39A 3NZHL 4F15B 3RVUC 4LDLB 4R7DB 1IGJB 4YNYB 2ZCHL 1C7SA 4M7JH 4FQXC 4WFFD 2VDOH 3QO0B 5FOBB 2FB4H 4BYHA 3FFCA 5CBAA 3AFLA 3DETC 3GSVB 3PDOA 3ARDD 4L29A 3GSWA 2XFXA 4HF5H 1WFNA 3B83A 2DJUA 1J8HB 1B9ZA 5SWQA 5E6IC 1HHGA 1JWSB 4CVXA 4MX7B 2H8PA 1MWAH 3F6IA 3HE6B 5EWIH 4FQXB 2BSSA 2EZ0D 1DN0A 1G7IB 2FX8H 4S1SL 4WFGD 2BNUB 2EEAA 4KRNA 4M7KL 1KBGH 4BH7A 3PNWB 4W6YB 1UACH 1MHPH 2VN4A 4PJAE 4XH2A 4JO2H 2UZIH 3WIHH 1NC4B 3T3PE 5EZIH 5C0FA 4IIQB 1F6FB 2HYMA 5C8JA 1IAIH 3ARGC 3LPWA 1RVFL 2ZSWA 1VB9A 4Z7VA 3VXUD 4V1DE 3VI4F 4JFPB 3ULVD 2OL3H 1KELL 1BD2A 2IAND 4UZGA 3WIIH 4PRPA 4OKVB 4PGEA 3I75B 4GG8A 5DJ6A 5F6HJ 3MUGB 4HIJA 1I7TB 3P30L 2AQ3A 3AS2A 2X4QB 4O02H 3SHSA 4KTEL 1AKJA 5DEFA 4ODHL 3QO1B 5LGJA 2F19H 1SBSL 3UYPA 3LKSA 4TVPD 1A6TB 4ZO9A 3T09A 2FEEI 4N8VB 3K2UL 1R5VA 5JPNB 1MNUH 5AZ2H 4IMLB 1YUHB 5IIEA 4RGOL 2A6KA 1DLFH 3LOWA 4WHTB 4WDIB 2NXYB 1CCZA 5E9DD 5I8OH 3ZT5A 3B9DA 5D1QC 4RSVA 5JW4M 5KAQG 4PJAB 1MCOH 1MY5A 2QHLA 1T1WA 1Z9LA 3QEHB 3VFGL 3BD4A 3FQTB 4NQSA 5D7LA 4RNRA 1UACL 1U3HC 2NY1D 2YWYA 2NW2B 3UBXB 3VRJA 4QRRA 1CGSL 3OAUH 3IS0X 4ONFH 4IS6B 5EFIA 1RHFA 2VDPH 3ULVH 5CGYD 3FT2A 4I3RH 4ZNEE 1EV2E 1ONQB 3EO9H 5JOFB 2QQKH 5GISH 5MEPA 3NIGE 3ES6A 1L6ZA 4JDTL 4HUUB 1XF3A 4JVPA 5KJRL 4MA1B 4IRZH 4ZG1A 2OBGA 4YHML 3IXAA 4HWZA 2WINB 3KNBA 2C5DC 3LKRB 3VFRB 4UOW0 2H3NA 2WUCH 2VLKA 4MCZB 1SEQL 4IRSA 5GS1B 1J8HD 3QUYB 3WIFB 2VH5L 3ZE2E 1FAIL 4NNYB 4ZD3L 1FNGB 5CJQL 1RJCA 3GMNB 5CINL 1EO7A 4NKIH 4TNWF 1TJGH 2DJSA 1L7TL 2KZWA 5EU6A 4YHNA 4JO4H 1OAZL 4JZJB 5ESAA 2FBJH 4NKMB 4D3CH 3LD8C 4WEMB 1JTPA 4XNUL 5IMOB 2GK2A 4F2MA 1UXSA 3UZVB 1IT9L 4NQCA 4HGWA 4UV7L 3LEXA 4TSBL 4KMQA 1GIGH 4QCIB 5FF6A 3ULVE 4Y4FC 1IGJA 5FV1L 3CJJA 4NO0B 3WLBB 5DA0B 5DJDB 5E5MA 4KZEL 3G5YB 4IIQA 4NYLB 1I9IL 4WFEE 2XA8L 5HDOA 4WI5A 3C08L 5B39G 3BQUC 1G0YR 1XGQB 2EZ0C 3W9DB 1KPRB 2R2HB 1ED3B 1HH6A 4NUJB 5JR1H 4CVXB 4KKBC 5I6XC 3TVMC 4P5MB 3WSQH 2XPGB 3NAAL 2BRRH 1HXMA 3U4BL 5J13C 3VFSA 4YDJA 2ZUVA 3V6ZB 3ARWA 5KSVB 4CL7A 4X9IA 2DMBA 2D7MA 2FGZA 3I84A 5EO0A 1Y6NR 1KC5H 2OK0L 1S7TA 4QOKB 4EIZC 4LK4A 2WIIA 3HE7D 3MLWH 4QHUA 1PYWB 1FSKC 5EZJA 3OKNA 4UT6L 2I07A 5HYSA 1EJOL 4DZBA 5EOCH 5D2NA 4ZUVA 3VXSB 1HNFA 2X4SB 4LLQB 3U4AA 4JHWH 1MWAA 15C8H 4BJLA 3AREB 4JM2D 5DFVC 3T0AA 5C1MB 1UM5H 25C8H 2R1XA 1A3LH 2ERJB 3EYSH 2CUHA 4JO4L 3DMMC 5FM4A 4AT6B 2NY2C 5D2LA 1OGAD 1N2RA 1NGQL 3BYYA 4G7YL 4LNVA 1QLRB 2ICWB 3NZ8B 4F9LA 5JW3H 3ILQD 3U7YH 2DKSA 2Y7QB 1EVTC 3ZYIA 3QFDB 4IJ3B 1NGXB 4QRTA 4P46C 3FB5B 1MRCH 5IFHH 1UENA 5EOTB 3NCFB 4JG0H 1AXTL 5K59E 4QHLB 1LEGB 3BKML 3TPUA 1J88A 1RJYB 4P3DA 3TNNB 4D0BB 3BUYB 4PBVC 5C2BH 1QACA 1X5KA 4JPIA 4LHJB 1W0YT 5DF0A 2JIXB 4FP8L 4NKMA 4WI2A 4MQXD 1NBVH 1EZVY 4NWUH 4WU5A 4AIZA 3KLAB 1MUJB 5J4MA 2E7MA 5J1AB 2DLTA 1IGFH 1G7JB 1HSBA 3UTTB 3QQNA 4GW1B 4LPTA 4HEPG 3I02B 2DDQL 4HK0A 5C71A 5L7XL 5F6IB 4L4JA 3V6OC 4JHWL 5H35B 4YIQB 1A7NL 1NAML 1C1EH 4M7LT 4D0CB 4CNIA 1QA9B 4UT6H 4C55A 4LVOB 2HWZH 4JFFE 4PJGB 2EO1A 4KDVA 4QWWC 4Y4KC 4PS4H 2QSQA 5AAMA 2IPTH 3E3QE 1H15A 2OTUA 3NA9L 5EA0L 5DR5H 5JXEC 1I1RA 4HMEA 3S96A 1FYTD 5KSVA 1IILE 2VZVA 2HWZL 1LNUB 5JR1L 4IOSD 3TH3T 1BVLB 3QAZC 2PXYC 4DGIH 4NUGH 1S5HB 3AMKA 5GGUB 2ZCLL 4X5XB 1OM3H 2YK1H 2ICEB 3QDJB 3RA7H 3RUGF 3JTTB 4UT7L 5GGQL 3W0WE 3VXNB 2EDNA 2X70B 5C0AD 5CEZH 4P49A 4PGDB 1S9KC 5GZOC 3TCLB 1L7TH 4TVSa 1I3VA 2OL3L 5FKPB 1OP5K 1P5VA 1DN2A 3MV9A 4W6XB 2JF1A 3LKQA 5EOCJ 3PP3H 3O3DA 2A77L 4PLNC 3MJ9H 1R0AH 1D5IH 3Q3GB 5AYUL 5J9PA 4G8GE 1MCWM 2OX5A 5I0DA 1OCWH 4YFDB 3HAEA 2D4FA 5I75B 5HI4C 1A1NA 1ZHNA 1NGWA 4CVZB 2OL3B 3K8MA 5IBUB 2VLLB 3DNKA 4K8RC 1ZSDA 4BELD 3P0VL 2H3NB 4MJ5B 3QFJA 2APWA 5DUMH 2EE3A 2P5EA 3TBWA 3PABA 4OZHF 4B0MM 2X05A 3QQ4B 1JHLH 3C60B 1EK3A 4P2OA 2XG4A 2H2SC 5GS1C 2Z92A 1J05B 1OD7A 4JM2A 3MLRH 3STZB 2C3VB 2VLJE 1FO0A 5E8PB 5MP6L 4X9FA 1I85C 2AQ2A 1B4JL 1TITA 5FHBL 2Q76A 4X0KA 1TTGA 1HYRC 5ALBH 2EO9A 5ICXB 2V17H 4M62H 3BDYL 4F2MB 3WL9B 4D0CA 3B9KB 3PGDA 3GHEL 5IB3B 3GB7B 1BZ7B 3FQXB 3SE4C 5HYQB 4P3CH 3QDGB 2DYPA 2ZUQB 3T0BA 3UROR 2GSGA 2XN9A 2VABA 4X4ZA 3PWPA 2EE2A 3T2NL 5L88H 2VE6A 1HZHL 4AIZB 4NNPH 2APFA 2DD8L 4JB9H 5C0BB 1IGMH 3BWUC 5GIRA 4EI6B 3LQAC 1A7RL 1VFAB 1B0GA 1ZEAL 1QUNA 1AHWB 1P2CA 3NFNA 1KG0A 1ZK9A 4TULH 4TSBH 2QSTA 3IS1X 2Y25A 3DHJA 1V3JA 1E6OH 3BPOC 3V8CA 1RPQA 3UPRA 3MRDB 3NN8B 1IM9D 3ECBA 1YEKH 4OGXH 4XCFH 3ISWA 5KTEL 5EUOF 4E0RB 3V5HA 4X83A 4M7KH 2GSIA 2R69L 4I2XA 4O51A 2Z0BA 1MJ8H 3QDMA 4KV5E 1T5WB 4HUWA 4JY6B 1DQJB 4FZEL 1YPZF 3B2VH 5EZIL 3BZEA 2PETA 5FOJA 4HS3B 2XXCB 5BVJA 4H88H 3DXAB 4G6JL 5DD1H 1T04A 2YA0A 5I9QC 1EERB 3TO4C 4U6HB 2VIRA 3MA7A 4U1HA 1P6FA 2LAGB 4K7PY 4OQTA 2VDOL 3RKPA 5DRWA 1GPOL 2A6IB 3RPKA 3GJFA 4Y4FA 2GW5A 1WICA 1O7VA 3RUGE 3AS0A 3VRLE 3OAUL 1CICC 2OCFD 1J86A 2OR8A 2YEZA 2HG5B 2AEQL 3P3YA 1WAAF 3MJ8A 3FT4A 5GS2H 1CFNB 1NGZB 4MA7L 5F9JA 4LFHD 1FGNL 3O4LB 4WW2A 1VCAA 2UV3A 3D39B 1AKJD 3MRFA 1U8NA 2VWEC 1K8IA 1RZJH 4O2FB 2BVOB 2HFFA 1HQ4A 4ZUTA 5BS0E 4ZTOL 1LK3H 4J8RA 2C26A 3C2AL 3GK8H 5ISZE 3REVA 4CNIB 2QTEA 4LMQE 3STZA 1YDPA 4OB5L 5KSUB 4UT7H 1QFWI 4MWFA 5GGQH 5FA3B 2N1KA 4GO6B 5C0CD 2IPUG 4HG4J 4MZ3A 4WGWB 4IOIB 1MEXH 2D7QA 4OJFH 3WJLC 3SGDI 1UXWB 4Y4KB 1IC5L 4KQ3H 3OKKA 3SDXF 1NDMA 5IM7A 4E9LA 2A6JB 3PWUB 5FUCE 1EFQA 5B38B 2BRQA 3U0TB 4DGVH 1NCDH 1SJEA 5ID0B 5TQ2H 3MLVH 3VE0A 2Z31D 4RAVB 1S7XA 1UM4H 3PDGA 5D93C 3H9HB 4ZFZA 4QXGH 4WFHE 2Q76B 3WKML 5IB5B 2WWMD 5AG9A 4C54A 3H3BC 1FBIH 2B8OT 5L7XH 2VB5A 5HD8D 3V8OA 3TJEL 5EOQL 1JNNH 4N0CC 3V52L 5D9SA 1MRDH 1NUNB 1YEKL 4OGXL 5M7QA 2CJUL 3HE7C 5E8EA 2LFGA 3LKSB 4FNLH 4WNQA 1VFOA 4FN0A 4GRMA 4POZC 3PUCA 3L7EB 1DEEA 4W70A 4LVHC 1P7KB 3B9VA 2AXFB 3E3QC 4EDWL 2OQJA 2AJZA 2WMPA 5F9OH 1CGWA 4H1LA 5T3ZH 1JNHB 4RGNC 4OI9A 1NFKA 1AXTH 3MGOB 2HT4D 5D6DC 1FFPA 3HKFA 3GSOB 2DTSA 4Z7QE 3FO2B 5SX4H 3K74B 3BZEB 5CGYC 1J0HA 5GRYA 4NM8L 1PZUB 5JW4Q 4KTDH 4LLMA 3CVIH 3ULUD 2I9TA 5CBEB 3DX7A 4G8GD 5J8OA 5SWSA 4G7YH 1EGJL 4L4TA 5F3BB 1HHHB 3GMPB 3OGCB 4JFFA 5DD3L 1AR1C 4L4VD 4OCRL 3V6ZA 4KZDL 4O9HH 3RWEA 2A6DA 4LIQE 4UDTA 4RWHA 2F54D 4LLVA 1JFQH 3FONA 5I8EB 4HPYH 2V9QA 1WFTA 2PYEB 3FO0H 4ODWA 1KLFA 4X8JB 5GHWH 1J8KA 1J87A 4NM4L 2QEJA 5I6XB 3VFPB 3QJHB 1DQDH 1HDMB 3A67H 5GS2D 5H37H 4YPJA 1JNLL 5FO8B 5E0QA 3HI1B 2B2XH 5EC2A 4NUGL 2PCPA 3U4BH 5C86A 4JPWH 4RAUA 1X5GA 5CMAB 3WO4B 4Z78B 1KFAL 4TVPL 4QNPE 3DX6A 1S8DB 4HFWA 5TDNB 2PO6C 4XP6H 4KVNL 3MV7A 3UBXG 1MFBL 2D0FA 4YHPA 2Y72A 5HPMB 3NACL 1S3KL 1SYSB 3IU3A 3L1OL 5D70L 3UPRB 2H26B 1CVRA 4ENED 5I1HL 3U0WL 3DSNA 1GIGL 3VI3E 4JKPL 1CGTA 5JDJA 5C7XH 1ADQL 1K2DB 1XEDA 2VMFA 4LCWE 5DA4A 1JZ2A 3R1GL 1S7UA 3QUZA 2FR4A 4XAWH 1X5AA 2V2TB 3G6JA 1NAKH 3BZDA 3JVGC 4LSPH 1QFHA 2AXFA 1FSKB 3QFJE 1D6EB 1OQOA 4X6CA 4ZXBD 3PE9A 4H1LB 1MRFL 4TRPL 2ORBH 2DRUA 1D5XA 4KMTH 4M1DH 5DFWH 3MA9L 1H3WM 2F9BT 3SGEI 3DMMA 2D03H 4XC1L 3VU2A 3QDJD 1ZGLP 1LO0H 1M6OB 5C3TA 1DANU 4M8VA 1OB1A 4GFTB 3OSKA 5LWYH 1S9XA 1U3YA 4JLRB 3SDAD 3WXWL 2I60L 2ADJB 1U3HB 5C9KA 4G6FB 3ILQC 5CJBA 4BKLA 1AO7B 5FYLD 4ZFZB 4N0YH 3L3JA 5D2NE 4OZFG 1AD9B 3HA0A 4JKWA 4G80A 1DSFL 4YX2H 2P8MB 4U31A 1RU9H 5J06A 1BOYA 3E8UH 3VXNA 2M8XA 2MHAA 3O11B 1X5JA 1PFCA 4FQLL 3D1MC 3UEZA 2CDGA 1P7QB 3MRGA 4N1HB 1DEEB 2EDJA 1TZHA 4LF3A 3HZYA 1OP3K 1ACYH 1V7NL 2LAAA 5D5MA 5C6TL 1I7RB 1OWWA 2Q3ZA 4RBPK 1S78D 3LQMA 1S8DA 4HFWB 3QUYC 2A9ML 4U0RB 1JZ8A 2QSVA 4MJIB 2YRPA 1JPTL 1KIRB 1EFXD 3QT2A 2P24B 4X8JA 4AEFA 2DQJH 4L3EA 2KDGA 1KJ3L 4CN1A 2Q7NA 4Y4KD 4R0LA 4KPHL 1LILA 5IMMA 4PJEF 4PRHA 4HIIB 5JXEA 4CDHA 4W4OA 2X7LB 4P5TD 3QSKB 3QDMD 1C5CH 3V5DA 3KPNA 2NXZB 1IGCH 1XR9A 1Z9MA 4WV1B 1KJMA 1A1MA 2A6DB 1R5WA 1R3JB 1CTNA 4LIQL 1IT9H 4J3SA 1NLDH 1EBAA 3SCMC 3EJZD 3MFGB 4AG4H 2AK1H 5IW3A 1OF2B 3MV11 3V7AE 3SPVB 1WT5C 4QHMA 4PJ7F 1NGYB 1CE6A 3HUJA 3HC4H 2OTUB 5I76A 3CMOL 4XPGH 1KBGL 4LCCC 3JWOH 5CJQH 5JXAL 3IRPX 4A6YL 2EH8H 1WLHA 1GH7A 4R4FL 3DROA 3CDGB 1Q9KA 4I2XE 1YEGH 2VC2H 1BJ8A 1VERA 2R0ZH 4ZOCA 5I16B 4HJ0C 1A5FL 4YHMH 4JQXA 3WHE1 4OSUL 3IVKB 3TEUA 2ARJQ 1DQDL 3MFFA 4PB0H 2YPLE 4H0GA 2P42B 1YNTB 4EUPA 1MY7A 3DYMA 3QWOB 4PJ8C 3CNKA 3TWCH 5BS0D 1DR9A 1H3PH 2SEBA 2PTVA 2XYCA 3VXRA 4F9LC 1MFEH 3PL6D 4XAKE 4XT1C 4FQHB 4PJDA 4KFZC 3G9VA 4S1RH 5ERWA 3TFKC 2NY4C 3S88H 3GJFK 3K0WA 3LN5B 2VSDA 4V2BA 3GDBA 2IG2H 1QEWA 3X11B 1A14L 3NBNA 3F7YB 2P5ED 3QIUD 3V0AC 5CEXA 1HHJA 4WGVB 4UDUA 2X4QA 3MOAH 2YHGA 1PBYA 4DQOH 2ESVD 3QO1A 1IL1B 3I6LE 1X6NA 1A3RH 3TGXA 3BPOB 4WHYG 1DLFL 4ODBD 5MHSE 3GIZL 3H9SB 4WI3A 1TJHH 1YYMH 4BKLB 4ZPVB 1U8OB 1IMHC 1SBSH 2J1KA 4I3RL 5EU4B 1N59A 3L3JB 4ONGL 1C5BL 1TXKA 4PY8J 5A16B 4KK5C 1OAXH 4QHUB 2AXJA 3FQWA 1K2DA 1R24B 3DUUA 5ISZD 2W65B 4KROD 5MENE 2X4TB 4YR6B 3GSNH 4KKCC 1KELH 2VAAB 3MX0A 2YEZB 3V0WH 1FBIL 2DQEL 4GSDH 5FDWB 1AGEA 5FYJH 5DSCA 4OT1H 3ZDYF 5FO7A 3H6JA 2VE6B 1P7QA 4RNRB 1S9WB 1TZHB 5HVHB 3TO4B 2OZ4A 5I66B 2VDNH 3RL2B 3OR7B 3X3FH 5TQ2L 1F00I 4Y2DC 3QB7C 2DI8A 3MLTA 3RAJL 4DUVA 4ACPA 2VLJA 2BNQE 5EC1B 3WD5H 5HGHB 2IANB 1MWAL 1JF1A 5LAXA 1MNUL 5BRZE 4H25B 5EOTA 1NCTA 5DMKA 5ECJE 4OV6F 4PRIE 5GRZA 2DWDB 2AKRA 4AEIH 4F8QA 4WIQA 4AM0B 1RIUH 4HS6A 5HJ3B 3LMJH 4JRWA 1NDMB 2DLFH 4DK6A 3KPRD 4CMHC 4X7DC 3IFPA 5L6YL 3BP7A 3CDGA 3PWNB 5IQ9B 1PLGH 3SDCA 4Q6YA 4H26B 3L5IA 2O5XL 1FPTL 3RIAK 1FH5L 2NY1B 4YDIL 1FJ1A 4MNQA 5K9KA 1AP2B 3DO7B 1CE6B 1JGEA 2KUTA 3HUJB 4NQDD 5CWSB 3OXSB 3IDXH 4O2EA 3ZTJG 5IFJA 5KSAC 5CSZA 4YFLI 4EQ2A 4FHBD 4WTZA 2H32H 3ZTJH 1CIUA 1E4XL 1I7RA 4OD1L 5FGRA 4FFZL 1JTOA 4OFYA 2XTJD 4MB4A 3C8KA 2MKLC 4GUPA 1X9QA 5BV7L 2PW1B 4ZO8A 1Z3GL 5E9DB 4FFWC 3O6FA 5C0CA 3W39B 1S9VA 3IDXL 3VGEA 3WFDL 3I6LD 5C0JB 2FHFA 4Z7UF 2CGRH 4KJWC 3AM8A 4HSQA 3AM8C 4U1IB 4UQ3A 3LAFA 2J6EL 3MRBB 5MI0B 3NFSL 2VZSA 1R24A 4U6YB 1KCUH 2ZSWB 2Z9TA 5F8RC 4Z77A 1KN2H 3U9PL 1YEDB 3SGEH 4K7PX 4KKNA 1NCAH 4HDIB 1UYWL 2XA3A 4UUJB 4L3AA 7FABH 3O2WH 4PJGF 3D3VD 3FB5A 5B3JF 3K3QA 4Z7QF 2V7HB 2BNRB 4QTIH 5BZDA 5IESL 1VACB 1KYOJ 1XIWD 4UDTB 3RVXD 1ZWIA 5DLML 1R5VB 2IBZY 3PWPD 4OZGB 3FONB 4TULL 4M9PA 5SWZB 2X9YA 4P23D 2ZJSL 2FLBT 3H3PH 4TSAH 5E8OB 3CVHH 4LCWB 4CW1A 4NWTH 1UH2A 5IHBA 1V3LA 3B5HA 4EOWL 3P9WB 2HH0L 1RURH 2FZ3B 4ZXBC 4LRNH 4TOYH 3LKNB 5GGTH 1NFDE 1AD0B 1KEGH 3MO1A 1X5IA 1P4IL 1FG2B 4M48L 1ORQB 5JDSB 3N1GC 3U6RB 2YA1A 4S1DC 4P3DB 5DK2B 4NKDA 4XBEL 4JR9L 1IBGH 1TCMA 1OAXL 1FE8L 3E6FA 4CVWA 3FB7B 2XXMB 5C0ND 4G7VH 3ZTNH 4KVCH 5FHBH 2A0LC 3MR9B 1R5IA 2BHYA 2YUWA 3GB7A 2G2RA 1HEZA 3ARFC 4LPYA 2Q3AA 3GM0A 3OHXA 5DMGD 3ARBC 5L2KE 3GIZH 3VGAB 1ERNA 3SDDC 1VA9A 4DUWA 4PRAA 1KULA 4OFYD 4IRJD 4HMDA 3VFOB 4NO5A 1Y18A 1JF1B 1TCRA 1CD1A 1OTTD 4QGYA 3M17B 1MIEH 1FYTA 3VXOA 1IFHH 2BOCA 3NFNB 3GKWL 4OZIB 1P1ZB 1QFUH 4U6YA 3BPNC 2WP3T 2Z8VC 2V2WB 1R3KA 3QWRA 1UWEL 3HNSH 4CMMA 4TQEL 2R23B 3RHWF 4FZ8H 3REWB 2XNAB 4L8SB 5D1ZA 3MNVA 1AI1H 3T3PF 4UIMA 5C70A 2VDKL 4WI8A 3DTXB 5KSAB 2H32B 4FXKB 4OFPA 4PD4K 4HPOH 1FL6B 5H94A 4V2CB 1LQSR 1Q38A 2VLKE 3OXRA 4YFEA 3HR5B 2M2DA 3H3KA 4G80B 1TIUA 4WRLA 4OKVA 1CFQB 4L3EE 4FTVD 4MNQD 3LMJL 4OSUH 3WEXA 5DVOA 1C08B 4LU5L 3WNPA 4PRID 5CSZB 5T1LD 2ZUUA 2ZSVA 1YEGL 5B38G 2AK4B 3MROB 3OZ9L 3SGJC 1JYNA 3R8QA 1R6VA 4U0QB 4OLZH 4PJ7E 4I0CC 1T20A 2NW2A 4JRXD 1G9MH 4M5YL 4C57C 5EFIB 3LQAH 5EO9B 1XF4A 2QADD 4RFNB 4ZOAA 3RZCB 4G6MH 1ZHNB 5D7LE 1LEKA 5AAWA 3U46A 1DQMH 3EOBA 1VADB 1MFNA 3HRZA 4M1GL 5DFVD 3C5ZB 3T0WA 3I2CL 3MRIA 1U3HD 5C0EB 2D4DA 3DVFA 2ICWJ 1KACB 1E4XI 4OLYL 3K2MC 4JM2B 3CVHB 5E7FA 5ACZA 2NY5C 4DN4H 5E6YA 2YC1A 5K9KB 4YC2B 4DKEH 3DO7A 3BH8B 2ADIB 1A1MB 3GSQA 4P9MH 4K23H 5DJAA 3ARXA 3WXVH 2YKLH 2C1OB 3LDBC 1CFSA 2P44B 4HCRA 1JMXA 1BFVH 4OZGA 4QRTB 4HWEL 3HNTL 3S3JA 4LHUA 1ED3A 5I1CL 5LGHL 1YMME 3ZT7A 5ETUB 4HG4K 4R2GB 4I0PA 5C6TH 2W0PA 4KJYB 1R3KB 4GBXD 3RWFA 3EDJA 1FZMA 4K8RL 1NMBL 1FG2A 1CL7I 2VL5B 1X5HA 1SJEB 4P4KA 5FYLE 5FHAL 2YD2A 2HFGH 3ZKMD 1TQCB 4PJ9A 4R8WH 4BZ1L 5ANME 4NDMA 5C09D 5FCSH 2VLRD 4TNVK 1UM5L 3EFFB 1JPFA 1S7QB 5C08B 2GFBA 4S1QL 4PG2A 4XNYH 2DQUH 2XWTA 4R2GD 5DDHB 5HDQH 3RTQA 5IHLB 4KVCL 4M8QA 3WYRA 4QRPB 3UJIH 5DT1H 5BZDB 1MHCA 3MRNA 1GC1H 4HJ0D 4KGLA 3RVVD 5LQBL 1JWUB 5DWUL 3TBSB 1S7SB 3FFCE 4Z7WB 1VHPA 4P5TC 4FQHA 4YGVB 4C83B 5I73C 4XNXH 2RCSL 3S96B 4EXKA 4N90E 2FH8A 4R4FH 2FIKB 2J4WH 3O45B 2Y4SA 1CD1B 3B9KD 2NX5E 4NQUA 4L5FL 4PUBL 4CGTA 2FSEB 4WW2B 4F7TB 2EIEA 4FQXD 5GRJH 4R6UA 2JJSA 1PZ5B 2NYYD 3E6HB 4JPKL 3DI3B 4MNGB 5CP7A 5E5UB 4GAJH 2DIJA 4KZEH 1XR9B 5C0CE 3BEWA 1NLDL 4LNRA 3MNVB 3EO1B 4GW4A 1J0JA 4OZGE 3G08A 5E6ID 2WAHA 3DTXA 1M7DA 1C5DA 5D1QB 1QFWM 2ZPKL 3MXVH 1FNEA 4DCQA 3ZYOA 3ALXA 2XV6B 4XHJD 3QIUC 4L4TE 4R90L 5FYLL 3DMMD 2NXYC 2O61B 3HCVA 2GHWB 4G42B 4OQ1A 1HSAB 3EOTL 3BKCL 2UZYB 1EA9C 5GRJL 2WQ8A 1M71A 2IFFH 4NC0B 5FM5O 3RZCC 1SQ2N 1KPUA 1ZVYA 2NXZC 3ARBB 1U58A 3QR2A 2Y7QA 2P8PA 3ZKNC 5KOMC 5DXWA 1KENH 2W1NA 3H8NA 3OR6A 4IDJL 5CKGA 1T66D 4AENA 3PABB 2AEIT 4GMSH 3IKCA 3MRJA 1UWXH 5KSAD 3VXME 3KAAA 1QSEA 1Q0XL 1L9MA 4JJ5B 1CXFA 5KSBF 2EEBA 3QCTH 3VH8B 4P2QD 1MQKL 4RX4D 1YN7B 1PVHA 5HDQL 2E7BA 3IXTA 1CT8B 3E0GA 3L3HA 2H45A 1FE8H 5EBMA 3CFBA 2PYFB 4PRPD 4KZDH 4YH6A 4IM8A 5JIHA 1Z9SA 4H1LG 4Y19B 4BH7B 1YJDH 3OPZH 1KF9B 3DURB 1A7OH 3TIEB 3KHOA 1DQML 1P4IH 2YA2A 4UINL 2DQHL 4M1CD 4P46B 3SKJL 4JRXB 5T5FL 5F3HA 1NJ9A 1A9BA 4YUEH 2EYSA 4HS8L 2F53D 2H8PB 3F7PC 1LP9F 4L4TB 3D6GA 1FVDB 4XPAL 3GJEB 4LDEB 1ZLSH 1P9MA 2NLJA 4JRYD 1T03L 4K94H 1J5OL 4WV1C 2GITB 1HYSC 4EQ3A 2JJVA 1BZQK 1FO0L 4JFFD 4DKEL 2VL5A 4DJMA 1U8JA 4YHLL 1IQWH 4LSPL 3U2SB 1F90L 4KTEH 4P23C 1S9XB 2VXSL 5KZCD 1YUHA 4YE4L 5T1KB 5JLZB 3QRFM 5LXGL 2ICCA 2ADJA 3UXFA 1F13A 2FHBA 2B5IB 1T2QH 1J9CT 1ZMYA 5KSBE 1I8MB 4YUEL 4FQQB 4PG9A 4QRQB 5F6IC 2GUOA 1OSPH 3O8XC 3P2TA 1EXUB 5GRVL 5C0AE 1BQHB 1X5LA 4OF8A 4D9RE 1I7TA 4PV9A 2X89D 2DYPB 3E6HA 4PJ5A 3MLVL 4JFDB 1CBVL 4NIKB 4XX1G 4Y16C 3DXAE 4ZUWB 1EEYA 5J9PB 1G0DA 3LQAL 2VLJD 1SVCP 1JGDA 4OCNC 5AD0A 1EEUA 5LAXB 1NEZB 3QP3A 3QXDB 1CFTB 5A2IH 1YYML 3QXAA 4BFIA 2B2XL 5CP3A 1E4WH 2IH1A 4YDKL 1UH3A 4O58L 5GGSY 1RZ8A 1R3IL 3QYCA 1F4XL 3S5LG 1U95A 2VABB 1WWBX 3BP7B 3RPIA 4P2OD 3QJFB 5ICYA 5DRNB 3DGGA 3SKJH 4R0LB 2D0HA 5L8KB 4E0RA 4IRSB 3WHE0 4OFKA 4BQ6A 4DKDC 3WKNA 4XMLH 4N5UA 4NNYA 3BO8B 4KQ4L 2QQQA 4WTWA 3G6DH 1B90A 3CLFH 1PJ9A 3TT3H 2GTZA 2W9LA 1NFDF 4ORGB 1EJ6A 4HIEA 4H0IA 2XZZA 5I8CA 4Z0BL 1D5MA 3IXTB 3MUY1 4BZ2L 4PY7B 1JWUA 1S7UB 3QUZB 4BZYA 2OTPA 4JFEA 4YEEA 2FBOJ 3WUWG 4JRXE 4NO0D 4KKBD 1RURL 2HH0H 2NLJB 3BISA 1HEZB 1CGXA 4Z95L 1PG7X 3GZKA 4HT1L 4EI6A 3UTSA 1Q94A 4HKBB 4KDTC 3NPSB 1U3JA 1UCBL 3QDGD 3SBWC 1HK6A 1FNGA 1ULVA 3LB6C 2GTWB 2X44D 3D2UA 3TIEA 1IC7L 3OJMB 2QHRL 3I85A 2MHAB 3OKMB 1HKFA 3QXWA 1IAII 5FB8B 1JPGA 3VXOB 4UB0L 3IFOB 1RIVL 5KS9A 2FECL 4LVHB 4L8CA 2BVOA 1CL7L 2E27L 1RUMH 4J6RH 5HHQB 2X89A 4J7RA 3DUSA 3K80A 1QSFD 5TE7L 4W81A 3O6MH 4FXGA 5HI3C 5C09E 2MNUA 2EDBA 3OKLB 3T8XA 1FG9C 2QHRH 3QIBB 5EUOB 3VFNA 3ULVF 1OAUH 1S7RB 4XP1H 2ZUTA 3RZWA 2EC8A 2HFGL 2VXSH 4Z0XB 3WNOA 2PW2A 4KPHH 1ZT4B 3HFML 3X11A 3GI8H 4AT6A 2X1QA 5GRXG 3MOAL 3K81A 1N5YL 5K9QG 4K2UH 4PRIA 4R26H 1JHKL 2EC9U 2D2OA 4NNPL 1CIDA 5DLMH 3BDXA 3DARA 3TA3B 4K94L 1J5OH 4ZUTB 1FFNB 1U0QA 3BZFB 4BZ2H 4DN3H 1I1FA 1TVBA 1ZXQA 4CDGC 5FYKE 1UFUA 1JGDB 1TPXC 4GXVH 2I07B 2X10A 4G8IA 2CDFB 2CO6B 1F8TH 4YHNB 3G6DL 5TH2B 5DHXB 1FPTH 5DJ0A 1JN6A 1WAAE 5FECB 3BXNB 3DVNA 1CFNA 5IT2L 4L8BA 4ODSL 5DT1L 2A83A 2JTDA 2XG5A 4XMKH 3T04D 2KPNA 4XVUC 3B2UD 2CLRA 5D2LB 4DN4L 2BXYA 4HGKC 2I9LA 4X6DB 2UVFA 3QIUB 4HKZB 3G5YA 4Q9RH 2QADC 3FO9A 2DKUA 3CUPB 5JMRA 2VXVH 5GZOD 3KYNB 2J88H 4MWFB 4XB7A 2EYTB 1P6AB 1J1XL 4YLQT 1I4FA 4PJGE 5FOBA 5KVGH 1MQKH 1H5BC 1NGYA 4KAQL 2ATPB 3WD5L 2F8OA 2PXYD 2F8XC 4X4YA 1C12B 2GTZB 4HZLA 4N8VG 1TENA 3TH2T 3CH8A 2A6JA 3LH2L 1JZ7A 2A73A 1LDPH 3IJHA 1IAOA 1EMTL 2GT9A 2BSSB 1TZIB 2H26A 5ETUA 1MHEB 4FZEH 4KI5F 2A77H 3C60D 1Q9WA 5TF1L 5I73B 2DWEB 2H41A 4N0RA 1I7UA 2BJMH 3HZVA 3RWIA 4FQQA 2VQ1B 4UI2A 1BF8A 1FNFA 5CUSL 1U8PA 5DYOA 5GGUA 4JQXC 4QHKI 5EU7C 2BVYA 4PJXB 4ONHB 3L5JA 5TJWK 3VFVB 4KRLB 1BM3L 4M6NH 4M9OA 5BXFA 1MFDH 3ET9F 5DUPH 4G6KH 1J1PL 5DVNA 4LCUA 4JFPA 3NIDE 1RHHA 1QFOA 4MXVF 4NRYB 2FYYB 2X42A 5HYJD 2HJLB 2OJZL 4PBWD 1KB9J 1P7KA 3DO3A 1X5XA 2NY7L 3MLZL 2UUDK 3EOAA 5IJVA 5E08H 4FRWA 1IEBB 3SGKA 3LEVL 3RAJH 4RAHA 4F37K 2ED8A 1S3KH 4QF1A 1E4JA 1IGML 3OKOB 2UWEE 4FXGB 4PUBH 5EN2B 4ZFGH 4X5XA 1FGVH 3LS5L 2QADB 3F7YA 5HPMA 3RZCD 1A64A 1K6QH 3UC0H 2VR9A 1XGTA 2XWBA 5TH2A 4EKXA 2R4RL 5K9JL 5C0DB 4LLMB 4OT1L 3ZKND 4YJZL 2B0SH 3IFOA 2ENSA 1ZKAA 4DOHB 2VXVL 3LDBB 3M8OH 32C2A 2FJHB 3O6KH 2Z35B 3UJIL 4Y7MA 1FL3A 1MQ8A 3MBXL 2VWEE 3QQ9D 1F4YH 2R1WB 5FKAB 3O9WC 3VRJB 1OTSD 2G5RA 3FOLA 1SYSA 2ZOKB 3IU3B 1N0LA 4DCQB 1F4AA 1AC6A 1D3CA 1KNOA 2EDOA 4GOSA 4IS6A 3QHTC 4XNZC 5C09A 4BQ8A 1ZE3C 4MA8L 5IR1A 2YZ1A 5IBLD 1G7LA 3VW3L 3QISA 1RZJC 2HJFB 1CU4H 3ZL4L 3TYFA 2E9IA 1UH4A 5T5NG 4JN1H 4D8PA 1B0WA 2ESVE 3O41B 5ISZA 5KN5A 4ZUSA 5TDOA 4LEOB 2FR4B 4JFOB 2P45B 2JB6B 2F54A 3WV0A 2JIXD 5I30L 5I8KH 3FZUC 5IVXF 1JUFB 3EZ8A 1XF5B 1KTLB 1JBJA 3TCLA 1JPGB 5DJYA 4PP1D 3RIFF 2ITCB 4KRPB 3WLWD 3GUTB 4EI5D 4XVUD 2YD3A 4CN6A 1LGVA 2NXZD 2R2EB 2DS4A 3TWCL 4M8QB 4YAQB 3VDBA 3KXFA 1AHWC 4ODUA 2B4CH 4GMTH 4XWOC 3ZKXB 4YHOL 1G7PA 4OGYH 3ZKQD 3OAZK 4J6RL 1T66C 3O2WL 3FB7A 1B6DA 2ADFL 3ZO0A 5E00A 4YPGB 3EDDA 4HUXB 3MRHB 5F1IA 5MERB 1CLOH 5C0IA 3BEVA 4Y19A 1N26A 4L5FH 4NO3B 5EORL 5MHSD 4FOMA 4EI5B 4OBSA 3ZT6A 3JVGA 4JY6A 1KSRA 1EMTH 1ZANH 5CCKL 3MGTB 3CFIC 1F58H 3QUZC 1FNSH 4EOWH 3D2UD 4WTXA 4I48A 4H20H 1GOGA 5C0BE 3SE4A 4M00A 4XVTH 5JPNA 1KJ2B 3WS6A 5T3XD 4JZOB 4GG6B 4G9FB 2R1YB 5HGGS 1JFQL 4CN4A 3NOIA 2VKXA 2A6IA 4JANB 4YDLB 4NT6A 3VWJC 3Q6GH 2QKIA 2FJFB 1I1AA 4UAOB 2VL4A 2A83B 3GO1L 4K71B 4MAUL 5EBLA 3TFKD 4KK8D 5D7IA 1HNGA 5T1KA 3F58H 5JLZA 1M71B 2F8VA 1TJGL 3FFDB 2R2CA 4AL8H 1P4LA 1YEDA 3B5GA 4QHMB 4ZTPH 4CRPA 3KLHC 4ZYKA 1OAKL 3DXAA 3AAZA 3MODL 1CDHA 4DVBB 1NQBA 4RA0C 2XY2A 3M1BB 1MVFA 2D9QB 2W9DL 1CDJA 4JG0L 1SVZA 2HRLA 2C1PB 1WC7B 1RK1A 3FT2B 3KLSA 4WUUA 3QH3B 2AGJL 2Q1EA 4L8DB 1QBLH 5F9OL 5TGBA 2K9UA 3U48A 4Z7UE 3IVKA 2EIDA 4NOFA 4ZOBA 4IOIA 3MRDA 3NN8A 2CLZB 4L3EB 1YEIH 4CU6A 4BFIB 3OX8B 3CFBB 5KG9A 3LEYL 4PTTB 5DZOA 3G6AA 5DD1L 2J12B 2AEPL 3MV8A 4QCIA 1U8NB 4Y2OA 3TBVB 3HAEG 2DF3A 4N0CD 3JV4B 5ISZB 4NQCD 1XZ0A 5HYJB 4JFQA 3IDUA 3O2VH 1U8IA 4KI1A 4ONHA 3VFGH 2MFNA 3EJZC 4Q9CA 4XP5L 1CR9L 2FX9L 5F8QC 4LLYA 1KCRL 4KJQD 5CS7A 5D6DA 1RUML 5JIPA 3BP6B 1WF5A 1P4BH 3UJTH 1EAPB 1NCDL 2G5BA 4TNVF 1T4KB 2DOCA 2YUXA 3NAAH 1XH3A 1MCBA 3EDFA 3NIDF 3GBML 4MXVE 1NEZG 1IEBA 4KK6D 3BP4A 3QUKA 1FZJB 2R0WH 3K2UH 1V5JA 3VRIA 4H25A 1URLA 1UEMA 2QR0A 4M6AA 3UZQA 2DWDA 4G43A 1HXYB 5HYSB 2A9NL 1A2YA 3F5WB 4KHTH 4ODVH 4HUXA 1KIQB 4RMWA 1FZMB 3V6OA 2DQFB 4LGPB 4EBQL 4B50A 1JP5A 2GAZA 3L3DB 4X6FA 3IDGA 1NGZA 3FO0L 5CSGA 2ILLA 5EBLB 5GZND 2AI0H 1HXMB 3I50H 3O6FC 3W0WA 5ADOL 4HH9A 2L0DA 3REWA 2HMID 4Q9QL 4CAGA 1F5WA 1FFQA 5GGSB 2CR6A 4O9HL 4J1UA 4JO2L 3VRLF 1FV1A 2UWEB 5FM5M 5B8CB 3BI9X 3WN5A 3MUGA 4HIJB 3LCYA 2FD6H 5F3BA 1NCAL 2P48B 4LSRL 5INDB 1OTUD 4OUUB 5EU4A 1BWMA 5JA9A 3GSNB 3QXAB 4XP9L 3CFJA 2QJDA 1B4JH 2WBJA 1F4HA 5KANG 5MEOA 3QUZD 3CIQA 3QEUB 4KJPC 1BD2D 2IANA 5I71B 3BUTA 4MQ7B 3VWJB 2ED9A 4XWGL 1F4XH 2D7NA 3SKMA 1G7QA 4GMSL 5FV2A 2D7OA 2FB4L 4GKNA 3QJFA 1N3NB 5JPMA 3TZVC 1F6AA 5MI0C 2NR6C 1YMMB 3UTSE 4NO2B 5C6PB 1T2JA 4JZOA 3EYFA 4L1HA 1QYGH 2EH8L 2HVKA 1YEEH 2YSSA 4N5EC 1B2WH 2R4SH 2C1PA 4X7EC 4C58B 3CMOH 5D2NC 3KG5A 5E94B 3EOTH 3H9SE 4P2QE 2FEDC 4NJ9H 4AJ0A 4GW5B 1X7QB 4Q2ZA 5IB2A 1A9EB 1CF8H 1JGVL 4UTBL 1XIWA 4OI7A 3QJHA 4X9BA 1H3PL 1P9MC 2ZUXA 4NM8H 1IM3A 5FGCE 5JQHC 1B4RA 2OQJB 3HN3A 1V8HA 2EIZB 3IFNL 1IGCL 3NABL 5BS0B 1JNHA 4OTXH 3VRIB 4PB0L 2Q8BL 2E7LA 1AC0A 1BIIA 1HQRB 1I9JL 3VD9A 1ORSB 4RGOH 4E41E 1MSPA 1OM3L 1MJJA 3RUGA 3P77B 4AEIL 5L2KA 4EN3A 4JKLA 1RUPH 1OP5H 1ZA3A 2J8UA 2R0WL 3LRGA 1BD2B 3NCJL 4ODHH 2HLFC 5HI3D 2WBJD 1J7VR 2AABH 1C16A 4OB5H 5SWSB 2FCBA 1VEOA 1K3IA 5JNYB 1G7HA 2BC4B 1KT2A 3V79C 1S78C 4HZLB 1K4CA 3S3PA 2JCCF 1UYWH 2C9AA 4MDJA 4S11A 5F9WC 1A6WL 2VDMH 4AMKH 5LQBH 3QQ3B 3JV4A 3BDYH 4XH2B 5A43C 2IPKA 5T5FH 1RD6A 1RVFH 5D7IB 4J3VA 1FCCA 4D9LH 2GI7A 4JN2B 5A2JH 2QQLH 4ZSOE 3Q6FB 3NFSH 4ODWB 3OAYH 3UTTD 4XCYA 2X70A 1UZ8A 3MQIA 1YJDL 2BSTA 4CU7A 3H42L 3IF1A 4MJ6B 2P5WB 2XWTB 2JB5L 4RFEA 5DJXB 5D1XD 1PZ5A 2AXHA 5BZWB 4A6YB 2UVEA 1Z3GH 3IU4H 3QEHA 4OZHA 2VISB 5I15H 2IALB 1CD0A 1AGDA 3C9NB 1A7PL 5KANI 5C2BL 4HDIA 4OD1H 3RWHB 5F7UA 1VKXA 2VIRB 1BD2E 3QG6A 3Q5YA 2L7JA 3MREB 1AO7A 4WHCA 5JDSA 1KENL 1MRCL 3GSNA 5I0ZA 2OP4H 3MJ6A 1RUAH 1J0ZA 3KPOA 5HGDB 4E41D 1V7NH 4HWEH 1MJ8L 5BW7A 4JM2C 2Q86B 1RUKL 2F15A 4KMTL 4M1DL 1XGTB 4KK9D 3WFHA 1F97A 1FLRL 3MV9D 3MYJA 1JV5B 4HH9B 5EH1A 1LE5A 2NY3C 2XN9B 1N0XL 1UB6A 2XZCL 2OM5A 4E41A 1H3UA 2FWOA 2CIKA 1F6AB 1LWRA 3VXRD 2COQA 4GQ9L 5GPRA 5JHLH 4MJIE 3B43A 3C60C 2ZPKH 3MXVL 3MNWA 5DJ8B 4M43L 1IKNA 5BRZD 2ARJA 3N9GL 5T1DL 4PRAB 4F37F 3BAEH 1M1SA 1TPXB 5MEPB 4BK4A 4UV4H 1NFDB 3HHRB 4OZ4A 3OB0H 4ZNCD 4ZNEA 1M6OA 1UKSA 5CZVL 5GSRB 1CK0L 4YHKL 1ZANL 1KLUB 2VC2L 3P4NA 3D18B 4Y4HD 3TYFB 4PJAF 2G2RB 4PJ9D 4K3DH 2N56A 3OR6B 2Y1VA 3S37H 3P9LB 3S36H 1V3KA 3MOBH 3WIFA 1A7NH 4LEXL 2CH8A 1MCNA 4JM4L 1UGNA 4XPGL 1MRFH 1MF2H 4NYLA 2VLMD 4NC2B 3N1FC 4G8EB 4YDVB 3VFOA 1CDBA 1RHHB 4NRYA 1XCQB 2B4CL 4GMTL 2KH2B 1FYTB 1C7TA 1BBDH 3SGDH 4OZHE 4L9LB 4LPUA 3ORJA 4MQXC 4N9OB 4L3CB 2DQUL 3GJEA 5AEAA 3UAJC 3QIWC 3KYKH 3QI9B 1S7TB 4QOKA 1VFBA 1Z0MA 2GSIB 1IM9B 1KB5H 4I2XB 1G7MB 1DQQB 4HWBL 1U92B 1CGUA 4PGCB 3HNSL 1NUGA 4FXKA 4OD3L 4N9GB 1JMZA 4JHZA 1KTKE 5D1QD 5LG1A 3UDWA 4GT7A 3ZHKA 2IBZX 3KPMB 5K93A 1F4WL 1YC8A 1P84K 4DAGL 5JW3L 3RIFK 3WJJA 4NFDA 3BIKA 1PY9A 1ZVHA 3GMOB 1AGBB 4HGMA 4X8XA 5TFSH 3FO2A 4KU1A 3EYUH 1FP5A 4KK5D 1KN4H 1E28B 1T1XB 5DZLA 3S34H 5LGHH 3QUXC 3DSFH 5IHZA 4NN7C 4M7LH 3T0EA 4KKCD 1GHFL 1U8JB 5F21B 3QFDA 4R7NA 3R0MA 3OKNB 1EUUA 3H7LA 5H94B 1EJOH 3ULVL 2V9TA 1QPXA 4RQQB 4J3OC 1U2CA 4NT6B 1NC2A 2GY5A 3W0WD 1CDYA 1FIGH 4PJEE 4Y5VC 5HI4D 4CADA 5JO5B 3MRMB 4PJFB 5HHPB 4JPVL 4HC1L 5HSFA 1OW0A 3ZDXE 4P2RA 3ZKXC 3CVIL 4J4PC 2FLRT 4HBQA 4KJQC 5ID1B 1GCFA 6CGTA 3PXJA 4LASH 4U1LB 4HMCA 1WISA 3FKUS 5IROC 4IRJA 4I1NB 2LTQB 3WO4C 4LFHG 5T3ZL 1E4KC 1J05A 5AZ2L 2AV7B 1N5AA 4M7ZB 1C5DB 5D7JA 2XTJC 2HN7A 4WNQB 2OS7A 1U95B 5CEYB 4O02L 4FQXA 1GZPA 1KJVA 3BESR 2DBLL 2G9HB 4Y4FD 3ARYA 4QY8A 4QKXB 5GZNC 1ADQH 3ARQA 4NC1E 4JFHE 3ARSA 2GJ6E 4ALAL 2X4OA 5CEZD 1S5IL 3B6SA 3ZHLA 4FFWD 5GS3A 2BDNH 3VH8G 1INEH 1DDHA 3BMWA 5F7EL 3BIKB 4PJ9C 1HCVA 4K3JH 1XH3B 5HYIA 4GG6A 4WHYH 3MNZA 2ID5A 2P8LA 5DEFB 1XIWC 3T0XA 3WFCL 3MRQA 4FQ2H 2IJ0C 1MFCH 3EO1A 4GW4B 4X4XA 2JJUA 2O5ZL 1JL8A 4GQ9H 5DZNA 2IAMC 4I0PC 3OKLA 3T8XB 1RU9L 3KPSE 2VQUA 4L9LC 5HHNA 5EB9A 5E99H 4LLUB 3VXSD 3BN3B 4KV5F 4Z7VB 4PJXE 2VITA 4Y88A 5IBTL 3AC0A 4MS8D 2XOTA 4WUKH 3KLDA 4GS7B 4CVUA 3PP3K 4Y5VB 5KW9H 1CDIA 5CWSA 2AEWA 5IHUL 3U83A 4Z77B 2O5YH 4O4YL 2OP4L 1A7QL 4L4VA 4NZRL 5C3LD 5KVDH 4MCYA 1LK2B 3MJ9A 4TVPE 4GAYA 4GXVL 3RY6A 2VDQL 3SKNB 3RI5F 4DAGH 1GGBL 4WFGE 4P0DA 5FA4B 1E6JL 5IFAL 3DX9B 3EFDL 3ARVA 4OI8A 3CK0H 2PR4H 4AM0A 2PF6A 1KLUA 4H0HB 4PJBA 5IB3A 1CE1H 4RGMB 5IOPB 3SDDD 4F8TA 3U7WH 1XGRB 5C07E 1KIRA 4JRYB 3PWVB 1CGYA 1GZQA 4NQEE 3TA3A 4H88L 1U8KA 1VSCA 5IHZB 3LN4A 4ETQA 5B21A 2DD8H 1I75A 4WI4A 1OT1A 4MJ4A 4JFZL 1QNZL 5JW4R 3EKCA 5HXMA 12E8L 1NCNA 3D0VB 3K4DA 4WUUE 5I1DB 3IKCB 1SEBB 4Z7OE 1KCVL 5DMGC 3SO3C 4OZIF 7FABL 3SCMA 4WVRA 1Q72H 1ZT1A 4C4KT 1N5AB 1V7MH 4NNXB 3T1FB 4TUJA 1G84A 3QUMA 1QHPA 3SO3B 2APXA 3D69B 1G7MA 4CJ0A 4K3DL 1GVIA 2L7UA 2PW1A 1FVEA 2NY5H 3SE9H 1PDKA 4WW2C 4YHKH 5KAQF 4HF5L 2XA8H 1JNLH 1GL4B 1U8HB 3WFDH 4GRLA 1AD9A 4ESKA 4X99B 3K4ZA 1I4FB 5B38A 5DGRA 3PL6A 3NABH 3FN0L 4PB9H 5C08E 3VA2C 5DS8B 1MPAL 2D31A 5HHNB 2CQVA 2R2BB 4EN3B 5DRXB 4G9DB 3EYOB 2J8UB 1XMWA 1ACZA 5GGSA 4LSRH 2UWEA 2OYPA 2GT9B 3S88L 2VDQH 4MSWB 3DWTA 1E0OB 5SWZD 2YMXH 4J3UA 4UT9H 5L9DL 4KQ4H 1XF2A 4NP4L 5D5MF 1YA5A 3SKOA 2ZWLT 4ZFFB 3W81A 2CPCA 5I1EH 4L4VB 3BRDA 43C9B 5SV4A 1Y0LA 2PTTB 4DUXA 3RGVA 3SDXB 1H8SA 2Q6WA 4PJDB 5T1MA 1YECL 2DICA 1MPAH 2NY3D 2F74A 2PO6A 3GI9L 2YMXL 2YUZA 1BFTA 1WFOA 3RU8H 4JGMA 5DQJB 4APQD 3HE6C 4F57H 2NY3B 5FXCH 2CMRL 4X6BB 2MQ0A 5F9JB 2RJMA 2BCKA 5IOPA 4FQ1H 3SJVB 2ZCLH 3PHQA 4XBPA 1N2RB 2CXKA 2YSSB 1N6QH 1TNMA 5E8NB 2XNAA 4L8SA 3GJFB 4JFED 4LCYA 4FNLL 2AV7A 4AEHL 3MRRB 3BHBB 2E8ZA 4LGSB 3PHOB 5B4MC 4HLJA 1JJUA 4PR5B 3D85A 4WTZG 3V4UH 1OPGL 4LSQH 3HG1A 4EVNA 5DC0A 1WWWX 4LRIA 1DEDA 1QBAA 3BUYA 1IAIL 4L3ED 4Y5VA 4ORGA 5ILTH 1HILB 1DVFD 3CX2A 4KXZH 3MRFB 1CZ8L 4LIQH 4G3YL 3CDYA 1KCVH 2X2YA 3EOYG 1R3JA 5GGVY 5DK0A 3AVEA 1F90H 2WBWB 1MJJB 2DJ4A 3WBDA 3U7AA 4MXQD 2F58L 2VLRB 4JFYB 1CE1L 1OLLA 3T0EC 3HB3C 1KNOB 4W4NA 3WDIA 1TJHL 3BGFB 3MUZ1 3RNQB 5LBSH 1TQCC 2B20A 3PIQB 1GC1C 3EFDH 2EXYC 4PJHE 2D31B 2XFXB 4K94C 1VEMA 4EXPX 1RZ8B 3HPJB 2A9MH 3CPLA 3VI3F 4F57L 5IFHL 2M26A 5I75C 2C3XA 1A7QH 4NZRH 3NZHH 1B88A 1PKQE 1FYHB 4JB9L 2DQHH 4BFEA 5B39A 3O9WA 5JTWA 2HT2D 4I0PB 3OAZH 3VE0B 1GGBH 5IFAH 3PQYD 3PNWA 4WEBH 1CLZH 3FOMB 3FRUA 1A22B 1TNNA 4YBQD 3LKPB 4LOUC 4IMKC 4O4YH 1FIGL 2W60A 5DURD 2WZPD 3TLRA 1NC2D 5IF0A 1IGFL 3BP6A 4NWUL 3C6SB 3U30C 4WO4B 5EWIL 1HKLH 2GCYA