1QNZH

Nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYSDDTNYNEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHYGSAYAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 0.5B ANTIBODY (HEAVY CHAIN)
publication title NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qnzH00
1CDYA 4PB0L 4KFZC 5ID0A 1WEJL 4HS8H 1YMMB 1O7SA 1RUPH 2WP3O 3FQTB 4KQ3H 5GXBB 3VDBA 2EDTA 3QUKB 2ED8A 2DLFH 1IKFH 3H9SD 3PWPB 4O9HH 3S36X 1JV5B 3PGDA 5GGTL 1EBPA 1UG9A 1BVLA 1XT5A 4P5TC 3P77B 1MCPH 1GOHA 5JOEA 3K8KA 2VUYA 3OR6A 4AENA 4DWHA 4ODTL 4XGZB 3RAJL 3MYZA 1H3VA 1GPOL 3MLZH 1U3JA 3UO1L 1GYAA 3RZCB 3KYOA 1I7RA 4MJIE 4LDOB 5F89B 5JNYB 1U8KB 3W0WB 3VWJC 2X7LA 4F7TA 2GSGB 4PRPA 5DEFA 1OSPH 3LAFA 4I5BA 3WFBL 5IMLB 3QB7C 3WLBB 2C4XA 2FGWH 2BNRB 4CMMB 4TVPE 5E6IB 1YYML 4I3SL 1J0YA 4H1LA 4GAJL 1I9EA 5EIVA 2FLRT 3DX8B 1N5AA 1B88A 1FGVL 3P30H 1LGVA 1RZIA 2YSSB 3MQIA 2GJ6A 4KRPB 3KHQA 3HB3C 4RWYL 2RB8A 3LH2H 3EFDL 1YQVL 3OV6A 1NEZB 4QRRA 3QP3A 4YIQA 5C07D 5L2KA 3FRUA 2VH5L 1NUFA 5J8OA 3DLQR 4FG6C 1CIUA 1U8HB 1H0DB 2WBKA 1AE6L 1RFDH 3B9DA 3NCYP 3LKOA 1QBMH 1QYGH 3LKQA 3FOMA 4O2CB 2VDQL 3OR7B 4A6YB 4NKQB 3C6LD 4C57C 4J4PC 4NQDD 3PDOB 3GO1L 4OQTH 3QUMB 2ZUSA 1WZ1H 3V6OC 2FJHB 1T5XA 2QLVB 5IW1A 2DQDL 3ZO0A 3LB6C 3MV9A 4LLYA 3UTQA 5B4MC 3VMNA 5GJTH 1WIOA 4P5TB 2XZQL 4TUJB 5LGKA 5DEGB 4IMLB 5DK2A 1T66C 5D8JH 5FYKH 3LCYA 3O3AB 1OGAB 2HTLD 3AM8C 3LQZB 5L6YL 4U1MA 5E56A 4XX1E 2FGZA 2VE6B 5SWZD 3DRQB 2CR3A 2FX7L 3VWJB 5HHVL 1GHFH 3QQ9C 4UTBH 1NC2B 3GK8L 2YPLB 4XMLL 4PJXB 4XXDA 5DRWB 3TZVD 1VPOH 3QSKB 4NT6B 4P46C 4X4ZA 3HMXA 3QEUA 3IFLL 3NVQA 4O02L 4HK0A 1OD9A 1NFDA 1S7SA 3GKWH 5GS0C 1QFOA 5JQ6L 4YXHH 4L1HA 1BREA 1Q0YL 1XFPA 1GGCH 4P9ML 4LSVL 3REVA 1A6AB 5DT1H 2CJUL 3FONB 2BOCA 4NCDA 5I1GH 2CQVA 3EGSB 5CZKA 1H3PL 1TIUA 3QRGL 3FL7A 5J1TC 1T2XA 3SE3C 3SJVA 4W6YB 5IV2B 1ZVSA 1U91A 5MHSE 2UV3A 2AV7A 1EEZA 1A6VL 4MD5A 1QFUL 2D7TL 1T21A 4QYOA 3MREA 4B50A 3CFBA 4Z7WF 2EKSA 2GTZB 1DBAL 3HC3L 3SKUD 1A9EB 1HZHL 4WU7B 3HI1A 1OPGL 2XTJE 3KPSA 2FATH 4LSRL 3AU1B 1KN4H 5DJDB 1FGNL 3ARED 5E99L 4U6VH 4CRPA 1EFXA 2PCPB 1HIML 5IF0B 1BWWA 4R7DB 2ZUYA 2R29H 1BVKA 2CDEB 1O0VA 1RJYB 3OAUL 4Q9CA 3X13A 5KVDL 1OTTC 1UH4A 5D2LF 1ES0A 3OKLB 3RTQD 1YEJL 2BMKA 4WUKH 3WJJC 4GO6B 3DUSA 4HC1H 2Y7QB 4B7LA 2FO1A 4XVTH 4KMTH 5E8EB 3A6CH 2FWOB 5EU6E 4JO3H 5KVFL 5K9JH 2CK0L 1RUKH 4WWID 2P48B 4G43B 4OFKA 2PW2A 3LPWA 4IDLA 3SE8H 4P57B 3X17A 4P46B 4S1DD 1BGXH 3FQUB 4PJ9A 3JV5A 4ZAKC 3ZKMD 1TJGL 3HZKB 3RNKA 1KF9B 1JMXA 1V7ML 1JGVL 4N5ED 2Y5TB 4WCYH 3MGTA 4RFOL 3SDXA 4U1HA 3G5ZA 4HBCH 1RULH 3V7AG 4LSPL 4BFBD 4W6XB 1A22B 5DMIH 4K3DH 5D7LB 3PWNB 1G6RL 1LP9F 2BVYA 3FB7B 5MEOA 3UYPA 3RFZC 3B2VL 5GGRA 3QH3A 2O5ZH 4NQEB 2Z92B 3D9AH 5SV3A 4MWFA 3S34L 2YA1A 2OTUA 4AIOA 5GGQH 4ZNEA 3W2DL 1HILA 2PNDA 4APQA 4CKVX 2UVFA 4YPGA 4PRPE 1CFTA 4WRLA 4QXWA 4POYA 4X9IA 3QFDB 3QUXD 3TIDB 5IFJA 1DZBA 3QIBD 3T3MF 3Q3GA 2OP4L 5E2WL 3VI4F 5JPMA 2HT4D 3CFIC 1UM6H 3OPZL 4UILL 1WFOA 5DMYA 3H42L 4TOYH 3LOWA 3GHEL 5DRNB 4ZFGL 3DV4B 1XGYH 4OFVA 2GJ6E 5BO1L 3G08A 1BIIB 4RGND 3VGBA 3E6HB 4GXUM 4HWEL 2M1KA 1TCMA 1U95B 3IKCA 3L7FA 4K9EH 4NRZB 4QRRE 3OKEA 5L2KE 3AY4C 4OFIA 3ZDXF 3CSGA 4Q9BA 2HTKD 2X70B 3LPGA 5EWIL 3VXMD 3WL9B 1WQVT 4L8DA 4EI5D 3LRGA 4L4TA 4N1EA 5DHVA 5HI4D 5HYIA 4YHNA 4O4YL 5F21B 4GMTH 8FABB 2VKWA 1U58A 1U3ZA 1B0GB 3NPZB 3QO1A 2IH1B 1TVBB 3HI5H 3HNTH 4RFNC 1TZGH 3LKNA 3X12A 2FZ3B 2ZKHH 4ZAKB 1SMOA 3FHAA 2ARJQ 2A0LD 4PBVC 3UTSA 4KKCD 1EHXA 3KJ6L 4U1GC 1FHGA 1E4KA 3ABZA 4UT6L 2HYMA 2IBGA 5FA3A 1A6UH 3SE9L 2R4RL 1BD2B 4XBGB 3MRRA 5FYJE 2EXYC 3KLAA 4CADA 4L4VA 4X7SH 3N50A 1NC4D 3FQXB 5JDSB 1LQSR 4OZIA 1MRDH 4NBXB 4TSBL 5KSAA 4D0CB 1GSMA 4Z9KB 3O2DL 5IBTH 4WHTA 1DSFL 4ODBD 1KB5H 2JIXD 2F5AH 1D5IL 4YE4H 2R2BB 3FOLA 3PJSA 5JHLL 4S11A 3D0LB 1YEDA 2VIRA 5DF0A 2A6DB 3HHRB 1A1OA 1R3KB 3MUGB 3IDNB 1IAOA 4NKOB 4RRPG 1NFDE 3DX7A 2I27N 3WO4C 4H20L 2NXZD 3FB6B 1ITBB 5CHNB 3MV8A 1DTUA 2NY0C 1XGQA 4NM4L 1KB9K 5C09B 4HS3A 3MROA 5I1LA 3EBAA 4H26B 4OZFA 1QFWH 3SJVE 3TN0A 1XAUA 2ID5A 4WHDA 3S37L 1UWEL 1TTGA 5GS2D 2IEPA 5T1MB 5E00A 3D18A 2BXZA 4I13B 4ELMB 3RWHB 5FECB 2MCG1 2P1YA 4NO2A 2R1WB 1ADQH 1OAQH 1KYOJ 1UZ6F 2OTPA 2VDOH 4NP4L 4WV1C 5DJXB 5A40E 4LP5A 5CP7A 4KDWA 1D9KC 2VITA 3I02B 1X9QA 1IBGH 1TQCC 4JFOA 3KPSE 4RFNB 4HG4K 1DFBH 1MHEB 5DJ0B 3VFGL 1G7MB 2VQUA 1RUQH 1GAFH 5I1AA 1LILA 2WUBH 3GSWB 4OCXL 2CK2A 5EZJB 4U1GB 1BLNA 5F1SA 1WBZA 3V4PH 4C83A 4FRWA 1CLZH 1B9ZA 4QLRA 2YK1H 2O61A 2YMXH 4YC2C 1K5NA 1WCBA 5T1LA 4IRSA 3RWCA 1N6QH 1AJ7L 2YPKA 3JVGC 1Z9LA 4KZDL 3D85D 3TJEH 2A6KA 3MJ8A 2CD0A 2CRMA 5E9DB 2NY7L 5AAWA 3V5DB 1I1YB 4BFEA 4L5FL 3VE0A 3TLRA 1N5YL 5EN2A 4M7LL 2XY1A 5DLML 1S7WB 1RHFA 2X4UA 4KVNL 4NQSB 2GW5A 1FP5A 3N85L 5IKCB 3WIHH 1JYWA 1KN2L 3WO4B 1TZIA 4R0LC 3FZUD 3GJEB 4GMSL 3C5ZA 3IDMB 1Z9MA 4P9HH 3S5LG 4HHAB 2NY0B 3SDXE 2JJSC 1AFVH 3MNZB 4Z78A 5HYSA 3ZE1E 3Q6GL 3ILQC 4Q9QH 5DMJB 3UTOA 3GSQA 3GRWH 3L5XL 1AO7A 1UXSA 3HMWH 3KPPB 5BJTB 1ZA3B 3OXSA 4WO4C 1AGEA 1XR9B 2PXYC 4WHYG 3S96A 3DSFL 1NDGB 2YD3A 4ZNEE 5C0JB 1SBSL 2NTSP 4XPFH 4K8RL 1CFSB 3HFML 2J88L 4QHNA 4OFPA 5DVLA 5E8OA 1KIRB 3QHZH 1TQCB 1J88A 2XZCL 5EU5A 2QV2A 5L2KD 5FUOH 4WFED 1OQOA 2EDRA 1YMHB 3LEYL 4XCYA 4PRHA 4Z18A 4MJ5B 1ED3A 1BFSA 3D5OF 4MNQA 2FHCA 4NO3B 3DXAB 5DGRA 3UCRA 1NLBL 2OJEA 4YC2B 3NCJH 3RKPA 1H3GA 3N0PB 2Y36H 4H88H 4XC3L 2AI0L 4FQHB 1A7QL 3MLXH 4CVZA 1G0YR 2C1OA 2ZCKL 3T08A 5IW6B 4BSWB 4NPYA 4P2OD 5SWSD 3DO7A 5HGDA 3MV9D 4X0KA 2LQRA 3O3EB 4HS6A 4EDWL 1IGIL 1CICD 3O3DB 4KROC 2VERN 5H35B 3NCMA 3JTSB 2X4TA 5D7IF 4L4TE 3LMJH 5ABDE 3L5IA 3BMWA 1A1MA 3EOAB 1QLFB 3VFTA 2FRGP 3PUCA 4R0LB 2MOVA 5E2JA 4H0HB 3V2AR 2GAZA 5DSCB 1BMGA 3UTSE 3BX7C 1EJOH 3TBYA 3GSNB 3WEXB 1OWRM 15C8L 2CO7B 3T0EB 1X5IA 1F45A 4D8PB 4OTXL 4L4VE 4JANA 5JIHA 3VFVB 5T1DH 3VFUB 4OZIE 4WO4B 3RWEA 2PXYB 4KDTA 4Y4HD 3ZTJH 1XF4B 5BCAA 1A6TB 2PR4L 1ZVHA 3UC0L 1CD9B 3U2SA 1RUAH 2P8LB 3QEQB 4X98B 5IMOB 5IQ9B 3RX8A 4R26L 5J6HA 5I15H 3T1WA 1FVDB 5AWNH 3TNMB 1IL1A 3GUTA 2YWYA 4OCYH 4LRIC 5I0DA 4JG0L 4LQFH 4YO0B 3TESA 2DBLH 5E2TL 3D39B 5EOQL 1WAAF 4JFDD 2AJXL 3WUWA 2MSPA 3VGEA 3CSYB 5F1NA 1A02N 1LEKB 3BZEA 3JXAA 4J2XA 3GMRA 2DQEH 3RVUD 1VB9A 2VL4A 4F2MB 3MV8E 2DTMH 4MXWH 1DQQA 1FL3A 1IE5A 5ICXA 1I8LA 4I8DA 3BEVB 1RHHA 1RZJL 3R1GH 1NANI 2OBGA 2BVQB 2JKXA 4ZUWB 2I9TA 4MYWB 5IK3B 4Z7NE 4HUXA 1HHIA 1D6VH 3O2VL 5BMFH 1CLOH 1NSNH 4KROB 4F15C 2NW2B 2JJWA 1A7OL 3FFCB 5DEZA 3U4BL 3MV01 1BJ1H 4EN3C 5JMOC 3IDJB 4P3WA 4N1CA 4FXGB 5JLZB 2VQ1A 2R9HD 3DMMA 3S35H 3QYCA 3JWDC 2DYPA 4KK5C 4DW2H 5BRZD 4YUEL 4HFWB 2BK8A 3RGVA 5HHPA 4JDZA 4FQLH 3CVIL 4GKNA 3L3JA 4W4OC 3ES6A 3G5VB 5E7FA 3O2WL 1FDLH 3NA9L 4WFHD 4PJ7F 1KFAL 1G9NH 5FF6A 1SYSA 2YC1A 5CCKL 4L4JA 5JW4Q 1FAKT 4FP8H 3O6LL 1AGBB 4JN2A 4OCSH 3MXWH 1JTPA 1R3LB 5IROC 1ZS8B 4UZGA 3VFNA 5AYQA 5LXGL 3M8OL 3RY6C 3UTZA 4KXZH 2J6EL 2HN7A 4ETQB 4XNMB 5CJ5A 4TYUA 4X5XB 3EO9H 1UH3A 5IFHL 1NFDF 4F57H 4Y8DC 4XWGL 2VAJA 3LSOB 3EJZC 3GSVA 5INCA 2CDGB 1MI5B 2I60L 1R3IL 4L9LA 5B38B 1FZMB 3G6DH 3PXHA 1BFVL 2AVGA 1LVEA 4UIMA 5DA4A 4AT6B 5FB8B 1RUMH 1VENA 1YNLL 4LIQL 4DVBA 4U31A 1FIEA 4RGOL 2LU7A 4I0PC 1KLGA 3ARWA 3VXSD 4NKDB 4JY5H 1KUMA 3OKDB 3IVKB 1MREH 1AO7E 4MA3B 4GLRH 1D5BA 3WN5A 4YDLC 4KRMB 3O45A 4BFIA 4DZ8B 5EORH 1YYLH 3T3PE 4RAHA 5IVXF 4PGJA 4PTTB 4ERSL 4JAMA 4GRLA 1KENH 3VXNB 4F15B 1VFAA 5C9KA 4PGCA 4Z7VA 4NUJB 3HPJB 3SBWC 2OL3B 4EN3B 5DI8A 3QRFM 2ZUUA 1SHMA 3EHBD 1MCWM 1KPUB 1FFRA 3LS5H 4YGVB 3DETC 4XP5L 1XR8B 1TVHA 4LPXA 3GI8H 4PRHE 5F1IB 3W5NA 1BEYH 4Y7MA 4MNQE 4EZMA 4FQ1H 43CAA 2W0FA 1ZLUK 4LASH 2IPUK 5J3HC 4EI6B 5BXFB 1CS6A 2AJ3A 4PJ5A 5IB1B 5DJYB 2YUWA 2OYPA 3J8F7 4MA8H 5J1AB 5F88A 2H32H 5KSUA 4J3XA 4LLVB 5BOPA 5HHQB 3EYFB 2MWCA 4M61B 4JY6B 1XZ0B 1A5FL 4NHCL 1TXKA 3TYFA 2ZNWA 1FFNA 4PG2C 2FX9H 5FKPA 5E4IA 2MCPL 5E6YA 1AXSB 1CG9B 3OXRA 1ZGLM 1HI6A 5CSGA 5HD8D 3MZTA 4M1CD 1F3JA 3G6JF 3U0TA 5IM7B 4Y1AD 4OLYL 3GI9H 2HVKA 2XWJB 3ZE1F 5LGJB 4J12A 4JZJC 3WFDH 1A6WL 4ZSOE 2MMXA 4OD2B 4NJ9L 5TE6L 5FO9A 5A1AA 2VISA 4PJAF 4I0PB 5ESAB 4XB7A 1RIVL 4YDVB 1NAMA 2O5YH 1DN0A 3CFCH 3DX6A 2HG5B 1I1AA 3UTTB 5EO1A 4XP6L 3NTCL 1NCAH 3TH2T 4AH2A 2BDNH 4JFXA 1J0ZA 4ZUSB 3TJHD 4YDLB 3L3DB 2QQKH 4CMHC 1QFPA 2NY5L 1INQB 2OJZL 4KJQD 5H2BB 4OV5A 5D7SH 3MV8D 2ZUTA 1AC0A 4P4RB 4HMEA 4Y0GA 4OD3H 1YY8A 1WTLA 3CFKA 3QBTB 3PHQA 4JFEA 2BVUA 5IIEB 1EUUA 5C8JB 3IJHA 5IHZB 3TN0D 1QR1A 1JFQH 1NCTA 2P5WD 2DQGL 2HRPH 1HEZA 3FAXA 3NFSL 5HYJD 2IADB 2YD8A 5E8PB 4KI1A 3CVHB 2J5LB 1OOAA 2RBLA 3BKCH 3LN4A 1FO0A 1NCDL 1GXEA 4G80A 1CLYL 2GUOB 5F7DB 5E4EB 1DEEA 4JO4L 5EZIH 5CILH 2V9TA 3IXAA 1AI1H 1I1RA 1A3RL 4P2QA 2V17H 3W9EA 4PJFA 3QQ3A 3RZWA 3SDDD 4PGEA 1T3FB 3C5SB 5DC4B 3K7UA 2DI7A 2YXMA 5T1LD 2XZAH 2CUMA 4U1IB 2H9GA 3RGHA 2BFVL 5DZOA 2CRYA 3PWLB 1UM5H 4XCCH 3AAZA 5AZEL 4N8VA 3FTGB 4OUUA 2CKBA 1QSFD 2WMPA 3RPIA 3ULUF 3EOBA 2HFEB 1J10A 3GNML 2E7LA 4P48A 4XBEL 1EZVY 2IANA 4LNVA 4XPHH 5EFIB 3B9AA 4JHAL 1MVUA 3EZJB 2Z9TA 3DRTB 4PJIA 2HP4A 4R90L 2RFXA 1QKZH 3K2UL 1A7RL 2WUCH 4CMHB 3V95A 5DJ8B 3SGDI 4D3CH 3C5ZD 5CBAB 4OD1L 5F7NC 2YKLL 1WWAX 1D3CA 3QULA 2R1YA 3H9SB 3D6GA 5C86A 2NNAB 5F8QC 1ORQA 4YWGH 2V7NA 4ODUA 1G7JB 4PJEF 2G75A 1QPPA 3WXVL 4TSCH 5AD0B 4LNRA 4JGJA 4QNPF 2EIDA 1LD9B 5C0CD 1NGXB 1P2CB 2HTLC 2XV6B 3VW3H 2B2XL 1K8IB 2O5XL 1N3NA 4OKVB 3GGWA 2FH6A 3HZMB 5L8LB 2R1XB 1U8OA 2EDBA 4XCEB 3BHBB 4CUCA 1JIBA 1ORSA 1PZ5B 3S35X 4HZLA 4G42A 4E41D 3TZVC 4S0SD 4G6JH 4BZ2L 1IT9H 3GBNL 4PRHD 4QXTA 5L2JB 1YDPA 1OTUD 2W65B 3WFZA 3D3VA 3CK0L 1F6AA 5DQJA 2GQHA 1F3DH 3ARRA 2X4SB 4Z7VE 3MJ9L 4P5KB 5SWQA 3RI5F 5DD5L 5CP3H 3PABA 1KLUB 3PP4H 1JWSB 2NY2D 1T22A 5IVNA 4H8WL 3K80A 1IVLA 3TCLA 3I2CH 2X41A 5C71A 5DK0B 4E0RB 3O6MH 1IFHL 2DD8H 3KYMB 4OZHB 2AW2A 4WU5B 1FFOA 5C0DB 1F2XK 4LHUD 5BZDB 1MF2H 4HLJA 4LSUL 2BZDA 4KK9C 4PJ5E 2PTTB 5TGBA 3QFJB 3L3IB 3LKPA 2C1PB 3C6LB 4N0FB 2VC2H 4WWKD 1J05A 4OGAD 3W5MA 3OB0H 4X6CF 2R0ZH 3ZLQC 5FA4A 5HJ3B 5E8NB 4K7PY 3AREC 3TBVB 5E5UB 4R3SB 4D0BA 3L3HB 3I6KA 1QQDB 4KH2A 4OZ4B 3VG0L 4OQTA 4DZBB 4Q9RL 1XEDA 2BVTA 1HH9A 3TT1L 3NCCB 5EZLB 2QHRH 3QISA 1AGCB 3A0OA 3O6FD 2D4DA 5T5NG 1CE6A 5EBMA 3QCTL 2X1OA 1T0MB 5FHBH 3GSUB 5TDPB 1R0AH 2MKWA 4HUVB 3TZVB 5HYFA 4QXGH 2GT9B 3B6SB 4PJHB 3RWFA 1REIA 4GSDL 4S1DC 2XPGB 1DQJA 2DLGA 2W0LA 4C56A 3H9HA 5HHXH 4HJGB 4EUPB 1GCFA 4OM0H 2BNUB 5JW5B 3ARDA 4K8RD 1NCNA 4N5EC 1KCVH 4JFEE 1T83A 1E6JH 1M7IB 3FQRA 2J7LA 4LKXA 4U2ZA 2DLEA 4XVSL 3IU4H 4KMLB 4WJ5B 1BBDL 3N1FC 3HUJA 3BH9A 3Q1SH 2A77L 3QNXA 1IZKA 4ZYKA 1UCBL 4LSSL 4I2XB 3EDJA 4M02A 4J1UA 1S5IL 2B4CH 5GISL 2IMMA 1I8MA 1F4XH 3DBXB 2DL9A 5F97E 5I8OH 2P43B 3DMMD 2WANA 3QUXC 3QIBC 4K23H 4NZTH 1XCTB 1ODAA 1IGCL 5GRZA 5MEQB 1FFPB 3CAFA 4P2QE 4PJFE 1IC5H 3AREB 1LE9A 2E9JA 3SHSA 2B0SH 2ILLA 3V4UH 1I8KA 4XP4L 1X4YA 4LCIH 4RGNC 1BX2B 2YPVH 1JZ8A 1GC1C 5AAMA 4XNUL 2P42B 1CFQA 4OUOA 3CZFA 4G7YH 3G9VA 3RTQB 1IC7L 3PP3H 1MLBB 2V9QA 3ULVH 1M05A 5LBSH 2GITB 5CJXA 4RNRB 1UQSA 1NGPL 1A8JH 2IANE 3F58H 4M6ML 1UB5B 3AUVA 4J3VA 4EI5C 3TCXA 5BVJB 4JZNB 1MSPA 3T1FA 1Q94A 4KGLA 1W0VA 4JM2A 5HI4C 1QO3B 4GMTL 3JV4B 2C9AA 3NN8A 1QSEA 4P59L 1EO8L 4QY8B 4QEGA 4Z7OE 2J8UB 4LU5L 3B3IB 5A2FA 4HC1A 3IFOB 5EU4A 2VR4A 5I8CA 2A0LC 2DQUH 5C0IA 2YRZA 3W82A 4F7MB 4KKCC 1ZT1A 2D4FA 4P3DB 2XA8H 4HIHB 5DHYA 1S9KC 1A2YA 1PYWA 1S9VB 4MS8D 5F9AC 1F58H 4JKPL 1PY4A 3H7BA 3VFWB 2UYLA 2IC2A 5TH2A 1FLRH 1GH7A 4K7FB 1KTDA 3MRJA 4EDXB 1D5XA 4XP1H 1N8ZA 1MCQA 3IJSB 1OVZA 4F80A 1NL0H 2VLLA 2FBOJ 3B5GA 4G6AD 4NSKB 2AJYL 3AC0A 3MV7D 3O0RL 2JLLA 3SO3B 5FEBA 2L7JA 4MJ6B 4LHUG 1PKQB 3DV6A 3QUXB 3GBML 5LCVL 4E9LA 3QIBB 2L4OA 4BA8A 1CT8A 2KDGA 2CIKB 3S5LB 3OF6A 1CWVA 2YEZA 3WNKA 4NKMB 3FJTA 4G7VH 25C8L 4GLRI 3D3VE 3E6FA 5L88H 1R3JA 2APWA 2NXZC 5EC2B 1K4DB 3VFPA 2ARJA 4L3EA 2BSSB 5MI0C 4XHQA 2VDPL 1QSVA 4RGNB 3BUYA 3EYUH 4M93C 5JXAH 1WBYA 4YXLH 3LEXB 3VDCA 4ZPTB 4Z7QF 3OKNB 1BQHG 3EDDA 4XNYL 5IB4A 5HPOA 1A6PA 2F15A 1F6LL 2QSTA 2WK2A 2F19H 3IFPA 4EVNB 3VGGA 1BVZA 4U1KA 1N2RA 3VXMB 1U0QA 2APVA 4LSTL 3C5JB 3MRHA 4UQ3A 3ROOA 3REWB 3WHXB 4JDTH 4EI5B 2XG5A 1WF5A 1S9XB 4D2NA 3LHPL 3RVVD 1RJZA 4M7ZC 4BM7A 1BM3L 3C9NB 4KTEH 1ACYL 1RK1B 4X4YA 3VXUA 3EDKA 3PE9A 4QF1A 4IJ3C 5EOCJ 4QGYA 1A7PH 4NZRH 1FL5A 5CEXB 3IFNH 3WUWG 3ZKXC 1KT2A 2IQAB 2FD6L 3KLSA 4KVCH 2E9IA 3BP6A 3TGXA 2DS4A 1F3RB 1G9ML 3MCLH 2VKXA 4MA1C 2YRPA 3B8SA 5IQ7L 1FPTH 3UYRH 1DUYB 2IFFL 2Z93A 1P6AB 4NDMB 4OGXH 5FV1L 5C70A 1NC4B 5GPRA 5T3XE 4K7PL 5TDNB 2IPUG 4XMPH 5CWSB 4IOIB 1P9MA 4IRZH 3MO1A 4G5ZH 3G5YA 2JIXB 3I50H 3MBXH 2JF1A 5I0ZA 1INDH 3ZTNH 1QBAA 1RIUH 2JK5B 3BGMB 2Q6WA 2FEDC 2H2PD 1KJVB 3V0VB 5FYKE 4M7JH 1DP0A 1XIWA 5E6ZA 1OW0A 5E8DH 4C56E 4XVUD 3FZUC 2NXZB 4M6AA 1C5BL 3ULUL 2I26N 1KB5A 4PJDF 5MI0B 3RL1B 1FIGH 2Y07L 4RAUB 5F96L 3ZZ1A 1XF2A 4M93B 4N8CH 2FJGA 1JZ5A 3GRWL 2CR6A 3A67L 5D70H 3U79A 4KRLB 1AXTL 3ROLB 7FABL 3KVQA 4P2QD 5MENA 4JLRB 2OXHA 3HUJE 3MJGX 1JPST 3KGRA 5C9JA 4B5EA 3LRSB 4LLWB 2EH8L 3UJTH 4M7ZB 4O2EA 4KKLC 3V6ZA 1MEXL 4IJ3B 4HQQH 5FCSH 4L8SA 1CDGA 1MCSA 3QEGL 3U6RA 1P7HL 3KDMA 2QADC 3OX8B 3ZKXB 4QRSA 2HT2D 3ARPA 3BKJL 3LKRB 2IAND 2RR3A 4WEUD 3EDFA 4XXCA 5DFVD 1ADQA 2A6IB 5B39B 4MA1B 1C5CL 3KS0H 5DQDH 3QDMD 1W72H 4ALAL 1CXHA 5LAXA 4UTAH 3IETB 1RI8A 1SY6H 3D85B 1CGYA 4EJ1C 4KJPD 5ID0B 4WI3A 3TFKC 1W0WA 4PGZA 1KPVB 3E8UL 2DI8A 1NCUA 3DVNB 1JYXA 5A3ID 3PWPA 4OLUH 1JV5A 5A2JH 2F53D 3NIGE 3WS3A 1VEMA 5IT2L 2ZUQC 3P77A 3DYPA 2BRRL 1HSAA 4I9WD 4OZGA 4AENB 3X3GH 4Z95L 5C0RH 1ZKAA 1A4KA 1QSEE 4XGZA 4JFPA 2X4PB 1OAZL 4XH2A 3TBWA 2Y4SA 2WQRA 2E7BA 5I1JL 4PLNC 1LDPH 3FHQA 1OAUL 2X7LB 4F7TB 3FMGH 2CSPA 2FR4A 2DM3A 5DEFB 2VLJD 2GSGA 2FO4A 1YEFH 3S3SA 4GRWH 1MNUL 4H1LB 5BS0A 1JZ7A 3WIHA 3LY6A 3MODH 4G6KH 3KPTA 2E7MA 1U36A 1RZIB 3EYOA 1IGMH 3T2NL 4PJFF 4DVRL 4TNWF 1OL0A 3KLHC 5L2KB 1IAKA 3FRUB 2C4FU 4ZTPH 4HAFA 2QADB 1EGJL 4LVHC 1FNLA 2Q76B 2ZCLL 3WNMA 2JB5H 4C4KO 2C3WA 3RVUC 3LKOB 4L3EE 4XPGL 2A83B 3FOMB 3RDTD 4DK6A 3F5WB 1FNSH 5I8KH 4O2CA 1TNMA 4FQJL 5LWYL 3OR7A 4S10A 1QD0A 4A6YA 3PDOA 5I74B 4G6ML 1QUNA 4X7DC 5ADPH 1ZK9A 4NBYB 2A74A 5HGAA 2G5BB 5IW1B 1DBML 1KCRH 2FJHA 3M17A 1MCNA 3MV9B 3UTQB 4MB4A 2N1KA 5JXED 4IDJL 3TBTB 1MCOH 4N9GA 2XNAB 4Z7OF 4KZEH 4OLXL 5DK2B 5CLTA 2YBRA 5EOCH 3B5HA 5DEGA 3MACL 2ZUQB 4M1GH 5D7KE 4ONFL 5I1CL 1QBLH 3VXUE 2VXTH 4U1MB 3O3AA 1OGAA 3LQZA 3PDGA 2KBGA 2VE6A 2D03H 3WDIA 2FBJL 3BAEL 1I8IB 5F1OB 3QQNA 1RZ8A 4HXBL 1UADC 1NC2A 4MMZC 2YPLA 5DUMH 2YR3A 4XXDB 4PJXA 5F7HA 5DRWA 5B22A 1MHPL 1CXLA 5FYKD 4NT6A 2WIMA 3QEUB 1BHGA 5HDBF 4PJ9C 1DUZB 4KKBD 2GSIB 4C56D 1LDSA 1YEHL 5HI5D 1ROWA 4Y4HB 2I9LA 2NX5A 2BNQA 4FFZL 1I85A 1A6AA 1AQKL 3FONA 2BOCB 3MRQA 4M5YL 2LU3A 3QO0B 4A2MA 1XF3A 2ZCHH 4JFDB 2D9CA 1B0WA 1U9KA 3TH4T 3IRPX 1E6OH 1R5VB 3IXTB 4PB9L 1ZVSB 2XKNA 3MJ6A 3ARVA 4M1DH 4LVHB 1A1NB 1LO3H 2AV7B 1EEZB 4NJAL 3QUZA 1XCQA 5GRWA 1T21B 2Q8BL 3MREB 4QYOB 4RX4D 3AROA 1CDIA 3S3PA 3CFBB 4APQC 4L8BA 4JEGB 5K9KA 4Z7UA 4BZ1H 4UDUA 1P5UA 1QLEL 3KPNA 4U1LB 4AQOA 1UB6B 5EA0L 3INUH 3G5XB 1ZANL 1PJ9A 4EOWL 1JYNA 2OMBA 3BSZH 5MENE 3AU1A 2KL6A 5DJDA 1ZGLB 3DSNA 1HNFA 4TNVF 2PCPA 4JO1L 3DIFA 3QWQB 1NGQH 2E3VA 1CXFA 3X13B 4R4ND 2BSTA 1I7UA 3AM8A 3EHBC 3LN5A 5T3ZL 3ZYJA 2J4WH 3DUSB 1ZHNA 2ICWB 2UWEB 2UZYB 3GI8L 2AJVH 4TPRH 2VR5A 1WWCA 1ZVYA 1UJTA 2FB4H 2JCCA 1OP9A 5J13C 2F58H 1FE8H 3PWVB 5E8EA 3U46A 1KIQB 1E27B 3K1DA 2WWMD 2PW2B 4TRPL 4TTDD 4HDIB 5SX4I 5HVFB 4ZDHA 2HJFB 4CU7A 4PJ9B 3IF1A 2X05A 4X80H 3T04D 3LQMA 1MFCL 2N7BA 4K94C 2LU4A 1NBVH 2WIIB 4XVJL 3AS0A 4YZFE 4Y2DD 5EULV 5INDB 3PHOA 1E4KC 3SDXB 3MGTB 5KANG 3WE6A 1CGUA 3PWPE 3G5ZB 3DVIA 4U1HB 1DBKH 2OK0L 1GGBH 1RVFL 2ZUXA 3PL6D 1FNEB 4ZS7H 5HD8C 4AEHH 1JHTA 4OZGE 5D7LA 5MEOB 2DMBA 5BV7C 3PWNA 4M1CC 3FB7A 3IDYC 2C3GA 5CLWA 5GGRB 3QH3B 5C7XH 1A9BA 4MWFB 5CJBA 4NQEA 1H8NA 2EYSA 5KSAC 1FBIH 4NNYB 3V5KB 1HILB 4APQB 1RSFA 4JM4L 4YPGB 1KTKE 4UI2A 2O5YL 4FNLL 1UA6L 2X4NA 3VXSB 3QFDA 3TIDA 1JJUA 1OGTB 3UPAA 2QQNL 5F9OH 2AEWA 4AG4L 3LS4L 1EEYA 3OF6D 3C8DA 1G0XA 1CDHA 5BS0E 3TJHC 4L8CA 5E2VL 1KJMA 1QNZL 1DLFH 1IM9D 3ARFA 1OM3H 3G08B 5EU7E 5I1HL 3OJMB 4OLZL 4LCCC 3IGAA 1CF8L 3E6HA 2E8ZA 3IKCB 4PJBF 1U95A 2EDYA 1RU9L 5LQBH 3UBXG 2E27L 1VKXB 3MRPA 3WFCH 4I0CC 4PTUB 2EDJA 3TN0C 2R8SL 3G6AA 2EXWD 5GHWL 4LAQH 1E28A 5IHUH 5J13B 1IGFL 3SKNA 3SOBL 4L4TB 3TYGH 2X4OA 5DHVB 2AABL 5D7KD 5IFAL 3MFFA 1NBYA 1Z2KA 2GEEA 1U58B 3UAJD 3OAYK 3QO1B 1I9JH 5I1EH 1B0GA 4N0YL 2IH1A 4U05A 3LKNB 4Q58C 4M43H 4HUMB 1DQLH 2FZ3A 5FIEA 1TJHL 4K3JH 3UTSB 4QRPA 1GZQA 4KHXH 4JM2F 2V17L 2AEPL 1YEEL 3SDDC 1MCIA 5AYUL 3I6LE 3VFRA 5FA3B 4GKZB 4IRSC 1EH9A 4CADB 1BD2A 3KLAB 3UJIL 4L4VB 5BV7B 1XH3A 3IDYB 3DHMA 1KYOK 2R0KH 4OZIB 1OGAE 5KSAB 4UNTA 3GSRA 1CVSC 4WHTB 2X40A 1JF1A 1IEBA 2EC8A 1YEKH 5KSBB 4YQXH 5GRUH 1C1EH 3FOLB 3OQ3B 4LFHD 2YPLE 1YEDB 2R2BA 3MBEA 1DBJL 1U8NB 4PJXE 4AY0A 1MCCA 1A1OB 2VDNH 3F7RA 4FFYL 1R3KA 3IDNA 2HFGH 3HNVL 5ILTL 2FECL 5E70A 4O5LL 4M7KH 1DQMH 2HAZA 4O51B 3C5ZC 4HIXH 3UZQA 3MJ7A 2NX5E 3MV8B 2BNQE 3U7YL 4PJGA 3OZ9H 3MLUL 4HS3B 4LCCB 3BIBX 5C09A 3T4YA 5JIKA 5DRXB 5EG6C 3RIFF 3QR2A 5ERWB 4OZFB 1JPTH 4P49A 5DTFA 4N0UA 1EJ6A 1UACL 3TN0B 4ESKA 5L7XH 2G60H 2Q87A 4X6DF 1YPZF 3WJLA 2PETA 2NY3C 1U3YA 4NZUH 4F7EA 5E00B 2EDWA 1CQYA 3D18B 5T1MA 4B53A 3ZYZA 5HYJB 2YD5A 1J11A 4GG8A 5D71H 1MFEH 4Z7UE 4O58L 3QNYA 5CP7B 3T2QA 2EDQA 3PWUA 4P0DA 2EYRA 5CZVL 1KJ3L 1MHEA 5DJ0A 3EJJX 3H0TA 1G7MA 4S1RH 1HQ4B 3GSWA 1ZHKB 1WBZB 3GIVA 3SDDB 2UZIL 4LRNL 4NN5C 2IGFL 1YN6A 2O61B 32C2B 2YS4A 1WCBB 5T1LB 4IRSB 2PYED 3ARTA 2Q1EA 3BGAA 4NGHL 4OIBA 2YPKB 3D0VB 1E4XH 2NY2C 5KBNC 4YK4C 3PWJA 1VA9A 1O7VA 3MCKB 5E2UH 1TETL 1S8DB 4UU9A 2VDKH 3MJ8B 1QSFB 1C16A 3Q2CA 2JCCE 1VSCA 1DL7H 2CXKA 3ARSA 1T0PB 5D5MF 5AZ2L 2NXYD 3NIDF 1I1YA 3L3OB 4MMXC 2Z8WC 3MA9L 1L7TH 5EN2B 1MCWW 3VD7A 1ZTXH 5EZOH 2X4UB 5DR5H 3ALWA 4WWKC 5IKCA 5JW3H 4U1SB 1A47A 3C2SA 1TZIB 4G9DB 4HT1H 3C5ZB 1CIDA 3GJEA 3MRGA 3V4VL 4ZUUA 5I1DA 2GCYA 4HPOL 3MXVL 3GSQB 1DANU 5ACZA 1AO7B 3F65A 5D7LE 2VDLL 3OXSB 3KYKH 4ZPVB 5C0CB 1P84J 2E7CA 4KDTC 5IUSA 4NQEE 2NY3B 1XR9A 5T5FL 1MY7A 3S96B 3ULUD 2ZPKH 2H1PL 3O6FC 5IWLA 5TE7H 3FRPA 1EMTH 2RAMA 4QHNB 4G6FD 1QHPA 1KIRA 3FAWA 4E41B 5EU5B 4AEIL 3LKSA 4PRHB 1YMHA 1LO0L 1ED3B 4MNQB 1QEWA 2W9EL 4NO3A 4NN5B 5TDOA 3BKMH 3MPCA 3TO2A 4NQXB 4JFHE 4KKAD 2B1HH 5D96C 4KI5E 1T2JA 5J7CC 2NY2B 3O4LA 4FQHA 3QHFH 4YK4B 2C1OB 4ZNCD 3RA7H 5FDYA 1FC1A 3QUYA 4XZUA 3VXQA 3L3KB 1U6AH 5IW6A 4PB0H 3MUZ1 4BSWA 1WEJH 5CD5D 5HGDB 4J3OC 3O3EA 3I6LD 4Y16A 3O3DA 4TN9A 5H35A 3NIFF 4XAWL 1JPSL 3N1MC 5CP3A 1A3LL 3R0NA 3MCG1 5EB9A 4YZFF 5J6GA 3QWOB 4YAQA 3DMMC 1OAYL 4WWKB 1DCLA 5DQ9A 4LPYA 2P7TB 4ODTH 2M8XA 3EOAA 4HH9B 3RAJH 4LFHG 3RGVC 1GPOH 4KV5E 4WNQA 4TUKL 4OQ1A 2EDHA 3UO1H 3CUPA 4QRPE 2AS5M 2VO5A 4M9OA 4CDGC 1QFWM 3SN6N 4NHUA 4DKEL 2JJSA 1BQHB 2EDLA 5C0AA 3WFBH 3T0EA 5D1ZD 1BD2E 1KGCE 2ZOKA 3KJ4C 4D8PA 4JANB 1KJ2L 1YYMH 4I3SH 3HR5B 1ULVA 4GAJH 3VFVA 3RWEB 3VFUA 4WO4A 3WKNA 1FGVH 2NX5D 5CJQL 3CFDA 2BNQD 3U2SB 1A6TA 4BQBA 2QL1A 3QDGD 5GRJL 5J6HB 4ZFZB 3O6FB 2P8LA 5IMOA 1IL1B 3GUTB 3ZE0F 4RWYH 3TNMA 2LTQC 4DFIA 4WY7L 4PR5A 3EFDH 3D39A 1YQVH 4DCQB 3WUWB 3BT2L 3P4NA 4L9LC 3WS6C 2VH5H 1LEKA 3QUZD 1MJJA 1AE6H 1AXIB 3R06B 4OF5A 1IQDA 1DQQB 1FL3B 4PJGE 4XHJD 4LEOA 5ICXB 5D96B 5C09E 2VN4A 1RHHB 2OQJB 3GO1H 4FZEL 4MS8C 4HULB 4N0UE 2QJDA 5SX5H 3WN5C 5I71C 3VU2A 3GSXB 1HHIB 3ARGA 2DQDH 3W81A 1BPVA 2OX5A 3D1MC 1PX3A 3STBA 2Z4QB 1NDMB 4OF3A 2XZQH 3FFCA 5F7YC 1KC5L 1SEQL 2AV1A 3IDJA 2OM5A 3P0GB 4FXGA 3DMMB 1YC7A 3OHXA 5L6YH 2NY4D 3RGVB 5HHPB 3VFSA 4JDZB 4GKNB 3L3JB 1Q8MA 2FX7H 3ES6B 4KK6D 4XWOD 5HHVH 3G5VA 3LZFL 4IOFC 3NCEB 3BI9X 3GK8H 2I24N 3BEWA 3DARA 3UPRA 3QIWD 1SYSB 4XMLH 3KJ4B 3IFLH 4O02H 1HWHB 2LABA 3O9WA 3QPQD 1I1FA 2R2EB 5JQ6H 1U8MA 2HN7B 3PIQA 4PJXF 2DICA 3STZA 4NN7C 1Q0YH 4LSVH 2CJUH 2WWKT 2XACC 3RKDD 2LTQB 4MZ2A 4LRIA 5DD1L 1H3PH 3JV6A 3QRGH 1IC1A 3GSVB 5INCB 3RVVC 4L9LB 4NNXA 2CDGA 5B38A 1RZKC 1T80A 1JWUB 5IMMB 1A6VH 4AT6A 1QFUH 2D7TH 3I3BA 4DVBB 5FB8A 3QIUD 4PLOB 2FIKA 5KAQF 2Y06L 4X8JA 4WUUA 1KLGB 1WT5A 4TNWK 1DBAH 1KCLA 2B8OT 3HC3H 1OLZA 1HZHH 1Q9WA 4BQ9A 3OKDA 3VFOA 4JR9L 1Q0XL 2WV3A 3NAAL 1EA9C 4MA3A 3WN5B 5I71B 1AD0A 4BFIB 3BUTA 4LSRH 1K3IA 4F33B 4DZ8A 1FGNH 5E99H 4JAMB 4MNHA 4XMPL 4PTTA 4HAGA 1HIMH 4YNYB 3NCBB 3VXPA 3SPVA 1WIPA 4JFFD 4PGCB 4Z7VB 4NUJA 3KPMB 3HPJA 3K0WA 2YUXA 4KI5D 3MV7B 2DQFA 1LNUA 3OAUH 4JKLA 5KVDH 5I1IL 3O3BA 3D87B 1YEJH 4YGVA 1TVHB 2DJ4A 1MIML 4GAFB 4MAYA 3KXFD 5F1IA 4G3YL 12E8L 4PLJC 3SDYL 3T4AA 5E95B 4YHIA 2AJ3B 4PJ5B 5KVFH 1E0OB 4JHWL 3QXDB 2CK0H 4RGMC 5IB1A 5KSUB 2VZVA 3O4LE 2WNGA 5T3ZD 1G7QB 4JVPA 4X6BB 5IROA 3RHWK 4LSQL 3EYFA 2E9WA 1LP9B 3JSSA 4M61A 4X99B 3RY6A 1INEH 3ECBB 4JY6A 4QRPD 1TJGH 3FN3A 1FFNB 3BFOA 1MELA 1V7MH 5FKPB 1JGVH 1T20B 4D9QE 5JW4M 3OG6B 4RFOH 1T89A 1U92B 5E5RB 2A73A 1AXSA 1HI6B 1CG9A 4LSPH 4NFDA 3U0PB 4LCWD 4OFDA 1F3JB 1G6RH 3U48A 1CGWA 1M4KA 3B2VH 3SGJA 1JMZA 2HVKB 8CGTA 3S34H 4C55A 2MQ3A 3PQYA 4PBWD 2DWDB 2HT2C 3W2DH 3ARUA 1JN6A 4OD2A 2VISB 4L3AA 5HYEA 1NAMB 3MBED 5ESAA 5C0AE 5DFVC 3HE7A 4LARL 3T0EE 2Q7YA 4BSJA 2HMIC 2OP4H 2H2SD 5E2WH 1FZKB 3BDYL 4JFXB 4KJWC 4N68A 3E3QC 3OPZH 4UILH 5JOPD 3L3DA 4U4BA 2AP2A 2R56L 3QXUA 1YQ2A 4WI8A 3H42H 3GHEH 4OV5B 4U6XB 4ZFGH 3O4OC 4XBPA 3U7WL 1DDHA 5BO1H 1G6VK 5A3IC 1YY8B 2H41A 3LDBC 4HWEH 4JFEB 4FQPA 1RD6A 2AQ2A 1UM4L 2BERA 3D39E 2EO9A 3IJHB 5IIEA 3N06B 4AL8L 1QR1B 4H0IA 5C0RL 5J12C 2HJLB 1Z5LB 1ZT4B 4X7TA 5EWIH 1OY3B 4G8GA 4CVUA 1F11A 5E08L 1RURL 4NOBA 4WEBL 4RGMB 5B3JE 3MLYL 2C5DC 2K9UA 4O4YH 2VLRA 1FO0B 3B43A 3LN4B 4G80B 5EUOA 3X3FL 1Y0LA 5DJAB 4RZCB 5CUSL 1B4RA 1DEEB 4P2QB 2C7UA 1GGYA 3I3EA 3QQ3B 5IBUG 4PGEB 3KJ6H 4QXUL 1MCJA 3C5SA 4OV6F 5E1AA 5MERB 4UT6H 4KUCD 3FFCE 1RY7B 1JWMA 3SE9H 2R4RH 4FFVC 4U1IA 4HIIA 2VXVL 3PWLA 1ZV5A 3AAZB 4MVBC 4MB3A 4OUUB 2CKBB 1J8KA 3RPIB 3FTGA 4TSBH 4XAKE 3EOBB 3NFNB 2HFTA 1N0LA 4JVWA 3L95A 1FG2A 3O2DH 1DSFH 2HFEA 5A2LH 1IKNA 1U3HD 2IANB 3U9UA 1D5IH 5MP6L 5JHLH 1MCLA 2VXQL 4WW2A 5I8KL 1FSKC 3RDTC 1MVUB 4FS0A 4YHOL 4PJIB 2RFXB 3DRTA 3MRFA 3MYJA 5JTWA 1X5AA 4P2CG 3WDJA 2EEBA 3L3GA 5DJ8A 4H20H 3O4OB 5CBAA 2VQTA 3H3PL 2RGSA 3QULB 4NC1C 4NM4H 1ORQB 4NCC2 2V7NB 3LDBB 3ORJA 2NNAA 5EOCL 4M03A 2G75B 1G7JA 1LK2B 2QBWA 5ECJE 1YN7A 4GKOA 4BKLA 5AD0A 1NJ9A 3U30C 1CR9L 1W72A 5J12B 1LD9A 4UIKL 3S37H 4HCRL 1SY6A 3C8KA 3V8OA 1N3NB 1UWEH 5C92A 1K8IA 3QT2A 3GGWB 4KKNA 4NQCD 1HXMA 1GRWA 2R15A 3ULVE 5IMKA 1U8OB 4WUUE 4Y19D 4XCEA 1FZOA 3RVWD 4NP4H 3C08L 4G42B 1XMWA 4M8QA 4ELMF 3VFGH 4QXTB 1YDPB 4OCXH 3K1KC 4KKBC 2W65A 1F6AB 4YFDB 5DQJB 2JE8A 2EYTA 3ARDC 3IS0X 4WVRA 5JW4R 2D7QA 3PABB 1TTUA 1HYSC 1KLUA 1AJ7H 3O4LD 3QWRA 1JWSA 1T83C 4KRNA 4U7SA 3TCLB 3QUYD 3UDWA 1Z9OA 4KZDH 4E0RA 2ESVA 5C07A 2PW1B 5I2IB 4WU5A 2NY7H 3C2AL 2XQBL 4LLQA 4Z5RA 4L5FH 4GS7C 5TGBB 1N5YH 1FSKB 4Y4KD 3RDTB 2H26B 2KQNA 3LKPB 2BCKA 4WI9A 5DLMH 4KTDL 3L3IA 1S7UA 4BYHA 2C1PA 1J05B 4WFGD 4JPKL 3C6LA 4N0FA 2XWBA 3ARBD 4KVNH 4NQDA 4UQ2B 2NY6C 3N85H 5GSVA 2WINA 3HS0A 1L7IL 1KN2H 4KK8D 5FA4B 3JV0A 2UVEA 3C6SA 5HTSA 4BUHA 5ICZA 5M7QA 1WLHA 1Y18A 4GMSH 3QI9A 1LEIA 1MAJA 4D0BB 1HHJA 4R3SA 3L3HA 2EEAA 5C0AD 4AEFA 4AJ0A 3Q6GH 5JO5A 3L5XH 4DKFL 1TZHA 3P9WB 1HDMA 3U30B 4D9RD 4R4NC 3U36A 4MQXD 4RA3A 3PQYE 5SWZA 3DSFH 5EZLA 1SBSH 1CE6B 2ITCB 5CJXC 5EBMB 4A6YL 4ZFOL 4K8RH 5K9QI 3HFMH 1T0MA 4O00A 2J88H 3QUML 5TDPA 1UKTA 2VNCA 1ZLUH 4GKSA 4LAJH 2XZCH 4PJCA 5JR1L 4UINL 4NRYA 4PJHA 4TSAL 3LEYH 4C56B 1RZGB 1OD7A 3H9HB 1MJ8L 3P2TA 3ETBF 3EOYG 3O41B 3IAGC 4HJGA 1NLBH 3ARDB 5JW5A 3WYRA 3TPUB 4XC3H 4GAYA 2AI0H 3FQRB 1MRCL 4OBSA 4Z0BH 4WDIA 1A7QH 3PL6C 1PG7X 1F4AA 3BQUD 2ZCKH 1MFAL 3S3JA 3ARGD 4XNQA 5C2BL 3T8XB 3HUJB 4HZAA 4WJ5A 3QNXB 2HWZL 4EDWH 4G8GE 4JPWL 1IGIH 2AK4A 1WSST 4J1UB 1I8MB 1ZLVK 2A9NL 4GS7B 1OLLA 1MFBL 2VLRE 4RRPA 3F6LA 5EUOE 2NY6B 4HJ0D 1N7ML 4M9PA 5GGSY 3D25A 3OSKA 4QTIL 1XCTA 3AB0B 2MPAL 2H6PA 1LE9B 3AREA 1IARB 5IEHB 1I8KB 2ICWI 15C8H 4JFZL 4DFHA 1OB1B 4NZJA 3CNKA 3V9FA 1BX2A 4OTXH 3BYTA 1CFQB 3CZFB 2P5EA 3SDAD 3RTQA 4GBXA 1CFNA 4PLKC 4GG6A 2EXWC 2PR4H 3UC0H 1EFQA 3RVXD 3QJHA 4R26H 4IS6B 3KWWA 3F12A 1UB5A 3TO4D 4EIZC 1X5ZA 2F8VA 4JG0H 3T1FB 5E2TH 1W0VB 5EOQH 3RWGB 4K9EC 3FFDA 5FYKU 3UAJC 5JORA 3NN8B 1I9JL 3SKOA 1T1ZB 5C0BD 2J8UA 3VRLF 4OCMC 5I8CB 2IBZX 3ULVD 3IFOA 4K3EL 3MLWL 3O8XD 4K55A 3AS2A 4Y2DB 5BW7A 1ZT1B 4S0TD 4WUUD 3P4LA 1KV3A 2CLRA 1RZJH 1A2YB 1PYWB 1N64L 4JRWA 4ETYA 3H7BB 3PL6B 3SCMD 4EEEA 4GRMA 1OWWA 5TH2B 5ISZA 3HE6D 4K7FA 1KTDB 1R5WB 1JGDA 3O2VH 4V1DD 3B83A 2VLLB 1A7OH 1EHAA 3CIQA 3U4BH 5HGHA 2XYCA 4NSKA 4WI6A 3DV6B 4BH7A 4MJ6A 4X6EA 1PKQA 4MA7L 3QUXA 4X5LA 5GS0L 4N5UA 3NA4A 5IR1A 3QIBA 1CT8B 4YUEH 5DD3L 4OCNC 1BOYA 2YEZB 3U7AA 4S2SB 4NKMA 1OW0C 3CVIH 4U0RC 2Q7NA 1R3JB 3V7AE 1T7XA 3O2WH 1PLGL 3VFPB 2ARJB 5EC2A 1G7HA 1KBGL 3NA9H 3LQAH 2BSSA 1KFAH 5CCKH 4HXAL 4DOHE 2YZ8A 3O6LH 2G9HB 5I76A 4GRWE 1JNNL 4ZPTA 3IAQA 1OF2B 5LXGH 3FT3A 5IB4B 4YR6A 3M8OH 3WMSA 2ESVE 5HPMA 5C07E 2J6EH 3IFPB 4DQOL 4U1KB 1N2RB 4EVNA 2KZWA 5FO7B 3KYNA 3VXMA 3MOQA 3ROOB 1XGTB 5IFHH 3REWA 1UH2A 4YEFA 2NR6D 4XWGH 1B6UA 3H3KA 4X4YB 2DB8A 3CPLA 4NQDE 4Q6YA 2I60H 1RK1A 4QF1B 1R3IH 5D9SA 3S37X 4L8SC 1FL5B 3CH1A 3PQYD 1BFVH 3L5WB 2HT3D 3X11A 1MIEL 3BVNA 3P9MB 1KT2B 1K3ZA 1U8QB 1I75A 1YNLH 4RMVA 4LIQH 2RIKA 3CDFA 3P4OA 4RGOH 3CCHB 3FT2B 4XC1L 4XXCC 3HE7D 1L9NA 5HDLA 4C59B 5E7BA 3ZDYE 1N59A 4R7NA 5LVEA 2Z93B 3HZVA 2A6JA 1DUYA 2Y1VA 2YOCA 5SWZE 4ERSH 1TQBC 3QDJD 6FABL 1CYGA 4UOJA 2JIXA 2CIIB 1CFBA 4QRQA 5K59F 4JRXD 2VZUA 4PJCE 2D0GA 4PJHE 4MD4A 3QA3A 1MWAL 3V0VA 4XP5H 5B8CB 3MOAL 1SVZA 4U0RB 3UTPD 1VACA 2CRIA 5GQBA 5DVKA 2GK2A 2QKIB 4NOFA 3RWJA 1KB5B 3IS1X 1HWGB 3RL1A 1XF2B 2MQ0A 4QT5A 2FJGB 4HX1A 3SQOL 1OHQA 4HKXA 1VGKB 1ZHLA 1HKLL 3TNNA 1A5FH 3NFPB 4NHCH 4JLRA 5CGYD 1EHLL 2MCPH 4ZO8A 4P9HC 3ULUC 4DGYL 2VDRL 4LLWA 5EU7C 2YA0A 3OB8A 2DQIL 1F13A 2FYYB 5EOTA 4N0CC 1QRNA 3V6ZB 2VDML 4R2GD 2JB6B 3U6RB 3KNBB 3NACL 3KDMB 1QRKA 4QRSB 1C08A 4U6HA 1A6WH 1TDQA 2BVPA 4P2RD 2BJML 4NJ9H 5TE6H 4PRBA 2V5TA 2BVOA 5CGMA 2VMFA 3VWKD 1RIVH 1CXEA 3DNKA 1FAIL 2C26A 1ZLSH 4XP6H 3NTCH 2QQLL 2BHYA 2R23B 2P5EE 2LVEA 3PV7A 3D85A 1W0WB 2NY5H 2OJZH 3I6GA 4GG6E 2CMRL 5CD5C 1TQBB 4UAOC 1KPVA 3IT8D 2FL5A 1SJXA 3DVNA 3DTXB 2E6JA 1ZGLP 1RV6X 5J4MA 3WS3B 5GZOD 2QSVA 4RIRA 2XT1B 3WKML 1HSAB 3OKOA 4OZGB 1A4KB 1BAFL 4JFPB 3HG1A 4XH2B 2X1QA 2QSCL 2DQGH 2J8UE 2X4PA 3TBWB 1CXKA 1TMCB 2Q86A 5SV4A 3MA7B 2XQYK 3NFSH 4OIIL 2FR4B 1AR1D 4LOUD 4JCLA 3NABL 4OAWA 2FO4B 1HOCA 1X5KA 1NCDH 1CLYH 3O6KL 5CBEA 5ISZE 2ICEA 4M5ZL 4JO4H 2IPTL 5BS0B 3KPQA 3CLEL 4I18C 1A3RH 5IB2A 4PG9A 3RU8L 5KVEL 3EYOB 1I85C 1L6XA 2CDFA 3QG7L 2IBZY 3QWRD 2BFVH 1PKQE 1U2HA 4G6FB 1IM3B 3TIEA 2ESVD 1IAKB 4WFFE 4HWBL 5DC0A 5AZEH 1WBXA 2ADJB 4FQXA 1A64A 5KTEL 1P53A 3QUZC 3KPRD 2Q76A 3OAZK 4F58L 1T0NB 3GNMH 5HGBB 4XBEH 2GK0B 2A83A 3SE4A 4RGNE 3F5WA 3P11L 1EAJA 4JHAH 1ZEAL 4PJEB 4R90H 4ZD3L 3K2UH 1L0XA 2DI9A 1A7RH 4HWZB 3VD9A 1RIHL 2A74B 5HGAB 1DE4A 3M17B 2UZXB 2G5BA 3EZ8A 1T1YB 3QI9D 4OD1H 4X7EC 4P2OA 4UAOB 5SWSA 2YKLH 3VXME 3TA3D 3BMVA 3TBTA 1CICA 4N9GB 1EEUA 2YBRB 2XNAA 2X09A 4N1HB 3CMOL 1V3LA 3HNSL 3WXVH 1VFMA 4PS4L 1Y6MR 3SDCD 1GGUA 3T09A 2XOTA 3NGBC 3N1QC 2B2XH 3HZYA 2O5XH 3BW9A 5IB5B 5GRXG 4F9LA 3VXOA 1ZHBB 1CQKA 1I8IA 4LKCA 4M6OL 4KK6C 5FYLL 3CD4A 1RZ8B 4XWOC 5GGTA 3HAEH 2Z0BA 3HPLB 5C6WH 3QIWC 4L1DA 4BZ2H 3BO8B 3GBNH 4I18B 3QDHA 3NZ8A 1DUZA 1LMKA 2GSIA 1K4CB 2IFGA 2V5RA 3QPQC 5LGHL 2I9LB 3CK0H 2WBWB 4G8EB 4WI5A 3VGHA 4Y4HA 2NX5B 4Y88A 4CDHA 2BNQB 1B3JA 3BN9D 4RMRA 5CJ8A 3MJ9H 1D6EA 3MRQB 1NGWA 1XGUA 5DD5H 1NLDL 3GJFB 1JRHI 4JG1L 3I85A 1G9NC 2ICES 3QO0A 1WISA 1XF3B 4H8WH 3K8MA 5HHME 5GZND 5L8JB 4JFDA 1IFHH 5F9DC 2XKNB 3O11A 1R5VA 3GSNL 3IXTA 3L9RB 3QUZB 3CDCA 1XCQB 1A1NA 4ODSL 35C8L 3DGGB 2AK4D 1ZAGA 2DIBA 2X10A 1CL7L 4LSUH 5JZ7C 2PKDA 1QVOA 3QIUC 4L8BB 5HI3D 5K9KB 4Z7UB 4OZHF 3TEUA 4NO0D 4UDUB 2F5BL 3KPNB 2ENSA 2O26U 3RZCD 1Q72L 4U1LA 4KUZL 1UB6A 2COQA 1DJSA 3G5XA 2DM7A 1UENA 3N9GL 3SKMA 3W0WD 1KCSL 2PF6A 1ZGLA 1U93A 3ARFC 4IRJA 2BNRD 1K8DA 3DIFB 1F5WA 5E6ID 1AHWA 4KQ4L 1CGXA 3VG0H 1EV2E 1PEWA 1QRNE 4KI5C 3MNVB 2P44B 4QRTB 2BSTB 2EICA 1I7UB 3LN5B 2P5ED 5FXCH 5HHOA 4OJFL 4Q9RH 3NGBB 4GBXD 5BRZA 5CD3A 1ZHNB 1PBYA 4KRPD 4PV8A 3TT1H 3OJVC 2UWEA 2ICWA 1TTFA 2JCCB 4ZOEA 4ENEC 3U46B 3QCTH 4OF6A 4MXQD 3PWVA 4PJ8A 1KIQA 2P8MA 1E27A 5CINL 3FQNB 3U4EB 3QIWB 1C7TA 5JOFA 2X9XA 4HDIA 2HJKA 1D7FA 3D2UA 1OCWL 3MR9B 4ZDHB 4GSDH 5IBUB 3IF1B 2HJFA 1RPQA 3EO1B 1INEL 4OFYD 2WIIA 1ZXQA 1EERB 3PHOB 4PJHF 4CL7A 5INDA 3RUGF 3WE6B 1FJ1B 2W91A 4DK3A 5KSVA 3MLRL 5ISZD 1JHTB 1FNEA 1MHHB 3DYMA 3FO9B 1NKOA 3HG1E 4XVSH 1A9BB 2EYSB 1BBDH 3IJYB 4JKKA 1KNOB 4P5TD 5FAAA 5C0EA 3BZ4A 2A77H 1UCBH 3EO0A 4LSSH 5D93C 4ZO9A 5GJSL 4NNYA 5GISH 1S5IH 3QIUB 3V5KA 4OCWL 5ESQA 4GJTB 5I73C 1T7VA 3MBEC 2X4NB 2ZG3A 4K2UL 2BP3A 2AKRA 3VXSA 1OGTA 4WFFD 3P9LA 1EEYB 3VXRA 2GFBA 2H2SC 1J1PL 1IGCH 4L8CB 3WNLA 1KJMB 5DUBB 5ANMA 3H8NA 3MRMA 4NUGL 3MRDA 1FNHA 3ARFB 1RZ7L 4NCC1 2Q20A 5EUKA 2VUOA 3IGAB 4XP4H 3DURB 3V6FA 2EDNA 4WTXA 5FGBA 3F7VB 4XNUH 3MRPB 4HBQA 3B9EA 1VKXA 5IEKA 3BKYL 1IC7H 3G6AB 4PTUA 2PO6D 4WFEE 3HB3D 1KCKA 4U3XA 1P6FA 3WJLC 1E28B 2H3NB 1J8HD 3SKNB 5FKAA 5I17B 3H9ZA 2Q8AL 1NGPH 4M6MH 2X4OB 3VH8A 5TFSL 3MFFB 1NBYB 4NO5A 4FG6D 1QA9A 3EOTL 5EBWB 4P59H 3BYYA 1EO8H 2H45A 4LU5H 1T5WB 4QRPB 1GZQB 5SWSE 3K81A 2OL3L 3IU3A 3MV9E 2AXJA 3NH7L 3VFRB 2NCMA 3ZMRA 3F6IA 2C4FT 3JWDL 1F4YL 3OKKA 2DQHL 4GKZA 2J12B 2H32B 3KPOB 4JKPH 4BQ8A 4LCWB 1N4XL 1XH3B 2VLME 5B4MD 1U8IB 3GSRB 4Y1AA 1A14L 3LIZL 5CZXD 5D93B 1FV1A 1T66D 1JF1B 1IAIH 1IEBB 5E24E 1IGYB 5D7JA 2VZ1A 1AQDB 5I73B 5KSBA 5TE4L 1U3HC 2AJYH 4W68A 3O0RH 3FB8B 3MBEB 2E5EA 1JF6A 5HHMD 3GBMH 1U8NA 1UT9A 5LCVH 5HDOA 5CEZL 1MJUL 4R8WL 1EO5A 1AD9A 3QQ9D 2NZIA 5KS9A 5JUEL 25C8H 3MJ7B 1L4IA 4O51A 1E4JA 1E4WL 4PJGB 2ZJSL 2VDPH 2DQTL 3T4YB 2ORBL 4LCCA 3WNPA 1S5HB 5DRXA 5GS0D 2FEEL 4RISL 5ERWA 3P73A 5DTFB 4N0UB 4EBQL 4KWUA 3EYQD 4JFDE 4XNYH 5D1QA 1VFBB 4YHZL 2P5WA 3MUHL 2IAMD 4F7EB 4LSTH 3FB5A 4J3WA 1UXWA 5F7KC 1FVCA 2R69L 3THML 4ZO7A 5IWLC 4GG8B 5HYJA 1QRND 1CXIA 5IP4A 3LHPH 3QNYB 1BM3H 3PWUB 1ACYH 2EYRB 1RJLB 3STLB 1NEZG 4ZO6A 3H0TB 1P7KA 3RVTC 5KVGL 4YXKL 3ZSSA 4M48L 4MX7B 1HQ4A 1BJ8A 5FDWB 3GIVB 1ZHKA 1P84K 2FD6H 2GJJA 3MRBA 1YN6B 3SDDA 2NY1D 1HYRC 32C2A 1OQXA 2A9ML 2D0HA 1G9MH 2HKHL 2IH3B 2V7HA 2WWKO 5IQ7H 2AERT 1YEGL 3D0VA 3RIAF 2IFFH 3LV3B 3VGFA 5HHOE 1IGJB 3PWJB 4UV4L 1MUJA 3QUYC 2OZ4A 5BRZE 2KH2B 4K7PH 4UU9B 3MCKA 3QG6A 1C16B 4RDQF 1JNLL 1S8DA 5IESL 2UWEE 1QSFA 5I30L 4MXVE 1JNHB 3CGTA 3CVHL 4B41A 4Y16C 1U3HB 4MDJA 4GAGL 3L3OA 1C5DA 3LN9A 2GHWB 4WFHE 1KACB 3HRPA 2V2TA 3CX5J 3HG1D 5B21A 1T1WA 2XRAL 2F54A 4U1SA 3S8WA 5DK3A 4KK8C 4G9DA 1S9WA 3MRGB 3IRZA 3O2DA 1C5BH 3BXNA 4ZUUB 3MRCB 3X14B 5I1DB 2GCYB 2QEJA 3ULUH 1Z3GL 3WLWD 2Y07H 5F96H 5ACZB 1IC4L 3T0EC 1I9RL 2J2ZA 5D2NA 1H5BC 4BH8B 3A67H 2IF7A 3BP4A 3IDGA 1T2QL 1AXTH 2HKFL 7FABH 1EVTC 5C0CA 3J7HA 4ZPVA 4M3JA 1IEAA 2NYYD 2V2XA 4NQCB 5KW9L 2ADFL 4OLVL 5KANI 4R9HA 4S1QL 2EH8H 3QXAA 2N7AA 4W6WB 3DVGA 2XXCB 1EDQA 3VXSE 1MEXH 1B2WL 3P3YA 4E41A 1KOAA 3VXRE 2BOBA 4FQXD 4JRYA 3LKSB 5L0QC 2A38A 3QEGH 4DGVL 3SGKC 5ANME 3P40A 4PRAB 4ZUTA 3VMPA 4PFEA 3B2UD 1HE7A 1QEWB 2Z35A 3S4SA 3BKJH 1JHLL 5TDOB 2ZG1A 3ZHDA 4KJYB 3TO2B 1PVHA 4OF0A 4NQXA 1ITCA 4MSWA 1JYVA 3MOBL 1C5CH 3O4LB 4YHYC 5DVNA 4Z0BL 2YD7A 4ALAH 4XZUB 3QUYB 3VXQB 3IDXL 2UUDK 3WIFB 3L3KA 2D2OA 1PSKL 2CLZB 3ARGC 3TBSB 4JFYB 3CXDL 5EO0A 2WM0A 1J7VR 3JUYA 3E8UH 4LHUA 4Y16B 2VYRE 2R2CA 2DQJL 4FQIL 3EFFB 5J6GB 5IT2H 5DC9B 5IB3A 4U6YA 5FM4A 2BRRH 4YAQB 3HN3A 4ZTOL 5DQ9B 1Q1JL 2VLMD 3QWOA 4EQ2A 4HKJB 2ZOLA 4Z95H 4WWKA 2P7TA 2F74B 4HH9A 4WNQB 4JJ5A 1OAZH 4HJ0C 3CUPB 5I1JH 4Q2ZB 5FFLA 4IBLT 1OAUH 4NHUB 3OKYA 2AXHA 2B4CC 3SGEH 3VFMA 1R3HA 3GJFH 5C0AB 1LE5A 1BQHA 5KN5A 1KULA 2ZOKB 1H5BB 5IG7B 4JQIL 4DAGL 2EH7L 1MNUH 1QSZA 3O9WC 4U1NB 3HR5A 2D3VA 4FQ2L 4Y1AE 3RBSA 3CFDB 5ENWA 2EXYD 2GY7B 1ZSDA 4ZFZA 1HQRB 3O6FA 5KSBE 1A6ZB 4JVUA 3T2NH 4PR5B 4DVRH 4ORZC 4NYLA 4PP1D 2HLFC 3RP1A 1CDJA 3P4NB 5E9DD 4DCQA 5L0QB 3C60A 4ODVL 5CGTA 1MAML 1V3MA 1MJJB 5KS9E 1EGJH 1ZWIB 4QGTA 3OAYH 1AY1L 4MCYB 2ZCLH 5CSBA 1CD1A 1IQDB 1FNGA 3ULVC 5KJRL 3O8XC 3R06A 4PREA 4XPGH 4LEOB 4ZQKB 2X1WL 3CXHJ 3CFEB 1WT5C 5I66B 1CI5A 5LWYH 4FQJH 4LMQE 2DMKA 4YHYB 1F8TL 2OQJA 4FN0A 3TH3T 4G6MH 3MMEA 4ELKB 1SJEA 4Q97A 3HE6C 1XGRA 4XTRC 1DBMH 3ARGB 2Y23A 1LO5B 1LO4L 3GSXA 2P5WE 1EZVX 2OTWA 4IRJD 4IDJH 1GZPA 4A2LA 2Z4QA 1NDMA 2OR9L 4OLXH 1ZOXA 4OLWL 5HYJE 2AV1B 2EDFA 3MACH 3UXFA 5I1CH 4ONFH 4KAQL 5JQHC 3GMPA 4Z0XB 4CVXA 5HHOD 3OHXB 3VFSB 4V2BA 5DD6B 4MAYC 5GIRA 2FBJH 2X1XR 2DJSA 3BAEH 2P46B 3U9PL 1D9KD 4PJ8D 3UPRB 3BEWB 4BFGA 4HXBH 3LQAL 3OGCA 1KPRA 3D2UD 1MHPH 4XRCA 4FZ8L 3O9WB 1I1FB 1AGDA 2ARWA 3SDAB 1OP5K 1U8MB 1YEHH 2R2EA 1PDKA 3PIQB 4OM1L 3STZB 1QSFE 5FV2A 2R0LL 3HI6L 4FFZH 5FYLD 2XKSA 1AQKH 2BRQA 4M5YH 4YHKL 1T89C 5C08A 1DN2A 3JV6B 1N0XL 2V2WA 4IM8A 4YHPA 5E5MB 4NNXB 2I07A 3WS6A 3SGJC 4PB9H 4YEEA 2F54E 5C0BB 4NJAH 1JWUA 2HT3C 5IMMA 2Q8BH 3O8XB 4JE4B 2FIKB 1P1ZB 4X8JB 4WUUB 1FYTD 4YX2L 3HE7C 1Q9WB 1QLEH 3VFOB 5D2NE 3VXRD 3QPXL 5EA0H 1FL6B 2EDKA 3BJ91 2N4IA 1ZANH 1AD0B 1A7NL 3HE6B 5LKNA 4EOWH 5C0CE 5D2LA 3BRFA 4F33A 3ZKSD 2ZP0T 4MNHB 3VXPB 3SPVB 4CW1B 4WI2A 4JO1H 4YNYA 4I4WA 3U4AA 3EIFA 5C3LD 1CE1L 3KPMA 5DWUL 2DQFB 1LNUB 3MV7A 2ZSVB 4E41E 1KCUL 3O3BB 4JRYE 4K7PX 5T3ZH 3ZDZE 2W59A 1NAKL 3EJYD 4MAYB 1HCVA 1IJ9A 2DKUA 1DANT 5D6DA 2MHAB 5GGVL 3T4AB 2Y72A 1VESA 2X89D 4AMKL 4YHIB 3WV0A 1CBVL 3QXDA 4TVPL 2UWEF 4TRPH 2E9BA 4MHHI 2J5LC 4DN4L 2P24B 5EH1A 1YY9D 3ARZA 1S7RA 1G7QA 4X6BA 3EAKA 3GDBA 3GMQB 5E4EC 5JIIA 1LP9A 4X99A 4J8RA 1MFCH 3ECBA 3VMOA 4XVJH 3U0WL 3S36H 4OKDA 5CGYC 1T20A 1NCWL 3BE1L 2A73B 2OK0H 1U92A 2BHUA 1RVFH 1CFVL 1CZ8H 2VJXA 3U0PA 2IQ9L 2DIJA 1FH5L 1HHKA 5FK9A 1UYWL 4XI5C 3SDXF 4R2GC 3PQYB 1HSBA 2NZ9C 4NN6C 2J6EA 4Z6AT 4R4FL 3GMOA 2DWDA 5D7JD 3BZFB 1JN6B 1IKNC 1GC1L 4JM4H 5BVPL 5C0GA 4PRDB 3HE7B 4FNLH 4WW2C 2Q7YB 1UA6H 5DDHA 4ZODA 1ZLSL 2QQNH 4AG4H 1FN4A 3DO3A 3LS4H 4Z8FL 3GKZA 1FZKA 4Q6IB 2DMCA 5E2VH 1QNZH 5J56B 1TJIL 1I4FB 4JREC 5EDXA 4XBPB 4U6XA 1DDHB 1KEML 5I1HH 4OLZH 3WDHA 1CF8H 4JQXA 4ACPA 5A2IH 5GZOC 3U82B 4XMKL 1RU9H 2E27H 1EIBA 3SY0B 3QAZC 3DVFA 5D1QD 4NWTL 2R8SH 4X7TB 2CLVA 2HJLA 1Z5LA 2FX8L 5GHWH 1ZT4A 4AM0B 1I9IL 3TVMD 4F37F 3UZEA 1UWGL 4G8GB 4HEPG 3L7EB 1F11B 1IGFH 5C6TL 3BWUC 3SOBH 3ESVF 1JUFA 1AR1C 2AABH 2MNUA 5IFAH 2VLRB 3MRIB 1AGFA 5EUOB 1Y0LB 5FGSA 5C0FA 5DJAA 4N0YH 1W8NA 1KEGL 4RZCA 4KY1L 4R4BA 1TJHH 2C7UB 2OS7A 1QFWI 2AEPH 1YEEH 3Q6FA 5E1AB 1M6OB 5AYUH 1VADA 5MERA 1EXUA 1JWMB 2APBA 3UJIH 4HIIB 1Z0MA 4KHTL 1FCGA 4MQSB 4JFQA 4HIJA 3UDWC 4R2GB 4K71C 5JHDA 4HLZG 1BQSA 4QHUA 3UPCA 4NN6B 1P4IL 1WTGT 4EN3D 3L95B 1FG2B 3NFNA 4MDIB 4ONGL 4P2RB 1IZJA 4YPJA 5CSZA 3U9UB 4OZIF 4KK5D 1VEOA 1B4JL 4WW2B 2DOCA 1I7TA 5I9QC 1DBJH 2CRZA 5CMAA 4WTZG 3C6LC 3MRFB 3MYJB 4FFYH 2D31A 2LV4A 2F54D 3QDMA 3HCVA 4OSUL 3CFJB 3HNVH 4PBXA 5ILTH 3L3GB 4O5LH 4BUGA 4JREB 2IPKA 3QI9C 4PUBL 3JTTA 3U7YH 1OTSD 1W0YT 3MLUH 4Y5YC 3MLVL 3TA3C 3H3BC 2F53A 1NUNB 1V7NL 1YN7B 4BKLB 1LK2A 1NJ9B 3QAZB 4YHML 1W72B 1EUTA 1UACH 4DJMA 4FQCL 3C8KB 2V9RA 2UY6A 1JI2A 4CN1A 4EQ3A 3L1OL 4M7LT 4YBQD 2C3VA 4CGTA 1HXMB 4BK4A 5IMKB 3HRZA 2X42A 4Z7NF 4XP9L 2FSEA 1FZOB 2VLJA 4O58H 4M8QB 5CZVH 4JRYD 3VH8G 1KJ3H 3LEVL 4GUPB 5DJZB 3BIAX 1DVFA 5D2LE 3DECA 5T1KA 2EIEA 3UEZA 1MHCA 4P4KA 2UZIH 4F3FB 4LRNH 2IGFH 2EYTB 4FQQB 4Y8AA 5D5MB 2LFGA 1L6ZA 2Y25A 4NGHH 5D72L 4DOHB 3MV7E 1A4JB 2AJZB 5H37H 4GRWB 3WFHA 3EYVA 1A0QL 4K71B 2ESVB 1TETH 5C07B 2N56A 5F72S 4FABL 3A6BL 2PW1A 4QTHA 5I2IA 3KPRB 4LLQB 5AZ2H 3V0WH 4Z5RB 3MA9H 5I9QB 3DETD 2BCKB 3RDTA 1S7UB 2H26A 2HA1A 2XWBB 4NQDB 5GSVB 2WINB 3HS0B 5D1XD 1X4XA 4RWHA 4UQ2A 4PD4J 3GSOB 3C6SB 2DF3A 1LP9E 1Y18B 5ICZB 1P69B 3QI9B 3V4VH 1QP1A 1LEIB 3FO1B 4Y5YB 3TA3B 1S9YB 1UZ8A 1HHJB 3PV6A 5JXEA 1MFDL 2FLBT 3UBXA 4HPOH 1V3JA 2HH0L 3MXVH 5JO5B 1TZHB 1IGTA 1YUHA 1HDMB 2VDLH 3AMLA 4M6NL 3M1BA 3T3ME 3U36B 2B1AL 3VI4E 3RTQC 5SWZB 4GBXC 2O93L 5T5FH 2GTWA 3K74B 2AJSL 4LSDA 1DQTA 2H1PH 2OR7A 2ITCA 3MZGB 1NGZB 4MXQC 3T3PF 2Q3ZA 2M2DA 4GKSB 4JQVC 4PJCB 1T7YA 3SGEI 3C60D 4NRYB 1YECL 4AEIH 3NOIA 3BPOC 3CLFL 4OCRH 1T4KA 1HH6B 2X9YA 1UKQA 4N90D 1LO0H 1PKOA 1RZGA 4I3RL 3ZDXE 2W9EH 3ZKMC 5BW7C 3O41A 3GM8A 4HFUL 3ZDZF 5FYJL 1BZ7A 4KPHL 2ADIA 5TJWK 4LHJB 2OMNA 2R4SL 4G8IA 3CDGB 4UBDD 4GAYB 3TPUA 3ZHKA 5D7IA 3N1GC 4WDIB 4CVWA 4FMFA 3N1PC 2LE9A 1J1XH 3AS1A 1G84A 4XNQB 4MAUL 4Z77A 4X4MA 3MUY1 3T8XA 2AK4B 4MD0B 4UB0L 3MJ9A 4RX4A 4XAWH 1JPSH 1ZLWK 3HMXL 1A3LH 3SO3C 4GW5A 3RIAK 1AH1A 4NO0B 1OAYH 3VGDA 2YUVA 4XPBL 1FRGL 3WNOA 2R2HA 3NZHL 3D25B 1NGYB 4TUKH 2HT4C 2H6PB 4ZS6D 5FHAL 2AEIT 2PYFB 4XNXL 1MRFL 3B5TA 1BZ9A 5IEHA 4DKEH 1MCKA 2OCFD 3R0MA 1OB1A 3MNWB 4UOW0 3V5HA 1KJ2H 2P5EB 1WAAA 5JHDE 4GBXB 1CFNB 3OL2A 4NQVA 2P8PA 1G7IA 2PO6C 5CJQH 4GG6B 4TQEL 1UJ3B 2HTKC 2DLIA 1NMBL 5GRJH 3QJHB 1VGEL 5I18L 3KWWB 5C08D 3F12B 4IS6A 5FCUL 1YJDH 1ZA6A 1HXYA 3DOSA 1FORL 4WY7H 1MCDA 3BRGC 1I3UA 1LEGA 4ZOAA 3FFDB 3RWGA 5JORB 3BT2H 1LK3L 4PJIE 3BPOB 3SKOB 5KZCD 3E3QE 1T1XA 3QDME 1T1ZA 3MFGB 2YHGA 5CIPB 3QFJD 4FOMA 3MLSL 1JGUL 4LDEB 4Y2DA 4ZFOB 4KXZI 5AUMB 3L5HA 4POUB 3S4SG 2CLRB 4UMGA 1H3WM 4LPWA 5T3XH 1F90L 2F53E 3AGVA 2RHEA 4FZEH 4GRMB 5DO2D 5DZLA 3PL6A 5ISZB 1UZ6E 5TQ2L 1FQ9C 4I9WE 4C58B 1R5WA 1JGDB 3BP5A 4DTGL 5CFHA 4X7FC 1GIGL 5CZXC 1S7VA 1IAIL 4PYGA 5HGHB 2X4RB 2DN7A 1KC5H 1SEQH 5HDQL 4QCIA 4UOW1 4BH7B 3JUZA 2VLJE 4X6EB 2ATKB 4NC2B 1NMCC 4PJ7A 3ARQA 5IR1B 4ZMAT 2Z8RA 4UDTA 1QPXA 1PW3A 1S3KL 4QOKD 3BP7A 4U6TA 4S2SA 1C8PA 4YDIL 1Q9LB 3VI3E 3TM6A 5A43C 3LZFH 3RWIB 5KVMC 1G7HB 1IM9A 2W07A 4HPYL 4F9PA 1AP2B 3DJ9A 1WWBX 4JDVA 4U33A 1R5IA 3NPSC 1TNNA 5I76B 2G9HA 1A3QA 2BY3A 3FT3B 4YR6B 4I77L 1OF2A 2GY5A 3EYQC 5HPMB 2XWTA 4YJZL 1FYHB 1NANH 2PO6B 5GS1A 3L5JA 5IOPA 3KYNB 1U8LA 1J8HB 2IAMC 2VAAA 1MCEA 5FO7A 1XGTA 3DGCR 4PY7A 4NWUL 5DD1H 1RAMA 3UZVB 1T03L 5M95B 1JGEB 2JJTC 2PN5A 3CPLB 4JO2L 1PGRB 3BISA 3IB4A 5D9SB 5IHBA 3CH1B 4U7KA 4X8XA 4OF8A 4KK9D 3X11B 3L5WA 2VOTA 3BVNB 4PRNA 1TVDA 1HKFA 3P9MA 1U8QA 4NC1E 3ELAT 3P4OB 5IVXA 1FG9C 2Y06H 1DQDL 1T7ZA 2X4QB 3MGOB 2XG4A 3CCHA 4NNPL 3W39A 3FT2A 2NY1C 1H8SA 4OB5L 5DURD 5FGRA 1N59B 4JR9H 4R7NB 1Q0XH 3NAAH 1I3RB 2A6JB 3HZVB 3W9DB 5DD0L 4NQTA 2R0WL 1QLRA 1K2DB 4CJ0A 3B9VA 1S7TA 1IQWL 5FM8A 5I16A 4YBLC 5FUZL 5ADOL 4P2YA 2CIIA 2EIZA 4QRQB 1NMCB 3VRJA 5HHMB 5I1IH 1UEYA 3FT4A 4MD4B 4K94L 4Z7VF 3QA3B 3P0VL 5GS3A 5B8CA 2ZWLT 1MIMH 3PF2A 2IG2L 5J11C 3KR3L 1VACB 4G3YH 3KHOA 5I19L 12E8H 3RWJB 3SDYH 1MH5A 2QKIA 2EC9U 4JHWH 3IAPA 2YA2A 2CKNA 4QT5B 5BV7L 3WLWC 3NPSB 1JF5A 1OARL 4HX1B 2NW3A 1BECA 1PG7L 5D7IE 4HKXB 4MJID 4YBHA 1ZHLB 1VGKA 4LSQH 4X4XB 4M62L 3TNNB 3G6JA 4X4ME 1DLHA 3NFPA 3JWOL 5CEYB 4FA8A 1X44A 1MPAL 2IAMB 2NYYC 3CH8A 1Y6KR 1X3DA 4NKIL 4TVPD 2CGRL 3P4MA 4XPTL 1P4BL 5EOTB 1QRNB 2FYYA 4PJAA 4DN3L 4F7PA 5JHDD 4HUKB 2JB6A 4Z76A 4FQXC 3KNBA 1U42A 3FN0L 1C08B 1NUGA 4U6HB 2GIYA 2BVPB 3QZWG 1SMAA 5ITBL 3B2UC 4MNGA 4PRBB 2BSED 2BVOB 5L9DL 1HK6A 2J1KA 4XB8A 3LD8C 2NY1B 3SE4C 3OBAA 3VJ6B 4LARH 2PYEA 4JPVH 2D7NA 3BDYH 2I5YL 2IJ0C 5I74C 3GIZL 4QHKI 2DLHA 1WAAE 2R23A 2R56H 5F7EL 4NQUA 1FZJB 3I6GB 4P2OC 4UV7L 1WIUA 4LQ1A 3ZYOA 3MGAA 2FL5B 3B8YA 3U7WH 2HVJA 4YBLB 1PY9A 2R39A 5F93C 1CICC 2RCSL 3DTXA 3KPLA 5TQ0L 1RZFL 4E5XA 4RIRB 1UM4H 3OKOB 1ZLVH 1I3GL 4AL8H 1HCFX 3HG1B 1CGSL 1EK3A 5J11B 5FO8A 5GGUB 5JPNB 2Q86B 2DWEA 4F9LC 1CD0A 2FECI 3MA7A 5EC1A 5E08H 1RURH 3I9GL 4WEBH 3MLYH 4OAWB 1HOCB 2AQ3A 2OZ4L 4RQQA 3X3FH 4C4KT 5J06A 5CBEB 2ICEB 3VCLB 3BPLC 1DVFD 4NBZB 5CUSH 1MWAB 3KPQB 3MRKA 5IB2B 5T1KD 4P4KD 4PG9B 4Y4HC 4QXUH 5SX5K 4OT1L 4EUPG 4RBPK 2CDFB 5A16B 3GHBL 3HC0A 4AZ8A 2V6HA 2VXVH 4PJ7E 3TIEB 3GRWA 1C7SA 4PP1C 1IM3A 3TT3L 4ODXB 1WBXB 5LJYH 4Y4FD 4FQXB 2ADJA 3MLTB 4ORGA 3ILPA 2EKJA 1NMAL 1T7WA 3FO0L 4GH7B 5E0QA 1T0NA 5HGBA 3LD8B 4GOSA 5MP6H 1QZ1A 1WJ3A 2GK0A 2VXQH 3NCYS 2VXSL 4PP2B 5MHSD 4BK5A 1AKJA 4YHOH 1FLTX 5AG9A 3WFEL 4GQPH 4PJEA 5FGCB 4MZ3A 4HWZA 1DE4B 2JELL 3TWCL 4P2OB 5DMKB 4LPVA 1T1YA 5SWSB 3H3PH 1JI1A 4S1SL 1OAXL 4PJIF 4IRJC 1CICB 2XTJD 4L3CB 3RQ3A 1AHWC 3Q0HA 4G9FA 5DA0B 4NFCA 5GGSB 1CR9H 1WZLA 2KUTA 3EYSL 2R9HC 3CDYA 4UIKH 4PV9A 1SEBA 4HCRH 3HZYB 3TC9A 3KG5A 3BW9B 5DUPL 3FCTB 3RHWF 1LO2L 4GFTB 1T6WA 3BD5A 5IB5A 2LAGB 3QCUL 3VXOB 4LKCB 4LVNC 4YDJA 1ZHBA 5IVXE 4JN1L 4P3CL 4Y5VA 1JPGA 5ETUB 1M71B 4PJ8C 5C3TA 1BJ1J 3C08H 3HPLA 2H8PA 2FHBA 1BOGA 5TF1L 5D1ZA 3BPLB 4HKBA 5F9JA 4F37K 3VG9C 2DM4A 3NZ8B 3BO8A 4I18A</