1JUFB

Structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords H2-Db major histocompatibility antigen
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jufB00
3MJ9A 4NT6B 2FX8H 1JYVA 4FQQA 4QTIL 5LCVL 3P4OA 2EIBA 3IKKA 4BZ1L 3UZEA 1XF3B 1QPPA 4RGND 3SQOL 2MQ0A 3HUJE 1DBBL 2G60H 2IFFL 4LVHB 1N4XH 3LDBB 4LVHC 1SVZA 1IM9D 3LDBC 3AVEA 4OZIF 5DZOA 4UT6L 4DZ8A 3O41B 3SKNB 1M05A 1WIPA 5C71A 5I73B 2PYED 2E7LC 2J12B 5IHZB 4NRYA 1Y0LB 4QKXB 2WANA 5HGHB 2OP4L 1BEYH 4WCYL 2Y36L 5IVXB 1HI6B 2IBZX 3SDAA 3D39D 4NN7B 1F4XL 3UTSA 1XH3A 5H2BB 3QCTH 4NN7C 1I8KA 5B21A 1X7QB 4FOMA 1TJIH 1K4CB 4ERSH 2NY4C 4OZGA 4QOKA 1BQLH 3W11D 4NQSB 3STLA 4C83B 5I1LB 1UZ8A 3TWCL 4K23L 1I9JH 5I1GL 4ONGH 4OQTA 4HUVA 5DK2A 4LCUA 1P4LB 3KPOA 4V1DB 1T4KA 3MRPB 1OT2A 4ZUWB 1ORQA 2HFGL 4DZBB 1I4FB 3K46A 3PL6D 1KIQB 3FT3A 3V95A 3VW3H 1XMWA 3MRBB 2E27L 1EJ6A 1FAIH 1F13A 5J11B 5J11C 1EAPA 4UNUA 1GRWA 2GSGA 3HNVH 2C5DC 3NTCH 3UAJC 1J0KA 3OKYA 4OZHE 4FRWA 3U9UA 4F58L 3RX8A 3REWA 1RMFH 3SGEI 4MDJA 4G8EA 3VH8B 5DRZA 5MENB 3KLHD 1U8OB 3MRIB 3TBVA 4RISH 3VDBA 3DOSA 4IRSD 1SHMA 3UX9B 5ESQA 3GMPA 4H26B 1PX4A 2CH8A 2NQCA 3EAKA 1QVOA 1D5XB 1SYVB 4R96B 2KPNA 2NW3B 5F6HJ 2BSSA 3OJ2C 3TYFB 1BZ7A 4XPGH 4UILH 2CIKB 2X4NB 1DUZB 2R8SH 3VXUB 3ARGB 5FB8A 4PP1C 4WEBH 2ZPKL 3MOQA 4NCDA 1MFBL 1YC7A 3VU2A 5T1KD 1NUFA 1FBIL 1KEGL 5BS0A 3NA9L 2W60A 2AJUL 3FO9B 1C5CH 1I9RH 4NQCD 3BH8A 2VLLA 4OCLC 3WEXB 4NQDD 3RVUD 3S6CA 2YPLE 1G9NH 4BFBD 1G7IA 5D2LE 5ALBH 4ZNCD 3KXFD 4PLOB 4U0RB 3RNKB 1J5OH 2QR0B 4U0RC 2GAZB 1CXEA 1DDHB 2ED8A 4RGOH 3MV7A 5EZJB 4C56E 4D0DA 4YQXH 5A43C 1KB9K 2W38A 4M7LT 4LVOB 4ONHB 4LVOC 3HZKA 2NY3B 3F7YB 4YHLH 3B2UC 2BY2A 5C0BB 2NY3C 3SCMD 4C59B 5E7FA 3O3DB 5HD8D 4C54A 5TE6L 3WL9B 3N1PC 4XBGA 2V7NA 4P3CL 2J7LA 4UINL 1Q9OB 4NDMA 3SJVE 1IGYA 2VLKE 1GYAA 2ENSA 5EOCH 4X6BB 2A1WH 4NRXB 5DA4A 5HJ3A 4G80B 3RIAF 1N4XL 2HFEA 2AKRA 5FO8A 5KSUB 1HK6A 3BHBB 4KTDH 4P59L 3HN3A 3QDAA 5EBWB 2BJMH 4J3XA 4JM2D 5F93C 1SJHB 4LSVL 1M71B 2A6DB 1J8HE 2DWDA 3VE0B 4GXVL 4HZLA 3IDJA 1DUYA 4IIQA 4JRYB 3QUKB 5DUMH 3M1BB 3MRMA 5B4MC 5I8CA 3GJEB 3PWUA 3F7PC 1ZA6A 4HPYL 2E8YA 5DRNB 5FKAB 4HKJA 3D2UB 2C1PA 5TE4H 4PJDB 4ONGL 1LEGB 1QZ1A 3PDOA 5CFHA 3OKDB 5D1XA 5FV2A 4PJ5A 2AV1B 2EO9A 4JFZH 5DVMA 3SDDC 1EUTA 2IH1A 1W0YT 2PXYA 3VW3L 4UMGA 1E28B 3T3PE 3DYPA 4LMQI 2EDLA 4GRLB 4N5EC 2DKSA 4GRLC 5KZCD 2O5ZH 3MNVB 2R2CA 5TDPB 4OCWH 5F3BA 4H1LG 4ZUVB 4RZCB 5B38B 2VN7A 1J8KA 1FPTL 1VCAA 3L1OH 1AGCA 1X4ZA 1BZ9A 2ZG2A 3TJEL 4LSTL 3V5KA 5GS0C 2XQYK 3GNMH 1I7RA 4YXKL 4L4VB 5T1MA 3ULVL 1XT5A 3WO3B 4TSAH 1E6OH 4OV5B 2ESVD 4LU5L 1L9NA 3S3PA 3RL1A 2JCCA 3DPBA 2VLJB 3WNOA 4HBQA 4UILL 1RAMA 1A9BA 2AK4A 2R8SL 4M9PA 3QDGD 5FA3A 4WEBL 3RWIA 2VXUH 2UZXB 1KPVB 1XCQA 4JQIH 4LIQH 5GSRA 1ZAGA 3Q1SH 3CH1B 2DL9A 5J3HD 3UC0L 4M3JA 5GS1C 4AYFA 3RWJB 1WCBB 1IZKA 2H6PB 2KUTA 1JWUB 3WFDH 1VDGA 4ZS6C 1CD8A 1UWEH 3MV8A 2Q86B 2Z92A 3HG1E 2P47B 4ODWB 2EICA 3I02A 1GHFH 4RMQA 3ULVE 3NZ8B 3GSOB 5DJXB 3ZDZE 5FOJA 1MWAL 3T4AB 5ALBL 3QI9B 4JPVH 1MCOH 2AERT 3QI9C 5T3ZH 1TENA 5ACZB 5JW4N 4OLUL 3IETA 4I18B 4I2XB 4KKNA 4R4BB 4I18C 4DN4H 3HCVB 4DKEL 4JN2A 4Y4FD 3HAEA 4H5SB 2WINA 3JTSA 5MERB 1CFVH 1SJEB 1B0RB 4U1JA 4JZJB 1WQVT 1Q9KB 1AGEB 4FQHA 2FH6A 1FO0H 3QXUA 3EO1A 4KK5C 4RNRA 4EBQH 3CFDA 4U7KA 1MI5A 2VZUA 1FFNB 5EOTA 1FORH 5BZDB 1RZ7H 4RMTA 3QZWA 1MCNA 1EVTC 4BK4A 5GSVA 5I1KH 2XTJB 1EV2E 4J4PA 2XTJC 3A6BH 4NO2A 5CEYB 2C4FT 4CNIB 3DXAA 2V9TA 4KK6C 3C08H 2A1WL 2D4FA 2QL1A 3K8MA 3ARED 4CGTA 2GSIA 4HZAA 4N68A 2Z4QA 3HPJB 2OZ4H 3OB8A 4A2MA 2FX7H 4Y4KB 4GKSA 1MCWM 3BZEB 4Y4KC 3FN3A 4M6OH 3VFWA 1EHAA 1W72A 2FO1A 1BAFH 4HFWB 2JJWA 5D2NA 2BVOB 2FNBA 4EUPH 3P0YL 2JB5H 3IXTB 4OFPA 4HLZG 2ITCB 3FJTA 1ZT7A 4PUBH 5J6HA 2AABH 2X4UA 1A3RL 4HEME 1OGAA 1RZJC 3IRZA 4OLYL 5HY9B 2WUBH 4FQLH 1D5ZB 2VL4A 3T65A 4G6MH 2BOCB 4XAKD 4MXQC 3AFLA 1MOEA 5K9KB 4X9BA 5BZWB 1V8HA 3EFFA 4ZTOL 1G7LA 1LWRA 4F15B 1PY4A 4F15C 3DUHA 1ZXQA 2J8UE 4JFZL 1P5VA 1LNUA 2J8OA 3FQRA 2GW5A 3H9SB 5CSZA 3SGJA 1JHTA 4MA3A 4LHUB 1TQBB 3RP1A 4GRWF 5FDYA 3M45A 5DEFB 1CGTA 1U8PA 4XNMB 4YPJA 2HTLC 2DD8H 4HSQA 2FD6H 3QIBD 4MVBC 1VFBA 5I8KL 2EKJA 1G0XA 5E8DH 1DQLH 2J5LB 5DRXB 4M8VA 2J5LC 1T1YB 4E0RA 1E4XL 4JR9L 2D31B 1T1XB 1BX2A 3DECA 2APWA 3BJ91 4PJAF 2VTFA 2VZVA 3LQAC 3U36B 4UQ3B 4L5FH 3FRUB 3DYMA 4YHMH 4KFZC 5LVEA 1E6OL 1J05B 1FAKT 1FLRH 2I60L 3QJFB 3NFSH 4DFIA 3FZUD 3P11L 1YYMH 1CFTB 1M6OA 2CO7B 4D94A 4KJPC 1GC1H 4DKFH 3ZE1F 2IF7A 3L3JA 2G75B 4NPYB 1F97A 5DVOA 4HGKC 4F7CB 1K8DB 2NXYD 1RJCA 1P6FA 4I77L 5KG9A 5GGTL 4JFEE 3G08B 2XN9E 4P2RA 1KPRB 4LASL 3RKPA 2B1HL 4MJ5B 3TM6A 4S2SB 1A6AA 4U1IB 3HE7A 2A6KB 3MRLB 4P3DA 2VQ1A 3V5DB 1NC4B 5E5RB 1AIFB 5IBTL 1TFHA 1XGRB 3QUMH 1F4YL 4JPVL 5HYIA 5T3ZL 3NIDF 3DIFA 4Q97A 1FNEA 4R9HA 3TVMD 4O9HL 4PG2C 4L4TE 1NDGA 3KPNA 4DN4L 3Q6FB 4YXHH 4PY8J 2OTUB 4CKVX 5L2KB 4R4FL 1CFVL 3BE1H 3O3EA 3VXMA 1TVBA 1ZWIB 1GGCH 3GSQB 4JM2F 4NSKA 2P5EE 1FO0L 3MRQA 3MV9B 4EBQL 3RZCD 3GHBH 2NX5D 1U9KA 3KG5A 4Z7WB 3P2TA 3EJYD 1M1SA 1I1AC 5AZEL 4N90E 1F3JB 4N1HB 3A6BL 4MA7L 3C08L 4U1MA 3UYPA 5HI5C 1KV3A 5E95B 1O7SA 4S1DC 4LLAA 4QRPB 3LSOB 4M7JH 4Q2ZA 4UUJB 5FF6B 2FX7L 2ZUSA 1I7ZB 4X98A 1MCWW 4PJ9B 4X9FA 1MCFA 4PJ9C 4XVSH 3RVVC 1JRHI 1LD9A 2A74B 1IQWH 2JB5L 1W2KT 2X05A 4JY6A 3BXNA 4IS6B 5ETUA 5JHDD 2XWJB 4HGWB 1F8TL 4BH8A 2VIRA 5BJTA 3PWPB 1XGQA 2HH0L 4PJXB 4GQ9H 3L7FA 4G6ML 4MS8D 3BO8B 3FN0H 4ODUA 2F19H 1AE6L 3JBG7 5DC4B 5C08A 2P24B 5DURD 5FUZL 3BKJL 4CAGA 1QSED 4NNPL 2FIRT 1L7TL 2EIZB 3LHPH 4ACPA 3ZE0E 2VZOA 5B39A 4L9LA 3PIQB 4GKNA 1OAUH 2CIIB 1DQMH 3L95B 1T20A 3VGDA 5GGVH 1X5ZA 2V7HA 4KKBC 4X6CB 1RHFA 1WC7A 2R56H 4NHUA 1S9XA 4ALAL 1IGJA 4H20H 3B9KA 2X4RB 1EFXA 1CTNA 1LO4H 1A7PH 1ZA3B 2VXQL 2M2DA 5EUOF 3O45B 1P84J 4Z7VE 5FOBB 4X6DF 4I3SL 1NCCH 1ONQA 3WHXB 2XIDA 1WZLA 3JV4A 1AY1H 3GRWL 1A3LH 3EKCA 3MRGA 1WFUA 2VXSH 1U93B 3B2VH 1AJ7L 3H6JA 1TITA 1NBZA 1OCWH 1T5XB 1KCVH 1I9IL 4HUUA 4ZFFA 2LU3A 4Y5YB 1KNOB 4Y5YC 3AM8A 4DKFL 2CLRB 5D7LE 2VAJA 3MRJB 4YFDB 2JB6A 4U1SB 1CICB 2HVKA 1JMZA 1CICC 5EU7C 4ZOAA 4KQ3H 4KI5E 1XIWB 3E6FB 5JPMA 5EU3B 1XIWC 5ENWB 4GW5B 1A9EB 1Z5LA 4W81A 3RHWK 4I0CC 1NGYB 2VAAB 3QDJE 2Q76B 3Q0HA 1QSVA 1FL5A 1OLZA 4YHPB 5GIRB 2DQTH 1P1ZB 3G04A 5D70L 3HUJB 5DJ6A 1BJ1H 3AY4C 2P7TB 3ULUF 2IG2H 5MEND 4AG4H 1CT8A 4YXHL 2UZIL 1F45A 3LMJL 1EVUA 3EIFA 2EYTB 4XWGL 3WS3A 2IJ0C 3N50A 1FL3B 3PXJA 5DJZA 4AIOA 3QIWB 3DGGB 1HHGB 2XPGA 1YYLH 2XFXB 3VGBA 1B0GA 3E8UH 4EIGB 3VFUA 1X5YA 3D3VA 4WFFE 3FQTB 4PP1D 1T89C 3F7VB 3ARGD 3VXUD 4U6XA 3TNMA 4PG9B 1B4JH 2G9HB 5DD1L 2GJZA 1DANT 2FGWH 4FXKA 2IBGA 3PF2A 4GAYB 1PZ5B 5D5MF 3ZL4H 3VFVA 2QHLA 5I1CL 3LH2H 1UKTA 3TT1L 3B8YA 1V3KA 2IANA 4WWKA 1IL1B 1FIEA 1H0DA 1S7VB 2R1WB 5IHUH 1LDSA 1JGDA 2DBLH 2A6IA 3U0TB 1TIUA 1DQDL 4UI2A 3V0VA 4HS6B 3GSUA 3LRHA 5HHNA 3THML 3HRPA 3IFNH 2ZUTA 4ZUUA 4RRPG 3QEQE 5HHME 3C60B 3K4DA 1JV5A 2O61B 3C60C 2B0SH 4OZHB 3UPCA 1S9WB 4DJMA 1X6LA 3QCUH 1R5WB 2IPKA 5K59E 5I16A 5F1IB 4MCYB 3RGVC 1FZJB 4LVNB 4GQ9L 4X6FA 5F9WC 4M3KB 3B2UD 4LVNC 2NY3D 8CGTA 3MCKA 5C0BD 4OCXH 4PY7B 1IKFL 3N06B 2ZOKB 4JPIA 3HZYA 3QQ4B 4LEOB 5MEOB 4UIMB 4WWID 3HRZA 3N9GH 4N0CC 3ARFB 1DQML 2PO6A 1JNLH 3ARFC 4LNRB 4NO5B 3S3SA 3MV11 4CVWA 4F7MA 2DQCH 4GG8B 3LD8B 4O2CA 4XZUA 3KWWA 2R56L 4P2QA 3LD8C 3CZFA 1NGPH 4PJGE 4WU7B 4QHUB 1DQJA 3ELAT 4NKDB 5SWQB 1A7PL 4NNXA 5FV1L 4NWTL 4LNVA 4M8QA 1C12B 2XA3A 3HC0A 1QKZL 1NCCL 4YBQC 2BSRB 4ZNEA 3I6GB 1AY1L 2YPLB 3GBML 4U6HB 4PJCE 4DW2H 4JRYD 4C4KO 2IQ9H 3PHQB 5ICYB 5D2LB 4LRIA 1KF9B 5AD0A 4Y7MA 1OCWL 1YECH 2XV6B 4BYHA 5FK9A 4K3HA 4KY1L 5I1EH 3D2UD 3ZKXC 3LY6A 1MJ7L 1UVQB 3BEVA 1QLRA 3CSYA 3DRQA 4X5XB 4JG1H 2O26U 3K81A 5IFJA 1T3FA 4ODHH 4Q6IA 1A8JH 4FFWC 1IQDB 4LHQB 5FYLH 5JA9A 4K3JH 4ZAKA 5CEZD 4QXUL 4KRLB 4L8CB 3QXDB 4N5ED 4AK1A 4GRLD 1UH3A 4CJ1A 4YZFE 2VLKB 2DLTA 3O2DH 1NLBL 3C09B 3MLXL 3ZTJH 5T3XH 3C09C 5MI0C 5JOFB 1QRNA 1R0AL 4LLMB 4Z7UB 5INDA 2VR9A 3Q2CA 4AG4L 4X0KA 2CJUH 3NCYS 1AFVH 1ZGLM 1AR1D 4L4VD 2QQLL 2HVJB 3GUTB 4CL7A 4OTXH 2AGJL 3MRRB 1AGDA 2GTZB 1J8HB 2OZ4A 3RZWA 1HHKA 2Z91B 2OMBA 5JNYA 4UB0L 3GMMA 5J4MA 4JFFA 1KFAH 2B4CL 2QADC 2VLJD 5E8OB 4BSJA 1WBZA 3TT3H 3VH8G 3O2VH 4M1DL 4EUPA 1FSKB 5IHBA 4FNLH 1FSKC 1RU9L 2A6JB 3H2WA 4ELMA 1B4JL 1X9QA 3O8XA 3KPSB 4CMMA 2V2WB 5CKAA 1KJ2H 3IJSA 1H3UA 4D9QE 4YGAB 3QNXA 1A21A 4ZS6D 3LH2L 1F42A 4HIXL 4RQQA 5DHXB 1TJGH 1N59A 5I15H 1JNNH 3V4PL 4YGVB 5I8EB 1O7VA 3IDYB 3IDGA 3L7EB 1O0VA 1JGLH 1UA6L 3IDYC 1KTDA 5CAYB 5J57B 4DGIL 4HBCH 3L3IB 5EZOH 1VHPA 3QI9D 2VOTA 3L5HA 3K4ZA 2OTWA 4E5XB 3UTSE 4NQEB 1N5AA 2YD8A 3WUWB 4QOKE 2GJJA 1LO5B 4IRJC 4BSVA 2ZCHL 4EQ3A 1ROWA 4KK5D 3P73A 2F9BT 2IBZY 3CLFH 5D1QA 3MXWL 3GSVA 3GFUA 3OKNA 4NWUH 1OP5K 3LN5B 3N1MC 5EFIA 5IVXF 4W4NA 5DJAA 1QLFB 3QFDB 3P30H 5A2JH 1N6UA 1KC5H 5DWUL 1MH5B 2XTJD 4I0KA 4PRNB 3HZMB 4HH9B 3LZFH 3QG6B 4KK6D 3VG0H 3UTZB 1JNLL 1VFAB 3HC3H 1A1OB 1H8SA 4BSWA 1BVKB 2DQCL 4PRDA 2K7PA 2X4TA 4LDLB 4D0CA 3PWLB 2H1PH 1NGPL 2LTQB 5F21B 4H8WL 2LTQC 4Y4KD 4PR5A 4ZO6A 3FOMA 4KKAC 1NC2B 3B5TA 3PGFL 3W0WA 1HILB 2Q3AA 4UDTA 1IT9H 3SE4C 4CMHB 4CMHC 3I6LE 4N0UA 3HG1B 2D7OA 1AGBB 5J9PB 2DMCA 3ULVC 3AUVA 1FDLL 5HHVL 2MTPA 3TN0B 2OX5A 4M5YH 3TN0C 2BC4B 2OJZH 3O6LH 4P2YA 3QUMA 4MXQD 3MUY1 4HIIB 3UTPD 1O5DT 4QHKJ 3RL2A 4JG1L 1NJ9B 4JFDB 4Q6YA 1Y18B 1D6EA 4F33A 4PLJC 4ODHL 2XQBL 2YD7A 3RY6A 4KMLB 3H9SD 4LQ1A 5CUSH 4G8GA 4LHUD 1FZOB 2VABA 1HQ4A 1I3VA 2HTLD 5CZVH 3IU3B 5LBSH 4TUJB 3MUGB 1GZQB 3EO9H 4MVBD 5T3XL 1PEZA 1XR9A 4U7MA 1DBJH 4DGYH 1MWAB 4ZXBA 2JJUA 3Q6GH 3EOBB 2DLHA 4OB5L 3IYLW 2CJUL 4PJFB 1C1EH 3AXLA 2QSCH 3MV7E 3EOAB 4YAQA 4OCYL 1N7ML 1PYWB 1QP1A 2DI8A 2DYPB 3DHJA 1ZLSL 2Y6SD 4MX7B 1UM5H 5FUOL 3OF6D 3O3UN 4G7YH 2RCSH 5B38G 3OXRA 1ZT4A 4KJPD 5GZOC 3ARZA 4RFEB 1NGXA 3TT3L 4XXCC 1KCUL 2IAMA 2IQAB 5HGBB 3VRLE 1OAXH 3X14B 1BOYA 3E0GA 1KJ2L 2CUIA 3AMKA 5CGTA 3B4NA 5C9JB 4OF6A 2EDDA 5L7XH 7CGTA 3UBXI 1NC4D 1TJGL 5DI8A 4PRPA 4NYLB 1DSFH 2DTMH 4HC1L 2P8LA 1JGLL 2UV3A 5E2WH 1YY9C 2DTSA 5C8JB 1YEDA 2HT2C 3MLRH 5F71A 2VO5A 1N8ZB 4NCC2 2NCMA 1S7SA 1YEFH 4JJ5A 5I2IB 1YA5A 4F9PA 3FFDB 3MYJB 4G6JH 3CFKB 3UYRH 5L2KD 2E7HA 3MUHL 4KTEL 2WBJB 1TCRB 1E4KC 2APFA 4EN3A 5F7EL 4IMLB 1QHOA 4Y8DC 1H8NA 4U1LA 4YDKH 3MQIA 3CLFL 3MV9D 4L8BB 5E2TL 4UV7H 1UB5B 4PJ5E 5JIIA 4CU8A 4G43A 3HFML 3B9AA 1GGTA 2H45A 1RHHB 1DQQA 2NY0B 3O4OB 1I1YB 1T0MA 3FTGA 3LZFL 1XGPB 3O4OC 3LKOA 4MAYA 1PAMA 1TJHH 3FMGH 4S1DD 3ZDYF 4YNYB 4PJDF 4QRPD 2P8PB 5DLMH 2XN9B 3D85A 1LMKA 3WJLA 3QNZA 2VR5A 2Z35B 5TE7H 3H7LA 1VFMA 1B6DA 2NY2B 4PJ9D 2NY2C 5GGSA 1RUML 3T08A 2D3VA 4K7PY 2HKFL 3WLWC 4ODTH 1KTRL 4L4JA 3W5MA 3VA2C 2P48B 5T5FH 4WI2A 4UQ2A 2HT3D 4JFPB 2JCCE 4NGHH 3BWAA 2EZ0C 3D69B 1IFHH 4M5YL 4LCCB 4Y1AB 3PWPD 3INUH 1ZHBB 4LCCC 4MD5B 2AK4E 3WHE0 4WO4B 1KTLA 5GJSH 3C8KA 2Q8AH 4WO4C 5DSCB 1J86A 12E8H 4WDIA 5GGUB 3Q5TA 4NM4H 3EDDA 2IEPA 3MREB 4PBXA 4QLRA 3FB6B 4OD3H 1JMXA 3G5ZA 1A2YA 3CSBA 4KKBD 1L7IL 5CZVL 5HYSG 4LMQE 1BBJA 4MA8H 3EO9L 2QKIB 5IT2H 4AH2A 4AMKL 1ND0B 4ZFZB 3DI3B 4QHNA 1YEKL 4BFIA 2D4DA 5IIEA 3D0VA 2CO6B 15C8H 5E56A 1U8HA 4KV5E 2F8OA 2YBRB 3LKPA 4K94L 1X4YA 5BQ7A 1U8IA 3K8LA 3LN4B 1HSAA 3TNNA 2J88H 4G7YL 2RCSL 4OGAC 4JDZA 4XH2B 5FGBC 1CD1A 3TO2B 1MI5E 1YN6B 4AT6B 2ARJB 2H2SD 4LQFH 4Q9CA 2I9TB 3VRJB 1CICD 2AXFA 3VGEA 4EVNB 1OAXL 4J23A 3DXAE 3CU1A 4LPVA 5D71L 2B1AH 2R0WL 1XIWD 5KJRL 4NRZA 2X9XA 1JUFA 5L7XL 1Y6NR 2X4SA 2WBKA 4WENB 5IJVB 3QO1B 4R90L 2DTML 4BUHA 3CSPA 2FZ3B 4HKXB 5E2WL 3L3GA 4JFQB 1RZ8B 4FP8H 5D2NE 3H8NA 4UTAL 4WIQA 1XF2B 1NAMH 3BP5A 1YEFL 3HI5H 1MY5A 1G84A 4XX1E 4ETQA 1OGAE 4G6JL 4PTUB 3FB5A 3IJHB 3UYRL 1RSFA 5TJWK 5JORA 3KS0H 3QIWD 5C6TL 1IGIH 4XI5C 1IEBA 4AM0A 2RFXA 3RWCA 3SDXB 3RUGA 4HWZB 3O9WA 1RULH 3W5NA 2ITDB 5FGRA 2WSKA 4XCCL 5BOZG 1A64A 2VZTA 4G8FA 1G7HB 4XWOC 3MPCA 2WUCH 4YPGB 2J4WH 4QRQB 4JM4H 4S1SH 5GRVK 2DMKA 3LCYA 1NANH 2F54A 1XF5A 4TYUA 5BV7L 4NN5C 2BSTB 1FYTA 5CD3B 4LGRB 4NC1E 3VXSA 3WFZA 1NEZB 1U95A 2XKUA 3QDJB 2ADJA 4ODTL 1U92A 1Y6MR 5FECB 5CJBA 4LKXA 3KDMA 4FQ1H 3C60D 4ZS7H 3S5LA 2GK2A 4I9WD 1MEXL 3O2DA 3S35H 2NXZB 4OZFA 2R0ZH 3DGCR 4TVPL 2NXZC 3GO1H 4P23B 5DEGA 2D0HA 2IGFH 5D8JL 4ZPVA 4Z77A 3EGSB 4P23C 1FHGA 2ATKA 2GY5A 2ED7A 5A2LH 3QUXD 4J3TA 5GJSL 2Q8AL 3OBAA 4WNQB 4D8PA 2RQ8A 1G0DA 1SYSA 12E8L 4W4OC 4Z7NF 4P2RE 5D6DC 4LLUB 1FG9C 1OF2A 1DFBH 2C4XA 4N0CD 1IMHC 2ZSWB 3ARFD 5CBAB 2DJ4A 1UKSA 1W8NA 2B8OT 1WAAF 1BJMA 1JN6A 4G42B 1F2QA 3AGVA 4MA8L 1QFWH 3DO3A 5IT2L 1M7DA 4Y2DA 2KZ1B 3BMVA 5C09A 2FSEB 4K3EH 1BQSA 1WGOA 5CILH 1MLCA 1P7KB 1EEYB 1VPOL 4YBQD 4G7VH 15C8L 3AAZB 3DX7B 2YPLD 1IGFL 1RZGA 3QR2A 2PTTB 4OCSH 1J1OL 5IEKB 4XCYB 1A7OL 1P4IH 3QAZB 5ICXB 4MSWA 3RA7H 5FDWA 3QAZC 4YC2B 4BH7A 4YC2C 3QEQB 5HHMB 3W9EB 4JCMA 4M1CC 2ORBH 2C3VB 2VC2H 1UADC 5I1IL 4I5BB 1HYSC 4PREB 5CHNA 2NY7H 3VJ6B 3OAYH 4FFWD 1U8LB 3MLTA 2B1AL 2SEBA 3T4YB 4OV6F 5F6IB 5EN2B 2WWKO 3P4MA 3OGCA 1S7WB 5F6IC 1MUJA 2MMXA 1MVFA 1MJJA 3SJVD 1PKQB 2VLKD 5L88H 2R2BB 1ZANL 1T5WA 4XBEH 5AWNL 1DBAH 4Z7WF 2XNAA 1OW0A 1HSBA 1U3YA 1U8JB 3U4BH 4OFKA 1A1NA 3D5OF 2ADFL 5FO9A 3MLYH 2EXWC 2BNRA 2ICES 2ZZUT 4ONOA 3HI5L 4NZUL 4RSVA 1NMBH 2H26B 3QWRD 3V6FA 4OF0A 3LEXB 1VENA 3SGDI 1J8HD 3BZFA 3BFOA 4PJHA 1LK2B 2A9NL 4KJWC 4P57B 4FQIL 5C08E 1JRHL 3HZVB 1HZHH 2YK1H 4N1EA 2RB8A 2HP4A 4PJCB 2EE2A 3ZKNC 5BRZB 1ZLVH 1OAYL 3KR3L 5D7KD 3B9VA 4RBPK 2VUOA 2E5EA 4PJIB 3WUZA 1HXYB 4RDQG 3KPSD 4X5WA 5HDQH 4HJGA 1VB9A 2FL5B 1Q0XH 3H42L 4PJXF 4G3YL 5EC2B 1D5BB 2XWBA 4OGYL 4IDJH 4S1SL 3VXQA 4P4KA 3TV3H 3BH9A 2EYRA 3G5VB 3BWUC 1X3DA 3E6HB 4BZYA 2VISA 1QR1B 3ESVF 1S7QA 2ENYA 4D2NA 1KCSH 3F12A 4UBDC 2ZG1A 3IKCA 3SDYH 5DK3A 3MLSH 1G7PA 1DBKL 4G6FB 2AVGA 4NQED 3G6JA 3LRSA 3CPLB 5LKNA 2GUOA 3S35L 3CFEA 4H1LH 1K4DB 1MNUH 3GO1L 1WZ1H 4M61A 2IGFL 2GCYA 2EH7H 2ZUVA 4MJ4A 1OM3L 5LWYL 2BY0A 5DJ8B 5SWSA 1WBXA 1K6QH 3KYOB 3MFGB 3MRKB 5DD6B 1PQZB 5J1AB 5JW5B 4NOBA 1DFBL 3BYYA 1K8IA 3VRIA 2PTVA 4WFHE 4Y19A 5HVHB 4RFOL 3ZE2E 1T2JA 1NCWH 5E9DA 5C0NC 4KXZH 1MCEA 2AEQH 5D72L 4X99A 3VD9A 1JHKL 4IHOB 2YD5A 3RVXC 4MJIA 5IEHA 1MJUH 3S3JA 5IMMA 4ELKA 4KKAD 5CJ8A 3SE9L 5CILL 1NC2D 3MODH 3S37H 1OQOA 4XHJC 1M05B 5DHVB 4CADB 5KBNC 4G7VL 4GRWH 2EH8L 3KPLA 1CK0H 3WJJC 3HG1D 3IDMA 3HKFA 1M7IB 1Q72L 3ULVD 5EOCJ 5DMIH 3L5WB 3E1F1 5C0DB 4Z6AT 1P4IL 1T80A 3RA7L 3TN0D 3NZHH 3GGWB 3HUJF 3SDAB 1BVZA 4XVTH 1XH3B 2GJ6A 3RX5A 2B4CC 4LCYA 4O58H 5MP6H 2VQTA 1KN2L 1VGKB 4QOKB 5DUPH 4JAMB 2PW1B 3STLB 1FIGH 1MFCL 4JFDD 4R3SB 4XP9H 1UZ8B 4WW2B 3DO7A 3L3OA 4WW2C 2Y7QA 3K3QA 4RDQF 2JIXB 2LFGA 3G5XB 2XZZA 3ECBB 1I3RB 1SBSH 5E2VH 2IANE 4FG6C 1L6ZA 5GJTH 5L88L 3CFJA 3OAZH 4XBEL 1AQKL 1KJMB 1DBAL 3O3BA 4L3CA 3O6KL 2MPAH 3QRGH 3MLYL 3VFGH 3OR6B 2AXGA 1NLDH 1TZGH 3GSWB 4XHQA 2YWZA 1PX3A 5AUMA 3QXVA 5IB4A 4YWGH 1MF2H 3CC5B 3I9GL 5TQ2H 3REWB 2MFNA 1R6VA 5JZ7C 2Q7YA 5IMKB 4U4BA 2DYPD 4DCQB 1AO7A 5JUEH 5D96C 5IFAH 4PJ7A 1BQHA 5GZOD 3DX8A 1HZHL 1FFOB 3WFHA 4GUPB 1LE9B 1P7HL 2A9MH 2D0FA 5EZIL 4APQB 2OSLB 4APQC 3QISA 1NL0L 4F2MB 2BNQB 2DJUA 4M7LL 5B8CA 1BZ7B 4OZIA 4GW4A 4OZHF 3TIEB 3EJJX 5DVKA 2GEEA 3GBLA 1Q0XL 3VXPB 1TETH 4P2QE 1NUNB 3NFPA 2FWOA 5KVFL 1N3NA 1YEJL 4WW1B 4PYHA 4GG6E 4UDUB 1RIVL 1JZ6A 1FGVH 2W60B 4H8WC 4LIQE 1WTGT 1YY9D 4XTRC 4N9OB 4WI5A 3BH8B 3CVIL 5EOQH 2HT2D 4ZNEE 2EC9T 2XYCA 3UDWA 2BP3A 1HYRC 2VDMH 4D9RD 2JELH 2YA2A 1OQXA 2XRAL 1MNUL 3ULSA 2WBJD 2G5RA 4UTBH 4QNPE 4DTGH 2W0FA 4D0DB 3OPZH 3H7BA 4HJ0C 3WFBH 3CDCA 3MA7A 2GIYA 3HZKB 1OT1A 3DURA 5DJ2B 2MKLC 1I1CA 2NY0D 4XBGB 2V7NB 5D2LF 3PWJB 2BCKA 3NH7H 4NDMB 2JJTC 4X9IA 4ENEC 4OLWH 1IGYB 4FFVC 1BZQK 1J0JA 4TN9A 4J3OC 1QRNE 3WMSA 2XN9D 5HJ3B 1MJUL 4J1UA 3H0TB 2HFEB 4XP4L 5F88A 2AKRB 4PB0H 5FO8B 4BKLA 3S7GA 2NY2D 4XCFL 2BY1A 4F7TA 3GKZA 4MDIB 3I75B 2VNCA 4YHIB 3WLWD 1PG7W 4GJTB 5C7XL 3DLQR 2VITA 1E4WL 4RMVA 1YDPA 4YDJA 4YDIH 1UEYA 4NKOA 4ZSOA 4LSRH 3NVQA 2EZ0D 5JLZA 2B2XH 3IDJB 4JFFE 2UWEB 3C2AH 4F8TA 2ZCKH 4XVTL 3SDCA 4Z7UF 4L4TD 1RUPH 3MRMB 3EW3B 5I8CB 4WO4D 1SEQL 4O58L 2D03H 5MP6L 1DN0A 1FFQA 4ELME 1NAMA 1C5BH 4XP9L 1WFTA 2WW8A 1HKFA 2A2QT 1Q9WA 3UO1H 1MCPL 3VG9B 1QLEH 1OP9A 4LLDB 3VG9C 4CVXA 4IOIB 1MCQA 1SY6H 2D7QA 1ORSA 4PJ5B 2V5MA 4OD2B 1S5IH 1SMAA 3U82B 2IH1B 3A0OA 5GJTL 1CFNA 1D5MA 1WF5A 3K2MC 3IVKA 2Q8BL 2WZPD 3VD7A 4HD9A 4X83A 3U4AA 3QH3B 3OB0H 4LAQL 4MHHG 4Y2OA 1JF1A 1BD2E 3QRGL 4M7KL 4MLSA 5F3BB 2DQFA 3D9AH 3TBSB 1QFWI 4XP6H 3D25B 5K93A 1N6QL 1CN4A 8FABB 4YWGL 1X5XA 1MF2L 3CAFA 4KJYB 3HB3C 4LFHD 4RMUA 4I48A 3CCHA 3V5KB 4XCNA 5JUEL 4OGAD 1U3HA 5HGGS 3T3PF 4CBPA 2Z31B 1EJOH 2Z31C 1AP2A 3OKEB 2PW2A 4IDLA 4X7TA 5ALCH 2X6MA 3ARBB 1MREH 3C6SB 3ARBC 2XKSA 4ZO7A 1S7XA 4FN0A 4ISVB 3VFTA 1DTUA 5TDOB 1HQRA 5E00A 3WKMH 5FA3B 3RWIB 1XGUA 2ICWI 1TETL 1XCQB 3QPXH 3RBSA 4K7FA 3ZLQC 3BQUA 4X8JB 4S0TD 1EA9C 1KJVB 3MBEB 3QJHA 2LAAA 3MBEC 4JPWH 4JO3L 2C1OA 2PNDA 5KANG 3W0WE 3SOBH 5EOQL 4N0UE 2Z92B 4YFLF 1F6LL 1FN4B 3LS4H 3EYFA 5T1LB 3Q3GA 1LK3L 4K9EC 1HKLH 1KT2B 2FX9H 4R8WH 2QSVA 4UAOB 2F53A 1LILA 4RX4D 4UAOC 3UP1A 4IMKC 1EGJH 2X10A 1ITCA 1SEBA 4KUCD 5AEAA 4LRNH 2LQRA 3RIFK 2IALB 1FH5H 2JELL 2K7QA 2MQCA 5CIPH 3V0AC 5FEBA 5IW1A 1R3HB 4D3CH 4P5TB 2DQDH 4P5TC 3HAEB 1H3XA 2WINB 3GI9H 4U1JB 4JQXC 2LU7A 2CLZA 4FQHB 1HH9A 1FJ1B 4GBXA 3EO1B 3ULVF 3MGTA 4PRHB 5M95B 4G8GE 4LDEB 3ZDZF 3CFDB 2HA1A 1MI5B 4F8QA 1WZMA 1GOGA 3NH7L 4P5MA 2J6EL 5I8OH 1PY9A 3TPUA 3BEWA 4FTVA 1UCBL 3QEHB 4HCRL 4NO2B 4J4PC 3RU8L 3DXAB 4XMLH 4KI5D 1KSRA 1UXSB 4RWYL 4PB0L 3BZ4A 5C70A 1J9CT 3IDNB 3F6LA 3B9DA 4NHCH 3QDJD 3ARDA 1CGSH 5GGQL 1LEIA 4GKSB 3VFWB 3BDYH 5D2NB 4K94C 1MHEA 5D2NC 2NXZD 5LGJB 2DM3A 3C2AL 4JDTH 4P23D 3OB0K 3K0WA 3B3IA 3U2SB 1RUPL 3C5ZA 1IBGH 2CK2A 4KHXL 4XBPB 4K07A 2EDQA 1FVDB 4XPBH 5FYKU 4NZTH 3FFCA 1AI1H 4G5ZH 4HAGA 1V7NH 2I26N 3UO1L 3LS5L 1C5DA 2HWZH 1RUQH 3BPNB 5KTEL 1S5IL 3QA3A 1LNUB 3CZJA 4PRPE 3FQRB 2FJGA 5L6YH 3NABL 2HN7A 1JHTB 2ADGA 1EO8L 1IM3A 1FV1B 3N1QC 1IM9A 3RI5F 4AENA 5K9JH 5DQDL 1ZLUH 3BP6A 1VFBB 3QHTC 1BVLA 4KXZI 1AQDA 1T22A 3D9AL 4MLIA 5E4EB 4TSCH 5E4EC 3EOTL 2PYEA 1SQ2N 4NC2B 3CD4A 4XP1H 1HOCA 1NQBA 1BX2B 1QFUH 1UC6A 2APBA 2J8UF 1KXTB 1OARH 3KPPA 4OLXL 1KB5H 1H3WM 2FGZA 2HRLA 4EJ1C 3X13B 3ULUL 4OF5A 1OGTA 3OV6A 3QEQD 4M1CD 5HHMD 1EJOL 4Q0XH 4QXTA 3WO4B 1HYSD 5ALCL 3D0LA 4DWHA 1F00I 4AL8H 1M6OB 3HNSH 4NO3B 1CXLA 1ZS8A 5EBMA 5I18H 2MCPL 5IWLC 3MRHA 2C7UB 4F3FA 3EZ8A 3K80A 1XCTA 5KG9B 1T0NA 3RTQA 2HFFA 2FCBA 3VGGA 5IOPB 4JRWA 4O51B 5ESVB 5BV7B 4JPWL 2VL5A 4MCZA 2X4QA 1A6AB 3P9LA 1AHWA 5BV7C 3HE7B 4YDVB 4NUJB 5I1AA 3HE7C 2VQ1B 3PG2A 5GXBB 1Q94A 3SOBL 1CYGA 4KUZH 3FT2B 4MNHB 2DQJH 2EXWD 4JEGB 1HKLL 4MQ7A 3F7QA 1NCDL 4R8WL 5JIKA 5HPMA 5J6GA 4KHTH 5LG1A 5I30H 1WITA 4LRNL 1FH5L 4IRSA 4XC1H 3QIUB 4KJWD 1NDGB 4D3CL 2FH8A 1NH6A 3QIUC 4JRXA 5I1DB 3R0MA 1MRFL 1JZ5A 5CMAB 4OSUL 5LAXA 4E9LA 5DMYA 3W39A 1A02N 3ZKND 3GI9L 4Z0BH 5HHPA 5BRZD 1BJ1J 5CS7A 3VXRB 4X9HA 2I9LA 5CP3H 2W91A 2VDOL 3MRQB 1T7WA 2VE6B 4JY4A 1A4KA 4Z7OF 4GKZB 3TPKA 4PRIA 2K3TA 1GCFA 3TBYB 5F6HI 5CEXA 5C07B 5T1KA 2BVPA 4QY8A 1UH2A 4U3XA 4CVZA 4EQ2A 3BYTA 2P1YA 3L5JA 4NQCA 1DE4B 3SKJH 1DBMH 4NHCL 5HYQB 3ZT5A 5E8NA 5DUBB 3WBDA 4FABH 4YK4B 4YK4C 4G6FD 3HMWL 2FLBT 1EEZA 4J3VA 3UMTA 1LD9B 1IAOB 1IARB 3KXFA 2QHRH 2APTA 3KGRA 4MJ6A 1DP0A 4ZUTA 4QO1A 4GKOA 3BXNB 1ZKAA 4P46B 3O3AA 4U2YA 4P46C 4F7PA 5CD5D 5BJTB 4HXBH 5EC1B 3V4VH 3SCMA 2HAZA 3TJHC 3FAXA 4J6RH 5ANMA 1I1RA 4PPTA 2HWZL 4X8XA 1P5UA 4HX1A 4R7NA 5GS2D 3CH8A 1MHPH 4Q7DA 3C5JA 3BUYA 5L6YL 1RZIB 5F7DA 3BX7C 1HIMH 1QQDA 3NFNA 1T20B 3G5YA 5INCA 3U46A 4D9QD 1LEKA 1G7JB 4O02L 1EXUA 4XHJD 3G6DL 5K9JL 3QCVL 1IGJB 4XAWH 2E6PA 3X3GH 5SWZB 4TPRL 3TCXA 1EFXB 5C92A 3JV6A 5J1TC 4JM2A 2X4OB 5DFTA 1QFUL 3IFLH 5ELIA 3P0VH 4CJ0A 4JANB 4HFUL 1OARL 3IAQA 3GIZL 1QBMH 3HI1B 4PV8A 3SDAD 4WVRA 4M9OA 1ZVSA 3RUGE 3S34L 4HUUB 4P49A 4WRLA 4AEEA 4QOKD 5MEPA 4GAGH 4OI9A 4POUB 4E42B 5I18L 1MAMH 4KUCF 3AM8C 3MRDA 2H32B 2VDKH 2JIXD 2X7LA 4XNQA 3JUYA 2P44B 3GBNH 3J7HA 2F5AH 4Z7VF 2OL3A 3BMWA 2HVKB 1BECA 1JZ4A 4N8VB 4XCEA 4FG6D 1OP3K 4KJQD 3T77A 4LLVA 5JPMB 2F54E 2YSSB 1DL7L 4ORGA 1FYTE 5F9JB 3SDXF 3HE6A 1UM4H 3JVGA 1CFBA 1FL5B 2F58H 5FYLE 4HS3A 4KUZL 4Y89A 3T0XA 3ARSA 5EZLA 1N64H 3G04B 4HDIB 5DJ6B 5ACLA 4QHMA 3LVEA 5JZ7D 5C2BH 1ZEAH 5ADPH 2WP3T 4KI5F 2NW2B 1CT8B 1MRDH 3FB7B 3I6LD 2ZKHH 4EDWH 1PG7H 3JTTB 3KHQA 4Z0BL 4PJEA 2QQKH 2ZUQC 3O6FA 2AJVH 2AEWA 2D7TL 2OR8A 2EEDA 3IU4L 4APQD 2NY5L 2XPGB 3FB8B 3U79A 2BNQD 3WIFB 5GHWL 3O6MH 4XXDB 4OF7A 5BW7C 4WFGE 4QXWA 1TVHA 2X89D 3C6LB 3CSGA 3QDGA 4BK5A 3C6LC 2EIDA 2VH5H 3VGHA 5DT1L 3RDTB 4FXKB 3RDTC 2N56A 3ILQD 5C09E 3WNMA 5I76A 4XTRD 1JPTL 3NCBB 4G9DA 5I19H 5FUCE 1G9ML 2CGRH 2G5BB 2VLRB 5IB1B 1CI5A 2LVCA 4YFLI 2A6IB 5DJCB 1SY6A 4MNGB 5HHNB 3GSUB 3U7WL 3MUZ1 4ZUUB 4QT5A 2PETA 1JV5B 2NPLX 1JNJA 2CRYA 2IPKB 1G0YR 5TH2A 5I16B 1FNLA 5CEZH 4HJ0D 5LXGH 4CU7A 4OUUB 1NSNL 2A0LC 2QQNH 4HXBL 3FO0L 1Q1JH 3V4VL 1JWSB 4ZD3L 3CIQA 3MCKB 5TQ0H 3BIBX 1PLGL 5A16B 2GYSA 4J6RL 3V7MA 3MLPA 1G6RL 1P84K 2CDEA 3VXNB 4ENED 2VDNL 1T21A 3HZYB 4LKCA 5ISZB 2VZ3A 3QWOA 4NKIL 1DEEB 1J87A 3VFNB 2R23B 3WN5A 1F58L 2WLYA 1DEDA 1LDPH 1HIML 5K59F 4WUKH 4F7MB 4JVWA 4MHHI 4M93B 1KLUA 4NZJA 5I1JH 5M7QA 3QULB 5ADOL 4P2QB 2BNRE 3CZFB 1AD0A 4DK6A 3NAAH 4GG6B 2FB4L 5HHXH 3B5GA 3DX9A 3DTXA 3V6BR 1S8DA 4F7EB 3IFLL 4M8QB 1VERA 1R3IH 4PTTB 3HC0B 4PJHE 5I1HL 2Z93A 2DM2A 3LQMA 5ICZA 1MHCA 2BRRH 4JJHA 5I0ZA 2DRUA 3GJFK 1CZ8H 5AD0B 3BESR 4LRIC 5D5MA 5L8LB 4PJGF 2ATPB 4ETYA 5F7UA 4GFTB 2FJHB 1EGJA 2P5WB 4O2EB 3V6ZA 1QLRB 3KYMA 1JGUL 5CIPA 3DRQB 5ECJE 2F5AL 4AIZA 1XF4A 4PJ5D 4UNVA 3MLVH 4M1GH 2VDLH 4TOYH 3R1GH 2UY6A 4Q6IB 5IW6B 5E2JA 4Q6IC 3HNTL 4PJCF 4J8RA 3U0WH 3MJ7A 3WFEH 3K2UH 5DR5H 4YHYB 3NIGE 4N8PA 4YHYC 2O5YH 1J1XL 1YEIL 5A2IH 1WK0A 3MXVL 1LO0H 4M7ZB 4P5KA 3A67H 4OJFL 2WMPA 2FO4A 1QO3B 3L5XL 5E2UH 1CDIA 1JHLL 1T1WB 3G6JE 2YD6A 3WXWH 1A7NH 4XNZB 5K9OA 3HB3D 1U2HA 4P4RA 1QA9A 3X12B 3SE3C 5C2BL 2DWEA 1ZEAL 3VCLA 5ADPL 3DROA 5BVJA 5CLTA 2GQHA 2ZKHL 2ERJB 3QG7H 5DJYB 2Z31D 3PL6C 2ERJC 1IC4L 3QXAA 5SWSE 4YZFF 1UWGH 4YUEH 1T03L 4GRMA 3ARBD 4LARH 4YHKL 5IF0A 4MB3A 2FHCA 5SX4H 5JNYB 3GMMB 4GW1A 1A5FL 1OLLA 4CW1B 5F7YC 3GSNL 2OR7A 3GI8L 4Y19E 3ZDXE 2OR9H 5JXEC 4MAUH 1BF2A 4QXGH 2M26A 4QRSA 3TBWA 4ELMB 1CE6A 3V6OA 3O8XB 4CMMB 5FAAA 3BRFA 3O8XC 4MJIE 1BIIB 4GO6B 4S1RH 3UTQB 3MBED 4Z76B 1BHGA 1JGEB 2K1MA 5E6ZA 4RQQB 3IFPB 1N59B 3L3DA 1RZJH 4M62H 3V52L 5T1LD 1QYGH 2DM4A 3EOYG 1MFEH 1KTDB 5F89B 2VWEE 4FXGB 3FQXA 3PE9A 3DVNA 1T2QH 4PJ8A 1SMOA 3QHZH 1BD2B 5HVWA 2AJYH 4JLRA 4HUXB 3RNQA 3TVMA 3PP3K 2GJ6E 4P5TD 3IJYA 5GRYA 5AYUL 2GTWB 3CFCH 2OK0H 4HUNB 4PJAB 1JF6A 4OZ4A 4DUVA 4PS4L 5IJKA 5ITBH 3BPCA 3PHOB 3HI6L 1Q1JL 3P73B 3RZCA 1B88A 1J0YA 3OKNB 1MI5D 4PY8I 3O4LE 5FYJL 1T04B 1KB5A 5DJAB 4Z7QF 3QHFL 4LLQA 3LQAH 4J4PD 5F1OB 5C0CA 1GPOL 2UYLA 3DXAD 1R5IA 3VFPA 1LDPL 4OLVL 5ILTH 2ED9A 4Q9QH 1YMHA 2FBOJ 4PRDB 2X4TB 4D0CB 4PGEA 4JO4L 4KVNH 5GRVL 1EBAA 3NAAL 4O2FA 1KULA 2VSCA 3VI3E 2BHUA 3B9EA 4HUWA 3BP4A 1AO7E 5EIIB 4UDTB 1JIBA 3TA3B 4PJ7E 3TA3C 1G7QB 4LPYA 1IC7H 3P9MA 4DK3A 1GAFL 5JHDA 4K2UH 4NO0B 1CZ8L 5F7WC 3BZDA 1YEGL 1OD9A 2EYSB 4CDHA 3PGCA 4JZOA 1I7UA 4OIBA 3DHMA 3EYUH 3VFRB 2YZ1A 1CQYA 2XICA 1D6EB 3MLVL 4M1GL 4F33B 3R1GL 4NT6A 3MLZL 4NQXB 3M07A 1CFQB 1XF3A 1ULVA 3WFEL 1MIML 1K2DB 4HLJA 3IFOB 2O5YL 3OKKB 1V7MH 1RZFH 1KB9J 2FECL 6FABL 1TXKA 3FQUA 3A67L 4XVUD 2E7LA 1L4IA 5IHZA 4ZXBB 1V5JA 3HC4H 4ZXBC 1FCCA 4S1QH 2ICCA 2X1PA 5HGHA 2FHFA 3T0EB 2Z8RA 2YRLA 3T0EC 1I8MB 1HI6A 4PLKC 5H2BA 1JZ8A 3DVFA 4DQOH 3WS6C 4LF3A 1N6VA 4R4NC 1K4CA 4LARL 4Q74A 1CL7I 4NQSA 1ZT4B 2R29L 4D0BB 2FR4A 3J8F7 2RIKA 1P4LA 4V1DA 3MRPA 4P9HL 1A22B 4ZUWA 2IAMB 4DZBA 3TLRA 2O5XH 5L9DH 4JO1H 5EA0H 3VWKB 2IPUG 3BRGC 3VWKC 1KIQA 4IM8A 1UYWH 4P2RD 3U9PH 3MRBA 1IGML 4HWBH 5DF0A 1DZBA 4WHYG 4ZYKB 4PLNC 2BNUB 3HE7D 1W0WA 1QBLH 3UJIH 5DJDA 1RZJL 4PRPB 4M62L 3UPRA 3HPLA 4LSUL 1MFEL 4OLZL 5EU6B 4ZSOE 5C0RL 1X5IA 3RX7A 3VRLF 3MMEA 3QHZL 4CU6A 1IRAY 1HINL 5MENA 1U8OA 1XZ0A 4ZQKA 3MRIA 2AJYL 4TVPD 1IVLA 1S7SB 3QIUD 5DMKB 4WHDA 5EUOB 1L0XA 4LP5A 4ZTPH 2OK0L 4H26A 1BBDH 5J3HC 1YN7B 3QFJB 4X6DB 2W0KA 1YQVH 1D5XA 4TULL 4EN3B 1SYVA 3VD5A 5JOPE 3VXRD 25C8H 2UY7A 5F9OL 4Z9KB 4TUOA 1RURL 1KIUA 3VXUA 4HWUA 1BP3B 1GIGH 4GAJL 3MSPA 1RUKL 1XR8A 4N9GA 3NCJH 1DQQB 3HAEG 4YR6A 3SHSA 1T0MB 3FTGB 5C07D 1YEEL 3TCLA 3KS0J 3LKOB 2HTKC 1L6XA 3FO9A 3SKMB 4Q9QL 4ZODA 5DMGC 5IP4A 3AS0A 1OAKL 4KVNL 3S97C 1S7UA 2FEEL 3D85B 4DVRL 3QNZB 3QZWG 3OR7B 3UBXB 5J12B 5IV2B 4OFVA 5J12C 2W9DL 4Z95H 1VGEH 3UJTH 4EDXA 3RNKA 2QR0A 5KSAB 3OWEA 2GAZA 1IC7L 1UB6A 5KSAC 2PR4H 4WUUB 2DKUA 3ULUC 1DDHA 2VLMD 3JWOL 1X5AA 3DARA 5EZJA 4K2UL 4P46D 4FFYL 2DIAA 1KEMH 5EIVA 2Y06L 2EE3A 4JFOB 4ONHA 3TGXA 2G2RB 3F7YA 1JFQH 2W92A 1YEHL 5C0BA 3KPTA 1KTLB 3C8KB 3W9DB 4JDVB 3EYUL 4XPAH 1D5IH 3WL9A 1Q9OA 4WDIB 2J3SA 2ZWLT 2BHZA 5EUKA 3CDGA 3TO4B 5BCAA 3ARQA 3TO4C 4XX1G 2HLAB 1NBQA 4FS0A 3U1SL 4G9FE 2BMKB 1MQ8A 2V17H 5I75B 4NRXA 3VA6A 2JCCF 4G80A 5I75C 3TEUA 3BHBA 2F53E 1CLOL 4M6MH 5EBWA 5SWZD 1A7RH 3PV7A 3VFMA 1EFXD 4ODXB 3F58H 4RMRA 4BFIB 1CDJA 5IIEB 1OPGL 5EU5B 1M71A 4HMDA 2EDWA 5F96H 4JG0H 5KSBA 3VE0A 1Z0NA 4OF8A 2HJKB 4U1KB 3K4AA 1U8HB 3AS3A 4QTIH 5LCVH 3LKPB 4DQOL 4BZ1H 3M1BA 2R2EA 5A2KH 2IFFH 2XOTA 1BOGA 3DBXA 5DRNA 5FKAA 3NCFB 4I13B 3D2UA 3ILPB 1CD1B 1EO7A 4UT6H 1X5HA 1LEGA 4LCIL 4OGZA 4WHTB 5C86A 4HJJL 1T1ZB 3OKDA 4FTVE 5L9DL 3SDDA 2AV1A 3C5SB 2E7MA 4XRCA 4KV5F 2PUQT 4WGWB 3U9PL 2KBGA 1A6VL 1E28A 4NRZB 2XG4A 5SX5K 2Y36H 2R69L 4NM8H 2YMXH 4GRLA 1F4XH 2X4SB 3EHBC 4WTWA 1UT9A 4HKBA 3ESUF 3SO5A 5TDPA 5EG6C 1XGYH 5I17B 4ZUVA 1F2XK 4TNWK 5B38A 4PV9B 1OSPH 3TWCH 4K23H 3N0PB 3ET9F 5CGMA 5DC0A 4KQ4L 1CGXA 3CNKA 1MAJA 2HFGH 1S7TA 2R9HC 1XF1A 3BP5B 4GLRH 5E99L 1T6VN 4HIEB 1JZ3A 4ZUSB 4ZTPL 4OV5A 1UJ3B 1UJ3C 2E27H 4LK4A 3FFCE 1G6VK 1HNGA 3EZJB 3QWQB 25C8L 2AJ3B 1IEBB 2VLJA 3VFOA 5E5MB 1NCAL 3M8OH 3C6LD 3BGMB 2R0LH 3DV6A 1HHIA 1KPVA 4F58H 4RGNE 2VZ1A 5GS1A 1WCBA 3KYNA 2H6PA 1JWUA 2OJEA 1IAII 3BUTA 4XB8A 2Q86A 2VLRD 2PYEE 5H94B 4ODWA 1XF5B 1RJLB 4RCAA 5DJXA 1CLZH 1GZPB 1U95B 3T4AA 2ADJB 1H3PL 5EH1A 1UXWB 5ACZA 2A83B 4LKXB 4IOFD 2E3VA 3KDMB 3EJYC 1PBYA 1NUDA 3S5LB 3HCVA 1BREA 1ZMYA 2E7CA 4H5SA 2NLJB 4LCWB 3I2CH 4OZFB 5MERA 1XEDA 4KDTA 1FBIH 2W9EL 1KEGH 1Q9KA 3NA9H 4P9MH 2AJUH 2A0LD 4A6YL 2Q1EA 2ATKB 1AGFB 4HKZB 4N0RA 1P69B 4JHWL 1FFNA 1SYSB 3EDEA 5BZDA 1UCTA 3DUUA 4HG4J 4RIRB 1BLNB 3KJ6L 3UTTA 5ISZD 4OAWB 1OF2B 3QEUB 5CEYA 1F4WL 2CQVA 1AD9A 5KS9E 1VACB 1U58A 2V17L 1NCNA 1KXVC 1FG2B 3R8BB 3I3BA 3ZYZA 4P2QD 3HPJA 4W6XB 3K1KC 1A7RL 4Y4KA 2FJFB 1YMMA 4Y2DB 3BZEA 5EU4B 3OX8A 4MS8C 5B39G 1V05A 4HFWA 2BOBB 4P3CH 4UINH 2NY6B 5FUCC 4JRXE 2NY6C 4UIKL 3IXTA 2ITCA 1KLGB 3RWDB 1UWXK 1X5FA 3CVHL 4LPUA 4PGZA 4JZNB 5FDWB 1DCLA 5HY9A 1B6UA 5TDNB 5ACMA 1D5ZA 4YX2L 5FA4A 2NY5C 5JIPA 3L6FB 2BOCA 2P5WD 5HDBE 4P59H 5CHNB 5KVGL 5BZWA 1AR2A 2XQYG 4PRIE 5I73C 3CU7A 1MCCA 4LSVH 2Y5EA 1H15A 3H9SA 2R1XA 4QEGA 4GXVH 1BGXH 3OGCB 4LHUA 3VD4A 4NM8L 2YMXL 4MD0B 4B50A 2B39A 4QHKI 3LOWA 5IK3B 5FKPB 2R1YB 5DQ9B 4XNMA 1G9MC 2ZSVB 5IMLB 4HPYH 1XGYL 5DRXA 1OSPL 2P42B 1T1YA 2COQA 4N8VG 3KXFE 1A1NB 1T1XA 1UZ6F 2E9JA 3F5WB 3U36A 4UQ3A 2BNRB 3KYAA 4XP5H 3V6FB 4LL9A 4PBVC 4U3CA 3BZFB 3KJ4B 3FO2B 3KJ4C 1QPXA 1OTTC 5ANME 2N7AA 4E41B 1NFDA 1G6RB 2G75A 3ZTNL 3M8OL 1NKRA 3NGBB 5JDSB 5JXED 3NGBC 4N0YH 3EYOB 4F7CA 1K8DA 1FPTH 2DLFL 2R0LL 3DNKA 5BMFH 4I3GA 1U3ZA 3X11A 3O8XD 1JGVL 3G08A 3TJEH 4ZO9A 1KPRA 4LSTH 2I07A 4HJGB 4MJ5A 4S2SA 1B4RA 1PFCA 4YXKH 5C0AB 2GITB 3ULVH 1UFUA 2F8VA 3V5DA 3VXQB 4LU5H 1F4AA 2E9BA 5JW4R 1DLFL 1JTOA 2IMMA 1AIFA 1JPGA 1ZE3C 1CLZL 2BVEA 4F57L 1AXSA 1XGRA 3WIHH 2NYYC 4WJ5B 1BD2D 3ARGC 4PG2A 3I85A 1HNFA 3LKQB 4LPCA 5F1SA 3ZO0A 5JR1L 2AI0H 3G6JB 3EDFA 3LRSB 3QQ3B 7FABL 2OTUA 3UC0H 1A6WL 4BELD 3I2CL 1ZWIA 4P9ML 4M61B 2GCYB 2VDQL 3BIKA 3GSQA 2AJZB 4HIJA 3MV9A 4PRAA 2W1NA 2Y23A 3WYRA 1JYWA 1A7BA 1I1AA 1MWAH 5E03A 2C3XA 1U8QA 4LLYB 4OLUH 4UV4H 4M4RA 3W2DH 1CU4L 4DKEH 1NCTA 4QRPA 1R3KB 1AXIB 1WWWX 1CLYH 3VFSB 3T04D 3EUUA 1I7ZA 3MR9B 5IMMB 3FONB 5IR1B 4LBEB 4PJ9A 4N8CL 1QEWA 1MQKH 4L29B 3TA3D 4HWBA 3KPLB 1Y6KR 3IDMB 3MGOA 4NZDA 4PJEE 3ZE2F 1RV6X 2VWEC 4I0PA 2E9IA 4NO0D 4HGWA 5HYEA 3ES6B 4EIZC 4PJXA 1ZHLA 3VGAB 5D7SL 2MHAA 3VGAC 3BO8A 3GSNB 3QDGE 3CXDH 5F7FA 5GRUH 3OAUL 4QGYA 3FRPA 4P0DA 1J11A 3L3OB 2Y7QB 3VMNA 4PGCB 3PIQA 1MVUB 1JTPA 3FQWB 3P0YH 4FQJH 1ZSDA 1BGXL 4FQ2H 3L95A 4CVUA 3O4LB 1A3RH 1ZTXH 4X6CA 2KH2B 5F7LB 4OLYH 1IKNC 3VXTA 2X4RA 2CR3A 4XNUL 3I3EA 4GT7A 4U31A 3KNBA 4LSSL 3ZKSD 4ZXBD 3O45A 1U0QA 2F74B 5FOBA 4ZTOH 3F6IA 3WHXA 3T0ED 5AUMB 2J2ZA 5IB4B 1TNMA 1P4BH 4PLKD 5ERWA 4CDGC 4XP5L 4R4ND 2ZCLL 4GMTL 2QSTA 4PJ7B 3L3HA 4FQXA 4L1HA 1BQHB 4Y5YA 3DX8B 3WSQL 1KNOA 1MHHA 5D9SA 5ID0B 1W0VA 3PNWB 2CLRA 4OLEA 3MRJA 4WHCA 3NIFE 3GK8H 4QGTA 5I8KH 2HLFD 4N0YL 2IAMD 1CICA 1U8MA 5BMFL 1E4XH 3EDJA 4JR9H 4BQ6A 5B8CB 3VWKD 4GW4B 5B8CC 1BFSA 5B3JE 1IEAA 2X1XR 1UKQA 2DI9A 1XIWA 3PP4L 3E6FA 3GKWL 5I66B 5EU3A 5HTSA 4GW5A 1A9EA 2B20A 1LO2L 2VAAA 2FATL 1AR1C 2GT9B 2WAHA 4HHAB 2Q76A 4PFEA 1RUAL 3HMXH 3NPSB 3MZGB 3NPSC 2I60H 4PRPD 4EUPG 1B2WL 3P11H 4Z8FL 2ZUUA 1P1ZA 3GB7B 1ITBB 3AY4A 3HUJA 5EU6D 2GHWB 3LV3A 2P7TA 3WFCL 3WIHL 1V3JA 1ODAA 3BAEL 3QUYB 5E1HB 1F90L 3QUYC 4I77H 2AI0L 2DJSA 43C9A 5GGTH 1ES0A 5HVGB 4LASH 5D5ME 3QFJD 2B1HH 4GG6F 4OCMC 5IFHH 4EN3D 4X7SL 1G1YA 2AJXL 1HHGA 4LOUC 2B5IB 1IGTB 2W0FB 2EEBA 3WNKA 1QNZL 3SE8L 1T89A 3VD3A 1OHQA 3FQTA 3CMOH 3F7VA 4NNYB 5IBTH 3N1FC 3DURB 3CMGA 1F4YH 3KHOA 3OHXA 2G9HA 2CKBL 2GK0B 4UV4L 3E2HB 3W2DL 4GAYA 4O9HH 3E2HC 2HTKD 3DX6A 5DMGD 1IL1A 4R4FH 1S7VA 3OG4B 2R1WA 1CLYL 1D3CA 3D85D 4JZJC 2DQGH 4J1UB 5F88B 1CDBA 4HXAL 3U0PA 1U8KA 5CZKA 1ED3A 4BKLB 3EYQC 4HF5L 5EDXA 4HS6A 5GRJL 1H3GA 4GH7B 4XPHL 5ITFB 1MQKL 4DOHE 3TH2T 4HV8B 1T0PB 3D18A 5KSAD 1KGCE 1RFDL 3C60A 4YDJB 3ULUD 5AZEH 2O61A 4NKOB 4WUUD 4ZSOB 5JPNB 4MA7H 5E6IB 5F1IA 4S0SD 3RGVA 4MCYA 5E6IC 4TTGA 3QRFM 4FZ8L 3SDCB 3VWJA 3SDCC 3CFIC 4PY7A 4BQCA 2C9AA 1JE6A 1GOFA 3CXDL 5GRUL 4P9HC 2ZOKA 3V6OE 4F9LC 3QQ4A 1PDKA 5MEOA 1JI2A 3M17B 2HJLA 3DVGB 1Q9WB 3TO4D 4UIMA 3K1DA 4CVXB 3TYGH 1AXTH 2FYYB 4FQJL 4FQ2L 1SM3H 1ORSB 4LNRA 3U6RB 4TSBL 2Y1VA 4Z18A 2DDQH 1WT5C 1ZTXL 4H25A 1CFNB 3IXAB 3OKOA 1A6ZA 1F8TH 4WU7A 4AEIL 2HH0H 4UU9B 4NKDA 1JF1B 3SO3B 1MCLA 3MLWH 4MNQA 4ELMF 5HYSB 3SO3C 4KI1A 1AE6H 4JFYA 5FUZH 3BKJH 1FCGA 4NNPH 1L7TH 2BSRA 3FHAA 3I6GA 1F6AA 1P4BL 3P77B 4U6HA 3CXHJ 4X7DC 3FAWA 4I48B 1ADQH 4K3GA 5ICYA 5DFVC 3HA0A 4XCNB 5TF1H 2NNAA 1YNLH 5HI4C 4XMKH 4FHBD 3JV5A 4BQ8A 1TQBC 5HXMA 1UVQA 3N85L 4JN1L 1ZHKA 4KK8D 2PW2B 4ALAH 1Q9LB 3GK8L 3ROLB 4X5XA 4MXVE 1CDUA 4NJ9H 3Q48A 1IC1A 3TP4A 4DGVH 2VXQH 3NMEA 1S7XB 4R26L 5C0CE 1IQDA 3VFTB 4I3SH 5E00B 3GRWH 5DTFA 5H35A 3QXDA 3EYVB 3EHBD 4EI5A 4K7FB 3HMXL 2GFBB 3QXTA 1AJ7H 3QJHB 2Y6SC 5J89A 1I9IH 1EHNA 5JOFA 4G9FB 5SV3A 2EDXA 3BGFB 3LB6C 4Z7UA 4PB9H 2R9HD 3RWFB 1IGCH 2XWTA 3MRNA 4JGUA 5JHDE 5A3ID 1SEBB 3MOAH 5L0QB 3SY0B 3QWRA 3GUTA 5L0QC 1KG0B 1BJ8A 3JWOC 3CLEL 1FFPB 3VMPA 2GTZA 5IFHL 4KKCC 3MNZB 1JK8B 5JQ6L 1C8PA 2WV3A 1E27A 1FNGA 1I85C 1YNTA 35C8H 5E8OA 1NGQH 2Q6WB 3T09A 3CMOL 3TESA 5D70H 1HH9B 2A6JA 4GBXB 5IVZB 1CBVL 3MGTB 5T5NG 3KPSA 2V2WA 5C0JB 4YLQT 5JO5A 3ZT7A 3BT2L 3TPUB 4GOSA 3BEWB 2UZIH 1Z0MA 1N2RB 3LMJH 4XWGH 4W70A 5DHYB 1IZJA 3DVIA 2ICWB 3BW9B 4YGVA 2DQGL 3UTOA 3BZ4B 1QHPA 4N0FB 3L3IA 3ARDB 2JK5B 3RHWF 1OB1A 4GXUM 5EORL 4KK9D 4XNYL 2YC1A 4KROB 4NQEA 1YPZA 4YHNA 5DD1H 1I3GH 2RHEA 1OL0A 3WUWA 5B3NA 1MHEB 4LCWD 1NKOA 4FFZL 4KZDH 4IRJA 1RVFL 5I1CH 3TT1H 4FXLA 3UBXG 3C5ZB 4NJAL 4V1DE 3C5ZC 1YJDL 3NCCB 2YD1A 3QDHA 1E6JH 1DQDH 1QLFA 2UUDH 3QFDA 5DYOB 1MH5A 2P4AB 5DRWB 3THMH 4PRNA 4TTDD 3HZMA 3QQ9C 4HH9A 3TYGL 3QG6A 1AXTL 4EI6B 4WFGD 1SM3L 3V2AR 5D1ZB 1VFAA 1YY8B 5D1ZC 1WJ3A 1BVKA 4HQQL 3QA3B 1QACA 2DDQL 1R3LB 3PWLA 2FJGB 2HT3C 5BXFB 1C08A 2WWMC 1CIDA 3IDXH 1IM3B 1FL6A 1N0XL 4H0IA 5AG9A 4Y2DD 3ZYIA 3MLWL 3V7AE 1HILA 2XA8L 4OBRA 3ROOB 1BVLB 1IKFH 1CTOA 2NY6D 3E3QC 5D6CB 5MEQB 3TH3T 4XNXL 2L4OA 4LGSB 5J9PA 1HOCB 3QDMA 4OCNC 1MLBA 3ZYJA 1ADQL 1I9EA 5TF1L 3KPPB 1YNLL 3TN0A 4XMKL 3KAAA 4UZGA 2BC4A 1OGTB 4TUKL 5DK0A 5E70A 1LQSR 3VXUE 3PV6A 3BDBA 1GOHA 1P2CA 1NJ9A 4JFDA 1ZS8B 4NJ9L 1QRKA 1Y18A 3EFDH 4DGVL 5T5NF 1S3KL 4NWTH 3GMLB 1QKZH 5CWSB 1FZOA 1XCTB 2KQMA 1RK0B 2W65A 3GBMH 1T0NB 3RTQB 2HFFB 4MA1B 3RTQC 2HRPL 3IU3A 4MA1C 3DYOA 4TUJA 1GZQA 5KS9B 3OTTA 4KY1H 1AHWB 5I1AB 1MJ7H 1AHWC 1MWAA 2X41A 2X2YA 4IBLT 4F80A 4JPKL 1CQKA 3EOBA 4PB9L 3T2QA 2H2SC 2BNRD 1IGCL 5HPMB 4PJFA 5JA8B 1HH6B 1Z3GL 3JWDL 3SGKC 3MOAL 3RWHA 4YIQA 2DYPA 5JMRA 1QFHA 1A6TB 3H3PH 4MX7A 4QXUH 4A6YB 5CJQL 2I25N 5GS2H 4JRXB 5IB5B 5C0BE 3MRFB 1OTTD 35C8L 1NLBH 4XXCA 3QO0B 1JL8A 1NGQL 3MLXH 4E41D 2XZQH 2CSPA 2FIKA 1R0AH 2I9LB 1EZVX 3KLAB 4LSPL 1RD6A 2VKXA 3X14A 3WNNA 5DHVH 3MLUH 4Y4HA 4JY4B 1A4KB 5E5UB 5C0AD 2H2PC 2QQLH 4PRIB 4JFHE 5CINH 1E4XI 1Z9SA 2AGJH 1NGWA 2BVPB 3DETD 4QY8B 4NYLA 4C55A 4CVZB 4WI4A 1U91B 1X4XA 3QIWC 4UB0H 2B4CH 1UG9A 3MJ8B 5C8JA 2UUDK 1I7TB 5KSBE 2NYYD 1INDL 2HJFB 5E8NB 3WDJA 4M1DH 5FYKE 1EK3A 1EEZB 1RU9H 3G6AB 3MZTA 5I2IA 3CVHB 1I3GL 5TGBA 3CFKA 5C0FA 2P8MB 5HYJE 4IRZL 2W0PA 1E4KA 4KZDL 4MJ6B 1R24A 1KBGL 5K9QI 3R0NA 4HIXH 4AZ8A 3T0AA 4L8BA 1UB5A 3V4PH 5DQJA 4F7PB 3DI2B 1PEWA 3VXOB 1UA6H 1E6JL 3MNWB 4ZFOL 1N0LA 4DGIH 5F44A 2MOVA 2OLDA 4U1GB 3S5LG 4U1GC 5CEZE 5ANMB 1I1YA 3C9NA 4OZFG 2IADB 3ZTJG 2YEZB 5DJ0B 3GMOB 4R7NB 2CLVB 5KOVC 1DLHB 4YNYA 3C5JB 3BUYB 2YHGA 2ZJSL 1KIPB 4P48A 2DS4A 3NFNB 2Z35A 3IDXL 2ZCHH 1OY3B 1ACYH 3QUXB 5EBLB 4YEFA 3MXWH 3QUXC 2AQ3A 4R6UA 5H8DA 3RY4A 1FZMB 5DWUH 3RAJL 1C7SA 2P45B 3NOIA 4Y5XA 2JJSC 3D69A 3S4SA 2AXHA 2VLJE 4LCCA 4Y1AA 3QNYB 3WLBA 1ZHBA 3MFFA 3RVTC 1F3DH 2EEAA 5DSCA 4H8WH 5MEPB 5DA0B 4DUXA 3QSKB 5BO1H 3EFDL 3PGFH 5GGTA 4NKMB 4WI9A 3MREA 4XNQB 2A73B 2OL3B 2KKQA 5IMOA 1FVEA 3O4LD 2EDOA 1JZ2A 1INEL 2AEPL 5EPMA 5DD3L 1FNSL 2W59A 1FDLH 5HHVH 3LKRA 2EDBA 2QKIA 5E7BA 3BD5A 1A1MA 3HE6B 3RUGF 3HE6C 2H3NA 2Q7NA 1UENA 2FBJL 3PGDA 4AEHH 3ZT6A 2NTFA 4C56B 5DEZA 5KW9L 3BKYL 4NP4H 4N5UA 2YBRA 2AQ2A 1VFUA 2XQBH 1AH1A 3LN4A 3H3PL 4Z0XA 1A7QH 3BRDA 5FGBA 1KIRB 3MJ9L 1PSKH 4Y5VB 3VMOA 3SJVB 4Y5VC 1FO0A 1LP9A 1NFIA 3CX5J 1YN6A 4AT6A 3O6FB 3IDIA 2ARJA 3O6FC 3IB4A 2XZQL 3UTTE 2I9TA 5DD5L 5DGRA 5FYJD 3VRJA 2MWCA 5CJXC 5IB3B 3LPGA 1EDQA 3BN9C 3MLUL 4OB5H 2AW2A 4ZMAT 3GDBA 1VA9A 5CINL 1MCSA 4OCYH 1N7MH 1ZLSH 3QO1A 2CUMA 5FUOH 1YMME 5HGDB 2FZ3A 4HKXA 5C6PB 2PTUA 3LEVL 4G9DB 5J0BA 3HLAA 4JFQA 4OKVA 3LKNB 2XKNB 4QRTA 1XF2A 1KCUH 4PGDB 4NFDA 4WV1B 3GMQB 3QUYD 2W9LA 4I8DA 4RAVA 4RX4A 4WV1C 4OQTL 3HHRB 4PTUA 4OM1L 3IJHA 2DQIH 5D93B 4LOUD 5D93C 5HHQA 1TTFA 2C26A 3UTPE 5TH2B 4AQ1B 2CXGA 4HC1H 1WUNT 3SDXA 2ITDA 3H9SE 1DVFB 1DVFC 2BDNH 1HHHA 3CUPB 1T21B 4LKCB 3DV4B 5KAQG 3QWOB 3U7YL 1BFOB 2XXCB 4QRQA 4OZGE 3WN5B 2MCG1 4KTEH 3V9FA 3WN5C 4KDVA 5F7EH 4FQCL 4OT1L 2BSTA 1KLUB 3EYQD 3V5HB 1ACYL 3WIIL 1NEZA 5E2TH 4JB9L 4WTZA 3BDXA 43CAB 4MQTB 2H9GB 3GRWA 3HFMH 3DTXB 2ZP0T 5E94B 2Z93B 4FMKA 1KENL 3BGAA 5DDHB 4CN6A 1WISA 5E6ID 5ICZB 3MO1B 1A4JB 4JQVC 4D9LL 4X6EA 5IQ9B 1NFDE 3SDCD 4WNQA 2DQHL 5GS3A 3QBTB 3BKCL 4W6WB 4HT1H 1D9KB 1JF5A 1VADB 5D6DA 2VQUA 1D9KC 3KLSA 5BO1L 5JOPD 3V6ZB 1RUMH 1LO3L 3AU1B 4XC3H 3DMMB 3KYMB 2HKFH 5LGHL 2YA1A 4K9EH 3DMMC 5C1MB 5CBAA 1BFVL 1MRCL 2QEJA 4KAQL 4G42A 4J8RB 4JO2L 2V2TB 2VXVH 1CDCA 3HAEH 1TVDA 2WIMA 2QBWA 1T66D 1P7KA 4P5KB 4AEHL 1EEYA 3WXVH 2FO4B 1MCKA 4X4MA 4RAUB 1HCVA 3AAZA 4FZEH 3DX7A 5K9OB 4NP4L 2R2HA 3IS1X 1QA9B 4JHZA 2DWEB 3VCLB 2PTTA 5BS0E 5BVJB 4XCYA 5DFVD 5IEKA 1T7YA 2AP2A 5HI4D 1UJTA 1KCRL 1A7QL 1I1FB 3MV9E 1PSKL 3NIGF 3QXAB 1L7IH 3MACH 4XVJL 4GAFB 4I5BA 2X4PA 5C0EA 4PREA 1NDMB 4AMKH 1LE5B 4OIIH 2F8XC 1MCBA 4GW1B 3VJ6A 1YEKH 3G6JF 1A6UL 3VI4F 4NBZB 4GSDH 2CKBB 3RPIB 3GMRB 4RWHA 2HG5A 4QRSB 3TBWB 2ILLA 4QRPE 1BQHG 5KAQF 4Y16B 3REVB 1OTUC 1U3JA 4Y16C 4K94H 3V6OC 1PKQA 4UT7H 1RY7B 1OSZA 2F5BL 3LB6D 4G9FD 4M6NL 1U6AH 1U8JA 5FHBL 5GGRB 1JVKA 4XPFL 1TTGA 4QF1A 2JF1A 3DSFL 3ZDXF 1ZHNB 5FIEA 1RZKL 3FQXB 3I84A 5AAMA 2BFVL 3DVNB 2L7UA 2VDRL 4PJ8B 5D71H 2H26A 2R0WH 4PJ8C 2DQIL 5KJRH 4PJXE 3RNQB 1X6NA 4KKCD 4CRPA 1URLA 3HZVA 2J8UB 3G9AB 5BRZA 2DQEL 4R90H 1WIOA 4L3AA 2EECA 4ODSL 2OXGA 4PJIA 4YO0A 4GBXD 4UTAH 2DIJA 2BDNL 3UCRA 1YNKH 2HKHL 4DAGL 4X6CE 2R4SH 5HYFA 5EC2A 1D5BA 5C0CB 2WBJC 4U6TA 3G5VA 5C6TH 5H37H 1YMHB 3E6HA 1RJYB 4OM0L 3ARDD 4O2FB 2W07A 5DVLA 4QRRA 1KPUA 4KROD 3DUSB 1NAKL 4XCCH 4ZOEA 2NY0C 1K4DA 2N7BA 2V5YA 4LEXL 2ZOLA 3P9MB 3C5ZD 4LPWA 4JFEB 5EU7E 5DJ8A 5BV7H 4HT1L 2PCPB 3I6KA 3KYOA 3MRKA 1PQZA 4PD4K 1OVZA 3VI3F 4XC3L 3QQ9D 2JJVA 4K9EL 2ICEB 4PJ7F 5D1ZD 2XXMB 2BVYA 2DKMA 3PWNB 1MEXH 2WWMD 4IHOA 5KSVA 4TVPH 2VXVL 1CXFA 5D8JH 3FQNA 4OFYD 4L4TB 4AQOA 4M43L 1RIUH 3FQUB 4MZ2A 5DHVA 4CADA 3WXVL 5LGKA 4KZEL 2OTPA 5DD0H 3WJJA 5F1NA 3O11B 4FZEL 1INQA 1M7IA 1Q0YL 2P5EB 2Z8WC 3L5WA 5C0DA 5C9KA 5F72S 3GGWA 3MV8E 3WNLA 3OJDA 5BVPL 3MACL 3PDGA 4MQXC 4B0MM 4LF3B 4DVBA 1WBYB 2NY4B 1WTLA 4X5LA 3GSXA 1VGKA 4JAMA 2PW1A 4OIIL 2FR4B 4R3SA 4WW2A 1RPQA 2JIXA 4GSDL 4PRBA 1VPOH 3G5XA 2XY1A 3ECBA 4WEMB 1IAKA 5F70A 5D7IA 4WU5B 1I3RA 5CGYC 3ZZ1A 2NR6C 1W72L 1IGFH 2R4RL 3RTQD 3EO0A 1J1OH 1A7OH 4UT7L 1KJMA 1FE8L 2HMIC 1JTTA 3F65A 2PYFA 5T33L 1U6AL 1W0WB 5EO9A 5I1IH 5DJDB 3OXSB 1S7RA 3AS2A 3UPRB 3OR6A 3HPLB 4KMTL 3GSWA 4I9WE 4YXLH 3CC5A 3MMEB 3OQ3B 4X4ZA 4YHOL 4JKKA 1MSPA 5IMKA 1XZ0B 3D87B 4ZQKB 4DCQA 4JRXD 4PYGA 1NCBH 1FFOA 1ZANH 2LVEA 4GUPA 4WI6A 1LE9A 1YJDC 5AWNH 4APQA 2OSLA 4F2MA 2BNQA 1HN1A 4R0LA 3TIEA 2ADFH 5IESL 3IGAB 3PHSA 4TUOB 2X89A 1YNKL 1W8OA 4HIHB 3VXPA 1XR8B 1U8NB 2H2PD 2R4SL 1P9MC 4NZUH 4N9GB 4PRID 5FCUL 4YR6B 3HS0B 3CK0H 1S9VB 1DJSA 4WW1A 1CDYA 4UDUA 1A0QL 2X9YA 3TCLB 4Z7VB 4MNQE 2A9NH 4FQIH 3MRCB 1JRHH 1J0ZA 4ONFL 1OAZH 4JY5H 1ZLWH 1OAYH 1S7UB 3KR3H 3MC0A 2DL2A 4XMPH 3ABZA 4K8RL 3BPOB 3U7AA 3BP7A 3BPOC 2V2XA 1TZHB 2H32H 4KPHL 3L5IA 1FP5A 3H9HB 3H9YA 5D7LB 5J1SC 4EDXB 4QRUB 3H42H 1UB6B 4G3YH 1EHLL 2IH3B 4YE4H 3L9RB 4OGYH 3ZHKA 4L8SB 2H41A 3GJFB 4L8SC 3KVQA 4KI5C 3S36X 3EYSL 1P7QB 2WK2A 1M4KA 2Y5TB 5CP7A 4OKDA 1H5BB 3S88L 4IJ3B 1H5BC 5DJ2A 4IJ3C 4ESKA 3CFBB 3PWJA 2JJTA 4QCIA 4R7DB 1XGTB 2NY1B 1DBKH 4AEFA 2NY1C 5EUKB 3CDGB 2FX8L 4MMXC 4P2OA 5FHAH 3T3ME 2E7BA 3UROR 5D7JB 4HULB 2G60L 5D7JC 4Z7UE 3H0TA 2V5RA 3PQYA 1GSMA 1OM3H 2RAMA 5LWYH 1RIUL 4MDIA 3I75A 2ZG3A 4YHIA 2C4FU 5DD0L 3RWGB 3VFMB 4U2ZA 3JWDC 4X4XB 5IQ7H 3U30B 5C0GB 4OIAA 2BY3A 3B6SA 3U30C 5KSBB 1BEYL 1BWWA 2UWEA 4CUCA 4RFOH 2YRPA 3QCTL 3RVTD 4LPXA 5D7KE 1G9EA 5D72H 1JHKH 1CFSB 4PP2B 2R2EB 3JSSA 1TJIL 4ERSL 2OQJA 4EOWH 1BOGB 1BQLL 5HYJB 3DBXB 4G6KH 4RMSA 3KPSE 3SE9H 3FOLB 1I9JL 5IB2B 3QUZB 1KJ2A 4LLDA 3QUZC 4IOIA 2EH8H 5E8PB 5E8EB 4LLWA 3SDDB 3ZKMC 4OD2A 1NUGA 1Q72H 4XRCB 3VXME 2YUVA 3IF1B 4HK0B 4HC1A 4W6YB 3QH3A 1ERNA 3HE6D 1FAIL 2L7JA 4K7PX 1ETZB 2YD9A 3HTLX 4HKBB 1AKJB 1CXKA 1ZT1B 3HNVL 1KN2H 4C56D 3NTCL 5IM7A 3TBSA 4WY7H 4NQEE 1QUNA 1YPZE 1MFCH 3D25A 8FABA 4YXLL 2CDGA 4KJYA 1RMFL 4R97B 4R97C 3ARUA 4RISL 1NGZB 1S7TB 5GRXG 1H3VA 2DAVA 2Z31A 1NCBL 4OGXH 3OKEA 1AQKH 3O6FD 4CN1A 1ZLWK 3ARBA 3GSRA 1T83C 3C6SA 3O6KH 1UQSB 4ZFOB 2Z0BA 1CD9B 4XPGL 3PWVB 3VFOB 3BN9D 1FVCB 4ISVA 1HHJB 5TDOA 2YN5A 4PJGB 2ID5A 1Z9MA 3DV6B 1HHIB 5IROC 3TIDB 3I9GH 2I27N 4LPTA 3CK0L 2GKIA 5GS1B 4X8JA 1KJVA 3MBEA 1IEHA 1J0HA 3KYNB 1CG9B 5GZNC 2OJEB 4Y0GA 1C5CL 1I9RL 3R06B 1OAZL 1CLCA 4JY5L 1LGVA 1FN4A 5EZIH 3S96B 5FO7A 5T1LA 1NL0H 1KT2A 3QDME 4XMPL 1G9NL 3RIAK 4M7LH 5GISH 4IMKA 4UOW1 3BIAX 1KXQE 1NBVH 3H9ZA 3LKSA 3WCYA 2IALA 1TLKA 2ZNWA 5C0IB 1J5OL 4XPTH 1R3HA 4P5TA 4YE4L 5KVFH 1HEZA 1YEJH 4RGOL 2ZNXA 4YQXL 1RIVH 4JQXA 4JFDE 4KDTC 4G8IA 2Z8SA 1FJ1A 4YHLL 1S78D 4L3EA 3CVIH 4PRHA 1DVFD 3A6CH 5F3HA 3KPMA 4M5ZH 3GZKA 3DUUB 3UTTB 2A77H 5FHAL 3QEHA 5EOCL 1AD9B 2QTEA 1KACB 1X5JA 2XRAH 4K3DH 1U58B 1UXSA 4QHLB 1NFKA 3A6OA 3IDNA 5IVNA 4KTDL 2FDBP 2H8PB 4PJFE 5CD5C 2BJML 1YMMB 1AC6A 3OX8B 5IQ7L 2X1QA 4RGMB 4RGMC 2D7NA 4PJBA 5LGJA 1MJ8H 3SKOA 5KS9F 4FQQB 5DUML 5HVHC 3P4OB 4NFCA 2VR4A 3U2SA 4XBPA 4EOWL 4XP4H 4G6KL 1FVDA 5EO1A 1D9KD 5FA4B 4DZ8B 4XCFH 5TE4L 3UXFA 4X4YA 3OAYK 4KWUA 2OCFD 3DMMD 5C7XH 2V5TA 3IRPX 1VESA 1E4WH 4NRYB 2AS5M 1SBBA 1EZVY 1H15B 1R5VA 4LGPB 3NN8A 2R1XB 4POZC 3FT4A 3AROA 3UTSB 1FV1A 3D3VE 3SDAC 2BZDA 2LABA 1I8KB 2O5ZL 3FCTA 1SEQH 4OCWL 4NQVA 4OZGB 5HDBF 3ARTA 4WY7L 2NTSP 3BJLA 4D9RE 5JOEA 4HUVB 5DK2B 4LCUB 3L1OL 5KVDH 1MCPH 3KPOB 1T4KB 1ORQB 3SPVA 3GNML 3PABA 4O4YH 3ARPA 3X13A 2CXKA 4KJQC 4M6AA 4OGXL 1A3QA 3FT3B 1KGCD 3ZMRA 3TH4T 4TSAL 2NMSA 2Q8BH