1JUFB

Structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords H2-Db major histocompatibility antigen
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jufB00
3MLPA 2JCCE 4W68A 1YJDC 2MKLC 2Y6SD 2VDPH 1MI5E 2Y72A 1E4KA 1LK2B 5CBAB 5D2NC 1N7ML 4KJPD 4N8PA 3S36L 2J8UA 1KJVB 4RQQA 4YDKL 5DHXB 1TPXB 3RWGB 4GKOA 1NCDL 1QBAA 4JVUA 1KYOK 3P77A 1MHEB 3CZFB 1MJ8H 5T3XD 1FGNH 4YBLB 3E1F1 3TCLB 3WS6C 1LP9B 4HJ0C 5FO8B 2YEZA 4XCFH 2HFEB 1U8OA 2MNUA 2AI0L 3LD8C 3BISA 4ZAKA 4JKLA 2XZCL 4OCSL 3NCCB 1TVBA 4XPGL 1MQKL 3STZA 4ZFFB 4Y2DA 5C0ND 4OV5B 1SEBB 5JW4M 4NWTL 5HHMD 4RISH 5MENA 1CLYL 5H2BB 1AO7E 3GBML 3MPCA 3L3DA 5D70L 3ZSSA 4HUKB 5C0FA 4RIRA 3QULB 4AL8H 1BZ7A 1OF2A 5HHNB 2UWEE 3QCVH 4MJ6B 5EZJA 2D7PA 3CDGB 1MFCH 4QXTB 2BZDA 1TQCB 5EUKB 4D94A 4KROD 1GIGL 4HGKC 4GJTB 3BH9B 2HWZH 3I3BA 1Z2KA 1N26A 5I73C 2PO6A 5C0RL 2O5ZL 3HC3H 3DIFB 3MLWH 1IQWH 3V4UH 4F7CA 3MNVA 5SWZD 2PYFA 5IMLA 4D0CA 4JM2C 2NY5C 5EUOB 3ARBA 2DWDA 4L3CB 2J7LA 2PW1A 4PV9B 4WENB 4I5BB 4EI5C 5E5MB 5GGTL 4DZ8B 3MCLH 3HZKB 4RNRB 4LMQI 5FYKL 1FSKB 4D9QD 2BNUB 4L8BA 1NFIA 5HI4D 4QRRD 4PB9H 4IOFC 3WFDH 4DN3H 4QY8A 2BXZA 1KNOA 3SKNA 3VWKA 5JOPE 1ZT1A 3T77A 3GMOB 5D5MB 3MLRH 2P8PA 1JGUL 3GSWB 2CDEB 1HZHL 2CRIA 2WNGA 5EPMA 5JOFB 1KPRA 5H94B 2H2PD 4M61B 3QZWB 4XCCH 1JYXA 2BNQB 1NAKH 4LAJH 5DJDB 3SDAA 5D96B 3MRHB 3FN0H 3LDBB 5DJ0B 2E7BA 3BQUD 3HMXL 3PJSA 1VKXB 5IFJA 1HHHA 2BOBB 2Q6WB 2CLVA 1OSPL 3LMJH 4ZTOL 3QFJD 1DQJA 4X80L 5D7JD 3QUXB 2DYPA 3CMOL 2FYYA 1YY9C 1A6PA 4H25B 1B9ZA 4MNGA 3BGMA 2JJUA 1U95A 2X1PA 1IAKA 1OGAA 1AXTH 5EZIH 2DL2A 5D2LA 4O58H 2DBLH 5F6IB 1IL1B 1JV5A 3MBXL 5DJAB 3HAEB 2P24B 3MRQB 4PJ8C 1QD0A 3L5XL 3G04B 3V4PL 2E9BA 3WJJC 1BX2A 1KB5L 3DPBA 3VXSB 2NY2C 4LPCA 1Q9OA 1F4XH 5FYJH 2YD3A 4P3DA 4OB5L 2GT9B 3QIUC 4GAYA 2EYTA 2C9AA 1S8DB 4Y5YB 3EFFB 2GCYB 3RL1A 1PSKH 1G9EA 3MRGA 2H1PH 5JR1H 3DVNA 2Y7QB 3C5SB 5I1LB 2DLEA 3V6FA 1RHHB 3ILQD 5J12C 5IB2A 5F1SA 2F19L 2M26A 4K94C 2CLRA 1NC4B 4R97B 2AKRB 4JPWH 3L9RB 3L3GA 4LQFH 4JDVA 5B3NA 3JVGA 1U93B 2XZQL 3MXWH 4N8VG 4FQIH 5TF1L 3FFCB 1MCFA 5E8DH 5DEGB 4JO1L 2BOCB 43CAA 5LBSH 1YC8A 3OKKA 2NY7L 1P6AB 3S6CA 2GAZA 4CAGA 3MGTA 5JHLH 3AREA 3TBYB 5SV3A 2EDLA 4GW1A 4JZNA 2CIKA 2NY5L 4OZIE 1DBAL 4TRPL 1I8LC 2R8SH 2ESVA 4PREA 4NP4L 5L0QC 2EH8L 2XWTB 5B39B 4DGVH 1RUQL 1YYMH 4LLUA 4NKDA 5GGVL 4MD4A 4TVPD 8FABA 3C6SA 4DGYL 4ZAKD 3M8OL 1VPOH 2NLJA 3ZKMC 2FJHB 4OLZH 2EIZA 3UO1L 3SDXA 1RIHH 2OXHA 4DGIH 5IVZB 5I1GL 4P49A 2E7CA 2RCSL 3QEGH 4B41A 5MEND 3SJVA 4HIXH 3SE3C 3I2CL 3PWPB 3PGFL 1G7IA 1U8QB 3G5VA 3B3IA 3O9WA 1HKLH 2BVPB 4A6YB 4P2QB 3OKDB 1A1MB 3DO7B 4F7TB 5FV2A 1NAMB 1JZ8A 2MSPA 1MAMH 1EXUB 4OCMC 1G7LB 5C0CA 3QUMA 4PR5A 5DHVH 5D9SA 4I2XE 5B8CC 4M5YL 1VFAB 4RMWA 4RFEA 1KUMA 3DGGA 1CZ8H 5IOPA 3ZHKA 1N3NB 3ARBD 4IJ3C 2P5WA 4MCYA 5FKPB 3MV8A 3FB6A 3H9HA 5KW9L 5DD1L 4Y5XB 3HPJA 2HLAA 1T04A 2PUQT 5C1MB 1HXYA 2FRGP 4P46A 2BJML 1FPTL 4BKLB 2FDBP 3ALWA 3F8UB 3S3PA 4CDGC 2YA1A 4MXVF 5M7QA 4I9WE 1BFVL 2OP4H 5HVHC 2ADGA 3QUZC 2IEPA 5EOQH 3VWKD 2DDQL 3DV6B 4PS4H 2DIAA 3RVWD 1UZ8B 4U1MA 4WO4A 2EXYC 1JPTH 1J18A 3MR9A 1S7RA 1QSFA 2HTKC 5CINL 2XT1B 3QUML 3O45B 1M05B 1V3KA 4P5MB 4V1DA 3KLHD 2A2QT 2ZNWA 2ZNXA 3OJDB 4FQXB 4J3TA 4RGNB 2N56A 4LLMA 4K7FB 1KELH 4MDIA 3GI8L 3MUGA 2D31A 4PJGB 5IJVB 4ZFZA 2IALA 2BHYA 3ET9F 4GKZB 2ZCLH 5SWSB 1AR1C 5IMKB 4XH2B 1RUAL 1XGPB 3V0VA 3WFHB 5CEZL 1OWRM 5BZDB 1B0GA 3EDEA 4K94L 1CVSC 2DYPD 1A64A 4XWOD 3L7EB 4M7KL 4U6HA 1QKZH 5HGDA 1JWMA 4IMLA 2R1XA 3CFKB 1JZ3A 3M1BA 3QEQB 2WINB 1I7UB 1NEZA 1Q38A 3R4DA 3S5LG 3HC4H 2IMNA 1ZWIB 5TFSH 4WI7A 1ORSB 4G9FB 4LDLB 3L3HA 1OSZA 4HJGA 1FNFA 1XGYL 4U7SA 4JAMA 4Q9BA 2J2ZA 3B5TA 1G7PB 4IRJD 4OLUL 5LKNA 4WTWA 5HJ3A 3DI2B 2I60L 5DMKA 3NZHL 1WT5C 3AM8C 4NUGL 4RDQF 3WS3A 1FE8L 4OLVL 1OAYL 1JTTA 4ODUA 4NYLB 3BKJH 2DQHL 1REIA 4O51A 5I30H 4G8IB 1KIUA 1MHHB 1CBVL 4JG1L 2VL5B 3X13B 1CQYA 2R69L 4PGBB 3A6BL 4NJAL 1A02N 4DOHE 3UX9B 4X4YB 3V8CA 3S88H 3V5KB 2E6JA 2FJFA 3ABZA 1FNAA 5IESL 4MXWL 1RVFH 3VXQB 4XBGB 5EU5B 2B2XL 3F7RA 1OAXL 3WIHH 1MUJB 1VSCA 4ZPVA 5CJOL 3QP3A 3KDMB 5T3ZE 1LE9B 3N85H 2DTML 1QFWI 3BIAX 1EFQA 4PRPA 4HG4J 4KUCF 1QLEH 4B50A 4MS8C 4ZQKB 4LHUG 2WBJB 3RWDA 3ARED 5GGSY 1KN2L 3GBNH 4KAQH 4M7LT 2EZ0C 4LCCC 3QPQD 2D9CA 3KPSB 2ICWA 2WWMC 2ESVD 4X6FB 1CG9B 1DQLL 4WU7B 1H3PH 3BPNB 3IFLL 3U7WH 2EYSB 2X4UA 3PWLB 4HK0A 3VFMB 4B7IA 1NFDA 3IU3B 1GH7A 3SGJA 2EYRA 2MCPH 4P57B 4IS6B 1T0PB 1DFBH 3DUUA 2DQEH 3HE6B 3VGFA 3F6LA 4KQ3H 2BRRL 4DW2H 5IG7B 5HI5D 2CH8A 2UVFA 4HLZG 4G42A 3JBG7 3O9WD 1FNEB 3BVNA 2AJZB 3QG7L 3EDKA 3NZ8B 2EICA 4D9LH 2Q1EA 3LQAC 1QR1A 4HUUA 3UPRA 3NA9L 1P53A 1KC5H 4GOSA 5C0CD 4YHIA 4DTGH 5GXBB 4HUVA 3A6OA 4KV5F 5AEAA 1L0XA 2VJXA 1G7JA 4R96B 4XWGL 5JXED 4LVHB 3SKMB 4JPKH 4KK8D 1FNSL 4RAVB 3WXWL 4DAGL 1R5VA 3OGOE 3FB7B 2VLJE 1RZJC 2P5WD 2ITCB 4JRXB 1MCIA 2H32A 3CCHB 3E6FA 3JTSA 3MFGB 5AZ2L 4Y4HB 4JKPH 5AYUH 3IFOB 1P7QB 4G7YL 4YO0B 3FT4A 1R3LB 4C57C 4PRAB 3F7QA 3S35X 4ZO9A 3ARPA 4OCWH 5C08D 5GISH 1OP5K 3NBNA 2AXFA 1L7TH 2EKJA 3CXDH 5E8NA 5HDBE 3DWTA 1KENH 5HI3C 5I74C 2HT4C 1S7WB 1AGFB 3VXNB 1JHLL 4WO4D 1I3UA 4RWHA 3TYFA 3UZQA 1TITA 1FFPA 3AXLA 4Z0BH 1RK1B 5ACLA 5C6PB 1QSFD 3GSUB 4UQ3B 4CNIA 3C2AL 3TVMA 1BZ9A 4E41A 1AC6A 4V1DD 5MEQB 3IT8D 4Y1AA 1OCWL 2XRAL 1LMKA 3UPCA 3DROA 2X4PB 2ICES 5TDNA 3ULSA 1KF9B 5D7SH 3P30H 4XCYB 2JJTA 1EEZA 4PJ7A 1XR8B 1WCBB 5DR5H 3CVHB 2V7HA 2VXUH 4GRWF 1R3HB 5F1NA 1EZVY 3RP1A 4YFDB 5C0BB 3RNKA 5L6YL 3O2VH 1AH1A 3D69A 3LQZA 4KH2A 5T33L 1YEDA 3D0LA 3B9KB 4BZ1L 1EGJL 4LASH 2HG5A 4OGXL 3P4OB 3LN4B 1WZ1H 3EOAB 4ENEC 3F12A 3MLZH 3JV4B 4FNLL 3JWDC 1YN7A 4GBXB 5F7HA 3QEUB 4QXGH 1AXIB 5L8JB 1LO0H 1DR9A 5EZLB 4G43A 1QA9A 2XPGB 4HLJA 4I48A 4NRYB 3RL2A 4OZFG 4U1HA 4LQ1A 1BAFL 1HKFA 4XZUB 3HC0A 1N4XL 2JCCB 3L3IA 2AJ3B 1MI5B 3Q1SH 3VDAA 4LU5H 2ITDB 1IAIH 4L4TE 4H8WC 3RWFB 4J4PA 4ZPTB 4WEBH 1F3RB 1PQZA 5CJ8A 3KYKL 1CDHA 5KSBF 3NAAL 1BBDL 4M1CD 1BQUA 2PTTB 4DQOH 2DQIH 1WISA 2HJLA 2CQVA 5EIIA 2N7BA 4LNRB 3GDBA 3GMLB 4I4WB 4N8VB 4PJBA 1T2QL 3CFCH 3VFRA 3FB8A 4N0CC 1TCMA 4IRSC 2UUDK 1KCRL 5E2UH 3CFBB 1AXSB 4TTGA 3KYAA 3BSZL 4J6RL 1IKFL 2YN5A 1U2HA 1R0AL 4P2YA 4I8DA 4Y88A 1LK2A 4GQ9H 3GNML 5CBAA 1VFBA 2IPTL 2VABB 3B9DA 3C08H 3U79A 4PRPD 1KJVA 3PQYA 4PLJC 5IROA 3X3FL 2I9TB 4XNYL 3RWGA 4Z77A 2EXWC 3BO8B 5EULV 5IFHH 4LSPL 1MRFH 3QDME 3U82B 3B8SA 1AO7B 5F7MC 3BFOA 2DMBA 3U7YL 1JF5A 3FQNA 2CK0L 3CZFA 5LGJB 5TGBB 1A4JB 2UWEB 1AHWA 3EOBA 4FQ1L 5EU4B 2DS4A 5IB5B 3KYNA 1ZHKB 15C8L 1LP9A 2GW5A 4U0RB 2F74B 3W0WD 5C0IB 3VJ6A 5FO8A 4EVNA 5IWLA 2XG4A 3JWOH 3OKOA 2HFEA 3UDWA 3HRPA 1A7PL 3BE1L 3MRIA 4Z5RB 4MJ5B 4ORGA 1UB5B 3ZT6A 1WEJH 4PB0H 3OB0H 4ZFFA 5ADOH 4DEPC 1JGDB 2R1YB 1RURL 1VEMA 1D6VH 1Z9OA 4UDTB 2MWCA 1DLFH 4KUZL 1G6RB 4U1KB 5H2BA 4F58H 3IKKA 3SDCD 2YD4A 4UOJA 3SKJL 4U6YA 2H26A 4X4ZA 1NLDH 1FO0L 4MJ6A 3CDGA 4QXTA 4IIQC 1J8KA 1F45A 1PG7X 1U8KA 4NZDA 2BNRD 5EBLB 5KOMC 3GBLA 1KCSL 2JE8A 2XA8L 4ZXBC 3BH9A 1ZEAH 2JB6B 2ZOLA 4F37F 1TZGH 5LXGL 1FZMB 4HCRH 3DIFA 35C8L 3LRHA 3NOIA 3AU1B 2F54E 3BN9C 3ZYJA 5E00B 3DETD 4UILH 1U36A 5F7WC 1DQTA 5EUOA 4L3CA 1N6QL 4PV9A 4TNVF 1KCKA 4K7PY 1GZPB 3G6DL 4XP4L 4DZ8A 1G1CA 1PYWB 2BXYA 4KQ4H 4RNRA 1BVLB 3HZKA 5F9OL 3NFNB 5J3HC 5ISZE 2BNUA 3JWDL 3T3PE 3MREB 4XAWL 1KCUL 3T0EE 2IQAB 4HKZB 5EBMB 2FX8L 3ARQA 1NSNH 3CUPA 3T3ME 1NH6A 3GMOA 2GTZA 3TVMD 5D5MA 1UWGL 1VERA 3O11B 4E41D 5GS0H 4M7LH 4HFUL 2CDEA 1QFHA 1AGCB 4JB9L 4UIMA 4WI8A 4JR9H 3H7BB 1OQOA 1RU9L 1JRHH 3RY5A 1CN4A 4YHLL 5JOFA 5D1XD 5H94A 4Y1AD 4M61A 3QZWA 2BNQA 3BW9B 2H3NA 3NTCL 5DJDA 4N5UA 2R0ZH 3MRHA 2DRUA 5HDQL 1S3KH 3OAYK 4H20H 3TT3L 3DXAE 2Z93B 1VKXA 2BOBA 2VDLH 3CC5A 3S5LB 1BBJB 3TZVC 4PJAF 1CD9B 2CO6B 5BRZE 4KVNH 1Q0XL 1JWUA 4PGEB 2QV2A 1X5LA 2R0KH 1C1EL 4H0GA 1DEEA 3QUXA 4NQSA 4X9BA 2DD8H 4KJPC 2B8OT 3NFSH 5J9PA 3OBAA 5BVPH 4MJ4A 1ZXQA 2QL1A 1IGFL 4W6XB 4ZUVA 5KS9E 4U3XA 4HT1L 2VDQL 1G9NC 5IIEB 2I27N 1GAFH 2EKSB 5IT2L 3H9YA 4R4ND 3MRKB 5FOBB 2HJFB 1IL1A 1JGLH 3WUZA 4FQHB 2NMSA 3MLSH 4Z18A 4YX2H 3QPXL 2J5LB 4S1RH 5DJAA 1NBVH 4TN9A 3RRQA 5JW4R 3SDDB 3DGCR 5BS0E 4JPVH 3MRBB 4PJXF 3G04A 2PCPB 4XHJD 1HOCB 3VXSA 4J4PD 2PNDA 1EO7A 4L9LB 2IPUK 2XWJB 4FFZL 2GT9A 5C0NC 1F8TL 1PAMA 1S8DA 4X7FC 4Y5YA 3EFFA 1FV1B 2R0WH 2GCYA 3OZ9H 3I6LE 1P1ZB 5I1LA 2Y7QA 3C5SA 3DLQR 4C4KT 3MRLB 4OZIB 3L5JA 3RGVB 4O02H 2C5DC 2XQYG 1NC4A 2AKRA 4LHUB 3L9RA 1U8HA 1UA6H 4CU6A 4ISVB 4KROC 4KFZC 1ZGLP 1R5IB 5CGTA 2HVKB 1H8OA 4XP5H 2O5YL 4EDWH 3PQYD 2AJSH 3FFCA 1BEYH 2YC1A 1BJ8A 4NZRH 4ZYKB 5GRUL 3SQOH 1QSZA 5JDSB 1LEIB 1QYGH 4KKBC 3EDDA 5FA4B 3RDTB 3X11B 4J23A 1TZIB 1AKJB 3ESUF 2YD8A 1K3ZA 3WO4C 4R4BA 3P73B 1QR4A 3I02B 2XWTA 4HWEL 4NQDD 4OSUL 5HI4C 5B39A 2FD6H 1ZOXA 3FTGB 4L5FH 5J89A 4G5ZH 4R0LC 2EEAA 1BVKA 2FJHA 3FJTA 3UROR 2NY0C 2Z31B 1JK8B 4LPXA 2APFA 5IVZA 1PVHA 4Q97A 4YC2B 3DBXA 4XPHH 3QQ9C 1XF2B 3RIAF 4HW6A 4YQXH 4OF6A 4KJWD 4XC3L 2GUOB 2QSVA 3PWPA 3JUYA 4QGYA 1UM4L 1Z5LB 1NPUA 3TPUA 2VAJA 1U8QA 4FP8H 1QSVA 1X5ZA 2BVPA 4JPIB 4A6YA 3LHPH 3OKDA 3V6OC 1A1MA 4F7TA 5E4EC 1NAMA 3QJFB 4XVTH 1EV2E 3QRFM 1EXUA 4PLNC 4KZDH 1G7LA 5AYQA 1I9IH 1I7RB 4JDTH 1C08B 4NHCH 2ICWJ 3KLSA 4ODWB 4RWYH 2VXSL 4HJJL 4YHYC 4K2UH 3N50A 1VFAA 3FB5B 5ICZA 5CJQH 4L1HA 2OYPA 4Q74A 4MSWB 5SX4I 1EHXA 4E5XB 5C8JB 1IKNA 1N3NA 4PRHE 2OL3H 3OB8A 2MOVA 3MCKB 1OAQL 1CU4L 5FKPA 1WBYB 4UTAL 1BQSA 4M6NL 4OKVB 3RI5K 5I6XB 1TCRB 2XWBB 1B4JH 5JORB 1NMAH 4X6BB 1TVHB 1C5DB 1GSMA 4DKDC 5IB4B 4YHNB 2HLFD 3P2TA 3DV6A 3TV3L 3F7YB 4HBCL 1PW3A 1NGZA 4DWHA 1S7UB 5E8OB 3VGEA 4XMPL 5CKAA 4WCYL 1IZJA 2LU3A 4M8VA 3A6CL 2NTFB 4LSSL 2BNQD 3O45A 3LS4L 3E0GA 4N8CH 4FQXA 2ENSA 1MHPL 2EDQA 3RWCB 5I1HH 3UCRA 3QRGL 5L8LB 1CWVA 3BMWA 1E27B 5INCA 3ILQC 5E70A 5JW4N 2XNAB 2ADJB 5D7IE 4HKXB 3NH7L 5IJVA 4WUKL 1SMOA 3MYZA 4M1GL 5EORH 2IBGA 2DKSA 4GKZA 3MV7A 5SWSA 5IMKA 1XGPA 3WFHA 4ZO6A 4HKBB 1E4KC 4K3DL 5BZDA 1NGQL 4X98A 1P2CB 4ODVL 3L7EA 4OZFB 5JIIA 2P1YA 5BV7C 3CFKA 1P4IL 5GGQH 3QEQA 2WINA 1I7UA 4H1LH 4RZCB 3RQ3A 3VA2C 1AQKH 4Y0GA 2ZJSH 1ZWIA 5F7NC 4G9FA 2R2EB 1OB1B 5IFAL 4KU1A 1NL0L 1TXKA 1SY6H 1A3QA 4ODXB 4RSVA 1NUDA 5FHBH 1AC0A 2ATPB 2NY6B 1H3UA 5FYJD 5HVWA 3O2DA 4ZAKC 1I4FA 2K9UA 3VXSD 2X4SB 4OTXH 5ERWB 3WE6B 4ZUTA 32C2B 4KKLD 4U1NB 4HC1H 5DMIH 1AGEB 1TJGH 3DX7B 3BEWB 4NQEA 2DKUA 4NYLA 1V7ML 1UWEH 4G8IA 4K8RH 3S34H 4OI7A 5HDOA 4X6DF 4XC1L 3X13A 1NDGB 3KGRA 4ZNEA 4PRIE 1UM6L 3QUYA 1EAPA 4LEXL 5CUSH 1ZGLA 2ZCHL 5HBBA 1NC4D 1OL0A 3LKNB 3O3DB 5ICXB 3G6AB 1BFOA 1W72B 4QRQB 4E9LA 4CVXB 3VXQA 3RJDA 5GGSB 4JHZA 4XBGA 5EU5A 2IANB 4NZJA 3BGFC 1IGIH 5EC2A 4AEEA 3KDMA 3ME0A 5DO2D 3ARBC 4U6VH 5I1IH 4P2CG 5A43C 4ZQKA 2WBJA 3ZTNH 1DBBL 2VERN 1B6UA 3ORJA 3KPSA 4ODBD 1HH9B 1CG9A 4WU7A 3CDYA 2ERJC 4OCYH 2EYSA 2VNCA 3HNVH 2Q7YA 3PWLA 4X8JB 5C6TH 4YHML 3VFMA 1NMCB 2HRPL 3GHBL 4WVRA 3IU3A 4POUB 3W9DB 2IAMA 1U3HC 4P57A 5J13C 3SCMC 2A77L 4IS6A 3HI5L 4TOYH 3R1GH 4OIBA 4NPYB 5ANMA 1FFOB 2R0LL 3HE6A 5MI0C 5IGXH 3PWPD 1S9XB 1PEZA 1G0XA 1W2KT 4XXCA 1NGWB 2MKWA 1P84K 1FNEA 2HT2C 3B2UD 3VFGL 4BQCA 2AJZA 2MQ3A 5HHXH 5E2JA 4D9RD 4GRLB 5F7KC 3HRZB 5GGRY 4LKXB 2XFXB 4Z7VF 1P7HL 1F4AA 4KI5C 2GITB 3GIZH 3IDNB 5T5NG 2KQNA 4N90E 3V0WH 1KGCD 4R96A 1XIWB 2X7LB 1A14L 4OQTH 3SKMA 4XWOC 3R0MA 1K6QH 1R3KB 4RAVA 5IK3B 3FB7A 4BQ9A 2P46B 5DDHA 2ITCA 1DBMH 1YPZE 3MJ9H 3ULUF 4UQ2B 3CCHA 3OL2A 1SBSH 2YD7A 4Q9QL 4XPFH 4Y4HA 1YJDH 3EYFB 4YHZH 5DD3H 5BV7L 3QT2A 2NY3D 4PRAA 5K9QI 3GO1L 3Q5YA 3LQMA 4KTEL 4KXZH 1S7WA 2CDFB 4IRJC 1AGFA 3VXNA 2FH8A 4XP1H 1SVCP 1WIOA 4URTB 2CGRH 4PP1D 3CMGA 4MA7H 3RHWK 1RK1A 4XPAH 4UQ3A 3GSUA 3HB3D 3VD3A 3FCTB 5J6GB 1KV3A 3ZT7A 2VUYA 3ARTA 3MMEB 1HXMB 4UB0L 1RIVH 5F97E 4X6EB 1IBGH 2VH5H 2X4PA 5J11B 3PWUB 5GGUA 3OGCA 1XT5A 5ID1B 4XCYA 4NSKB 3OJVC 4X7DC 3MV7D 5SWSD 1XR8A 3CVHA 2F8VA 3SE8L 5C0BA 1JZ6A 4EXKA 2AJVL 3QO1B 1MCEA 4L4TB 4RAUB 4JY4B 3B8YA 1UYWL 3QEQD 3P4OA 3MLYL 2Z35B 3LN4A 5DJYB 3FT2A 1D6EA 1CE6B 4K3EH 3O6KH 1UKTA 3AREC 5I8EB 4FZ8H 3U36B 5T1DL 4GBXA 3VRJB 2ZKHL 4G9FD 3QEUA 3T04D 3QPQC 1S5IH 4QHKJ 3Q2CA 3LKSB 5EZLA 3BDYH 2XPGA 4M9PA 3V5HB 1BECA 3MACL 4OCLC 1HDMB 5KOVC 1PD6A 5CEYB 4JQIH 2JCCA 3BZEB 5LGHL 4W6YB 5IVOA 4JHWL 3HTLX 3WKML 2ITDA 4ZD3H 1BM3H 3UYRH 3NPSC 1OTUD 4LSQH 3RWFA 4NQED 3LEYL 1KCVL 2O5XL 4Y5VB 3V4VH 1A47A 5E4IA 3CAFA 1IAIM 3QDMB 4M02A 2PTTA 4BSWB 1CE1H 4CW1B 3O9WC 3QUYD 4LNRA 2AEPL 3GMLA 4I4WA 4M7JL 4N8VA 1HCFX 3FOLB 3D25B 1HINL 3M17A 1ACYH 4P3CH 2DQJH 4UU9A 1KG0A 3CFBA 5DA0B 1AXSA 2KZ1B 2UVEA 3ZDZF 5JXEC 4KK8C 3RBSA 3TNNB 5FUOH 3C6LD 5F9WC 2M2DA 2I9TA 1T5WB 1QBMH 1JI2A 5KAQF 4Z7WE 4XTRC 2MFNA 3BO8A 3ZDXE 4OD1H 1DQQA 1ZSDA 1AO7A 1FORL 2BDNH 1VDGA 2G75B 3IDXH 3VFVB 3H3BC 1A4JA 4M7ZB 4X7SL 5ABDE 5IB5A 3RNQB 1PLGH 4LSRH 3VGAB 3GK8H 5HXMA 4WO4C 4GG6F 2IAMD 3PDGA 1ZLWK 1QFWM 4U49A 3IB4A 4UIKH 4Z5RA 1P4BH 1UB5A 3HHRB 1DBKH 2F54B 2WV3A 4LCYB 2JK5B 4KRLB 3X14B 3THML 1ADQA 3S35L 4NN5B 3DX8B 3CZJA 4UDTA 3D9AL 3GJFA 5D1QB 1I9RH 1G6RA 4U1KA 1NBQA 1Z6JT 4KTYA 1NCWH 4Q6IB 1NC2D 4OCNC 4M8QA 5ISZB 3TT1H 1M7XA 1YEEH 4APQC 3T0EB 5FF6A 5C0GB 6FABL 4NC1E 3N06B 3W39B 3ZTJG 1KN4H 4PG2C 5ADPH 4MWFA 3IRZA 3IDYB 1FZMA 4WW2C 4LPWA 1C5BH 3AU1A 4HH8A 4LF3B 5E00A 4N9GA 2RJMA 3HG1A 4LKCB 4C58B 4UNUA 5KANG 1QEWA 3P4NA 2VC2H 4FFWC 2R23A 1RJZB 5DHVB 1J12A 1QACA 1PYWA 3V6BR 5J7CC 1BVLA 4PGDB 2V5MA 5DQDL 3NFNA 3DXAB 2FB4H 2VKXA 4OIIH 3TNMB 3MREA 1AJ7H 4JKWA 1OPGH 5BRZB 2Q8AL 3T08A 4CMMB 2IQAA 1HNGA 4HKZA 2G60H 4D0BB 3PV6B 3ZKSD 1LO3H 3OHXB 3VH8B 4HG4K 5KZCB 3O11A 1W0WB 2FBJH 4QTHB 4U1IB 4ZMAT 3IU4L 4MNQE 1AGCA 3H7BA 5KS9B 4EUPH 4TQEH 4M1CC 1DVFA 3WL9B 5EB9A 3BW9A 5L2KE 4IMKC 3ZDYE 2J88H 1CGTA 4JREB 5KVFH 4GRMB 5IP4A 2LAAA 1VEOA 4MMZC 3MV11 2Z93A 1LEKA 5C0BD 1F58L 4L1DA 4QHLA 5E6ZA 1W0YT 5I2IA 5EOCH 2J6EA 4PGEA 2P8MA 3KJ4C 4K23H 1H9VA 5EU6E 5MEPB 5KSVA 3QNZB 4PJDE 4F9LC 2CIIB 4Y4KC 2OZ4A 3ARDA 4WUUD 4GBXD 4OD2B 1RMFL 2EKSA 3CX5J 5FOBA 1F90L 2ZSWA 4DVBB 1UCBL 4P5TA 4FQHA 1AY1L 4KKCD 4QEGA 1T7VA 3TBVB 2DQUL 3SDDA 3SGJC 3MRBA 4QOKA 3ZKNC 4PRBB 3BZ4B 3PHSA 3ILPB 4UT6H 1LWRA 4YFEA 4L9LA 3Q3GB 4R9HA 1QZ1A 2XWJA 4FMKA 3RUGE 2ZUVA 1OM3H 1N64L 3BAEH 4F33B 1F6LL 1RZKC 2NY4D 2F5AH 2BP3A 1R3IL 3MRLA 4MZ3A 3SDCC 3HNTL 1A3LL 5JDJA 3RGVA 3H3PL 1V3LA 2F8XC 5DK3A 1QPPA 3AS1A 4LHUA 4HIIB 5EBGA 5DUML 2X70B 4J3UA 4FXLA 4ISVA 5AG8A 3VRIA 1DLHB 2Z92B 2XICA 1V7NL 5IV2A 1LD9A 1FAKT 1XF1A 2HVKA 3BKYH 3MRMB 4GS7B 3V52H 5F6HJ 1VADA 5CP7A 2I5YL 4JO3H 5HHOE 3PABB 3DURA 5ID0B 3MJ7B 3C8KB 3DETC 2CKBH 5CD3B 4ONGH 3VFNB 1LEIA 1AO7D 3IXTA 1LO2L 4PJ9D 4LRIA 4XNMA 1O5DT 5FA4A 1KJ2H 4QTIH 1TZIA 1AKJA 2GQHA 3AMLA 2PYEA 3TN0B 2X4RB 3P73A 4LGRB 4JFHD 3I02A 4JE4B 3M45A 1HILA 2AABL 2NXYB 3FTGA 5EC1B 1MCCA 3P11H 3UTSE 2YZ1A 4P9ML 3T65B 1I1AB 2QQQA 5DUPH 2VDKH 2Z31A 1JK8A 4P23B 3TVMC 4NRZB 4OI8A 3WSQH 2JJSA 3ARWA 4PRHB 1XF2A 3SE4C 4U1GC 2FECL 5D1XC 3EOTL 2VLKE 4HEPG 4BH8B 2GUOA 2MQCA 4MLIA 4XGZB 5TDOB 5K9KB 2NW2A 4JGUA 3RWHB 1MJ7L 3FONB 4Z78B 1LDPH 1FLTX 5JZ7D 4NQCD 4LCIL 3W11D 4FMFA 1MY7A 2KZWA 1J5OH 1I7RA 1C08A 3BESR 4ODWA 4ERSL 1EVUA 1T03L 4KUCD 1I3GH 3FB5A 4PGJA 4NT6B 1BLNB 2Y06L 1Q94A 1JPFA 3K8KA 1BF8A 5C8JA 4R8WH 1SYSA 3HG1D 2D0FA 2VN4A 3D87B 5DA4A 2B39A 1WBYA 3KPOB 5IEHB 4GSDL 3RZWA 4R4NC 2VLRE 4OM1H 5FYKE 1WZLA 4HUMB 3T2NH 5D7IB 3EO1B 1RUKH 5HYSG 5DFWH 1OAKH 2XWBA 4TSCH 5F3BB 1Z9SA 5JORA 1TVHA 3BPOC 2FNBA 1C5DA 1U58B 1T6VN 5EIQA 4X5WB 3VXME 4YHNA 4H5SB 4KJYB 3RWJA 2F5BL 3HLAB 4LARL 4XHJC 5F1OB 3F7YA 1J1PH 3FQXB 5D8JL 4RRPG 2W92A 3RBGA 1NGXA 4I3SL 1S7UA 4HSQA 4NKIH 3S98A 4LNVA 4TSAH 5I1DA 1DVFD 1S9KC 5L88L 1DZBA 4Z7WF 4K3JH 3RWCA 5GZNC 1E27A 1BFTA 5F7LB 1JHKL 1FYHB 3EYUH 2XNAA 5GHWL 2ADJA 4UTBL 3WEXB 5E2TH 1BPVA 3PIQA 1UADC 1RZKL 4NZUL 4ZG1A 3AB0B 3RTQA 1D5BB 4X7EC 4HKBA 2APWA 3VXOB 4AH2A 3F5WB 1Q0YL 4KTDL 4HPOL 1P2CA 3NCJH 1FNGB 1GC1L 3ARDD 3BUYA 3LQAH 5D2NE 5MEOA 1RV6X 5HHPA 2DWEB 3RIFK 2KKQA 3LEXB 4RZCA 1U8MB 4N1EA 2X40A 2VLLB 3LH2H 1CGXA 1KFAH 4PRIB 1FJ1B 4P5TD 3VXUD 2R2EA 5JHDE 1OB1A 1AHWC 4MJIE 1BGXH 3ZE1E 5JPNB 2JIXB 5HHQA 2IQ9L 3SDDD 1BJ1H 3TYGH 1RZJH 3QXWA 1IC5L 2ATPA 1RZGB 3UDWC 5K9OB 4QOKD 4B53A 2RR3A 4RFOH 3WE6A 5ECJE 4U1NA 4BSJA 5A2KH 3CFDB 5DK0B 1AGEA 3CNKA 3DX7A 3BEWA 4OZGF 4KJWC 5TF0A 2HJKB 5A2IH 1KCLA 4ZUWB 3TO4D 4WGVB 2IFFL 1NDGA 3PP4H 4H1LG 5D93B 3OV6A 4NZTL 3LKNA 3O3DA 3AS0A 3ZYZA 2DQFB 3MJGX 3ROOB 1W72A 4PJAA 2FO4B 4MHHG 1X5IA 3OX8B 2W9DL 4W81A 1PKQE 4FTVA 5GGSA 1A6WL 4JM4H 2G9HA 2IANA 4WWKB 4YDLC 5C2BH 2X2YA 3AY4A 1FNHA 3Q48A 4MD0B 1MRCH 3VD7A 1CLZH 5E24E 1YEIL 1F97A 1IE5A 2NQCA 4YWGL 2GYSA 3QI9B 5T3ZL 2VE6B 1AKJD 1CF8H 2I07B 4J3SA 3FOMB 1HH9A 2PYED 4KK6D 4ZS6D 5FHAH 3MV9E 1CIUA 4CU7A 5DZOA 4NGHH 4PJXA 1G6VK 1HSAB 4X8JA 5BMFL 1UCTA 1F6AA 3IRPX 4QRPE 5CJBA 1PEWA 3SY0B 2R2HB 4KPHH 1WAAE 2D7QA 3UTPE 3P0YL 5CCKL 4NPYA 5GGRB 4H88H 5DJZB 4TUKL 1YPZB 3RWEB 2GFBB 1S9XA 3GSNH 1JF1B 1U6AH 4M00A 3MRDB 1I3VA 4ZUUB 1FG9C 4TPRH 5HY9A 3OKNB 2VB5A 4GRLA 4I9WD 3HRZA 4YHOH 4OLWH 1TVDA 2XFXA 1MCNA 4LKXA 4PP2B 1EMTL 3EUUA 2GITA 3IDNA 2AV1A 1AR2A 2VDPL 1NKRA 3RKPA 1XIWA 2X7LA 1D5ZA 4WFGE 2CUMA 1CYGA 1KACB 1R3KA 2VQ1A 4YZFE 5F9JB 5JIPA 4L3EA 2LVEA 3AGVA 1NANI 2QQLH 4UQ2A 3CVIH 3CSBA 3EYFA 3WFBH 3OR6B 3FFDA 3MUHL 2FL5A 3NACH 1MJ8L 1FGNL 5DFVD 1VCAA 5HD8D 3C09B 5HYIA 1JZ5A 1CICB 1S7XB 2WUBH 4XMKH 2CDFA 1N59B 2VLMD 3ARGB 4XCFL 4ALAH 9CGTA 1DANU 2MHAA 4IDLA 4O9HH 2VXTL 2NYYD 3CFJB 2Q7NA 3O3UN 3MLVH 3FCTA 4CVWA 4KKLC 5J6GA 4OQ1A 3L95B 5BJTA 4LFHG 1X6NA 3MMEA 3WFEH 1HXMA 4RISL 3MRNB 3PWUA 1X5JA 5ID1A 5FYLH 4FQPA 4NSKA 3RTQD 5ITFB 3QCVL 1MFCL 2XV6B 1WUNT 1GPOH 5I8CB 5I75C 3K0WA 3IKCB 2HAZA 3QO1A 3MYJA 4RAUA 4JY4A 1QFPA 1CI5A 3HC3L 2FIKA 3MLWL 1IQWL 3V4UL 3SGKA 3GRWA 4M1DH 4BZ2H 2Z35A 3IJSA 5DJYA 4CVUA 2L7UA 1CE6A 2AEIT 3QXAA 1LQSR 2P49B 1MAJA 4S2SB 5IW1B 4NM4H 5I8EA 3U36A 1PFCA 4GLRH 3VRJA 1FDLH 2OQJA 4BQ8A 1UM5H 2HKFH 3LKSA 1TFHA 3MCLL 1AD0A 3V5HA 4X6CE 4WFED 1HDMA 4OZ4B 2PXYB 2V6HA 2OMNA 5CEYA 4WV1B 2IWGA 3EZ8A 3BZEA 4KRPB 4DN3L 1NEUA 3H3KA 1XGUB 3QHFH 4MB3A 4OIAA 3WUWG 4WI2A 1X5XA 3MLRL 3RA7H 3OJ2C 4Z7WB 5D71H 1IAMA 3QDMA 3G08B 1TMCB 2QADC 4MB4A 4BSWA 4CW1A 5IMMB 1A6ZB 4QYOA 3B2UC 1G0YR 3FN0L 3D25A 3GRWL 3ZO0A 5FGCE 1TZHB 1D7FA 4D3CH 5GRJH 1T20B 4FTVD 3D18B 2IAND 4J3OC 3P4MB 1FZOB 1DQDH 4XNQB 1MCBA 3LMJL 3SOBH 1ED3B 1CD0A 4MAYB 3TNNA 2HMID 4L9DA 1IKNC 5EH1A 1A2YB 3LIZH 4ZOBA 4NOBA 3NIGF 1AXTL 1T3FB 1GZQB 1ZS8B 5EZIL 4O58L 3EYVB 3QEHA 2DBLL 4NHUB 4HAGA 2NY3C 2G75A 3VFVA 3VE0B 2AJXL 2X4QB 3KPMB 4JRYE 3RVVD 3BRDA 3RNQA 5A3IC 4HWZB 3HN3A 5F93C 1G9NH 1OW0A 1KIRB 1A9EA 4PP1C 1HQRB 4XPTH 5DFTA 3KPRB 5T3XH 4OZGB 2HKHH 1F4XL 5DEFA 4JN1H 2JK5A 3X14A 1JHTA 2AXHA 1ZLSH 2WP3O 1PSKL 4ZO7A 3VI4E 1WV7T 4HZAA 2H1PL 1MCWW 4QF1A 4X5LA 5JR1L 5F9DC 4PJCE 2PKDA 3O4OB 3NIDE 2AK4E 4M93B 1YDPB 2FEDC 5HPOA 1HE7A 3QXTA 4JPWL 4LQFL 3T0EA 4M62L 2YHGA 1FL3B 1XIWD 1WFNA 4PJ5E 4NO0A 4L3ED 1XH3B 2EE6A 4FQIL 4MNQB 5E8DL 4LF3A 3BXNB 5LBSL 3BJLA 4JRWA 2ZG2A 4LKCA 4ODHH 4OBRA 5L2KB 5JHLL 2QSCH 4Z7NE 1E6OH 2JELH 5DK2B 1RJZA 5GSVB 3IJHB 1FRGH 5C09E 3RWIB 1MCWM 3DXAA 2R8SL 2OMBA 2V9TA 1YYML 1WTLA 4QCIA 4ZFGH 5ETUB 5BRZA 1MIMH 1VPOL 5EU6B 1TIUA 3IF1A 5T1LB 4D0BA 4OLZL 3PV6A 2DMKA 4WWID 1RIHL 3VH8A 4PJDB 4DGIL 4NKMA 1XGQB 1OTUC 3QIWB 4QTHA 3QEGL 1V8HA 4Y89A 1B88A 5KS9A 3SN6N 1LDSA 4HIXL 5IVXE 2WQ8A 2UZXB 1CVRA 3WL9A 4JKMA 1D5MB 3QUYC 3ZT5A 4JM2F 1HKLL 2X10A 3KNBB 4GRMA 4Z7VA 1NJ9A 3DOSA 1EO8H 4F57H 1ZLUH 1MAML 3CLFH 4JG0H 1AGBB 4J8RB 3BZFB 5TQ0H 1INDH 5F70A 4PY8J 5MEPA 4PBWD 2P48B 2ZUQC 3QNZA 5KTEH 3PP3H 3C6LC 3RUGB 5C0AE 1K85A 3WJLA 1CZ8L 2CIIA 2A1WH 2E8YA 4ZSOE 5K9QG 1BD2E 3HZVB 5J0BA 1Z3GH 4XCNB 1JUFB 3ZKXC 1XGTB 3BHBB 3ALXA 4EUPG 5DJ8B 3V2AR 4DVBA 3WFCH 1MJJB 1UQSB 5HYJE 3CFIC 4MQXD 3TBVA 1WICA 5I16B 4ZNCD 2ZUUA 1CXHA 5EOQL 4PS4L 2IAMC 4GW4B 4H1LB 5GRVL 4PRBA 3BZ4A 3ILPA 5HHOB 1JPTL 2E7MA 1IZKA 2FSEB 2CMRH 5EA0H 3Q3GA 4Y4FB 4HS6B 4MA1B 2FIRT 2CJUH 4B7LA 1CDCA 3PL6B 2GY7B 4HWBA 4GMSH 4L8SB 4OAWB 1JNHA 4OLEA 2LVCA 1KELL 4PJEE 4QHMB 5F1IA 3CD4A 3S37X 3ROLA 4MAUH 5F71A 2I9LB 2UY6A 4HIIA 2ZCLL 4WDIA 3UTSB 3V6ZB 2GJ6D 2A6JB 4I3RH 3HPLB 5HGHB 2Z92A 1CGSH 1VACB 2AI0H 4CVZB 3MV01 4JQXA 2NZIA 4YXLH 5HGGS 1FH5H 5J1AB 3C9NB 1QKZL 3LKOB 2Y23A 3GJEB 3PABA 5ID0A 1XF4B 3MJ7A 3C8KA 3LKPB 2VLKB 4NWTH 5CD3A 1TENA 1X5AA 3VFNA 3JSSA 2PF6A 3UZVB 2BERA 1CXEA 1ZE3C 3SKUD 5TFSL 2EEBA 3IETB 3HE7B 1U8JA 1EEQA 2BSRB 4Z7OE 4YAQB 5JW5B 4LOUC 4R90H 3FAXA 5ALBH 1EHNA 2X4RA 3TN0A 5D1ZB 5D4QA 4HWBL 3KYMB 1EZVX 4DKEH 5EC1A 4G3YH 3RFZC 1GOHA 3GMRB 4X9IA 1I1AA 1LHZA 1JIBA 5JO5B 4KDTC 3TLRA 1JVKA 1WZKA 2J4WH 4NRZA 1T7YA 4P23A 2ED7A 3KHQA 3KWWA 5FGBC 2VWEC 3BKJL 1GGBH 3MA7B 2VXQH 2OI9C 5I30L 1VEPA 2YK1H 4XGZA 2VLRB 4GUPB 3BRGC 1CDBA 5KVEL 3ESVF 2YD2A 1AIFA 4Z78A 2CD0A 4Q0XH 1T22A 4HIHB 1OD9A 2HFGH 4KRNA 2A38A 4BUHA 1KJMB 3VXMB 1RVFL 4S1SH 1EPFA 5TPWH 3QO0A 1B2WH 1AE6H 5I0ZA 1EERB 3G5YB 3FZUD 4NO0D 3WIHL 4NT6A 1BLNA 1KBGH 3MJ8B 3VD4A 3C60C 3MOAH 5C0JA 1QSEE 1HIML 1ZKAA 4AEHH 1H15B 2R4RH 3DMMC 1RJLB 1NBYB 5ILTH 3GBNL 4KAQL 1QNZH 3KPOA 3KPNB 4EOWH 3D3VD 2IPUG 1J8HD 3EO1A 4BYHA 2APXA 4KKCC 4QWWC 1H3PL 5F3BA 5C3TA 5KSAC 1FVCB 2F53A 3U7WL 4GXUM 4WW1B 3TH3T 4GG6A 3OG6B 4ORZC 1RK0B 1NCNA 4X5WA 1UZ6F 4H5SA 4KJYA 2D7TH 3HLAA 2V17L 3VFWB 2OSLB 5FDYA 2MCPL 4LEOB 4N68A 3FQXA 2X4OB 5KN5B 5ITBH 1DFBL 4LPTA 5D2NB 3TH2T 3T4YB 2Y07H 2DQEL 1BF2A 4X4XB 4PJIF 4DW2L 2B1HH 4LBEB 3PHOB 5SV4A 3K80A 1IEBA 2NY4C 3VGBA 5JHDB 1EBPA 2N4IA 4GG8A 4MJIB 3FRUA 2R9HD 4D9LL 2VYRE 4YDJA 1KC5L 5DRXA 1D5BA 5AUMB 3KPLB 4DTGL 3VXOA 3U1SH 1BMGA 3F5WA 5D6DA 4POZD 4EEEA 1QO3B 2W0FA 3JUZA 4FXGB 5AAWA 4JPKL 3ULUD 3LD8B 3QG6B 3QDJE 2XKSA 1FNGA 1M71A 2DWEA 3ARFC 4WY7L 3MO1B 3UJTH 2Y4SA 1U8MA 4LLYB 4LPUA 4PJ9C 4JKPL 5AYUL 3O6FC 1TJIH 4PRIA 3VI4F 4XMLH 1VGKB 1FJ1A 3WUWB 2BVTA 3WIIH 2H45A 1G84A 5JPNA 3H9SE 4NRXB 5GISL 3PNWA 1PY9A 2XI9A 1L7TL 1PKQB 3CXDL 2X1XR 1KENL 1NMBH 1RZGA 1J86A 5JIHA 5K9OA 1CFVH 2FECI 3OPZH 4Z0BL 4JQVC 5I73B 1WBZB 1KLUA 1V3MA 2DM4A 3CFDA 5DK0A 3RPIB 1NFDF 3OG4B 3TA3A 4M43H 2HJKA 5FYLE 1CLOH 1YQVL 2DQGH 4JM2B 3PWNA 4Z7NF 1IRAY 1KIPA 3MV9B 4MQTB 5EOTB 4EI5B 2NXZC 4LLDB 1BWWA 3P30L 5D7SL 2XKUA 4TRPH 2DQFA 1E28B 4WHCA 1RJYB 3ROOA 2FO4A 2EH8H 1X5FA 5JZ7C 5DR5L 2IF7A 2VXUL 3T0XA 1DN0B 1Z9MA 1FFNA 4QRPB 4JFFE 1YMME 2K1MA 2Y5TA 1A1OB 5EBWB 2YRPA 1DANT 5E9DE 3T0DA 3TH4T 4U2ZA 1OTSC 1BWMA 1MF2H 4MX7B 4OD3H 4LASL 4Z76B 2R2BB 4EDXB 4LCWD 1WZ1L 3I6KB 4NFBA 1UFUA 3MLZL 1FC2D 4LLAA 4R6UA 1HI6A 5IM7B 1A9BB 5K9JL 1F3JA 4S1DD 2DQCH 3QI9A 2VE6A 4QXGL 2I07A 3BD5A 5F44A 4HUWB 4XPBH 3TN0D 2P45B 3LEVL 3PE9A 2R29L 1FGVH 5ESAB 1OT2A 2GKIA 4WNQB 3DX9A 2JB5L 1HSAA 5GS0C 1SBBA 1DE4B 4HHAA 1B0RB 1NLBH 1MREH 4DUXA 3SY0A 3S7GA 5GRVK 2R2HA 3Q1SL 2W9LA 4P23D 3OAZH 4LU5L 1IAIL 3K3QA 5GGRA 1PJ9A 5DJZA 1YPZA 3BP5A 4WEBL 4YE4H 1O0VA 3RWEA 1DVFC 4KMQA 3CX5K 1S78C 4DQOL 2DQIL 5F3HB 5B3JE 5JTWA 4O4YH 3EW3B 1JF1A 2Q76B 3MRDA 4DVRH 4ZUUA 3CFCL 1MCJA 5EZOH 2YUWA 3OKNA 3BT2L 1M6OB 2GJZB 4FQQA 4PP2A 3WLBB 4WGWB 5E2UL 3G5XB 1TDQA 4ZTPH 4CGTA 3EO0B 3FT3B 4PJ8B 4L8CA 2EDEA 1HHIB 3L5WB 4GQ9L 4WFHE 4PG9B 2HTLD 2L0DA 3C08L 4PJ7F 2HA1A 4F15C 1CFSA 1GOGA 2BC4B 3ARDC 2NY2B 4N0RA 5GS3A 3EHBD 4RMVA 2ZPKH 3QIUB 3QUMH 4Y19D 5IFHL 3MSPA 1MRFL 2FX7L 4YIQA 4UINH 3WN5A 1U8NB 1HHGB 1QLRB 1Q9WB 5GS2D 3VMOA 4P5TC 3QDAA 1FVEA 5FUCC 4C59B 4YDVA 4Q2ZB 3CK0L 4GAGH 3B43A 4NC2B 2F53D 1TNNA 5J12B 3SDDC 4PJEF 3G9VA 4YXKH 1MFBH 4ZFOL 5I71C 5T3XE 1RZFH 4NNXB 1CICA 4QRUB 3ARGA 3JWOL 4AIZA 2V2XA 4HWUA 5B38G 2HN7A 4L9LC 2H8PB 3CFJA 4M7KH 5E1AB 1WEJL 5GJTH 3L95A 5ADOL 5IMOB 3S3SA 4PRNB 3QXDA 1D6VL 3GIVB 3MRNA 1NBZB 2XG5A 1DLFL 3TO4C 1QVOB 5HHME 4F58L 1NGPH 3SGDI 4F9PA 2XN9D 5D72L 4X6CB 4GKNB 4JO4H 2ZUXA 1UH4A 4QT5B 1NLDL 3QWRA 5L0QB 3QNYB 4KMLB 4BM7A 4EUPB 2XIDA 2IG2L 4M3KB 5CIPA 4UAOC 5I66A 1ZEAL 3L6FB 5IBLD 4PTTB 1TZGL 4HCRL 3NZHH 3S96B 4CJ1A 1OAZH 4U31A 4M4RA 4UILL 3QDGD 4R26H 4G80A 4S2SA 4PRID 4U1LB 3P9LB 1CBVH 4H0IA 4UV7H 2IBZX 2EDXA 3IVKB 4ZS6C 3A6BH 4KK6C 4KQ4L 5JXAL 2FX9H 5FGCB 1VHPA 1J88A 3MODL 3PDOB 1XCQB 2C26A 1IM3B 2YA0A 2LFGA 2MPAH 1PG7H 3I85A 3P0VH 3QQNA 1P9MC 4WV1A 4G6JL 4N0UE 1H3VA 4D9QE 3NVQA 3SKOB 1T89A 3HA0A 1NSNL 4WFFD 3K4DA 3QHZH 5EOCJ 2JJSC 1F6FB 5B8CB 1WSST 5GS0L 1ORQB 1L9NA 4M7LL 1MWAA 2DTMH 1K8IA 3TA3D 4Z7WA 4JR9L 4YXHH 1INQA 1FQ9C 1JRHL 3CJJA 3QB7C 5INDB 1KEMH 3MLUH 4IJ3B 5IMMA 1ULVA 5L9DH 4G6KH 1A8JH 1A6ZA 2R0ZL 3EYSH 3ULVF 4KJQC 4JRYB 1YEHH 3BIKB 2GI7A 1S3KL 2BY3A 4XP9H 3VDCA 5BW7C 2VDLL 3D18A 3V6OE 3P4MA 1CS6A 5HVHB 3OQ3B 4XNQA 5DI8B 3QUZB 3WIFB 2R0KL 1U0QA 3H2WA 1QFUH 2DD8L 4MAYA 4GMTH 4UOW0 3GM8A 4OF5A 3NFSL 1A2YA 3DVGB 3LZFL 3QFJE 5GS1C 1G1YA 2CPCA 2BVYA 1Q9KA 4AIXA 1L7IH 1ZVSB 1T3FA 3QI9D 3VFSA 4PRDB 1GAFL 4PJCB 4JFEA 4JDZB 5I6XC 4NHUA 3GEWB 1JGLL 2AK4B 3VE0A 3E2HB 3KPMA 3MLSL 1T66D 4YX2L 4Z8FH 5EUOF 1UVQB 5HD8C 1NBVL 1QQDA 3MRPA 4HWZA 3O4LD 1ZT4B 3VFTA 3CIQA 2J8OA 1S7SA 5BQ7A 4JPVL 5DJCB 1SJHB 1BZQK 1KIRA 4JZJC 4PJ5B 2ZWLT 2NYYC 3KPRA 1JCKA 4G6FD 4F80A 1KJ2B 3C2SA 4OZGA 3UTTE 4YPGA 1UWXH 1DSFH 2EDFA 2BY1A 1C16B 1SQ2N 1X5GA 2Y36H 4EN3A 1JZ2A 2R0WL 3GKWH 3OZ9L 4UZGA 4TVSa 5AZ2H 3NCMA 5D5MF 2A9MH 1K2DB 5C09B 1QRKA 4O02L 2A6DB 2OTPA 1YDPA 3RTQC 1J10A 4XBPB 3CXHJ 4UNTA 3U0WH 4ETYA 5DVLA 1UA6L 5FM4A 1DDHA 2DOCA 4NBYB 2IH1B 1OP3H 1SHMA 3D2UB 2A74B 4EDWL 5J1TC 4PV8B 2AW2A 3DYMA 1TTFA 2AJSL 2W0PA 3C2AH 2EIEA 3E3QC 4FHBD 1BEYL 1NFKA 1X3DA 2J8UE 4NZRL 3BGAA 1N5YH 4I18C 1F2XK 3ARRA 4M9OA 3SQOL 5IVXB 5L2KA 2EC8A 4P4KC 3WO3B 1QYGL 5DK2A 4RRPA 1L6XA 1IM9B 1F42A 5GSVA 2D0HA 3IJHA 4K9EC 2R1WA 2H32H 4RMUA 3F58L 3ARGD 2FD6L 1BQHG 3DRQA 3VI3F 4L5FL 2YWZA 4N0FB 4TVPE 2X41A 1MRDL 5EU6A 4CMHB 3ZLQC 3VXRD 5C0AB 4PJDA 2UYLB 3QIWA 4K8RC 3VXTB 4P48A 4XPHL 5CZVH 4ZSOB 5HSFA 4YQXL 1BD2B 2DKMA 5MENE 1MNUH 3CX2A 1D5MA 1FYTA 4OJFH 5ALCH 4FP8L 5I17B 4OI9A 4LCCB 3SPVB 5HYJB 4UI2A 3LHPL 2AJUL 1UB6B 1Y6KR 3SO3C 2E27H 2EECA 3OAUH 1BAFH 4HGWA 4KZDL 4HWNA 3AY4C 2XY1A 1OTTD 4J8RA 4JDTL 4R4FH 5D7LA 4NHCL 4RWYL 4K2UL 2YRLA 2HMIC 2IGFH 5CJQL 3RUGA 1G7MA 1MCSA 2L7JA 5IQ7H 2OL3L 2X5PA 3GB7A 5IB3B 1NGYB 4XCNA 1XGTA 4JFXA 5FCSH 5DJ8A 4PJEB 4RFNC 4DUVA 1T2QH 1VFOA 2YXMA 1UQSA 3IFPA 1KLGB 3KYOB 1JYNA 1JYVA 4NQVA 1S7QB 1B4JL 1R5WB 1NMAL 1YMHB 1KCRH 5I16A 1YY8B 2Z9TA 1N8ZA 1CFQB 1MLCB 3BSZH 1MVUA 2X89A 4GW4A 4OFYA 2FO1A 5DSCA 5IR1B 4LLQB 2FSEA 4OLYH 4Y4FA 3RKDD 2WUCH 2OM5A 4HS6A 4U3HA 3T2QA 1JPSL 1R6VA 3PL6A 4L8SA 4N8CL 1FVDB 3QQ4A 5F72S 4OAWA 5I1HL 2IC2A 2GSIA 2W59A 5E56A 5DRNB 3U7YH 3GJFK 3D85D 3R0NA 2C3XA 4MMXC 3OF6A 5IF0B 4ONHB 2AV7B 2NX5B 1L4IA 3L3OB 3V6ZA 1JGVL 2A6JA 3UJJL 5HGHA 4KI5E 4CUCA 4CVZA 3T2PA 1A7PH 2DL9A 3C9NA 1J1XH 3LKOA 1FIEA 3GJEA 1TLKA 2RAMA 3LKPA 4MNGE 1FL5B 3GMNB 1PBYA 1R24A 3N9GH 1ZVHA 4JFED 3D0VB 4UUJA 1AQKL 4KUZH 2YR3A 2ZJSL 3O0RH 1P5UA 3U0PB 2BSRA 1INEH 1JN6B 1FO0B 5JW5A 5JPMA 4L3AA 1SY6L 1FP5A 5C86A 1ZTXH 3BP4B 2ARWA 2VISA 5D1ZA 3PWVB 2B4CC 2ORBH 5FHBL 3QIBA 3KYMA 3UTZB 3GMRA 2FWOB 2R56H 2XA8H 5JO5A 3KPRD 4OTXL 5I76B 3U2SB 4E0RA 4HC1L 4EN3D 2EIDA 1QSEB 2IMMA 5DMIL 4B5EA 1TJGL 1GGTA 1LEGB 1JI1A 5GGTA 3MA7A 2CXKA 1UWEL 4JANB 3DJ9A 2VLRA 4K8RL 3S34L 4AENB 4GUPA 4NUJB 5CUSL 3ULVH 1JFQH 3QAZC 3EYOB 4CDHA 3T8XB 5DJXA 1CT8B 3X17A 1KJMA 2BVEA 4GKSB 4XAWH 3VXMA 1MFNA 2MCG1 3G5YA 4P4RB 4PJGF 1IGIL 1I7TB 2VDMH 5AWNH 5E2VL 3SGKC 4X0KB 4AEIL 3FQUB 4D8PB 3PV7A 4HFUH 1I7ZA 4O2FB 4PUBL 1RU9H 4U6VL 5I1IL 5L2KD 1H15A 1TETH 5DMGC 1RJLA 1MFDH 4GW5B 1DUZB 1JE6A 5B38B 3KPNA 3HMXA 1YECH 3JWNC 4MQXC 5KG9B 4LSVH 4YLQT 3D48R 4IRSB 4OCYL 2ESVE 4XXDB 1RFDH 3MCG1 3LB6C 3W81A 2Q8BL 3HNVL 1RK0A 3FO9B 5C6TL 2GK0B 4XCEB 2V2TB 1N2RA 1Q0XH 3VFWA 3HUJE 4Z9KB 1ZLVK 3HI6H 3QDJB 3TEUA 3OKYA 3HCVA 2X4OA 4WI4A 5KN5A 1T80A 4X99A 4TOYL 2A6IB 3R1GL 4QGTA 5HGAB 3OSKA 4HX1B 2B5IB 4X4XA 5IGXL 4U1SA 4NM8H 5L2JB 4LBEA 2NY1C 1FYTD 1RZ8B 4OGAD 3MUZ1 2P7TB 3BUTA 4PLOB 4JFQB 3U9PH 5JHDA 4UT7H 2ZUWA 4MJIA 5A2JH 3F7VB 3H9SB 5HHXL 4OFDA 2LAGB 2GK2A 3WS6A 5AUMA 1KB5A 5D7LD 3K1KC 5EO1B 5C0CE 1QO3A 4QRSB 3V0WL 4OQTL 4FXGA 1K6QL 3QG6A 2IH3B 3QCTH 4I0KA 1DBML 3MJ9L 1A7QH 5A2FA 5I0DA 4DEPB 3MO1A 1L0QA 1JTPA 1SBSL 4LLYA 4KVCH 2P5WE 4XPFL 1YJDL 4UT9H 3FHAA 3KPPB 4YHZL 4Y16A 1A6AA 1VGKA 2P5EA 1FZJB 2OTWA 4F3FA 5F6HI 2X1WL 4NRXA 4H26B 4KKAD 1ZHLB 4JFFB 1T5XA 1YMMB 3DX6B 4RA3A 5C08E 1OW0C 2X89D 4IIQB 4XP1L 3X12B 5EG6C 2YUZA 3WNPA 3I50L 5E9DB 2CGRL 4MA7L 4XPAL 3DTXB 4L4VD 4Y4FD 4ZXBB 3BP6B 2ILLA 1WBZA 4MXQD 3B5GA 5CSZB 4WI9A 4LP4A 2EDNA 3O8XC 3RX8A 4OZHF 3FRPG 1RIVL 4JM2A 4V1DE 4CADB 3M07A 1K5NB 5TE4H 4P2OC 5MP6H 2VH5L 2Z8SA 1XF5B 4NNYB 3MV9A 5EOTA 4EI5A 4LLDA 4FQ2L 2ICEB 1E28A 4C83B 3GSOB 2NCMA 3LV3B 4HWEH 4Q9RH 1EH9A 5GZOD 4U7KA 4QRPA 3K8LA 4ODSL 4W70A 3FZUC 1A1OA 3LRSB 2V2WB 3O41A 4NQTA 4MX7A 4KGJA 4Z76A 1QTYT 4G6MH 1ONQB 3I6KA 4K3EL 3O6KL 1IAOB 1A9BA 4FZ8L 4I0PC 1KSRA 4GXVH 1S5IL 2C7UB 3IDIA 3PUCA 3BDYL 3HZYB 3QIBD 5LG1A 5ESAA 4YUEH 3KXFA 4WNQA 2M1KA 2D03L 1B6DA 4JQIL 1NCUA 1DE4A 3ZKQD 1B0RA 1OQXA 2M8XA 3VFOA 1Y18B 4JFOB 4ZD3L 5FO9B 4LAQL 1UJ3C 3UYRL 1CFNB 4LSQL 2V5RA 3TJHC 3QH3B 1IC1A 5KSUB 4M5ZL 2X42A 1HH6A 4FN0A 4PPTA 3V4VL 4Y2DD 1CE1L 5F3HA 4UTAH 2BSED 4LHQB 2Q76A 5JLZA 3STLA 4J3WA 1XF3B 1ACYL 4O2EB 2R9HC 4P3CL 1M6OA 2GJZA 3WLBA 3F6IA 4QHNA 2N1KA 3EO0A 4Y8DC 4POZC 3FT3A 4PJ8A 3AAZA 1YEFH 3PDDA 1HHIA 3L5WA 4A6YH 3GSXB 3ULUC 4HBCH 3WJJA 2DI9A 4FQLH 5FUOL 2QKIB 5KVGH 1NAMH 2PO6D 1BQHB 3SDYH 1QBML 3QIUA 4P59H 1VGEH 4OD1L 4RBPH 5HHMB 5E6IA 3S36X 1U8NA 2BDNL 4U7MA 1HHGA 1QLRA 5HDLA 4LFHD 3IDXL 4Q2ZA 4HXAH 3PWJB 3QR2A 3ALPA 4X5XB 3VXPA 1PLGL 4NNXA 2YPKB 1CDGA 4LSRL 2O61B 2CR6A 5BXFB 1TNMA 5BVJB 1TQBC 4WJ5B 3U48A 3W0WE 4KROB 1MHCB 4UIKL 4KI5F 2H8PA 1P4BL 5E1AA 1DBKL 3C8DA 1A21A 5I19H 2JCCF 3QJHB 4PRNA 1UACH 5JW4Q 4FXKB 3GIVA 5KJRH 5JW3H 5DTFB 1I9RL 1NBZA 5JHDD 1QVOA 1IMHC 4MJID 3RVTC 2W65B 1NCWL 4I13B 1ND0A 4X6CA 2UZYB 1H3TA 3SDAD 3TT1L 5SWQB 4NO5B 1YEEL 1CLCA 4XP6H 1PG7W 3WO4B 4N0UB 2BY0A 4KHTL 1KN4L 1XMWA 2QHRL 2CSPA 4GS7C 2O26U 4R0LB 4NCC2 5ADPL 3L6FA 2BNRE 2NY0B 3S96A 1C5BL 1S9YB 2UZIH 1YQ2A 1YNLH 5GSRB 7CGTA 4Y16D 3DECA 2P5ED 3KVQA 2VC2L 4S1DC 5CSGA 1OGAD 1LK3H 1UM6H 2YBRB 5FIEA 3MBEA 2HH0H 1XCQA 2FB4L 5CS7A 5DLMH 4DK6A 1IAII 1AJ7L 1C5CH 1OPGL 5E4EB 2Z4QB 3SKOA 4X9GA 5I15H 3K2MC 4TUJB 3C5ZC 2G60L 2UWEF 1LO3L 4GXUN 5B8CA 4N5ED 5DQ9A 5E2WL 4ACPA 4PJIA 4YHYB 3QFJB 1ORQA 2FBJL 1EHLH 3ARZA 1FLRH 5A16A 4E41E 5INDA 4TQEL 3O2DH 3LSOB 4JM2D 4D2NA 5DC0A 3MV9D 2J88L 3S4SG 3IDMB 5KVFL 4JRYA 2VDRH 3EYQC 3H8NA 2OXGA 2VIRB 4JVPA 2F58H 1D9KC 1T0NB 3RU8H 4XVJH 1ZT7B 3DV4B 4YHMH 5DI8A 1NEZG 4KHXH 4K23L 5TE7H 1YUHB 3BOVA 1PX3A 3UTTB 3HUJF 5FA3A 1LNUB 1BOYA 1JYWA 3BKMH 3K8MA 5DQJB 3DVGA 3X3GH 3EHBC 2WWKO 3K4AA 5DJ2A 4NFDA 3WHE0 4EBQH 1SEQH 4PRDA 4PJCA 4JDZA 2AK4A 1XR9B 3GMQB 3KXFD 4RX4A 1UVQA 4R2GD 2UY7A 5K33A 5KANI 4WFGD 5DJCA 2FH6A 1TTUA 1YA5A 4PJ5A 1GL4B 3W82A 4UT6L 3Q5TA 3HFMH 2J8UB 3RY6A 5B4MD 4I0CC 4OZHB 1C16A 4RQQB 5BV7B 1OM3L 3PXHA 3VG0H 3RIAK 5FCUH 1VFMA 4ZOAA 5JMOC 1AQDB 2D9QB 3SJVD 3LVEA 1RZ7H 2F5AL 3P77B 1HYSC 2ADFL 2DQTH 1K2DA 4C55A 3TJEH 3AB0C 1G9MH 4QO1A 4AT6B 4XBPA 4KK5D 5D6DC 1U9KA 3QFDA 4NQUA 2IH1A 2D0GA 3U30C 3IAGC 3D2UA 2VSCA 4ZAKB 3AROA 2A74A 1WFOA 5IBLC 2JTDA 3BKYL 3V52L 4PV8A 2NY2D 4GFTB 4JO3L 5E7BA 4G8EA 1WT5A 3AM8A 3U6RB 3PQYE 2C1PA 2DLFH 2CKBL 4ONGL 5E6ID 5MENB 1MJUH 1ZK9A 1PZUB 2WSKA 1IM9A 1KJ2L 3OKLA 4QTIL 3MV8D 5CEZD 3S8WA 2APBA 4P46D 5EZJB 5HPMB 2HP4A 1JGEA 3P11L 3ELAT 4NQDE 1JRHI 1EGJA 5DUPL 2VDKL 1DJSA 2AEQH 1K3IA 1UEMA 2EH7H 1YZZA 3BGFB 3WSQL 3FQTB 3MNVB 1KTRL 3TA3C 3MLYH 1JPGB 4JY6A 1BD2A 4D0CB 3ARBB 2DWDB 4WW2F 3VWJA 1E4JA 4NDMB 5DRWB 5DYOB 2EC9U 5H37G 5D93C 5ESQB 3REWA 2H41A 1WIPA 4LCCA 3SPVA 1UB6A 1LDPL 3MRRA 1JZ7A 2ERJB 1T1YB 1J5OL 4PJHE 4XNZC 4OZIF 3HI1B 5FO7B 1KNOB 2BMKA 1I3GL 3T77B 1U3HB 4XBEH 5CP3A 5J13B 3CVHH 2O5XH 4PGCB 4R8WL 3SCMB 4O5LH 3VGHA 3ECBB 2P4AB 4DKFH 5MI0B 5IB3A 2QR0A 1NGYA 1S9WA 5FDWA 4JN2B 4NN6C 1YNTB 3D39B 5DVNA 3ZE2E 3MBED 3QISA 4PJEA 3T2NL 1HK6A 4G8GB 1JZ4A 1OAKL 1T66C 5AZEH 3KYOA 4TSCL 2VAAB 4LRNH 1SM3H 4RMRA 1S7QA 2ZUTA 1YMHA 1HHHB 1YY8A 1CFQA 2CLVB 1MLCA 1AP2A 5FUZH 3ARXA 1HN1A 1X5HA 2ED9A 4EKXA 1J1PL 5IR1A 4LLQA 2DYPB 4BJLA 3EDJA 1YYLL 1MCPH 5IKCA 1MCLA 3MOQA 4MNGB 1H3WM 4TSAL 1F4YH 4I77H 3RZCA 3T4AA 1FVDA 4K3JL 2RQ8A 2BNQE 1FORH 3K74B 4JRYD 4TULH 2KH2B 5DRNA 2C3VB 5E2TL 1JV5B 4DN4H 3MGOA 5IF0A 2AV7A 2NX5A 1ZANH 2PN5A 3OKEB 2AGJL 4HQQL 3L3OA 4C56A 4BUGA 3V5DA 1Q9LB 4TSBH 1A3RL 4IRJB 1CQKA 5KVDH 3NCJL 1BX2B 3EDFA 5SX5H 3LQAL 1MCHA 1FL5A 3GMNA 3WN5C 3BYYA 3D0VA 3KAAA 3MRGB 4MCZB 3LH2L 1KFAL 3U0PA 4KRMB 1FO0A 4UV4H 3MJ6A 3BP4A 3WDHA 1BGXL 2AQ2A 3TYGL 3PWVA 1RZJL 1MHEA 4U05A 3AS3A 3L3GB 5LCVH 1AR1D 3B9EA 3TCLA 1CXLA 4PJ5D 3UTZA 2EDWA 2RFXB 5FYJE 1X9QA 4RFOL 1IC7H 3ARYA 5I76A 3WDJA 3JXAA 1MVFA 4Y8AA 2VDOH 1QSEA 4G8FB 2D7OA 3RPKA 1LEGA 1UGNA 2X9XA 2GAZB 4JANA 4RAHA 3BWUC 4OV5A 1SEBA 4I1NB 3AREB 4NUJA 4S11A 3PP4L 2CIKB 3I3DA 3EYOA 1ADQH 2ESVB 1CT8A 4LCUB 4PREB 1U8LB 3GJFH 4GKSA 7FABH 4MD4B 3QULA 2Q8AH 1G6RH 3D2UD 2MTPA 5HHNA 1OTTC 4JM4L 5C2BL 3HUJB 2MMXA 4P4RA 2H2SD 1I7TA 4L29B 5EUKA 3VG9C 4X0KA 5C2UB 1CLZL 4D8PA 4MVBD 1N0XH 3MC0A 3NPSB 1H5BC 1EX0A 4FFVD 3WD5H 1DUZA 5B38A 2W91A 3HR6A 1G7IB 4PY8I 5CSBA 1CF8L 5I1EH 4MQ7B 3B3IB 3O9WB 2X05A 1HQ4B 25C8L 1A0QH 3OKMB 5CHNB 5FHAL 1QBLH 4RCAA 2K7PA 4I5BA 4P3WA 3CU1A 4GAJH 5E5MA 4IRSA 4NGHL 4NIKB 5JMRA 1CGUA 2GK0A 2YUVA 1BVZA 1RUPH 4XCEA 2V2TA 5C0CB 4PR5B 4WEMB 4S0TD 4IOIB 3VW3H 1PY4A 4KPHL 3I9GH 3QDJA 2A6IA 5FM5O 1CFBA 5HGAA 3RKDC 4H88L 1AI1H 1BD2D 4HX1A 5IOPB 1A7NH 3VWJD 2ZUYA 2X1OA 2P5WB 4MS8D 1W8OA 1RZ8A 3GSWA 4J7RA 4MCYB 3FQWB 3GSNL 4JFQA 5DMJB 2HLAB 3O2WH 1UCBH 4TPRL 3F7VA 1HXYB 3H9SA 5HYFA 4S10A 5AAMA 4H8WL 4HFWB 4YHOL 4OLWL 1BQLH 5C08B 4D9RE 5DJ0A 5E1HB 3WNMA 2VITB 1IEAB 4QRSA 4U1MB 2Q6WA 2Y6SC 1S7RB 2VRAA 4MHHI 3MOBL 1GGIH 2J6EH 3CVIL 4V1DB 5MHSE 4H25A 1ZVYA 4NWUH 3WFBL 3LN5B 1FZJA 5J56B 3NACL 5FOJA 3CXHK 3MUGB 2D31B 2OZ4H 5DD0H 4JFFA 1YMMA 2WUBL 3DX6A 4XMKL 3V0VB 4APQB 4AMKL 3S4SB 4ALAL 3X12A 1FCCA 1HWHB 4O9HL 5E9DA 3HAEA 3K81A 2P24A 3MRQA 3VGGA 3DTXA 4ZXBA 4XAKD 3MLVL 4EN3C 4ZODA 4WW2B 2DJUA 2R1XB 3RZCD 1ZLVH 2VZVA 3WFEL 2Z8VC 5L7XH 1E4WL 3Q6FB 1NEZB 5K59E 4CADA 5IBTH 1HHKB 4NNYA 1CTNA 4JJHA 5FFLA 4M93C 4HF5H 4PFEA 2ICEA 1TJHH 2NX5D 5FYLL 3UC0H 3LRGA 4C83A 3GSOA 4HJGB 1ITCA 3LV3A 1RHHA 4C56D 4FRWA 1JWSB 2XTJD 1GPOL 3MV7E 4RA0C 1JTOA 2YPLE 1P4LB 2V2WA 4GRWH 5HDBF 5CEXB 1VFUA 1A6UH 1WWBX 1WFUA 4M1DL 1ONQA 3WS3B 1U93A 3DNKA 1RI8A 4ODUB 1IAOA 5DWUH 4NM4L 5DEGA 1JBJA 1IGJB 1QRNE 2BOCA 4KDVA 4TYUA 1FDLL 4HK3N 1UM5L 2HKFL 1MJ7H 2X6MA 3HZYA 3MXVH 1EBAA 4KMTH 1CL7H 5CMAB 2LTQC 3TBYA 3EZJB 2FJFB 2FZ3B 3GI9H 2RHEA 2CDGB 5CLTA 4JGMA 1I75A 3QHFL 4AM0B 4JFOA 2ZUSA 4XRCB 3SGEH 3KJ4B 1CFNA 4I2XB 3RA7L 4HUNB 2CO7B 1QOKA 5D71L 4HLZH 3MA9L 3ULVD 4NQEE 4Y4KB 4OGAC 1HCVA 2WIMA 2H2PC 1C7SA 3T0VA 4ZNEE 5DC9B 2ICWB 4HMEA 3ZE2F 3TF7C 4D3CL 2ATKB 5GRJL 1LE5B 2X4UB 4P2QA 4HK0B 3BQUC 3DO7A 1JNNH 1DQDL 3W0WB 3SOBL 1ERNA 3GSXA 2V7NB 2YRZA 5D8JH 4I3SH 2QKIA 3TFKD 3QCUH 2W07A 1BQHA 3LIZL 5D7JC 2VO5A 5B39G 1KXTB 3HMWH 3B4NA 3OWEA 1DP0A 3BVNB 4KXZI 1E4XH 4JFZH 3O6ML 3PWJA 3SDCB 2Q86B 4J3VA 4Y5XA 5C9JB 4X5XA 3UPRB 2E7HA 4KKAC 2O61A 4YHIB 4BKLA 1G9NL 4HUVB 5BVJA 1OAUH 4WJ5A 5H35B 4EQ2A 3QDJD 4OF3A 2LABA 2A0LD 1MHCA 2BNRB 1U42A 3ZYOA 2DIJA 5T3XL 2HKHL 3RX7A 4MA1C 4JN1L 4PLJD 3ZE0E 1UZ8A 2C3HA 5ANME 3RJQB 2DLGA 1ZLSL 2EXWD 1V05A 2H32B 3E6FB 3JTSB 5DTFA 1O7VA 4LP5A 4ZDHB 2W65A 3U7AA 1M05A 4NBZB 1DQMH 1S7TB 4LSDA 4P5MA 3OJDA 3FKUS 1T1XB 5SWQA 4NO5A 4YHPB 5LQBH 3I75B 4K7FA 2W1NA 5GZOC 4GH7B 2PR4H 4U6XB 3L5HA 4PJGA 3NN8B 1OD7A 2DTSA 3TYFB 4LK4A 4R0LA 4ZO8A 4XH2A 4IBLT 1DEDA 3QA3B 3N0PB 4PJFE 1S9YA 3TVMB 3QUXD 3CLEH 1BZ9B 4E41B 1EUTA 1MFAH 2Q20A 5GSRA 1S5HB 1W8NA 4ODHL 4U1GB 1T4KB 5D1XB 2IFFH 2JELL 3HS0B 4OZFH 2YBRA 4QRTB 2Q87A 1FRGL 3EJJX 3QIBC 1A6VH 1ORSA 3FN9A 4JFFD 3KJ6H 4DOHB 3V6OA 1MIML 2D3VA 5F1NB 2DLHA 4QXUH 4TUJA 3D69B 3LQZB 3A0OA 1G7PA 1YEDB 4NOFA 4K9EH 1IFHH 1MSPA 1FIGH 3F12B 4Y2DC 1D5XB 3CFEB 3SQBA 2R4SH 4HV8B 4KDWA 5LWYH 1DBJH 2VWEE 5T3ZH 3IDMA 4DUWA 1MHHA 1QA9B 1T2JA 3HNSH 2VL5A 5GJSL 2VIRA 1EO8L 4F57L 4PGBA 4U1HB 3B83A 5HYEA 1T0NA 1IGCH 3CLFL 4JHAH 1ZT7A 4JG0L 4X4YA 4HS8H 3BD3A 3L3IB 3BPOB 3V5KA 1INDL 4Z7QE 1J11A 3UTTA 3JV6B 3T3PF 5KTEL 4M6OH 5B21A 1LNUA 1W72H 5DQJA 2PO6C 2A1WL 5L8KB 1ZGLM 1LO4H 1MUJA 1MPAH 3FFCD 4OCRH 3T3MF 4TNWK 1LE9A 5BO1H 1OOAA 1Z3GL 1YEKL 3H0TB 4WUUE 1J0IA 2EC9T 4OT1H 3U0TB 3WFCL 3GMQA 4PYHA 3VFRB 1CK0H 3L1OH 1J87A 2OS7A 3S97C 2D2OA 3DUHA 4X6FA 1I3RB 3TIDB 4WFHD 3HZMB 4WI3A 1T6WA 4XNUL 3FO0H 1EEYB 3FO1B 2WM0A 3QWOB 3TGXA 1VFBB 4YEEA 4IRZH 3VWKC 4OCXH 2CMRL 4QXWA 5EA0L 3PQYB 4OZHA 4PIRF 3RVWC 2CJUL 2C4FU 3DHJA 4Z77B 1VB9A 4HDIB 3T2OA 1AQDA 2VLJB 4GMSL 3BMVA 2XQBH 1RUMH 5IG7A 3KLHC 3FQNB 3SDAC 5KS9F 3P0GB 1AHWB 3EOBB 4MAUL 4AT6A 1J9CT 4P2QD 3KYNB 5E99H 1GGCH 3NZ8A 3NCYP 4NQDB 3VJ6B 4EVNB 4IHOB 4I3RL 4K71B 3OKOB 5E8PB 1CGSL 2EDRA 4HXBH 2VXTH 3MRIB 4YXLL 4ORGB 2QLVB 1FH5L 2C3GA 2ZSVB 3U6RA 2Z91B 5GRWA 3ZZ1A 4Y16C 5F7EH 4LPVA 1DL7H 4KY1H 4JRXA 5K59F 4LSTH 4R90L 3S37H 5ALBL 3IFOA 4U6YB 2H26B 1P7QA 4YO0A 1J0HA 1R3LA 5HPMA 8CGTA 1BOGB 4PJHB 4DKEL 4JFHE 4G3YL 2WLZA 1U8KB 1YEJH 3MFFB 3MRJB 2YPVH 1ZMYA 4YDLB 2ZOLB 1MCOH 2J4WL 2XA3A 4N5EC 4HBQA 2WP3T 1MH5B 2QQNH 3FQTA 4PTUB 2FBOJ 1JPGA 2B4CH 1GOFA 4TVPL 1GGBL 2QJDA 2VXQL 2ZCKH 3VA6A 4NDMA 5DRWA 5DYOA 2YK1L 1H8NA 4KKBD 5ESQA 3K2UH 5MEQA 4FQXD 4RGND 4Q0XL 4YK4B 2HFGL 1IQDB 4JO2H 4S1SL 5TPWL 1T1YA 1B2WL 1AE6L 4NQCE 3HI1A 5FO7A 1WCBA 3MRCB 1PX4A 4TUOB 3CUPB 2NY0D 1BIHA 1R3HA 3GFUA 2GTZB 1T1ZB 3JVGC 1KBGL 1KLFA 12E8L 1U3HA 4JFDE 2VQUA 1I9JH 3QYCA 3TO2B 3SCMA 2E5EA 4PGCA 4UIMB 3MOAL 3QQ9D 4AEHL 4LVOC 1H3GA 3ECBA 4HKJB 2R4RL 2W0KA 2ZP0T 3B9KA 4FFYH 5ILTL 3HG1E 2H3NB 1QNZL 4OF7A 4JN2A 4EOWL 5IW6B 1YNTA 2OJZH 3D39A 1A7RL 3EOAA 1WWWX 4G8GA 3JV4A 3GRWH 1KT2B 2VAAA 4NNPL 4ZOEA 4R2GC 2A9NH 2E9IA 3U9UB 3ZHLA 3FRPA 3CC5B 1SJXA 4BSVB 1RHFA 2J12B 4NRYA 4ODTH 2D7TL 4FQCH 1JWUB 3BKCH 4XZUA 2VL4A 1DEEB 4NN7C 4NQSB 4OGYH 2AJ3A 3LCYA 1MI5A 5ITBL 1WQVT 5B4MC 2Y07L 4UOW1 5J9PB 1NCAH 2B1HL 4ZUVB 1RIUH 4ZPTA 2YKLH 2N7AA 4K55A 1HEZB 1Q1JH 3KLAB 5HI5C 1P84J 2AJXH 2C3VA 5T5NF 2JLLA 5LJYH 3OKEA 2JF1A 1CR9H 2I25N 3SE9H 4KV5E 4KK5C 1KOAA 4Z0XB 3U1SL 1Q9LA 2P43B 4IRJA 3LS5H 3UTTD 3MRFB 4U3CA 2WBKA 4Z95H 5C3LD 5DXWA 2AXGB 3ZE0F 2VABA 5CBEB 5E6IC 5DZNA 3UJTL 5EWIH 3OXRB 4MCZA 4JJ5B 2BX5A 4W4OA 1TJIL 4XMLL 2WBJD 2QQKL 3WIIL 1H0DB 3FO2B 3KPSD 1QP1A 3VXUE 4OLXH 2VXVH 5FUCE 1UXWB 1JL8A 3INUH 4P46C 1U8HB 2YMXH 4AG4H 5LGJA 4M62H 1NMBL 5TGBA 2UWEA 1CFVL 2VQTA 5D7IF 5EU4A 4KI1A 2RFXA 3G6JE 1ZHKA 3OPZL 3TM6A 3K4ZA 3MUY1 4GT7A 4DJMA 2F74A 5I75B 2DM3A 1GRWA 4QOKE 5C0IA 3TC9A 1HYRC 1EK3A 1KIQB 1IC4H 4G8FA 2YC1B 4LSUH 4EI6B 4PJFF 4MJ5A 1HWGB 4M43L 1CLOL 3HE6D 2DQGL 1A22B 4Q6YA 1JGDA 2R1YA 1J0KA 2ICCA 5I9QC 4NJ9H 4R4BB 4LCUA 1U8LA 5EU3B 4GRWE 4J2XA 4JY5H 1ZLUK 5C0EB 3O3BB 3HUJA 2FGWH 5I1CH 1BVKB 4CRPA 3IFNH 1F4HA 3K7UA 3H42L 5FYKU 4L29A 1RQ5A 4V2BA 2E3VA 1MF2L 3PP3K 5DD5H 4OD3L 5DGQA 2FHFA 5EBLA 5F8QC 3DBXB 1X4YA 2JB6A 5I18H 4DCQB 4K7PH 2DM2A 4JRXD 4ETQB 3TPUB 2QADB 2DQCL 4MQ7A 3MBEC 4Y4HD 1YNKL 1HQ4A 2P47B 3OKMA 4XPBL 5CHNA 1P7QD 4RDQG 3DYOA 1FGVL 5HGBB 1MEXH 1GZPA 2PYEE 3F65A 2G5BB 4CN4A 1NLBL 4I3GA 1MREL 4N0YH 5CILH 5CD5D 2WZPD 3KR3H 4IOIA 3VU2A 5E5RB 4Z7QF 3IYLW 5ICZB 5FAAA 4XB8A 5JXEA 5TQ2H 5EBMA 4L4JA 1F11B 5KSBE 4YE4L 3TP4A 4HMDA 3IS0X 4ZOCA 3FN3A 3FQWA 2Z8WC 4R7DB 4O4YL 3MZGB 4DVRL 3O3AB 2NY3B 3OMZA 5EZOL 4HFWA 3MLXL 3UAJD 1XEDA 5C08A 2VKWA 3EO9H 4BK5A 4ZTPL 2VITA 1IEAA 4V2CB 2XZAH 1OARH 5BS0B 3S5LA 1BBJA 2ID5A 1U3HD 4Q58C 3E8UH 3SCMD 1NGZB 1M4KA 2RGSA 4IDJH 3WMSA 5F96H 3BWAB 1FHGA 3B9KD 2ZPKL 3VCLB 1IGMH 3D39D 2VDNL 3LN5A 1ES0B 3MNZB 4UINL 2HT2D 1BIIB 5D6CB 3E2HC 4G8GD 5INCB 3ULUH 5IIEA 4GAGL 5D7KD 2J3SA 1OHQA 2OK0H 1CXIA 4YXKL 1MFBL 3MRKA 2HJFA 3DO3A 3Q6GH 1RZFL 3S9DB 1AFVL 4KI5D 3MV7B 4APQA 4RMQA 2YPLB 3S4SA 4OM0H 5F7DB 2H6PB 4W6WB 4X98B 2VLME 1MI5D 3Q5OA 4YPJA 3RY6C 3WDIA 4PG2A 1A1NB 2COQA 1DUYB 2DIBA 3ZL4H 5GJTL 1NKOA 1Y6NR 3EFDH 2PCPA 4WW2A 4YHKH 1HOCA 2BFVL 1QRNB 3Q6FA 1NGPL 2LV4A 3SBWA 1HHKA 1FV1A 3GHEH 1YPZF 3JV5A 5DEZA 4JO4L 1P1ZA 5I1JH 3DRTB 4HWBH 3UXFA 4OZIA 1JWSA 1G0DA 1J1OH 5I8KH 1FL6B 1WK0A 3WNKA 1I4FB 1AD9B 4HK3J 1P4LA 2H2SC 3BDXA 5CEXA 3CSYB 4ZUTB 3L3JB 4MVBC 1R5IA 1OAZL 3B2VH 3L3KB 4NQEB 4R26L 1KB9J 3E3QE 1UKQA 3PGCB 4FFVC 4ZYKA 5KVMC 1IGJA 2ADIB 5FB8B 2WBWB 2AAVA 4UV7L 4IMKA 5JDSA 5IHLB 3QUYB 1EAPB 5KVEH 1ZGLB 2FX9L 1I1FB 2XXMB 5CMAA 2MPAL 1BFOB