2DQGL

Crystal structure of hyhel-10 fv mutant (hy53f) complexed with hen egg lysozyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqgL00
4KK9C 5TDNB 4U7MA 2R39A 3WL9A 2AEQH 4G6ML 1T1ZB 4C55A 1BVKB 2JTDA 5L7XL 3BPOB 5I8KL 4BZYA 3VFMB 2DTSA 3CH1B 3ESVF 4JY4A 4LNRB 1RZIB 3L3IA 3IYLW 1CDJA 4HZLA 1YPZB 3CSYB 4OB5L 4WO4A 4OD2A 3NFSH 4L4VB 2X7LA 3QIUD 5EU6E 4TUJB 3V5HB 1BFOB 5JW4N 4J2XA 3NTCH 5T3XL 1J1PL 2CDFA 1QLFA 5EZIH 3SBWC 3T0ED 4ZUVA 5EIQA 4XCNB 5I1CH 4CVZA 1KJMB 3NZHL 4G9FE 5EO0B 2Q76B 1T5WB 4O2EA 5F8RC 3O6FB 4TULH 2E7HA 4M5ZH 1AGFB 2DAVA 4P5KB 4RFOH 1S3KH 5E6ID 2Q7YA 5EN2B 4CMHC 4N9GA 2J7LA 2YK1L 1QSEB 1QFWI 3FHAA 1TETL 4W81A 2CR3A 4QHKI 2MFNA 4BQ6A 3FRPA 1INEL 4AH2B 4HWZB 1GXEA 2YD1A 1NLBH 2ARJQ 3C2AH 4NKMA 1MJUH 2GK2A 5F96L 4NWUL 4GBXD 3ZE2F 4NJ9H 5LWYH 1QVOA 1J05B 3THML 1VACB 5LBSH 1KB5A 4Q74A 2WWKT 5KOMC 4PJBA 3OB8A 1QFWL 1XH3B 4PV8B 2Z4QB 4ZFOL 1QD0A 5DMGC 5BOPA 2AXGB 1FVDA 3NCYP 5L8JB 2YD2A 4NZDA 1Q9LA 5FYLL 1KXVC 3PQYB 1OAZH 5IV2A 4L3ED 4KHXH 2NTFA 1YZZA 4KRNA 1C08A 3A6OA 3SBWA 4K23H 1YYLH 4WO4D 5E8DH 4GG6B 4OQ1A 2J88H 3MUGA 4NRYB 2W9EH 2A2QT 4HQQL 3W0WA 2IF7A 1TTUA 2XPGA 3BPOC 4YXKH 4R7DA 2NY0B 4K7FB 5FYJE 2ZCHL 3JV6B 4JDVB 3PG2A 1SY6A 1CD0A 2BMKB 4M3KB 2ITDA 2LVEA 1RJZA 5BRZA 3BZ4B 1EK3A 3QNXA 5CGMA 5SWSA 1ZVHA 4HIEA 3WIHL 2FBJH 3O6FC 4Z7OE 4WRLA 4LSPH 2HFEB 1A1NA 3MACL 4KK9D 3PWLB 3VG9B 3HPJB 3MLTA 1SEBA 4JFZH 4KI5D 1DEEB 1DBJH 4GAFB 2GHWB 3MV9E 5IFAH 1H3VA 3HZKA 5T1LB 4H0GA 2IALB 3HNVH 5KAQG 3OX8B 3SO5A 4P59H 3U83A 1IC7L 1RPQA 4FXKB 3BP4B 4I48B 1P4BL 4JO1H 1A64A 4OFKA 4OT1L 4AEHH 2WAHA 1GOGA 1YEFL 3J8F7 4IRJC 2DM2A 4X7SL 3C08H 4M1GL 1BVKA 1JCKA 2B2XL 5HHME 1H9VA 1IM9D 3HE6B 5JIPA 2M2DA 3VFMA 4Z7QF 3CH1A 4LNRA 3BIKA 3LZFL 1RZIA 3O4OB 1ZTXL 3W0WD 3CSYA 4ZFFA 1YMHB 4L4VA 3LPFA 1X5JA 5B22A 4TUJA 3V5HA 1BFOA 2JJSC 1EUTA 3P73B 3KS0J 4IM8A 5C0EB 4BH7B 5JHDA 3GSUB 4XCNA 1AE6H 5GZND 3WFCL 1KJMA 2J8UB 5EO0A 2VQUA 1CGSH 1T5WA 1EUUA 3OGCB 3O6FA 4WCYH 3BFOA 4XVUC 4ZTOH 2HYMA 1F8TH 5SWSD 4U0RB 3LKSA 1XR9B 2NY0C 4P5KA 4J3XA 5CINH 1ZOXA 3UTSB 5DUPL 4PJ5E 5EN2A 5C0CB 4DVBB 1QSEA 4YDIH 3U0WL 4QHLB 2W0KA 3HG1B 4NOFA 4LSDA 4G3YL 5FK9B 5D7KE 2DLFH 2QV2A 5DMGD 3DVIA 4OQTA 2A0LC 4IJ3B 4K7PX 3U4BL 1MEXH 3B6SB 1SYSB 1J05A 3JV0A 3ROLB 4JKLA 1VACA 5DA4A 4DCQB 3MJ8A 3NPSB 3EZJB 4LSTH 1V3JA 2VDML 5EH1A 3UTTE 3M07A 2V2TB 2YD9A 3C5SA 4PV8A 2Z4QA 4H1LH 2FLRT 2JB6B 3TT1L 2O26U 1W72H 4N0YL 4TNWK 2AXGA 5I1HH 1CU4L 1S9KC 2XXMB 3QUXB 1AO7E 4HXAH 5BMFL 3PQYA 2JJSA 4CBPA 4PLKD 4PJGF 1ZMYA 5EWIH 1WFUA 4KAQL 2DLHA 4GG6A 4DKEH 4L4VD 3QCVH 3UJIH 1ETZB 3NIFE 2D4DA 3HE6C 5MEPB 4J3WA 3LKRB 5IQ7L 3PV7A 4K7FA 3O6FD 3O4OC 4DKFL 3BN9D 4XC3L 1ZA3A 3JV6A 4JDVA 3BO8B 4LAQL 1C5BH 2BMKA 2BVPA 2UWEF 2B1AH 3BZ4A 1Z9OA 1FNLA 1OSPL 1G9ML 1JGDA 5DWUL 2M26A 3P9MB 4G8IA 1QSED 4HHAB 1HIML 1KCRH 4EZMA 3CUPA 3BD3A 4YHYB 5C0BB 3I3DA 4YWGH 4K3GA 5J3HC 3CC5B 1KJ2H 1KELL 2R1XB 4U0RC 3PWLA 5D8JH 2ZG3A 3HPJA 1OT1A 4YLQT 3E6HA 2ZJSL 5DD1H 4LL9A 2N56A 4DOHB 1V8HA 1WZLA 5GIRB 3FCTB 3CXDH 3OX8A 3I75B 2APFA 3ULVH 1R3KA 1B0GB 4K3EL 5CEZH 1WBZA 4IDJL 4CL7A 3V4VL 4FXKA 2VB5A 3BP4A 4FMKA 4I48A 4JY5L 3N50A 4WHTB 4B5EA 4V1DE 4LSUL 5DJCB 1CXFA 3O81A 3KYNB 3PQYD 4KJWC 4XMPL 2APWA 3RVVC 2PNDA 4MXVE 3HE6A 3NPSC 3BT2H 3UJTL 3RVXC 3KXFB 1DQLL 2VERN 1J1OL 4WWID 4ZPTB 4XVUD 3X12B 5JXAH 1YMHA 2XZAL 5J1SC 3QUXC 3D9AL 7FABL 2NY0D 3P73A 4HD9A 3D2UB 3IDXH 5C0EA 4BH7A 5AAWA 1IM3B 4OZHB 1N5YH 2BNQE 3OGCA 4Q9BA 4NO2B 3QFJE 1GOFA 2M1KA 2A0LD 2DWEB 3BSZL 3GUTB 5F44A 1OTUC 4QRRB 3OKMB 4ZO7A 4P2OB 4KDVA 4LNVA 4QCIB 1Z3GH 3DSFH 5C0CA 4OTXH 4DVBA 3GB7B 3D18B 3HG1A 1JZ4A 4RNRB 5FK9A 5M95B 2FX7L 1H8SA 5T1LD 4HH9B 3QDJA 3WS6C 2UVEA 2LAGB 5LKNA 2BVEA 4F37K 4R4NC 1P4LA 3B6SA 2AJYL 4JFOA 4YHYC 5JORB 5TE4H 1FIGL 4R3SB 5L9DH 5EUOB 4DCQA 4FQ2L 4UT7H 1A4KB 5JMRA 2V2TA 3I3EA 2X4RB 2JB6A 4ERSL 5ACZB 4HC1A 1CFNB 5J06A 4BKLB 3HE6D 1WT5C 3QUXA 3O4LE 4ZNEE 5JHLL 3FB7B 1FE8H 3PXHA 4YDKL 5CWSB 3DYOA 3GK8L 2VDQH 5C86A 3RPKA 3LKQB 3MRCB 5IF0B 4KGJA 3RWGB 4PP2B 4HG4J 1ETZA 1I7ZB 3SDXF 5CILL 3C8HA 2KQNA 4I2XB 5MEPA 1GGBH 2VIRB 1F90H 1MUJB 3LKRA 4M3JA 3U30C 5IMOB 4XMLH 5D1QB 15C8L 4FA8A 1V05A 4CVUA 2V17L 2V5TA 1BM3H 1CE1L 1CLYH 1B2WH 1FORL 2H6PB 2ARWA 3MMEB 5F9WB 3BKML 3UTSD 1PDKA 3FOMA 5C0CD 3P9MA 3T2NL 2YPLB 4HHAA 3WS6A 3HG1D 2EIBA 5JPNB 2DQDL 1TZIB 5C0BA 2B1HL 4YHKH 5JUEH 3CC5A 2R1XA 3X11B 5F9AC 3BH8B 3X3GL 4LP5A 4A6YL 1CLCA 5C6PB 1H3WM 4P2OC 4KJWD 4WHDA 2VC2H 5AEAA 4L1DA 3U46B 3RVVD 3PWPB 4HKZB 4R97C 5GIRA 1WT5A 3NCEB 1AXSB 3RVXD 3K2UL 1MELA 2HT2C 4KRMB 3VI3F 5JA8B 3AREB 2PYEB 3QUXD 3KYNA 2AP2A 4QGTA 1IEHA 1TMCB 2ZCLL 3DTXA 4RAUB 1T7XA 3BYYA 4LHUG 2WINB 5E2WH 5J1TC 4MXQC 4L9LB 3DXAB 5E8EB 3VCLA 3KXFA 4GAGH 4F37F 3ZKNC 3AMKA 1S7TB 1OGAB 3X12A 3UPCA 3T2QA 3BRGC 1PY4A 3VJ6B 3WDIA 2HH0L 2XXCB 3Q5YA 1U8OA 5DDHA 1X5GA 1BAFH 4EUPH 4AL8L 1TJHH 1JBJA 3SE8H 5F7KC 1I9IL 2GI7A 3NABH 1JYNA 1JMXA 3D2UA 4M7ZC 4G7YL 5T5NG 1IM3A 1MSPA 3LEVH 3CX5J 3OPZH 3LMJL 4ZOCA 4UNUA 1DBAH 2LU4A 1YEJH 3P9LB 1DLFL 2R0KL 2L7UA 2A6IA 1FLRH 2ZP0T 5HHXH 2NXZB 4JY6B 4R4ND 4QRRA 3OKMA 4FQHB 4P2OA 5D1QC 5C0BD 5F7FA 5IBLC 1R3LB 4PJ8B 1AXTH 4HWEH 1CK0L 3PGCB 3GB7A 3UO1H 5E95B 3D18A 5CZVH 5IJVA 2NY1B 1HNFA 4RNRA 2KDGA 1LO4L 3MJ7B 5F9WC 4DGVL 3W11C 5B8CC 4MZ2A 5GS0L 1H3XA 2HKHH 5EOTB 4UILL 3U4EB 1OD7A 3IVKB 1CD1B 5H35B 5JORA 3ULVF 4R3SA 5IROC 1RURH 2BHYA 1E4WL 5EUOA 1ZHNB 4PUBL 1C5CH 4Y4HB 1TZGL 3FRUB 3RKDC 4K9EH 1KV3A 3L3JA 2X4RA 5ACZA 1X4YA 2H41A 1CFNA 3FMGH 4BKLA 3WIFA 3KXFD 3DX6B 2NY7H 5I16B 1ZGLM 4K3DL 2XG4A 1W0VB 2R0LH 5CWSA 3H9ZA 2H8PB 8FABA 3S35L 3LKQA 5EU7E 4NSKA 4MJ2A 3MRCA 5IF0A 3RWGA 4PP2A 5GZOC 4FQJL 1I7ZA 3D2UD 3WJLC 1G1YA 5CJ5A 4M61B 1N6QH 1TNMA 5IHUH 4I2XA 4QHNB 2EO9A 2R56H 3ZKSD 2EO1A 4PV9A 5HVHB 5D1QA 5DT1H 2D7NA 2VXTH 1MVUB 5MHSE 4GLRH 1B4JL 4PRHB 1IT9H 3RNKB 1Y0LB 1VESA 3SOBL 5JDSA 4OLVH 2P5EB 4QRRD 5C09B 1BP3B 2H6PA 4MNQB 4P2OD 3RI5K 4D8PB 2IEPA 3EDJA 4PJAF 5B8CA 3ULUE 5DMYA 2UY7A 4OM0H 2G60H 2BSTB 2YPLA 4X80L 3MNWB 2XKNB 4P2RB 1TZIA 3BEVB 4JKPH 5E2JA 4WTXA 4LLWB 4HWUA 3MLRL 5IROA 3X11A 1SEQL 2C3HA 3BH8A 1UYWH 3ARGB 4NFBA 4XMKH 2D4FA 1I8MB 5I2IB 3QEQE 3BKCH 5T3XD 4PJ8C 3U46A 3PWPA 4LQFL 4XWGL 1IAKA 1L7IH 1OAYL 1GHFH 4MXQD 1F4YH 2XQBH 1AXSA 2F58L 2IPTH 2NY1C 5I1EH 5JW3L 4P4RB 2OTWA 3RWIB 2VDNL 2E6PA 4QO1A 4CJ0A 2JE8A 2PYEA 2YA1A 3IAQA 1QRNE 3WJLA 3GRWL 3HRZB 4EDXA 4RAUA 1D5IL 1MFNA 2WINA 1JI2A 2IFFL 4LLYB 2BOBA 4AEIH 2VLJB 4JFEB 3DXAA 3G5ZB 1Q72H 4L9LA 3DVFA 4OCWL 5E8EA 3WSQL 4YHLL 4YAQB 2EE2A 4PJHE 1MJ7H 2QSVA 1S7TA 4YFDB 3S88L 1OGAA 1DSFL 1J0HA 4XVJL 4WI3A 2R9HC 3VJ6A 3MNVB 2F19H 2WIIB 3VXMB 1Q38A 1RIHL 2XZCH 4JKWA 5BV7H 5D1QD 1IVLA 4G8GB 5IBLD 4PRIB 3JV4B 5E8PB 4X6FA 5K9QI 5F3BB 4GQ9H 4KTEH 4AIOA 1G9EA 2CDEB 4PJEE 1WWAX 3W11D 3P9LA 4G6MH 3GO1L 5TQ2H 1NCBL 2YPLD 5L7XH 4JY6A 3QA3B 5FYLD 5I8KH 4HUUB 1WGOA 1R3LA 5E00B 3WCYA 4PJ8A 2ADJB 1UZ6E 4HS6B 1RIVH 2FSEA 3PGCA 3ZDXF 4X5WB 3RKDD 3BIBX 1G7PB 1RZKC 3EFFB 3MJ7A 5EOTA 3PWPD 3MZGB 1NGXB 2J2ZA 3U4EA 4Q7DA 5L2KE 4BSWB 4FQXB 3IVKA 1CD1A 3ROOB 5H35A 3NZHH 5JW4R 1QFHA 1ZHNA 2BNRE 3QO1A 5BXFB 3ARED 3FRUA 1RV6X 1MJJB 5A2KH 2C3VB 4PJDE 3SDDB 5L0QB 3K4AA 1I1YB 1FC2D 2FD6L 1U8IB 3LQZB 1ZLWK 3DXAD 4C4KO 1Z9MA 3TNMA 1TETH 3DX6A 4D9RE 2F54B 5TF1H 5K9KB 3LRGA 3OL2A 1OGAD 1W0VA 1INEH 1OQOA 2H8PA 3QHTC 4QXGL 1F4XH 1TQCC 4FRWA 5EOCL 3UC0L 5F96H 4NWUH 4M61A 5KANI 4QHNA 3THMH 1TVBB 4BSJA 5C0GB 1V7NL 3ARTA 1S78D 2E7BA 3BJLA 2NYYD 5I73B 5AAMA 2ICCA 1MVUA 1QFWH 3QDHA 4PRHA 1IEAA 4JFDB 4Y19B 3RNKA 2ZOKA 3QQNA 4XBEL 1MH5B 2NXZD 4WJ5A 2P5EA 4MNQA 5FYLH 5SV3A 4ODUA 4PJ8D 3LEYL 5F72S 5FCUL 2EDOA 4D3CL 1N64L 2BSTA 3VXUB 1FV1B 4WTZG 3MNWA 4LP4A 1MF2L 2XKNA 1ODAA 2NY1D 3HRPA 1FG2A 2HT4D 3BEVA 2ADGB 4U1JA 4NC1E 1GPOL 1DEDA 4LSRL 4HQQH 3P30L 2BSSA 2NR6C 1G1CA 1YEGL 5I2IA 4LCWE 1RULL 4PS4L 3LN5B 4PRNB 2ZCHH 4Y4HD 2X40A 2EDYA 2NCMA 2R29H 4WI9A 3GMLB 1QFPA 3QJFB 1MCFA 4P4RA 1A7RL 4U1MB 3VI4F 3RWIA 2EIDA 1KJVB 3EHBC 1JHKH 2AK4E 2DD8L 4FQXC 5DC0A 5C2UB 9CGTA 2CO6B 5GQBA 3FO1A 3WIHH 2P8MB 5C70A 4CKVX 3HRZA 2I60L 4YUEL 3RDTB 5HGAB 4LLYA 2VLJA 3QWQB 3G5ZA 3ARPA 4QGYA 3CXHK 1HNGA 4YAQA 1DBMH 1FRGL 5IBUB 3N06B 3SDDC 5L0QC 1OQXA 3DBXA 3HFML 3CH8A 2APBA 3IFNL 2VN7A 1I9RH 2WIIA 1F4WH 3VXMA 4QNPF 5DK0B 1PG7X 4PRIA 3Q1SL 1IC7H 4NO3B 2AI0L 4PRHD 5JQHC 3JV4A 1T20B 1R0AH 3PUCA 4J3OC 3T09A 1U58B 1FHGA 2P5ED 3MLXL 3P77B 4OT1H 5C09D 2CDEA 2ZUWA 2I24N 4HEME 3FT4A 3IB4A 4GKZB 1JPST 3QA3A 1WISA 5F7WC 4HUUA 4H20L 4P2RD 4B50A 3TH2T 1CVRA 4WI4A 5E00A 5I73C 4U1NB 2BERA 3VFSB 2ADJA 4AG4L 5D5MF 1INQB 1ZTXH 5CS7A 3ARGD 4OZ4B 2VZSA 3PL6B 1G7PA 3EFFA 2CRIA 1S9VB 1NGXA 3FB6B 3NFNB 4XBGB 4FQXA 5DMJB 3ROOA 4XX1E 1YMMB 3V0WL 3WFCH 1AQDB 2PTUA 1ZV5A 3OZ9L 4RCAA 1CIDA 1T66C 2A83B 1J10A 3AU1A 3B9AA 5TE7H 1GGCL 2C3VA 3SDDA 3ZE0E 3QXDB 1I1YA 2DQIL 4X7TB 1U8IA 3LQZA 2VLJD 4JFED 3U0WH 1KENL 1BOGB 4Y5YB 2F54A 5K9KA 4G3YH 4NM8H 3MJ9L 3L5WB 4XPFH 2YRLA 4G8EA 2X70B 4GS7B 1LQSR 3VXMD 2GFBB 4BYHA 1JUFB 3TCLB 2UZYB 1SMOA 4G8GD 2C3WA 2EDTA 4PRID 1NBVL 4X4XA 1D6VL 1SVZA 2FL5B 4JHAL 3RDTC 2NY3C 1TVBA 3RWHB 3QNYB 5I1KL 2AJXL 5IVOA 1YY8B 3LRHA 2VDMH 5ELIA 4GKNB 4JFDA 1KJ3L 4EJ1C 5GRVK 3TT1H 4D9QE 1MH5A 4N0YH 1CU4H 2NR6D 5BMFH 5FDYA 4ONOA 2AQ3A 2JLLA 3VXUA 5CSGA 1FV1A 1HHJB 4KAQH 5JDJA 1M7DB 2ADGA 4Z78B 5TF0A 4NBZB 4HKBB 3EHBD 3RVUC 3AS2A 4Q9RL 4FQXD 2CRMA 4D0CB 1OARL 1QSFE 3NCMA 1OSZB 3LN5A 5IHLB 3V52H 4PRNA 4DKFH 2X41A 4XC3H 2ID5A 1MFDL 2P48B 1DR9A 4FOMA 4LAQH 3GMLA 4RMRA 1LD9B 3QJFA 4U1MA 1KJVA 1TDQA 5J8OA 5LVEA 1OSPH 1G9MH 5IWLC 2E9BA 5DWUH 2AXFB 4MB3A 3UBXI 1HIMH 4XVTL 2F54D 4K94H 3PDGA 1RI8A 3QPQD 3RDTA 5HGAA 1KELH 2FEEI 4X99B 2I27N 2JIXA 2ZJSH 3OQ3B 1PY9A 1U6AL 3MXVL 5B4MC 4FP8H 1HILB 5DK0A 4Y5YC 5DHXB 2H3NB 2XWBB 4U1GB 2A6JB 4K3EH 3TP4A 4NO3A 2EXWD 3V4VH 4FZ8H 1EIBA 3RJDA 4JFDD 1MWAL 3HI1B 1T20A 4HJGB 4Y19D 4GS7C 2VQ1A 1K9TA 3BMVA 3O6MH 4MVBC 1BZQK 1T80A 1JF1B 3P77A 4LSUH 1QLRB 2FEEL 5GS0C 3CVHL 3QCUL 1VGKB 4ONHB 3RGHA 1U8LB 3O3UN 3VXUD 2IH1B 4GKZA 3DX7B 5I1LB 1KC5H 3TF7C 4PTTB 3UJTH 3O3DA 1DQLH 4S10A 4C4KT 4FNLL 5F6IC 3TNNB 1J1OH 3CDCA 1INQA 1KOAA 3GNML 1T66D 4DUWA 4OZ4A 3PL6A 2ZUSA 2NW3B 5C07D 4X6CB 5DXWA 5D7JB 3NFNA 4XBGA 1PQZB 1RUML 5IWLA 1CCZA 1DQJA 2BHUA 1XF2B 1YMMA 3BGAA 1AQDA 3ZYIA 1NFDB 3FO2B 1KB9J 4AY0A 2EDBA 4N5EC 1YN6A 1XGTA 2A83A 3BSZH 5A2FA 1WUNT 1VFAA 2ORBH 4X7TA 3RDTD 2UV3A 1T0PB 3P3YA 1HXYB 4JPKL 4ODWA 5I8CB 1BOGA 4Y5YA 1L0YA 3VWJB 1QA9A 2FX7H 3L5WA 4OKDA 1QOKA 2X70A 1Q0XL 5CSZA 1BQUA 4OJFL 2GFBA 2MSPA 3BI9X 3OHXA 43C9B 1JUFA 4RMTA 3TCLA 4M8QB 4OCLC 4X9BA 3B9DA 2AJYH 3BDYH 2AXJA 3FOLA 1FIGH 4LPTA 1BJMA 1GIGL 1YY8A 4OSUH 1MRCL 3A67L 3N1FC 3WYRA 4W6YB 3TT3L 2VSDA 4GKNA 4PD4K 2OR7A 3RVUD 4ERSH 5JPMB 3F7VB 4F7PB 4YK4B 3VMOA 3LD8B 1UH4A 4U1GC 4XP4L 3D3VB 5IFJB 4W70A 1FG9C 1HHJA 3HZVB 4YDKH 1A0QH 3GK8H 1N7ML 3PL6D 4U7SA 1M7DA 2X4UB 4CU7A 3KVQA 4HKBA 1JWMB 1BVLB 4WU7B 2YD6A 5CILH 4HBCL 1NSNL 1JF5A 3DUSB 5C2BH 1IGML 1YMMD 4TSBL 4ZS6C 2P4AB 4D0CA 2C4FT 2JK5B 2HT3C 2DQCL 5KVEH 1HCVA 5AG9A 5K59E 2AQ2A 3ARWA 1ZE3C 2ICWJ 2V17H 1LD9A 5D1ZC 3QH3A 5D7JC 1HYSC 3BKMH 4EBQL 4YHZL 4RGNB 1A3QA 1QO3B 5B4MD 4E5XB 2AXFA 1JI1A 2CIKB 2DQDH 4YIQB 1WIPA 1FSKB 4MVBD 4OBRA 1OL0A 4X99A 3X3GH 4ZMAT 3HR6A 1YJDL 4A6YH 5DMKB 5GS0D 2HLFC 4EIZC 1W0WB 2IBGA 5F9DC 1HILA 2V7HB 1J87A 5GISL 3QG6B 1S8DB 3S36L 2H3NA 2XWBA 4WFFE 2A6JA 2X4NB 3VWJC 5CUSL 4HJGA 2JCCF 3K4ZA 3RWJB 1JF1A 4YHPB 1QLRA 3CGTA 2APVA 2GITB 5DHYB 4K8RL 4ONHA 1JHLL 3QDGA 1U8LA 2IH1A 3C6LB 4CVWA 5I1LA 3GEWB 3DPBA 4RZCB 4HK0A 2JJWA 1AY1L 4N5ED 2NY2B 2IPUG 4YK4C 3VW3L 3LD8C 4IMLB 1PSKL 4GRWB 5D1ZA 2FECI 5D7JA 4EI5B 4G7YH 5IMKA 3ZT6A 5ALCH 1XF2A 4HJ0C 4JQXC 2ZNWA 1VKXA 3LMJH 1NFDA 2EE3A 3FO2A 4ZS7H 3DJ9A 1EHLL 3VH8G 1DLFH 4XP5L 1BD2B 4X5LA 2R0KH 3CPLB 4MD4B 5HHVL 5DHVB 1ZSDB 4I9WE 5IBTH 1YYML 2FECL 2VKXA 3WHXB 1CK0H 2A1WL 1HXYA 3T0WA 4MJ4A 5I8CA 4Y16C 1IAIM 3VWJA 4ZO9A 1BJ1H 1LO4H 4DGVH 4RGNC 5E70A 5GS0H 5CD3B 4UILH 1VB9A 5CMAB 3PNWA 3EYVB 4M8QA 3K8MA 2QJDA 4XHJC 1VEMA 4BUGA 3Q6FB 4IDLA 1FSKC 4HX1A 1E4WH 4I3GA 3S97C 4ACPA 3HI6L 1DUZB 3P4LA 2ZUQB 2E3VA 3VRLE 1OB1B 5JPMA 2A6DB 3F7VA 4F7PA 3MV7E 5I0ZA 2HT3D 1GAFL 5KSBF 3D3VA 5IFJA 5I1JH 5IMMB 4M03A 2Q8AL 2BRQA 4JQXA 1T4KB 3S35H 4I3RL 1HYSD 4FQJH 3KPTA 1JWMA 2GTZA 3C6LC 1P84K 3N1QC 3LY6A 2JK5A 5IW1A 2VR5A 1IC1A 4YHML 1EH9A 1B4JH 4JM2B 4R9HA 2ZUVA 2NY2C 3F6IA 3IGAA 3OKDB 1VFOA 4Y16A 3OF6A 2HLFD 5D1XB 4PJAA 3FAWA 4MA8L 2EDQA 1A21A 5TJWK 1MCNA 3MRGB 1QO3A 3VG0H 4R26L 3RGVB 4X80H 1KTRL 3RZCB 4MAYB 2VUOA 5HDOA 2CIKA 4YIQA 3VWJD 5K9JL 4NNYB 4PJCB 4AQOA 1MY7A 2GSIB 3MLRH 5FOJA 3QIBB 5DMKA 3VDBA 2GT9B 2HRPL 4NQDE 3T8XB 1W0WA 4XWGH 1J11A 3O9WC 4FN0A 2V7HA 1OAYH 4JO4L 4ZNCD 3QG6A 1S8DA 1Z2KA 2F58H 5JW3H 2X4NA 4FFYH 1V5JA 1D6EA 1FNFA 1ED3B 2UY6A 2X10A 4FQCL 3WO3B 1EAJA 1MHHB 4YHPA 5T3ZL 2GITA 3HUJB 5DHYA 3D3VD 3GRWH 1D5IH 3C6LA 2CH8A 1HZHH 2FX8H 2IFFH 4POUB 4HJ0D 3WSQH 4UT6L 4YHLH 3W2DH 2YZ8A 4XCFH 1OF2A 2IQ9L 2ZUQC 4RZCA 5IESH 1DSFH 3ULUL 2YBRB 2VR4A 1FYHB 5EUKB 5T1KB 4UTBH 2PTTB 1HDMB 5GGTA 1DANT 1KEML 5J6HB 3QBTB 2D7TH 2GUOA 5KVFL 5LQBH 3WNPA 2HN7B 1WFNA 4WVRA 3PV6B 3OF6D 4QKXB 2O5ZL 5J89A 1MWAB 4RGND 1BD2A 4N0FB 1JPFA 5T5NF 3CPLA 4MD4A 1EHAA 1NCBH 4G9FD 5BS0E 1CTNA 1ZSDA 1AC0A 1NEUA 3CVHB 1ND0B 3OKEB 1AJ7H 5GPRA 3WHXA 3KYKH 4L3AA 5JXEC 3KPLB 1NCCH 4MD5B 4UZGA 4XB8A 1MOEA 1Q0YH 4F9PC 1YEEL 5FF6B 3MLWL 5D1XC 1BEYL 5CD3A 3QUZD 5TE6L 3RGVC 5CMAA 3EYVA 4MAYC 5KG9B 1SVCP 1RUKH 5ISZB 3RHWF 2FATL 5ACMA 1U8MB 1JZ8A 2VLLB 3HAEG 3K4DA 4GKSA 5IB5A 1DUZA 3HC4L 4YC2C 3QB7C 3B5HA 1OB1A 3C6LD 2A6DA 5CBEA 3D39A 2PTVA 1XCQB 25C8L 4U1HB 4XTRC 4KRPB 4XXDB 2MHAB 3VFWA 2NY2D 5DQ9B 5CP7B 5D71L 3T0EE 3BD4A 3F5WB 1T4KA 3VGGA 3WE6B 4QXGH 4KTDH 4EI5D 2VXSL 4OCMC 2YS4A 4OCRL 3UC0H 4Z0BH 3F12B 3QXAB 4H5SB 1Z5LB 5HGDA 1V7NH 2EDLA 3IDYB 3N1PC 5D7LB 1BD2D 5JXEA 1XF3B 3OKDA 3P11H 4XBEH 4GRMA 2B4CC 2AEPH 3NCJL 3RJQB 4F9PA 5D1XA 3EDDA 1G7IB 3MRGA 1N64H 3RGVA 5DJ8B 1P1ZB 4KK5C 4MAYA 1MF2H 4FQQB 1UCTA 5GGSB 4NNYA 4PJCA 1WSST 5ESQB 3K7UA 1GPOH 4Z7WB 5JOPD 5L88L 3INUL 2X1QA 1YEGH 4HS8H 1RULH 4CDGC 5FYKD 4HS3B 4NQXB 2HFFB 1FL6B 2ZZUT 2VSCA 4KVNL 5HHNB 3PHOB 2EZ0C 2GTWB 2DD8H 4MJ6B 5F93C 5CIPA 1B0RB 1MCDA 3TC9A 3LPWA 5EU5B 3HUJA 3VE0B 2BHZA 3B5GA 1IEBB 3UTOA 2I60H 4YUEH 1I1FA 3L6FB 3OAZK 1DN0B 5ID0B 1JTPA 5I9QC 5ADPL 1FRGH 2A73B 1JNLL 2C4XA 2EIZA 2YBRA 3HFMH 2QR0B 3IFNH 1FNSL 5EUKA 5T1KA 2PTTA 2H2PC 1HDMA 1U8KA 3GKWL 1QSZA 3IDGB 4WENB 4XAWL 4KRPC 3Q1SH 1JGUH 2AI0H 4JM2D 5J6HA 4MD0B 1LO5B 1CDIA 5JXED 2A38A 3PP4L 5CEYB 2QSCL 5D7IF 3O2WL 5HHQB 3DVGB 2HN7A 4GSDL 5DMIL 3PV6A 4RBPH 5INDA 3MLXH 5DHVH 4NCC2 4RX4D 2W1NA 1MWAA 5D1XD 4XNMB 4FTVA 4OIAA 4WY7H 5FYJH 1M6OB 2FCBA 3FQRB 4N0FA 1DQDL 3RGVD 3RZCD 1FVCB 4MAYD 3J7HA 3DUUB 4H20H 3CVHA 4U3CA 3IDYC 4KI5E 1ND0A 3OKEA 3T3MF 4XWOC 4AG4H 5D5MA 4U6TA 3KPLA 4MD5A 3QIBD 2R0WH 4OI9A 1EZVY 3B9EA 3D48R 5DO2C 3RNQA 4Z7UB 1K3IA 3O6LL 4PJBE 3EOBA 5FF6A 1OM3H 1UJTA 3WNMA 1KCKA 1G6VK 3SE4C 2FEDC 3WUWG 3V0WH 4YDLC 5DJAB 4UMGA 4YFLF 5KG9A 3VU2A 3M45A 5ISZA 5I1GH 3LAFA 4NOBA 3T2PA 3OZ9H 1UM6L 1U8MA 2FH6A 7CGTA 2VLLA 1XEDA 4X8XA 2JELL 1GGCH 5A16B 2DQIH 1JZ6A 3W0WE 4HKXA 2J12B 1XCQA 4O51B 2XV6B 4U1HA 1KENH 2R8SL 2VISB 3VGDA 2I9TB 4XXDA 2MHAA 3MJ9H 4XPBL 2H32H 3L7EB 5CEXB 4NN7C 5C08A 5DQ9A 5CP7A 5IKCA 1Q1JL 2ZCKL 3F5WA 5T1KD 3WE6A 4OFVA 5JLZB 2RAMA 5JW4Q 1UM4L 3VXQB 2V5YA 4HDIB 3F12A 1NBVH 3QXAA 1RHFA 4DEPB 1Z5LA 4CGTA 4JHAH 5HTSA 1I7TB 3MC0A 5I1KH 5SWSE 4KK5D 3RWCA 2IFGA 1BJ8A 3K0WA 5DFVC 4C54A 3ABZA 4WI8A 1KJ3H 1XF3A 1YEHH 5B3JF 3FQWB 5E99L 5FM8A 4G6AD 2HTKC 1KACB 4WEBL 4F7CB 1QLEH 1LO2L 2EDNA 1G7IA 3HTLX 2AW2A 1Z0MA 3SE4A 5DS8B 5DJ8A 1P1ZA 2FHBA 4LIQL 4FQQA 5GGSA 3QISA 2EZ0D 4Z7WA 5KS9F 4Q9RH 2Z91A 3L3KB 1IE5A 4MGXA 1OARH 1XCTB 4L3CB 5ISZD 3DRTA 2O5XL 1BIIA 2SEBA 3I02B 4TSAL 1GCFA 4HS3A 4NQXA 1QHPA 2HFFA 1FL6A 5HHNA 2IAMB 5EFIB 3PHOA 2GTWA 1YPZE 2IPKB 4TNVF 4MJ6A 2NLJB 1B0RA 1IL1B 4L4VE 2H2PD 3MRLB 5EU5A 4XVTH 2VDOL 3VE0A 4K07A 3WFZA 4RBPK 4KRPD 1WTLA 2EC9T 4HPYL 4S1QL 1JNNL 3L6FA 1DN0A 5ID0A 3CFEB 2YUXA 5F7YC 2A73A 3P0GB 5DD3L 2R2HB 3RL2B 5F7EH 1WV7T 3ARYA 2V6HA 4JQIL 2W65A 5C6TL 2QR0A 4WDIB 4HCRA 1U6AH 2FHCA 3MXVH 5DZLA 3IDGA 5D7LD 4XWOD 4MD0A 1LO5A 1IKNC 1MWAH 1XF5B 5CEYA 3OGOE 5HHQA 2WSKA 1FZOB 3DVGA 1QSEE 5F97E 5K33A 1HWHB 3REVB 5E1HB 4H8WC 4XNMA 5MENB 3CVHH 4FQLH 1M6OA 1HYRC 3G5YB 3MUY1 2YD3A 3DUUA 1L0QA 4QXTB 4FNLH 3QFJD 2HJLB 3IFPB 3GNMH 1LP9F 1G84A 3SN6N 4Z7UA 3FN3A 4POYA 3MLYL 4BA8A 4Z7NE 3QUMA 2OCFD 1RUMH 3KAAA 5DJAA 2QQQA 2DIAA 3PQYE 4LMQE 4OZIB 1H0DB 1GC1C 4LKXB 4U2YA 1F3DJ 4Q58C 2OTUB 4GG6E 3MODL 5MP6H 3CFJB 3LV3B 2ZUTA 3IDMB 3R1GL 3EJYC 1V3LA 5ANMB 1KCVH 4JZOB 2JF1A 4O51A 5ICZB 1RK1B 2VISA 2I9TA 2IAMC 2WMPA 5CEXA 3L7EA 1A7QL 3IFLL 1IKNA 4ETYA 5DLML 1Q0XH 4WEUD 4MHHG 4OJFH 2C9AA 1VA9A 4L8DA 5JLZA 2HTKD 1RZJL 3VXQA 3T2OA 4HDIA 4R2GB 1LE9A 2ZUYA 4NQVB 4GRLB 4HK3N 1I7TA 4PJFF 3MRNB 4BFEA 2IMMA 4XCCH 2A9ML 4DW2L 3A67H 4ODHH 2DM7A 2N4IA 3DI3B 3ZDZE 5DD0L 4M6AA 2EH7L 2FJGB 5FA3A 3IS1X 2RR3A 3FQWA 4K8RD 4LLDB 3TVMC 3V8CA 4F7CA 5F9OH 5KSBB 4Q9QL 1X5AA 3BVNB 1EO7A 5DS8A 1JGEB 1N7MH 5CJBA 5GRJL 2OLDA 1F2XK 5EBGA 3KS0H 4DFIA 2J8OA 1FVEB 1K4DB 2APXA 1U8HB 4HBCH 1NSNH 3EOYG 1AKJA 3L3KA 4Z7OF 1IGMH 2XRAL 4TSBH 2BJML 2E27H 3NAAL 2D31A 1KPRB 1XCTA 3WV0A 3AUVA 2XN9B 2OM5A 3Q3GB 2P44B 3OJMB 3I02A 1A2YA 4G6JL 4HT1L 1DL7L 2HJKA 4O4YH 4LLQA 1MIML 2IAMA 4LRNL 1KUMA 3MR9B 2IPKA 4EBQH 5C0NC 1LO0L 5EA0L 5FYKU 2NLJA 1IL1A 3MRLA 2DTML 2LABA 2NXYB 1N8ZB 1J86A 3H42L 4MJ5A 5C3TA 1JPTL 4RMSA 5ESAB 4B7LA 3CFEA 5J6GB 2J8UE 3RL2A 1YJDH 2VYRE 3MA9H 5I76A 4DGYH 3RUGF 1X4ZA 1HK6A 2IG2H 5GISH 4UNTA 3S36H 3TVMA 2FR4B 3HLAB 1T6WA 5CUSH 3UTSE 2CIIB 1XF5A 2JCCA 5C0CE 1P7HL 1FZOA 2I26N 3HG1E 4EIGB 2NY5H 4E9LA 2NNAB 2WBKA 4R2GC 4WW2F 4K8RH 1JHLH 4GRLC 2X1WL 4O5LL 4NFDA 1I4FB 5FM4A 5GGRY 4BZ2L 4MCZB 4GJTB 4J12A 1NGQH 2HJLA 1T03H 3IFPA 3GFUA 4LK4A 1AY1H 2DQGL 4OAWB 1ACYL 2WM0A 3VW3H 1EEQA 4UQ2B 1PSKH 2CQVA 3DSNA 4UNVA 4PBWD 3EJYD 3OXRB 2ADIB 4NYLB 4PP1D 3B43A 3B5TA 2IAMD 4OGZA 1H0DA 1AH1A 5HI5C 1BVZA 1NLDL 3TYGL 4XP5H 4HIHA 1FH5L 2H1PL 2OTUA 3UXFA 2DQJH 4PJIB 3CFJA 1I75A 3LV3A 1UB6B 5E2UL 1GGUA 3IDMA 4KKCC 4QT5B 4AENB 5ANMA 3RWEA 1YYMH 2WWMC 2A1WH 3MCKB 5ICZA 1RK1A 5TH2A 3ZSSA 1IKFL 2X44D 1WFTA 1NKRA 1AGEB 2QTEA 5MEQB 1MAJA 2UYLB 3TJEL 2IQAB 4OUUB 2IBZX 2NXYC 4NQVA 4GRLA 4KMTL 3X3FL 4MDIB 4GG8A 3BP5B 3MRNA 3BAEL 1MCJA 3HI6H 1UB5B 3WFHB 1LE5B 4HULB 3CFIC 2YPVL 5C0BE 1JHTA 2OYPA 5MEND 1CGWA 3FQTB 2FJGA 5T3ZD 1X3DA 1QQDB 1P69B 1JJUA 4LLDA 1GAFH 3VD5A 5KSBA 3MLSL 3QPXL 4Z76A 4DOHE 2F5BL 5HHPB 3S3PA 5A2IH 1JGEA 4Y8AA 2UZIH 2XYCA 3FZUC 3UTZB 4UV4L 1FVEA 1K4DA 4K71B 5C0ND 2VQTA 2BVOB 3GI9L 4JKKA 5DZNA 1KPRA 3O11B 1LEGB 2XN9A 3Q3GA 1NMBL 3JSSA 3TZVB 5IEHB 5FECB 4NP4H 2IH3B 4JRWA 2GJ6B 3KXFE 3K1KC 1LEKB 4U0QB 3MR9A 4MA8H 2K3TA 4PLNC 4R26H 4XPAL 1N8ZA 5IUSA 5K9JH 2X4OB 5AG8A 1XGRB 2D9QB 3ILQD 3QUKB 4OZHE 5ESAA 3ARFC 5J6GA 5E2VL 2GY7B 4PJXB 4MXVF 2KZ1B 1V3MA 1A14L 2EDDA 4R2GD 2A9NL 2HRPH 3KPSB 4ZUTA 4GRLD 3IT8D 4JO4H 5C0DA 5A40E 4K2UL 2APTA 4QRRE 2FR4A 3HLAA 3U4AA 3TM6A 3UAJD 1I85C 2CIIA 4P99A 1EFXB 4FQCH 1H15B 5T3ZH 5CZXD 2ICWI 2NNAA 1SM3L 1I4FA 3MUZ1 2IJ0C 1A7OL 1BFVL 1IRAY 4ETQB 3EGSA 3JUZA 5T3XE 4HUXA 1CIUA 3ULUH 5EUOE 2Y5TB 3MRKB 4P4KB 1ZEAL 4E0RB 4JLRB 4LHUA 4UQ2A 1S9XB 1Q9KB 2XN9D 5M94B 1N2RB 3OKNB 4KKCD 3EDEA 3OXRA 4HIIB 1NAKL 1KEMH 2ADIA 2DQUH 2WWMD 3GJFB 3ALPA 5D7IB 4ZSOB 3BOVA 5CKGA 2O5ZH 4UUJA 4K71C 4S2SB 2W60B 5I8OL 1MCOL 3ARFA 1KIRB 5I1IL 2YUZA 1UB6A 5E4IA 4ORZC 2NXYD 4AENA 4JB9L 4QT5A 2BY1A 4I2XE 4NQSA 1ZVYA 3MCKA 1RU9L 3EO9L 4X6BB 1P4IL 1I85A 2YD8A 1AGEA 3MLWH 1BEYH 5DK2B 2EC8A 3B4NA 3MRDB 2VE6B 3PE9A 5TE6H 2UYLA 5AZEL 2IQAA 3M8OH 4OUUA 5ALBH 3EJZC 4RFNB 5KSUA 2DQFB 4MDIA 2FATH 3BP5A 4V2BA 2YPLE 3QRFM 1UB5A 2P1YA 5FYLE 3FZUD 3HMXL 3WFHA 1LE5A 3U79A 4YXLL 1CXHA 3NACH 3FQTA 3V95A 3V6ZB 3LRSB 5DJ2A 3KDMB 1QQDA 4MSWA 1U8PB 3N85L 4PGEB 25C8H 5AD0B 4KHTL 3ZYZA 5BVJA 4X8JB 3PWPE 1OAUL 3DOSA 5D71H 2NMSA 4IRZH 4RAVB 3GIVB 3NZ8B 2BVOA 2KQMA 3VXRA 1QPXA 2PYEE 1NCAL 3O11A 1LEGA 1T2QL 3TZVA 5IEHA 1EJ6A 3GBMH 2OK0L 2IH3A 3U82B 2RFXB 3DXAE 2GJ6A 1B4RA 1LEKA 5DJXB 3NCJH 2BZDA 4F58H 1OGAE 2JJVA 2NW2B 1FJ1A 4OZFB 1TLKA 5I71B 2EDKA 2PN5A 3RIAK 1OW0C 2QBWA 1C12A 4PLJD 3OMZA 1T21B 2X4OA 4S0SD 1XGRA 1ZGLB 1J0ZA 2LAAA 3QUKA 5L88H 1M4KA 2DBLL 2EYSA 4PJXA 4WGVB 1MCWM 4NPYB 3C6SB 3KPSA 1J1XL 1PKQB 4OV6F 4X6DB 2FHFA 4PJ7B 1LDPL 4F57L 4KVNH 4OF6A 3IXTB 4LCIL 5CFHA 1EFXA 4U33A 4OZGB 2CO7B 4G7VH 3AMLA 1H15A 2X6MA 4WUUA 5E5RB 3U9UB 2W9LA 4RFNC 4XAKD 3HMWL 3QULB 1DVFB 4J3TA 1A22B 1XGYL 2D03L 1KCLA 3G6JB 2HMIC 2YR3A 4J3SA 4TPRL 4N8VG 5ADPH 4ETQA 1JNLH 4ZD3H 3LH2H 5K93A 3O45B 5B38B 2ZSVB 3MRKA 3QEUA 1LEIB 4JLRA 2XY1A 3GSQB 4MCYB 1FNSH 2X4QB 3WO4B 5I19L 1FPTL 2DF3A 1S9XA 1Q9KA 3GKWH 2V9TA 4XAWH 1QBMH 4ZOEA 3TZVD 4HIIA 3GJFA 2QSCH 3MRMB 3O2WH 1S5HB 5D7IA 2GJ6D 4GSDH 2W07A 1OW0A 3BQUC 1IGCL 4POZC 3BZFB 2LU7A 2W60A 4S2SA 5H8DA 4F15C 1DQDH 2WUBL 1KIRA 1B3JA 4G5ZL 4BFBD 2G2RA 1RZJC 4D9LL 2NZ9C 3U48A 4Z18A 1FZMB 1S7RA 4N1EA 3WXVL 3DVNB 4LARH 1LP9B 2CK0L 4X6BA 2GK0B 3P0VL 4XPTL 5I8EA 3FT2B 1MFAL 2BY3A 3ARBB 4GW4B 3I2CL 1QBLL 3KPSD 5DK2A 2HA1A 4PRHE 3MRDA 2VE6A 4X7EC 5I71C 5C09E 1EEUA 2P5EE 4MNQE 3GSWB 3SDCB 2DQFA 2PCPB 4ODVL 1EFXD 1HHGB 1UM6H 4NZTL 4GAJL 4M4RA 3ME0A 3BRDA 4P2RE 1NUDA 3N0PB 4OGXL 4JFXB 1BIHA 1IGJA 3V6ZA 1A02N 3LRSA 1X5YA 1R3JB 3KDMA 4HWBA 4TRPH 1U8PA 4Y8DC 5AD0A 2OZ4A 4CW1B 2R8SH 5I18L 3DROB 4LSVH 4P4KD 4ZDHB 1U3ZA 1RMFL 3ULUF 4KMLB 1Q1JH 2ZCKH 4PRAA 5DQJB 4UAOB 4YEFA 3BQUA 1UM4H 4RAVA 3GIVA 3HKFA 3T0XA 1DVFC 2CRZA 3NZ8A 5TPWH 2AV7A 5D2NB 4PJFB 3QWOB 3SPVB 4PB9L 3L5IA 4BQBA 1NJ9B 1KB5L 3T08A 3UROR 1P5VA 2XTJB 3V4PH 4UBDD 3WO4C 1HWGB 2VLJE 4JFEE 4C83A 4ELMB 1KPUB 1QYGL 4MB5A 4AIZB 3LN4B 5E99H 5DJXA 4WEBH 5J11B 5E03A 1IZKA 3H3PL 4KUCD 1KIUA 3VXME 1MCHA 5F7HA 3DX8B 4G8GE 4PRIE 1T21A 3KG5A 1ZGLA 4NUGL 1C8PA 3O41B 4KFZC 4WTZA 1DQMH 3EO1B 3MRFB 3C6SA 2BVYA 1PKQA 3I6KA 1MY5A 1FO0L 3KJ6L 3O3AA 4PJ7A 4GAYA 1XT5A 4DWHA 5FM5O 5EIVA 5DI8A 4JO2L 3LB6D 2DL9A 1S7QB 2DI7A 4NQCA 4OZGA 2ERJB 3U9UA 3UPRB 4QRTB 2EEDA 3SJVB 2VDOH 4OLXL 4Q6YA 3SDCC 4MQSB 2BFVH 3QULA 2XICA 1DVFA 2XG5A 4PJEF 5HI4C 4HPYH 4S1QH 3G6JA 1JNNH 2CXGA 4CMMB 1A3LL 4WHYH 5CD5C 4PGZA 5DD3H 3GSNL 4POZD 2B0SL 2ZSVA 3AROA 3RUGB 5C6TH 3SKJL 3GJFH 4MCYA 2X4QA 1UZ6F 1OAQL 4JDZB 1Z0NA 2Z0BA 4O02H 3GHEL 4H1LG 3MRMA 1S5HA 5LGKA 1JYWA 4M48H 2F54E 3CU1A 1ZWIB 3L7FB 3BZFA 2C3GA 5FO7B 5D2NC 4YQXL 3EBAA 1RK0A 1KN2L 4D0DA 2FO4B 4P2QB 3G9AB 1VSCA 2XTJC 3CDYA 4XP9H 4PJDF 3RA7H 1U91B 1FZMA 1CS6A 3DVNA 4MQTB 1LP9A 2GK0A 5EULV 3FT2A 4NQEB 4L8BB 3ARBA 5J11C 4GW4A 3DMMB 3MLYH 1G7LB 4JFDE 4O9HH 4Y19E 1FP5A 1E28B 5EZLA 1BHGA 2E9JA 1FGVL 3GSWA 3JTTB 3SDCA 4F2MB 1F11B 2ICWB 3VXUE 4G80B 3WEXB 3MOBH 3BE1L 3MODH 3Q48A 2YUWA 4JFXA 3R1GH 1ZS8B 1CFQB 4KK8D 1R3JA 1NUGA 4CW1A 2IBZY 1A7QH 3DROA 3IFLH 4OIIL 1UENA 1U95A 4ZDHA 4M62L 2CXKA 5DLMH 4OQTL 1CI5A 4LMQI 2VZVA 5DQJA 2CLRB 2ERJC 4JGMA 4QRSA 1GZQB 4RWYH 2AK1L 4PRBB 3VGHA 2VAJA 2QHLA 1CXLA 1NAML 5D2NA 4PJFA 3SPVA 2WZPD 3VFGL 1T7ZA 1OP5H 1MQKL 4OLYL 4ELMA 1J88A 1KPUA 2EH7H 4OZFH 3BXNB 3LN4A 3CLEL 3E2HB 4AIZA 4PB0L 1UT9A 1X5ZA 4P9MH 1RZ7L 4Q9QH 5HPMB 5B3NA 1CBVL 1UADC 4FFZL 1AP2B 1N59B 3OKKB 4DVRL 3DX8A 2OL3A 3STZB 3ARBD 1JWSB 4WUKL 4WW2C 3O41A 3I85A 3PP3H 2OMBA 4XPHL 1RVFL 3ARVA 3EO1A 2XRAH 3NAAH 5T1MB 3MRFA 3SDCD 3V5DA 4OFIA 5D2LB 5FGSA 5BQ7A 5HI4D 1CFSB 1ZANL 2E7MA 3KPPB 1X9QA 1DL7H 4LDEB 3GJFK 1MCEA 5CD5D 1MIMH 2AS5M 2DKSA 3DMMC 3CNKA 4LRNH 4JANB 1S7QA 4NNXB 3VFPA 4NBYB 5CHNB 1R24A 4WFFD 3UPRA 4WI7A 1NL0L 4QRTA 1J5OL 2DTMH 3SJVA 3HHRB 5EBMB 4Y4FB 3E3QC 3EDFA 3H42H 1JPTH 1YMME 4CMMA 8CGTA 5C8JB 1HXMB 4N1HB 2VN4A 4HW6A 3NIDF 5FB8B 3IFOB 3RUGA 1T7YA 4RAHA 4JN2B 1WAAE 5ILTL 5H37H 3LN9A 5GSVA 4JDZA 5IB4B 3P4OB 5IFHL 1LNUB 3ZKXC 1BQHG 2CJUL 3IDIB 5DR5L 4YR6B 3NH7H 3OB0H 3GSXA 5I66B 4G43B 1NUFA 2IMNA 4QRQA 1ZWIA 4G8FB 4WW2A 3BIAX 3IDNA 5FO7A 4AEFA 5J9PB 1UA6L 4O5LH 5BJTA 4BZ2H 5KVGL 1RJYB 4GO6B 3RTQB 3C5ZC 2FO4A 4P2QA 3RVTC 3IRPX 1U91A 3MRRB 3ZE0F 1GZPB 3OKYA 2DQGH 4S11A 1ACYH 3E2HC 2ED7A 4NQEA 4L8BA 5IW6B 2ENYA 4LPCA 1R5WB 1F6AB 2XKSA 3DMMA 3I6LD 3MZTA 5EC2B 3TPUB 5JA9A 1BREA 2AJUH 1URLA 1S7SB 2YA0A 5IM7B 1H5BB 3JTTA 3WLWD 5EOCJ 4F2MA 3SQOL 3EYSL 1F11A 2AGJL 3DUHA 3BISA 1NLDH 4JRXB 3WEXA 1E6OL 2B39A 3O6KL 5E2UH 3SJVD 1IC5L 2EH8H 1OP5K 3HNSH 2P47B 4NFCA 1EHXA 1ZS8A 1CFQA 2X1OA 3VH8B 3VXSB 1M05A 4HPOH 1IKFH 1FZKB 5IVZB 5D72L 5EC1B 1AO7A 5IB1B 2CLRA 2EKSB 1GZQA 3TJEH 4PRBA 3TJHD 1SBSL 4NNPL 4QOKB 3WD5L 4X7FC 3X3FH 3CLFH 3BAEH 5IEKB 2X4PB 3LKNB 3C5ZA 2EIEA 4O2EB 4FABL 3IF1B 2YPVH 3FO0H 3TA3B 3NA9L 3BXNA 5DJYA 5I15L 1YNKL 5DEGB 3A0OA 4K3JH 4OF3A 2Y25A 4PTUB 4P2QD 5HPMA 3MLSH 2WBJC 2XZQL 3RAJH 4J3UA 1AP2A 1N59A 3I9GL 4EUPG 1X4XA 1N6VA 3OKKA 4K3HA 1IGFL 1D9KC 1EEZA 4NQED 1X5HA 3WN5B 4DN3L 5T33L 3DMMD 4N5UA 4JM4L 5CJOL 5EBWB 1S5IH 1RD6A 3RTQC 3VFUB 1SJXA 1SMAA 1QVOB 1CFSA 3KPPA 2P46B 2QQKL 5DYOB 4S1SL 4FMFA 3MX0A 1SJEB 3DECA 4NNXA 3DGGA 5CP3H 1F3RB 4X6CE 1H5BC 5EBMA 2R4RL 4HMEA 4U31A 4V1DA 4XPAH 5GGVL 1VGEL 1PW3A 1C08B 4YO0B 4KDTC 3C8DA 5E2VH 1ITBB 1HXMA 1NFDE 3MUHL 1A14H 2BY2A 2YXMA 4XNYL 3MUGB 3UJJH 5FB8A 3IFOA 2A9NH 3KPQB 2Y6SC 4JN2A 3D1MC 5DD6B 5IB4A 3P4OA 1LNUA 3RVTD 5KVDL 2WBJA 3IDIA 1FO0B 1QFWM 4OUOA 4YR6A 4CMHB 3AGVA 4L4JA 4UQ3B 5I66A 3T77A 5BOZG 4S0TD 4LSQL 1D9KA 1A6ZA 5BRZB 1SHMA 1BFTA 1CGTA 5J9PA 1S7UB 2GKIA 4KQ3L 3UDWC 4Z77B 1A7OH 4XI5C 1BFVH 4PG2C 3RTQA 1N6UA 4X4MA 2QSQA 3TA3C 1JVKA 3MRRA 2MNUA 1GZPA 4NWTL 1J8HB 1DJSA 1SEBB 5IW6A 3V7MA 1F6AA 3GSNB 5EC2A 3QXWA 3HZKB 1JN6B 1NAKH 3W81A 1XGQA 1S7SA 5IM7A 1H5BA 3WN5C 2XI9A 1A6VH 1TTGA 3D3VE 4XNUL 1CR9L 4LCYA 1U3JA 4JRXA 4KDTA 5FGBC 1MCOH 5I8OH 4Y4FD 3WFBL 4PRPB 3MRIA 4M43L 3ZE1F 3VH8A 4EDWH 5ICYB 3VXSA 1QACA 4RGMB 1RU9H 3EO9H 1P4IH 1PLGL 2XNAB 5DVOA 2QEJA 1FZKA 3BIKB 5IVZA 4RA0C 4LVHB 5EC1A 2D7QA 3ARRA 3O4LA 4ZFFB 5IB1A 1VADB 2EKSA 5AZEH 3OV6A 5GS2D 1KTLA 4QOKA 4RGNE 1RZGB 4Y88A 5JHDB 4R6UA 5IEKA 3UDWA 2X4PA 3A6BL 3LKNA 4PG2A 4AM0B 1XF4B 3HMXH 5FO9B 1YDPB 4BK4A 3IF1A 4YXLH 1BZ9B 4UV7L 3TA3A 1KFAL 5M7QA 1KB9K 4PYHA 1CD8A 5DEFB 5K59F 3ZMRA 3LKSB 3FQXB 5DEGA 1MJ8L 4Y0GA 3HAEB 3RTQD 3VDAA 2C1OB 5FV2A 4PTUA 3S35X 1BX2A 4E41B 2XOTA 1OAUH 5F21B 2VMFA 4LASH 4QRPB 3WN5A 1PEWA 1BBJB 1IAMA 2PF6A 4EI6A 1WZMA 3S6CA 2ATKA 1WVZA 5FGBA 5EBWA 3VFUA 1NCAH 4IOIB 4IRJB 1U8QA 1ZLSH 1T2QH 1VERA 1NAMB 1IFHH 3W9DB 2OK0H 4JRXD 3MJ8B 4XH2B 1F00I 5DYOA 4EVNB 1SJEA 5ECJE 3C5SB 4GOSA 5HI3D 3HE7B 1VEPA 5L2JA 4X9GA 1T5XA 5LGJB 2Y6SD 4JFHD 5DSCB 3VXSD 2PW1B 1GGIH 1AGCB 4GRWE 4W4OC 3OKLA 3RP1A 4ELKB 2YPKB 2G75B 2J6EL 4JKMA 4YO0A 1T7VA 3PABB 4N8CL 4XRCB 4QOKD 5GS2H 3GI8L 1OT2A 3KPQA 3TBYA 5KTEH 1BD2E 2HAZA 4RGMC 1MHPH 4FXLA 1LDPH 1TENA 4XI5D 5DD6A 3UTPD 1FDLL 1M7IB 3TA3D 1FO0A 4LVHC 1ZA3B 4MZ3A 4XCEB 4LCIH 4Z6AT 3ZL4L 4UQ3A 3ZDXE 3N1MC 2BVPB 5I1AB 1JGDB 5JOPE 5DQDH 3BZDA 5FYJU 4G8IB 1S7UA 3VXNB 4BH8B 2D03H 4Z77A 5GHWL 3T3PE 4NKDA 3CUPB 1WZ1L 2IWGA 1KSRA 4R4BA 3R4DA 1NH6A 3ZTJH 3LOWA 1J8HA 3ES6B 5FYKE 5JOEA 5I19H 1FPTH 3E6HB 3GSNA 5L8KB 3O0RL 5D7SL 3GZKA 1JN6A 4X98B 4ZO8A 2KL6A 1R3KB 4W4OA 1WBZB 4IHOB 5KVMC 4M02A 5H2BB 1PX3A 4EN3C 1LO3L 1ZT7A 4MXWL 2BDNH 4JO3L 4JZNB 2WUBH 1H8NA 4Z8FL 3E6FA 4PGJA 1G0XA 4D9LH 3QHFL 1UXSB 4PRPA 4I77L 3ZHLA 5ICYA 3AXLB 5TDOB 4CN4A 3VRLF 3WXVH 3AC0A 3V4UL 2XNAA 3P0VH 4XPTH 4P46B 1MFAH 3HE7C 3I2CH 1QBLH 3WS3B 5K9OB 1ZT1B 4ZTPL 1VADA 4MA3A 4R90L 2VZOA 1L7TL 2FX9L 3QXUA 1HKLL 1RZGA 5ACLA 2FRGP 4UDTB 4ODVH 1CTOA 1B88A 4GAJH 4WU5A 5DF0A 4RFEB 4AM0A 2HKFL 1XF4A 5FO9A 1YDPA 3WUWB 3LHPL 5BRZD 1BZ9A 1YC8A 4PJCE 4IBLT 4OGXH 3V7AE 4AK1A 3T65B 5DEFA 5E4EB 3L1OH 3FQXA 2GEEA 3SKMB 2D7MA 3HAEA 2C1OA 3I50L 4Y1AB 4YGAB 2W9DL 4E41A 5GRWA 1J8HD 1RMFH 4QRPA 4HFUL 5EB9A 1BBJA 4UTAL 2ENSA 5KSAB 3PJSA 4EN3A 4O2CA 3LQAC 3QDJB 2Z31B 2Z93B 4IOIA 4IRJA 4PB9H 1YECL 1P4LB 4JFOB 5FDWB 3HUJE 2FDBP 4H25A 1KB5H 4P2YA 1NAMA 3LS5L 3P2TA 2R23B 4W6WB 4JCMA 3W9DA 4DKAA 3QEQA 1NBYB 4XH2A 3TGXA 1JGLL 4EVNA 1QYGH 3MLUL 1RZKL 3Q6GH 3HE7A 5LGJA 3LKOB 3H3PH 1LDSA 1HHKB 5DSCA 2ZG2A 2PW1A 1AGCA 4LLUB 3MV8B 4ELKA 3MLPA 2YPKA 2G75A 4MLSA 4F7TB 4KZDL 3JWOC 4NUGH 5ENWB 1TJGL 1LK3L 1QRNA 2R1YB 4LGSB 5C92A 2VDRH 3PABA 2HJFB 4XRCA 3H9HB 5JHDD 1FO0H 3KJ6H 5DUBB 2J1KA 1SY6H 4KWUA 1UC6A 4P46C 1M7IA 2NZIA 2FGWL 3IKKA 4XCEA 1LGVA 1MLBB 4JO2H 1JRHL 4DQOL 4KPHL 5C0FB 3MV01 5I1AA 4OF7A 2L4OA 2P45B 4E41D 3ESUF 3FOMB 3VXNA 1G6RB 4BH8A 1UEYA 2W91A 3C8KB 4QRPD 1A3LH 5LJYH 1RUAL 1R6VA 5ISZE 2BVUA 4Z7VB 2B0SH 4FQPA 1BF8A 3TBTB 3ES6A 3P9WB 5E4EC 3SKJH 1JMZA 1OAQH 4IRJD 3SKUD 1U0QA 3B2VL 5C7XL 3GHEH 1WZKA 4X98A 2YN3A 3MOAL 1U41A 2DMBA 3UYRL 3G6DL 2B7DT 4IHOA 1I8LC 4ZUWB 5H2BA 3HE7D 2Q87A 2P43B 5KSAC 2OJZL 3I3BA 2Z31C 4HGKC 4JZNA 4YQXH 1KN2H 3V0AC 2MCPL 4OD1L 2OTPA 1UXSA 5HGHA 3DTXB 3AXLA 1HINL 5TDOA 2DI9A 3VCLB 4M7LL 3U30B 4P46A 5D7LE 3WS3A 3KR3H 5K9OA 1ZT1A 4YGVB 1HSBB 1F13A 1U8OB 5DDHB 2WLYA 2HTLC 3NFPA 4MQ7B 2GJZB 2V9RA 4UDTA 3VD3A 4TNWF 2F9BT 4LU5L 4OM1L 4RFEA 3BE1H 3WUWA 3WIIL 1K6QL 2VL5B 5CKAA 5I74C 2C1PA 2CKBL 4Z7WE 4ZAKB 3T65A 5DRWB 2A6IB 1NGZB 4LLVB 3SKMA 4LLMA 1OTTC 4Y1AA 1FL5B 4R97B 4OIIH 1HH6B 4M62H 4OD3L 4OQTH 2L7JA 5IJVB 3T4AB 1UH2A 3QQ3B 1I8LA 32C2A 4Y4KB 4LVEA 3QEHB 5D93C 5KSAA 3WKML 1K4CB 1NAMH 2OXGA 2Z31A 2CGRL 1FQ9C 2Z93A 3BPNB 3VFGH 1NANI 5FDWA 1BPVA 4X4ZA 3MBXH 5SWQB 2R23A 4X7CC 1ROWA 1MFBL 3ARZA 3WFDL 2MQ0A 1MQKH 4OLYH 5T1DL 3RY6C 1NBYA 5C9JA 4P57B 1DN2A 3CLEH 3L3JB 4PB0H 5DFTA 4WNQB 1K5NB 3LKOA 1YY9C 1WC7B 1HHKA 1CBVH 3WIFB 4QRUB 2R15A 2QQLH 1CGUA 5AUMB 4DVRH 3TCXA 4LLUA 1QFOA 4P46D 3MV8A 3NFSL 4M7ZB 2B8OT 4WUKH 2X05A 4F7TA 5ENWA 8FABB 2XQYG 3MSPA 4XPHH 1RVFH 2R1YA 4NSKB 5EZIL 2HJFA 3MFGB 3H9HA 4JCLA 1LWRA 5JQ6L 5IB2B 1FYTB 5DUBA 3CDFA 5EIIA 1ZANH 3BDBA 4PV9B 4IMKC 2ED8A 4M5ZL 3CZJA 1UVQB 3S5LG 5J3HD 5F7MC 1MLBA 1S3KL 2W0FB 4Z7UE 5C0FA 5JDSB 4WWKB 2YOCA 4TTGA 4Y1AD 5B8CB 3E8UL 5E5UB 1G6RA 5LGHH 3C8KA 1MAMH 3CCHA 2OX5A 1MRFL 1NLBL 4NC0B 2HLAB 5KSAD 4Z7VA 3BH9B 4ZAKC 4KI5F 3RY6A 3QDJD 3TBTA 2Z31D 3BYTA 1UJ3C 5BZWA 4NJ9L 5ILTH 4DGIH 5ESVB 1ERNA 3LKPB 4YBQC 5IFHH 2H2SC 2CJUH 1KLUB 1IAKB 4PJBF 3H9SB 3ZKQD 4ZUWA 2OTWB 2QHRL 4Y4KC 5CAYB 1TQBB 2FJHA 2BRRH 3MXWL 4P5TB 3IRZA 3O2DA 3BPNC 5KVGH 2HTLD 4R7NB 3ZT5A 4DAGL 1QR1B 3MV8D 4K23L 3BEWB 1YYLL 4EDXB 1IARB 2GYSA 1G9NC 2BOBB 1XMWA 2E9IA 5BO1H 2W9EL 4U6HA 1EGJA 5C0RL 1RAMA 4A2LA 4YGVA 1HSBA 2FBOJ 4P9HC 1TPXC 5IQ9A 1QNZH 5F9JB 1OTUD 4MQ7A 2CPCA 4QEGA 4KV5E 3EYSH 2GJZA 2AGJH 1O7SA 1JYVA 3BKJL 3RBGA 3TV3L 4X6FB 1E6OH 1B9ZA 4JE4B 4D0BA 3O6KH 2VL5A 2OSLA 3ULSA 1IC5H 4ZAKA 1N3NB 5DRWA 2AVGA 1UJ3A 1NGZA 4LLVA 3QCTL 2EKJA 1W8NA 4BSVB 1FL5A 3QNZB 5D72H 2FSEB 1HH6A 4KRLB 1DQTA 3T4AA 3ZDYE 4WWKC 3QQ3A 4Y4KA 1CVSC 2C4FU 3QEHA 4TOYL 1K4CA 1SBSH 4NNPH 2Q1EA 4P59L 3WD5H 1HHIB 2CUMA 2JKXA 3IDJB 1VEOA 2RQ8A 2BXYA 5SWQA 4FABH 2VUYA 1QSFA 3U7AA 3NA9H 4NKQB 3BDXA 4HC1H 3QO1B 2CLVB 4P57A 4CNIB 4OI8A 3VRJB 1YNKH 4WNQA 5FUOL 2GQHA 3NOIA 1A7NL 1K5NA 5LG1A 1RJLB 1WC7A 2Z9TA 1I3RB 2XZQH 4QRUA 4UINL 3IU3B 1YPZF 1MCSA 5AUMA 1CLOL 3TNMB 1IGFH 4DN3H 5T33H 1TQBC 3A6CL 4P5TC 5CJOH 3X13B 5EBLA 4M5YL 1EO5A 5MENE 5IB2A 1FYTA 5C0AB 1CGSL 1F3DH 3LSOA 1R5VA 4WCYL 5T3ZE 2QQKH 4S1SH 1UVQA 2DKMA 3FKUS 3MCLL 3QIWB 4GT7A 3GJEB 4LSSL 1ZLWH 1IEAB 4ZAKD 4HMCA 2ZOKB 5DURB 2DMCA 4WJ5B 2W0FA 1IILE 1NDMB 3PIQA 4WWKA 4ODUB 4YBQD 5D70L 2R4RH 3OR7A 2H2SD 3VXOB 1VGEH 2EDHA 2DLFL 4Y2OA 1NDGB 3GMRB 1FG2B 2HT2D 1BQSA 1NMCB 1RQ5A 2J5LB 4U1JB 4Y4KD 1U42A 2HLAA 1U3HC 1UWXH 4OZIE 2J6EA 4XNYH 3BH9A 3S36X 3VMPA 1KIQB 6FABH 1MEXL 2MPAL 2J8HA 3MLVH 2BSSB 4KK6C 3L5XL 2CMRH 5ESVA 4LEOB 3LKPA 3L3OB 4LVNC 5F7LB 2Q86B 1P7KB 1KLUA 2HFTA 1T1YB 5KVDH 5L6YH 4J3VA 5ANME 4Z7NF 3H9SA 2GIYA 1KT2B 1CFTB 3ZKND 5CSBA 3IU4L 1UKSA 1K8IB 4P5TA 5E0QA 1A7PL 5FGCB 5BZDB 2CUHA 4R7NA 3FO1B 3WLBB 1TQCB 5AYUL 2MQ3A 1QR1A 6CGTA 3BEWA 3S4SG 4GG6F 1ONQB 1OHQA 2P42B 2R69L 4OLZL 4RRPG 1RIUL 4LGRB 2P24B 4RISL 4B7IA 5E6YA 3CD4A 4TYUA 3W5NA 1FYTD 3DBXB 2MCG1 1ORQB 5F9JA 3QDMB 4OLUL 2X42A 4KJPC 5KSBE 4QXWA 4XNUH 5KOVC 2DM4A 4WWKD 1U3HA 2Q3ZA 1A9BB 4CU6A 5DFWH 4URTB 1N3NA 4M43H 1UKTA 3FT4B 1KXQE 4HBQA 3U0TB 2AJVL 4U3HA 4F80A 1KJ2L 5F6HJ 2V2WB 2XN9E 4BSVA 3QNZA 3QIWC 2P5WB 1IJ9A 4OB5H 1B90A 3CXDL 5T3XH 1J1PH 1OWWA 3ULVL 4DKDC 1HHIA 4JPIB 1BBDL 3IDJA 3H9SD 3RI5F 1F42A 3A6BH 1NMCC 2J5LC 4B41A 3WHE0 4ZFZB 1MCRA 4NJAL 3P4NB 3UTQA 4UV7H 1KFAH 4P5TD 3RFZC 2CLVA 3AU1B 4M6ML 2PYED 4CNIA 3VRJA 1IZJA 5GZOD 2Y1VA 4FS0A 1RJLA 2CKBB 3L3GB 1I3RA 2YK1H 3IU3A 3AB0B 4YDVB 1CQYA 4Z5RB 5JXAL 1C7TA 1MCQA 1FCGA 2LQRA 1XGUB 4G8EB 2RBLA 4JJHA 5LXGL 3IDXL 4XNXL 3X13A 5HSFA 1I1CA 2J8UF 4X4XB 5C0AA 1UWXK 2XWJB 2E5EA 5E6ZA 3DHJA 1XIWC 2NY6C 4DN4L 1U2HA 2A6KB 3G04B 3QIWA 3GJEA 1CXIA 2FYYB 2QQNL 1BGXL 1PEZA 4KK6D 1Z3GL 1NDMA 1BQLL 4OGAC 2PXYC 2D0HA 5JIHA 3PHSA 3RU8L 3ORJA 4WV1B 3QZWG 4PJGB 5K9QG 3VXOA 3MRPB 1WBYA 1NDGA 3GMRA 3VWKB 1NMAL 4P48A 2EXYC 4I1NB 4N8CH 2JJTC 4ZODA 1KIQA 3GI8H 4NRZB 4HXBL 1DANU 4PJIE 4LEOA 3L3OA 2J3SA 1A6WL 5J1AB 2Q86A 1PFCA 1P7KA 1T1YA 2VXUL 2V2XB 1FNGB 3ZL4H 5ERWB 1I8KA 4MQXC 4A2MA 3H0TB 1KT2A 2UWEB 1CFTA 1NGWB 1AHWB 4PLOB 4U1IB 2R9HD 1K8IA 3IAPA 5BZDA 1H3TA 3FL7A 3L5JA 3WLBA 5GHWH 4KJPD 3MRHB 1ONQA 1TNNA 1WWCA 4OKVA 2DLTA 2NY3B 2P24A 3PWJA 5EO1B 3TYFB 4Z95L 3MACH 1XIWA 2JIXB 2FJFB 3CX2A 4N68A 2EICA 4N8VB 5GGTL 4CAGA 3O0RH 5C0AD 2R1WB 1ORQA 3AB0C 3QDMA 4EOWL 2PXYA 1BM3L 3QIWD 4XAKE 4FZEL 1CLYL 3NA4A 2BNUA 1B2WL 1P4BH 3VRIA 5DURD 2VQ1B 1LO3H 4MXWH 1UACL 4JO3H 4Z8FH 4PPTA 4MNQD 1YEFH 5KANG 1MCKA 1A9BA 4X7SH 2JJTA 4M1GH 1KXTB 2Z8RA 4PY8J 2B2XH 4I77H 3ARDC 4J7RA 1F2QA 2ZOLB 4PRDA 3U0TA 5FUCC 3O3DB 2FGZA 1N0XL 3V4UH 2V2WA 3VA6A 3GHBL 2P5WA 3LZFH 4MA1C 3Q5OA 1X6LA 3GBNL 1ZAGA 3R0MA 5HDBE 2GJ6E 3NPZB 1L7TH 2FX9H 4WV1C 1DQJB 4JPIA 4PY7B 3OR6B 3H7BB 4YNYB 5FYKL 2COQA 2HKFH 3VWKC 4ZFZA 1IMHC 3P4NA 2KPNA 4UI2A 3B3IB 1YN6B 1XGTB 3P4MB 3U36A 5I75C 4LIQE 4M1CC 4XBPB 4HIJB 4PJXE 5E2WL 1QBAA 1VFAB 1FFOB 2CKBA 2W9DH 3KPSE 3L3GA 3MPCA 5DUPH 5J12B 4P0DA 3TH3T 4ODWB 4YDVA 4Z5RA 3M1BB 1Q9WB 4HFUH 4EQ2A 1AHWC 4UTAH 1QA9B 1Y6NR 1J12A 3PWUB 1XGUA 5KJRL 1IC4L 5CSZB 5F7DB 3ISWA 3OHXB 4YJZL 3QDMD 4OGAD 3U4BH 4OZHF 3UZQA 3DV4B 1YECH 4LVOC 5DK3A 2MKLC 2OP4L 3FOLB 1DBAL 5EZJB 3ARDA 2XWJA 2DS4A 2I07B 3K8KA 1JGLH 3MLUH 2A6KA 5F6IB 1RZKH 3G04A 1TFHA 2EXYD 2X4TA 4PYGA 2FYYA 5B39G 5IR1B 2F53B 5GJSL 4UIKL 3STLB 4L3EB 3CFCL 4HWEL 1YA5A 2ZUUA 2P5WD 4WV1A 5E7BA 4PJGA 4KZDH 3MRPA 3EYUL 1TJGH 5D7IE 2R2BB 3LS4L 4MQXD 4ZSOE 4OF5A 3VWKA 4DJMA 4WFGD 4R4FL 3VXTB 3SDXB 4QF1B 4NRZA 3SE9L 4OF8A 1NBZA 3BHBB 5EUOF 4ZYKB 5FOBB 5IQ7H 5GGUA 3K8LA 1DTUA 5J1AA 4U1SA 2DQEL 5IT2L 2BSRB 2FGWH 4K9EL 2V2XA 1FNGA 2UVFA 1TJIL 5ERWA 3H0TA 3D69B 1II4E 3FMGL 2UWEA 3SDDD 1NGWA 1AHWA 3QH3B 4AQ1B 3T0EC 4U1IA 1Q94B 1Z6JT 1JIBA 1XR8B 1I3GL 1L4IA 5EPMB 4ODTL 5IMLB 1OGTB 1EXUB 1RUAH 3MRHA 4QWWC 1MFEL 5EO1A 3TYFA 1N6QL 2B4CL 2DICA 2FJFA 3B2VH 4N8VA 5J12C 2R1WA 3MOAH 4JPWL 3UYRH 3G6DH 1C7SA 1X5FA 4IDJH 4EXPX 2VZ1A 3AFLA 3C9NB 5F1IB 1JPGB 1PYWB 2OJZH 4JY5H 2YRPA 3SGKC 1W72B 2G60L 3QDGB 4XMPH 4NKIL 1VPOL 1IBGL 4JKPL 5B21A 4F3FA 2ZOLA 4AMKL 3ARSA 1HINH 1NCNA 3VWKD 1DFBL 1UYWL 4M7LH 3QWRA 1INDL 1P2CA 1WF5A 3WFEL 3DO7B 4XMKL 4HK0B 2XZAH 5DGRA 4RIRB 4UU9B 3EOAA 3D9AH 2X9XA 1YNLL 5D1ZB 7FABH 1A6AA 1GHFL 3T0EA 3KYAA 1F4YL 3SKOB 2IPTL 4NZJA 3MFFB 1EZVX 5IMKB 4PY7A 3OR6A 1TXKA 3H7BA 1AC6A 4YNYA 4RMWA 4LU5H 4OM1H 1VKXB 4AIXA 2VXQL 3WIIH 2WBWB 1FFNB 5LCVL 1K6QH 1AR2A 5E8OB 3U0PB 2MWCA 3B3IA 2CKBH 3P4MA 5GJTL 4QTIL 3E0GA 4XBPA 4HIJA 1WITA 3LVEA 1Q72L 1FFOA 1PKQE 2NY3D 2QKIB 5BVPL 3T4YB 4X6DE 4PJ7E 2WP3O 3M1BA 4OD3H 1KJ2B 3F65A 2JIXD 1Q9WA 2F19L 1CXEA 3PWUA 2XZCL 3WKMH 3EDKA 3UBXG 5F7DA 4OZGE 2CGRH 3SGKA 3PNWB 4OCXL 4DUXA 5GGSY 3DV4A 4HLZH 2ZNXA 5EZJA 3F7QA 4HX1B 4GQ9L 4KTEL 1KIPB 1MFBH 3WFDH 4KI5C 3KPRB 5T1DH 2R2EB 4FQ2H 1EAPB 2I07A 3G6JE 4X5XB 1TZHB 5TQ2L 3VD7A 2W92A 2JB5L 1BWMA 2Y23A 5MI0B 5IR1A 2F53A 4YH6A 2DIJA 3STLA 3D85B 2EC9U 4KKBC 3CIQA 4L3EA 1A6UL 1OOAA 5DRNB 1RIVL 5FA4A 2V9QA 3QWRD 1QFUL 5JHLH 2ATPB 1NANH 3GMOB 4KDWA 2R2BA 2WUCL 3NCYS 1ZHBB 4YXHL 1CDHA 4PR5B 4X4YB 2GTZB 1CDUA 3SDXA 3VXTA 5JQ6H 5F1SA 4QF1A 3R8QA 2HWZL 1NCDL 3G5VA 3V5KB 4S1DC 3BHBA 4ZYKA 5GSRB 5IW1B 5FOBA 1KCUL 4QWWD 3V0VB 15C8H 2BP3A 1N5AB 2BSRA 3OXSB 3MRBB 3IGAB 1KPVB 4YHNB 4Y16B 5FAAA 1LP9E 3D69A 1CE1H 2O61A 1FORH 1F3JB 1Q94A 3LDBB 5GZNC 4PJAB 3E8UH 2GW5A 4ZFGL 1XR8A 5TF1L 1T1XB 5EPMA 3T2NH 4IRSB 5IMLA 1OGTA 2XFXB 1EXUA 1MRFH 2B1HH 3U7WL 1F4XL 1AQKL 4HCRL 2ZSWB 4I8DA 5C0IA 4LAJH 2Y9RT 3K2UH 5FHAL 1D6EB 2QHRH 3C9NA 5F1IA 1JPGA 2F53D 1PYWA 4H1LA 1BQHB 3MXWH 1W72A 2ZUXA 4F9LC 4DAGH 1IM9A 3ULVC 2KUTA 2DMKA 2ZCLH 1WWWX 3I84A 3GIZL 5D2NE 4PJFE 1JZ2A 5A2LH 2N1KA 1OF2B 1MHCB 3DO7A 5C0RH 5MI0C 2XTJE 4N0UB 3QUML 4RIRA 2HH0H 4UU9A 5GRVL 4ELME 4GXVL 4PLKC 4AL8H 1LILA 1I9IH 4N90D 2AABL 3SKOA 2R29L 3MFFA 5DRXB 1MNUL 2GUOB 1SYVB 1GGTA 3BKJH 3TV3H 5IHZB 1JHKL 3F7YB 1FFNA 2YRZA 3KWWA 5E8OA 3U0PA 1JPFB 1A6TA 3GBLA 3AM8C 4WW1A 4QXUL 3BN9C 3QCTH 1T0MB 3ZTNL 3I6LE 5ID1B 2QKIA 4XP6L 3GM8A 1DBML 3T4YA 1TIUA 3GM0A 3O9WB 1KJ2A 5HGGS 1I9RL 1F4WL 4H8WL 4YEEA 5HXMA 1PVHA 3LDBC 1ZK9A 4TOYH 1HHHB 4X6EB 1C5DB 4IRSC 4KKBD 4MLIA 1BZ7B 4F9LA 1R0AL 4CADB 3SJVE 5TDNA 4KROB 1KIPA 3KPRA 3V79C 2R2EA 4GFTB 3QRGL 4PBXA 1EAPA 4PUBH 4X5XA 1T1ZA 1TZGH 1TZHA 3UCRA 4GKSB 5IB5B 1EA9C 3KHOA 4RA3A 4OCSL 3B9VA 5IB3B 1I3UA 3QDGD 5FUOH 2J4WL 1A7NH 3RUGE 4CN6A 5CBEB 3D39B 4ZS6D 3D85A 5FFLA 3OJDB 4EXKA 4S1DD 4UINH 1B6UA 1YPZA 5DRNA 1CLOH 4K3DH 3OG4B 2ATPA 5HBBA 4KZEL 4L29B 3VFWB 3GMOA 1GC1L 3A6CH 4UB0L 1ZHBA 3F62A 5D1ZD 4CVXB 4PR5A 4KMQA 5D7JD 4EUPB 4X4YA 4M5YH 1SBBA 2F5AL 3AM8A 5HGDB 2Q76A 4NZRL 4WI2A 3V5KA 3WNKA 5HYSG 5GSRA 1FAIL 3V0VA 1N5AA 5TE7L 4P2QE 5KSVB 4LSSH 3MCLH 3MRBA 3OXSA 4NHCL 1AGFA 5JR1L 1KPVA 4YHNA 4GRMB 2EEBA 3SOBH 4IEFB 2OXHA 1OCWL 4NQEE 1F3JA 1KCSL 3S3JA 5D70H 4Y7MA 1WQVT 1T1XA 4NM8L 4IRSA 4XPFL 2XFXA 4AH2A 1PZ5B 3H3KA 4HWZA 2E8YA 3E3QE 1H3PL 2MPAH 1SEQH 3RQ3A 5CJQL 2ZSWA 2VLKB 2G5BB 3L5XH 1T83C 1Z9SA 3ULVD 4YC2B 3VG9C 4ODSL 5CEZD 4GXUN 4LQFH 2BVTA 4APQB 1ORSB 3KPRD 1KYOJ 1UH3A 4LLAA 1XH3A 4HUKB 2UUDH 2PUQT 2C3XA 2DOCA 3GGWB 1G7JB 2H9GB 3AAZB 2VDNH 3IU4H 4AEEA 1BQHA 1FZJB 4WTWA 1A7PH 3D85D 5IVNA 1RJCA 5CIPB 4XNQB 5AYUH 4KROC 2R69H 4OLZH 1RIUH 1I1FB 4L8CB 4RISH 2Q7NA 4NRYA 4OCWH 2WP3T 1MHCA 1YEDB 1PJ9A 5IG7B 3S88H 2EIZB 2ZPKL 4N0UA 4XVJH 4PFEA 3HI5L 3V52L 3SHSA 1RIHH 4DZ8B 1U8KB 4OLUH 3V6OC 2GY5A 1CD9B 3NMEA 5DRXA 4YZFF 4KXZI 4XC1L 1SYVA 4Y2DB 4Y16D 5IHZA 3F7YA 5LAXB 5INDB 1RZFL 2FIRT 3QG7L 2FIKB 1RFDL 4FTVB 3GO1H 3OAZH 4K94L 5BW7C 4IRSD 1DE4B 2AJVH 2HFEA 1M1SA 1T83A 4XHJD 1T0MA 1EO8L 5ID1A 5E08L 3BGFB 5D2LE 5D5MB 4LEXL 3O9WA 1TITA 3WHE1 5IK3B 1DEEA 3RNQB 3VDCA 5T1LA 5IOPB 2IALA 4BFGA 2LTQB 3EOBB 4FP8L 2VH5L 1H8OA 1HHHA 2X1XR 4X6EA 1C5DA 1BBDH 4FZ8L 1CG9B 1BZ7A 4KKNA 1I8IB 4CADA 2AERT 3O6ML 4JHWL 1PGRB 4IJ3C 2JJUA 4NJAH 3JVGC 3GSVB 1P6FA 4M6MH 2GJJA 5I9QB 1P6AB 5FUZL 5IB3A 1KC5L 4APQC 1A8JH 4NDMB 2DLGA 2FD6H 2XA3A 3OJDA 1FBIL 4HKXB 2NTSP 2YSSB 3V6OA 1SJVA 3S3SA 4K9EC 1CT8B 4L29A 1ZHKB 4JVWA 4ZG1A 5C08B 5IKCB 4LPYA 3D0LB 1R3IL 5LXGH 4XNXH 4CVXA 1RSFA 4NM4L 4EUPA 5EOCH 1CDCA 3GSUA 5BV7B 1QP1A 2J8UA 1PKOA 1WTGT 5BW7A 3RWCB 4DN4H 1WAAF 1WIUA 4X4ME 5KSVA 1XR9A 4ZUSB 4CRPA 3HA0A 2ORBL 2QQNH 1BGXH 3UTSA 2ESVB 2R0ZL 1BQLH 2UUDK 3RU8H 4QHLA 3LEYH 3S9DB 4IOFC 5FCUH 3MJGX 3SCMB 4YHIB 4D3CH 3O9WD 4Y2DC 4JPVL 1PZ5A 1L9NA 3WNOA 4YDLB 1NMAH 3JVGA 4LSRH 3NIGE 2Z91B 3BDYL 2VDKL 2VTFA 3P30H 1SYSA 2VLKA 4HXBH 2G5BA 4JRXE 3ROLA 5FCSH 1A6WH 4OSUL 4PS4H 5JW4M 3DRTB 4APQA 4KROD 1BIIB 1ORSA 3BGFC 5CLTA 2SEBB 2VXUH 4JFHE 2H45A 2VZTA 3VXSE 2V5RA 3GGWA 1A7RH 2Z8SA 2LTQC 1G7JA 2H9GA 3AAZA 4NN7B 4HV8B 4G9DB 3CAFA 1FZJA 3D39D 4IIQB 4N0RA 4XNQA 1A0QL 4LFHG 4QOKE 4L8CA 3S96B 4Z95H 4ONFL 4B53A 5C2BL 4GRWH 1YEDA 3UTPE 5IG7A 2Z8WC 3UYPA 5GGTH 2W65B 4XXCC 5KVEL 1JZ3A 3JV5A 3FB5B 4DZ8A 3IS0X 1MQ8A 3BO8A 2ARJB 2BK8A 4EOWH 3FFDB 4X9FA 4FZEH 3KLDA 5JNYB 4ZFOB 4Y2DA 1UACH 35C8L 5LAXA 1NPUA 3VFOB 2FIKA 5BV7C 4ISVB 1DE4A 1JNHB 4X7DC 1F4HA 1JTOA 4L5FL 1CYGA 1N0XH 2DDQL 3U1SL 3P40A 3GHBH 1UZ8B 3EZ8A 5IK3A 4Q2ZB 3GBNH 2VLKD 1IGIL 5IOPA 3FCTA 4Z9KB 3I75A 4APQD 3QUMB 3SDAB 4NGHL 3SCMC 2Y07L 1B0GA 1CG9A 3K81A 2RB8A 1I8IA 4XTRD 5FYKH 2YC1B