3EJYD

Structure of e203h mutant of e.coli cl-/h+ antiporter, clc-ec1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/proton transport
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyD01
4OZFG 4Y7MA 3WO3B 5GHWH 3WHE1 3LH2H 4PJFA 2BVOA 2Z8VC 4GXUN 2HN7B 4P2CG 4OUUB 2OR8A 5IBUG 3FQWA 1OF2B 4JANA 4YHOL 4E0RB 4GQ9H 2ED9A 4XP1H 1S78D 4KHTL 4YHZH 4XPGH 3QQ3B 4ZOEA 3UJTH 3VXRE 2D9QB 1C16B 3HFML 4PJCB 4L3CB 5F1KC 1RZKH 3QXDB 3TIDA 3SDAA 3VWJC 3BE1H 1G9MH 2ZUXA 3QCUH 4RCAA 4HWEH 4GRWH 4JRYA 1GXEA 3TNMA 4XNXH 1AKJD 1EBPA 1W0VB 4BFIB 1AQDA 1EO7A 3N1PC 5CSGA 2YS4A 1U8OA 5LGHL 1OLLA 2VLJE 1TZGL 4HXAL 4XH2A 2AXHA 4Q74A 4Q6IA 1MCOL 5I8KH 1UGNA 3H9SE 3EFFA 1YC7A 4UZGA 1QFPA 1VGKB 4NQCA 2G60L 3D1MC 1IAIH 4XXCA 1NPUA 1TVHB 5DEZA 2IBGA 4Z95L 5MI0C 5HYSB 1AXSA 4LLMA 5IOPB 1FZKB 5GSRA 3D3VE 5D5MF 1CICB 4GFTB 3REWB 2UUDK 2D7TL 4WDIA 5D72L 4CDGC 3NA9H 1JWSB 1P7QB 4LLDB 1VHPA 3EOTL 2MFNA 1KG0A 3QXAB 1U8JB 4UT7H 4ZUUA 5GGSA 4Y2DC 1NL0H 3W11D 5DUBA 1UB6A 1JGUH 3QUZA 4L4JA 2H8PB 3O6KL 3WS6A 4XNYH 4HS3A 4O2EA 3BZ4B 4JDVB 5L6YL 4ZFZB 4XX1G 5DHXB 4S0SD 4P2YA 1OQOA 1KJMB 3X12B 3EGSB 3IFOA 3SQOH 4NQVA 5IVOA 4OLXH 1EEQA 4K3JH 3TO4D 1M6OB 3CVHL 3UBXA 3O2VL 4OT1H 1LO3H 4NPYA 1ZT7A 4ZFOA 1DCLA 3ZTJG 1NGYB 1OAZL 1QFWM 1E6JH 4FQXD 5IQ7L 3DYMA 2QADD 5KZCD 5FO9B 3HRZA 1T2XA 2O5XH 4YUEL 1MCRA 3L3IA 1T5XA 3TZVB 2Y72A 5E1HB 5E08H 1OCWL 3LRSB 4ZXBC 1E28A 5TPWH 2FYYA 4PS4L 1SYVB 2OMNA 3U82B 2XFXA 1NGPL 3WIHA 1T0PB 3SE3A 2ENYA 4J8RA 5BO1H 2FX9H 3DX9B 4LSTL 4O9HH 4XAWL 2NYYD 1WCBB 4NJAH 1RAMA 4E41D 3T0XA 1N59B 5LCVL 2GT9A 35C8H 4NZTH 4L3EB 4HXBH 2YRPA 3EYQC 1IAMA 3DRTA 4NCC1 3HE7D 4K23L 5I1DA 4DQOL 3V6ZB 1I9RH 4H88H 2AXFB 4IRJD 3D69B 3R1GL 4JVWA 1MUJB 2A9ML 1RZKC 4G9DB 3W39B 1K8IB 2YRZA 5F44A 1C5CH 3MLXL 12E8H 4U1KB 3OB0K 1VEMA 1S7TB 3T3MF 2JIXD 1DQJA 5HY9B 1HCVA 1MIMH 1RUPL 4JB9H 4FQ1H 4TOYL 5IHZB 1B6DA 3L6FA 3ULUD 4JFFB 3GSQA 2M26A 4NWUL 5ID0B 2Y23A 2FJFB 3A6CH 4YHPA 5E5MA 4OM0L 4Z9KB 4L4TB 3BZEB 4LPTA 3FTGA 2XXCB 2R23A 1W0WB 3DXAB 1P4LA 3RRQA 2Z8SA 1EHAA 1MCWM 2IAMA 4QOKE 5E00A 1E4KA 4QRUB 5F9DC 4EDXA 5IWLC 1MFBH 3DJ9A 2E7LA 5HGHA 3CFKB 3LN4B 1KBGH 2YMXH 3PQYB 3KXFA 4ZQKB 5EZLB 2Y9RT 4FMKA 2FGWH 4LDLB 4URTB 2ZUTA 3WUWG 3WIHL 3CSYA 1W8NA 3TWCL 3D6GA 4WHYG 4AYFA 3SY0B 1U8IB 3S88H 2GJ6B 4RX4A 3N0PB 3QQ9C 5IK3A 3A67H 4MAUH 4YX2L 3BSZH 4QHNA 1CFSB 2D7QA 5E9DE 2AJSL 2WUCL 1HQRB 3QIUA 5D1QB 3HI1A 3UTTD 1SJXA 5KSVA 2C3HA 3S36L 1XF3A 5GGVY 4GSDL 4ZNCD 2DD8H 3BUYA 2GJZA 2AEPH 2WUBL 1AO7D 1U2HA 5DFWH 1JZ4A 2EDKA 2B1AH 3UEZA 2BNRE 1HHIB 5I17A 4U7KA 5DMGD 5KSUA 1G1YA 1KN4H 3STLB 4BQ9A 2AAVA 3RZCA 4HX1A 4TULH 4POYA 3ZYZA 3IJYA 1KTDB 1AXIB 1FFOA 4Z7UA 2QTEA 2MQCA 4NQSA 4PJ5A 5IIEA 3BP5B 3W9DB 1ITBB 3DX6B 3EYFB 2V17H 3TT1H 2AV7A 4OF6A 1MFAL 3MNVB 3OX8A 3ZSSA 5CMAA 2IMNA 5JMOC 4B5EA 4FS0A 5IBTH 3F7RA 4XP5H 5E2UL 5DLMH 4ELKB 3NAAL 4FFYL 3TCLA 1I1AA 3NIDF 4X83A 4Y1AA 3T0EE 1F3DJ 4PRHB 1CQKA 3NCYS 1PX3A 4WW1A 3SJVB 3VGAB 4PJDA 1OSPH 2X89D 4NKIL 1A1OA 1A1MA 5JHDA 3QDMD 3GI9H 4UV7L 1GSMA 1A47A 4MJID 5D71H 3WKML 1RK1A 3Q5YA 4MA7H 4GJTB 1K5NB 1BM3H 1XCQA 4NKDB 1A7BA 5DD5L 2NZ9C 3P30L 4O51B 2OP4L 4UILL 1I7RA 2DI8A 2OBGA 5ANMA 4ODTL 1HWHB 4ZFFB 4X0KB 3WFEH 1FFNA 1HSAA 4K9EH 2DQEL 4FQHA 4MA1B 5C0FA 4K7PY 4HFUL 4X6BB 1CDBA 1UM4H 2FH8A 3D0LA 2G75B 1SM3H 1G7PB 2QQLL 4JFXA 4BQ8A 1YMME 3LQZB 5M7QA 3BXNA 3GZKA 1YJDL 4EN3A 4YDJA 3QEUB 5F7WC 4EQ3A 4ZD3L 4XXDB 1Q94A 1RIUH 2XN9D 3QISA 4OFKA 3PWNA 4LASL 3P4MB 2YRLA 4RWYH 4OBRA 1IAKB 4Z7VF 1UXSA 2RJMA 1T21B 1KCVH 3T0EC 4H20L 4JLRA 5KS9E 1SHMA 5E8DH 1T0MA 3KPLB 2GUOA 3DURB 2EDHA 4QHLB 1A1NA 5EU6E 5A2JH 1W72L 1U8MB 4PJ8B 5CKGA 4I3SL 3MRLA 4HMCA 3TVMA 1YQVL 4N1EA 3SDXA 4LARL 3CSPA 5SWZD 1JHLH 5LBSH 3BVNB 1H3VA 1LEKB 4Z6AT 5I2IA 1LEGA 4HWNA 1F11B 2BFVL 4PJ7B 1A6AB 4EI5A 5FUZH 4NO0B 4EI6B 2H32B 4C83B 4EVNB 3HE6B 3IDXL 5DHYA 3D85B 3PABB 2R8SH 5CP3A 5BS0A 2NTFA 4OM1L 1BFTA 4I2XA 4RGMB 4PJ9B 4OD2A 2BRRL 3RVVC 3S7GA 5MEPB 1KNOB 4XNQB 3F7YB 4CMMB 3FFDA 2NLJB 3DTXB 3VFSA 4PP1D 4FQCH 1EUUA 4N9GB 1HIML 3SGJC 3FB7A 4JY6B 1QOKA 4HC1A 2A83B 5I1JH 4WFFD 3V0VA 2OI9B 3UTSA 3NGBB 5E8OA 2JKXA 2EIZB 4HV8B 3WXWL 4U1HB 5CD3B 2CMRH 2FLBT 4NQXB 3HNTL 3KYOA 1T7XA 2X9WA 4I77L 4IHOA 2VSDA 3WJJA 1C5DA 2AXGA 1GHFL 1AD9A 4KTDL 3OKNB 5C07B 3L5JA 3HC3L 4PREA 1RZ7H 5T1LD 1IEBA 3ZE0E 4F7PB 1NEUA 1RUAH 2XPGA 5DJYA 5EOCL 1RZGB 4GKOA 3W0WB 3QG7L 5L2KE 1SY6H 4OCNC 4HWZB 3E2HC 2XWJA 4F37K 2VL5B 4LLQA 3BN3B 4FTVA 5IGXL 5CBEB 2ZP0T 3O2DH 2CK0H 4P9ML 5D6DC 5KG9B 2UY6A 3AFLA 5JW5A 5D7IB 2MCG1 4NT6B 5C6TL 3WV0A 1RUKL 5GISL 1FL6A 3B2UC 2FH6A 5ICYB 5HYJD 4OV6F 1GGBL 1UWGH 4WW2F 1XEDA 1V3JA 3FQUB 1TETH 3ABZA 2NTSP 5FGBA 1U91B 4YZFF 5DUML 1NLBH 3DYOA 1QRNA 5BXFA 3QUKB 3TA3D 2P5WA 2UWEB 4KRPB 3DX7A 4OLZH 1KJ2H 3KR3H 3IFNH 3OJMB 4PLOB 1FDLL 3MO1B 2XI9A 1OGAB 4POUB 5D2LE 4BH8A 3VFGL 1YC8A 4JPVH 5C09E 2DQFB 2XIDA 4ONOA 3TJHC 4GAGL 3D39A 3MLSH 3BWAB 5F8QC 3L3JB 4NRXB 4M5YH 4WU7A 3DARA 4ERSH 2DM4A 1BVKA 2CLRA 2DJUA 4H1LG 3IFPB 1OM3H 5HHQB 1O0VA 3QO0A 3RWHA 5F7NC 1FZOA 4HPYH 2VE6A 2B2XL 4P2RA 5IB3A 5D7SH 3MRBB 1NGWB 4AQ1B 3RHWF 2W60A 4HUVB 3L7FA 1DLHA 4JJ5A 1R3KB 1WCQA 2ZCKH 3UYRH 2FJHB 5DXWA 4M1DH 5KN5A 5IV2B 1NGZA 3C5JB 3FRPG 3GSVA 3K46A 3L5IA 2GJJA 1JUFA 3KPSA 5T5FH 4JFED 2AK4A 3MLVH 3Q3GB 4FQPA 2VXQL 1KF9B 2Z91B 5E4EB 3O0RH 5EB9A 3QXUA 1KIQB 1W0YT 2R1XA 2HKFL 3L3HB 5GGUA 5FYJH 4WVRA 2P5EA 4UT6H 1JCKA 4CW1A 4NN5C 5DMIL 3LS5L 4WU5A 1DBBL 4HULB 1UACL 2IALA 5AUMA 3BKMH 3RKDD 4YPGB 4DVRL 4R2GB 3VXRD 2R2EB 3MNZA 4JAMB 4LPCA 1U2CA 1WUNT 5I75B 3BT2L 3MRDA 4RMRA 4PJEF 4HS6A 3VFOA 1MQKH 3OJVC 4PGCB 3E6HA 1QR1A 2Q7NA 2HLFC 4PJXB 4E5XB 1WISA 3VWKC 5T1KB 1QFUH 3QDGD 4OJFH 3ROLA 5B3JE 8FABB 2BERA 2QQNL 3VXQA 3BAEL 2NY3B 1JN6B 1RIVH 3AS0A 1A7PL 1A6WL 2R4RL 1HDMA 1IQDB 1FNEA 4X6EA 3RVUD 1JP5A 4KQ3L 3M1BB 3QRFM 3KPRB 3GB7B 4M5ZL 1WWWX 4ZXBD 2WMPA 3O2WH 1EHXA 2VDNL 1ZGLB 4S11A 4XC3H 1U58B 1U42A 5EWIL 4HW6A 2F58L 4Z7QE 3ARDC 3SDYL 5C0DB 1A7QH 3D0VA 2XRAL 2PXYD 1ZT4A 2DKSA 3L1OL 4KDWA 4MSWB 4LRNH 5EA0H 3EYQD 4MZ2A 2D0GA 1Y6NR 5INDB 2Y36H 5CJOH 3WJLC 4QT5B 1MCBA 1FNHA 1N3NA 1NAKH 2VLKE 3RJQB 4BM7A 2KPNA 1IGFH 3MBEA 4UDTB 4ENEC 5KVFL 5LXGH 4NQED 1ORQA 5DWUL 4HIXH 2G9HA 5C8JA 2X7LA 1ETZB 5CHNA 2Q86A 3DBXA 5EOTB 3RQ3A 2BY1A 5SV3A 4N0FA 4HUWB 3VWJB 5JO5A 1GIGH 2J4WL 1OHQA 3BP4B 4L3AA 1K9TA 1DSFL 4OI8A 3LN9A 1UZ8B 1U92B 2VZ3A 5F6IC 1UEMA 3HUJB 3I2CL 4WUUB 1G7LB 3WHE0 4HQQL 4NCC2 5D7KD 1TTGA 3MLRL 4N0YH 1TXKA 2WANA 1F45A 4EQ2A 1XGRB 5MHSE 1HQ4B 4HUUA 4I5BA 3C2SA 2DQIH 1U0QA 1IEAB 2HT4C 1DE4B 3ARBD 5I73C 2ZUVA 5MI0B 4K7PH 2BMKB 3F12A 4PJIA 2WAHA 4Z7OF 1H3WM 4G8EB 4X9HA 3X13A 4GW1B 4KUCD 1JMZA 3QQ9D 4M7LL 4RFNC 1QSFD 2X05A 3QFJA 1J1XL 1CXLA 1B3JA 3SDAC 5D7JA 2C7UB 4N5EC 3BESR 4LU5L 4Y4KD 4Y2DB 3S5LB 2NY1D 5E6ID 4WENB 4P2QE 3EYVB 1D5ZB 3WO4B 4C4KT 1HILA 1DBML 3V4UL 5JOFA 2VXUL 3GMRA 2YR3A 3G6AB 4JPKH 1FGVH 3ARFA 4LIQH 1WC7A 1NCBL 4M6NH 4Q6IC 3IF1A 2OQJA 3QIWD 5I1KL 1EUTA 4MQ7B 1A9BB 4X6FA 3T1FB 4TUKL 2EICA 2VLJB 3DROB 3FFCE 4XXCC 4KMTL 4B7LA 2HKHL 2EDYA 1JNNH 3H9SB 1OWRM 1IGCL 2VXVH 2FSEB 5T3XH 4KDTA 3L3OB 2H1PL 4LCYA 1D7FA 4MDJA 3FT3B 5J9PB 4XHJC 4OD1H 1RUQH 2LU4A 3V5HA 3DVGA 3O3DA 3ULVH 5H35B 3ECBA 3HS0B 4O02H 2FR4B 1F13A 3D3VB 3MROA 4M1CD 4BFEA 1JPSH 3RFZC 3DMMA 1L0QA 1WZ1L 3RHWK 3QUZC 1G7JA 1NGXB 1U95B 3WS6C 5CEXA 3WL9A 3P4NA 1MWAH 2IADA 3QCTH 3TYFA 3DGGB 2A77H 2AEQH 3BHBA 3CDGA 5FA3B 4ZOBA 2OJEB 2NZ9D 5BZWB 1OARH 4NRYA 4KMQA 1IEHA 4OLYL 3F58H 4LF3B 4G8FA 4QYOA 1EJOH 2I25N 3B83A 2DMBA 3MV8D 4JREB 5BZDB 3O6LL 4XRCA 1BMGA 5HI3D 3MA7A 4HKZB 5EC2A 1SYSB 1E27A 1U8NB 3BDYH 5C0RH 1CD8A 3HHRB 1A7OL 4QHKI 3ZKND 5HGDA 1FVEA 2P47B 5I1HH 5ECJE 4WGWB 3SKMA 3G5VB 4M3KB 3SE3C 3V52L 4LHQB 3KXFE 4QHUA 4HWUA 2OL3A 1EFQA 1UXWA 2YD3A 5FKPA 2VN4A 3JV6B 3L3KA 4YWGL 3MOQA 1T03H 4W68A 5FGRA 5IVZA 4G8GD 3V4PH 4ZPTA 3VXPA 4OFPA 1AR2A 5HHOD 1L7TH 3UJJL 2VDQH 1HEZB 3J8F7 5IVXE 1BP3B 2C9AA 3AVEA 3ORJA 3X3GL 3LEVH 4Y4FB 5T5NF 3L5WA 3RZWA 3OR6B 4FQ2L 3PDOB 5IFHL 2VABA 3NTCH 2EDBA 3ETBF 3BMWA 2XZCH 3OGCB 4XHQA 1VPOH 5IMLB 1YECL 1RUMH 4DUVA 4MJ6A 5FECB 4XMPH 5JORA 4FFWC 3GMLB 4ZMAT 2V2TB 1I3RB 5F7DA 3RU8L 4P46A 4Q9QH 4Z7UE 3MLTB 4QTHA 1QLRA 2P8LB 5GS1A 2IAMC 2B4CL 4PJ5E 1CD1A 3C08H 1E4KC 5DRWA 4LEOA 3PL6D 3GSUA 1JJUA 1S7QA 4LKXB 1H3UA 1F8TL 2J8UF 1C8PA 3U0TB 4NKQB 2K1MA 3G6JF 1LEIA 2Y07L 5BCAA 1HINL 5JA9A 5FDYA 2VDKH 3QHTC 4QOKB 1J8HE 4X7TB 2YD1A 3QEGH 2X70B 4Y16D 1Q0XL 4Y1AE 4N8CL 2AV1A 2QEJA 3IS1X 3WFDH 2W9EH 4PJDE 1EPFA 1TZIA 1JE6A 3NABH 3NIDE 5JHDE 2V2WA 2GTWB 4FZ8L 4RA3A 4A6YH 3QIUC 3N06B 5HPMB 3OHXB 1TNNA 5K59E 4H8WH 3M17B 2V9RA 1GGCH 1YNLL 5E9DB 4PLKC 1T22A 4ZUTA 3GMOA 3QEQB 5ANME 2ZCHL 5KBNC 5EN2A 3OPZL 4Z7NF 3ZE2F 1CZ8L 2X4RA 5GGQL 1C12A 3BEWB 3MBXH 4MQXC 4P23D 4P49A 1YJDC 4X6DE 3RZCC 1SJEB 1EEYA 1XGYL 2LFGA 4LKCB 4Z0XA 1HYSD 1G84A 2BNRB 1KPRB 4G7YH 3RDTA 3VI4E 4WTZA 6CGTA 4QLRA 4WNQB 3RVXC 1DFBL 4G43A 1X6NA 3OAZK 1F4XL 2VKXA 1XGPB 1X4ZA 1NAML 2MTPA 5I8EA 4JDTL 4WEBL 4G6JL 4CNIB 4L9LB 5JHLH 1KENH 4MX7A 4RIRB 2NY6D 5HYSG 5JPNB 1JF1A 1MCFA 4HLZH 2FHCA 5FK9A 1X5YA 2YWYA 3SGEH 3U36A 4XNMB 1KB5A 5FCSH 4HC1H 5EO0B 1PVHA 3KG5A 1U8PB 3F7PC 4BELD 4PJAA 3MOAL 5D7LA 4KROC 3VFVB 3M8OL 3TN0A 3T0EB 4ZUVB 4OZGA 1CE6A 1EH9A 5CGYC 2Y06L 3MCKA 3HMWL 1BWMA 5BVPH 3BIBX 3SDXE 2NXZD 4BSWA 1F3JA 3DUUA 3PDDA 2WWMC 1CF8L 3O81A 4OFDA 2H9GB 1JMXA 2CKBL 1CD9B 3UJIL 4HWBA 3FB5A 2O61B 2YUXA 5GGRY 2YWZA 1ZHKB 4KKAD 4ONGH 5LWYH 3FMGH 4YHMH 2E27H 4UUJB 3ES6A 1V3KA 5BS0E 1N7ML 4DGYL 4QXTB 4I2XE 4EN3C 5C6WH 3RVTD 1TJIH 4OCXH 3VA2C 2PYFB 3MFFA 4WJ5B 1K2DA 1JNHB 3NIGF 1P2CB 5BMFL 3R06B 3LD8C 4MHHI 3BGFB 1YMMB 4JFZH 1FNAA 1A4KB 2DTMH 5E2TL 4CUCA 2AJYH 3QUYD 3RTQA 4XCEA 4QWWC 1Y0LB 5DD6B 1BECA 4PLJC 3S8WA 4GG6F 1T5WB 5I1CH 1DDHA 4NM8H 4F80A 2L4OA 1DUZA 2A74B 3SPVA 1EO8H 3UTOA 3S36X 3ZKXC 5JNYA 3MGAA 1KB5L 4MJ4A 5IB5A 3PIQB 5KS9B 4Y19D 4D8PB 2IH3A 3MGOA 4QEGA 2IPKB 3MV7A 3TVMC 4H8WC 1S7WA 2ZNXA 4R4BB 1PLGL 5JUEH 1R0AL 4LQFL 5EU6B 4YJZL 2BP3A 1XGUA 4NJ9L 5GRXG 5ITBL 1YEFL 2HG5B 3OKLB 3JXAA 1DN0A 3HR5B 1UB5A 4U1SA 2EYTB 4Y5XA 1I1CA 2R2HB 3K4DA 2VLRD 4EI5C 5I30H 3GJFB 1GZQB 4AENA 1H3XA 4F57H 2EDXA 1G6RB 4J4PC 3S3PA 2YUVA 1I1YA 2E7CA 2EKSB 2Z93B 1HOCB 3PHQA 4KC3B 3QG6B 4V1DA 1MJUL 2JB5H 1QBBA 5F1IA 2HVJB 2BSRA 32C2B 3IDGB 4AM0A 5CWSB 1KELH 4P5KB 2FJGA 1XIWA 3E2HB 2ADFH 4FQLH 1ZLSH 4IOIA 5CD5C 4IS6B 1OVZA 4J6RH 4G5ZL 4F7CA 2IBBA 1OT1A 1G9EA 4G6ML 4JFPA 3RNKB 4I13B 5EOQL 4LVEA 3FONB 1DZBA 1QQDA 4HFWB 3SDCD 4R4FL 4TTDC 3L5XH 4TUJB 2MCPH 3PGCB 3QUMB 2P5WE 3VGHA 1R3IL 1JGVL 3ESUF 4MLIA 3ARSA 3BH8B 4OF5A 2RB8A 4MWFA 4DAGL 5LKNA 1U93A 4ONFH 3Q6FA 3V5DA 3G9AB 2DQHH 2JCCF 3D39E 3VXUD 4NNYA 4ENED 5F1NA 2W0LA 4CVWA 2FHFA 4IDLA 1QUNA 1MCPH 4M3JA 4C58B 5E5UB 2OLDA 5DHVA 1NEZA 2DBLL 4OFYD 1LE5B 4Y2OA 2OZ4A 1HNGA 4XP9L 1KB9K 1HKLL 3NOIA 4S1SH 3BX7C 4MXVE 4N8VB 2BOCB 3OL2A 4YLQT 4XX1E 1N6UA 1AC6A 3ULSA 1TTFA 3VD4A 4M8QB 1R3HB 3CUPB 4QXWA 4WEMB 1QSVA 5L2KB 2CUIA 1WBXA 2Q6WA 1I7ZA 4OGYL 4EUPG 2GTZB 4DKEL 2G2RA 3KPSE 1FLTX 2VDRL 2AK4E 4LSUL 2YOCA 2GAZA 4QRTB 3TNNA 1CLZH 5FGBC 3GBLA 1EGJH 1NUNB 1UM5L 3SKJL 3UTPD 1YUHA 5FYJD 1JV5A 2P5EE 4XVJH 4QXUH 1Q9KB 3O9WD 1CFVH 1ONQA 3BEVB 3T4YB 4JHWH 4ZTPL 1X7QB 1BZ7B 3S37H 2W65A 1CD0A 4NGHL 1MEXL 4HUMB 4GW5A 1HWGB 2QLVB 1OGTB 5J4MA 3SDAD 4NN5B 1A2YB 5JIIA 3VH8A 4G8IB 5D2LB 4JRYD 4HJGA 5C09B 3U46A 3T65B 3VFTA 1NBVL 1FFPB 1DEEB 3GUTB 1E4XH 5CZVH 3S4SA 5B4MC 3BPCB 3TEUA 5FHBH 3NH7H 5DRXA 1H15B 1KT2A 4MVBD 4GBXB 1JPGB 1N64L 1BQHG 3S3SA 5I19H 1FN4B 4S1RL 1FZMB 2VR9A 4XP6L 5HYQA 1ZSDB 1NDMB 3VWKB 1CXEA 1TJHL 2X4NB 2L0DA 4ODXB 4UB0L 5FV2A 3JWDH 1MAML 1YMHA 2PYEE 1WAAF 2ZUUA 4X6CF 5F7LB 4NQCD 3TGXA 3F8UB 4BH7B 3WFCL 4NO2A 5E03A 25C8H 3RVWC 4ZAKD 4JM2F 1A3RH 1LGVA 2JJWA 4ODUB 5SX4I 4LPUA 1TITA 1U3YA 4BSVB 3WMSA 2R1WA 3MRFA 5C70A 3INUL 5AZEL 4I3GA 1HI6A 4LBEA 2XQYG 3IDMB 1OOAA 5HHXL 4LHUA 1MHHA 1Z5LA 2C4FU 3CD4A 5H37G 3SN6N 1RU9L 5LQBL 1KIUA 4FMFA 3L95A 3OG6B 3ARDB 3QRGL 3SDDA 1VENA 3MRGA 3GHBL 1GC1H 1Z3GL 4Y5YA 3OAUH 1GYAA 2D7NA 1U3HA 3MNWB 4XP4H 2PUQT 1AGEA 5DQDH 1XR9B 4OQTA 5CSZB 4N0UE 4ZO7A 2XACC 3MZTA 4L29B 4LEXH 4KPHL 4WHDA 2BXZA 5DEFA 5F7EL 5IEHA 1N8ZB 4WY7H 3EO1B 1F3DH 1A5FH 1FVDA 3GBML 4S2SA 4K94H 4OZ4A 1YN6B 3U2SB 1MJ8H 3Q1SL 3EOBA 1DL7H 4XTRC 1EXUA 2QHRL 4OZIF 3HAEH 2GCYB 4K3EL 4KJPD 1BFVH 4MS8D 3IU4H 5K9OA 4H25B 5I1AA 4P4KB 4OCSH 4ZFGH 1RPQA 3DRQA 1MRFL 1TDQA 4MB5A 2BNQD 2R1YA 2CK2A 4H0IA 3EHBC 5BRZE 4OLWL 3NN8A 2ATPA 1JYVA 3BGAA 4D0DA 3GMQB 5GS0H 3DVNB 3ARVA 1NLDL 1TCRB 4YO0B 4DWHA 2J8OA 5FKAA 1DN2A 1V7ML 4EZMA 1OP3K 1GAFH 2AJZB 3DUSA 4PJIE 4X8JB 5CZXC 3T0DA 5C3LD 1EHNA 2XWTB 4XC1H 2F53A 2VDML 3DV4A 4M93C 5EU4A 1FL5A 2APWA 3RAJL 2X4UB 1XH3B 3AUVA 3GHEH 2BVOB 3RWFB 5I73B 3MBEC 4PRNA 5L0QC 1NBQA 3FQWB 3LKPA 5A40E 4JANB 5FDWA 1SBBA 1QG3A 5IW3A 3K7UA 2D31A 1IL1A 2ZJSL 3KJ6L 3KNBB 5TFSH 2VLKB 1YNTA 5E99H 4CU7A 4HIIA 1JK8A 3CVHB 4TSCL 1DQML 4PJCF 2DQUH 4OQTL 1UA6L 4QRRE 1U8HB 5TF1L 3GJFH 4X4XA 2WIMA 5K9KA 1AQDB 1IQWL 5DC9B 4YHKH 4FFWD 4HAFA 4Z0BL 3GSXA 5GGTA 3JWDC 5JW3H 4L5FL 4O2CA 2W1NA 4XH2B 2IAMD 1TPXB 4Q6IB 5T1DH 3L3GA 5T3XD 3OKEB 4WHTA 3VXME 4P2OB 1NSNH 1JPFB 4R26H 1AGBB 1I8KA 3JVGA 1AJ7L 4LL9A 4QO1A 5DD0H 4XPHH 1T66C 5JDSB 2A38A 2ZCLL 1YA5A 4JO1L 3UBXI 3ULVD 4LLMB 3T08A 2F8XC 3GDBA 5TE4H 4DN3H 4MNQA 3QUMH 3RUGA 4RX4D 4WFGD 2WP3T 4WDIB 2BVQA 1NFIA 2B5IC 1IM3A 1IT9L 5E7FA 1FHGA 5D7JC 1IC7H 4Z7VA 4QRQA 5ICZB 3QIUD 3NCJL 4KI5E 5DUBB 4P0DA 1UB6B 3QUZB 3QJHB 4TPRL 2DYPA 5FYLH 1QBMH 4HK0A 3V6BR 4JFHD 1SEBA 3ARFC 3F5WA 4JO3H 1OAXH 5I8CA 3IFOB 4P2QB 4NQVB 3QSKB 3UBXB 4NBYB 3RZCD 3I6GB 1I8LA 4ACPA 3MACL 1WBZB 5HYFA 4YC2C 5DO2D 4F3FA 4YHYB 5CJXA 3QA3A 3WFHA 1GPOH 1O5DT 3TFKC 3NIFF 1AIFA 3EYSL 4PJ5D 7FABH 5IFAH 4L8DA 3VDBA 3ZYJA 2UUDH 2EXYC 5GGTL 1D9KB 4GG8A 4KDTC 1ZWIA 3HRZB 1V3MA 4YDVA 1ZVSB 2DQTL 3FFCB 2FX8L 3O3AB 1E28B 3LV3B 5DURD 2A6KA 3QFDA 5EZIL 3HI6H 4HUXA 5ALBH 1XF2A 1I1AD 4YXKL 4U1JA 3MV9E 1EFXB 5L8LB 4J8RB 5DMKB 3DMMC 3VGDA 2GFBA 2VAAA 3CMOL 3MRIA 5CFHA 4HG4K 1DQLH 2QR0A 5E5RB 1WFOA 3DRTB 4WUKL 1B0GB 1G7HA 5I1DB 4PD4J 1TQBC 3QDJB 3OXRA 3MRJA 4ZO8A 5E94B 2R4SL 4KI5C 4YIQB 2J88L 4BZ1H 2BNUB 3EO0A 1FYTA 2I26N 1QVOB 1DLFL 1LDPH 1KEGH 4NN6B 4XVUD 5IROC 5HXMA 2WWMD 4J12A 4NO3A 1DQJB 3GK8H 3ARTA 3ARGB 5JOPE 2B4CC 1I9EA 3AY4A 2XY1A 4HUKB 3L6FB 3LN5B 3ZE1F 3KJ4B 3GSQB 3AM8A 2RFXA 4YAQB 2D7PA 3OWEA 4YHPB 5E5MB 5HDQL 3CC5B 4ZO6A 1A6ZA 2RR3A 4OF7A 3FTGB 1VFUA 4NOBA 3LZFH 1RJZB 1J88A 1OP5K 5JLZA 2ZSWA 1ZLUH 2VYRE 2X2YA 2X4QB 1QNZH 1MCWW 3DVFA 4Q0XL 5GRUH 5D70H 4MXWH 2VXTL 3P40A 1X5XA 4GOSA 5JR1H 1KB9J 2J8UE 4JM4L 3V7AE 5HGHB 2JJUA 4PJHA 4PLJD 1MCQA 4WI6A 1F42A 3KXFB 3X11A 3UROR 2FB4L 1F6FB 4PRPE 4KU1A 5B21A 1BEYH 5TQ0H 3CSYB 1V5JA 5FUOH 1MH5B 4MXQC 3HPLB 2JB6A 1TNMA 3OR7A 5IK3B 2O26U 3ALXA 4OD3H 4QHNB 3TVMD 2XZAL 3I3EA 3JWOL 1DBKH 1CFTB 3W81A 3O4LE 4AL8L 5L88H 5DDHA 1KCSL 1PW3A 2NCMA 3DPBA 3FO2B 5IVXB 3QXTA 4GAYB 4U1MA 2ZUYA 3H6JA 5AEAA 4HWBH 1Q1JH 2GJZB 4EI5D 1QLEH 1A14H 2VERN 5D93C 3MCLH 4P46C 4NZRH 2X6MA 4KZEH 4XPAH 3JV4A 3K8MA 4P3CH 3PWPE 5GS1C 1MLBB 5I17B 1QEWA 2XY2A 1J86A 1BOGA 3IGAB 1A6VL 4OZHE 3NBNA 4ETQB 3IB4A 3QQNA 2J6EA 4IEFB 4YK4B 5FYKH 2CIKA 2EDNA 1KGCE 2WIIA 4EOWH 4Z7UB 5ISZE 1FFOB 4NQSB 4Z95H 5CD5D 3MRNA 1X9QA 5AWNL 3I3DA 2AV7B 3L9RB 5HTSA 3F7VA 4HZLA 3OX8B 3WN5A 5CMAB 3UTSD 4WFHE 4TTDD 4NC1C 3LY6A 1J8HB 1DBAL 1CLOH 5D7LE 1MCJA 3TCLB 2YK1H 1YEEH 5I18L 3GSOA 2JK5A 4Y1AB 1EHLL 2FEDC 4ZUSB 4GAJL 1QACA 4WW1B 2PETA 1J7VR 1W72B 2BVUA 4MD4A 1K6QL 4TSAL 1A1OB 1ZGLM 4LLVA 5JHDB 2BCKA 2NY2C 4KROB 2VAJA 3QQ4A 4P48A 3QAZC 1RK1B 1F2QA 3DGCR 1LO5B 1XCQB 2R0ZH 4MD0B 3IETB 3MJ9A 4E41A 4PGBA 4XPFH 5E95B 5DK0B 2ZNWA 5GJTL 5ANMB 1II4E 1KULA 4I9WE 2V5YA 4X5WB 2DICA 4WCYH 1HSAB 4FTVD 3RDTC 4LSPL 3FCTB 4XPBL 4K71C 4PJEA 4X6DB 2R0KH 3E0GA 4YUEH 1G1CA 3C09B 3MXVL 5KJRH 3I50H 5TDOB 3HNSH 3GJEB 5DZLA 3EJYC 1K3IA 4NZJA 1NCAH 4NNXB 3EIFA 4N90D 4EN3B 2J6EL 2P8MA 3TH3T 3ZHLA 4RNRB 2BK8A 4KRLB 1H3PH 5J11C 3PWNB 2D3VA 3ZDXE 1QRND 5D9SA 3CX5J 4JFYB 1UJ3A 1UXSB 4OKVA 1CK0H 3ISWA 5IG7B 4PR5B 3TN0C 4JLRB 4CVXA 5FO8A 3WYRA 4LAQL 3NPSB 3MXWL 2LAAA 2R0LH 1EZVX 5I71B 3UZQA 5CCKH 2P48B 5KW9H 2GUOB 4PRDA 1J0YA 5C0CD 4P4RA 2H2SD 1FCCA 3S98A 1MI5E 4PB9H 1RUPH 4ODHH 4TOYH 3MRLB 1X5ZA 1PX4A 5DD3H 2R2CA 3SDXB 1SBSL 5I1GH 3SE9L 4L4VA 3SCMA 1KTRL 5HHME 5EZOL 2OZ4H 1S8DB 1WITA 3U4BH 2JELL 1G0DA 2K7PA 1ZHBB 2EDEA 4P2RD 5EUOE 3MJ9L 4KVCL 4OCRH 4V1DE 1N6QH 4NQDE 4ALAL 1IC4H 4KTEL 4PJ7F 2BOBA 2ARJQ 1XR8A 4N0CC 2CLZA 4GRLA 4XMLH 5BS0B 4GQPH 2C1PA 2XKNA 3OKDA 4I2XB 3RTQC 4YEFA 1F5WA 3LKRB 3THML 1M05B 5K9JH 4Q7DA 1A6TA 4TUOB 3ZTNL 1VDGA 2VC2L 3DETC 4XNUL 4L8BA 4OUOA 1CDHA 1S3KH 2B8OT 1BJMA 3ULUL 1G9NL 2VDLL 3FB7B 5MEOB 1ORSB 4ZS6D 4P9HL 4P5TD 1MCHA 1A0QH 4MQSB 3V0VB 4ELMA 3V8OA 2P24A 1J9CT 3FOMA 3QPQC 2AJSH 3HN3A 1G7IA 2W0PA 2Y5TB 3SGDH 1AI1H 1VADA 5DJ2A 1W8OA 3GSNH 3KYOB 3KHQA 5A1AA 4P57A 3E6FA 2CGRL 4IHOB 4OI7A 1BZ9A 4DOHE 1C5DB 2WW8A 4OZFB 3ILQC 5HJ3B 3LCYA 4Y5XC 5CILH 4HKXB 4ZDHB 5IBUB 3TBWB 4WI2A 1OAUL 4JVPA 4C56A 1A7RL 2XPGB 4OLVL 1ED3A 3OKOB 3P4OA 5I6XC 3W2DL 3D25A 3C5ZA 4Q9CA 4F8QA 3T8XB 2X1XR 3TPUA 1A8JH 2ITDA 4MJIA 2P46B 1CGUA 4KKNA 3BW9A 1XIWC 1UM6L 1VFAB 4RBPK 2F54A 3OJDA 2NR6D 3QWRA 4JPIA 1CQYA 1MFAH 1YEIL 4RMTA 5J13C 1A4JB 1Z0NA 3EHBD 5ESQB 5JW5B 3N1QC 1H5BA 5IKCA 5D7IF 4BQBA 1XGTB 2DWDA 1YQ2A 1QKZL 4YGVB 4CRPA 4Y4HB 1RD6A 4ORGA 5CZXD 2C4FT 5DR5H 3O4OC 5D1ZD 1G7QA 1HXMB 5JW4Q 2YD9A 2P5WB 5IW6A 4HEPG 1F00I 4HT1L 3MBED 4KAQL 4LQ1A 4LNRA 3MRKB 1LD9B 4AQOA 1U6AH 5KSAC 4MD5B 1CXHA 3WFZA 2VH5L 4HJJL 4X9IA 4E9LA 4GMTL 3EOAA 1E4JA 2EH8H 4G9FE 3WD5H 4JG0L 4NP4L 2A6DB 4S1DD 3L7EA 3B2VL 3FB6B 4U6TA 4XAKD 2NY0D 1Z0MA 2HJKA 4B7IA 3LS4L 4QGTA 1UCBL 4MNGA 1KPVB 3P0YL 3QO0B 2E6JA 3RWHB 2QQLH 5C0BE 4PGEB 1RMFH 2DLTA 1MPAL 2VE6B 4PIRF 1NCNA 2N56A 3B4NA 3GMPA 5ALCH 4AK1A 2ITCA 3HKFA 3G5YA 5DJCB 5ADPL 1DLHB 1SJHA 3GKZA 4X6CE 5L7XL 1WT5A 3QI9A 4B0MM 5C7XL 1NCCL 1T04B 1YEDB 4W4OA 4YH6A 4AEIL 5D8JL 1JUFB 43C9A 1T66D 2NW3B 3KPSB 5EDXA 2AK4B 4BUHA 2IMMA 1JTOA 2DKUA 1CN4A 5D1XA 2Z31B 5DT1H 3FO1A 1PYWA 4Z7WA 2R1XB 4U1IA 1C5BL 1RURL 4PV9A 4Z76A 4F9LA 3QFJD 4JFOB 2P5EB 4CW1B 3MUJA 5D7JD 4U6XB 3B8YA 4WU5B 3VMPA 3N50A 5E56A 5AUMB 5J6GA 4APQD 1WLHA 3WE6B 2XA8H 4XWGH 4K3DL 2WBWB 1JNLL 3MNZB 2ICWJ 2ATKA 3U30C 1RHFA 1OAQL 3CFJB 1SQ2N 3CXDH 3ARFD 3FN9A 3MRDB 4MDIB 4HS6B 1IGYA 1P4BL 4AG4H 1MJJA 4I0CC 3H9HA 1T4KA 1ZLVK 1D5IL 4UT9H 4Q2ZA 4PJXF 3ROLB 4LSVH 3K8KA 4Z8FH 2XQYK 2P49B 4PGDA 3MUGA 5C2BH 3VXQB 3IXAA 2BRRH 1FORL 1J8KA 2VLLA 5E8EB 5HVFB 15C8L 5DMJB 1FNEB 2PYEB 5GS0D 1AFVL 3WNLA 1WGOA 1N2RA 1T20B 5A16B 4NQUA 2X4PA 3C6LD 3FQXA 4RGOL 3BDBA 5LGJA 2AKRA 3UTQA 3DMMD 2YD7A 4RAVB 3G6JA 3TBSA 5IEKA 4Y5YC 2WZPD 1ZT4B 2PO6B 4ZPVA 1U3HC 5JW4N 4D0BA 4XCYB 4IJ3C 3IDNA 4I0PD 3ZO0A 1KSRA 2D03L 4KTDH 4F7EA 2NPLX 4M93B 1CIUA 5KVGH 1N4XL 1N3NB 1JWUA 4D3CH 4WO4D 4ZO9A 4IOSD 5L0QB 1JL8A 3MRRB 4UQ3B 1S9VB 4RDQG 5F97E 2HTLC 4KHXL 3OKYA 1CGXA 1NANI 4N0UB 2H3NB 3TA3A 3C2AH 4WWKB 1IMHC 1Q72H 4LGSB 1JNJA 1AD0A 2PR4H 5HGAB 5JO5B 4JCLA 3OB8A 5FO7A 1FIGH 1MCIA 5LGKA 4P9MH 4YDIL 5EO9A 3KWWB 1UZ6F 5C0AA 3CU1A 1DQTA 3LKOA 5C6TH 3HUJF 3P77B 5KTEH 2CKNA 1V7NL 3ARED 1FNGB 1KLUB 4JY5L 4PB0L 1EZVY 2R0WL 5BRZB 4I5BB 2I9TA 4QRPE 1F90L 4MNQE 5DZNA 3RUGE 3H3PH 3SOBH 3CH1B 3P9LA 4UU9B 2CDGA 4UTAL 1BQLH 3KYNB 4PJIB 4FFZL 5T33H 5E24E 1MHEA 1H8NA 1HHGB 4R4NC 2VXSL 3O6ML 3VFGH 3ARWA 3HA0A 1AE6H 2H6PA 5DI8B 2I27N 2EC9U 2B5IB 5I16A 1QBLL 3FB8A 4JFEA 1NC2A 2VOTA 5FYLD 3HZYB 4GUPA 2EYSA 4PG9B 2CPCA 5JOPD 1QO3B 3NFPA 2FX7L 1HILB 2B2XH 1NKOA 5JOFB 3GMRB 3NZ8B 1DVFB 4P46D 1ZXQA 4QRRB 1IILE 5MP6H 2DB8A 2XTJE 5F7FA 1S7RA 4KK5C 1WC7B 3QDHA 2Z35A 2I07A 1QFWH 4G7VH 3IF1B 5BJTB 2UZIH 1A02N 4PJGA 4YC2B 4GRMA 5B39G 3HI5L 2ZWLT 4K8RH 4MAYD 4ONHA 3JVGC 3NCCB 3GSWA 1YYMH 1IM9A 1RFDL 4C59B 3O6FA 3QDGA 3VXMB 4MDJB 4G6KL 5J1SC 1CWVA 3ARPA 2DM7A 1BLNA 1KCUH 3QNYA 3V5HB 5A2IH 3O3DB 4NOFA 1BF8A 3RGVB 5I76B 1VGEH 2ICEA 4XWOC 4FFVC 2XNAA 3MROB 2FEDD 1T2QL 3NCBB 5FGCE 4QHMA 3PXHA 4ZOAA 2OK0L 2B0SH 4X80L 1FO0B 3WFBL 4KK8C 1FYTE 1IFHL 4WV1A 1G7JB 1JWMA 3P4NB 2IADB 3TYFB 2XZQL 1O7SA 4X7SL 1KIPA 2VITB 1TQBB 1IBGH 2A6IA 3PP3K 3HMXA 2PXYA 4X4YB 1T1XA 4JO4H 3IDJA 2DJ4A 1I8LC 4GBXD 4Z78B 2P44B 5EBMA 1HYRC 2EE3A 5CJXC 5IW1A 2VDPL 3LEXA 3U83A 2XTJC 2YPVH 1BBDL 5L2JB 1A7PH 1AC0A 1G0XA 3RDTD 2A0LC 2NY4B 4LFHD 1JPTH 2YBRB 3GBNH 3N85H 5IF0B 1KXQE 4PUBL 2ADGB 3KDMB 2QQKH 3MJ8B 4FXLA 2HFTA 3MJ7B 1JZ8A 2CUMA 1GVIA 1KXVC 1TQCC 2WBJA 5F9JA 5HGDB 1MRCL 4JZOB 5IM7B 4KKBC 2ERJC 1IKFH 3AAZA 3S34L 3SKMB 4PJHE 4YXLH 3HCVB 2X4OA 2NNAA 3ZTJH 3L1OH 4K2UL 1UXWB 5DC4B 5FKPB 5HHVL 3HLAA 4XBPB 1T6WA 3MV9B 3L3KB 3TN0D 3RP1A 4YBHA 3FOLB 1UYWL 4CN1A 3KLAA 3EYUH 3VXPB 4JZNB 5C0EB 5DWUH 4JKWA 5DK2A 2DLFL 1JHTB 4M7KH 1INQA 1JRHH 1VEPA 4IMKA 1A6PA 4KUCF 3ARBA 5AD0B 2W9LA 3L5WB 2JCCA 1HHKB 3AM8C 1DSFH 1PZ5A 5GHWL 1RI8A 1S78C 4RGND 3VFRA 1QSFA 2F15A 3LH2L 5EBWA 1LO2H 3CXHJ 1IAOA 4HQQH 3ZDYE 1KJVA 4OAWA 3FQTA 3H7BA 1UC6A 3UO1H 5FYKD 1NAMB 4GQ9L 4HH9A 4XP1L 3QYCA 2XQBH 3CVIH 4NM4H 4YHZL 4Y4KA 4FOMA 3IRPX 5CEYB 5GS1B 3UJTL 4N0CD 2CD0A 5E6IA 5AAMA 4U1LA 1RZKL 1CE1L 3ARUA 1ZANH 3QNZA 2GSIB 3E1F1 5DD1H 3BE1L 1G9ML 1A6UH 2IGFH 3QCUL 1NCDH 4HWEL 2V7NA 1LEIB 1RZ8A 4XNXL 5CJ8A 2VJXA 1AGCB 4YFLI 2J8UB 5CSBA 2DN7A 5CJQL 5LG1A 5F72S 4JHZA 2EYRA 2FL5B 4PRPB 3MV7D 1FVCA 4O2FA 2YHGA 2V2WB 4G6FB 2HFFA 2V9TA 3RPIB 4XVSH 1RK0A 1GGIH 1IAIL 1MCNA 1M7IA 3HC4H 4LVHB 2ZPKH 2ARJA 2CKBB 2ID5A 3EDJA 4PTUB 4E41E 2BRQA 4WHYH 2Y6SD 2NY2B 3O4LB 3UZVB 2MOVA 3QAZB 1NFDA 3GMOB 1IGTA 2GSGB 2EE2A 2Y7QB 1BX2B 3NA9L 4N1HB 3DVIA 3W11C 5IHBA 4A2MA 1C12B 1FRGH 2YN3A 5ICXA 5F7UA 2CDEB 1WEJH 3RWDB 3KYKL 4TUKH 2I60H 1CYGA 3TBYA 3NCFB 4KMTH 4XCNA 1NL0L 3FQRB 3ZT5A 2F5BH 1BIIA 3SO3C 3P0VL 3PWPB 4QY8B 3QULA 4LCUA 2MQ3A 5A43C 4TNWF 3FZUC 2I9LB 4OZHB 4XNYL 1G0YR 3ULUE 4LSQH 3WN5C 5IB1B 4H1LB 4DK6A 3QDAA 5ISZB 1U8KA 3SQOL 4OLXL 4K3JL 1WAAA 5HDOA 3QHFH 5B38A 5SX5K 5FK9B 4Y8DC 2QADC 5E8PA 2HFEA 1KB5B 2YKLH 4OT1L 1DQDH 3MRHB 1LO3L 2XWBA 2QV2A 5J11B 5EO1A 4H0HB 1KLGA 1HH6B 1KIRA 1I85A 4LLWB 1L0YA 1E6JL 5D7LB 3IVKB 5F3HA 3P73A 4OCWL 2O5XL 1HXYA 1NC4B 4Q9RL 5TPWL 3VMNA 3MODH 4I48A 4W4NA 5BO1L 2FX9L 3WS3A 4O9HL 5CP7A 5JW4R 1PG7H 3OAZH 4NJAL 2MWCA 4G8GA 5CAYB 3LQAH 5SWQB 3GGWB 35C8L 4NZTL 4LCWD 3UBXG 4HXBL 3UPRA 3O8XD 5HHOA 5GIRA 4H88L 4AEFA 4QF1A 3UTTE 3V6FA 4DKDC 2ICWA 2ADJA 4J3SA 3IAPA 3V52H 3OGOE 4DCQA 4UDUA 3ULUC 1C5CL 1AGFA 12E8L 1AO7E 3MFFB 1K2DB 2J12B 4P9HC 5DJDA 2ZSVB 3S97C 3QH3A 4I18A 1SJVA 4B41A 1MIML 3IAGC 4JB9L 4FQ1L 4QCIA 1UJ3C 3BIKB 3RTQB 4YWGH 2LV4A 2OMBA 3U0PA 2C4XA 1ZT1A 1DDHB 1PKOA 1EBAA 3A6CL 4H5SA 1J0IA 3VFMB 3IDIA 1B88A 3S3JA 3TH4T 1MFCH 2I5YL 1K4CA 3W9EA 3PL6A 4GG6B 4ZOCA 1RJCA 1H3TA 4DVBB 4RFOH 2A6JA 4HHAA 2AI0L 1FO0H 5DJ6B 1NDGB 3H2WA 4IMLB 3WIFB 3MGOB 4KKCD 1D5BA 2V5SA 2IAND 1YEGH 3QZWA 3MUY1 4J3OC 4DN4L 3CMGA 3SCMC 4Y16A 1KBGL 2OXGA 2YMXL 1XGUB 2FD6H 1P6FA 2XG5A 2FGWL 1MI5B 2HN7A 3AROA 4OUUA 1UB5B 2Q3AA 1OF2A 4E0RA 1Y18A 1BAFH 3QDME 3DV6A 3BPOC 3S88L 4XNZC 5HHMB 4MJIE 5FM4A 3LIZH 3QQ3A 5C0NC 2AQ2A 3A67L 5GS3A 1C16A 5EUOB 4MAUL 4L3CA 3BSZL 2CLVA 3NACH 4GRLC 3QXDA 1YY8B 4V1DB 4PJBF 4NQDB 5DVMA 2EO1A 5F1IB 2BSRB 2DWEB 3IFLH 4AM0B 3UDWA 5F71A 4MJ5A 2FJGB 1XIWB 3CFBA 5DMGC 4WI5A 5IFJB 2YEZA 2DD8L 3UTZA 2EDWA 1KN2H 4P23A 5J13B 2AEPL 4JFPB 3QPXH 5C71A 1IZKA 4LHUD 2B1AL 1LP9E 1QQDB 4LVNB 3DX8A 3SDDD 1KN4L 3MA9H 4FZ8H 1F58H 1MIEH 4JRWA 4TULL 1U3HD 1VGKA 5A2KH 4MWFB 5DK3A 1TVHA 1FNLA 2DOCA 2SEBA 3A6BH 5F89B 5L8JB 2XN9E 3O4OB 3Q6FB 1XF4B 1FZKA 2V17L 3TT1L 2OTWA 5ADOH 4NNYB 2DKMA 3REWA 5F1NB 1PKQE 3QIBB 4HKBA 5T3ZH 3RWJB 5IBTL 4XP5L 1JWSA 1P7QA 5DLML 4DOHB 3MV01 3D48R 3LQAC 5KSAB 1L0XA 2KZ1B 3QXAA 5DHVB 4PYHA 1OPGH 1HH9B 4IIQC 1NEZB 5ESVA 4MNGE 3QXWA 3UXFA 4KRNA 4KGLA 1CL7H 2KL6A 1OSPL 6FABH 2H8PA 3ZE0F 4YHNA 4BQCA 3GI9L 3BZ4A 4JDVA 4G6JH 4DW2H 4LOUC 3ULSB 5D71L 5SWZE 4MA7L 2GYSA 1BM3L 1UT9A 1TVBB 1WWCA 4JG1H 1M6OA 1I7ZB 4R8WH 4JGJA 5E7BA 1TMCB 1WZLA 4L8SB 2G2RB 5JXEA 4D94A 2GAZB 5K33A 2EDTA 3FQNB 4DKFH 1M71B 3TNNB 1U36A 1NGYA 2F53D 3MOAH 4Z7WE 4GS7B 1KCRH 1NBZB 1UM4L 1YUHB 3P0GB 4C55A 1LVEA 1JV5B 3CCHA 3V9FA 1SM3L 1ZE3C 2BY3A 3IDYC 1XMWA 1J0HA 3LRSA 1IRAY 4R4ND 4F2MA 4HF5H 3OKKA 1SYVA 3FAWA 1QFOA 2B7DT 3VFNB 2W65B 5GRJH 4R7NB 4TNWK 3E3QC 3DX9A 3KPMB 1WCBA 1RIUL 4WFFE 3VH8B 1N59A 2YXFA 1A9EA 4RWYL 4V2BA 2A9NH 5D2LF 3U46B 4JFQB 4JKMA 1KCVL 4JVUA 4G9FB 2AXFA 4KMLB 1IZJA 3K2UH 1MVUB 5DRXB 5E8DL 1MUJA 1KT2B 5AZ2H 1T1ZA 4KK6D 4G9DA 2E9IA 4UV4H 3W39A 3BKCH 3GI8H 4P59H 4U1KA 3CK0H 1S7TA 2AK1H 5C0BB 1EJ6A 1WT5C 4XCFL 1YMHB 2CUHA 3QI9C 5IHZA 1QLFB 1IGMH 2W91A 4B50A 4W4OC 4XPTH 3RL1A 4H1LH 2VLRA 4RMWA 1PEZA 4KV5E 1JHLL 5LBSL 5ID0A 2FJFA 4JN2A 5EULV 4X6CB 2ESVD 3WHXB 1SY6A 4MNQD 4L4TA 4JR9H 2A73B 1A3LL 2DTSA 2FWOA 5T1MB 1I3GH 3MRFB 3O2DA 5FUZL 1HI6B 1W0WA 4LBEB 4PG2A 4NDMB 2P1YA 5J57B 2ILLA 3FO9B 1INDH 1MHHB 4JFDD 4XWOD 4QRUA 2R8SL 3ET9F 1R6VA 4LPYA 1RVFH 3CFEB 3CFKA 3LN4A 2FO4B 5HYJE 5DTFB 4IRSB 2V5MA 4F58H 2EC9T 1OD7A 2VQTA 4ZQKA 1S9YB 1YEFH 4FQIH 5EZLA 1TZHA 3GRWH 4NBXB 3SDCA 4FQCL 1PEWA 2E3VA 3VXSD 5IEHB 3SY0A 1U8IA 4RMUA 5IHLB 2GJ6A 1MF2H 1KJ2A 2FRGP 1X5LA 5I1JL 1NJ9B 5H94B 2IWGA 1CFSA 1MJUH 5FXCH 2N7BA 2P7TA 3IS0X 3A0OA 5DJZA 3PGFH 1S7UA 2CMRL 1MHPL 1LQSR 1RZJH 4GXVL 4PGJA 5K9OB 1KJ3L 3CPLA 4M6OH 3TJEH 4NWTH 5I1AB 5B3JF 5HPOA 3DRQB 1VESA 1Q9WA 1FIEA 3WNOA 1CLYH 2YPLD 5EOQH 4DZ8B 1T6VN 1HHIA 1RZ7L 3G08B 4HGMA 3NN8B 2ATPB 4D0DB 1RUAL 3STLA 1NH6A 5ACLA 5FKAB 4HLZG 1F6AA 1IKNA 3MR9A 3BDXA 4M6MH 1SY6L 2B1HH 1FAKT 3DX6A 3W9DA 3LSOA 1RHHA 3DV4B 5HYEA 1K3ZA 4GLRI 1FL5B 3MNVA 4PRBA 2WINB 2FLRT 4YFDB 4QNPE 4AH2B 2XZZA 4JFEE 3LKSB 3WUZA 5FDWB 3LB6D 3LKNA 3D2UB 2D31B 1IL1B 3HMXH 4F15C 3TA3C 1YNTB 1UWGL 1VFBA 3SJVA 2UYLA 1MSPA 2VB5A 1E4WH 1TETL 3O9WA 3TYGH 1HHJB 3IKKA 1NLBL 3MOBH 2HMID 1VACB 1PBYA 3U6RB 1KJ2L 3KR3L 3IFNL 5DGQA 1I75A 2GK2A 1OAYH 1OP3H 5HGBB 2NMSA 4K8RD 4O51A 3ZHKA 4JPVL 5D2NE 3QO1B 4LSUH 3I02B 3N1GC 3MLSL 5CGTA 3T0BA 3L3GB 3R8BB 3QDGE 4WHTB 3SKJH 1B6UA 5J1TC 2PW1B 3G5XB 4M5YL 1I8KB 2G75A 4S1QH 2D7OA 3UYOD 4ERSL 1MFEH 1G7PA 1OM3L 5TQ2H 5I74C 2BHZA 2ZOLB 3DSFH 4HPYL 4QRPB 3RUGB 5D7SL 5ID1A 4GXUM 1MRDH 5GRYA 1NFIB 1S9KC 5JIKA 1IM3B 4ISVB 4XXDA 3BOVA 4ZAKA 1NBYA 2ZCKL 3UYRL 1IAKA 2EECA 4XI5C 4DJMA 1T21A 4J23A 3IKCB 3ARZA 2GW5A 4X4ZA 4R90H 5T5FL 4AEHH 2QSCH 2NXYC 3MLVL 1N26A 2DYPB 4JQVC 4UINH 3KPLA 3RX7A 3DURA 3RKDC 5BV7H 4XP6H 5EU5B 3BMVA 4HS8H 3WLBB 5FYJL 3ZZ1A 4PV8B 4UT6L 3U7WH 4NQEE 5EFIB 1U8MA 4GMSH 2FDBP 2WLZA 4IRZH 3BKML 2XT1B 3WFHB 2XTJB 3AB0C 2K9UA 5D2NC 3HC0B 4PPTA 2ZUWA 4L8DB 3FZUD 1LEKA 4EBQH 2F19L 4IDJH 4X5LA 1E6OH 1NKRA 4PJ7A 5DEGA 4JZJB 3HZVA 4NO0A 1UQSB 1MQKL 4EI6A 3KLHC 4C83A 3HE6A 1FPTH 2VRAA 3GNMH 3V4VL 1QFUL 1XF2B 2BHYA 1F4WL 2ERJB 3D85A 3PABA 3QJFB 4OJFL 4U1JB 5AG9A 4QTIH 2AGJH 5D7KE 2LVEA 3RVUC 4BKLB 1FAIL 5GRWA 1EEZB 5ILTH 3GHBH 4PJ9A 2OR9H 3AMLA 2WWKT 3T77B 3DWTA 3LHPH 2EDFA 5MEPA 1KNOA 2BNQA 4U6HB 3F7YA 4XNQA 3PG2A 4WV1C 3MRIB 3DTXA 1K4DA 5ESAB 1JGLH 5FGCB 4N9GA 1AQKH 3OXRB 1PQZB 4JY6A 2PXYC 2V2XB 3O2WL 2DQJH 1RULH 3EO0B 2A83A 1FYTB 4ZUWB 1J87A 1ZLUK 4HV8A 1WIPA 2MSPA 1A7QL 4NO3B 4U1HA 4FABH 1QSFE 5CD3A 3RA7H 4NQXA 5TDNB 4LRNL 5EA0L 1YEKL 2CRZA 3QWOB 1G9MC 2Y36L 3WSQH 3V79C 2CRYA 3OKNA 5C07A 1PSKH 3TT3H 1NAKL 2WBJC 1MREH 1OAKH 2J5LC 1IGFL 5F3BA 4RMSA 4F8TA 3VI3F 4HIXL 4NHUB 4F7PA 1R5WB 5JLZB 2DMKA 1NLDH 1RZGA 1RZIB 5I9QC 3W0WA 2CSPA 1MCCA 2DLIA 2YPKB 1AKJB 1X5JA 4JPWL 4LVOC 1VEOA 4PJHB 1GIGL 2L7UA 5CBEA 3SEPA 3RAJH 5KG9A 1QSZA 2OX5A 4TN9A 4W6XB 4ZFOL 2LE9A 5D7IA 1INEH 2ZKHH 3MYJB 2YZ1A 2IG2H 4N0YL 1BQSA 2R29H 5ICYA 2ZJSH 1I8IA 2KH2B 3OR7B 4UOW0 5DQJA 4IMKC 1H0DB 2Z92B 4HGWB 2BVTA 1RZFL 3ARBC 3FQUA 2HAZA 4L4VD 3SCMD 1KTKE 2DQIL 3VD5A 1U91A 1NFDE 4UQ2A 2YXMA 2UWEA 3L3DB 5IVNA 5BV7C 4JGUA 1OP5H 4N5UA 4NYLB 5IVXF 4U1MB 4K7PL 2E6QA 4M7LT 5GRVL 1OGAA 3SE8H 4L5FH 1MWAA 2DQFA 5C0ND 4DZBB 3R8QA 4Y4KC 3MRCB 2NY1C 5E6IC 4GRLD 1X44A 3QCVH 3L3JA 1F2XK 3QXVA 1FL3A 4XCCH 3C9NB 2BHUA 5C0JB 2CIKB 5E2JA 2GI7A 5E2VH 5F9AC 4CVZA 3SO3B 4Z7UF 3IFPA 5JIHA 3MV8E 3TO4B 2EH7H 3QIWC 1IJ9A 3MRBA 1NGWA 5J6HB 1FGVL 4LIQL 1JI2A 3H42H 4OLUH 3IJHB 4M6NL 4EUPB 4CMHB 4FQXB 2QADB 5KZCB 5IV2A 1ES0B 1HHHB 3C5JA 5I0ZA 5TGBB 4U1NB 4ODSH 1EMTH 1T1YA 4MD4B 4TPRH 5CIPH 1JNNL 3GMNB 4FNLH 1R24A 4PJDF 4U6VH 2VXVL 3Q3GA 5T3XL 3FHAA 4M03A 3QQ4B 3AS3A 4LSRH 4M1CC 3L3HA 4OD1L 4G8GE 1RUQL 4C56D 4FQJH 3H0TB 4LSSH 4E41B 3RY6A 5FOBB 5FF6B 3ULVL 3C5ZD 5ACZA 3GM0A 4PGBB 5K59F 4O02L 5HHOE 3HE7B 4YPGA 2R56H 1JPSL 2W92A 3VCLB 1KTLA 2R2EA 3OAYK 4IRJB 1CGSL 2F54D 1I3VA 4JAMA 2BZDA 3QWRD 5C9KA 2MPAH 1CTOA 3FT4B 4LOUD 4LRIA 1MWAL 3SQBA 1ND0A 3QCTL 4AMKH 5DJXB 4X6DF 2A77L 2AEQL 4PGCA 2JIXB 4E5XA 2FZ3B 2YC1A 1OWWA 5EZIH 5T1KA 3E8UH 5CJ5A 1H8OA 3TBVB 1OARL 5M95B 1IGIH 1BQHB 2DJSA 3QB7C 8FABA 3VI4F 5IT2H 2P8MB 1D5XA 5HI3C 5ABDE 1KACB 4WFED 1WK0A 1EJOL 2GIYA 1I85C 3WEXA 1IQDA 3CMOH 3ZKNC 5D9SB 3H8NA 4WUKH 1A7NH 4CVXB 1LO0H 3KPRA 3GB7A 3SGKA 3BDYL 1XF5B 1SEQL 5C0RL 5BQ7A 5I1HL 4PRDB 3VD3A 1CFQA 4P4RB 3CFDB 2R15A 1AR1D 5C0DA 3TO2B 5ELIA 2IBZX 2V9QA 5F70A 1CBVL 1YPZE 3GIVB 3CLEH 4MYWB 4O4YH 5INDA 4XGZA 4QT5A 1YZZA 4A6YA 1U8LA 3SDXF 4Q58C 1T03L 2ED8A 3KPQA 5HHNA 5HDQH 3V4PL 4UBDC 4XB7A 1ACYL 4UDTA 1OQXA 1MFNA 3BPNC 4DGIH 3EBAA 3BPOB 2NQCA 1L7TL 2FIRT 4XNZB 4GKSB 1ETZA 2D4FA 4RMQA 1N0XH 1GOFA 4LDOB 3VRJA 5EOTA 3UTTB 4I18C 3BZDA 1XR8B 2GQHA 3QI9D 4PJBE 4YHLL 3LEVL 2D0FA 1EVTC 2XKNB 3OKDB 3KPPA 4J3WA 3VFPB 3VGEA 4NZDA 5JPMA 5B8CB 1AO7B 2P4AB 3NTCL 4D0CA 3HG1D 1UZ8A 5D1XD 1WBYA 2XZCL 4ZSOE 4TVPD 1VPOL 2VR4A 3CNKA 3HUJA 4U7SA 4WUUA 5GSVA 2IQAA 1G7LA 1RUML 3PL6C 2PTTB 4XMPL 1ZVHA 3KYMB 3I9GH 4Q9QL 5IUSA 1XGRA 2NX5D 1B2WH 3C08L 2P24B 1HQ4A 3FOMB 2MHAA 1FG2A 1ZHLB 1G7IB 1I4FB 1IEAA 4Y16C 5T3ZD 4OFVA 4KUZH 4NUGL 2VDKL 2DS4A 1YDPA 4G8EA 3I3BA 3QEGL 1YNKH 5MEND 4GW1A 1YEHH 4JE4B 3WFDL 4XB8A 1AGDB 2W9EL 2DQCH 1Z9MA 3BD3A 3TC9A 2F74A 3JTSB 4JY4A 1A6VH 2PKDA 4I3RH 2NW2B 3BGMB 2C7UA 4IIQB 3QDMB 1KCKA 4A6YL 2DQDH 5CBAA 2ITDB 3UDWC 4MJIB 3S5LA 5C08D 3VGBA 2XXMB 4ZTOL 3EYVA 1CDGA 3LMJH 3W5NA 3OJDB 4HIEB 4K9EC 4H8WL 3OJ2C 1T2JA 4X9FA 1GGCL 4N1CA 5GS2H 4P23C 5I15L 1S9WB 3G6AA 4MCZB 2JJTA 4D9QE 1R5IB 5IKCB 4NKOA 1HYSC 5D6CA 5E8NA 3VFUB 3MBXL 3CU7A 4MQ7A 3V7AG 3ROOA 1A9BA 3X3FL 3T1FA 3MREB 4MCYB 2VLJA 3V5KB 5SWSD 1LP9B 3MLWH 4G7YL 2Q76A 2NY6C 2CO7B 3MV11 3L3OA 3I6KB 5J9PA 1ZOXA 2DLGA 4YDLB 5JHLL 1KENL 1NMCC 3IDYB 2XN9B 2X4SB 4RBPH 3D3VA 3EOAB 4HC1L 1PKQB 5CINH 4Y19E 3ZYIA 3QHZH 1U95A 1WVZA 5LAXA 5C0AD 2HVKB 2ICCA 2NXZC 3D9AH 4AIXA 3DGGA 4MNGB 5C0CA 5BVPL 4WTZG 4MXVF 4HPOH 4LFHG 1T3FB 3T3PE 2VLRE 1GH7A 2ITCB 1CIDA 5JXEC 4LF3A 1SJHB 4KKAC 3FO0L 5SWZB 2QQQA 3Q48A 3PV6A 2WM0A 5F7KC 4ODWB 3F6IA 3RVTC 2CJUH 3V0WH 43C9B 1SYSA 4EIZC 4LAQH 4ONGL 5LWYL 3FMGL 3D18B 1JHKH 3HNVH 4YHML 5I1IH 4HK3J 3MXWH 1NCWH 5BW7A 4Z7WB 3C5SB 1TJIL 3G5VA 4OCXL 2Q8BL 4Z76B 3QUYC 2UZXB 2CRMA 1XCTB 3B9KD 3EDDA 1NC2D 4JFZL 5AYUH 1C1EH 2DTML 3QUXD 5J6GB 4XI5D 2DDQL 2AJYL 5E6YA 3NZHH 3JV6A 5IQ9B 5EZOH 4UTBH 5H2BB 4C54A 2NXYD 1XZ0A 2ATKB 5I1CL 4NM8L 4P5TA 4UIMA 2K7QA 3BP6B 4YNYA 3F7QA 1IC1A 5CJBA 1EO8L 5CEZH 4W70A 1EDQA 4KTEH 1ADQH 1AXTL 1QYGH 1ZA3A 1HEZA 3VXUE 3RX5A 5LVEA 1T4KB 2VDOH 1R3JA 2EZ0C 5FA4B 5MERB 5IESH 4Y4FA 1GZPB 4PGDB 2Z8RA 3MUGB 3IXAB 1IM9D 5JUEL 4CN6A 3PDOA 3GFUA 3PNWB 3EO9L 3G6DH 2A1WH 4HK3N 1A21A 1UVQB 3O6FD 4BZ2H 2D9CA 5T1LB 4AIZB 5FECA 3SO5A 1N2RB 5I30L 3KLHD 2VDLH 1I3RA 3S35H 2HJLB 3BWUC 4PG2C 4LCCB 3PXJA 3MLTA 3FQXB 3SKOA 3PWVA 3C60D 4R9HA 1BVLB 1LK3H 5IR1A 2JB5L 3STZA 3IJSA 5TH2B 3TBSB 4JHBA 5GGVH 4ZPVB 3RWCA 4F7MB 1U41A 2X1PA 2PW2A 4QOKA 4YEEA 4FQLL 1ZLSL 1ZLVH 2W0KA 3SDCC 1EGJA 4J6RL 3PWLB 5DVOA 2X70A 1R3LB 3BP7A 3UTPE 4PJFE 5HYJB 4Y8AA 5DJ0B 5FYJE 4DGVL 3SJVE 5H37H 2MQ0A 3T04D 4HDIB 3MRPA 4P5MA 3VGFA 3TF7C 3L5XL 5D1ZA 2MCPL 2GTWA 3VDAA 1KV3A 3TA3B 1JGEB 2IPTH 1QSED 1AD0B 5DFVD 5HPMA 5FO7B 4ONFL 3M17A 4M1GL 5E9DA 4JRYE 3WDIA 2DQHL 2FBOJ 3CIQA 5EO9B 4KH2A 2WBJD 3QEQA 1DBJL 1WJ3A 2CR6A 1WIUA 1JBJA 3B5GA 3SKNB 1MCPL 3K81A 3BEWA 4KGJA 1B0WA 1L9MA 1RJLB 4RSVA 2H32H 3T4AA 2V5RA 1IKNC 4HJ0D 4LKCA 4L8CB 1TTUA 2BNRA 1Z9SA 3ARQA 2I9TB 3PJSB 4OB5L 2BC4B 4WNQA 4NQCE 4X98B 4KWUA 3P9LB 1HNFA 4L9LA 5C92A 1JGDB 5I74B 5JA8B 4M7ZC 1MHEB 4PJIF 1P7KB 2AJXH 1IARB 2NY5H 2VH5H 2H6PB 3QIBD 1REIA 4PTTB 5I16B 2J2ZA 4JFEB 1L4IA 2ORBH 3VGAC 3O9WC 3B2VH 2LVCA 1EGJL 5JQHC 4GUPB 2OS7A 2EYSB 3VFVA 1NEZG 4WIQA 2X4TA 4ZUVA 4XVJL 3NFPB 3DHJA 3V95A 4QXUL 3T2QA 3VRIA 1CFVL 5AG8A 1J5OH 3MJGX 4LNVA 5F1OB 3S37L 5EPMB 4NQTA 4NC2B 1X5FA 4APQA 2BSTB 3VXRB 1YN7A 1WTGT 1PY4A 2Z35B 2HLAB 2C1OB 3PWUB 2H2PC 3GIZH 5DRZA 4JO2L 3WBDA 1NMBH 1CT8A 4MVBC 2O61A 4O5LL 1I8MB 4AEIH 3AB0B 2HJFB 3GSWB 5D2NB 5IB2A 5E1AA 1E4XL 1QRKA 5CZVL 2BSED 4UUJA 3N9GH 3HAEA 3QDGB 3NH7L 5FHBL 3REVB 2C26A 4QXTA 3QEHB 3BKYH 4CU8A 5I19L 5FCUH 3MLUH 2PYFA 4WJ5A 4X8XA 1JNHA 2BNQE 3QNYB 4OTXH 2L7JA 3B5HA 1P2CA 4ZAKC 1WICA 3R06A 3EKCA 3JWDL 3TBTB 1KEMH 1A4KA 2ICEB 4G80B 3CDCA 3VXOA 1JNLH 1YY9D 2J1KA 25C8L 4ZXBB 1VCAA 1T5WA 4HLJA 2EC8A 4EXKA 3VW3H 1A3RL 4FXGB 2CIIB 2ICES 3C6LA 1JWMB 2A74A 3DECA 3VH8G 4OGXH 5DF0A 4KJWC 1FGNH 2PXYB 1UWEH 1F97A 1T1XB 3PIQA 5KS9A 4KI5F 5DC0A 3S4SG 3OV6A 1AHWA 3IDJB 4JKKA 4D8PA 1NQBA 4E42B 4OQ1A 2IPKA 3EZJB 4KQ4H 4PRID 4CGTA 4I0PA 5IW1B 3LEXB 4JEGB 5CLWA 1IAII 4R4BA 3BZFB 1OB1A 4WO4A 4XVTH 3OAUL 3BI9X 3BRGC 4XP4L 2HG5A 4NQEB 5DQDL 3HR5A 2ARWA 4LEXL 4DTGH 4LIQE 1N5YH 3FN0H 3GJFA 1BD2D 1A5FL 2J5LB 3VI3E 4UAOC 3RWEA 3MCG1 1QD0A 1S7XA 2EKSA 2Z93A 3AAZB 4K94L 4KJPC 5DJ8B 2HT2D 1HOCA 3BH9A 4MS8C 5IJVB 3VXNB 1MJ8L 3QG6A 1MJ7H 4PJ9C 1DL7L 3HPJB 4JM2D 2X4OB 2Q7YB 4BSJA 5I1LA 2HVJA 4PLNC 2AP2A 3IDGA 1S7VB 3PP4L 4GW4B 3RWIA 4P5KA 3PP3H 1DUYB 3HLAB 4LHUG 1BFVL 5T3XE 3IU4L 4LVOB 5EUKA 4OCSL 4KVNH 1NGQH 2NY5C 4ZFGL 4R6UA 4ORZC 1C7SA 3AREA 1YYLH 2OI9C 5GGRA 3ULVE 2RAMA 4TUJA 5GS0L 3PGCA 3QUMA 1LO4H 4WFGE 2OTUB 3ME0A 1CR9H 3BH8A 3ARBB 3P9WB 3TESA 3JTTB 1B0RB 3RBGA 4XC1L 4PP2A 4RFEB 4RAUA 1PZ5B 5GQBA 1QSFB 4UBDD 5EBWB 3GHEL 5J06A 4GH7B 4WRLA 4QXGH 1KJVB 4OAWB 4PBXA 1VKXB 3K0WA 3RWGA 3BQUD 4UNVA 4HH9B 4JFHE 4Y4KB 4RISH 1ZLWH 3P11H 3TIEA 2NY1B 5E6IB 5TE7H 1LE5A 5E99L 3EZ8A 3LEYH 4I4WB 3QNXA 4IOFD 2C3VB 2JF1A 4TRPH 3QNZB 4N8VA 2BOCA 2DQUL 3FL7A 4CJ1A 3VFWB 3NVQA 1MCSA 5HI5D 3AS1A 3SHSA 5EC1B 1RZ8B 4UTAH 4M8QA 4FFZH 1R3HA 2M1KA 3CUPA 3JWNC 2W59A 5L2KA 1BVZA 4YHKL 2E7LC 3QIWB 4ODVH 5JW3L 1EVUA 3GMMB 1BFOA 4MAYA 4EEEA 2ED7A 2ZG2A 4JRXD 3VJ6A 4O2FB 5T1DL 2IQ9H 4QRTA 4JKPH 2VQ1B 3ULVC 2OSLB 2HFFB 1NSNL 5F7YC 4R26L 2LU7A 5F88A 3VE0B 2OL3L 1JF5A 5DD0L 3T2NH 4XPHL 5H8DA 3PHOB 4UOJA 3WIIH 3CFCH 4HAGA 1TFHA 3BEVA 3T4YA 4DN3L 1NFDB 3RPKA 1OGTA 1PDKA 3O11B 1A2YA 2ADIB 1IC7L 1LE9A 1JFQH 3TBYB 4OSUH 4YXHH 1NMAH 3MRMB 4YFLF 5C09A 4GKNA 5IMKB 5C9JA 1BIIB 1FFPA 3QULB 3GUTA 4U3CA 3BPCA 1F02I 5FYLL 4GBXA 1JPGA 1QBML 5DO2C 1IGJA 4OZHF 1FN4A 4M43H 4BFGA 4JO3L 1FZMA 1OAXL 3OMZA 3AU1A 4OFIA 2BY0A 2X4NA 3U1SH 3BYYA 4ODXA 3MV8B 5E8PB 5JXAH 2ICWI 5E2WH 5I66B 3U7YH 7FABL 5IFAL 1KLGB 5EORH 2F9BT 1EK3A 1EV2E 4ODUA 4U1GC 5E4EC 1I1AC 1S5HB 3F6LA 5JQ6H 1CICD 4LPXA 4BSVA 2R9HC 3P73B 5FHAL 3WXVH 1ZA6B 1P7QD 5GZNC 5KSBA 3RY6C 3HI6L 2GHWB 4M4RA 4NUJA 1RJYA 1U8QA 4I48B 4K7FA 2C3WA 3WS3B 4CU6A 3RGHA 4HZAA 4LSDA 4G8GB 2HFGH 2IFFH 3MNWA 5I75C 2O5YH 4GKZB 1DQLL 4LRIC 3UPRB 1XR9A 2FATH 4PUBH 2G5BB 5CSZA 5HDBF 5HHOB 5DYOA 1MCEA 5GIRB 4XVUC 5SX5H 1N8ZA 2KBGA 3ZDZE 4YHIB 1CDIA 4OBSA 3FJTA 4BZ1L 1CGYA 3S34H 2EO9A 2AXJA 4DCQB 2Y25A 3B3IA 1LDPL 5INCB 1YN6A 2AW2A 3ZT6A 3O45A 5JXED 1KEGL 2XYCA 4D9QD 4D9RD 1NUGA 2VNCA 3GK8L 5FB8B 1T89A 5HI4C 5EZJB 2GCYA 3HB3D 4H25A 5F96L 2Q8AH 2FGZA 4P4KA 3U0PB 3TZVD 4U3HA 3SGKC 4Y5VA 4XBGA 3CAFA 4HD9A 1WWBX 1BJ1H 1FV1A 3RIFF 2GITB 3PL6B 1CDCA 2W0FB 3LZFL 2DLFH 3GMQA 4K7PX 3ZDXF 1R5VB 2QJDA 2A6JB 1PZUB 1QNZL 5GRUL 2GK0B 3UTSE 4MXWL 2MKLC 2LU3A 1UH3A 3PGDB 4L3ED 5JR1L 5EBLA 4G42A 1I9IH 1CG9A 3DUHA 2XWTA 2RCSH 4Y16B 2HTKC 3P9MA 3VA6A 2X4UA 1XH3A 3RWFA 1PD6A 2R69H 1BPVA 2UVFA 1YPZB 1BEYL 1Y18B 5TQ0L 5J89A 5FUOL 3DV6B 2EZ0D 4XMKH 4HMEA 1QZ1A 3KNBA 2VLKA 9CGTA 1KYOK 2CLVB 2FO1A 4OD3L 1CE1H 1M7DA 1I9JH 3CVHA 4JFFD 5EUOF 5GS2D 1DBKL 2IFGA 2J8HA 5L88L 1U8HA 2WV3A 2X41A 1CTNA 4MA3A 1CU4H 4MJ5B 2OYPA 1YEJL 3CFBB 4L4TD 4PJBB 4FTVE 2APTA 2EDLA 4HWBL 2YEZB 1Q1JL 5DVKA 4RQQA 3UTZB 1QLEL 2EDDA 4P23B 1MVFA 1A14L 3DXAD 3L5HA 5CJQH 3VU2A 4NZUH 3MCLL 4R7DA 2DLEA 2CXKA 4NZRL 4YQXH 4KZEL 4XPAL 5IMMB 3UCRA 4P3CL 2AABH 2F5AH 3DX8B 4ZSOB 5ERWB 4M61B 3OKEA 1CXIA 4N90E 2BY2A 3PQYD 3I6LD 5I1EH 4OF8A 5FYKL 5AYQA 4P2OA 1JPFA 1AGBA 4LHJB 4U49A 4EOWL 1HKFA 2SEBB 5A2FA 3QBTB 4MGXA 5JDSA 2NY6B 2E8YA 1X6LA 1DQQB 1MAJA 1QRNE 1FFRA 2DQGH 5HD8C 1ZVYA 2OTWB 3IU3B 2GJ6D 1WIOA 3MMEB 4HKBB 1B4JH 2MMXA 1NMCB 3WJJC 3BD4A 1MNUH 1CFNB 4FZEH 1CLOL 5D5MA 1ZS8B 3KYKH 2YK1L 5ICZA 1YEEL 5ESVB 5C0CE 5D1QD 1LWRA 1VA9A 3P0VH 5HVWA 4KY1H 3WO4C 3QJHA 3GO1H 5FUCE 4YHNB 1I7TB 1QHPA 1FC2D 2NXZB 4NSKA 2JJTC 3ZT7A 2R0ZL 4JKLA 4P2QA 4OKDA 4P2RE 3GEWB 2FIKA 2VZTA 5JMRA 5DSCB 3I6GA 4KZDH 1WBZA 5GZOC 4KI1A 2YD8A 4LCWA 4XPFL 3O8XA 2OM5A 4PY7B 4U33A 5I8OH 4F33A 2OJZH 4WCYL 1Q9OB 3G04B 5B39B 2PF6A 1D9KA 4U4BA 2R0KL 4OCWH 3CCHB 1ZVSA 3FFCA 3O3AA 5KJRL 1X5HA 3I50L 4Q9RH 1IVLA 1FZJB 3DI2B 3HNSL 3LV3A 4F2MB 3OKKB 3U9UB 1DEDA 1NCAL 4OGAD 1EFXA 1T1WA 1OTTD 3QUYB 3WLWD 4PRHD 2BSSB 3Q6GH 5DMKA 2MKWA 3SJVD 3MUHL 1H3PL 4PBVC 1A9EB 5CEZD 1J1PH 2ZUQC 5GPRA 1FNSH 4X7DC 1CK0L 1B0GA 1ZTXH 4B53A 4M7JH 1FC1A 1G7MB 5DUPH 2H2SC 3QDJA 1WTLA 3GSNA 5E94A 4Y19B 4YIQA 3GKWH 2R0LL 2BNUA 4FQQA 5KW9L 5CCKL 1T1ZB 2IANA 1QVOA 2J7LA 5FUCC 2P8PA 2DLHA 1S5IH 3DIFA 1ZMYA 2H2PD 4JCMA 3ARGA 4PB9L 4ODHL 3HZMB 4JREC 3LN5A 3U4EB 1G6VK 2KDGA 5DD3L 3RL1B 4UMGA 1AP2B 3OZ9H 2VLRB 5I1GL 2OZ4L 3U4BL 4JHAL 4YAQA 4JN2B 4CADB 1F4YH 3CC5A 5DZOA 5BW7C 2I5YH 3RL2B 4OCRL 1N6QL 2FWOB 1IC4L 1RJZA 1AY1H 4TQEH 2BJMH 2X4QA 2AI0H 1KC5H 4OCYL 3Q2CA 1HSBA 1P4IH 4F7TB 5KVDH 4XBEH 3HZKB 4XMLL 4ZYKB 4DN4H 1P1ZB 1X4XA 4RRPA 1MHCA 1TVDA 4NHCH 3HRPA 5K9JL 4ZS6C 4P5TC 1UENA 1TZHB 3UPAA 3KPOB 4BUGA 3VXTB 3SDCB 4KJWD 3H7LA 1S3KL 1MH5A 2APFA 2VIRA 1KJ2B 1PAMA 3HPLA 4G3YH 4F37F 1A0QL 2UV3A 4PJ8D 4M6AA 4Y4FC 2PCPA 1CFTA 1K8DB 2P7TB 1BBJA 1RIHH 3RIFK 3JV0A 2YD5A 5DJZB 4DFHA 4OLEA 1AI1L 1S7UB 3FO2A 3QEQE 5IVXA 3VXUB 3GSNL 1D5MB 3MRQB 5IP4A 4GAYA 1SVZA 3CPLB 4PY8I 3N1MC 5IHUH 4NO0D 4AT6B 5F6HI 5J12C 4XAKE 5DJAB 1Q9WB 1Q0YL 3HE6D 5CILL 2HH0H 4K07A 3D85D 2AJUH 1MLBA 1FP5A 4HBCH 1S7SB 3EFDL 3G5ZA 3IGAA 3M07A 2NR6C 4PJ9D 1D3CA 5FIEA 4ETQA 3FT2B 5J1AB 1F6AB 5F6IB 3Q5TA 5GGSY 4N0RA 2AJVH 3MR9B 2KQNA 1C08A 5A3ID 1OTUD 5HHPB 4YBQD 3LSOB 1RHHB 3OF6D 4JN1H 4R0LA 3L9RA 4PRBB 4R3SB 4NRZB 4M7ZB 3LKNB 2V7HA 1J8HA 5D1ZC 5CUSH 4D9LL 2VL4A 1BGXL 5IBLC 4EDWH 4PJFB 3QFJE 4ZUSA 5DVNA 2AERT 1VFBB 1RY7B 2UYLB 5ENWA 3O9WB 1W72A 5DR5L 2N4IA 4OF3A 1OD9A 5C07D 4RFNB 1J05A 4XZUA 3ZL4H 3K1DA 1LO5A 4MD0A 5FM5M 2FNBA 5E4IA 3TIDB 3FRUA 3IETA 4MZ3A 3SDAB 1U6AL 4S1DC 3W0WD 4JRYB 4KK9D 5K9QI 3TNMB 2NY0C 4JDZA 1G6RH 5DK0A 2EH8L 3WD5L 2RQ8A 1OSZA 2FECI 4X5WA 4RZCA 4OIIH 1U8OB 1FLRH 3BD5A 3FCTA 5MEQA 4LDEB 4DUWA 4X6DA 3C6SA 4HKJA 4YE4H 4L9LC 2YA1A 2FCBA 2GY7B 4I1NB 5TDOA 3EFFB 3GJEA 3MSPA 1RMFL 3RNQA 4NNXA 5GJSH 5ID1B 3FN3A 4NQCB 5ALCL 3RUGF 4RNRA 4QKXB 3LAFA 4ZAKB 1AXSB 1NBYB 3CDYA 4HCRH 5GSRB 2ESVA 5IB4A 1OW0A 4ZS7H 2VISA 3UPCA 1I1FA 2LABA 4JFYA 4KRPD 1GCFA 5IG7A 4PR5A 1EAPA 1GC1C 3LKQA 1MCLA 1OGAD 1KG0B 5DT1L 2X5PA 4JFDA 2VUOA 4ZUUB 1ZEAH 5GGSB 3UAJD 4WWID 4APQC 4FHBD 5KAQG 3B5TA 3K80A 1MQ8A 1P84K 4XCFH 2W9DH 4K94C 4HS3B 4O2EB 5B22A 1HK6A 3BO8A 2XA8L 4LLAA 4XWGL 3VXSA 1S8DA 3BN9D 1ZHBA 2WQ8A 4WI3A 1OTSD 1A3LH 3CXDL 3I84A 5DEGB 5DRNA 3HZVB 4M62H 4NPYB 1ZT7B 1V05A 4AG4L 4ZFOB 2E5EA 4J4PA 4UAOB 4UT9L 3MLZH 2HWZH 3BGFC 4LSVL 2E9JA 1KYOJ 4Z8FL 4KDVA 4U05A 5GS0C 5C2BL 3L3IB 1T5XB 3LKRA 3IXTA 4MA8H 1M05A 2FYYB 3VG9C 2BNQB 1KPUA 2YPLA 4TUOA 3C6LC 2XFXB 3U0WH 1K4DB 2R9HD 3V2AR 1KXTB 5GZND 3VG0H 5MEOA 1ORSA 2N7AA 3EJZC 1TJGH 1AHWC 2GT9B 3DLQR 4I0PC 1J0KA 1DR9A 2WNGA 2X10A 4R2GD 3LQMA 5DMYA 2Y5TA 4Q6YA 1MHPH 4WO4C 3ZLQC 1Q9LA 4GXVH 3EDKA 5T5NG 1BFSA 2DI9A 1KJ3H 3NFSH 1T7YA 4FP8L 1C7TA 5F1SA 5FYLE 2AJ3A 4OZFA 5HJ3A 5KVGL 5KVEH 4D3CL 4HKXA 5T1KD 2FBJH 4UI2A 4ZDHA 1CCZA 1KFAL 5F3BB 4YGAB 3TBWA 3CH8A 1K85A 2NY3D 3OKOA 4MB4A 3U9PH 4OGZA 4X5XA 3T8XA