3EJYD

Structure of e203h mutant of e.coli cl-/h+ antiporter, clc-ec1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyD01
1ZMYA 1A64A 4ODHL 4S1SL 3EJYD 4WFED 1EUTA 4ZQKA 1RZKC 1ZWIA 3O4LE 5LWYH 4KXZI 4W6YB 4IMKC 2E27L 5D1XB 4BZ1L 5KS9B 3QO1A 3QQ4B 4M7LH 1QYGH 2NY0C 5I74C 2DI9A 4I0CC 1MH5B 5DDHA 4PGDA 1U0QA 4M9PA 5CAYB 2GFBA 1I1AC 3T4YA 1E6JL 1LO2H 3QJFB 3BEWA 1OD7A 5HSFA 1QLEL 1NCTA 3HZMB 4PRIB 3WNPA 1GCFA 2J88H 4DVBB 3HS0B 3SDXF 4GW5B 2OLDA 3QISA 1ACZA 3G5YB 3QUZC 2J8UF 3AAZA 3W82A 43CAA 5IIEA 3F8UB 5B39G 4LU5L 1IM9B 5ESVA 4LCWE 1NMAL 5CD3A 3SE8L 3PL6A 1BF2A 1UXSB 4L3CB 3VD9A 2WWKT 2CDGA 5DYOB 2ZSVA 1FIGL 1N2RB 1IRAY 4M7JL 3MFGB 3G5XA 1INQA 5CILL 5FYKL 5F7FA 2E7HA 2J5LC 3IJSB 3LIZH 5EZOH 4EXKA 2DAVA 1QO3B 4PJGA 1TZGL 3NGBC 3ARGB 1IQWL 3P4MA 3Q1SH 1C1EH 4Q7DA 3QEHA 5C9KA 3CXHK 4TRPH 4YHYC 4OCRH 2CGRL 1C16B 4XHJD 4G8EA 5I71C 2HJKB 4LCIL 3KYKH 4L8SB 1VFBA 4JPVH 3BT2H 4LOUD 2DIJA 2DQIH 2FGWH 2AJSH 3MYZA 3H42L 4QHKJ 3TT1L 5D1XA 5KS9A 3QQ4A 1IGFH 5K9KB 1SEBB 4N90D 2GJ6E 4NQEB 4ONGL 1MH5A 4R8WL 3Q3GB 4NP4L 4OI7A 5E56A 5LBSH 2NY5L 2NXYB 3QJFA 3WS6A 5F8RC 3QQ3B 3WIHA 3MLSH 3HZMA 4J2XA 2VISB 2EO9A 1EO8H 2MSPA 1SQ2N 3PP4H 3HZVB 3UJJL 3HS0A 4KHTL 5MERB 1VB9A 4GW5A 1B0RB 3G5YA 4K3GA 3SDAD 1NGQL 2QKIB 1WISA 2YMXH 4YHZL 3B8YA 1IM9A 3VW3L 1T1YB 3WL9B 4JQXA 3TPUB 2F9BT 1C08B 1PDKA 4QXUL 3U46B 4JG0H 1UXSA 4L3CA 4CVZB 5BV7C 2O61B 2EEDA 4RGOH 5DYOA 3SDDD 1SBSL 2FB4L 2OJZH 1N2RA 2FHFA 2VN7A 5JR1H 1X5IA 2EE3A 4E5XB 3X17A 5K9QI 5DJ6B 3TIEB 3IJSA 4KKCC 1QO3A 4AEEA 3ARGA 1S9YB 3EHBD 3H7LA 5DMIL 2EXYD 4V2BA 4HGMA 2APBA 3L5IA 4Y19B 1LK2B 4PRIE 3ZL4H 3PE9A 1C16A 1IC1A 2GTWB 5CJQH 4OLZH 3HRZB 4WGVB 4ERSH 1A0QH 2HJKA 1FC2D 1T7WA 4NN6C 4H8WC 3LHPL 4L8SA 1YNLH 1KPVB 4B7LA 4XVJH 3VG9C 4AJ0A 3Q5TA 3L3KB 3LPFA 5LWYL 2BJMH 1QSEB 3HN3A 4AEFA 4LHUG 1B90A 4M7LL 3OPZH 5K9KA 2D7PA 1QYGL 1SEBA 3IDXH 4NQEA 4RDQF 1W8OA 2IALB 1SBBA 4U6VH 1LO2L 5GGSB 3QQ3A 4HD9A 3EUUA 3PUCA 3QUXD 3RGHA 2VISA 4WI3A 2J88L 4P48A 5FV2A 3HZVA 4IJ3C 2E9WA 5AEAA 1B0RA 1I85C 2QKIA 2VZOA 2XFXB 2V6HA 3BQUB 3L9RA 4U49A 3RRQA 1KIUA 3CVIH 1HHKB 2VDPH 1VFMA 4XP6H 1T1YA 3WL9A 1JYWA 4JGJA 3TBTB 1KTKE 4Y8DC 3TPUA 1C08A 3SGJA 3U46A 4JFED 3T2NH 3G6AB 4CVZA 1SVCP 3M07A 3QBTB 2EDJA 4G7YH 4HIXH 4E5XA 4P5KB 5DJ6A 3TIEA 2DTSA 3SDYH 3LIZL 5EZOL 3IDJB 1S9YA 5D71H 1CI5A 3Q1SL 1C1EL 5HI5C 2XWTB 3JWDC 4TRPL 3VXMD 5JXEA 5JIPA 4QHNB 3QFDB 4OCRL 2GTWA 4CDGC 1DTUA 3SDXB 5HVWA 1X6NA 1AHWC 1ACYH 5JZ7D 3KYKL 2X4PB 1T5WB 3QDGD 1KPVA 4JPVL 3BPOB 3BT2L 4LSUL 4NGHH 4YK4C 2J8UB 4Y1AE 2DQIL 2FGWL 4LASH 4UQ2B 3T65B 4NCDA 2AJSL 1JZ3A 2P7TB 3BGFB 4Z7VF 5FCSH 1QSEA 4NQVB 1IGFL 3LN9A 3KHQA 4KDVA 4X6BB 1F6LL 4JFQB 5LBSL 4QOKB 2IALA 4N0FA 3K1KC 4QLRA 5GGSA 3B6SB 3L3HB 3MLSL 5IG7B 1EO8L 3LPGA 3K7UA 5C0BD 3PP4L 3LAFA 1Z3GL 4OLUH 4Y19E 5JOPE 3GJEB 3BQUA 2YMXL 3GJFB 4XT1C 5E99L 5FYKU 1XAUA 4OCMC 4R4NC 1H8SA 4P4KC 1FFOB 4XI5D 3RX7A 3TBTA 4UIMA 1ZLSL 1D5BB 2VERN 3D3VB 3GMMA 4GLRH 4MCZB 4JG0L 3G6AA 2D2OA 5E7BA 3BGAA 3CDGA 5JR1L 1WWWX 3RHWF 4P5KA 3IDJA 2E7MA 2DI7A 3O2VH 5TE7L 3LS4H 5EBLB 3AM8A 2R0ZH 2XN9D 3ZL4L 2XWTA 2CUHA 4QHNA 3WDHA 3QFDA 1J10A 3ZT5A 3O9WB 5CJQL 3SDXA 4ERSL 1A0QL 4XNZC 3K46A 3C6LD 2X4PA 1T5WA 1YNLL 1U9KA 1UKTA 4FQ1H 4XVJL 2J8UA 3DJ9A 4NCC1 4UQ2A 3ZYJA 3ZKND 4V1DB 2P7TA 4UIKH 3QEGH 1DN2A 3T0XA 3U2SB 4NQVA 2APFA 1NMCB 3OPZL 4R3SB 4KFZC 4PJHF 4X6BA 3IDXL 4DWHA 1QHPA 4JFQA 4TVPD 4BSWB 4EKXA 4U6VL 1KPRB 3JV6B 2Y6SD 3B6SA 3L3HA 1T5XA 1YPZF 2XKUA 4JM2F 3RNKB 5M7QA 2YA1A 5IG7A 4DVRL 4GRLC 4XNQB 5BCAA 1CN4A 1H9VA 5GQBA 3QG6B 4RMRA 3GJEA 4OGXH 3GJFA 1YYMH 5J06A 3CVIL 4G8GD 2VDPL 1WAAA 3SDXE 2E8ZA 1EFXB 1FFOA 3C60B 1KJ2B 4ZOAA 4GW1B 4H1LB 4GKOA 5F7DB 2J8UE 1D5BA 3T2NL 3D3VA 4MCZA 1NFDF 3P77B 5HVFB 2O5YH 5JMOC 4G7YL 4HIXL 4Z7NE 1PY4A 4XB8A 3DPBA 4DN4H 4I5BB 2EC8A 3ROOB 3SDYL 1U36A 3VD5A 3X14B 2OZ4H 4QOKE 5D71L 5TDOB 5EORH 5EBLA 3O2DH 5DD0H 1DR9A 3JV5A 1VDGA 5A2FA 4XVSH 4JO3L 4ETQA 5JW5B 3O9WA 2HFFB 4W6XB 3KNBB 1BFOB 4NC0B 4WI6A 3X12B 1ACYL 3QA3B 4NGHL 2HT3C 4HKZA 5EULV 4RMSA 1J1OH 3KHOA 4LASL 5L6YH 1A3LH 2NTFB 4V1DA 3W0WD 3UJTH 4H88H 1ZAGA 3MOBH 3PQYD 3U2SA 1L0QA 4HX1B 4R3SA 1F97A 5CHNB 3TEUA 3D3VE 5MEPB 2APXA 4JPKH 4G9FE 4N0YL 4BSWA 1KPRA 3JV6A 5CP3H 4HIIB 2H32H 1CDGA 4RBPK 2VWEC 4XNQA 2EDEA 3RBSA 4X6DE 5JHDB 5HHPA 4JN1H 2AJZA 2OL3B 3QG6A 1G9MH 4OLUL 5CJXA 3E6FB 4X4ME 5CIPB 3FQTB 4OD2B 4QRRE 4F7MB 4U31A 5F1IB 1JVKA 2IADB 3B83A 4DZBA 4WW2C 1EFXA 2VZ3A 3C60A 2BOBB 4EQ2A 2GIYA 5DMYA 4GW1A 4H1LA 1KB5H 5F7DA 3HMXA 1ZHLB 1CGVA 2XTJC 3P77A 4V1DE 4CN1A 3BESR 2G75B 5EIIB 3Q5OA 4Z7VB 3BKJH 2PF6A 3O3BB 3E2HC 4TNVK 2G5BB 2WUCH 3X14A 4NO5B 5FB8B 5TDOA 3O2VL 4RZCB 1Q38A 4XP5H 3LS4L 2R0ZL 3LQMA 2YRPA 2Y1VA 5GGVY 1R5WB 5DQ9B 5JW5A 1JZ6A 4JGUA 3KNBA 1BFOA 1DL7H 1JPSH 2DICA 2EDOA 4ZUVB 3X12A 4K94C 3QA3A 4R90H 4FQ1L 1IQDB 4NUGH 4P5MB 3FTGA 3KPRB 1TQCB 3C9NA 1J0HA 3AREB 3QEGL 4IIQB 4UIKL 3RIFK 1UWXH 4ZPVB 1F90H 4PTTB 4HX1A 4ALAH 3LPWA 3QRFM 3B2VL 1I7TB 2YOCA 4I4WB 3W11C 1T83C 2BC4B 3O2WH 3BN3B 4TSCH 3CXDL 5JHDA 2OL3A 2E9IA 5DVMA 3E6FA 5BV7L 5CIPA 3FQTA 4OD2A 4F7MA 4OGXL 3DETD 1YYML 5F1IA 4C4KO 2IADA 2BVTA 2ZUSA 2BOBA 4OFKA 3AB0C 4QRUB 1DBJH 1KLGB 3TJEH 4Z0BH 5FIEA 3NN8B 2G75A 2O5YL 5EIIA 1JWSB 3DXAD 2N7BA 2HTLC 1VGEH 2LAGB 2WSKA 3U30B 3P9LB 3O3BA 2HJFB 3SQBA 2EDHA 2G5BA 4PJHB 5HXMA 1BBJB 2OZ4L 4NO5A 4RCAA 5FB8A 4RZCA 1P7KB 4UUJB 5EORL 3O2DL 4JM2B 1YPZB 3DX7B 1CICB 3BRFA 4LCWD 1R5WA 4X4ZA 2FH6A 4XVSL 4OLVH 4EN3D 1ZHKB 4BZ2H 5GIRA 5KSAB 4ZUVA 4LQFH 3FT3B 5IF0B 2R29H 1IQDA 1J1OL 1MJUH 5L6YL 4WFFE 2EDRA 1A3LL 4P5MA 3KPRA 4G6FD 4IIQA 4MAYC 3AREA 3D87B 4H88L 4MQSB 5CGYC 3MOBL 4JJHA 4ZPVA 4PTTA 1WCBA 2OK0H 3RP1A 2C4XA 4JPKL 4HC1H 4HIJB 1I7TA 1MCHA 1IL1B 1NFDB 4RGNB 5J4MA 4Z7VE 5HPMB 4I4WA 3P4OB 2BC4A 1NC4D 1QR1B 3RY5A 4D0BB 3JBG7 3MLRH 4P5TB 4JN1L 5F93C 1G9ML 3MRMB 4RFNB 4JPWH 3UDWC 5HHMB 1TFHA 5IMMB 3UTZA 2MMXA 3IVKA 4U33A 1WFUA 1XGRB 3BGMB 1F13A 3PL6D 3FB8B 4QRUA 1KB5L 5CINH 1KLGA 2G60H 2J3SA 3T2OA 3NN8A 3OR6B 4Z7WF 3JWDL 5K59F 3KPRE 2CMRH 1JWSA 2NY3D 2NZ9D 5IESH 3BKJL 4G6KH 1KTRL 3SKNA 3P9LA 2HJFA 2OR7A 4PJHA 3QIBB 2WUCL 1P7KA 4XP5L 4UUJA 5IQ9B 4KV5F 4JM2A 1YPZA 4L3EE 1A7NH 3A6BH 1OCWH 4PLJD 2CO6B 1ZHKA 4XMKH 1DL7L 1JPSL 3GDBA 1I8LC 5KW9H 2WINB 3CH8A 2WIIB 3OXSB 3FT3A 5IF0A 4R90L 1RZJC 4MA7H 4MLIA 1RPQA 4OFIA 3T08A 5AAWA 5D1XD 4NUGL 1XF5B 1ZSDB 4FFVD 4CN6A 1J7VR 2WBKA 3QNZB 1F90L 1GC1H 1T0NB 4ALAL 2XZZA 2VXSH 2WZPD 5JUEH 4M6AA 3DYPA 2FR4B 1U8QB 4HIJA 3TA3A 4PRID 1NFDA 1IL1A 2BY0A 4GS7B 5HPMA 3P4OA 3SE3C 5IB3B 4UILH 1QR1A 3O2WL 4D0BA 4O2CB 4MD4A 4P5TA 3FQUB 4PJHE 4TSCL 1KACB 4LNVA 3BAEH 3MRMA 3UZEA 2F53E 2ADFH 3P30H 5D6CB 1BZQK 3OKKB 1A4KB 1T4KA 1XGRA 3BGMA 4U1JA 4APQB 4P46C 5C0FB 1KCRH 1MIEH 5I73C 1DSFH 3FB8A 3TJEL 4Z0BL 5F6HI 3OR6A 3C09C 4NPYA 1NCNA 5E70A 2VIRB 4U4BA 2EO1A 4LSPH 5H37H 4MAUH 1VGEL 1FVCB 3ARGD 1FDLH 3T2QA 2LTQB 3QIBA 3VE0B 4MHHI 2NXZC 4LHQB 1HHJB 4GRMB 1YEDA 5EN2B 1U3JA 5IQ9A 2CLZB 3U48A 3F7RA 2CSPA 1QFPA 1VERA 3ELAT 3QIUB 5ESAB 1K4CB 4I18C 2E7LC 3ZTJG 5ICYB 5EA0H 4OLVL 4BZ2L 1IKNC 3R0NA 4LQFL 5HHME 4OUOA 3RWFB 3FRPG 2UVEA 1MJUL 4LARH 5C0RH 4HUUB 1XF5A 1NC2A 1ZSDA 4NQED 1X5XA 3QNZA 1T0NA 4YXLH 2OK0L 2DKMA 3BIBX 2NXYD 5C7XH 3FB5B 4HC1L 1U8QA 1XCQB 2BHZA 3CJJA 2NYYD 2MFNA 3FO2B 3L3DB 5TH2A 5FM5O 5IB3A 3ARQA 3CFCH 4O2CA 4WV1B 3MLRL 2PYFB 3FQUA 4Z95H 2N4IA 1UCBH 2E9BA 3NA9H 4Y4FB 3WD5H 2ITCB 3L6FB 4JPWL 2UYLB 5D6CA 5GRJH 3UC0H 3OKKA 4R7DB 3R8QA 1A4KA 2XWBB 3T0AA 4JHWH 1OLLA 2Z92B 3TPKA 4APQA 5C0FA 2FD6H 4TYUA 1BM3H 5CINL 5I1LA 3DGCR 3IAQA 2G60L 4KI1A 4JO4H 2DL2A 4OQ1A 1T2XA 4LPWA 4I48B 2VIRA 1KB9K 4BYHA 2CMRL 1O0VA 5IESL 4G6KL 3ULUF 4Y2DB 1MI5B 1Q1JH 2YR3A 3VE0A 4Y19D 3MLPA 3QXWA 1HHJA 4GRMA 5JOPD 1T66C 2AP2A 5EN2A 5JXED 5HI3C 2J4WH 2CLZA 1I8KB 3CCHB 4PJ7E 4JFHD 1A6AB 1A7NL 3A6BL 3QAZB 3QIUA 1OCWL 5ESAA 4JFYA 1K4CA 2C26A 5KSUB 3RL1B 5ICYA 3X3GH 1CIDA 4FZ8H 4XMKL 2B20A 4HZLA 4LK4A 1KV3A 4MA7L 3RWFA 3DLQR 4HS8H 4U0RC 1QSED 1Z5LA 4DZ8B 3OAZH 2CXKA 3C8HA 1TETH 5JW3H 4OKVB 1GC1L 5IJKC 3B2UD 2VXSL 3PP3K 3FB5A 4PRPE 1XCQA 5IK3B 3L3DA 4Z7WB 3FO2A 1EHAA 2Q3AA 4UILL 5CJ5A 4WV1A 2PYFA 1BREA 4Y4FA 3BAEL 2ITCA 3BQUD 1LDPH 3L6FA 1SYSB 1IT9H 5E8EB 1DFBL 5L2KE 3MODH 2ADFL 1VADB 3P30L 3T0EB 4PP1C 3I9GH 4R7DA 2XWBA 5HDBF 3DBXB 1FORL 2Z92A 4U7KA 5E7FA 1KCRL 1MIEL 4OFYA 1DSFL 3U7WH 4BQBA 4M8QB 4QO1A 1B0GB 1RJZB 5GS0C 2Z4QB 4Z78B 4I48A 4PJ5B 5FYKE 4M7KH 3C2AH 4LSPL 5TQ2H 4MAUL 4Y2DA 1MI5A 1FDLL 5CSZB 4U1NA 5F9DC 1WEJH 1KLUB 3EO1B 2F74B 2QQQA 1INDH 3FAWA 4TNWK 3CCHA 1I8KA 4D0DA 1A6AA 3VXRB 1XF1A 1UADC 5KSUA 3RL1A 5EA0L 3BI9X 1QSVA 1XGQB 5I9QB 1ZVHA 2G2RB 4LARL 5C0RL 4DZ8A 2R8SH 4HJGB 1J5OH 2WBJC 4PP2B 1XGYH 2E7CA 1T3FB 4OKVA 3GMRA 2I60H 4YXLL 1N0LA 1PX3A 2HRLA 2D4DA 4QOKD 5C7XL 3FN3A 5IK3A 4Z7WA 1GAFH 1KYOJ 1S9WB 3Q6GH 5MEQB 5A43C 1CFNB 4LLMB 5F97E 3ZZ1A 1MI5E 1EBAA 3CFCL 4HXBH 5FUCE 2QSQA 5GRXG 4Z95L 1UCBL 3NA9L 3WD5L 5D93B 5AAMA 4BKLB 5E8EA 1S5HB 1VADA 2ZJSH 3T0EA 5GRJL 2QADB 3UC0L 3U4AA 3AS2A 1I8IB 5J11B 3DBXA 2F54B 1BECA 4JHWL 1B0WA 2FD6L 3OKOB 3D3VD 4OQTA 1BM3L 4M8QA 1H5BB 4JO4L 1B0GA 1RJZA 1PSKH 4Z78A 4PJ5A 5ITFB 1L6ZA 2L4OA 5JDSB 4XPAH 3UEZA 1MJ8H 4H0HB 1TPXB 1JZ4A 4FG6C 4PB0H 2XZCH 1Q1JL 5CSZA 1KLUA 3EO1A 2F74A 4Z7WE 5DSCA 2NY2B 1RAMA 2KUTA 3K80A 4HFWB 1RIUH 2J4WL 3KS0H 1YQ2A 2VQUA 3O9WD 2D9CA 3VXRA 4F15B 4JO1H 3X3GL 4QWWD 4KJPC 1XGQA 4FZ8L 4Y5XB 4Z7OF 3UROR 4KV5E 3HMWH 2G2RA 4V1DD 1OVZA 5GS1C 1NL0H 4HS8L 3O41B 3K4AA 3CX2A 4HJGA 4PP2A 1TETL 3L3GA 3QCUL 1T3FA 2WP3T 3WFCL 5JW3L 3U9UB 5JW4Q 2BFVH 3VI4F 3RVWD 5IB1A 4P9HC 3NFSH 1JPTH 5F9AC 1DQJB 1S9WA 3QI9C 4P2YA 5MEQA 4IRSC 4LLMA 5FDWB 3ARTA 3PGCB 1IGIH 2X2YA 3MJ9A 2C1OB 2IAMC 4X9IA 1MCCA 3ARBB 5DC0A 5ETUB 4BKLA 1IT9L 1S5HA 3O6FC 3MODL 3VXRE 1A8JH 1KCLA 3CMOH 1OWRM 2X9XA 1EFXD 3I9GL 3C60D 4PPTA 2CK0H 1I8IA 1KFAH 4PRHB 2F54A 4ZOEA 4LVOC 3U7WL 3OKOA 3CNKA 1H5BA 1QBBA 5C1MB 1JYXA 2HLAB 3DX6B 5ITFA 3C2AL 5JDSA 5TQ2L 3ARFB 5DFVD 3QG7H 3U0TB 4Y0GA 3MROB 5LG1A 4M61B 1WEJL 5D2NB 3E3QE 3LKRB 1LP9F 4HFWA 1INDL 5E0QA 3RTQC 4YBHA 5EBWB 4J3UA 3L3JB 3CH1B 2OR8A 4OKDA 4DTGH 4QKXB 4FQ2L 3PV7A 3FMGH 4HWNA 4ORGB 5CEZH 2MKWA 5EO0B 2H1PH 3O41A 2ITDB 3AU1B 5J1AB 2R8SL 1JNNH 3BWUC 1J5OL 1XGYL 3TBVB 3GHBH 3U9UA 1ZLUK 2DM2A 2I60L 3CMGA 2VITB 3PJSB 3S96B 1Q0XH 3EOAB 2Z8RA 1GAFL 3S4SB 4GRWH 5JHDD 5FDWA 1KCSL 4HXBL 1FNSH 3PGCA 1F4WH 5F7UA 3NPZB 1AGCB 2W38A 4WCYH 4PB9L 1KLFA 5ETUA 2MOVA 3MBXH 5HYJE 1NBZB 2ZJSL 5CGMA 2XIDA 3ZHDA 2I9LB 4PRHA 5JORA 1IGCH 1T7YA 2JIXD 3L5XH 1Y18B 4EIZC 5KSBB 1JK8B 2C9AA 2HLAA 1PSKL 5KAQF 3DX6A 4L9LC 1GJIA 5AYUH 3BPNC 4XPAL 5DVOA 1MJ8L 3ARFA 3U0TA 1V3KA 2XZCL 3QCVH 2EDLA 4M61A 1CLYH 1U8LA 3BIKB 3HA0A 4XHJC 5D2NA 4Q58C 3LKRA 1XT5A 2ZSWB 1UQSA 3ZE1F 1RIUL 3MSPA 4O02H 4QCIB 3MRRA 4KWUA 3L3JA 1MHCB 3CH1A 4G43B 4JO1L 1REIA 4HQQH 1DBAH 4ORGA 4BSVB 4YFEA 2J6EL 5EO0A 3KPRD 4PJFF 3ARED 4JY5H 1NL0L 3DSFH 2ITDA 3AU1A 4PRHE 5J1AA 1AJ7H 1I3GH 3TBVA 2NW3B 1PG7H 2OI9C 4YHPB 1A3QA 3QUMH 1CVRA 1RURH 3S96A 3EOAA 3NFSL 1JPTL 1RFDH 3MGTB 3S4SA 1XMWA 3SDAC 1Z2KA 2DLFH 4TUJB 2KKQA 1RK1B 3GO1H 3RVTD 4YHKH 1IGIL 1HXMB 1YDPB 3RWCB 1ZGLM 1YMMB 1X4YA 3RQ3A 4QXWA 1X5AA 1NBZA 3CMOL 4J3SA 2CK0L 3BZFA 2I9LA 3D39B 1KFAL 4PJAE 3SDDC 1Y18A 5KSBA 1JK8A 3D25B 3O3UN 5IT2H 4PYGA 2EXYC 5HDBE 4AEIH 1RVFH 3GK8H 3QG7L 3QEUB 3MRKB 2MCPH 4BJLA 4M00A 3BIKA 3ESUF 1AXTL 2NX5B 2F53D 4JM2D 2ZSWA 1CICD 4QCIA 4PJCA 2JKXA 1MHCA 4G43A 1B6DA 4M1CD 5KSAD 4DTGL 3AY4C 4PJ9B 5MI0B 3O3DB 3FMGL 4BSVA 1GGBH 5CEZL 4K07A 5JXAH 2FECI 4NZDA 4RNRB 4DGVH 3GHBL 2NW3A 4W70A 4MA1B 1QHOA 4X7TB 4HHAB 4YHPA 1WWAX 4RGND 1Q0XL 1INEH 1WZ1H 5HHOE 1X44A 3MGTA 5LJYH 1BOYA 4NM8H 4LEOB 4P5TD 4PR5A 4TUJA 5IR1B 1RK1A 4I9WE 5J9PB 5DO2D 1F4WL 1PX4A 4XRCB 1TZHA 3RIAK 4WCYL 1HXMA 1YDPA 4OSUH 3RWCA 1EHXA 3FKUS 5HHMD 1LP9B 1YMMA 2A2QT 3MBXL 4H1LG 4ZFGH 3HNSH 5EU6B 1DBMH 2DLHA 3D39A 1IGCL 2H26B 3KYOB 1IVLA 1GIGH 3L5XL 1U8OB 1NLBH 3D25A 3ORJA 3TVMC 2FNBA 4RDQG 4YHOH 5I1DB 5AYUL 2XTLA 3QIBD 4J8RB 1P4IH 3QEUA 3MRKA 3QCVL 3P73B 1CLYL 4YWGH 5F9JB 2NX5A 4C55A 3N85H 4M93C 1G0YR 2MWCA 5JZ7C 4O02L 3TN0B 5BRZB 5BO1L 2PYEA 3KPPA 4BQ8A 2EYRB 3VGGA 4PJ9A 4HQQL 1YMME 1KB5B 3O3DA 3QB7C 1DBAL 4WHYG 2VLJB 3WKMH 3BDXA 4W4NA 1I1FB 5HGHB 4JY5L 5JPMB 2W59A 3DSFL 1AJ7L 1I3GL 4RBPH 4RNRA 2E6PA 1OQXA 4L1DA 5E9DB 1OWWA 3VGAC 3QEQA 1PG7L 3BFOA 1H3UA 5E6IB 4Z7OE 3B3IB 4X7TA 4HHAA 3U79A 3QUML 1RURL 4WI2A 3GJFK 2OZ4A 1OAQH 1RFDL 3GBMH 2HH0H 4KI5F 3O2DA 3KPNB 1U41A 4LEOA 2V5RA 2DLFL 5IR1A 3GO1L 3VI4E 1X5YA 2Y72A 1OAZH 4LGRB 4YHKL 3ULVH 4XRCA 2NX5E 2CK2A 3SDCB 3U4EB 4XI5C 1LP9A 4K7PX 3MTRA 1A6VH 4L8BB 2VABB 5EU6A 1MCWM 3QXUA 4APQD 4ZUTB 2W92A 5DA4A 4CJ0A 4TOYH 4XP9H 2H26A 5I1AB 4OFDA 1U8OA 4YR6B 3FB6B 4F7CB 5IT2L 4PJFB 1R3HB 4AQOA 3HE6B 5CP3A 2EIBA 5I1DA 4DCQA 4AEIL 1RVFL 2DQCH 3GK8L 2FX7H 3RAJH 4J8RA 1S7XA 2MCPL 1PKQB 3P73A 1MY7A 5F9JA 4OIIL 3MRLB 4WEMB 1RU9H 3C6LC 2FYYB 3KPSB 3BPCB 3QIUD 1V8HA 5BRZA 3TN0A 2N1KA 2COQA 1BJ1H 4JJ5B 5H94B 2YXFA 3MCG1 2EYRA 5DT1H 4ZMAT 2P45B 1YY8B 1KB5A 1ITBB 2VLJA 1GGBL 5EU6E 1I1FA 5FYKD 5HGHA 5JPMA 5JXAL 1BGXH 5F7HA 3S5LB 1A1OB 2Y6SC 5E9DA 4DGVL 4LSVH 4I8DA 3O4OC 5E6IA 4DGIH 4BZYA 3B3IA 4WI5A 1RZFH 3KJ4C 1INEL 1WZ1L 5KVDH 2BVQB 4JO2H 4RGMC 2H3NA 3KPNA 5EU4B 3RA7H 1SVZA 5C0CB 3GIVB 4UOJA 4Y4FD 4R97B 2AJ3B 4BSJA 3SDCA 3U4EA 4OSUL 4HWBH 1HHGB 3D0LB 2VABA 3VD4A 1ES0B 4NHCH 4ZFGL 3F5WB 4MD0B 4FQJH 3RY6A 1DBML 1X7QB 3DYMA 1UM5H 4ZUTA 5IBTH 1R5VB 4WUUA 3TIDA 1CTOA 5I1AA 1GIGL 5J56B 4LPUA 2W9DH 4CDHA 3GB7B 3DMMB 1NLBL 4YR6A 4PJFA 1R3HA 3HE6A 4YHOL 3WIFA 1V3LA 4Y2DD 1MI5D 4DN3L 3SE9H 1P4IL 5ID1B 4RQQB 1PKQA 4N1CA 4YWGL 3MRLA 4XNXL 4HK3N 3KPSA 3WN5B 3BPCA 4R0LC 4JKLA 4JJ5A 5H94A 4RAVB 1NAKH 1FN4A 1YY8A 2YD4A 3KYMB 3DI2B 4V2CB 4U6TA 3ZE1E 3WKML 1LDSA 4NWTH 3CLEH 5T3XD 4PLKC 1SMAA 1OP5H 2VLRB 3JWNC 5DJ0B 3S5LA 3O11B 1A1OA 1G7IB 1G6RH 2C4FU 3VRIB 5BXFB 3LV3B 1GVIA 4PJFE 1OAQL 3GBML 3HI6H 4J23A 1U3HD 4LCCC 4XP4H 1ZV5A 5EU4A 1AXSB 4Q9CA 1UYWH 3CAFA 5C0CA 3GIVA 1PKQE 3ULVL 1OAZL 1QNZH 2AJ3A 4HH9B 4WJ5B 4F9PC 1NEUA 3TJHD 1GYAA 1IGYB 1JWUB 1HHGA 3LD8B 3D0LA 3T0ED 4KJQD 4PJEF 1ES0A 4S1RH 3F5WA 1X7QA 3O8XB 1R5VA 4TOYL 4XP9L 2V17H 2ZUVA 4XCNA 1FZJB 2AXHA 2BSSB 4PJ5D 4HC1A 3GB7A 2GHWB 4MS8D 3DMMA 4S1DC 2VAAB 3IYLW 5ACMA 2X09A 3GZKA 3X3FH 5JOFB 2FX7L 3RAJL 3R1GH 1YEKH 5ID1A 4HH8A 4RQQA 2IPKB 5DI8A 1FPTH 3BPLB 1JNHB 4AG4H 1RU9L 3VXRD 5CSGA 1S7UB 4YEEA 1RJLB 5BJTB 3O45B 6FABH 5C0CE 5EUOB 2EKJA 3VI3F 5DT1L 4RAVA 1JPST 5DRZB 1MOEA 3UBXB 3KYMA 2VL4A 5DUBA 5FO8B 4Q0XH 1BGXL 2VLRA 3QDMB 3O11A 1G7IA 4LSVL 3ZMRA 3VRIA 5BXFA 3FRUB 5CEXB 3LV3A 4NSKB 4DGIL 3VXQB 2DQHL 5HGAB 5C09E 4BQ6A 2ICES 5KVDL 1MY5A 5T1MB 4HLZG 4JO2L 5C3LD 1AXSA 3RA7L 3DETC 2A0LD 3U83A 3VD7A 4EDXB 4WJ5A 3HC0B 4HH9A 5DJ2A 1IGYA 2VR5A 1CDCA 1HOCB 4RIRB 4NHCL 3TCLB 2F54D 4FQJL 5ISZB 2ED7A 2RQ8A 1UM5L 5IBTL 3O8XA 4Q6YA 3I3BA 2VC2H 1ZT1B 1FZJA 2BSSA 4G7VL 4ACPA 2A6KB 1BQHA 4NZRH 4N1EA 2VAAA 5FGBA 1RI8A 5JOFA 1TQBB 5I19H 3SE9L 3QSKB 2B8OT 1CE6B 1R3IH 2H6PB 2NY2D 2IPKA 3LZFH 2VL5B 3A6CH 4EN3C 1T6VN 1JNHA 2IG2H 3ARYA 4EUPB 5HYJD 2JJTA 1U8NB 4TVPH 5BZWB 3PWVB 1S7UA 3FFDB 1RJLA 5BJTA 3O45A 3RPKA 3CX5J 2ZOLB 3NTCH 5EUOA 5E00B 5ADOH 3QRGH 3L7FB 2IBZY 4MQ7B 2ZWLT 5DRZA 3BMVA 1CXFA 1NAKL 1DE4B 2LFGA 2QR0B 2J8HA 5K9OB 5FO8A 4NWTL 3CLEL 4S10A 1OM3H 1CFVH 1CXEA 5SX4H 3CVHH 1CLZH 2A73B 1G6RL 2DMCA 5CEXA 1EZVX 2QQNH 4NSKA 4PGZA 3VXQA 5HGAA 2APVA 4XBPB 5T1MA 3HI6L 4X7CC 3ULUD 1UYWL 4OD3H 4PRBB 4IEFB 2A1WH 2JJSA 4EDXA 1QNZL 3HC0A 1F45A 1G1YA 3ARBD 5EUKB 1EAJA 3X13B 2XOTA 2EZ0C 4KI5E 2HT4D 3VWKC 3PL6C 2F8OA 4YIQB 2BP3A 4S1RL 4RIRA 3TCLA 4PRHD 1YEHH 5JLZB 4R4BB 1WFOA 2ATPB 1L0XA 1FVEB 5ISZA 2RR3A 4OCNC 2ZUQB 2NY3C 2V17L 1AKJB 1ZT1A 3VGEA 2A6KA 4M7ZC 1V7MH 5J6GB 3QDME 1A6ZB 4MMZC 3ARFD 3NIGE 4YAQB 3X3FL 3RY4A 3ARDC 3R1GL 4IOIB 5F70A 3GSRA 1CE6A 4TUKH 4PLJC 2D4FA 1FPTL 2AEPH 4QHLB 2JK5B 3VXSB 2PTTB 2VL5A 4EUPA 4AG4L 1U8NA 5BZWA 3PWVA 3FFDA 4KJWD 1DEEB 5AZEH 2AJXH 2ZOLA 5JIHA 5E00A 5D1XC 4HXAH 3L7FA 1UH2A 3OXRB 4MQ7A 5F9OH 3GHEH 3AROA 4FFVC 2D03L 2PNDA 1DE4A 3PP3H 4RAUB 2QR0A 4MLSA 3GI8H 5K9OA 5B4MD 4JZNB 2MPAH 3VGHA 4Q0XL 5ISZE 3ZYZA 4GRWF 5D7JB 4NZTH 2BNQB 2A73A 2AXJA 2P49B 1QFWI 4LIQE 4GG6F 4XBPA 2A9MH 2W1NA 2QV2A 4MX7B 2ENYA 3WO4B 4PRBA 2NQCA 4JQXC 1EK3A 1NCUA 2AKRB 5EUKA 3X13A 2IH1B 1B2WH 4HS6B 1NCDH 4YIQA 4KK9D 5ESQB 3WDJA 3EYQC 6CGTA 5T1KB 5JLZA 4ELMF 4R4BA 1CQKA 2ATPA 1FVEA 1U58A 1P1ZB 5IFAH 2XZAH 5IKCA 2W60B 3RZCB 1AKJA 2VC2L 3ARGC 1NQBA 3ZTJH 4NZRL 4Z7UF 5J6GA 1A6ZA 3EDEA 1NBVH 4YAQA 5DD1H 4HG4J 1EEQA 3RDTB 4I9WD 5I19L 5B38B 1R3IL 3V6ZB 4ZXBD 3LZFL 4QHLA 2JK5A 3VXSA 5BVPH 2PTTA 2CR3A 3A6CL 2IG2L 4XMPH 3SQOH 4TVPL 1XH3B 4LPXA 4AMKL 1DEEA 4FXKB 2FEDC 3NTCL 1KENH 5ADOL 2CKBH 1HNGA 3QRGL 3OXRA 1JTTA 1FNFA 2OQJB 4JREB 4RAUA 1RSFA 2HFGH 3MLXL 4JZNA 5CLWA 4X9GA 1OM3L 5D7JA 1CFVL 2BNQA 2NYYC 3CVHL 8CGTA 1CLZL 4P23B 4YO0B 2QQNL 1JTOA 5KVMC 1FYTB 2W0FB 5DMKB 1XCTB 2GI7A 3O3EA 1YEEH 3V4PH 4K8RD 4MX7A 1QACA 4U2YA 4OD3L 2A1WL 3FO9B 4CW1B 2AKRA 1YMMD 3S35H 2IH1A 4HS6A 3EDFA 5ESQA 1PAMA 4OZGF 5C86A 5T1KA 1YEHL 1ZANH 1G0DA 2FJHA 1P1ZA 4L4VB 4YHMH 4YPGB 2W60A 3RZCA 2QLVB 1ZHNB 1ZEAH 4PJEE 1V7ML 3WEXB 2BNQE 3EOTH 3QIWC 2AV1B 4C57C 3RDTA 2RHEA 2NX5D 4FTVB 2HKFH 5F6IB 4TUKL 2BXYA 4NRXB 4GUPB 2AEPL 2ID5A 1NANH 1QBLH 4G8FB 1XH3A 5H2BA 3S34H 1XIWA 1D6EB 3ZHLA 4FXKA 5AZEL 2AJXL 4KQ3H 4PJ9D 5IVOA 25C8L 5F9OL 4ODXB 1NUDA 4OGYH 2OQJA 2N7AA 3GHEL 4W4OA 1KG0B 4Z77B 4WHDA 2VAJA 1XR8B 3NOIA 4ONOA 5EO1B 3B2UC 3GI8L 5D96B 5J1TC 2MPAL 2J7LA 3L5WB 4LVNB 4KZDL 4NZTL 2HVKB 5D6DA 1UJ3B 1N64H 4P23A 4NOBA 4YO0A 3STZB 4KDWA 3HI1B 1IGTB 1URLA 4JLRB 4TPRH 1FYTA 3UTPD 1AE6H 2W0FA 5DMKA 1XCTA 2A9ML 3BQUC 4R96B 2CUIA 1DQMH 4N5UA 5LKNA 2DJSA 3FO9A 4CW1A 3DIFA 5D1ZB 1GZQB 5CJOH 1XGTB 4PJBF 2PW1B 4XBEH 1R3LB 5L8KB 1B2WL 2YEZB 5LXGH 1NCDL 5EU6D 3D2UB 4TTDD 4HMEA 4M6OH 1CVSC 1LO4H 5IFAL 1HCFX 2XZAL 1FFPB 4L4VA 4YPGA 5SWQB 5FUZH 1GGUA 4NRZB 4Z0XB 2Q6WB 1LEKB 3LN5B 3WEXA 4XNMB 4J7RA 1NBVL 2M8XA 4GRWB 5DD1L 3WFZA 2PO6B 4KC3B 4Y8AA 4JKMA 2P8PB 3GMLB 4FTVA 3C8DA 1FYTE 4NRXA 4PYHA 4GUPA 5BVPL 4GG6B 1QFOA 4XMPL 3SQOL 1T1WB 3BPOC 3TN0D 4G8FA 3WIHH 1FC1A 2NCMA 1D6EA 2D7OA 3BGFC 1NJ9B 4JB9H 1GPOH 1KENL 3LEYH 2CKBL 5A16A 3RKPA 1E6OH 1KG0A 2VLJD 2YD9A 4Z77A 1OAUH 1XR8A 2YRZA 2HFGL 5EO1A 5HD8C 4YEFA 1BP3B 3L5WA 5E9DD 4ELMB 5T5NF 1AO7B 2BDNH 2HVKA 4F7PA 4MJ4A 5E6ID 4MDIA 4DAGH 1UJ3A 1MNUH 5C0JB 3S4SG 3ULVF 1FFNB 3STZA 1KYOK 2FSEB 1IGTA 2O5ZH 3HI1A 3T2PA 5B8CB 3G6JF 3G5VB 2ADIB 5F1KC 4Z7UB 5D7KE 5EBGA 1YEEL 4R96A 3V4PL 3DGGB 2Q7YB 1A2YB 3HLAB 3GMOB 1OF2A 2ARJQ 3BISA 4KRNA 3SDCD 3JZ7A 4J12A 1XGTA 1WT5A 5HDQH 2PW1A 1R3LA 3S35L 2YEZA 1E28B 1E27B 2Q20A 3D2UA 4MMXC 4LCYA 4ZAKB 1ZANL 5E8OB 5DD6B 1LVEA 5C3TA 2OTPA 1FFPA 4YHML 5SWQA 4UV7H 5D7LB 4YGVB 4NRZA 1HWHB 1ZEAL 4Z0XA 3SGKA 3SEPA 2Q6WA 5ECJE 3HE6D 1J18A 1LEKA 3HE7C 3LN5A 3EOTL 4U1LA 4XNMA 4Y5VB 3VGFA 3IJHB 2PO6A 3CC5B 3RIFF 2P8PA 5GISH 3GMLA 3S97C 4MJ5B 1NGZB 2HKFL 5HTSA 4M02A 3UMTA 4QWWC 4GG6A 1NFIA 5IB2B 1T1WA 1QBLL 5BZDB 2MHAB 3G04B 3S34L 1DUYB 1JI2A 4GG8B 4O2FB 1NJ9A 2WM0A 1WJ3A 5I8EB 4L4TE 1R0AH 4OGYL 1NMCC 4LLDB 3U0WH 2KZWA 5CEZE 3V95A 2OSLB 4ELMA 3OJVC 4M3KB 1AO7A 2A6IA 1HDMB 1NGYB 4XH2B 2YZ8A 1T1ZA 3BD5A 5C0JA 1DVFD 2CD0A 1N64L 3OL2A 2FSEA 5B8CA 4OF6A 1W0VB 4LPTA 4WTXA 5DVKA 1J88A 1AE6L 4Z7UA 2LE9A 4GRWE 1KJVB 3DGGA 2C5DC 5C0CD 1DQML 1A2YA 3HLAA 3GMOA 3VFRB 4Z9KB 4I0PB 4WFHE 3C60C 3V8OA 3JV0A 5CJOL 1YY9D 1L9NA 4XBEL 2DBJA 3KR3H 1XFPA 5LXGL 3FCTB 5HYQB 1TTFA 4FQLH 1E28A 1E27A 3CU1A 1QPXA 3THMH 4M62H 5DD6A 4M6OL 3NCCB 1OP3K 1LO4L 3MOAH 4AZ8A 4JFFE 5D7LA 4YGVA 5DFVC 1CFSB 3DMMD 4N8VG 5FUZL 4PG9B 3IKKA 1EHNA 3WFHB 1PJ9A 3VDAA 4Y5VA 3IJHA 2IC2A 2E7BA 3CC5A 4MJ5A 4S0SD 1NGZA 1P69B 2V5TA 1F3DH 4JCMA 3U82B 5IB2A 1LWRA 1WIPA 3MRCB 4LRIC 2JELH 1P4LA 3WIHL 5BZDA 2MHAA 3FAXA 4FFWC 1QSZA 4WWKB 4O2FA 1A6WH 4GG8A 4JB9L 1GPOL 3LEYL 2FLRT 5I8EA 5TQ0H 3QP3A 5D1QB 5I75B 4ZFFB 2UVFA 4YDJB 4PJBB 1E6OL 4LLDA 1OAUL 3W5MA 3LOWA 5TGBB 3O3AB 4LCUB 2X1WL 2OSLA 4W81A 5DJCA 1W72H 1MVUB 5GS3A 1HDMA 1NGYA 4XH2A 4DAGL 1MNUL 5D7LE 5A40E 5ELIA 2O5ZL 1TNMA 1NGWB 2X1OA 4M1GH 3EYFA 5JA8B 1VESA 1AY1H 2MNUA 1KJVA 5F1OB 1P9MA 2PCPB 4E0RB 4LAJH 2D7QA 3MFFB 3VXUB 3VFRA 1RULH 1UKQA 2C4FT 2MKLC 2DQJH 4I0PA 3GI9H 5HDQL 4MHHG 2BVOB 3FCTA 5HYQA 1OTUD 1CFTA 5ILTH 1S7TB 3WJLA 2NPLX 3O8XD 1MELA 1KGCE 2F5BH 5B3JF 3SJVB 4UV7L 1M6OA 1CFSA 1QLRB 3HR5B 5IVXE 4X0KB 4PG9A 3MYJB 1RZIB 3VGDA 1RQ5A 4OZGE 4QRPE 5IWLA 4WWID 2DM4A 4QEGA 5DUMH 2Q8AH 5GISL 2R0KH 1Z9MA 2WK2A 1EO5A 1I1AB 3G6JB 2Q76B 4KI5D 3EDJA 4OCSH 3MRCA 1X5JA 3RVUD 3RX8A 3OKYA 4OTXH 4WWKA 4IIQC 1TQCC 1U8IB 3AREC 3GNMH 4ZFFA 1R0AL 4YDJA 3EYVB 3U0WL 5F88B 1MCSA 3GJFH 5TGBA 1N59B 3QDMD 12E8H 1YEIH 5FGCB 3SHSA 1H8NA 1T6WA 5KAQG 3NIFF 1JPFB 4K7FB 2R2BB 2YBRB 1NGWA 3TNNB 4OF8A 2ZP0T 2X4TB 4K9EC 2PCPA 4L29B 2Q8BH 4E0RA 3MFFA 1GGIH 4U1GC 2BSED 4OZ4B 3HZYB 1K8IB 1MAKA 2BVOA 3OWEA 4OF0A 4FQLL 2YSSA 3CK0H 3OAYK 1CLOH 5ISZD 1S7TA 4H20H 3THML 4M62L 2FZ3B 3U30C 4PJBE 3MNZB 3EFDH 3MOAL 5DHXB 3VFNB 3SJVA 1EAPB 3HR5A 1QLRA 1PLGH 4X0KA 3MYJA 1RZIA 5IROC 1CR9H 1F5WA 3R8BB 4IMKA 1KTLA 3LKSB 2VZUA 1CICC 2K7PA 1BBDH 2R15A 1I1AA 3G6JA 2Q76A 4M1CC 5KSAC 1NFKA 3S36H 5L0QB 4QTHB 1F58H 3HZKB 2JELL 1I9IH 3VXUE 1DZBA 1FE8H 2YPLA 3PWPB 2NY4C 1A6WL 2ICWI 1U8IA 5TQ0L 4KVCH 2F5AH 4YHLL 2V7NB 3ZO0A 1SM3H 5C08A 3EYVA 3S5LG 5F88A 3GRWA 3VWJC 3B9EA 5JHLH 2DB8A 1N59A 4PBVC 4RGNC 2AXFB 2YD1A 2GKIA 3DSNA 1W72L 1MPAH 1JGEA 1AP2B 4U0QB 3SJVE 4BELD 4H1LH 1JPFA 4P5TC 4K7FA 3QT2A 5FCUH 2EICA 5F3BB 2R2BA 2YBRA 3RL2B 3DRQB 5DO2C 3TNNA 1K2DB 4RFNC 4M1GL 4K7PY 1AY1L 4MVBD 3N1MC 5A2JH 1G7HB 2VDRH 4L29A 1VSCA 3ALWA 3UTTA 3WXWL 2V2TB 1RULL 3ULVE 2FHCA 1OTTD 1YNTB 2DQJL 4OZ4A 3S6CA 3G6JE 3UTOA 1ROWA 1VKXB 1YJDH 3HZYA 3GI9L 4YDLB 1K8IA 4UBDD 4F8TA 4QXTA 5ILTL 4TUOB 4QHKI 5C92A 5I1EH 2FZ3A 2F5BL 1AKJD 3MNZA 3JUZA 3VFNA 1EAPA 3QIBC 2NMSA 3RWIB 2FX8H 4JY6B 1E4XH 5FGCE 4LSSH 4FOMA 3MLWH 2BCKB 4Z5RB 5TPWH 1IGMH 4WHYH 5DUML 4G3YH 2Q8AL 1MCBA 4N90E 4D2NA 2Y23A 4ZUUB 1WFNA 1YQVH 4HWBA 4QTHA 4BA8A 4Y4HB 4OCSL 3GBLA 1OARH 3HZKA 1KN2H 3PWPA 1HIMH 4XVTL 4OTXL 1KJMB 3GNML 2V7NA 2OL3H 3MRQB 1IARB 4KMQA 5D5MF 4M5YH 5A2LH 5D7JD 2GSIB 2BNQD 12E8L 4GS7C 2AXFA 1YEIL 4HK3J 1K8DB 1P2CA 1AP2A 4JFZH 4XPGH 4C58B 5DMGC 3LQAH 1BOGB 1OGAE 3IKCB 3RL2A 3DRQA 1K2DA 2B1AH 1FZOB 1TTGA 1F4HA 1CGUA 1G7HA 2V2TA 2Q8BL 3F65A 3EZJB 2BZDA 1GGIL 1NMBH 5JNYB 2EE6A 1YNTA 3BP7B 1VKXA 4K2UH 4W6WB 2LQRA 3VXNA 5T1KD 1BVLB 3CK0L 1CLOL 3PWPE 3ZHKA 3AS1A 3OV6A 4TNWF 4TUOA 4H20L 3RZCD 4OFPA 1BQHG 4HT1H 3EFDL 5ACLA 3K4ZA 5MENB 4LVHB 2LTQC 2XA8H 1PLGL 1C7SA 1CR9L 4NM4H 3RWIA 1RMFH 3U4BH 3TLRA 4B5EA 4JY6A 4I3SL 3RDTD 5EC1B 4BFIB 2BCKA 4Z5RA 3QIUC 4RMTA 2W9EH 1BBDL 4ZUUA 1NDMB 2GK2A 3FFCB 3ISWA 3S36L 1F58L 4MWFB 3MLTB 1I9IL 1FE8L 1FRGH 3OG6B 1KJMA 4KVCL 4NN5C 4O00A 2F5AL 3MRQA 5H37G 3GKWH 1UEYA 4QF1B 5JHLL 2GSIA 3KXFB 5IBLC 2R0WL 4P23D 1K8DA 1MPAL 3V4VH 1J0ZA 4BUHA 3PDOB 1MRDH 3HMXL 1FYTD 5FCUL 3IKCA 1BOGA 1BVZA 4Y4FC 5HDOA 1U91A 4PGCB 3ALXA 1FZOA 1OAKH 4G5ZH 2DTMH 1JYNA 2PXYB 4AIOA 2VDRL 4XAKE 3O6MH 5JW4M 3MXWH 3TBSB 5JNYA 5E5UB 3MUHL 3BP7A 1MUJA 5FXCH 1YJDL 4ZSOB 3PNWB 4KXZH 3BWAB 3LHPH 4D3CH 1OGTB 1CS6A 3F12B 4L4VD 5GGVH 3RWJB 5I1EL 5IUSA 4Y2DC 2Z8VC 5MENA 5FUCC 4JKWA 3QDGE 1K3ZA 2FIRT 2R9HC 5D7KD 1E4XL 4U1MB 4LSSL 4BFIA 3OJMB 5J6HB 4P4RB 4EUPG 4FTVD 5TPWL 1IGML 5B3JE 4G3YL 1NDMA 2UUDK 3FFCA 5EPMB 1YQVL 3DROB 2WBWB 4MWFA 3MLTA 4AIZB 2ICEB 1KN2L 1HIML 4POUB 3WNNA 4JDTH 4N8CH 1ADQH 2OL3L 2P4AB 1PD6A 3EO0A 4QF1A 4M5YL 4GMSH 3E0GA 2WP3O 1U3HC 5MENE 3QPQD 5C07B 1IAIH 3PDOA 4JFZL 2VZVA 3MRIA 4XPGL 3LDBC 1N3NB 3LQAL 3EBAA 4JY4B 2B1AL 4PGCA 4PFEA 3RKDD 3TJHC 5FKPB 2PXYA 3NMEA 4KJQC 3NIFE 5D1ZD 1NMBL 3TBSA 2YA0A 4L4TD 1CZ8H 2CO7B 3MLYH 3FFCE 4ZSOA 1PY9A 3PNWA 5CEZD 3U7YH 3SOBH 1H3GA 2XN9E 3KPQB 3WSQH 2XKSA 1OGTA 5LGJB 1KCUH 1F42A 3RWJA 1M7DB 5A3ID 4HT1L 3V0WH 32C2B 3UZQA 2EC9U 1S7QB 5D5MB 2XA8L 1NUNB 2F58H 3KXFE 4NM4L 3U4BL 4U1MA 2PO6D 3LRHA 1LEGB 5J6HA 4P4RA 3V52H 4NBXB 1EO7A 4FFZH 2OJEB 4HUXB 1P6AB 2W9EL 4ZS6D 4G6MH 5I9QC 4NIKB 4TVPE 3DROA 3IDUA 4JHBA 4AIZA 2ICEA 2CDFB 3C87A 3CSBA 1FRGL 2WANA 1S7WB 1VHPA 4HLZH 4ZSOE 3UYPA 3GKWL 3KPOB 2GK0B 3MJ6A 1AO7D 5D9SB 3E3QC 4JCLA 1ZOXA 2PN5A 2J8OA 3SY0B 3V4VL 1MRDL 1GGCH 2NY6B 2YK1H 2XTJB 1N3NA 2A0LC 4OZHF 4H5SB 1NCCH 4JY4A 1OAKL 4G5ZL 2DTML 4CVWA 5FKPA 5KBNC 3Q6FB 1WF5A 1LO3H 3E2HB 3MXWL 1S78D 1FNLA 4EJ1C 5J11C 4JEGB 2RIKA 2VB5A 2BY1A 4UU9B 1H5BC 5GJSL 3OTTA 2P24B 4ZAKD 1ORSB 2QJDA 3L7EB 3KPQA 1LO0H 1HKFA 4D3CL 5LGJA 5GGVL 3SO3C 1TPXC 5D7LD 5GZND 32C2A 2IBBA 5GGRB 3NABH 1S7QA 2BMKB 5D5MA 2B7DT 4OLWH 2J2ZA 2NY2C 1DLHB 5IVNA 1LEGA 4XP1H 1A3RH 4R26H 5C07E 2OJEA 4HUXA 1EV2E 4F15C 5EIQA 3QJHB 1N7ML 5F7NC 5INDB 4Y5XC 4L4JA 3CX5K 3QFJB 3LQZB 4HAGA 3RX5A 2CDFA 4YDIH 2XV6B 3PWJA 1KGCD 1S7WA 4KJYB 5F71A 4N8CL 3S3SA 1ADQL 2VXUH 3OSKA 2FWOB 2XYCA 1JCKA 3KPOA 5HVHB 2GK0A 3CZFB 5D9SA 4NJAH 4GMSL 3SGDI 4Y5YC 4XNYL 3SY0A 4LLQA 2DS4A 2BY3A 2D0GA 5D5ME 1IAIL 4DKFH 1T0PB 1MFBH 4MNHB 1HE7A 4H5SA 1WLHA 2OMBA 3O81A 3DO7B 3ARBC 1SJHB 3Q6FA 2HT4C 4I0PD 1P7QB 1OAXH 4NKMB 2R4RH 1FFRA 1CZ8L 4ODUB 4NQUA 2BNUB 3S35X 3MLYL 2H8PB 2FX9H 4UU9A 3U7YL 4PJIE 2P24A 1ORSA 4J1UB 3L7EA 3RVVC 3WSQL 3LVEA 4MNGB 3RWHB 1KCUL 2WQ8A 5F7WC 1GHFH 3NCYS 5HJ3B 4RFEB 4MJ6B 1BF8A 2DDQH 3V0WL 5CD3B 5LGHH 5TFSH 2BMKA 4MDJB 2F58L 1IEHA 2VOTA 3P4NB 1NCAH 3H3BC 1UWGH 1RUAH 2CDGB 4K71C 4KK8D 5CD5C 1DLHA 5T3XH 4ONHB 2KH2B 1INQB 3V52L 4FFZL 5F8QC 3TZVB 1BMGA 3QJHA 5IV2B 4KJWC 4HKXB 4OBRA 5FKAB 5INDA 3X11A 2X1PA 43C9A 3TFKD 2O93L 3H3PH 4G6ML 3QFJA 3LQZA 4WWKD 3V6OE 3HC4H 2DIBA 5D1QD 4KUCF 4KJYA 4YBQD 4NZJA 5L9DH 4P3WA 2EXWD 3WDIA 3RIAF 1VFBB 5GS2H 3CZFA 3RJQB 2A83B 4H0GA 1EEYB 4WI4A 4OQTH 3ROLB 2YK1L 3VFTB 4JAMB 1C5DB 4MNHA 1NCCL 2YD3A 3DO7A 5BOZG 2BRQA 3VXUD 1SJHA 3GM8A 2X05A 2X89D 1JMZA 1ODAA 2FH8A 1LO3L 2ADJB 3DXAE 4KK9C 1SJVA 1P7QA 4NKMA 2GY7B 4ODUA 2BNUA 4OJFH 2H8PA 3B9VA 3QFJE 3K4DA 4B0MM 4PV9B 3B5TA 4ZD3H 4J1UA 1TITA 1LO0L 5D2LE 2ICWJ 2V5MA 4HJ0D 4MNGA 3RWHA 4HKJB 4DEPB 2Z0BA 5HJ3A 4RFEA 4MJ6A 3SJVD 5FYLH 1BZ9B 3T3PF 1S5IH 3NABL 1UM6H 4MDJA 3VFUA 1U3YA 5FA3B 3F7PC 3P4NA 3QHZH 4ODSH 4OLWL 1WK0A 4ZXBC 5J57B 1MF2H 1U8JB 3W81A 1AR2A 4ONHA 2YUZA 1A3RL 4XP1L 5J3HC 4R26L 3ULVD 3TZVA 5DMJB 1I1AD 2IQ9H 4JGMA 4Q9BA 1PG7W 5IV2A 4HKXA 5FKAA 2B5IB 2YN5A 4I77L 3I50H 4OZHB 2DI8A 4OCXH 4YDIL 4Z8FH 1L7TH 3U36B 1WAAF 4C4KT 3DHMA 1NPUA 3FJTA 4GKSB 2VXUL 3CSYB 2HTKC 3MJ9H 1JZ7A 4NFDA 3MX0A 1BAFH 1M7XA 1DANU 4XX1G 2WLYA 4MNGE 4NJAL 3UX9B 1ZGLB 2A83A 1EEYA 4X5WA 3WKNA 4HPYH 5TDNB 1E4JA 1OSZB 5ERWB 5I73B 2DLTA 3VG0H 4DKFL 3ROLA 3I6GB 3VFTA 4JAMA 1C5DA 5KTEL 3RWEB 1MFBL 3H8NA 3C5JB 3QDHA 1UENA 2ADJA 2AVGA 1C12B 5DJXA 3VD3A 3CXHJ 2KQNA 1SHMA 1OAXL 4UNTA 2R4RL 4PJGE 4QYOB 2FX9L 3QXAB 2BERA 4PV9A 3L9RB 3HUJF 1QRKA 3T4AB 3BO8B 35C8H 4HKJA 3KS0J 5L88H 1HN1A 2DDQL 4KKNA 1E4WH 1I8LA 1BZ9A 5E4EB 4YDKH 1OSPL 5TFSL 5LGHL 1OGAD 4JVUA 2R0LH 4M1DH 2V2XB 5FA3A 1NCAL 1UWGL 1RUAL 2OBGA 1U8JA 5T3XL 5KS9E 3UPAA 4XPTH 1OTSD 4LMQI 3ZLQC 1VEPA 3JV4B 2W07A 4OZHA 4PJ9C 1A7OH 3H3PL 5TF1H 5MI0C 4RMQA 1O5DT 3PWPD 3SE3A 3HC4L 3U36A 3ULUH 1KTDB 4NN7C 5L9DL 4GKSA 1WTGT 3CSYA 3HAEB 4HK0B 3KVQA 4MA1C 4CVXA 1JYVA 1FGNH 2OTWB 1ZGLA 1WIUA 2MTPA 2B1HH 4CAGA 4P46A 5TDNA 1OSZA 5ERWA 1NEZG 2VDLH 4OQTL 2HLFD 3I6GA 3ZSSA 3K8KA 1V5JA 3RWEA 3OKEB 1GRWA 2DWEA 5FYJH 2ORBH 3C5JA 2HWZH 1AIFA 4N0FB 2LABA 4KKLC 1C12A 4TTDC 3H9SB 1OP3H 4QYOA 4YFLF 4OJFL 5CZKA 3QXAA 3ZE2F 3CFEA 1CFBA 2P43B 4TQEH 1FL6B 4U3XA 4ZD3L 1ZT4A 3T4AA 3BO8A 2NR6C 3FQNA 5GRWA 2E7LA 3EYSH 5LQBH 5DEGB 1W72B 2EDDA 4M03A 3F7VB 4UIMB 4OCYH 1S5IL 4UDTB 1UM6L 4HUNB 4HMCA 2V2XA 3GMMB 3DVIA 2DQFB 1G9MC 1J05A 1FLRH 1CCZA 3QHZL 4GAGH 1UJTA 4NKOA 4ODSL 1CL7H 1MF2L 1T7ZA 1ORQB 1PQZB 4XAKD 3CDGB 3TN0C 5IFJB 4NQEE 1MJ7H 2IQ9L 3JV4A 1YEJH 4Y4HD 3WV0A 3I50L 4J3TA 4NWUH 3HG1B 3EW3B 5L7XH 2X9WA 4G42B 1N6UA 5I16B 3KPTA 1EVTC 4OCXL 1L7TL 1XF2B 4PJ8B 1PEZA 2XWJB 1KTDA 1Q94B 4HK0A 3HAEA 5A1AA 3IDMB 3MJ9L 5E6IC 1BAFL 4LDEB 3H2WA 4M6MH 1LK3H 2OTWA 5FGRA 1I9EA 2DN7A 2X9YA 4HPYL 2X4SA 5DWUH 4RSVA 3VG0L 1V7NH 3OKEA 1ZLVH 4OGAD 3VGBA 2X5PA 1T5XB 1BQUA 4XC3H 5GGQH 1EX0A 4PREB 3H9SA 3MJGX 4XXCA 3OX8B 1CF8H 4R2GB 5F7MC 1F4XH 1FL6A 4P57B 1QOKA 3HE6C 4JFHE 3FQWB 35C8L 5DEGA 1W72A 4LP5A 4PBXA 1P84J 5L88L 1J8HA 3F7VA 3ECBA 5MEND 3BE1H 1E4WL 4YDKL 5T5NG 4UDTA 2R0LL 4M1DL 2DQFA 5J13C 2IF7A 4RGOL 2WBJB 1ORQA 1QSEE 1PQZA 2OJZL 3PG2A 1ETZB 5IJKA 2D7MA 4Q9RH 4XPTL 1QD0A 5IFJA 2VLKB 3FFCD 1EEZB 3DV6A 5FF6B 5E5MB 4JFXB 1S9KC 1A7OL 5TF1L 3IFOB 4GBXB 3HG1A 3REWB 5L2JB 4G42A 1PW3A 5I16A 4K8RH 1WQVT 3ULUL 3A67H 1XF2A 4PJ8A 4ETQB 2XWJA 1Q94A 4OLZL 4AT6B 4HGWB 4LBEB 5SWSB 1IC7H 3IDMA 5IVZB 3TYGH 1DVFC 5I0ZA 1FGNL 3AS0A 3KXFD 4HKZB 3HUJB 5KANG 2BJML 2C1PB 5B3NA 1CGYA 2B1HL 1BVKA 2VDLL 2VXQH 3FOMB 3WLBB 3QQNA 4EI6B 1FLTX 1T22B 3IFLH 3GFUA 2YPVH 5FYJL 2PXYD 2HWZL 1OHQA 1YY9C 1OAYH 3OAYH 5EU7E 2ICCA 2ERJC 3NCJH 4PREA 4KK6D 4NNXA 5HHPB 1IE5A 4JANB 2AJZB 4GXUM 3OX8A 3KLHD 2XG5A 4PJXF 4TQEL 1NSNH 1H3VA 3DMMC 4P57A 1JZ8A 4WHTB 1FFQA 4DZBB 3FQWA 4XP6L 3EYSL 1JGVH 3TNMB 5LQBL 4JRXA 1I1YB 3MRPB 5SV4A 3MUY1 2W9LA 4PGBB 5DVNA 4NOFA 5GS1B 1FLRL 4GAGL 1CL7L 4UZGA 2GCYB 2WBJA 3WN5C 4HPOH 1ETZA 4L8CB 3T3PE 1MJ7L 2CLRB 2DLIA 2VLKA 4UB0H 1YEJL 5EO9B 1EEZA 2C3XA 5FF6A 4BK5A 5E5MA 4JFXA 3IFOA 4GBXA 4NWUL 2XKNB 3REWA 5L2JA 5L7XL 2GJJA 1DP0A 4FQPA 5I8KH 3CLFH 4LHJB 2I27N 4AT6A 4HGWA 4AM0B 3P9MB 2IAMB 4LBEA 5SWSA 5IVZA 5FGSA 3SGEI 1A7RH 3MJ8B 3HUJA 4M6ML 1LK3L 1WAAE 2C1PA 3RGVC 5IJVA 3FTGB 3C9NB 1OPGH 4LVOB 5C07D 5EDXA 3SN6N 5DWUL 1FCGA 3FOMA 2IANA 3WLBA 4EI6A 1AGBB 1V7NL 3L5HA 1T22A 1K4DB 3E6HB 3LEXB 3LD8C 2DWDB 4OM1H 5IHZB 1OTUC 2P42B 3OG4B 4XC3L 5GGQL 1ZVSA 5DRNB 2CJUH 5TJWK 4DUVA 3O8XC 4JANA 1GC1C 3V7MA 1CF8L 3RTQB 5IOPB 1F4XL 1MQKH 4N0UB 1FAKT 3N0PB 1GSMA 4WHTA 5IGXH 3FZUD 2VDQH 1KIPB 3TNMA 1I1YA 3MRPA 2VLLB 3BE1L 4MB5A 3NBNA 3WHE1 2R4SH 3H7BA 5FAAA 4PGBA 5C0ND 5GS1A 1MFCH 4QGTA 2JJTC 2GCYA 4KI5C 1KCVH 1EJ6A 3RVUC 4L8CA 4Q9RL 3FN0H 4FQQB 1OQOA 1K85A 2DQTH 2CLRA 1R5IB 5EO9A 2EIEA 4QHUB 3FHAA 5E95B 1YC8A 2XKNA 3VH8B 4K8RL 3A67L 4YX2H 2G9HB 3NA4A 1A14H 4AM0A 3LH2H 3P9MA 2IAMA 4MQXD 5GIRB 1IC7L 2CIIA 3OZ9H 3TYGL 4K3DH 1JFQH 4YHNB 3MJ8A 5EWIH 2CRZA 4NC1E 3PWLA 2NY6D 4O51B 1MCFA 2XTJD 4QT5B 2JJSC 1WCBB 2CPCA 1U6AH 2VXQL 4Q74A 2XT1B 3QULA 4JVPA 1AGBA 1EIBA 3IFLL 5AD0B 1K4DA 2YPVL 3E6HA 3LEXA 2DWDA 1OAYL 1QLFB 3BPNB 4R7NB 5HGBB 5IHZA 2P8LB 1F00I 3NCJL 4JVWA 5DRNA 1BX2B 1B9ZA 5C0GB 4R4FH 3LKOB 3RTQA 5IOPA 4N0UA 1CDBA 1NSNL 2A74B 3GEWB 3UTZB 3W39A 3IVKB 1MLBB 1KIPA 1JGVL 2ZUUA 4WO4B 4Y16C 2WMPA 5F21B 2Z93A 3QWRA 1TQBC 1BJ1J 2VLLA 4KKAC 3ZE2E 2EIDA 5DURB 2OTUB 1FP5A 3V6FB 4YXHH 1KIRB 3D48R 1Q9OB 3KPLB 1F02I 5M95B 1KPUB 5EZLB 3B4NA 3SKNB 3EOYG 4FQQA 4DN4L 3HFMH 5FM4A 3NCEB 1R5IA 4UB0L 3QFJD 3RZWA 4QHUA 1YC7A 4C56B 3IGAB 5DD0L 3VH8A 2XXMB 3MV9B 2KBGA 5I8KL 3HHRB 3CLFL 5JHDE 2IGFH 3BZEB 2G9HA 3QYCA 1MVFA 1GGTA 1MCRA 1PKOA 4N0UE 1N8ZB 4PJXB 1A7RL 4YHNA 3CD4A 5FYJU 5E2JA 3PDGA 1KBGH 2XG4A 3VFSB 2JF1A 4BQ9A 4CJ1A 3V6BR 1OPGL 3UJTL 4U1SB 4O51A 4MVBC 2Z35A 4QT5A 2AEWA 3EAKA 1O7SA 1QFWM 1OTTC 3TA3B 3QZWB 5AD0A 3VFOB 4OM1L 1QLFA 5T5FH 5GPRA 1P7QD 3GBNH 4R7NA 5HGBA 4UBDC 1UZ8B 4GKNB 3PABB 4HUKB 2P8LA 2WQRA 4MD4B 2CJUL 1BX2A 2ZUQC 1U93B 4HUVB 5C0GA 3TO4C 1ZS8B 3LKOA 1MQKL 4I3GA 2A74A 5IGXL 1MLBA 2VDQL 3WXVH 1T4KB 1QRNB 4WO4A 4U1JB 4UINH 5T3ZH 1IKFH 2R4SL 2OTUA 2UUDH 2CH8A 2VRAA 3DRTB 4NPYB 4P3CH 4WFGE 3V6FA 1KIRA 1MFCL 1CWVA 1Q9OA 1AGEB 2DMBA 3KPLA 5DC9B 1KPUA 2E5EA 5EZLA 3TZVD 1KCVL 4A6YH 5HYSB 3FN0L 1YECH 2DQTL 1EXUA 2Q87A 4C56A 1C7TA 1YEDB 3IGAA 3MV9A 3VDBA 1UC6A 4IRZH 1H3TA 5D7JC 3WFBH 1R6VA 4YX2L 3BZEA 1A14L 1F8TH 1Q9KB 3LH2L 1JL8A 2GJZB 3OZ9L 4K3DL 1N8ZA 5CEYA 1JFQL 4PJXA 2YS4A 2FEEL 1BFVH 5EWIL 4E9LA 3VFSA 1UGNA 1N6VA 1NC2B 4U1SA 3WO4C 2X4NB 3WLWC 1U6AL 4WI9A 1QUNA 5ITBH 4JKKA 3TVMB 2X4OB 3ZKXC 1OT2A 3QZWA 2YD8A 3VFOA 5TH2B 4MNQB 1MCNA 4F8QA 4KROB 1UZ8A 1Y6MR 1KC5H 4GKNA 3PABA 3T77B 1ADQA 1U93A 2CRYA 2DQUH 3RZCC 4C56E 4HUVA 1I4FB 4QY8B 1ZS8A 1Z0NA 4R4FL 4Y89A 3N9GH 1IM9D 1YPZE 3CDYA 4CKVX 2VR4A 1T89C 5DK0B 3CUPB 1NUFA 3JSSA 3CU7A 1KXTB 2IPTH 1QRNA 3AY4A 3RDTC 1EEUA 3WYRA 4YQXH 5I1LB 1DBJL 4PJXE 1P4BH 2UV3A 4H26B 3DRTA 4XGZB 4YXHL 3AGVA 4MXQD 1AGEA 3QDJB 5HYSA 1X4XA 2DQDH 3VFPB 1I3UA 1L0YA 3HFML 1UACH 3B9AA 1U8KB 3UTQB 4JREC 4NKDB 1NFDE 4RGNE 5T1DH 3ZDYF 2ZOKB 3ZTNH 4HKBB 1PZ5B 4GO6B 2I24N 4JFYB 5D6DC 2IGFL 1XF4B 1W8NA 1Q9KA 4P23C 1YEGH 2GJZA 4HZLB 2D7NA 3ALPA 2R29L 3IT8D 1L4IA 4JFEA 2ZG3A 1KBGL 4N5ED 2VZ1A 1Z5LB 4ZFZA 1QRNE 2DRUA 4FRWA 2X4NA 2X4RB 1BJ8A 2UWEF 3MO1B 1WZMA 1JZ2A 1FYHB 4ODTH 3TVMA 2X4OA 1DANT 2YC1A 4LIQH 1OT1A 2FO4B 1TJIH 1C5BH 1CT8A 2EECA 4MNQA 4M8VA 4RISH 5ACZB 1I9RH 2VR9A 3MR9B 3T77A 1MCJA 3BH9A 1I4FA 4QY8A 4EUPH 5FEBA 1Z0MA 1HWGB 4Q2ZA 5I18H 2WW8A 5DK0A 5GGTH 3CUPA 4XCYB 3DARA 1UVQA 4UINL 4E41B 1FL3A 2MJWA 4JZJC 5T3ZL 1IKFL 4H26A 5CMAB 4P3CL 3HKFA 4XGZA 5I8OH 4IHOB 4LKCB 1FNGB 4A6YL 5KVGH 3QDJA 2VXVH 3VFPA 1RZGB 4FQHB 4GW4B 3KGRA 1YECL 1MCPH 1FAIH 3H6JA 4U1NB 1U8KA 3KJ4B 3QUYC 1ZT7B 2P5WB 3UTQA 4NKDA 4MNQE 2ZOKA 4B7IA 1MHEB 2VN4A 1F4AA 1EGJH 4D0DB 1IILE 4HKBA 2OS7A 1AI1H 1PZ5A 1DUZB 3WFBL 3TBYB 1XF4A 5JMRA 2UY7A 5DHYB 4YPJA 5KW9L 3QPQC 4N9OB 4KGJA 4KQ4H 1BLNB 1BFVL 3G6DH 2ZG1A 4B50A 4HWEH 4QGYA 2O26U 2X4RA 3GMRB 3NFPB 3MO1A 5D1ZC 3DYOA 4NUJB 5ITBL 5JUEL 3MNVB 3SPVB 2Z31B 2FO4A 1JZ5A 4M4RA 3T1WA 1AXIB 5ACZA 1UKSA 1KC5L 3H9SD 3MR9A 5DEFA 2SEBA 1J11A 2XICA 1BFTA 2DQUL 3MV8B 5A3IC 4OIAA 3KAAA 1TNNA 2GSGB 3SGKC 3N9GL 4EBQH 4KUCD 3Q0HA 3T1FB 4XCYA 1F3JB 2IPTL 4X9HA 2PO6C 2VZTA 4E41A 4NQDB 4ZNEA 4YQXL 1JE6A 4S11A 2ILLA 1P4BL 5CMAA 4ZS6C 4IHOA 4LKCA 1FNGA 3OHXA 4NFCA 4AQ1B 3QXDB 3MLVH 1RZGA 4FQHA 4GW4A 5INCB 3BN9D 2K1MA 5HHXH 1UACL 4O4YH 1LE5B 2V5SA 1ZT7A 2P5WA 1B4JH 3HG1D 3RWDB 5DSCB 4LCCB 5T1DL 1MHEA 3ZTNL 4PJ8D 1JWMB 4WW1B 1DUZA 3TBYA 3RFZC 4LSRH 5DHYA 4PP1D 1YEGL 4QRSB 5KSBF 4PG2A 1BLNA 4EI5B 1SY6A 5SWZB 4L1HA 3L3GB 4HBQA 3C5ZC 1FSKB 3LS5H 3GSOB 4AENA 5GS0D 3NFPA 3TP4A 5IB1B 4NUJA 1S78C 1K6QH 5E8DH 4CBPA 4ODTL 3MNVA 3OGOE 3SPVA 2YN3A 2Z31A 4LIQL 1TJIL 4F9LC 1OW0C 3DHJA 1C5BL 2AABH 4RISL 4PJCF 4ZAKC 1I9RL 5H35A 2IQAA 1NUGA 3IDNB 3LMJH 2ED9A 4R2GD 2DLEA 3MV8A 2GSGA 4PGEB 5GZNC 4PRDB 2L7UA 4FQCH 5I18L 5GGTL 3T1FA 1BJMA 4BZ1H 3T0BA 1F3JA 2KL6A 1CIUA 4NQDA 2AK4B 5I1CH 1UXWB 2WBJD 3V7AG 3BUYA 5I8OL 5T3XE 5M94B 5MEOA 5KVGL 3QXDA 2VXVL 5GRVK 5CZVH 2VLKD 5INCA 4RA3A 5E94A 4LLAA 1HINH 2UWEB 1MCPL 2LAAA 1FAIL 3BD3A 4POYA 1LE5A 4GBXD 3RWDA 4MJIB 5K59E 4LCCA 4P3DB 4XVUC 1OD9A 3O4LB 1EGJL 1JWMA 4WW1A 2YA2A 1AI1L 2JJWA 1A9EA 5SWSD 2H45A 1MCEA 5IQ7H 3MV8E 1X5LA 5EFIB 3I75B 5FV1L 3WS3B 4QRSA 4CN4A 1ERNA 2VQ1B 4KQ4L 1HKLH 3T0EE 4EI5A 3KJ6H 3BP6B 5SWZA 3G6DL 3B9KB 4HWEL 1ZKAA 1X4ZA 4BFEA 2NY1B 1CDUA 2CIKB 3GSOA 4HMDA 1B3JA 4I0PC 4J4PA 4PJ5E 5F7YC 4GAYB 5L8LB 1N5AB 2JTDA 3WJLC 3IDNA 1MIMH 3WJJA 4EN3B 4PGEA 3OKDB 1JMXA 1LDPL 4PRDA 5C0EB 1U8PB 1SJEB 3KYAA 4EBQL 5IWLC 4KK8C 3R0MA 3ZYIA 5FYLE 5JORB 3DO3A 3HTLX 3MUGB 4TSBH 5CKAA 3ZKMC 4ONGH 3P3YA 3ILPB 2ZNXA 2AK4A 1CXHA 1UXWA 2NY5H 3V0AC 3I6LE 2OXHA 5SWZE 3TFKC 1T03H 5DD5H 4M7KL 2CDEB 3MLVL 5HHXL 4M6NH 2UWEA 5I75C 4O4YL 5D1QC 5IB4B 1U8LB 2Q7NA 4YBQC 1B4JL 1NGQH 4MJIA 4P3DA 3JXAA 1UQSB 3RI5K 2EXWC 3HAEG 3O4LA 4XAWH 3MRRB 2GYSA 3STLB 3EJYC 2APTA 3SE4A 3HC3H 2AQ2A 1ZXQA 2XQBH 5EFIA 3MMEB 2GJ6B 3I75A 4LSRL 1LNUA 3VWKB 3WS3A 4DUXA 2VQ1A 1HZHH 4GXVH 3NIDF 3SBWA 2FB4H 4ISVB 3BP6A 1Q8MA 3ULSA 2F54E 3B9KA 4KK5D 2BNRB 4M7LT 5DHVA 2CIKA 4I3RH 3LS5L 4CNIB 5J12B 2AXGB 1E0OB 3IDGB 4LLUA 1J8KA 1UH3A 4JRWA 5E8DL 1U95A 1T7XA 2FBOJ 4GAYA 1N5AA 4X98B 2AABL 3ARDB 3Q6GL 4HCRH 4NFBA 5IHBA 3LMJL 4LCWA 2FIKB 4HJ0C 1MCWW 3RTQD 4OBSA 1ZLWK 4EN3A 3OKDA 1M1SA 3MPCA 2GTZB 4Z18A 5C0EA 1U8PA 1CD0A 1SJEA 3JVGA 4FQCL 3ES6B 4XPHH 3QWRD 2DM3A 3BZFB 4E42B 3MUGA 3RJDA 3ILPA 3IXTB 3ULVC 4OT1H 3MLZH 5I1CL 5I66A 3ARZA 5E5RB 4F37K 2CDEA 4UT6H 5CZVL 1NC4A 4PB0L 5JQHC 1FO0H 3N1QC 1HINL 1G7JB 2M1KA 3PWUB 5IB4A 4DKEH 2PTUA 3OB0K 4NJ9H 4LOUC 3ZE0F 5AUMB 3ULUE 4PJCB 3STLA 4Z7NF 1RZ8B 5IQ7L 5E4IA 1AC0A 3MMEA 3CIQA 4D9QE 2GJ6A 3VWKA 5CZXD 2AJYH 3JWOH 3HMWL 4WFGD 1HKLL 4CU6A 3KJ6L 5EIVA 4ISVA 1PEWA 1WBXB 4BQCA 1I3VA 1K5NB 2BNRA 2BFVL 2VDOH 4CNIA 4EDWH 4HV8B 2BXZA 2AXGA 4X6FB 2VYRE 4IOFD 3IDGA 3MREB 5FYJE 2ESVB 4U7SA 1IAII 3FQXB 4X98A 4JFDB 3ARDA 3WUWA 1H8OA 4PR5B 3MA7B 3MUJA 1MIML 2FIKA 5GXBB 4CL7A 1TZHB 2EDQA 5D2NE 4LSUH 3P40A 3HI5H 1MREH 3Q2CA 4RWHA 2GTZA 5D70H 4MXVF 4WO4D 4FQXB 3ES6A 4I13B 3IJYB 4E42A 3KLDA 2Y4SA 4TSBL 5DURD 4X6DF 3BYYA 3NZ8B 3IXTA 1OTSC 5L0QC 5GGSY 3IAPA 3STBA 3EHBC 1T03L 4PRIA 5DD5L 2BNRE 4N8VB 4DVBA 1XZ0B 3A0OA 1JRHI 2ZUYA 1Z3GH 4M6NL 1G7JA 4C56D 3PWUA 1WUNT 4MD5B 2ZUWA 3MV9D 4MCYB 5AYQA 4Y1AB 3QUKB 5E99H 3T3MF 2X4UB 5TF0A 4XAWL 5AUMA 2PYEB 3KPPB 4DKDC 3HC3L 1FL5B 1RZ8A 3ARSA 1ZLSH 2HYMA 2XQBL 3UXFA 3IF1B 2HLFC 1HZHL 1L6XA 4GXVL 3MGAA 1HYRC 4N0RA 4URTB 1GOHA 2H1PL 2P48B 2FRGP 1WBXA 1JNNL 2DKSA 1K5NA 5TDPB 3QUXC 4I3RL 3QEQB 3LEVH 5F96H 4HV8A 5ICXB 3TA3D 4X6FA 5KSBE 3MREA 2IH3B 2ESVA 3FN9A 5TE7H 4YDLC 1OY3B 3QIWB 2V9TA 3FQXA 4JFDA 4BFBD 1J86A 4HCRL 3MA7A 1FNSL 1DN0B 2A77H 2VUYA 4KUZH 1VFOA 4LKXB 3I3EA 1EDQA 2QSVA 1IZJA 1M71B 1XEDA 1F3DJ 3TH3T 4PJCE 1QRND 4FQXA 2P47B 4LVEA 4XPHL 2ZUXA 4QTIH 2ATKB 1UB5B 3IJYA 2GITB 3NZ8A 3Q3GA 2OP4H 4OT1L 1L9MA 3MLZL 2EDXA 2E6QA 1J0JA 4QRTB 4Y4HC 1HYSD 1OOAA 5JIKA 1KSRA 5HI4D 1QTYT 4DCQB 4DVRH 4N8VA 5MHSD 4UT6L 3VFGH 5MERA 1MQ8A 1XZ0A 1QA9B 1S7XB 1FO0L 5HVGB 2ESVE 3G08B 1WZLA 4DKEL 1UB6B 4JKPH 4MD5A 4JFDE 4MCYA 5CLTA 1BPVA 4MZ2A 4Y1AA 2ARWA 3QUKA 2X4UA 1NGPH 4NJ9L 4NYLB 2ZPKH 3L1OH 1FL5A 5DZNA 4P0DA 4RX4A 2AJYL 3JWOL 3IF1A 3IFNH 2O61A 1NC2D 3R4DA 1YMHB 5C70A 4IRJB 3D39E 5FK9B 3VCLB 4OGAC 3OR7B 2QSCH 4YGAB 5DQDH 5TDPA 2VDOL 4GFTB 3TVMD 5ICXA 4EDWL 1RZKH 2IH3A 4JPIB 3S3JA 4Y19A 4MNQD 1LK2A 2MQCA 4KROD 3QIWA 2H3NB 4IDLA 2A6DB 5E2WH 3EJJX 4JO3H 5EUOF 3BJ91 3HRZA 2LV4A 1DN0A 4HBCH 4U7MA 3RBGA 4F2MB 4LKXA 4LVHC 3HI5L 1MREL 3MRDB 5C6PB 1M71A 3L3KA 5D70L 1P84K 2ZUTA 2APWA 4JQVA 5EU3B 3N06B 1EJOH 2PYEE 2ATKA 1UB5A 2V9RA 2GITA 4KDTC 4WUUB 3TIDB 3DUSB 2ADGB 4I0KA 4N0YH 3GRWH 4HDIB 1HQRB 2HN7B 3QDJD 4QRTA 3PXJA 3WIFB 3QEQE 3O6LH 1RIHH 4YBLB 1VCAA 1QA9A 2ZNWA 3VH8G 4U1HB 3G08A 1JF6A 1UB6A 3AMKA 3UTPE 2XFXA 1RIVH 2XACC 1HHKA 4OI8A 3H3KA 4NYLA 3L3OB 4OD1H 5EOCH 1I3RB 3ZKNC 1LQSR 1FQ9C 1FN4B 1LP9E 2Y9RT 3KLSA 4G9FB 1TXKA 2GAZB 1JP5A 1YMHA 4ZTOH 4IRJA 5FK9A 3VCLA 4K23H 1GXEA 3OR7A 1IEAB 2PXYC 1YNKH 1DQDH 4DJMA 1EERB 3MC0A 3LEVL 4X6DB 5F96L 3JTSB 1ZA3B 5F44A 3HE7B 1AR1D 4KK6C 4JPIA 3NIDE 3BDBA 4QRRB 3L95B 1XGPB 2C3HA 3KLHC 4NM8L 2A6DA 4D8PB 5DGRA 1N4XH 3SKOB 4FA8A 2EDTA 2A77L 5HPOA 1Y0LB 4F2MA 4KUZL 1I8MB 3MRDA 3T65A 5BRZE 1QFWH 5EU3A 5KOMC 3HNSL 2YRLA 1JIBA 3DX8B 4QTIL 4ZFOB 4E41D 4OFYD 3NVQA 1T80A 3IDYB 2D7TH 3DUSA 2ADGA 5GRYA 1QQDB 4XCNB 3AUVA 2OP4L 2VLJE 3INUH 1KEMH 4ZOBA 3B2VH 4HDIA 4QOKA 1HQRA 2HN7A 2IWGA 1JGUH 5E9DE 3VFGL 3CXDH 2P5WD 4YHIB 1CGTA 3F62A 4U1HA 2VKXA 5DI8B 4P59H 5BV7H 4JKPL 4Y4KB 1A7BA 1BZ7B 3N85L 2D0HA 1NGPL 2X1QA 1M4KA 3L3OA 2ZPKL 1DJSA 3L1OL 2A9NH 5I8CB 1I3RA 7FABH 1G9NC 1JBJA 1MCDA 2RJMA 1J87A 5DUBB 4G9FA 2GAZA 3IFNL 3ZE0E 1RHHB 1GGYA 4PIRF 5E1HB 4O2EB 4A6YB 5C2UB 1QKZH 3ZYOA 1LGVA 1IEAA 1NBYB 3QZWG 2QSCL 5CS7A 4WUUE 3DVFA 4H8WH 5DQDL 3OBAA 4X6DA 3JTSA 1ZA3A 4YC2C 4PTUB 3HE7A 2Z31D 1RZKL 4DOHB 5CGTA 3WUZA 4X4MA 4C59B 1H3PH 4MGXA 4QRRA 2HH0L 3L95A 1XGPA 1RHFA 5E2WL 4D8PA 3GMNB 3SKOA 1AQKH 1WIOA 2BHYA 3MV8D 5DJ2B 3FZUC 3P11H 4HBCL 2DL9A 1Y0LA 4OLXH 5GS2D 1I8MA 1I9JH 3KPSE 1A6VL 1HSBB 2BRRH 5C0NC 1EJOL 5KVFH 3DX8A 4ZFOA 4NQDD 5F7LB 4ENED 4MB3A 5HYSG 1QQDA 4PLKD 4KTEH 5BW7C 3GRWL 3ZKSD 1BQHB 4MXVE 3RWGB 3RNKA 2V7HB 2DQCL 4O58H 3O6LL 1RIHL 4W68A 4YHIA 2EYTB 2E3VA 4IBLT 4Y4KA 4MQXC 1BZ7A 4K7PH 1RIVL 2VSCA 3BRDA 1NCBH 2X7LB 4FQIH 5FYLD 1KJ2A 4OD1L 3EIFA 4KY1H 5I8CA 5EOCL 5JW4N 2NY6C 3FT4B 4EI5D 2JIXB 1D7FA 3JWDH 3T3ME 3I6LD 5BOPA 5SWZD 1RHHA 3CDFA 3MRFB 4ZTOL 4PJ7F 4RMUA 4O2EA 4A6YA 4ZG1A 4K23L 1NBYA 3V6OC 2F8VA 1YNKL 3QO0B 4I5BA 4F58H 1DQDL 3ROOA 1KUMA 4J4PD 4S1DD 3FT2B 1CBVH 4PTUA 2UZXB 1RZFL 1FGVH 4ZUWB 4M5ZH 3VU2A 4XNUH 1NLDH 5K9QG 2YUVA 4OZFG 4U2ZA 1N4XL 3GMNA