1FG9C

3:1 complex of interferon-gamma receptor with interferon-gamma dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
210
Chain Sequence
b'VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON GAMMA
publication title Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 210
sequence length 213
chains with identical sequence D, E
ec nomenclature
pdb deposition date 2000-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C01
4Y89A 3QWRD 4XXCC 5HYJD 2YA2A 1E6OL 1W72L 4ZPVB 5H94A 5DHVH 5A1AA 4F9LA 1S7TA 5E94B 2B4CC 4O51B 1ZHNA 5FOBB 3SCMC 1HEZB 5J0BA 4U1MA 1LE5A 4IMLA 5IB1B 4I3SL 4NZRL 2ARJQ 4FNLL 1EFXD 1BBDL 5BS0B 4NKQB 1NJ9A 3MV8A 1KYOJ 5GGVY 4PJBF 1FJ1B 1QQDA 1MI5D 1U3HD 4V1DB 1PYWA 1MCJA 3SCMA 1Q9OB 2WBJA 4OKDA 2FLRT 4M61A 1MFCH 4MJ2A 3ALXA 2ZPKL 3VFNA 3LQAH 3LZFH 1A6PA 1T04B 3VH8A 3UBXB 5BXFB 3TBWB 5CEZL 4FXKA 4OFDA 2DMBA 2F54D 2FECL 1WFOA 1TVHB 2Y7QA 4UT9L 4IDLA 3LMJH 5JORB 1H8SA 4OM0L 3QUYB 4S1DC 5CJ5A 1EHAA 1BECA 4JDTL 4R97C 3BN9C 3TGXA 4GBXD 2MKWA 5L2JB 2UWEF 5E56A 1OD9A 3S4SB 1DUYA 5FYJL 3U7WH 4EI6B 1KB9J 3OBAA 2AV1B 5AEAA 2HH0H 2IQAB 2QKIB 2DQDL 4HWBH 3VI3F 3G5ZB 2E7HA 3QDGE 2OMNA 4G8GD 4ZYKB 5L8KB 5CZKA 3S3PA 4APQB 4YZFF 4PLOB 2ERJC 1S7XB 2B1AL 4PGZA 1YY9C 2GSIB 5I71B 1AR1D 1Y0LA 2LTQC 5IW6A 5CIPB 5CINL 4PLNC 4GAGL 5JPNB 4S2SB 3BPOB 4YDJA 5GS0H 4WEUD 4BZ1H 2E8YA 1WK0A 3U83A 3NZHH 3LRHA 2QEJA 3CXDH 3DETD 1FG9C 3FTGB 4JGUA 1KN4L 4N90D 3UTQA 5FO8B 2YSSA 1JK8B 5D7JC 1EX0A 2IAMD 3MJ7B 3WIHA 1P4IL 1TENA 1ZT7A 3L9RB 2Q8BL 3FQWB 1UZ6F 2B0SL 5TQ2H 1F4XH 4ODVL 4PLJD 2E9WA 2VQ1B 4L8BA 1U8HA 2FHBA 5H2BA 5D7JA 2YWYA 3SDCB 4I3RH 2V2XA 5I76A 3VWKD 3K2UL 2VL5B 4JM4H 4PJEB 1T66C 3ZDZE 2FECI 3C2AH 2AJVL 4KPHL 3VGAB 5GS1B 3WXWH 2DQTH 2B1HL 4L3CA 4ZUWB 3CUPB 1LO5B 3MMEA 1LP9E 1G0DA 5JIHA 1UA6L 4C55A 1DSFH 4K3GA 1X5JA 4HK3J 1A4JB 1E6JH 2ESVB 3HTLX 3BJLA 4MNQD 4UTAL 5D71H 1YDPB 4OIBA 4WHTB 3VW3L 5GISH 1J88A 3P73A 4Y2DD 2BNQB 2D4FA 1N7ML 4ZPVA 1EAJA 1S3KH 4ZO6A 5I1DB 4D94A 4M93C 1NMAL 3WFEL 2X4OB 4UNUA 5E94A 3VE0B 5T3ZE 2NY4C 3MCLH 3O2WH 4L9LB 5DXWA 5FOBA 2NY6B 3U4AA 5I8CB 2HRLA 5IB1A 5GS0D 3BUTA 4OCSL 2CK2A 4LP4A 5BS0A 4UIKL 5F44A 1V7MH 5IHUL 1DQJA 5EC2B 4ESKA 1ITCA 4XHJC 5J4MA 1WC7B 1Q9OA 3ULUL 2YXMA 1P7KB 1OTTC 3N06B 4P2RB 3C6SB 3MRFB 2R69H 4H0HB 1P2CA 4OCLC 5IBUG 2BVTA 1T04A 5F21B 4ZXBC 3UBXA 5BXFA 3DXAD 5HHXL 4HGKC 4F7TB 4YWGH 5C09B 4PJXA 2YD5A 1QD0A 2VXSH 5IFAL 4GJTB 4YPJA 1A9EB 1FBIL 5JORA 4W4OC 1JPST 3IETA 3DO7B 4QXTB 3TN0D 5HDLA 3IDMB 1RVFL 3LS4H 4ZXBA 4OV5B 5L2JA 4APQC 3GB7A 1JWUB 2EDDA 1V7NL 2ZKHH 1G7MA 1IC5H 2JJTC 3ILQD 4ZSOE 4U31A 3S4SA 1CE6B 3VXSD 1T7XA 5D6DC 2VZSA 1PGRB 4EI5B 3WN5C 4EI6A 5FGBC 5I71C 4W4OA 4LPTA 4UBDD 3G5ZA 1GIGH 4ZYKA 1NC4D 4NN5B 3AU1B 2XA8H 4P4RA 3KYMB 4APQA 3BKJL 3GM8A 5D7IB 3ECBB 2WV3A 3V79C 3IYLW 5D6DA 3WN5A 5CD5C 5FGBA 2D9CA 1CT8A 3HZYA 3RDTD 2VDPH 4RQQA 1SJHB 3KWWB 5JPNA 4Z7WE 5J13B 1Q72L 2IADB 2V2WA 1MF2L 1BAFL 4RAUB 4EKXA 1H3PL 3IU4L 3RWCB 2DIAA 3QPQD 1JK8A 1W0WA 3MJ7A 4S1RL 4XPFH 2AQ1A 5DMYA 5IM7A 2ZZUT 3WNLA 1JNHB 2O5ZH 4LCWB 1CR9H 1T7ZA 3VGAC 2VQ1A 5CUSL 3T3PF 2VDQH 2MCG1 4HUKB 5FGRA 4JFEB 3EYUL 3HUJA 1N4XL 5FB8B 1FFQA 1MQKL 4XC1L 5CILL 4J3XA 4OLWL 1JRHL 3RVXD 2DF3A 4XP1H 5I6XC 2R0WL 5E6ID 4FQ1H 3QUMH 1DE4B 4OM1L 4OQ1A 4Y0GA 1MCSA 5DJ0B 4I9WE 4R26H 2HTKD 2DLGA 4K9EC 4L9LC 4LHUD 3O81A 1MFEH 2QSCH 1W8OA 4O4YL 2ESVA 5IJVB 1T1WB 4GUPB 4PJBE 1VFBA 5HGAB 3WLBB 3STZA 1AY1H 3WNPA 3RX8A 3B6SA 4RFEA 3TT3H 1A7RL 2E27H 5ALCL 5CZVH 3E8UH 3M07A 3TH3T 3ARZA 4L9LA 4Y88A 4BUHA 5F96L 5BRZB 4H8WH 3UC0L 1HCFX 1ZLWH 4FN0A 4JDVA 4PRBA 5TH2A 3VXMB 3SY0B 3U6RB 5EU3A 3RP1A 1NCAL 2Z93B 1GGYA 3OGOE 5D5MF 4RMQA 4EQ3A 2Q7YA 4O02H 4UV4L 1J8HE 2C1PB 4ZTOL 1P7KA 2UWEE 3ZE0F 1MWAH 4P2RA 2F5BH 2QR0B 4HJJL 2AXGB 4X6FB 1MRFL 4CVXB 1KIQA 1CD8A 3SEPA 4TUKL 1AXTH 3VI3E 4QHUA 1EV2E 3QXWA 2O5YL 3L3HA 5IMMA 2GFBB 4YZFE 1U3YA 4GLRH 5DF0A 3DO7A 3TYGH 5E6YA 3IDMA 5I1EL 4NN5C 2DYPA 3FJTA 1GOFA 3U2SA 1JWUA 2WWMC 2DIJA 1JRHI 1T6VN 5JW4M 2H32B 5GQBA 1GC1L 4OT1H 3HN3A 5TQ0L 3JSSA 1W72A 1LK3H 4YFLI 4PR5B 1FZOA 3GIZL 5J13C 1CL7H 5AAWA 3L3JB 3P9WB 5DQJB 5ID1B 5SWSD 3EZJB 1UZ6E 5LCVH 4DGVH 3OPZH 3NABL 1TTUA 4B53A 4CVUA 3GSRA 1SJHA 1RZJH 5C0AA 5INDB 4C57C 4YHMH 3LS5H 5CMAA 2IADA 4J1UB 1MIML 1A8JH 1T4KB 4PB9L 4RAUA 1IBGL 1CFTA 4Z7UB 4UILL 2KQNA 2X9XA 3LB6D 4NZUL 4KKAC 3TBTB 3LKOB 5IP4A 1D9KD 1OSZB 5C0ND 1HIML 3E3QC 5J1AB 4AY0A 1XF1A 1JNHA 4LCWA 4ZO7A 3P11L 3ZDXF 4BH7B 4HDIA 1G7JB 2FO4B 4JHBA 4WFGD 3OKMB 1KXVC 4IMKC 3X3FH 1U8OA 5F1KC 5T5NF 4P59H 2QV2A 1A6WL 4GAJH 2VLME 3I2CL 4DCQB 1YNTB 2F74B 3OJVC 2DB8A 5DJ0A 3KNBA 2UYLA 4W68A 3T0AA 4YIQA 5KN5B 5BO1L 2IANB 5CJOL 1IQWH 1DL7L 5DFTA 5SX5K 1T03L 5IJVA 4GUPA 3C5SB 5CS7A 2ZUYA 3QXAA 4Y16D 4AEFA 3WLBA 5JPMA 4JDZA 5KJRH 1I1AD 1IGFL 3G5YA 4NQCA 1YQVH 1CD9B 3P9MB 4LHQB 1GAFH 1U8QA 3VDBA 4F3FB 3KXFD 2WNGA 5SX4H 1INDH 4S0SD 3SY0A 3DURB 3IDJA 1F4YH 5D8JL 4O2CB 2Z93A 3F7YA 3RVVD 5KVDL 4HF5L 2C1PA 3F62A 4KTEH 2VUYA 3GMLB 3RL1A 2VLRD 2HLAA 25C8L 4DVRH 3D5OF 3I02B 3BT2H 5HYIA 2Z8VC 3ARDA 2DQIL 3MCG1 2Q3AA 3WKNA 3SO3B 1CLOL 1NLBL 2GFBA 2EXWD 5I16B 1FNEA 4HV8B 1CFNB 1R5VA 5I2IA 4R3SB 5DYOA 4LKXB 1A7PL 4XNMB 4QWWC 2P5WD 2X4PA 1CLZL 1R3LA 4ZAKB 2IH3B 4OF5A 1MFCL 4TNWF 3PGFH 2H32A 5HI3C 3BP6A 1ZA3B 1DVFB 4NN7B 4G3YH 1MPAH 1ACZA 2Z35B 5I9QB 4QRRB 2VDMH 5ADPH 2Q6WB 5DT1H 5LGHH 3CMOL 3PHQA 4G6FB 3TWCH 3V4PH 3WHXB 3JWOL 4HEME 3GBNL 5HHME 3LMJL 4ODXA 2QHRH 1L7IL 5DQJA 3ULUC 4FTVE 4OZHB 1IM3A 1KCRH 1MCDA 3B9EA 3BMVA 5INDA 5CJXC 4IOIB 2KQMA 3T3PE 1OSPL 5E8PB 2XXCB 1FNHA 2OR9L 5EU7C 4NBXB 4W81A 5JW4Q 2DDQH 1NLDH 3TCLA 2P47B 4XBGB 2M26A 4YHPB 3TBTA 3VFPB 4LAJH 3O8XD 4UTBH 5CJXA 2AJUH 1OAKH 4M3JA 3WL9B 2X89D 3CDGB 3U4BH 3F5WB 4HIJA 1U8LB 2BJMH 2P5EE 1TETL 2WUCH 2E6JA 2X4TB 4R96B 5IVNA 2C7UA 1M71B 4OFPA 4Y7MA 3O6ML 3SJVD 4NBYB 1WJ3A 5I17B 3HMWH 4GKSB 1NUGA 5MENE 3S8WA 2KZ1B 4LF3B 3O6LH 4LARH 1QACA 4DCQA 4OKVB 2XWTB 4JM2F 1QSED 2F74A 2Q20A 3BPLB 3DRTB 4WFED 1EUUA 3BZDA 3QJFB 2ZUSA 5GRVL 1F4WH 4QRQB 4XZUB 5IVXE 4HWEH 4M6OL 2EEDA 4D9LH 2VH5H 1QFWH 4W6YB 3F6LA 3EGSB 1UCTA 3DSFL 1S7RB 2AEPH 2EDXA 3FONB 4NWUH 4WU7B 3JV4B 2SEBB 4B50A 5D5ME 4ZFGH 3VMNA 2EKSB 4NKMA 1FDLL 1Z9MA 2VLKD 3VXOB 3ZE0E 1HSAA 5J6HB 1FZMB 3EFDL 3O3EA 4LPUA 5GSRA 4KI5F 3E6HB 1Y18A 2Y36H 4CVWA 1MCNA 3A0OA 3MV9E 1Z9OA 3ULVF 2YN3A 3DURA 3KYOB 2MCPH 1DSFL 1KUMA 2G5RA 1IMHC 2Z31D 3DTXB 2HFEB 2JB5H 4P2QE 5I75B 1G7IB 4R6UA 4HH9B 3SO3C 5I1IL 4MJIA 1QLRB 2FSEB 3RZWA 4BKLB 1LO4H 4E41E 5H35B 1CLCA 3QSKB 5A3ID 1INEH 5AYUH 5C07D 4PRPD 1EFXB 2BMKB 3QH3A 3HRZA 4C56E 4QOKA 3UTTB 5D70L 4P2OD 1QRNB 3IDNB 4FQIH 2PR4H 1MI5B 3ARRA 3FL7A 2AEIT 5JXED 1AO7B 1G0YR 1NBQA 1HDMB 1BM3H 2WUBH 3NFPB 5GHWL 5I9QC 5DK3A 4AG4L 3FB6B 4NFBA 4P4KB 5J7CC 1NCBH 1CFNA 5GRJH 5DTFB 2DJSA 1X4YA 4HUNB 2VJXA 4GRLC 4XNMA 3ARBD 4U6HB 3TF7C 1OAUH 4HUVB 3KPSE 2GQHA 2R69L 5SV3A 4G9DA 3O0RL 5EO9A 1ZA3A 4MJ6B 5F70A 5HYSG 4N8VG 3EJZC 2HFTA 4N5UA 2R1XA 1XF2B 3S3JA 4TPRL 5JUEL 2Q6WA 4MHHI 4X4ME 1HH9B 4GBXB 4GRLA 5DJCA 3WHXA 1W0VB 3SDAB 1DBML 3RVTC 2BNRB 5C3TA 4BH8B 3H9HB 1KFAL 5FFLA 1HILB 2GT9B 2ORBH 1HKLH 2R15A 3KPRD 1JHLH 1U92A 3GSOB 3VD7A 1FNFA 3EHBC 2DQUL 3W5NA 3ZDXE 3VXUD 4G8GB 1D5ZB 3SKOB 1DDHB 1J11A 3ROLB 4P49A 3LY6A 3QIUD 4PGBA 2YD2A 1AGBB 1TPXC 3OXSA 2AQ2A 1J0ZA 1I7UA 1T1YA 4FQJL 4WUKH 1G6RL 2IC2A 3VGFA 4PRIE 5DD0L 2WIIB 2XA8L 4KUZL 4QRPB 4ORGB 3RWEB 1A1MA 4D3CH 4D2NA 4TNVK 5KVGH 2DLFL 3MUGB 4RFOH 4XRCA 1PY4A 2EZ0C 1U8LA 4ELMA 1L6XA 1E4XH 3T4YB 2DL9A 1GC1C 4OLZH 1K9TA 2CPCA 3GHBH 4K3DL 1JTOA 1QBBA 4F80A 5I74B 2IAMB 3V4UL 3MRGB 3T4AA 1NDGB 4NRXB 5HSFA 2H2PD 3DRTA 3ARWA 3CH8A 3NTCH 5J8OA 5E99H 4QRQA 4XZUA 2VLJD 3RWIB 5I1GL 3MODL 1ORSA 2R0LH 3BEVA 5T1DH 1OTSC 3VWKB 5DGRA 3EGSA 1ONQB 5C0BD 5DI8A 1S7RA 1AKJD 3WIFA 3JV4A 2XG4A 1S7SB 3X14B 3OAZK 2EKSA 2AJYL 5IHZA 3VXOA 4TUOB 5IBTL 4M9PA 5J6HA 3MRLB 3P0VH 1FZMA 4XBPB 5I75C 2O93L 2ZG2A 2FB4H 2YA1A 1Q0XH 4XNZC 1CG9B 3STBA 3E6HA 1HHIB 4R4FL 5FF6B 4MNQB 1ZT1B 3WNOA 2VSDA 3D9AH 4U05A 1CD1B 3H7BB 4ONOA 5BQ7B 4J8RB 4H5SA 4N0UE 4M1DL 1U58A 3O2DH 4XWOC 4FFVC 1AY1L 3QQNA 5IMOB 5I0DA 3V52H 3C5ZD 1T3FB 3DUUB 5KTEH 2D0HA 5H35A 2AXFA 5DZOA 4EUPH 2CLRB 2YPLD 5CZVL 1EBAA 5DJZA 4K23L 4P4KC 4O58L 4L8DB 2BMKA 5T1KA 3WUWG 4NFCA 3UTTA 1BFVH 3BFOA 4PY7B 2PYEB 3JWNC 5I1AA 5C71A 3BD5A 2GY5A 3NH7L 1AO7A 3SE3C 5EWIL 4JPVL 4OZFG 3HNVH 1NCCH 3RY4A 4CDGC 4PJXF 1DN0B 4DW2H 2ATKA 3QT2A 3BRGC 5F7FA 3GBLA 4U6HA 1ZS8B 3OTTA 3B2VL 2X05A 1RJZB 1EZVY 1NL0L 1JTTA 1U95B 3MXWH 3P4OB 3IDGB 3CFIC 1G7QB 1RHHB 4PG9B 4IRJB 1XF2A 4IHOB 3TN0B 3MOQA 1GHFH 4KFZC 3CX2A 2DQFA 1MCPL 5GZND 2BNRA 2X40A 2XZQL 3TO2B 2F53E 1PBYA 1OGTB 2AJXH 4YHLH 3VXSB 5C0CD 5JA8B 2XFXA 5ISZE 3QWQB 4E0RB 4X6EA 1DEEB 1DFBH 5CLWA 1D5ZA 1DDHA 4W70A 2ZUXA 3ROLA 2DLTA 4HFUL 4HLZG 1HQ4B 3VG9B 1QZ1A 1A6UL 4EIZC 1M7DB 1CDGA 3RVWD 1AHWB 4QRPA 1CICB 5ANME 4CBPA 3RDTB 1VENA 1A7OL 3RX7A 3GMPB 1NEZA 1WZ1L 5TGBB 5DVLA 1OM3L 3T4YA 4XNQA 1T22A 4Z77B 1LGVA 5F8QC 4X9IA 2YS4A 3AS3A 1OL0A 4HS3B 1D5MB 2OP4H 1QFWM 5JOFB 4KQ4L 3DX7A 5IB3B 3UTSB 5A43C 2G2RA 4LCYA 5C0EA 1V5JA 3JWOC 3BZ4A 4MS8D 1IAIL 4RNRB 1NDGA 5GJTH 3QDGD 2X10A 5A2LH 3NCCB 4Q6IC 2I60L 4FQPA 4KI5E 2R2EB 5EU5B 3RWIA 1ZGLM 3SGKC 3ARED 5DRZB 3VD4A 3EOTL 5GGTA 3ULVE 4LQFL 2DL2A 4O2EB 1ZVHA 4IRZL 5FA3A 1ONQA 3SHSA 4N8CL 4U1NA 5C0IA 2BVQB 3RWJA 1U8PB 4Q6IA 2EXYC 5K33A 1WBZB 5DD5H 1KJ2L 1D5XB 1RSFA 3MV8E 1D5BB 4H88H 4ERSL 1HI6B 1LO0L 5JZ7C 4X0KA 4LHUB 1CG9A 3VI4E 2E9BA 4EOWL 3BW9B 3DSNA 3OR6A 1G6RB 1UGNA 2A1WH 1CD1A 3WIIH 3H7BA 1U93B 2NY0D 1H5BC 1IL1B 2GJ6D 4GW5A 2VDOH 5BQ7A 4KUCF 3ZYOA 1UCBL 4QRSA 2D9QB 4DN3L 3QEUB 4HUXA 2PW1A 1JF1B 3JUZA 4QGYA 3DUUA 1IKFH 1FIGH 3BSZL 1NGXA 2CLRA 3GSQA 4PJFA 3PWUB 1H5BA 3UZVB 1B2WL 3BDYH 4XBEL 5IEHB 4PY7A 2PYEA 5BOPA 5DSCA 1PVHA 1OAXL 6FABH 4OTXL 3WV0A 2D7OA 2CDFB 3RUGB 3ARGC 15C8H 4MA3A 4YDIL 4QT5B 1IC1A 3EDJA 4IRJC 1O0VA 1GYAA 3CSPA 5E4IA 4LLQB 1LWRA 4JY6A 3SKUD 4N1CA 1LILA 3GRWH 1CZ8H 1GGCL 4PJDE 4GG6A 3SE8L 1ROWA 5J3HC 5LGKA 3MXVL 2BZDA 4KZEL 4WW2A 1IAII 2A9NL 4NM4L 3ARGA 4EVNA 4PJIB 4IRJA 5C9KA 2IALB 5J6GA 2N7BA 3LKRB 4ODTL 5T3XE 2HTLD 1N3NA 3B83A 3P0YH 3G6JB 1GGTA 3QXTA 3T3MF 1V3JA 2NY1C 3DVFA 1Q9LB 3VG9C 1OGTA 1PFCA 5JO5B 4WFHE 5JIPA 1AHWC 3HR5A 4E0RA 1QBML 5GS2H 1CICC 4JEGB 3CK0L 1ZXQA 2VIRA 5CZXC 5K9QI 1F58H 4I5BA 1A1NB 4OCYH 1HQ4A 1YMME 4BFIB 2CLZB 2ZSVB 4JN1H 1M7DA 5SWSB 1BJ1J 1AHWA 3IKCA 1MCFA 4XCFH 1CICA 5BVPL 1XGRB 2NZIA 5LGHL 3GO1H 3V5HA 1Z0MA 1MIEH 3LPGA 5DJ6A 1I75A 4PJGA 3ZO0A 1T5WB 4JRYA 5TGBA 1KCRL 4PGCB 1T0MA 5HVGB 3LDBB 4XX1E 1IILE 1X4XA 3DIFA 1D5MA 1A0QH 4PD4J 2IBZY 1OAYL 1RK1A 1FNAA 1IE5A 1MLBB 5K9JH 4ZOBA 4ZQKB 5DFVC 3EO0B 4XNYL 3ZKNC 1MWAB 5F7WC 3M45A 1CK0H 3GM0A 3T2NH 1BFTA 4YHNB 1RUPH 4NN6C 1RURL 4FP8H 4LAQL 4Y4FD 5EU5A 5CGMA 1C12B 1A6AB 4J6RL 3RI5F 5F7KC 4CADB 5DRZA 2OCFD 4DEPC 2YPVH 2VZ3A 3T0EB 2P24A 5DO2C 4UAOB 1RIHL 1T21B 4WNQB 2BFVH 3OKEB 5F7UA 5DMIH 4F7EA 1R5IB 4PRHD 2XKNB 1JF5A 4JGMA 3BWUC 5BS0E 1D5XA 2BHZA 3EFFB 4JKPL 4M7ZC 2R4SH 4R4BB 3SDXB 3MA7B 1HI6A 2R9HC 4PJ7B 4NC1C 5L6YL 4LARL 3DLQR 4V1DE 4JY4B 1WF5A 3PWPB 5GS2D 5JW4N 3BW9A 5GRWA 1G6RA 2YRZA 1AGFB 3BIKB 3LD8C 5CBEA 3JV6B 4P5KB 1KN2H 3PWNB 1WBXB 5AUMA 1F2QA 2ZNWA 1IEBB 4H1LH 1HZHL 5AWNH 2P4AB 4JRXD 1X5FA 3UP1A 2X44D 3HC3L 3QEUA 4WI4A 2Y72A 4LSPL 4PJXE 3MLZH 4FQQB 4P9HH 1MFBH 3VGGA 2RCSH 2PXYD 4N0YH 4OB5H 3EBAA 3KXFB 4EDXA 1XGYL 1KC5H 1C5CH 5FM5M 1L0QA 2HJLB 5HHOA 4IIQC 2V2TA 1FYTA 2N4IA 4J7RA 1QR1B 5B3JE 3FRPG 2QJDA 5FDWB 1GVIA 1S9XA 4TOYH 2OTUB 3LCYA 2EO9A 3QIBB 4KROD 3F12A 4QT5A 1UWXH 5GGSA 1BJ8A 2JB5L 2L7UA 4M6AA 4F7MB 4PREA 4IIQA 4P23C 2HKFH 3QA3A 5FO9B 4PP2A 4PS4L 1LO4L 2X4RB 3MO1B 4MDJB 2QADC 4GSDL 2DS4A 1E4WH 1F6LL 4LEOB 4OZGB 4NO2A 2X09A 4PJIA 1KLUA 3ESUF 5A2KH 2IALA 4FFYL 4FQIL 5EN2B 1HXYA 1GZPA 1WFNA 2OR7A 3PP4H 1NPUA 5E2TL 4P23A 3G6JA 1IGMH 1FYHB 1F11A 1LEKB 2DQEH 5L9DL 1T20A 2PO6D 2P5WB 5LG1A 2CMRL 5CHNA 5MEQB 1ZEAL 1KPVB 3KLHC 5AG9A 4YC2B 2DICA 3QISA 4JFQA 2C4FT 4MD4B 4YXLL 5IB4B 3IVKB 2GJZB 4RZCB 1AP2B 1J8HD 1EEYA 1VEOA 4JQIL 1A1NA 3B2UC 5GGSY 4KDTA 4GW4A 1MSPA 1XZ0A 2R39A 3B9DA 5C0FA 1UT9A 3CFBB 2CLZA 3F7QA 5KW9H 3LDBC 3IB4A 3MLSL 1L7TH 1SM3H 5I18L 3S5LB 1CF8L 3OJDA 5EOCJ 3OB0K 1K4DA 1GPOL 4WHYH 3FZUD 1WICA 4Q9QH 2IPUK 1RUMH 4M7LL 3ULUF 2ORBL 5DJ2A 1JF6A 4Z7UF 3VFTB 2O61A 1S8DB 4LIQL 4PJEE 3DUSA 4LCCB 4XCNB 2HG5A 2WAHA 2NY2B 4EJ1C 1AJ7L 4PFEA 5AZ2H 1TJGH 2ICES 4X6CA 1S7WB 2EDKA 2APFA 5DUMH 3S88H 3D25B 5ESVA 4M48L 3O8XB 1MLBA 3O11B 3TBYB 3E6FB 3T0EC 5D6CB 5K9QG 4G9FB 4JQVC 4NHCL 2Y5TA 4LLAA 2ESVE 1QFUH 4OCMC 3I9GH 3GSWB 1CWVA 4YO0B 1KB9K 1GZQB 4RFOL 3QUZA 4QHKJ 2BNQE 3WJJC 5ESAA 4YPGA 4CADA 3SJVB 3UJIH 4L8CB 3T0EA 4JQVA 2APBA 2HVJA 1F5WA 1T21A 4WNQA 4NPYB 4OGZA 3HFMH 2HN7B 2VDLH 4RDQG 2E8ZA 2FJGB 3OKEA 3JV5A 4KMTL 4XC3L 2AEQH 3B5HA 3V0VB 3WJJA 3EFFA 4TULL 3QHTC 1T5XA 4U6YA 5J57B 5IROC 2HT3C 1P4BH 2MPAH 4JY4A 3PWPA 2F19H 1VFOA 5ID0B 2XOTA 5HGBB 4P2RE 5C0RH 2BY3A 5T1DL 4KVCL 2EDTA 1WBXA 3RTQD 3T65B 4CAGA 2CH8A 2R29L 1JP5A 1IEBA 3KPOB 4YHOL 1A3QA 3HB3C 4PJ8D 2HFFB 2YPKA 3P77A 1BQUA 1UWEL 4JVWA 5IROA 4U3HA 1FORH 1Q1JH 5C09E 3BX7C 4KKBD 5D1QD 5L88H 3QIBC 4MAUH 4LCUA 3HZKB 2VABA 2HJFA 2HJLA 2QQKH 3WKML 2Y25A 4LLWB 2VLMD 2VAAA 4U1GC 3MRKA 1QR1A 3AB0B 1F8TH 1U36A 3EOYG 4F7PB 2D03H 3B9KD 1MFAL 4IRSC 2OTUA 5TDOB 4J3SA 3GHEH 1X3DA 3QIBA 3WEXB 2IMMA 4GAYB 1KTLB 2VZUA 2DLEA 3ZKXB 2XQBH 4HKZB 4L5FH 2XYCA 5E24E 3CFEA 1J1OH 5EH1A 2E9JA 3P4NA 2J8UA 4NP4L 3VFWB 3MO1A 4IRSA 4JFFB 5D7IE 4U6TA 4YFLF 4ZOEA 4WI7A 4OZGA 3V6FA 5H37H 3QDJA 1N0XH 1I9RH 3JV0A 4NFDA 4E42A 3KPQA 3O41A 2BOCB 1JE6A 1NBYA 2VN4A 2YEZA 1MRDH 3TPUA 1AD9B 1KJ2A 1FNGB 1UKTA 5D96B 2AXJA 3DV4B 3FFCB 3QIWC 3X12B 3LPWA 1EJ6A 2X4QA 3ARBB 1A7BA 1U91B 4RRPG 5MEQA 3BGFB 4LGRB 5TDNB 1MHPH 3MNWB 1KPVA 1NCCL 1X6NA 4PJ9A 4WTZA 4RA0C 1FPTL 4S1SL 3F6IA 3UTZB 4MD4A 3QCUH 2G5BB 3IVKA 1MNUL 2GJZA 4RZCA 4UU9A 1IT9L 1UKSA 3BISA 4CN6A 4AIOA 3WBDA 5IQ9B 3MROB 5CEZE 3QIWA 4WI6A 4M7JL 2NY2C 4MD0B 3PL6D 3WE6A 3O4LB 4LCWE 4NM8H 2IH1A 2XZZA 1VCAA 3WS3A 3LQZA 4JFEE 2GI7A 3A6CH 3NCBB 1R0AH 1ZGLB 3QG6A 4P5TB 2VMFA 3E3QE 4JO2L 4KJQD 2Z8WC 1ZLUK 3UDWC 2YMXH 4HT1L 4ZUSB 5FYJE 5D7SL 5FGCB 3H9SD 5C08A 2W9EL 2IFGA 1FH5H 3D25A 4XPAH 1JNNH 3LN4A 5ADOL 2IBBA 2J5LB 3TBYA 2DJ4A 3IXAB 4AIZB 3QPXL 3PHOA 3MRDB 4DKEH 2PYFA 3QEGH 4ZOCA 3T0XA 3UDWA 1DQTA 4JN2A 4ZS6C 4Y1AA 3GSWA 3S9DB 4YO0A 1JGDB 3T1FA 1DQLH 5B38B 2R2BB 3D1MC 5HHMD 2GK0B 2GK2A 1XCQB 3BPCA 4L8CA 4FTVD 2DM3A 1LO2H 3ETBF 3KDMB 4DTGL 4LASL 1QA9B 5ENWA 5F9OH 5BRZE 4NPYA 1MCOH 2FJGA 5JOEA 4I13B 2EDFA 3VXME 1NFIA 3BGMA 5DC9B 4ZUUB 5EORL 2OJZH 5HDQH 3S37H 5LKNA 2P8MA 1TJIH 2J8OA 5IGXL 1CU4L 5DRXB 1G9NL 1CXLA 2GY7B 3T65A 1JZ6A 1KJ3H 5MERB 4I0CC 3TBVB 4HWUA 2HFFA 4GRWH 4RRPA 3QDMA 4LLYB 3S6CA 2P5ED 1ETZA 5CJBA 1D6EB 1J1XH 4LMQE 4QXGH 4Q9RH 3ZKXC 4KK5D 5F89B 4FXGB 3TA3D 1PZ5A 1JI2A 4LLWA 1LMKA 4WCYH 1RULH 2WMPA 1H3XA 3S35L 1YYMH 3L5XH 3C09B 2A1WL 5E2JA 3C5ZB 1K2DA 1G9ML 3PGDA 1ZT4A 3FN0H 3CSBA 4NO0A 3OX8B 4F8TA 3DNKA 3P9LB 2AVGA 3SDDB 2P8PA 3UEZA 3T09A 4OLVH 2JK5B 4YX2L 4JFFA 2NW2B 4QXUL 3BGFC 5F3BB 1UEMA 1GXEA 3ZKSD 4Q9BA 4PRNB 2BXYA 5EBWB 4U1JA 3MOBH 5ICXA 5C70A 1AFVH 4DKDC 1AD9A 3LKQA 1KB5L 3DV4A 2BERA 3FFCA 4Y5XB 2JJSC 3D69B 4LLMA 3JBG7 3GSXA 2FL5B 4DK3A 4Z7QF 5DJDB 4JFDA 5TDNA 1T2JA 3N9GH 3ULUE 2FX8H 1PLGL 1VSCA 4X7FC 4Z7UE 3UTZA 3SPVB 1FFOB 3BJ91 3BI9X 4P2QD 3ZE1F 1MUJA 4P5TC 5B4MC 1I1YA 4FQCH 4FFWC 5IQ9A 2VDKL 3MLTB 4E41D 2JJSA 5F7DB 12E8L 4ZS7L 1ZWIA 3P4LA 5EU7E 4MQ7B 3O4LA 1TVBB 4HMEA 4K94H 4C56D 1NGWA 5C0CB 2K1MA 4OIAA 5E03A 3RBGA 4NCDA 3HI6L 1KG0B 2YA0A 4P5TA 2J5LC 4N0FB 3ZSSA 4ETYA 5IF0A 3RKDD 1Z3GH 3TFKD 5E2VL 1K8IB 2C3HA 4R7NB 4ZUSA 1A1OB 4JZNA 1IC7L 4KK6D 5BOZG 3NA9L 1F58L 2FD6L 1A5FH 3KPSD 2OK0L 1VACB 3MLUL 2P46B 2IANE 2ZNXA 5CSBA 4IBLT 2QTEA 4EUPB 1KCVH 5IJKC 5T1LA 4WIQA 2FR4A 1S7VB 2AQ3A 4UIMB 1JGDA 2EEBA 1JZ8A 1MIEL 4M5ZH 5B38A 5I73B 3QXUA 2LE9A 3PDOB 3ZKMC 5HY9B 3VXTB 3QXVA 2RJMA 3HE6D 4DGIL 1T1ZB 3BZEA 1RZFL 4QY8B 3RZCD 3CLFH 1EBPA 4XVTH 3CCHA 3RAJL 3IDUA 3DVGB 3KDMA 2DTSA 4LNRB 3U1SH 5IJKA 4Y4KB 3ZKQD 2F58H 1ZA6A 2DTMH 2DWDA 4NKDB 5D1ZD 3B4NA 3AREB 2VSCA 4PPTA 5KSBB 4JPWL 4PRID 3T2PA 4RWYL 1NAMH 2FJHA 5KAQF 2EDEA 3MRRB 4OGYH 1N64L 2A77L 2A6DB 4OD3H 3LKNA 3IJSB 4ONGL 5E7FA 4Z18A 3IFLL 3SQOL 3TBVA 2V17L 3UXFA 3DVIA 3HZMA 4X6BB 3FQTA 2BFVL 3C09C 3VFGH 1TNMA 3A67H 5CEXB 3VRIA 3UTOA 4F58L 1BZ7B 4K7FA 3ARUA 1PKQB 3HI5L 3O9WC 2A6IB 3V8CA 1S5IL 5A16A 3HC4H 1A6VH 1CGTA 3P2TA 2GJ6B 1R6VA 4LSTH 5FUOH 4EIGB 1SJEA 1BEYL 4K8RH 2QQNL 1P7QB 4HCRH 3TP4A 1CGYA 3T0BA 4G7YL 2UUDH 1KN2L 3UJTL 3LN5B 1FAIH 5IFHL 1YEGL 4NKOB 3SQBA 3GBML 4MSWB 3O9WA 1EHLH 3CU1A 5CWSA 4JZOB 1I8IB 1PX4A 1CGXA 3MRBA 5GJSH 4QRRE 4KKNA 4M43L 4OB5L 2JK5A 1LEIB 1Z2KA 4Z6AT 1NANI 4KJPD 3SDYL 4LFHD 4PRNA 4OZHE 2GUOB 4ODSH 2C3GA 4QCIB 4GG6F 5IESH 1OB1B 4G6KH 3A6OA 3D69A 4YDKH 3UPRB 1U8NB 1EAPB 2FL5A 4M5YH 4N5ED 2DKUA 2ATPA 3SPVA 3MR9B 3QEQA 1Z5LA 4EDWH 1QYGL 2BRRL 2ZJSH 3G08A 5CKAA 3TH4T 2BVUA 3MLTA 1RIUL 4HAGA 1E4WL 2BSTB 2AJZB 5IV2A 4X80L 3NPSB 4MQ7A 4K2UH 5GGVH 2YKLL 1CIUA 4ZFFB 4I8DA 5EZJA 1IGML 1KG0A 5GGRA 4N0FA 1DANU 1K8IA 4YBQC 3QEHB 5I1HH 3FQUB 4KQ3H 5IQ7L 4WJ5A 5FCUL 4DN4L 4R7NA 1GGBL 3GGWA 3FO2B 3HLAA 5I73C 4Y4HB 1EERB 4HIIB 5DMGD 3OF6A 4K8RD 3GI8L 3G5VB 3MLRL 1VACA 4PBWD 1BGXH 2Z4QB 5F1NA 3GKWL 1JV5A 4O2FB 2J8HA 2LFGA 1KSRA 1XGPB 1MHCB 2ITCB 3I50L 1A6ZA 1S7VA 4WWKD 4Y4KC 3MBEC 1KELH 5HDBF 1YEEH 2H6PB 3SKMB 2RFXB 3D0LA 3RIFK 3PDOA 2DD8L 4LU5H 4OCXL 3VXTA 1OPGH 1RZKL 2F53D 3C60C 2CJUH 5T1MB 2X4UB 4JG0H 5BMFH 3GJFK 5ISZD 2CQVA 1B6DA 4BFGA 5K9OB 5C2BH 3Q1SH 4LNRA 5GGRY 3U7YH 1PAMA 1YN6B 1FFPB 4Y4KA 3MBEA 1U0QA 2AW2A 5B8CB 4R2GC 3RNQB 2X4NB 3UPCA 4FMKA 4NKDA 1UENA 4Y4FB 1BWWA 2NR6D 4TTDC 2YD9A 5DRNB 1CBVH 3QHFH 4I4WA 3CVIL 3C60A 1JWMB 1QFUL 4FZEH 2DBLH 1XH3B 1LNUA 4XVUD 4CW1B 4OAWB 2C3WA 4FQ2H 4HK3N 5E8NB 4JM2D 3GZKA 3UYOD 1HSBB 2ZG1A 4UT7L 2WIMA 3IJSA 4PRHB 3UTTE 5HHNB 3FHQA 1QRNE 2ZCHL 1NGQH 5DK2A 1F2XK 2VDLL 3QCTH 4AQ1B 1MI5E 1QTYT 5F1SA 4HXAH 4I0PD 1AO7E 1PKQA 2A73B 3L5JA 2NQCA 3FQRA 2A6IA 5D2NC 3SKJH 3S97C 3GUTB 5DD3H 1X4ZA 3RJDA 1I9IH 4U2YA 1JGLL 1JWSB 1JYVA 4JRXB 3UPAA 1P7QA 3TIEB 5CEYA 4RGOL 4KI5D 4RMRA 3LN5A 3BH8B 3V5KB 2PXYB 4NKOA 3Q3GA 3ULVD 5D2NA 4Z7QE 4JZOA 1I8IA 5DDHA 3KPLA 5T3XH 4F57H 2XTJB 1EGJL 3RUGF 5L8LB 1IZJA 1ERNA 3K7UA 4JAMA 4KV5F 1C7SA 3HNTL 3UO1H 2BNRE 1G9NC 2D31B 5F7EH 3DV6A 5HGGS 3MV8D 2H9GB 1B6UA 4LLVA 3G9AB 1K5NA 2IEPA 3PQYA 1OB1A 3SCMD 4M6NL 5GPRA 1MH5A 3UPRA 2WINB 1U8NA 5DQDH 3NPSC 4PJIF 4M1CC 1P1ZB 3GK8H 4HG4J 2FATL 5EUKA 5CCKH 3QFJB 5JQ6H 5F3HB 3MR9A 4LCIL 3G6JF 1CE1L 4QRPE 5DUPL 5HYJA 1V3LA 2HT2C 2AJZA 2OS7A 3WO3B 1S9KC 1I9RL 2PO6B 1G1YA 4RIRB 3LEYL 4JPIA 5E9DB 1G9MC 2AI0H 4P3CL 3MNZA 4Y4HC 1DLHA 5I1KH 3FB8B 2JB6B 3KJ6H 1J8HB 1BFSA 1EA9C 2FCBA 5FO7A 3OKNA 3INUL 2H26A 2FX9H 4RMUA 4OCWH 3VFVA 4S1DD 5L7XL 1AI1H 3MRQA 2NYYC 1NMCB 3FO2A 3BN9D 4MCYB 5SWQB 4Y4HA 1QFPA 1Q0YL 3G5VA 5F88B 4AIXA 5HD8C 1VKXB 4O2FA 1K4CA 5KAQG 4B7LA 4I0KA 1ZVYA 4NT6B 2F54A 2PW2B 2ITCA 1JYNA 2H6PA 5T3XD 1AGEA 2W65A 3L3KA 1C1EH 4HAFA 4U6VH 3QQ4A 3KPTA 3PNWB 4HC1L 4HWZB 1KB5A 3EAKA 4NKIL 1EJOH 4FFZL 2X4UA 5T1MA 1OP3K 1OAQH 1YY9D 5EPMB 3JUYA 3QAZB 1YN6A 3MFGB 5HYQA 4XPAL 3GSNL 4XCEA 1YMMD 3IFOA 5DRNA 2PCPB 1EH9A 1AH1A 3CX5J 1C8PA 1DLFL 3QZWB 2YRPA 3LV3B 4OAWA 1SEQH 5D7JD 3BYTA 1FNSH 3NN8A 4K7PY 3SDXF 1NGZB 2OL3L 1BX2B 3OKOB 2ADFL 5DHVA 5HHNA 1NGPH 2PYEE 1QP1A 3DHMA 4JO3L 3QBTB 1BIIB 4PP1C 2VXUH 3P30L 4G43B 1SMAA 5FKPB 5GIRA 3NCFB 1YEDA 1FFNA 1A3LL 1NMBL 1T66D 4LP5A 1JWSA 2XTJC 4XCCL 1R24B 3L7EB 1MCBA 3ET9F 1I7ZA 4X6DA 1CD0A 1MREH 4X83A 3TV3H 3NAAH 5EG6C 3TLRA 2Y6SC 2P42B 3GSVB 1MJ8L 3LOWA 3LKPB 2YD8A 5E0QA 3CAFA 4NJ9L 3RWFB 2W9DH 2HYMA 4DUXA 5IG7A 2AP2A 5CGYC 2FEDC 2IGFL 2HVKA 3QCVH 3MPCA 3MLVH 3DYMA 3C08H 4YE4H 3NZ8B 4Q9RL 1F3JA 3U4EB 4UV7L 1UADC 1H8NA 2OMBA 2XI9A 1EMTL 3LEXB 5BS0D 3VXSE 1FC1A 2K9UA 3LRGA 1MJ7L 5EO0B 2XY1A 1X7QB 5E1AA 2NY4D 1U6AL 4OZGF 2WINA 5EA0H 3FRUB 1G7PB 1MLCA 1JGEA 1ZSDB 2IG2H 4YQXH 4CJ1A 43CAB 1LO3H 3IDIA 3QFJA 4ZUTA 4UB0L 3P40A 4I2XB 4BFBD 3F58H 4PGDA 4XHJD 3L5WB 1I3GL 1R5WB 3PWVB 3WFZA 3VG0L 3CFDA 4Y2DA 1NFDA 1XGTB 7FABH 5DD1H 1W0YT 4AQOA 1OTTD 5DQ9B 2I5YL 2CIIB 4RIRA 5E9DA 1NMCC 3TNNB 4CDHA 2AK4B 3U30C 3GSUB 2JB6A 4GMTL 5HDBE 4OI7A 3UTSE 1OLZA 2FX8L 2BOBB 1FHGA 4P0DA 1Q9WB 3PUCA 3HPJA 3ZHKA 2AABL 4AL8L 5LXGL 3NCJH 3PL6B 2EYRB 4TSAH 5SWQA 3LIZH 5IKCA 5CBAB 2FBJL 4APQD 1ACYH 5E8DH 1JYWA 4CN4A 3LH2H 4HGWA 4CU7A 5BVJB 4PUBL 3PP3H 1JHTB 1H9VA 4K9EH 1KLFA 5EZOH 3DXAA 2VXVH 5EOTB 3NIDF 4M1GH 3HCVB 3QAZC 2APWA 3K46A 3BEWB 1JZ5A 4LHUG 1FVEA 1BD2A 4CNIB 1CDJA 1FE8L 3H9SB 1IEAA 3MRCB 3JWDL 1N8ZA 1VESA 1E0OB 1AD0A 5CD5D 5EPMA 1FV1B 2UVEA 2LQRA 1A5FL 5TE4H 5EZLB 5IR1A 5DJYB 4MA7H 5GXBB 2LU7A 4LSQH 3IAGC 4NZTH 3DMMC 2PCPA 1FFRA 1NC4A 2VR9A 4NC1E 2AK1L 2YUXA 3FO9A 2D3VA 5SWZB 5E8EB 1F3RB 4NO3B 4WU5B 1ES0A 1I9JL 1CGSL 3OKOA 3WFBL 3S36L 3OV6A 3DMMA 1S7UB 4NQDB 4A6YL 1J0IA 5FECB 5IEKA 5C9JA 1ZV5A 3S35X 3R0MA 3T0DA 2XZCH 1GRWA 3RUGE 5FKPA 3WFDL 3TEUA 1U8IB 4KV5E 4G8EA 1AGDA 1E6OH 3MBXL 4Y2OA 1W72H 3FB5A 1RZKC 4AT6A 2ESVD 3OL2A 6CGTA 2ICCA 5T5FL 4QTHA 1VPOL 3STLA 3IS1X 1IGTB 2BNQD 4RFNC 3LKPA 2P8LB 2EC9U 4I3SH 4NZRH 4KJWC 5D7LB 2JELL 2MKLC 2HWZL 3L95B 4FNLH 3IU3B 4PJIE 3TVMB 1BBDH 3R0NA 5EBMA 1YY8A 1UQSB 3A67L 1KEML 4UMGA 3G6JE 3U0TB 3MUY1 1S9YB 2OJEB 1MHHB 3I84A 5E8OB 3OWEA 2ZPKH 2ADIA 3TBSB 4DJMA 4HIHB 5CEZH 3FKUS 4P2RD 1RHFA 5D5MB 5C0DB 1ZSDA 1KPRB 1S7QA 4UT9H 5SWSE 1UM6L 4I2XA 3TIDA 4OM0H 5IMKB 2OL3B 3L5WA 4YUEL 5C09D 3PWVA 4JDTH 3GFUA 5D2LA 1IAKB 4FZ8L 2Z91A 1ZTXL 2V7HA 3EO1A 5ITBL 5DC4B 3LRSB 3TNNA 3QULB 1AE6L 2AK4A 4MAYC 4QTIH 1QUNA 2DYPD 3GSUA 2DQDH 4NNXA 4I18A 1X9QA 2CRZA 4DAGH 2VISA 3WXVL 2B1AH 1A9BA 5DUBA 5KVFH 4JO4L 3PDGA 3G6AA 2XV6B 3EZ8A 3TESA 4OIIL 3HAEB 3TNMB 3QNYB 4N1EA 2DQCL 2HAZA 4MAYA 4X5WB 4GRWB 4WFGE 5CINH 3I75B 4GAGH 4CVZB 1Q94A 2WWMD 1UM4L 2I24N 1EGJA 4ACPA 3T0EE 4LGSB 4RGNB 5EOTA 2HA1A 1GGUA 2V7NB 2P1YA 1SYSA 1FZKB 4WENB 5TF1L 1IVLA 1KN4H 2P45B 3HE7B 3BEWA 1KCLA 1CDBA 3O3AA 3EYFB 3TJHC 1IGJB 4HS6B 1P4IH 4XP6L 2ID5A 3SDXE 3L1OL 2Q8BH 2B0SH 3HS0A 4PJ7E 1KF9B 5FUZL 4TSBL 2A9ML 1FV1A 4ODVH 3PWPE 1A14L 5JA9A 3BAEL 5KVMC 2CO7B 1VB9A 5CEZD 1O7VA 3FT3A 3HI1B 5BZWA 1XR9B 3K2UH 1V3MA 4LCWD 1FL6B 2R56L 5D93B 3FT4B 2LU3A 4JFED 2QLVB 3ELAT 5SWZA 4KKAD 3SGEI 2AJVH 3KXFE 1KIPB 2VZOA 5GZOC 2B1HH 3VWJB 5D1ZB 4RA3A 1UA6H 4NQDA 3D3VB 3RX5A 2VZTA 4M9OA 5FYJD 3U7YL 5FECA 1QFWI 2EDRA 2H32H 3VFUA 1U8IA 3VW3H 1CBVL 1SVZA 3TVMC 4F2MB 1AQDA 4HLJA 3ZT7A 4IOFC 4PD4K 3N1MC 4OUUB 3V6ZB 1NMAH 1A4KB 3WFEH 5I8EB 4LPWA 2ZCLL 1YECL 5K93A 1IGTA 4UDUB 4OZGE 2FYYB 3QDAA 3TVMA 4NQCD 3IU3A 5MEPB 4OCSH 4GKZB 1NGQL 1X6LA 4UIKH 4HC1A 3L3IB 3WNMA 5IHUH 4G8IA 4U1IB 5BRZD 4ODUB 4F9PA 3GMNB 35C8L 1KIUA 1QSVA 3D39A 2HT4C 5JMOC 2P5WE 4CGTA 1LEGA 5DRWB 3ULUH 5DD3L 4RMSA 3GSNA 4DKAA 1WWCA 4Z9KB 4TUJB 5IW3A 3TBSA 5LBSL 4YJZL 3ZLQC 2WP3T 5HHXH 5CKGA 4R0LC 5KS9B 5MEOB 3JTSB 3KR3L 2NLJB 1KPRA 4JG1L 3ZDYE 2OL3A 3KLDA 5ECJE 2F8OA 1TQBB 3VXRB 3ES6A 1RVFH 3BDXA 3OKLA 3UO1L 3VGEA 2ADGB 3L3GB 1KCUL 4A6YB 1V7NH 4R0LA 4FHBD 1CGVA 2P43B 4MJ5B 3RQ3A 1FZJA 3IT8D 4OFIA 3WIHL 3NIDE 4N0UB 4HBQA 3VDCA 1FRGL 1WEJL 1JN6A 1XF3A 4U3CA 3BKJH 4RGNC 2ICEB 4G9FE 3X3GL 1NGYA 3BESR 3QI9C 2DM7A 3I6GB 1ADQA 3HE7C 4MNGB 4PYGA 4Y1AE 3ZZ1A 4NUGH 4QWWD 1GSMA 3I75A 2VLRA 4CVZA 3SJVE 3QFDB 3NCYP 3BXNA 4R8WL 1R3KA 1Q72H 4MWFA 2Q3ZA 2V7NA 3QI9A 1MF2H 2DI8A 3U36B 1BAFH 3RPIA 5DEGB 5CP7B 5C86A 5I1KL 1BF2A 3HE7A 3IU4H 1KTDB 4WW1B 1HWGB 1FGNH 2J7LA 3RBSA 1HYSC 2CKBL 4NQXB 5DURB 1NUFA 4XPTL 4OCWL 1FN4A 3T77B 3ULUD 4KRNA 5D93C 1A2YB 3OHXB 1JNLL 1J0YA 4U7MA 1B0RB 5IW1A 4TTGA 2BSED 1JMXA 2FGZA 4HKJB 5CUSH 2CR6A 5E5UB 4DQOL 1ZANL 1F02I 3EDFA 3VWJC 4DUWA 3EYUH 5F9JB 3MRJA 1N4XH 1MHEA 4NIKB 5ESQA 2YOCA 3P4MB 1HHHB 4XC1H 5CILH 3HI1A 4OLWH 3U9UA 2J4WH 1FL6A 3QDME 4HXBL 1JRHH 2R0WH 5ISZB 4OLXH 4C83A 3X13B 4LSSL 3SE4C 5TFSL 4K07A 4OM1H 5KSBF 3MJGX 1QBLL 3C8DA 4NQEB 5LAXB 3FCTB 3D3VA 1R3JB 3BP7B 5DHXB 2FJFA 4JZJB 4O4YH 3HG1B 3SE4A 5HHVL 3PDDA 1M7IB 4JM2B 3JWDC 4F33B 5ALCH 1JGUL 1P4LB 1A4KA 4WVRA 1WZKA 4YAQA 3NACL 4NNYA 1ZHKA 2X89A 4JFFE 3UCRA 4UDTB 4UDUA 3UC0H 3U79A 5CD3A 2D4DA 3AAZB 1SMOA 2UVFA 3FFCE 1YNLH 2NTFA 1G84A 1TMCB 4UV4H 3PABA 4ZTOH 2OQJA 5CGTA 3F7VA 3U7AA 4TUJA 4HJJH 3ME0A 1MRFH 1SYVB 1QSEA 1TQBC 1MREL 1P6AB 1S7TB 3V6BR 1BWMA 2WK2A 1ZHNB 4XPBL 2KKQA 3DUHA 1YZZA 4U1MB 1LE5B 5KS9A 2OXGA 4IMLB 3JTSA 1J0JA 2Q7NA 1N0LA 2O5YH 2OM5A 4ZFZA 3O4LE 4QOKD 3MV8B 1OLLA 4OD2B 2EE6A 4YE4L 3VXRA 1QQDB 5I1EH 5T3ZL 4Q6YA 1PYWB 3L3GA 2APTA 4A6YA 3SCMB 5LVEA 2WBJB 1U3JA 4KTDL 5J12B 4M61B 4KHXL 4MJ5A 2NXZB 3VFNB 2XQYG 5FGCE 1GC1H 1NAKL 2AS5M 5TQ0H 1R3IL 2EDJA 4FXKB 1LE9A 5LWYL 3W0WA 3GIZH 2ICEA 4U0QB 3C2SA 2X1PA 4MZ3A 5F97E 4MNGA 2YRLA 3W82A 5KOVC 3NABH 3BKCL 2BY0A 4G6FD 4GRLD 2DM2A 5DD1L 4OJFL 4HPOL 5IK3A 1UYWL 1TZIB 4P2OA 1MIMH 3EJZD 4PB9H 3U36A 5CP7A 1IBGH 4LDLB 1W2KT 4WW1A 4UILH 5F9AC 4ZG1A 4NZUH 3V6OA 1CLYL 4E5XA 2GIYA 3RVTD 1B0GA 1HIMH 3T77A 1A2YA 4TSAL 3RGVC 1JPFA 1Y6MR 5E2UL 4RBPK 3EHBD 1Y0LB 3EDDA 4ZNCD 3P11H 2MJWA 4HKJA 5E8DL 3W11C 3LH2L 5IW6B 2NZ9C 3PIQA 1ZKAA 4YHKL 1H3UA 5F9JA 1PSKL 1HWHB 3P4MA 1T6WA 1MRCL 1N5AB 4HFWA 3RNKB 4N1HB 2GITB 4X7TA 1XT5A 4M6MH 3WDIA 5L2KB 2IF7A 4JZJC 3UTQB 4KK9C 3RGVA 1A6WH 1CDIA 3X13A 3QIUC 3I2CH 2LTQB 3DX9A 4JKKA 3LQMA 1PJ9A 1OHQA 1ZT7B 3T0VA 2R0KH 4NQEA 3CSYA 3SOBL 3M8OL 4XNXL 3OSKA 1R3JA 2ADJA 2EZ0D 1FL5A 4G6JL 3VXUA 5BO1H 3UTPE 4JZJA 5CJOH 1DL7H 3HKFA 1U8HB 1T03H 4MQTB 3QIUA 5H2BB 3WSQL 3ORJA 4YHIA 4L29B 2V2XB 4KK8C 1P4LA 3QUKB 3O45A 3CFCH 4KHTL 3MLXL 3VRLF 2AXHA 3GI9L 3GMOA 5FYKU 1UH4A 2MMXA 3S96B 4UDTA 4LDOB 2GCYA 4L3CB 3MMEB 1T7VA 4JCLA 1OTSD 2CKBB 4Z76B 4HGMA 4PJHA 5D8JH 5LQBL 4G6ML 4JB9L 2ZOLB 3W9DA 1K8DA 5KVDH 2YUWA 4HF5H 3P73B 3OZ9L 3MJ9L 4YDVA 4RISL 25C8H 1SYVA 4Z0BL 5T33L 2DQIH 2OTWB 1EXUA 2W0PA 1SQ2N 2VLJA 4Q2ZA 2WBJC 4QLRA 1AC0A 3H0TA 3NIGF 5J12C 1FLRL 2NXZC 5C8JA 5ETUA 3TPKA 1CLOH 1NLBH 1JZ2A 3UTTD 5C0CE 4OD2A 1DQJB 3MA9L 1QRND 43C9B 4M93B 5E1HB 1UM5L 2NY4B 3BZFB 4FFVD 3ZSTA 3BVNB 3NBNA 1A7PH 1AO7D 2W60B 4P57B 1B3JA 1CLZH 4NO5B 3C87A 4GXUM 1MJJA 1P2CB 4P4KD 1B4JL 4EUPG 2DQGH 4PJXB 3S7GA 5GGTH 3CMOH 4CN1A 3CZFA 3JWOH 3GBNH 5KSUB 2X4SA 1L7IH 3IETB 2FZ3B 3FMGL 5E5MB 5EU6A 4ZXBB 5JHLL 3GB7B 3SDAD 1P5UA 2BNRD 4PLKC 3HPLB 1G7MB 4F8QA 4QRUB 1OSPH 1TZIA 4ELKB 3QHZH 3M17A 2OR9H 1HHJB 4QTIL 4KDWA 2BSRA 4G80A 2R2CA 3RPKA 4DAGL 4P4RB 1RU9L 4UINL 4HZAA 5KVFL 4ZNEE 3BQUB 4A2MA 5KSBE 2Y07L 4KRLB 3WN5B 4F7CA 1CT8B 4QRPD 3HZYB 1RFDL 4PY8J 4RQQB 5FV1L 2EE2A 1TETH 1UJ3B 2WBKA 1DBJL 5IB5A 4NYLA 5EOQL 2DAVA 1N5AA 2EYTA 2V2WB 3O6MH 3RNKA 1N59B 3PXJA 3CXHK 3S36X 2GITA 5L2KA 4TNVF 3WNKA 1MVFA 4OCRL 1UB5A 2Y4SA 2NNAA 3R06B 3MLWL 2RHEA 2CDEB 1W0WB 3L3DB 1PKQE 2EYSA 2KPNA 4KZDH 4JVPA 3U0PB 4NHUB 2Z8SA 3UAJC 4BSVB 5IM7B 4M6OH 2GJ6E 1OW0C 3NCEB 4OF6A 5D72L 3REVA 1KT2A 3DSFH 5EBLB 4HKBA 3HUJB 4L29A 1KOAA 1PEZA 2ZUTA 1FDLH 2QQLL 5I8OL 3N1FC 1MFDL 3QUKA 3CH1B 1N5YL 1OW0A 3O2DA 1PQZA 3EFDH 1OAZL 3S96A 5IBUB 4PV8A 5B39G 3N1GC 1C5DB 2JF1A 1NKRA 2CKBA 3MRPB 4AENA 2WWKT 4Z76A 3AS2A 2I07A 5I6XB 5KVEL 2B2XL 2ZOLA 4KXZH 2XWBA 1VFBB 2EXYD 3STZB 5I1IH 3KLSA 3B6SB 4RFEB 1BREA 5F9WB 2E7BA 3RI5K 1KLGB 5JZ7D 4KH2A 3SGDI 2OTWA 3QO0A 4N9GA 5D70H 2XY2A 3RVUC 4AH2B 4FQHA 4JDVB 4PRBB 1GJIA 5TH2B 3DPBA 5EU3B 3HNSL 3BHBA 1E27A 1KNOB 4CRPA 43C9A 2PYED 5GHWH 4ZFOL 4AG4H 3RIAF 3BZFA 2Q7YB 3BVNA 2NY0C 1OP9A 2YWZA 1XF4A 5AD0A 2W60A 3DOSA 4P57A 1DN2A 4NO5A 3S34L 2WSKA 3O0RH 4N0CC 3U0WL 5AZEL 2EKJA 4YK4B 1KIQB 4IDJL 5LJYH 4XMPL 3E1F1 2VWEC 5D2LF 5GRZA 1KIRA 4TPRH 1I1RA 4QHUB 5JUEH 4WEMB 3L3HB 5IMMB 4O5LL 1DBMH 5KSUA 4IRJD 1KFAH 2G60H 3V4VL 2FZ3A 2B7DT 4GKNA 5E5MA 2IPTH 2H1PH 3BN3B 1RUKL 4X7CC 3JXAA 2DYPB 2DQUH 3U2SB 1ZE3C 4KWUA 4DZBA 5J3HD 3HPLA 1CTNA 4U1KA 3BQUC 4QRUA 4OD1L 5EO1B 4ELKA 5I15L 1HHJA 4LSVL 4KKCC 5BV7L 3DX8A 2XKUA 4BQ9A 3J7HA 4FQJH 3RHWK 1H3GA 1UJ3C 1G6RH 1W72B 1FZOB 1LP9A 5DD0H 4KUZH 2EDOA 1C5BL 3MREA 3BQUA 2DLFH 4MXWL 4WFFD 1DCLA 3WJLC 1CICD 4NUGL 3GSRB 4JLRB 5C0AB 1UJ3A 3EOAB 1RPQA 4Y5YA 5CZXD 1WWWX 1YEIL 2X1WL 4JY5H 5CMAB 4K3DH 1HHGA 1N59A 4JRYD 4PRHE 1ZLSL 3V4UH 4FXLA 4HX1A 5IFJA 1CFTB 2VDNL 3H42L 3R06A 4LKCB 1FGNL 2CDEA 3WJLA 3VRLE 3L3DA 3UTSD 1DZBA 3U0PA 1JCKA 4NHUA 1LHZA 2KBGA 3IS0X 3CLEH 4BSVA 5I1GH 3AUVA 2HRPL 3MRMA 3MODH 5ICYB 3RWGA 4JRXE 4HDIB 5JXAL 4PJCB 3ROOA 5EBLA 4BZYA 2VR5A 3GJFB 2AJYH 1U8OB 2J4WL 5DFVD 2CSPA 3BH9A 4NQVA 3WMSA 1QR4A 1XF5A 3ZKND 2JJVA 5IBTH 4OLXL 3CH1A 1ZLVH 2XTJE 4L4TB 4K3EL 4K3HA 3AFLA 5F6HJ 1JTPA 2IMNA 1X5HA 5F9WC 4R4FH 2R23B 3KNBB 2UYLB 1C16A 3NIGE 3RWHB 3VXPA 1C5DA 1RIVH 2OYPA 3G6DL 4OGXL 4YIQB 3MRPA 7CGTA 2X7LA 1HN1A 4KI1A 4JFOA 5DO2D 4M1DH 3PHSA 2UY7A 3O3BA 3QXAB 3L5IA 4PV9A 5JPMB 3KG5A 3OGCA 4JDZB 3LHPH 1B0WA 3QFJE 4OLYL 3G5YB 2R9HD 5GRUL 1KLGA 4K23H 4NQCB 4O58H 1BJMA 1YMHB 3NCYS 4TVPH 4G8FB 3U9PL 4C4KT 1U8QB 1K85A 4M4RA 4AH2A 1J87A 1HNFA 4G6AC 1TZHB 2V6HA 3NH7H 5HHOD 4YK4C 5E9DE 1FYTD 3IDJB 1KNOA 5EWIH 4JPVH 1Q38A 3PJSB 1OP5K 4Z7WA 3F7YB 4B7IA 1R3HA 4XP4L 5J1TC 1J8KA 4H1LG 3G5XB 5BZDA 1YNLL 4V2CB 4RBPH 1M6OB 3TT1L 1OQOA 4POZC 4W6XB 3B2VH 3RL1B 2HLAB 4GQPH 5IBLC 1NL0H 3OJ2C 3ARDB 1BVKA 4KRPB 2DQHL 4XMLL 2EE9A 1CFQA 1GL4B 1SJVA 3MFFB 5F1IB 2X1QA 3OAYH 1MCPH 2XZQH 1KGCD 3A6BL 5KSVA 1FNEB 5F7YC 3QYCA 4GO6B 2V5RA 4P23D 1RZ8A 1R5VB 1PDKA 3VCLB 5I2IB 5DYOB 4WEBL 4OZIB 2FGWL 2X4PB 1R3LB 4XI5C 2QADD 5EO1A 3BP6B 4HFUH 2WW8A 4PB0L 4GRWF 3DBXA 4ETQA 2LVEA 3DGGA 1A6UH 3EOBB 3W2DL 3QZWG 5I66A 3MJ9A 3BRFA 3K4DA 1EO5A 5HHPA 1MCEA 4D9RD 3PHQB 3VMPA 1A7OH 4ODXB 4UUJA 4XTRC 4XP9L 4POUB 2DMCA 3KLHD 1WZ1H 5K59F 1IM3B 1G0XA 3QXDA 4HS8L 4JLRA 5C1MB 1OM3H 4HG4K 2VE6A 4JKWA 3E2HB 3EOAA 2XA3A 3MV7A 4D0CA 9CGTA 3CZJA 3B2UD 1VERA 4KQ4H 4X5XA 2CUMA 4J3VA 3TCLB 2CRIA 4LKCA 1IAIH 2VXQL 1Q9KB 2XTLA 1RUAL 5KSAB 1RQ5A 2W0FB 1YEHH 2I60H 1NCUA 1IJ9A 3VFOB 1HNGA 4OSUL 4WHYG 4HIJB 2C5DC 5ICYA 3EOTH 3MOAH 4LQFH 1I8LC 4IRZH 3CSGA 2H8PB 3QR2A 4PJCA 1INQB 5F6IC 3Q6FA 2ZSWB 5IB2B 4N8CH 2C7UB 1TQCB 2C1OA 3GJFA 4WWID 3T0ED 4M6ML 4ODBD 1KJ2H 2YD3A 1U8KA 4ERSH 4L4TA 1QEWA 1LO0H 1KXTB 1I8LA 1BQHG 2CKNA 1DBAH 2XKSA 1PG7W 2R0KL 4EOWH 4LRNL 1HXMA 2R23A 3RWHA 3FOLA 3QUXB 4PTTA 1XEDA 3VGDA 5D1XC 1OGAB 3PWPD 5CSZA 1UCBH 4DN3H 4KJYA 1MCHA 4R7DA 5MHSE 5DD6A 4NKMB 3BSZH 1WWAX 4UOW0 1HSAB 3WNNA 4I2XE 3Q5TA 2IPKA 3CFCL 5ILTL 3ARFC 2HT3D 1YMHA 4HMCA 5E5RB 3FOMA 3O3EB 5D1XA 1B2WH 5FHAL 3B43A 5GSRB 5C6PB 4XBEH 4G8FA 1OWRM 4PG2C 1Y18B 1OAXH 3CX5K 2CGRL 4OTXH 4PYHA 3MZTA 1QVOB 1TZHA 4MNHB 2P7TA 4YDIH 1MQ8A 1S9WA 3ARDC 3D48R 3HB3D 4P48A 2AK4E 3PJSA 5FYJU 2ZG3A 2W91A 4KRPC 4JVUA 3EYOA 5KS9F 1AXIB 3ARFA 3G5XA 2BDNL 1M6OA 4MJIB 3QIBD 4PG2A 1GGCH 2JCCA 2CRYA 5DK0B 4YR6B 4J3UA 3SE8H 5C0JB 4X8JA 3MXVH 4KZEH 5HVWA 2A9NH 4NM4H 1F4AA 1YEFL 3VFRA 3QH3B 3HRZB 4QOKB 4ODTH 3DHJA 3MFFA 5F1IA 3QDJD 4L9DA 4PJ8A 3BE1L 3C9NA 2EDYA 2MFNA 2I9LA 5D1QA 1NBZB 5D4QA 4Y5VB 3VCLA 1QBMH 3H9SE 2VXTH 4OZIA 3CK0H 3WUZA 4M02A 1Z9LA 3RRQA 4G9DB 5EO9B 32C2B 2BXZA 1AR2A 2R1XB 3B9KA 3EOBA 3E2HC 5H37G 1AQKL 2DQGL 3ZL4L 3V5DA 1MJUL 2L4OA 1T2QL 4HPYL 2N1KA 5GGTL 3BP5A 5BVPH 3QIWD 3W81A 4GRLB 1A7NL 5DJCB 1EVUA 2NY7L 1YC8A 4Z8FH 1QHPA 4F37F 4M62L 2B20A 1U92B 3Q2CA 4D9QE 5SWZE 3HC0B 5KSAC 1TVDA 5F1OB 1UKQA 2RGSA 4LBEA 4U7SA 4ZFOA 2UV3A 3QHZL 2VDRL 1OAYH 1T89C 5FYKL 4PGBB 1N6VA 3OXSB 2NY2D 4NQDE 1I7UB 1T1XB 1T1YB 4XNYH 2HJKA 1BOGA 4XVSL 5C08D 3EJYD 3OQ3B 2ZWLT 1Q9KA 2NY3C 1HOCA 4JR9H 1TQCC 3KPPB 5KSAA 1RURH 3GMRA 1MCKA 2W0FA 3LSOA 5FAAA 1A1MB 4LAQH 5I30L 3VFOA 4G9FD 4J6RH 3I6LD 4XRCB 1J5OL 1T89A 3WYRA 1PD6A 1TPXB 3DYOA 2DKSA 4ELMB 4Y1AD 3ZYJA 1H15B 2H8PA 1INQA 5BV7C 2ZSWA 1Y6NR 5IB2A 1RIHH 4R9HA 2XXMB 3QUXC 5L0QB 5D7LE 1RJYB 1KTKE 2KH2B 4JKPH 2EH7L 3T4AB 4KVNL 5L6YH 1OT2A 1NCDL 2Z92B 3H3PL 4ZS6D 1ODAA 4KZDL 3QO1A 1DQDL 3ARYA 3QUXA 4U33A 1ORSB 3BEVB 4BQ6A 5HHQA 1OGAA 1HZHH 5DI8B 3WIFB 4XNUL 1BP3B 5F7HA 3HC3H 4ENEC 5DA4A 4RCAA 2D7QA 3DVNA 4LSPH 3RWDA 2BRQA 5IHZB 3MRIA 4PJHF 1XGYH 3QDMD 1CDUA 3IF1A 3TJEL 1O5DT 3DX6B 1DBKL 1X5ZA 2E3VA 3VJ6B 1JPTL 4FTVA 1QVOA 1G6VK 4MNHA 4M7KH 3VXQA 3WD5L 2A0LC 5IIEB 4H5SB 5FCSH 3BYYA 3MUHL 1H3VA 1U58B 3CDFA 2YK1L 1XIWC 4XNZB 2B4CL 5DK0A 4O9HL 4PS4H 4YR6A 1NCWL 5C0JA 2AXFB 1T0NA 2H3NB 4NCC2 2P49B 4GSDH 4NO0D 5DJZB 2XN9B 2F5AL 5T1KB 4Y5VC 2EH8H 3OB8A 3CMGA 1I7TB 2ICWI 4GRWE 2M2DA 4KK5C 5ELIA 4FFYH 2GJJA 2JIXB 4JFFD 3KYAA 4DKFL 5E2TH 5I1AB 1XIWA 1I8KB 4ZDHA 5L9DH 4RGNE 2CMRH 5HPMB 1ZEAH 1MCWM 1NBZA 4Y5VA 5K59E 3FFCD 3VMOA 2ATKB 4YXLH 5M94B 3RY6C 3W39A 4JFDD 3TA3A 3N85H 4GRMB 5MENA 4JQIH 3W5MA 2MTPA 32C2A 4LVOC 4KGLA 3MLSH 3QG7L 3KLAA 5I18H 1CF8H 5IVXA 4U2ZA 4DGYH 2DQFB 1GPOH 2X1XR 2ZOKA 3RY6A 1JHKL 1IAIM 4M7LH 5EOCL 2G60L 3O4LD 2UZXB 2EDLA 3FT2A 2IPTL 2H1PL 4LIQH 4X4YB 1IAMA 2XFXB 3ZT5A 1I8MA 5F7MC 2V9TA 1ZGLP 4X6EB 5IT2L 3HC0A 1AJ7H 2AJ3B 5T5NG 4P5TD 5B4MD 5JR1L 4FFWD 4BQCA 3THML 2O5XL 4M48H 3D3VE 1T1XA 4JANB 3BD3A 4NHCH 3MV9A 3VDAA 3KPPA 1ED3A 5L0QC 5ACMA 3UX9B 4NUJA 1NEZB 2ED7A 4LL9A 5IHBA 4GKOA 1H15A 4XNQB 1T22B 2V5TA 4E41A 4JY5L 3PF2A 4DFIA 2FO1A 4KMTH 1XGUB 4XC3H 3DX7B 4C56A 1X5KA 3IXTB 1RJYA 2G2RB 3GEWB 4JHAH 4KK6C 4LCYB 4XAWL 5EDXA 5C0EB 1RZGA 5C0GB 3BZ4B 4TULH 1GOGA 2Z0BA 2Z92A 4RX4A 3H8NA 5FYLL 4JFXA 4Z5RB 3ZKMD 3CLEL 4HUUA 2NMSA 4YGVA 4KVCH 4MXVF 4PJ5B 4LFHG 2R29H 4YHOH 4X5LA 2RBLA 5FA3B 2FX7L 4HZLA 4KTYA 4P9ML 2JJWA 4XB7A 1UWEH 3O3UN 4U1NB 4FG6C 3MACL 5C0IB 3RWJB 5KS9E 4PTUA 4Q6IB 3OKKB 3C8HA 3HMXL 2HFGL 4X4MA 3IFNL 3DX6A 3VXRE 4X0KB 3WKMH 2KDGA 3VJ6A 2J6EL 5HYSA 4N8VA 3OR6B 4Z95L 2EIEA 3HE6A 4TRPL 1MFAH 1J05A 1RIVL 3RZCA 3P3YA 4GW5B 5IIEA 2ICWB 5C7XL 1HINH 3CPLB 2GYSA 3UTPD 3O3DA 4QRSB 3BKYL 3PGCA 4HUXB 3WHE1 2BVPA 2XPGA 3W0WE 2PW1B 3LHPL 4PBXA 4NP4H 4ODHH 1NGXB 2H3NA 3EYQC 3GSQB 5FHBL 3RY5A 2XN9A 1IGCL 5FOJA 4PJFB 4MNGE 1H5BB 4TVPL 4OF3A 3SDDD 3BO8A 1I7TA 5GGUA 2UZIL 5DSCB 2JIXA 1UWGL 4Y19B 4U1LB 1I8KA 4MA3B 3FQXA 3ZTJH 1KENL 1F3DH 5HPMA 3QWOB 1CXFA 1FPTH 4S1SH 4JY6B 3ZMRA 1MNUH 4GG6B 1IT9H 2Q76B 2P48B 4LOUD 5EULV 4GRMA 4WW2B 5DJAA 4U1SA 3ARGB 4M7JH 4EVNB 3UYRH 4W4NA 4H20L 1CXEA 4UT6L 2BSSA 3EKCA 2NTSP 5J6GB 1WSST 3RU8L 1N3NB 4GXVL 4YXKL 1U2HA 1A64A 1UH2A 5HPOA 2YZ1A 4JO2H 5C92A 4X4YA 4X9GA 3HR5B 2AJ3A 4HT1H 2A6JB 5D7SH 4X98A 2VIRB 3VRJB 1L0YA 5SX5H 2W9EH 4I5BB 4NQEE 1IQDB 3CU7A 1URLA 5ADOH 3AS1A 3JZ7A 2NY1B 3V0WL 1X5XA 3QPXH 2RIKA 5E2WL 4JANA 4ODWB 2NW3A 3OF6D 5DMJB 3IKCB 3HG1E 1TTFA 5GSVA 2R1YA 1XCTB 3V5HB 2BVOB 4JJ5A 1DQQA 5DJ6B 4PJGB 4YBQD 1QFOA 2ITDA 5HI5D 4QHLA 4JRYB 3TC9A 1T0MB 3FO1A 2A74B 2B5IC 2K3TA 3X17A 4HK0A 1YQ2A 4HMDA 4DTGH 4LASH 4YHZL 3DIFB 5GGQL 5EIIB 1RK1B 3W9EA 1XGUA 3D85A 1BF8A 4WO4C 1TITA 3IXTA 1ORQA 5EORH 5C0GA 2PKDA 4LSUL 1UG9A 2HKHL 3KJ4C 3HUJF 4B5EA 4Y4KD 3MBED 2NX5A 5IGXH 1CU4H 1ND0B 1XGQB 4Z5RA 1YEHL 1G9NH 4LK4A 3WUWA 3RA7H 4X4XB 4DZ8A 1QKZL 1EHXA 3C60D 4JREB 3MOAL 4PJ5A 4WO4A 1ZLWK 4WY7H 3U46A 1YEKL 3K0WA 1QO3B 2R4RL 4BSJA 2YZ8A 2P24B 1IKNC 4J23A 4R2GD 4OZFA 4NN6B 4XVJH 3OKKA 1SY6L 4F7EB 5DLML 4TTDD 1MCIA 1D6VL 4DEPB 4KAQL 4ZOAA 3VH8G 1Q8MA 5DR5L 1JMZA 5ACZA 5I1JL 1DBAL 1BMGA 3K8MA 1IKNA 4HJ0C 3B5GA 3S35H 3NCMA 5CBEB 3Q6GH 5AUMB 3FO0L 1G9MH 3WDHA 2ICWA 4OF7A 4M7ZB 3CPLA 3BIAX 4PRDB 1P7QD 3PXHA 4EDXB 4YX2H 5IWLC 4QXUH 3LD8B 4NCC1 5KG9A 1EPFA 5HHOB 2V2TB 1FYTB 3UMTA 4H25A 3QDHA 5EU4A 4LSRL 3ALWA 1KB5H 1S9XB 4LLDB 4Y19A 4U1LA 4WW2C 2AGJL 4POYA 3F12B 4JCMA 4B0MM 5IWLA 5GGSB 3QWOA 4LPYA 1PLGH 3PQYD 4PREB 4IIQB 4JO1L 4ONHA 4TQEL 5I1CL 3QA3B 2Q76A 4PP2B 2VDKH 3AS0A 3K1KC 4MMZC 5TE6L 4IJ3B 12E8H 2OTPA 2GTZA 4ZS7H 1F6AA 1FO0L 4NO2B 1KLUB 1WVZA 4XHQA 3BWAB 1BVLA 4JFZL 1HXYB 1GZPB 2BNUA 4ONFL 4P23B 1PG7L 3K3QA 4WHDA 2GAZA 3HI6H 4YBLB 1F11B 5CLTA 1T20B 3C8KA 2CIKB 5CHNB 4M1CD 5L2KE 2QADB 1JPGB 5E2VH 1OARH 5A2IH 2VXTL 2R8SL 4JFQB 1H8OA 2A6JA 1IC7H 4XXCA 2HT2D 3H9YA 3VRJA 1EEYB 1EZVX 1GH7A 2AV7A 3NA9H 5K9KA 2FD6H 3AVEA 3F7RA 1IQDA 3O6FC 4OQTL 4W6WB 4YLQT 5I1LB 1HCVA 1XZ0B 4GW4B 1BFOA 2OK0H 5C0FB 1C7TA 4S0TD 3MLUH 1NANH 4ODWA 3OJDB 4Y4HD 4QGTA 1K4DB 1L9NA 3UJJL 1NC2B 4XX1G 1IGIL 1XCTA 1NBVL 2BVOA 4PBVC 4Z8FL 5DJ2B 3O6FA 4JKLA 4NC2B 2O61B 4DGIH 3DUSB 4HD9A 1EIBA 1RZFH 2A74A 2HG5B 2NYYD 4MXVE 4U4BA 4AM0B 2VC2H 3RAJH 5GRYA 2MSPA 3AXLA 4X6CB 5EIIA 5F93C 5ESVB 4NQSA 4JREC 5HD8D 1VEMA 1A47A 3ISWA 3RIFF 4MD5B 4HW6A 4PJCF 4F15B 4P46B 4X9FA 2Y5TB 3GMMA 4JR9L 4JPWH 3DROB 1ND0A 4RWYH 3GNML 1XGQA 1CGUA 2IQ9L 4HEPG 4X4XA 3R1GH 3QUZB 5ESAB 4YPGB 4M7LT 4MDIA 1TJHL 1N64H 3VA6A 2A77H 1QO3A 4ONGH 4PJDA 3SQOH 3IFLH 2ED8A 2F9BT 1MAML 4MB4A 2HVJB 2V17H 1P84K 4F58H 4FQLL 3T0WA 3HI5H 3C5JA 2YUZA 3QRFM 4XGZB 1T5XB 4U6YB 1S5IH 3PWLB 5CP3A 3UBXG 4OGAC 1P5VA 3WFCL 1BEYH 4MVBC 5L8JB 5EFIA 5HGDB 1S9VA 2QQNH 2F8VA 4G7YH 2QHLA 3UJTH 4GMSL 4PGEA 5IFHH 1YEGH 3GBMH 5TPWL 1KCSL 2YPKB 3P77B 4PRDA 2NY5L 1IM9B 1J12A 4PP1D 5JLZA 1KCKA 4M43H 3EO9H 1YMMA 2VO5A 4G7VL 2YBRA 2WBWB 2OX5A 4HIEA 2BX5A 4LCUB 2QSTA 3S4SG 2VABB 2R0ZL 2HJFB 3SDYH 1UB6B 2EDWA 2GTWA 3CNKA 2XTJD 1A7QH 2VAAB 3MGTB 1EO7A 3MRKB 4D0DB 2JCCF 2VWEE 3BD4A 3ILPA 4LLDA 2OLDA 2Y6SD 3MGOA 3QQ3B 4M7KL 1QLFA 4IJ3C 3ARTA 3CVHA 3HRPA 2W9LA 3IDXH 1I3RA 5CGYD 1AXSB 2FEDD 8FABB 3H3BC 4CMHB 1VGKA 4U1GB 3CFEB 1IGYB 1TNNA 4YBLC 3MNVA 1FL3A 1QYGH 2BRRH 3P4NB 1X5IA 2J8UB 4IRSB 3VU2A 5TE7L 2IFFL 2NXYB 1MAJA 1RIUH 3FFDA 3QFJD 3B3IB 3V6FB 3QDJB 4X80H 2EH8L 4E42B 3Q0HA 3EUUA 3KPQB 3O41B 4OZIF 1NBYB 3BWAA 5ALBL 3EW3B 2YEZB 3TPUB 1D5IL 3HMXA 1KJ2B 3D2UB 2YKLH 2DMKA 5C3LD 3EYSL 4KDTC 2E7MA 2X4QB 2CIKA 1CDYA 4O51A 2J6EA 1JPGA 5E9DD 1HEZA 4PJ9B 5IQ7H 3U48A 4MJ4A 2DLHA 3KYNB 4WUUB 1QPXA 1GGBH 5FCUH 4DN4H 3FB7B 4HUWB 4UU9B 1CVSC 4XPHL 3F8UB 3N85L 5H8DA 1S78C 1KYOK 1TZGL 3MLYL 5I1LA 3K8LA 2M1KA 3QIWB 3GI8H 1FJ1A 2VKXA 3MLRH 3OAZH 3GKWH 4V1DA 4ZUVB 3WE6B 1VA9A 3TZVB 2IH1B 1WTLA 1UXWB 1YEJL 4FS0A 3WS3B 4ALAL 3LQZB 3I50H 1NC2A 3QUYC 4DGYL 3HUJE 3QG6B 2DD8H 3TBWA 4OCXH 1RZKH 4F15C 3NFSL 4R90L 4P46C 2X41A 4M3KB 1TVHA 4AM0A 1BD2D 5EUOB 1GGIL 5C08B 2OZ4L 4NNPL 5HVFB 2EICA 3QUYA 3QUZC 3TO4B 1UACL 3LN4B 4H0IA 2Q8AL 5F8RC 5I19L 4XT1C 4MD5A 4N68A 3PHOB 2WANA 2PYFB 3CVIH 4P46A 3DROA 4JN2B 4Y1AB 1N26A 3E0GA 2FRGP 1FO0B 3T1FB 5C2UB 4LMQI 2AV1A 2IQAA 2QKIA 1A6TB 3FRPA 3BPCB 4XB8A 3L5HA 3BPOC 3X11B 1U8MB 4UT7H 2NPLX 1S7XA 4QO1A 2AJSH 2DQJL 5ENWB 2ZCHH 4DOHB 1KACB 2JJTA 2IBZX 1RZ7L 2H2SC 2GSIA 1NFIB 3BGMB 4JHAL 1OY3B 2KUTA 3DMMD 4NWTL 5CIPA 2XQYK 3GKZA 3N1PC 1DQML 2P8MB 4XGZA 3M1BB 4S2SA 3ZE2F 4LLUB 5EZIL 1EEUA 3PWLA 4KMQA 1JGLH 4FQXB 5HGDA 2ZUUA 4GQ9L 3LAFA 3FTGA 4RGOH 1OTUC 5FO8A 1RUQL 2ARJB 4JFHE 3SDCC 1F90L 3MTRA 3QDMB 1IM9A 3L9RA 3FQWA 1ETZB 3NPZB 1JGVL 1EGJH 3C6LB 5TDPB 1CFBA 3HNTH 5B3NA 5GS1C 1UB6A 3WDJA 1PZ5B 4CMHC 3T08A 4NGHL 3MGTA 4D0DA 3SDCA 2VL5A 1QOKA 3L7FB 3QQ3A 2NXYC 4M6NH 4PJEA 5BCAA 1LVEA 1QSFB 2FH6A 4KJWD 1K2DB 3PGDB 4AEIL 4FABL 1ZT4B 3T3ME 1DBBH 1SBSL 1HINL 4WI5A 1AXSA 2COQA 5GS1A 2FATH 4NO0B 8FABA 1CTOA 4ZUWA 2KL6A 3CUPA 1LO5A 4QRTB 4LCIH 5IVZB 1CE1H 2D0GA 1IGYA 5DUPH 2P8PB 1BIHA 4YFEA 5MHSD 1BOYA 4ODHL 1OCWH 1NQBA 1FGVL 5DVOA 1A4JA 3SO5A 3B3IA 2NY6C 4PJ9C 3IFPB 4L4VB 4U1JB 1MY7A 1YDPA 3LEYH 1SY6A 4WHTA 5ICXB 3QQ9C 1EUTA 3D2UA 5C0AE 3LKQB 4P3CH 2BNQA 3MV7E 5I1DA 1YNKL 4LLMB 3D0VB 1K3ZA 2X4OA 3VE0A 3GSXB 5JHDB 2HMIC 4JFDB 3TZVC 2YXFA 4BZ2L 3INUH 2AK4D 5C6TL 5IVXF 5I8CA 1MCWW 4UOW1 3KYNA 4WUUA 2XRAL 5L7XH 3D18B 4ORZC 3FB7A 3OMZA 1MUJB 3IKKA 4HUWA 1JPSL 1RV6X 1I1YB 1AIFB 4S1QL 1Q0YH 5EC2A 4YGAB 3SE9L 2CK0L 3UYRL 4ZUVA 1ZWIB 3TZVA 4J12A 1WC7A 1UXWA 1YYLL 1NGWB 4MAYD 1EEQA 2DN7A 4PJCE 3KS0H 3C6SA 3V8OA 3MRFA 4MQXC 3TO4C 3KPMB 1F42A 5IF0B 4X99B 4JHWL 4HC1H 4LVNB 4F7TA 4NKIH 5C09A 4FFZH 4L4TE 2VLLB 4JZNB 2DI7A 5EUOA 2HLFC 4EI5C 3ZTNL 1A9EA 3VGHA 4EBQL 3TO4A 2BHYA 3GSNH 4QXTA 1U8JB 4ELMF 3ZYZA 1J0HA 4OV5A 5MP6H 2BVEA 3JTTB 5T1LB 2FR4B 1CE6A 1DLFH 1VGEL 4EI5A 1FO0A 2VKWA 3TJHD 5AG8A 3MRNB 1A6TA 3DARA 2VAJA 2DI9A 4D8PB 2OL3H 4XCYB 3X11A 3BZEB 1U8MA 1LDPL 2ADFH 3AU1A 4NQCE 4OV6F 3VD5A 3KYMA 1OWWA 3CCHB 4FQXC 5SWZD 4D9QD 2A38A 5D7IA 4O00A 3ECBA 3K4ZA 3BUYB 4JO3H 2CXKA 3T8XB 3P30H 1ZA6B 2DWDB 2XZAL 2D7TL 4NQDD 3KWWA 3M1BA 4LLUA 4OQTA 4ZO8A 1A3LH 1NMBH 3PV7A 3C6LC 4XCCH 4FQXA 1QNZL 3RA7L 2FJHB 2JCCE 4NJAH 5GZOD 1ADQH 4Q0XL 3RWCA 4EN3B 1MJ8H 4X7SL 3HAEH 5TJWK 4WY7L 5JW3L 4EZMA 4NJ9H 2ARJA 3LKNB 3MV11 1YC7A 4AMKH 1TCRB 1BPVA 2IGFH 3HZMB 3FQTB 3OKYA 3C6LA 4XVJL 5TDPA 1PY9A 3VRIB 4K7FB 2VL4A 5D7LD 4UV7H 3TVMD 4ZD3L 1EMTH 1EO8L 1QSZA 4IOFD 4JFEA 5A16B 5FB8A 1MJ7H 4MA8L 1SJEB 4OZIE 1U6AH 3D39D 1CFVL 3L7FA 2V5MA 2H41A 5DJXB 1QSFA 3Q6GL 1IRAY 1ITBB 1DE4A 3O9WB 5CWSB