1FG9C

3:1 complex of interferon-gamma receptor with interferon-gamma dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
210
Chain Sequence
VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords INTERFERON GAMMA
publication title Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 210
sequence length 213
chains with identical sequence D, E
ec nomenclature
pdb deposition date 2000-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C01
4PRBA 4M3KB 4TVPH 5DI8B 1J0JA 1G9MH 3TGXA 5J0BA 1T20B 1X4YA 1ND0A 3VRJA 3TYFB 1QFPA 3QUYD 1M1SA 2B2XL 4D3CL 4JFEE 2W65A 5IMKA 1JYWA 3FO0L 2FX7H 3ZE1F 4PJDE 1MCFA 1EGJL 4JFED 2AQ2A 4NRYA 2ZPKL 4KPHH 2DWEB 4N68A 4PRIA 4AIZB 2BJMH 2IPUK 3TPKA 5J6GB 1FZMB 5D96B 3O8XC 3SCMB 3CH1B 3MO1A 4U3HA 5GHWH 3TC9A 3VI3F 1E28B 1HZHL 2WQRA 3RGVC 2CUHA 4HZLB 3QUYA 2Y07H 3HTLX 1EUUA 2ZOKA 4YO0B 3NIGE 1Q1JL 4JFEA 1FORL 4JM2B 1YEJL 4QHMB 5EORL 3MRBA 1A6TB 4PJDA 3ZTJH 4X80H 2NTSP 1LMKA 4PFEA 1NCBL 5F1NB 4JY4B 1MCBA 3TVMD 1MWAA 4MA8L 1MF2L 3BXNA 4YHYB 5I30L 4WDIA 3SOBH 4YEFA 1CR9L 3QEQB 2EDOA 4LVOB 1NJ9A 1EJ6A 1WZKA 2VXSH 4U1MA 5ESAA 3LAFA 3LEXB 3OAUH 4YQXH 4APQC 2HLAB 4XC1H 4U1JB 1YEDA 1T2JA 1A1NA 3TVMA 3N1PC 5ENWA 4KVNH 5JW4N 2DB8A 3T65A 1A64A 3U0WL 3VG0H 3ZKXC 2FYYB 3FHQA 4KKAD 5E08L 4XC3L 1FL3B 4HJGA 3WFCH 2UZIL 1U91B 5LGKA 5CBAA 2DI7A 3FOLB 4U7SA 4GG6E 2XTJE 3S7GA 1KF9B 2P8LA 4PJXF 2R4RL 1W0WA 1FG9C 4GXUN 4L3EE 3KPNA 3UAJD 1O0VA 2AK4E 5KVDL 1NCWL 3DO7B 1UEYA 5CSGA 1N5YL 1KCRH 4L3ED 1ZT7B 2C1PA 3M1BB 3KG5A 4QXTA 4PJFE 3QIUC 4F9PC 5CS7A 4ONHB 2ADGB 2Z4QB 4HUNB 5C0BB 4LSDA 1AY1H 3R8BB 2AI0L 4GO6B 3OZ9H 5F93C 3WFDL 1NMBH 5I71B 4BZ1L 4EJ1C 2R0LH 3MRFA 4IDJL 5MEQB 4GLRH 4L3EA 4R96A 4TPRL 4PGBB 3HAEB 3V0WL 5C0FB 1N5AB 2XG4A 5FA3B 1XIWD 3P9LA 4J3UA 4LK4A 1MHPL 2IALB 3VRLE 3AY4A 1EO8H 3MQIA 4N8VG 2XWBA 1HSAB 1ZSDB 3KJ6L 5HHVL 4KWUA 1QBLH 2OSLA 3WLBA 5A2FA 2XV6B 4OGZA 4YH6A 1YN6A 5GRZA 5I1EH 1KJVA 4Z5RB 1LO5B 1XIWA 2VXVH 1NCCH 5GGTH 1NSNH 4GKNB 1NLDH 2VL5A 5D7JC 3WFHB 1A22B 4KZEL 2HRPL 2A6DB 4HIXH 4WTZA 5ACMA 1SM3L 3HR6A 5DRWB 4WNQA 5D72L 4XNUH 2QQNL 1QLEH 1IAKA 3MBXL 1SBSH 5AZ2L 2ARJQ 1S7RB 3L7EB 3MUGA 3TIEB 2I07B 5CGMA 3O2WL 3G5VA 1DDHB 2JB6A 4P4KD 2AEQL 3L9RA 3GHEH 1MOEA 3BO8B 3I84A 3U7YH 1WZLA 1BD2E 1KIRB 1U3HC 3CVHB 1K8IB 3L3DB 1UWGH 4FOMA 4XPBL 3V8CA 2COQA 5F8RC 5I1JH 1IEBB 4X6DA 2BVTA 4GW4B 5HBBA 2GY5A 4KMLB 5EZJA 3JTSB 4XP6L 2VXQL 5FGRA 4OD2A 1DN0B 1KC5H 2VUYA 4P4KA 3T0XA 4ZXBC 2BFVL 3ALPA 4HWBL 3BGMB 2ICWA 4HJ0C 3QCTH 3DHMA 3K8MA 1ZVSB 5I1GL 1NBYA 4WCYH 3VWKB 1IC5H 3K80A 4OLVH 3CIQA 3ULSB 5SWQA 5EUOB 4F15C 2FGWH 3MLZL 4PIRF 3SKNB 3CX5K 1DQTA 4HEPG 3CPLB 1ZLSL 3W5NA 4MA1B 3SGKC 3WO4C 3RWDA 2P8PA 1DQQA 5CJOL 1L7TL 1MI5B 1NAMH 4NQCB 1MUJA 2GFBA 2QR0A 2YUZA 1LNUA 5L2KB 1HKLH 5LAXB 4PV8B 3MNVB 5KG9A 5L8KB 4MQXD 1E4KC 3T0EE 1L0XA 5GGRA 1M6OB 5L88L 1OAUH 1K4DB 4QF1A 1NCUA 3MUY1 5H2BB 5I15L 1A5FH 3T0ED 5D1XD 3V4UL 4LOUD 3THML 5JIHA 4CW1A 2OZ4H 1VPOL 1YJDH 4ZO9A 4OT1L 5DUPH 1IGYB 4PTUB 2B1AH 3P73A 3LKSB 4CAGA 2YD8A 1WBYA 1WBZB 3GUTB 4GAYB 3W11D 1NGXB 1AR2A 4HIJB 3BVNA 2GJZA 3S35H 1DQLL 3ZKNC 4PJ7F 4AK1A 1M7XA 3T0EA 2OM5A 5D1XA 3M8OL 3IFPB 1FO0L 1HNFA 1OAKL 1WV7T 4WFHE 4OZFA 3D39E 2P7TA 1CFSB 1SEBA 4PLKD 4X4ME 2ERJB 2IAMC 1FHGA 2JK5A 2HT4C 4WFHD 4LVNC 4HUVA 3MCLL 1PG7W 1KELH 3F12A 1MRCL 2BY3A 5DD3L 1JGDB 5A3ID 4ZFZA 3TBSB 1J7VR 1RJYB 1NKOA 1TJGH 4NUGL 5KAQG 1CD1B 3EOTH 4KDVA 2CDFB 2I24N 3F62A 2ENYA 3F6LA 5D1QC 4X99B 5E8EA 5HY9B 5IVXA 1DQJA 4QRQA 5HI5D 1Q0XL 1ZLVK 3ARXA 1OWRM 2Q3AA 1ZLUH 2X05A 5KJRL 4X4MA 2DQDH 1EGJH 1N59A 2YSSB 3RWCB 3RU8L 3OHXB 3WBDA 2Q76A 2BVOA 1OVZA 3NCJL 5MEOB 1H8OA 3T4YB 4NQEB 3GIVA 1UXWB 1DLFH 1Q9OA 5BW7C 1HZHH 1P7QB 3O2VL 4TSBH 5CJ8A 3ESUF 1ZEAL 4M62H 1UZ8A 3HZVA 4HWNA 3I02B 4P3DB 3VDBA 5FHAL 1Q1JH 5DMKB 3W0WB 3G5YB 3P40A 4J8RB 4KVCL 1B0WA 2G75A 2BVEA 3T0VA 1MF2H 4EEEA 5DJ6A 1CLZH 3V5DB 4YR6A 3ARPA 1RU9H 1UCBL 4HWEL 1U8QB 4NZRL 3L6FB 4KRNA 4G6KH 3DUUB 1JL8A 1BEYL 1LE5A 2DD8L 5AWNL 4R2GB 3ZLQC 5HYSB 5HYEA 2K9UA 4FXGA 5IB3A 2EDLA 5EZLB 3ALWA 3U4BL 3ZO0A 4AEEA 4G8GB 3IDXL 3ESVF 3V5KA 1DEEA 5AUMA 3BH8B 3B9KB 3U0PA 1EAJA 4D94A 3SGJA 4UU9A 5E9DE 3C2SA 5GZNC 3H42L 1QSED 4NN6C 5AG8A 3H0TA 3OJVC 3VD4A 5KW9L 5IMOB 3TF7C 2MKLC 3RNKB 4B53A 5IBLD 3CFDA 4JPWH 2EDKA 1NCWH 1YEIH 2VLLB 3ILPA 3N06B 3TN0D 4JRWA 4QGTA 3WCYA 2XZAH 4N5ED 1D3CA 1NUGA 1QSEA 3ARYA 4U3CA 4EDXA 2NZ9C 1KJ2A 1AI1H 2BOBB 1OP5H 3GZKA 3WFDH 3GGWA 3FN9A 2VSDA 1YEHH 4RQQA 1CK0L 1IKFL 4UNTA 3QQNA 1QRNB 2K7PA 4TPRH 1TZGH 3BDBA 3TN0A 5ALBL 3CFJA 3TLRA 3S3PA 5BZDA 2E27L 2FGZA 3B2VL 4GSDL 1TJIH 1KN2L 4CL7A 1NFIB 4QOKB 1MHPH 5H94B 1EFXA 3O3BA 5T1DH 5BJTB 3FOMA 3KLSA 2HT2D 2ATKA 3KS0J 4XP4H 5DJ2B 2HJLB 3PABA 5EO1A 1ZGLB 5E8PB 2VDQH 1EXUB 1X3DA 3S37L 1B2WH 4Z9KB 2GT9B 5C07E 4MNQD 3CFCL 3QULB 2FR4A 3MRGA 5C07D 4XBGA 5F9WB 4LLUB 4N8VB 4XNYL 3T2PA 4I18B 4NOBA 3U7AA 1MRFL 5D93C 5IQ7L 4OD3L 2EIBA 3F7RA 1IM3B 1MHEA 3FMGL 5GGVL 5ICYA 1ZHNB 4HH9B 1TVHB 2VDLL 3ZTNL 2A6KB 1D6VL 4OUUB 1N6QL 2MJWA 3QO1B 5IMLB 4NCDA 4AG4H 1KJMA 3O6FD 5DLML 1OGAD 4HXAH 4MNQA 1DUZB 1VFAB 1PW3A 3ARDD 1T4KB 4HWZB 5C07A 3S8WA 2A2QT 3AXLA 3KPQA 4QXUL 1TZHA 1E28A 3VXTA 3QEQE 2W0FB 4G8EA 1XMWA 2GHWB 3CLEL 3QRFM 2MHAB 1NUNB 2BC4B 4HV8A 3R0NA 2J4WL 4OAWB 1A7QL 3EYOA 4IRJB 1TPXC 2VAJA 3G5ZA 4F3FA 3O6FA 3FCTA 1CZ8H 3GSNL 1OGAA 1A9BB 1U58A 5HI4D 4ACPA 1N6UA 2EDFA 2GAZA 3ARDA 1WBXB 4L4VB 3VDAA 4HULB 4YDIH 1DVFB 3GMLA 5ANMA 3SDDB 4LVEA 1CYGA 4KK8D 3VGAB 3RWHA 4M48L 4JN2A 4RGNE 1T2QL 4F7MB 3NCCB 3SDYH 3FQNB 1HH9A 3GMRB 4RBPK 3WJLC 4RGND 6FABL 3MNWA 3LEXA 1VGEL 4U1JA 3R8QA 1DANU 1MQ8A 1A7RL 1GRWA 1XGTA 4LIQL 1D6EB 4PJ9D 3GM8A 1GGIL 1KTRL 4PJ8C 2FHCA 4AM0B 1VADA 3HE6B 4M03A 4UZGA 5CJOH 1YMHB 3UTQB 4JG1H 3UXFA 3O6LL 4G7YH 5DMGC 1EHXA 4PJEB 1I9JL 4UB0L 5KBNC 1BOGB 1EBAA 2KPNA 5C0BE 4Q9QL 4F7TA 2YRPA 3BEVA 4Z0XB 1QFWI 3QA3B 4PRDB 3GK8L 2VDNL 1EJOH 3T04D 3BJLA 5FFLA 4TTDD 1EZVX 4PJHA 4PJ9A 5D96C 3SCMC 3WN5C 1GC1H 1OAXH 2B0SL 4NO0B 2D2OA 1PG7H 2VUOA 3VGGA 5DO2C 4DGVH 2CLZA 3CXDL 1CIUA 4LNRB 1F4XL 3QI9D 3ZSTA 3MJGX 4BH7A 1AGEB 1S5HA 1DQLH 2YK1L 5HI3D 5KOVC 5GPRA 1FO0H 5MEQA 1BQLL 2PW2A 4HK0B 1D9KC 1AD0B 3UBXI 4PGBA 5KS9F 1MY5A 1L4IA 1UH2A 3Q3GB 4NFCA 3OKOB 1N5AA 4J3XA 1IL1A 2DKUA 2OX5A 3V7MA 4NUGH 3DRTB 3QI9A 4JFQA 3LV3B 4HFUH 5JIKA 3GMMA 4U6YA 2NW2B 1MFAL 2VIRA 1RIVH 1A02N 4M93B 5E4EC 2ARWA 2AJXL 3Q5TA 4HBCL 3X14B 1T22B 5AEAA 3QUKB 3SO5A 2JB5H 4RFNB 1B4JL 1C5BH 3JV6A 2VNCA 3SKOA 5KJRH 4IMLA 3NCJH 2DMBA 4OD1L 2BNQD 1LO0L 5IB5B 4BQ8A 4J3TA 1K5NB 4OIBA 2WUBL 3LQMA 5FUZH 1P6AB 3ULVL 4WO4B 5FHAH 3UTZB 4XPAH 2I07A 3OF6D 1FRGL 1CDIA 2F19L 1ACYL 1H9VA 2BNQA 3WL9A 4ERSH 5C6PB 5ADPL 4ELME 5DYOB 1XGRB 1VEMA 1MEXH 4CMMA 1XGPA 2AKRB 5MENB 1N4XL 5IFHL 4PRAB 5LGHH 1U8JA 1S7TB 2G5BB 2J1KA 2IBZY 3S97C 2OJZH 1QBBA 4WTWA 3OF6A 1RK1B 4C57C 2FSEA 4LAQL 3MCKB 1DN0A 3T8XB 4M5ZH 4MNGB 2Q86B 1MFEH 1MI5E 1BZ9A 4NQCE 3AS0A 1DEDA 2ED8A 4MX7B 3TCLB 2NY6D 4OTXL 1I4FA 5L2KE 1MI5D 2A1WL 2DQEL 4NQCD 5J12B 3U4BH 4ELMA 1MCWM 3IDMA 3VXQB 3UTSE 4KTDH 4HGKC 3E8UL 1IAMA 1P4LB 3QAZC 1IAOA 1PSKH 3P0YL 3V6OE 3UTSD 5DFVD 1A7OH 3GBNH 4HSQA 1I3RA 1VFMA 5TH2A 3PGDB 5C0ND 2LAAA 3G08B 1T21B 2YPLB 1MI5A 4NQCA 4N0UE 2E7CA 1ORQA 5GXBB 2ZUQC 1R3LA 1CDCA 5ISZE 4MXVF 4OM0L 3UTSA 1J0ZA 4QRTA 3ULUF 1K4DA 5F71A 4PYHA 5ISZD 1TJHH 2D7QA 1G6RH 4DFHA 4KDWA 4UQ3B 3SE3A 2OZ4A 1XCQB 2EE6A 4ZUTB 4JRYB 3SDAD 3VE0B 5FF6A 4XNZB 1CXIA 1EHAA 1IGYA 1A2YB 1UXSB 4LLWB 5C0IB 2D0FA 1BFVL 2X1OA 3GSUB 5SWSB 1CK0H 5E24E 4N0UA 3PIQB 4X9FA 3UPAA 3NABH 3ARZA 4NKMA 3HI5H 5HGHA 4OIAA 2E27H 3B2VH 2APFA 1S7VB 5ISZA 4K8RH 3VXRB 3BKYL 4Q0XH 4Z7UA 1SJEA 3SDAA 1KTDB 4RMSA 2DM4A 5B38G 1CE1L 5EO0A 2GQHA 3VFOB 1A3LH 4KK5C 5JW3L 4NQEE 3ZTJG 5L0QC 3L95B 3VWKC 2F5BH 3HNSL 3CFCH 4NQED 5EU5A 1XF5B 2GTWB 2X4TA 1VSCA 5HY9A 3W9DB 4K3EL 4LSPH 5I6XC 4NKOA 5DEZA 1II4E 3IAPA 3RL1A 1K85A 4Y4HC 1JZ2A 3U1SL 3QFJB 4EI6A 4FQIL 4KTYA 2V2TA 2CIIA 2XWJA 1D6VH 1EGJA 3AC0A 4N9OB 3MRRB 2NZIA 4IEFB 3KYOA 1MVUA 4N8PA 3ZHDA 4D9RD 3T4YA 4NQEA 1GXEA 4G80B 4PR5B 1NL0L 4JVUA 2IFFL 1UVQA 4UI2A 5GSVB 5IVZA 3LB6D 1MFNA 5GS0H 3VFTB 4OGXH 4D0DB 4F2MA 1C12A 2EDQA 1RULL 2VN7A 1HHKA 5CKAA 3OV6A 4EI5B 4HIIA 4KKCC 1KPUA 1DLHB 4J8RA 5FYJH 3P4OA 5KSAC 4DVBB 3O41B 1BWWA 1G1YA 4FQ2L 5IIEB 4YE4L 4ODUB 1NH6A 2FJHA 3HPLA 3VG9B 4LQFH 5BQ7B 4PLOB 4K9EL 4O5LL 4G8GE 1DL7L 3QDGB 1MCJA 2FL5B 1AD9B 1T2QH 3STBA 4KKLC 3MGOB 3L6FA 3B9KD 3DUUA 4ZTPH 3RKPA 1VGEH 5IK3B 4LSUL 1GH7A 4HXBL 4YDLB 32C2A 2DQIH 3RVTC 1BVKA 1HHIB 5CCKL 4G6JL 2X1XR 5HYFA 1V3MA 3PV7A 3MRCB 2H1PL 2Q8AH 3SE9H 3FO1B 2F5AL 1RQ5A 2DIBA 1I9JH 3B9KA 4AQ1B 1ONQB 4UB0H 5E6IC 5E99L 5F3HB 3L5XH 4HAFA 5HHPB 2Y5TA 3EO9L 3M17B 3GHBL 2I5YL 5IESL 3U0TB 3UJIH 1TETH 5HGDB 2VDNH 5IVOA 3RUGF 5IMOA 2Y06H 2HMID 4GG8B 1HSBB 2CXKA 4AENB 1QRNE 5F7EL 4A2LA 2CQVA 2W9DH 4PD4K 5CEYB 1QRND 4X4XB 1BBJA 5IW3A 1P84K 3LIZH 4QOKE 2A6IA 1PY4A 2LTQC 4XI5D 3RWEB 2CIKB 4UIKH 3RVUD 3S98A 5CP7A 1Q9LA 3CXDH 4QOKD 4YXKH 3SHSA 1L9NA 1MCDA 1MREL 5DEFB 3MRMA 3LS4H 1N64H 2XACC 2DQTL 1IC7H 1QSFB 3DMMB 4P2QE 1H5BB 2W0LA 2DTML 4JB9L 3GSWA 3SQBA 1QRNA 1VHPA 1PZUB 4F7CA 5DVOA 4M9PA 4P2QD 3HG1B 4X4YB 5FV2A 5F9JA 5DVKA 3C5ZC 4QOKA 5H94A 4OB5H 1G1CA 4M6NL 5IB1B 1R0AL 2HJLA 4U1NB 4WGVB 2Q6WA 1F97A 1X5JA 4GUPA 2AV1B 4ZTOH 5GS1B 3W5MA 2YPKB 2J88L 2G9HA 2AJXH 2N4IA 5TPWL 1EVTC 4P5KA 5EOCL 4P2QA 2C3HA 5DZOA 1I1AC 1AR1C 1EIBA 1B4JH 1JNHB 2BERA 4ZUUB 4ZPVB 1VESA 2R9HC 3QDHA 2BVPB 4GAGH 4LLUA 4M4PA 1XR9B 4ODXA 5F7DA 3SJVE 4HK3N 2DAVA 4QWWD 4H8WC 1FVCB 3SJVD 4LEXL 4JN1L 3OGCA 4BFBD 1G9NC 4YHZH 5TDNB 1V7NH 5IMLA 3WSQL 3QNZA 4ZD3H 1S9VB 2WQ8A 2WBJB 4XRCB 4L9LC 1NFDB 1J1OL 3H9SB 5CZVL 3TT3H 1I9IL 5FUCE 3BSZH 1AHWB 4IRZL 2BVQA 4KDTA 3SJVA 3WD5H 1CIDA 5ADPH 2VQ1B 1AGDB 2BC4A 1DUYB 2RFXA 4P9HC 1I1FB 5IKCB 4U0QB 2OR8A 5BXFB 2EICA 4P3CL 1A9BA 4JGUA 5K9OA 5KOMC 4J23A 4K7PL 1Y6KR 5KZCD 4EN3D 4NIKB 1FDLL 5H35B 3VWJC 4K7PY 1T0PB 4PJEE 4HWBA 3HR5B 4RCAA 1V7ML 1UACH 4OTXH 5C6WH 3GIZH 3S36L 3VFMB 2CKBH 3Q1SL 4GT7A 4Y5YC 2OK0L 3X11A 2NY2D 4QRSB 1TNNA 3E8UH 1E4XI 5DZLA 4EN3A 2H32B 3B2UC 1Z5LA 4KJPC 4AIOA 4OF5A 3GMPB 5B21A 3DTXA 4I18C 1OTSC 5IJKA 3C6SA 1KPVA 1QLFA 3M45A 1RJZA 1ED3B 3JBG7 4NO0D 1CXLA 5GRWA 3QEHA 5CINL 4OCRL 5M95B 5IJVA 3DV4A 4KY1H 4E0RB 2ZUUA 5JMRA 2DJ4A 4PRDA 4MB5A 1NGWA 1NC4B 4L29A 3QXDB 1HKFA 1P7KB 3ABZA 1CQYA 1HYRC 4ZUWA 2Z8VC 2VZUA 4CNIA 1ZV5A 4NO0A 5AZEL 4YHML 5I1KL 5JORB 3VXUA 5DHVB 2AXFB 4JO2H 1OM3H 4ALAL 3QUMH 4IRJC 4OKVA 2O5XL 4IMKA 3MR9A 2VL4A 1XGQB 4I0PC 3ZMRA 1YUHA 5FB8A 4X6CA 4NO5B 3QEUA 4OV6F 3VMPA 2EEDA 1JYVA 5HDBE 5IF0B 1FH5L 1FO0A 2XA8L 5DRZA 3JTTB 1CLYL 3NZHL 1A1MB 4UT7L 1JV5B 4MWFB 2BRRL 1YZZA 3OKOA 1CL7I 4XH2A 5J1AA 3FQWA 2E8ZA 1OD9A 4U1LB 4G8IB 1WEJL 1AIFA 2E6QA 2VMFA 4LARL 1J86A 4U1SA 4L5FH 3HNSH 1OD7A 2QQQA 1JHLL 1YYMH 5IV2B 5B38B 2MCPL 3X14A 3FB7A 3VI4F 2IMMA 3LEYH 1LP9A 2AEPH 3TZVD 1OOAA 4P23D 1RMFL 5FO9A 4XCYB 3VXOB 3RX5A 5C2UB 4Q6IB 4GW5A 4OLYH 3D69A 1KBGL 3ZHLA 4MQSB 4DTGH 1PZ5A 4IRSB 4X9GA 5MENE 5I1IL 4UUJB 3G6DL 1K2DB 3CJJA 5MEND 5EBMB 3EHBC 3QIWC 1CXEA 1S9XA 3HI1B 3TZVA 2E9IA 4P23A 4FZ8L 2A83B 3QQ4B 3BD4A 2DWDB 1HINH 1BVLB 4MNGE 3RL2A 3ZHKA 4O2CB 5EOCJ 2EDHA 1OB1B 1AE6H 2R4SH 3L3JB 4YE4H 1GOFA 4OQTH 3HCVA 4KUCF 3C8HA 2BVUA 3IAQA 5MENA 4PRAA 2GUOA 1S7TA 3PGFL 3VU2A 1A3QA 1KULA 3IS0X 1I9RH 1UT9A 1XEDA 2GYSA 1VACA 1R3KB 1RK1A 4F37F 1KLUA 3MCKA 3T8XA 2DQJL 4LSUH 2FH8A 1KN4L 2VDPL 5JPNA 2YPLE 3DURB 3BPLB 4WEBH 4WI3A 3BIAX 3VFSA 5EUKA 2BNRE 3QUYC 1KG0B 1FZKB 3NACH 4TSCL 1UG9A 3TO4B 2BNRD 4R97B 5L2JA 4LSRH 2KDGA 3MLXL 3MJ8A 4GFTB 3EYFA 4MAYB 4NQTA 3JWDC 4Z76B 4Z7VF 2B4CH 3UTTB 1YNLH 1IC4H 4OFDA 4OLXH 3MSPA 3EO9H 2ADFL 1KIUA 2DQUL 4JRYE 3FZUD 3PNWB 4GRMB 3DYPA 2QKIA 3MXWH 4MZ3A 5SWSE 1IE5A 1QFWH 5C9JA 3RVVC 2BNRA 4WUUB 2ATPB 5SWSD 2G2RB 4LL9A 2ILLA 3HZKA 5I2IA 4KRPB 4NRXA 4WO4C 1JCKA 5CJQL 5CBEA 1DBJH 4LRNH 3MLWL 3WDIA 1WITA 5DD1L 1DN2A 2OL3B 1X5HA 3BPOC 3PG2A 1FVDA 1MJ7L 2Z8RA 4PJGE 4XBPA 3GRWH 4HKBB 2DL2A 1VGKB 3RWJB 3MOAL 1K8DA 1KENL 2BXYA 3Q6GH 4CDGC 1GL4B 4KQ4L 4NDMB 1CXHA 3RTQB 1MFBH 4OCLC 1UWXH 1MHHA 3QUXD 1DCLA 3QFJE 2NW3A 4M6NH 3S34H 4PREA 1P2CA 2PYEE 4R4BA 3RNQA 5JPMA 3QFJD 4M6ML 3AM8A 2PYED 4XNQB 2J88H 4KKAC 2AJYL 3HZYA 4PJGA 5J12C 2NLJA 3QNYB 4GG6F 4GS7B 1QUNA 4W6XB 3GB7A 4AH2B 4NM4H 3QUXA 4RFEA 2GTWA 2QSVA 3O11B 2NY1B 5L6YL 4K2UL 4XTRC 1T5WA 3MFFA 2JJUA 2UVFA 1WCBB 4XCNB 3WXWL 3QFJA 5CGYD 3UAJC 2PYEA 4JN1H 4DKAA 4OF8A 5H37H 4QHKJ 2C5DC 4PJFF 5BZWA 3MRJB 5E5MB 1AJ7L 3P77A 4NHCH 3MRRA 1UM4L 5FYJD 1U92B 3U7WH 4YIQA 3CUPA 2FH6A 3OKLA 4JO4L 1FYTB 2FZ3A 5DUML 3RY5A 3QDGE 5CZVH 1ES0A 3AY4C 2WW8A 2DYPB 2ZOLA 4IRZH 1J0HA 4Q9CA 5F6HJ 3G04B 4JFDB 4JO1H 2YN5A 3C08L 4YX2H 3FRPA 3K2UL 1JPFA 3N9GH 1JNLH 2NXYD 4XNZC 1LE9B 2XN9B 1CE6B 1J10A 2CK0L 3CX5J 3RZWA 3A0OA 1KCVL 2EXYC 1M7DA 3GSNA 3O41A 1XIWC 4U1KB 1FQ9C 4LIQE 2YXFA 5IFAL 5BQ7A 3LS5L 5CIPA 3CMGA 1J0KA 3CZJA 4U05A 2E5EA 5KVGL 1YEKL 3LKPA 5F6IB 3PDOB 2A77H 4OIIL 3WUWB 4YDJA 4FABL 4KKNA 1XAUA 5ILTH 2C3VA 4X6BB 1YEFH 1QQDB 4BYHA 5FYKL 4DGIH 1XZ0A 2EYRA 3MJ9L 4S1DD 2LABA 3N1GC 4TQEL 2VAAA 4WW2B 5IEHB 3OR7A 2QQKL 3O0RL 3F7YB 3O2DH 3MREB 5DC0A 1B90A 3VRIB 5K93A 1IGFH 1T03H 4MA3A 4ZAKD 4JKLA 4FFWC 4OCRH 1FSKB 2XQBL 3TESA 1VKXA 4P4KC 4ZS7H 4NM8L 2BY1A 4XP5H 3BH9B 5D6DA 1BLNB 1SY6L 4JKKA 4AEHL 1RZFL 1AP2B 4TULH 4YHLL 1A6ZA 4K3DH 5D9SA 1X5FA 4ZAKA 3SPVB 5I1KH 4X6FA 4ZUVA 3IDNA 3MGTA 4OF6A 5J4MA 4JR9L 3MLTB 3TV3H 2MQ0A 3IT8D 3WIHL 2HT3D 1T04B 4NQXA 4R0LB 3AB0B 3MV9D 5DEFA 5DHXB 2IGFL 5I76B 2NY5C 5B4MC 1MLCA 2ZG3A 4C83A 2YKLH 2AJZB 1NFKA 1J8HB 1H5BA 1EEZB 5E8DH 1FLRH 5E94B 4PPTA 1MCOL 4IOIB 4POZD 4H5SA 3VCLB 4V1DD 3NN8B 2XYCA 3FN0H 4D9LL 1CD0A 3QHFH 5ERWA 3T2QA 1UB6B 4QRUB 5DWUL 2VDOL 1S9WB 3MV9A 3QQ3A 2GSGA 1TQCB 1CT8B 3NCMA 1U8HA 2YPKA 3ORJA 4PG9B 3MACH 3ULVE 4XWOC 1NC2D 4JFZL 4V1DA 1JNHA 1NEZG 2D03H 1R3IH 2YD1A 3ULVD 2FEDD 2JJVA 1JK8B 4L8CB 4MQXC 4K94H 1KBGH 1RZJL 5IM7A 1T7XA 3T0EC 5D1XC 4LOUC 1FVCA 2P4AB 1HCVA 3MODH 5I1IH 5CWSA 1I3UA 3DIFA 5TDNA 3MYJB 1NC2A 1VFOA 2XXMB 4PB9H 1UYWL 4YHKH 1FPTH 1B3JA 4LVHC 3GI8H 4XXCA 4OCWL 2O5YL 1CGSL 1AHWA 5IMMB 4MS8D 1RZKL 3OR6A 4Y1AB 4H20H 4YWGH 4NQVA 1CFQB 1GHFL 1S7QB 3I6GA 2D9CA 4PLKC 5ACZA 3GJFA 3PGFH 3ZDZF 4MJ6B 2FD6H 3BHBB 5A3IC 5CLWA 4LKCA 1KNOA 3REWB 2FWOB 3GO1L 5E2VL 1TMCB 2DQJH 5T3ZL 1B0GA 2EDBA 2VDPH 2XFXA 4U6VL 5DJXB 3HR5A 3H2WA 4KROB 4MSWA 2YUVA 5JHDB 3G5XB 3EGSA 2O5ZH 2CLVB 4NNPL 4KJWD 3CSYB 5JQHC 5GS1C 5TQ0H 5SV3A 2R69L 3KDMA 4FMKA 4JKWA 3TNMA 3MLXH 1JN6A 2AK1L 3FB8B 3WKNA 4DZ8A 2ADFH 1Q8MA 3CU1A 2V5SA 4WIQA 4Y4FD 1KPRB 3LKRA 4WHCA 1DBAL 3SDXB 4G42A 4TOYH 1LQSR 4KMTL 4P99A 2YD9A 4GRWF 2YS4A 3NOIA 1JF1B 3R06B 1G0YR 1MH5A 4BA8A 2UZXB 4FQHB 4N90D 1QFHA 4Y5VA 5BV7H 1H3PH 5FO7B 2DI9A 3ULUL 4CVZB 2AJVL 4PUBH 3HE7B 5DK2A 3RAJL 1KYOK 4Y4FA 3SBWC 3F5WA 3DX8B 4KZDH 1QA9B 4S1QL 1ZGLM 2CGRL 5FECA 2AXFA 1ZTXH 4NC0B 3MOAH 1KENH 3K3QA 43CAB 2L4OA 3OG6B 2IQ9H 3CXHK 3SGJC 1DP0A 1G7PA 4Y16B 4RX4D 5EOTA 2UWEB 2IEPA 2YA2A 1FIGH 2P1YA 3IGAB 3PWJA 1OP3K 1HWHB 5EC1A 2DQHH 1IGIH 4HWUA 2VKWA 3ZE1E 1O7VA 1W72H 4ONFH 3BDXA 5IG7A 3WNPA 2AJYH 2CMRL 4NN7C 2BSSB 9CGTA 1QEWA 4S11A 2JJTA 4NNXB 5CZXC 4LLQA 1N8ZA 3OG4B 4RX4A 5EU3A 2IAND 2H26B 2PYFA 4IRSD 7CGTA 2ADIB 4BZ2L 1WVZA 1ZA6A 4AEIH 5KTEL 3PP3K 5IV2A 3RY4A 1KB9J 2OTWB 4JFFE 4ZQKA 3IU4H 2D7NA 5IBLC 4BSWB 1A1OB 2PF6A 5E56A 2HFFB 4M61B 4JFFD 5EN2A 3TN0C 2HTLD 5IGXH 3GM0A 4N5EC 1E6OH 2ZSVA 3BZFA 5KN5A 2IANA 5I8KL 3BUTA 4IRSA 4YUEL 4HEME 1QR1B 2XZQH 3PGCA 1PQZB 3QFDA 3O9WD 5D2LB 2NPLX 3GBML 3OB0H 4PP2B 5DRNB 5TF1L 3TP4A 3BPNC 4JFFA 1HH6B 4AL8L 2DOCA 1KCVH 4WU7A 1NBQA 5B3NA 1QNZL 1OT1A 1RVFL 5DS8A 4BFIB 4HF5H 3U9PH 3VGFA 4JJHA 3EFFA 1G9MC 4I4WB 4OQTA 2HT2C 3O9WA 4JFYB 1V3KA 3OKEA 2H8PA 4RFOL 4QYOA 1RURL 3LKOA 2IF7A 2I9LB 1YEKH 4Q2ZA 1HQ4B 4N9GB 3RIAF 4LKXB 4OIIH 3O3AA 1WTLA 4N1HB 3P30L 3DXAA 3BZ4A 4FS0A 2AW2A 2YMXH 1OPGL 1UZ6F 5EIQA 5FHBH 4HKZB 4MXWL 3P4MA 2NYYD 2VDRH 2DIJA 4GKSA 1GZQB 3FRUB 4JM2F 2DTSA 3VFPA 3MJ9H 2PO6B 1PLGL 4PJXE 4TRPL 4WUUE 4S1RH 4TQEH 3UJJH 3HFML 1OW0A 5J1TC 5L7XH 4WUUD 3O0RH 1QPPA 5IW1A 2EH7H 2H45A 4HPYL 3DARA 3O6FC 4KRPD 4OQ1A 2WWMC 5B22A 2M26A 2OR9L 2OMNA 1CS6A 3ARDC 2GJ6B 1EPFA 1RUKH 1YNTA 4A6YH 4OLWL 5JXAH 2BDNH 1GCFA 1D5XB 5I8CB 4PJXA 3MRKA 4PJBB 4WUUA 4CN6A 4WWKB 2DQFB 2G2RA 3CK0L 3FT2A 3GMNB 3BKCL 1L7IL 1XGYH 3RTQD 3BI9X 2N56A 3C6LB 1A7BA 4HIEA 4BSVB 1JMXA 3SN6N 1YY9D 4LSQL 4K71B 4KHXL 5KVEL 4KK8C 4X0KA 4JM4L 2V2XB 2E3VA 3GKZA 3S4SG 4HKBA 4KMQA 4RGNC 1FV1A 1LD9A 4G5ZL 3C8KA 4MZ2A 1G7JA 5D2NB 5TDOB 1WT5C 4JFXA 3UBXA 5CP3H 4YC2C 4XGZA 1FAIH 2D7TL 1KLFA 5A16B 1U8NB 1CL7H 2NY1D 3HI6H 5DWUH 2NY3D 1MRDL 5FA4B 1ADQL 1DE4A 4PJ9C 4NP4L 4XZUA 4Q74A 2QADD 1WFNA 4KV5F 2PCPB 4NZTL 4BSJA 5F3BA 1S3KH 4JY5L 3EJYD 4N1CA 1H3TA 4RNRB 3NZ8B 4NT6B 1UA6L 4J1UB 3ZE0F 3LEVL 1JGUL 2J5LB 4LPCA 3A6BL 3OKKA 1ZHLB 5IT2L 1C1EH 1A7NL 4JFDE 3TNNA 5LJYH 3O45B 3RDTD 4TTDC 4Q9RL 1WCBA 3S96B 5DTFA 4JFDD 4C55A 3PV6A 4QCIB 1AH1A 2Z31B 1WQVT 1MNUL 3NA4A 3TBTA 5K9KA 3JWNC 1NEZB 3QUZD 4R7NB 3C5JB 3N85L 3LMJL 3W81A 3WE6B 1EVUA 4POYA 2E9WA 3QI9C 4U3XA 3RDTA 4X7DC 2MCG1 3U2SB 3REVB 4JFDA 3DVGB 4HKXA 1A0QL 1GOGA 4FG6C 2Q8BH 3MLYL 4P5MB 2ZCKL 1PJ9A 2B1HL 4YGVB 2H3NA 3QUZA 4J3WA 3AMLA 2BSTA 1KTLB 4XVUC 3GSQB 4D8PB 4XCCH 2B7DT 1DBBL 2X4PB 1EUTA 3V4VH 2R0KL 4BZYA 2WUCH 4QTHA 5I18L 5JW4M 3UP1A 4JY6A 3BQUB 1FZJA 3MV11 3GI9H 4O4YH 5ESVA 2X1WL 4ELKB 4E5XB 3ROOB 3O3EB 2NQCA 3PDOA 1CN4A 5T5NF 2Z93B 4YBQC 3HNTL 2CR6A 2CKNA 3R4DA 2VLKB 1I7ZB 5E5UB 2E6PA 1WCQA 3H7BA 3LN5A 3WDHA 3K7UA 1J5OH 3JV4B 3PWVB 4NPYA 3WFBL 4M3JA 2D3VA 3MUHL 1E4WL 1HIML 2VITA 2HLFD 4NQSA 4IIQA 4P9ML 4OSUH 1UJ3A 3O2DA 4XXDA 4Y5XA 5FO8B 4B5EA 5D7SL 2ICWI 1CICB 4QHLB 4LEOA 4H1LB 3R1GL 4EVNA 5JQ6L 2LV4A 5HHOE 4JAMA 3CCHA 1J8HE 3MUJA 1ZMYA 4NUJA 1Q0YH 1QOKA 4PJ7E 3QWOB 4Z78B 5HHOD 4YEEA 5EUOF 1BJMA 3ULUH 1KGCE 1MCNA 1KEMH 4GBXD 3KR3H 1AP2A 2IG2L 4JCMA 1KGCD 4O9HH 1IKNC 3PWPB 5IHZB 5C0JA 3RVWC 5ICZB 1FGVH 4D9QD 1F3RB 2OI9B 1T04A 3QXAA 4PGCA 4GW1B 5EO9B 4OFKA 1CDYA 4XPHH 4S2SB 5HHOA 2ITCA 1YNKL 5FM5M 1N26A 2AJZA 3PHQA 4PJ7A 3BRDA 4GBXA 4EIGB 1R5IB 1JHKH 7FABL 3H9ZA 4G6MH 3DGGA 4LDOB 2FECL 3PWNB 2W9LA 3CDGA 3LQZB 2VZSA 4ZFGH 3C9NA 1DQDH 5AYUL 2WIIB 1PEWA 5C0CB 2ZUTA 3SE3C 3Q5OA 3TJHD 1YJDC 4PG9A 1Y6NR 4WW2C 2MOVA 2BCKA 1GGCH 4WTXA 4DKEL 4XPGL 3E6FA 4YGAB 2VSCA 5KVFL 2FJFA 3RPIB 2NTFB 5KSBB 4HIHB 2YUXA 4PJAB 4AT6B 5IQ9B 5I8KH 1A14L 4R8WL 3V6ZA 2NY7L 3SDAC 2V5TA 3LKNB 3MYJA 3BD3A 4NKIL 1CFNA 4NWTL 1CFVH 5D7IF 2IQAB 3OKNB 5DZNA 4AL8H 1J8KA 5I1AB 3G6AA 3T0WA 5J6HB 5FCUL 4UINL 3KGRA 2VZ3A 4R90L 3NFPA 3FT4A 3GNMH 1UB5A 3QDMA 4P2OD 3OAYK 1CFQA 1S7QA 1NMCC 3RX8A 2YWYA 1RUPH 3TBWA 1FP5A 5E8NA 5GRVK 4KRMB 4NWUH 1Y18A 3AROA 3BP4B 4O58L 1MLBB 1H3GA 2RB8A 1T2XA 4GAJH 2HJKA 1MCPL 4RAVA 4P5TC 3BT2L 3OKMB 5HTSA 3HC4H 3HZMA 4PJ5E 1K4CA 4L9DA 4P2OA 4UIMB 4E41B 4PD4J 3QPXL 4PJ5D 5HJ3B 3WS3B 4JRXE 1TQCC 1P84J 1AKJD 2CLVA 3L3HB 2GY7B 2CRIA 4JRXD 3IB4A 5KANI 1HDMB 3VGBA 4G9DB 3EJJX 1FZOB 1E0OB 1WGOA 2WWKT 4OF7A 3U9UA 5IBTL 3UBXG 1WC7B 3DUSB 5HYJD 1SHMA 3OJ2C 3ROLA 4X98A 1MJ8H 4EIZC 2DDQH 4ODVL 1B9ZA 4P48A 2CJUL 1YMMB 2EECA 3EW3B 3LB6C 2XKNA 2HWZH 2YRLA 4M43L 3QT2A 4PJ5A 2R56H 4OLWH 1AKJA 5CJXA 5GISH 2VR9A 5GGQH 1YC8A 4JRXA 4NBZB 1AXTL 3R06A 3P4NA 5B8CA 1OSZB 4JJ5A 5HYJA 2AJ3A 1JMZA 4WU5A 4Y16D 4ZO7A 2FO1A 5MHSD 1A6AB 3BW9B 4L8BA 4LSVL 4IOFD 3ARFD 4RIRB 2APTA 1QO3B 4KHXH 15C8L 2DL9A 2YD2A 5C0EB 1T6WA 5H37G 1JTOA 3X12B 3ARGD 4I48B 4M7ZB 4G5ZH 1ZVYA 5CHNA 1JFQL 3GSOA 2EKSA 3Q2CA 1QFOA 4Y16A 1RHFA 1NAKL 2MPAH 2D7TH 4FTVA 4U33A 3D48R 3S4SB 3JVGA 3ARFA 2R23B 4JFOA 4XVTH 1F2XK 2F54E 4YDVB 3SGDI 5INCB 4NP4H 3WIFB 4YDKL 1J05A 2F54D 3BE1L 3JUZA 3ARGA 1W72A 3QIBB 1IQWL 3MFGB 5TGBB 3N0PB 4I0CC 1UA6H 4NO2A 4ZOAA 1TCRB 4DZBA 1T66D 1SVCP 1JGUH 1F6AB 3A6BH 5D2LE 3EO1A 5IT2H 2C9AA 1FGNH 1A7NH 3C09B 1MCWW 5IW6B 4IJ3B 3CNKA 5DVLA 3F7VA 3IJYB 1A1OA 2F54A 3VH8A 2HFFA 3FL7A 3QSKB 4M61A 4MA7H 3MRQA 3MNZA 1INEH 3ECBA 3IDGA 2A9MH 3DBXA 4YK4B 2EDWA 3KLAB 3RVUC 3BDYH 5DEGB 3RI5K 4MD5A 3ARQA 1H3UA 1PQZA 5EFIB 4P2YA 2JF1A 3W9EA 1FNEB 2CLRA 4P9HH 3LY6A 4W70A 3FO2B 3VMOA 1HQRB 2D0HA 4M8QA 3MLYH 4DKDC 4GH7B 2C7UB 2ZCKH 4NSKB 4WHTA 5FYKE 3S9DB 3AGVA 1U8IB 3IXAB 2XZCH 3EFDL 3IDYB 4M7KL 4XMKH 3SQOL 2XKSA 4FQ1L 1ULVA 3HPJB 5HYIA 3EYUL 3CC5A 4QGYA 1BBDL 4P2RB 2OJEB 1M05B 4XCEB 2A74A 5I1DB 1U6AL 1HK6A 5FYJU 2I9LA 3U36A 1XF3A 5K9QI 3V6FB 4BFEA 4YHNB 1BIIA 1AQDA 1F3JB 5GRJH 4DUXA 4MCYB 4AQOA 3MJ9A 2XRAL 4QWWC 1HXYA 5IHUL 4PJBE 4WW1A 4OLEA 5DJ0A 1E4WH 4KDTC 1T0NA 3VXSB 3QUMB 4ZUSB 3K4ZA 1F11A 1BMGA 4FQXB 5D7LE 3O4OC 3HB3D 2DBLL 2V9TA 4TUOB 3UYRL 5IFJB 1I3VA 1ZHBB 2DS4A 4RMRA 5D7LD 4LLDA 4UOW1 3C6LD 4LCWB 1DBMH 5JO5B 2FATL 4A6YA 5J8OA 1N0LA 4EOWH 1D5XA 4PJBA 2WZPD 4XNXL 4EUPH 1P5UA 1P4IH 1BX2B 3DX7B 2YD6A 5T33H 3BISA 3GMNA 1Y6MR 2ICES 4UBDD 1NCDL 5JA9A 3KYKH 5D7LA 4PGEB 1CGVA 2E9JA 2Y23A 3C6LA 2VB5A 4EN3C 5JIIA 4PJEF 3WIHA 3QNXA 2V5MA 3IFLL 5EPMA 1BREA 4NN5C 4CVWA 1URLA 5JMOC 5DA4A 5IJKC 2VH5L 1DSFL 3O8XB 1JGVH 2F53B 4ZFOB 5HPMA 1KUMA 1MHCA 1QBMH 5KS9A 3RGVB 2NY2C 3OX8B 5CP3A 4OI7A 2WANA 4Y4KD 3DVNA 5EDXA 1WICA 2ARJB 1JP5A 3LRGA 5HSFA 2AXGA 3IETA 2X70B 1UM5L 2YHGA 5JDSA 1GC1C 3QO0B 5J1SC 1INQB 3KXFD 4NT6A 5I19H 1RUQL 1UM6L 1AGCB 5CD3B 4WJ5B 4JG0H 3LKQB 4GLRI 5KVFH 4M1DH 5EIIB 2AAVA 4Y4KA 3PL6C 4IMKC 3LQAH 5DQDL 3LH2L 2VC2H 5GGSB 1LK3L 1D5IL 1MJUH 2BMKB 1R5WB 1XGUA 1DTUA 5EBLB 3H3PH 4LCIH 4APQB 5I1CH 5HHME 1I8KA 4P4RB 1PKQB 1U8MA 3WIIH 2AV7A 4YJZL 3NH7H 3KXFA 5HHMD 4F58L 1I3GL 5K33A 1CI5A 4K7FB 2VZ1A 1WAAF 3RHWK 4NWTH 1PX3A 1FVEB 3LPGA 5GZOD 5T3ZE 2EYSB 4HMCA 5MERA 1T7VA 3ZKXB 3GSXB 2Y7QA 4UINH 5KAQF 3DX6B 5T3ZD 3SE8L 2X4OB 5DUBA 4F33A 1FNGA 1M71B 2PXYD 4MYWB 1RZIB 3RWIA 3FQTA 3E3QE 4B41A 4Q58C 2EIZA 4QRPB 3BP5A 1CLOH 5D2NC 5F1SA 4DAGH 5DJAB 5A2KH 3BT2H 3OGOE 4BKLA 2Z91A 2J7LA 3QIUB 2DLFH 3O3EA 2PXYA 1CU4L 2C4FT 4IS6B 4PBXA 4UQ2A 4S1SL 4DCQB 1CD9B 5FK9A 3JWOH 5C6TL 3ARBC 1JWUB 3BX7C 4U2YA 2V5RA 1I7ZA 1MWAH 5FGSA 2B8OT 2YZ1A 4MXVE 2Z35A 3ULUE 3BZEA 4CUCA 4HKJB 3ULUD 2WINA 2AS5M 4NYLA 4KUZL 4ORZC 2ICEA 1KIPA 3EDFA 1AXTH 5CEZL 1CF8L 4XP1H 2I9TB 2FJGB 4L8SA 3RHWF 1RZGA 4KKBD 1S7SB 1HXMB 4LLVB 3QWOA 2X40A 3D25A 1NQBA 5C0AD 1CDUA 4WY7L 5GS2D 5JUEH 2YEZA 3VH8G 5D7JB 2IPKA 3DI3B 3KPSB 4G43A 1NLBL 4M02A 2ZWLT 5E7BA 5D1ZD 3B5GA 5TQ2H 4FFYH 5C0CE 4MQ7B 3HC3H 3SKMB 4ZS6D 4MD0A 5BVPH 4HUWA 1R24A 1XF4A 1FL6A 5C0AA 2MFNA 3TH2T 2HJFB 5LGJA 4WV1A 2EIEA 2R2HB 2AJUL 2RHEA 3QDJE 1R5IA 4OZIB 5D8JL 3QH3A 1B0RB 4NGHL 4Y2DD 1JPTL 4G8FA 3MRLB 4PJAE 1G7QB 3CU7A 1UKQA 3LQZA 3QDJD 4C4KO 1S78D 3DNKA 4L3CA 5C2BL 1T5XA 1U3HB 3IDIA 1BFOB 5D1ZA 4X6EB 2QSCL 4KHTL 1I1YA 5F96L 1CLCA 5EOQL 1RUAL 2XTLA 3FONA 3FZUC 4JQIH 1JRHI 1T80A 2F15A 2ESVD 2XQYG 4P57A 1GGBH 5HHXL 2WSKA 3ZKQD 3O6MH 2HVJB 3NMEA 4X8JA 2X1PA 3WHXA 5GGUB 4Y2DA 4PY7B 5BMFL 5C0GA 3QDJA 4ZXBB 3D0LB 1MIEL 1RK0B 3MRNB 3T4AA 1DFBL 3TIDB 4PJAA 3X3GL 3NIFF 5IQ9A 3TH3T 1OLLA 3C5SB 3WO3B 1CICC 4F8QA 1HYSC 3VFRB 4V2CB 2DKMA 2W38A 4K8RC 2ESVA 2APXA 3MXVH 3OAZK 3VFUB 3VGHA 4F15B 4YXLH 3AM8C 4XWGH 3FTGA 3CD4A 1EEYA 3CFBB 3UJTL 2IQAA 3KWWB 3WO4B 4Z8FL 4EQ3A 1U2CA 5I1AA 1I8LA 4I77L 4L8DB 4R7DB 1E4XL 4KAQH 3QUXC 1S7WA 5T1LD 3EYUH 1CWVA 4UV4H 4X4ZA 2EC9U 4FZEL 3L3GB 3RZCC 1GGTA 1LO3H 5EC2B 4W6WB 4HFWB 3MBED 5EA0L 5CILL 5DJCB 3BP4A 4KTEL 3V52L 1MLBA 4DWHA 3HUJB 1YMME 5T1LA 1S7XA 4UIMA 1I7TB 2CRZA 1S8DA 5GS0C 2QTEA 1QPXA 5HJ3A 4LSTH 1ETZB 2E6JA 2CDEB 4TUJB 3MBEA 2X4RA 2W60B 5BRZE 4NKQB 5DGQA 1HEZB 1CGYA 4YFLF 2DBLH 3DUSA 1KFAL 4O02L 3BPCA 5BRZD 3IRPX 1TIUA 2DMKA 5IB2A 3L3IB 4HT1H 2IAMB 5FAAA 5GRYA 4DK3A 4CU6A 4LVNB 3TPUA 2HFTA 3KPLB 4FQJH 4POUB 4HUXA 1BZ7A 2XY2A 3RUGA 1NGQH 2P5EB 2NXYC 4XNXH 2VXTL 5D1QB 3OB8A 3DSFL 3IU3A 3VMNA 43C9B 3AU1A 5C3LD 2YD5A 1VB9A 5BRZA 1NCDH 3HLAA 5B39A 1KT2B 2EH8L 4F7EA 2BSED 3BW9A 3IDJB 1KXQE 3PHOA 4ZOCA 4LLMB 5HVHC 3KPPB 35C8L 2EDEA 3IFLH 4YBLC 3B6SA 2GITA 4PBWD 2JELL 3GFUA 3X12A 2PW1A 5GJTL 5LCVH 2VH5H 1HNGA 3U82B 1I85A 3H9HB 2X2YA 2NX5B 4JDZA 4HHAA 4MNHA 2Q20A 4DN4L 3T3MF 1A8JH 5I8EB 3V0VB 3ILQC 4S1DC 2R23A 5EU6B 5LG1A 3RRQA 5K9JL 1T1XB 3V5HA 5D6DC 2IFGA 5JOFA 2AABL 2AXJA 1MY7A 4MD4A 4XVSL 5D70L 3STLB 2HFEA 4HQQL 4JE4B 5IUSA 4KJYB 1RUQH 4ZAKC 4ZPTB 1TCRA 2J8UB 4UAOC 1JPSL 2VR5A 3IDUA 4CGTA 2Y9RT 5DQDH 1NEUA 3H9YA 4OZFH 3W2DL 4UTAL 4MVBD 2R2EB 1RZ7L 3E6HB 4F7PA 3RPKA 3VFNB 1FJ1A 5B3JF 2DICA 3HA0A 5DJYA 1KJ3H 4P59L 4LBEB 1MFCL 5DQ9A 3QEGL 3G6JB 5C08B 3FFCB 3LHPH 2X4UB 5HGAA 4P2RE 4Z77B 4P46D 1H0DA 2HT3C 5EWIH 4P2RD 1FNEA 1ODAA 1MAMH 1G84A 5HDOA 2GK0A 2EXWD 1IGTB 1NGZB 4NN6B 2C7UA 1WZ1H 4Z6AT 4WVRA 2ORBL 1U8IA 2ZZUT 3KPRE 4G3YL 3EYSH 4P46A 5ID0B 4JANA 1ZS8A 3KPRD 4P2RA 1N2RB 1Q94B 3VXSE 1YPZB 1NFDF 5I1DA 2DRUA 1EMTL 5C7XL 3VXSD 3DX9B 1CU4H 1SJHB 4S1SH 1OGTB 4FQXD 4LHUD 2ADJB 2W07A 5C6TH 4LCWE 3EOAA 1ZK9A 2FX9H 2FEDC 4HCRL 3I2CH 5LQBL 5BV7B 2L0DA 3CVHL 5HGBB 1S5IL 1WWWX 4XXCC 3TA3C 1KYOJ 1Z2KA 2EDRA 2ZSWA 3KPRA 3GMQA 3INUL 4YHPB 4RDQG 2HN7B 4YPJA 4PB0H 4I0KA 1F42A 4JDTL 3SDCD 3VXSA 4ZDHA 1A4KB 4ZUSA 1FBIH 3QG6B 5HHQA 3RGHA 1UFUA 1U95B 4FQXA 4LHUA 2ED7A 4KUZH 3NBNA 1HHJA 1ZHBA 2MTPA 3GMOA 4OKDA 5GSRB 5I1HH 1CF8H 2BOCB 1LDSA 4U6HB 1RUML 4R26H 3IFOA 3WXVL 1A4JA 4MS8C 3BRFA 3RKDD 3QWQB 2F53E 2F8OA 3PJSA 3SDCA 1FAKT 1T3FB 1Y0LA 4OCYL 4HX1B 3D5OF 4OGYH 2F53D 2V2WB 2XPGB 5GRUL 4M7JL 2EDJA 5D93B 3TWCL 3V79C 4QT5A 5ITFB 1KB5L 3T09A 1L0YA 3RVXD 3IDYC 1UGNA 5ITBH 1G9EA 1WJ3A 1HILB 2VLRB 3BP7B 4R4FH 3D3VE 5DD6A 1ZLWH 2NXZC 3MLSL 3TBVA 3VI4E 5I66B 4LHQB 2K1MA 2F53A 2QQLL 4WFGD 2QEJA 3D3VD 2BNUB 4QHUB 1ZWIB 3X3FL 2W9EH 3SGDH 4NC1C 4OZGB 1CFTB 2L7JA 4EBQH 1SYVA 5C2BH 1T1ZB 1EA9C 1F8TH 3FB5A 4MJIB 2QSCH 4KHTH 5F1IB 5F96H 1TPXB 3L5IA 4Y5VC 5EOQH 4YAQA 1PKQE 1QVOA 5EZOH 1OL0A 1EAPB 3KHOA 3ARRA 3U46B 4N0CD 4H88L 3QO0A 3I3EA 1INQA 4B7LA 4RAUB 2UYLA 4CDHA 3GBLA 3CFEB 3D3VA 2RGSA 5BMFH 4OM1L 2A0LC 4FQQA 3PE9A 4OCMC 1Z9MA 3IVKB 2B39A 4RRPA 1F90L 1X5IA 3S5LA 1S7UA 3D85D 1F4YH 3X3GH 2CDGB 5GGSA 4PRPD 1RIUL 4RISH 1OAZL 5DHYA 2V17H 3GJEB 4KJQC 5E2TH 4XX1G 4H25B 2DM2A 3ES6B 4HGWA 3B9DA 4QRPE 4JPVL 4KUCD 2X4QA 4HJJH 4RAHA 4QRPD 1YEEL 1FFQA 1T89C 4PJ8B 3BKJH 3VFGL 1OAQH 3QCVL 2JJTC 3D85A 3K4DA 4MDIB 4NKDB 1P53A 1PYWB 4PRPA 5L9DL 3S3SA 2R8SL 5TE6L 3KYNB 2X4OA 2VO5A 2F58L 4L1DA 2V6HA 2Z92A 5C3TA 5ESQA 3PDDA 3EO0B 4H26A 2P46B 3U83A 1RHHB 2UUDK 3L3OB 1JWMB 4I8DA 3TT1H 4QRPA 2XT1B 1KLGA 4KTEH 3V52H 4Z7VE 1R6VA 4NO3A 3WN5B 1A6UH 5BCAA 4HC1L 3GKWH 4JHWH 3P9MA 4MLSA 4W6YB 4IS6A 1RAMA 4U1GC 4PJCB 1EBPA 2NMSA 4NHUB 5I1LA 1NBZB 3MV8B 2Y36L 1E6JL 4WFFE 5INDB 3QCUL 4JVPA 1D9KB 3FO9A 1ZT4B 4NJAL 4WFFD 4KI5C 3MV7E 4D0CA 1IT9L 4R9HA 4ODBD 1SQ2N 4Z7VA 1OF2B 1C5DA 4Z7WB 5L8JB 3OXRA 3NCYS 1IZJA 3AFLA 3EYVB 3MV7D 1MQKL 3O9WC 4KQ3L 4JQXA 1ZT1A 1QKZL 1EEQA 2BHUA 2P8MB 5D7JD 3SKJH 4Z7QE 4AIXA 3MLRH 4I5BB 3O3DA 3QJFB 4OFPA 3IAGC 1V3LA 5HPOA 2VXTH 4N0FA 1M7IB 4GKZA 3U4AA 3FFDA 1FL5B 2HH0L 1U0QA 3D18A 4U6XB 4YXHH 5E4EB 2H6PB 4BH8B 4ZYKB 3MV7A 1K9TA 3MOBH 1YDPA 5JXED 5D7JA 4M5YL 5EH1A 4FN0A 4WEUD 3W39A 4G6FB 4H8WL 3V6BR 4AEFA 1ZGLP 1YN7B 2EYTB 4YPGA 1U3HD 4HD9A 3TBYB 2V9QA 1J1PH 1F02I 2B4CC 1G9NL 1F2QA 2IWGA 4OLZH 1NGPL 3BUYB 2NYYC 5GRVL 2XTJD 4C59B 3MLVH 1NMAL 3AAZB 3RWFA 2NY0D 4PS4L 4RMWA 1J0IA 1QACA 2R2HA 5JXEA 1FNSL 1QYGL 2AK4D 3EDKA 5JR1H 1FCCA 1B0RA 3A6CL 1NCTA 5EZIL 1REIA 2IADB 1HHHB 1X7QA 3EDEA 4U1HB 1U3HA 4HUKB 4HJ0D 1V8HA 5HVWA 4WHDA 2W0KA 1F13A 3STZB 4GG6A 5TDPA 2B5IB 3KYMA 4UTAH 1G7HA 3W2DH 4LP4A 4ZG1A 1C16A 4WENB 2AK4A 2FHBA 2BHYA 3WHE0 5FKPA 3QRGL 1J0YA 4QHNB 2D7PA 1D7FA 4PJFA 1GIGL 4R4ND 2HKHH 3PQYB 3QEGH 5F9OL 3B9AA 5T3XL 3WFEH 2FHFA 2ZCLH 5A40E 3NGBC 5LWYH 4HPOL 3QAZB 2X10A 2DF3A 4O00A 3V2AR 3HUJE 3SGKA 2GK2A 5F88B 4FFZL 5F1OB 4MAUL 2R39A 4TUKL 2VE6B 1BQHB 4IHOB 1S9YB 2HVKA 4UDUB 2EKJA 1AO7B 5JLZA 3KLHC 5DQJA 4QTIH 2NY3C 4K3JH 4DKFL 5KSUB 2P5WB 2ZUQB 1AFVH 2R1YB 3KHQA 2DLGA 5IOPB 4EUPG 2QADC 4HFWA 5IB4A 3GEWB 1D5MB 2VISB 4PTTB 4JFPB 1J18A 3HUJA 4LGRB 5DURB 2ZJSH 1HI6A 3T77A 3ZYZA 5LQBH 4WI4A 1LK2A 2ZUWA 2R1WB 3RDTC 3CVIL 1MFDL 1BD2D 2P5EE 1G7MA 3TO2B 4JHAL 1RZ8A 2CDEA 5LXGH 1A7PH 2VABA 3QB7C 4ZFFB 2R29L 2W60A 1ZLUK 5CEXB 1X44A 3ARTA 1FFOA 4YFLI 1MJJB 3QUZC 4RZCA 4DW2H 4W81A 3QZWB 3MRPB 4GQPH 4ZSOE 5BOZG 4N0RA 4Y19B 3WXVH 1BD2A 1F45A 5L0QB 3OJMB 5TE7L 1JUFB 5DD5H 5I16B 5HYQA 4MDJA 4OF3A 2ZUVA 5I6XB 4WW2F 2LVEA 4YHIB 4X7SH 4Y4HB 3TWCH 3S5LG 4CADB 3OKDB 5EU6E 5LBSH 1AXSB 3P11L 5E70A 1LDPL 3PXHA 5FOBB 4JPIA 1KB5B 4ODTH 5C0RH 5EU6D 4YNYA 4D2NA 4ZSOA 1SVZA 4KGJA 3OKYA 4IIQC 2Y72A 1FFPB 1JIBA 1UJ3C 2Q7YB 2E7MA 4MJ5A 4Q97A 2J8UE 4JHBA 3MTRA 5TE4H 1G7IA 4Y5XC 3HS0A 1C5CH 4F80A 5BW7A 2GSIA 4JZJA 4LPXA 3VJ6B 3CMOH 2X89D 5AD0A 4ODHH 1Z3GL 3RY6C 2NY4B 1DBKH 1A3RH 3TFKD 5EU6A 4JDVA 2HLFC 4FXKB 5C09B 2GCYA 5KSAB 3PP4L 4NNYB 1PKOA 2OP4H 1JRHH 3G6JE 3VXPA 5C08E 2YBRA 4N0YL 3FFCE 5TFSL 1NCNA 3FQRB 4NRZA 5FKAB 3AUVA 1C7TA 1HCFX 4OZHB 1FE8H 1I7UA 3B5TA 4OM1H 5C08D 3FFCD 5AYQA 4BQ9A 1KV3A 3DROA 2VXUL 2X89A 4M1GL 1LO4L 3PWLA 3RA7H 2G5RA 5GIRB 1LGVA 4HUUB 3QJHA 4X7TB 1O7SA 4AYFA 1N0XL 1FN4A 4PV9B 3ARVA 4XP9L 3D39D 5E8OA 1OSPL 3T0AA 5GZND 3L5WA 1TZIB 4GBXC 2I60H 2H2PD 2MMXA 4JPVH 3ZDZE 3ZYJA 3BZDA 4GRLC 3FFCA 4HS8L 2OTUB 4Z77A 12E8L 2JTDA 3VFGH 4DUVA 4TSAL 4R3SB 1A6VL 4XMPL 5D7IB 4ODSL 1D5ZB 1CG9B 1JGLL 3TYGL 3LSOB 2B20A 5CSZA 1OP5K 5C71A 3D2UD 4D3CH 2B2XH 5KSVB 3MA9L 3JWDL 1PDKA 2VDML 2F58H 3QXWA 4PJIB 3D39A 5E6IB 2NR6D 3FO0H 3MLUL 1CDGA 2ZNWA 2X4NB 2ZPKH 1EEUA 3S88L 4OLUL 3HMXL 3NA9L 4LPWA 3NAAL 1JGEB 3C60D 4K94C 5EU4A 1IGJA 1N2RA 1I7RB 1IVLA 3D2UA 4OCXL 4HC1H 1ZA3A 3IXTA 4CN4A 2LTQB 3TJHC 5J9PB 1XF2B 4I3RL 4YHOL 3KPMA 1FORH 4MGXA 1J1XL 1OGTA 1YEJH 5EORH 2ADJA 5ID1B 2IMNA 2ZG1A 4Z0BL 5CEZE 2IH1A 4GRWE 3OXSB 1NCBH 4MA8H 5CEZD 1H8SA 4JVWA 3C60A 3LN4A 3CSGA 3PWUA 5I30H 3U6RA 3EJZD 4NJAH 1CR9H 1FC2D 3U4EB 3CFKB 2R1XB 3VW3L 4J12A 4KQ3H 1MQKH 3C5ZB 3QG6A 4LCCC 4ISVA 1WF5A 1QLRA 2JCCB 1MCCA 1QP1A 5ICXB 2AGJL 5GS3A 1FFRA 3HNVL 1R5VB 5DMIL 3RIFK 4O2FA 5IR1A 1F3DJ 5ALCL 3IKCB 4C4KT 1I1AB 2BSRA 4P2OC 5CMAB 3WEXB 3U0WH 1FNHA 1H15A 4ETQB 4MB4A 3GSRB 5E08H 5EU7E 2FB4L 4TNWK 5JHLL 1CTNA 4XC3H 1U8LB 1NDGB 1L9MA 4FRWA 3B3IB 1E27B 2UZIH 4L4JA 2O61B 3OAYH 5E9DD 5CLTA 3SDXF 1A21A 3SE4A 3L7FA 2R4RH 3RQ3A 3BP7A 5KVDH 4L9LB 1RY7B 2J8HA 1N5YH 1T6VN 1H8NA 5I66A 3NVQA 2OQJB 2CO7B 5CJXC 1LILA 3Q6FB 4CMHC 5JOPE 1ZWIA 3IFNL 3KNBB 4UMGA 3OPZL 4XVJL 5B8CC 1IM9B 1IFHL 5BO1L 5E9DA 2R0ZL 3MJ7A 2AI0H 1UQSA 3QXTA 4WTZG 4BZ1H 5CUSL 5BV7C 1NGYB 8FABB 4IDJH 2F74B 4DQOL 3L5JA 1V3JA 4K23L 3NTCL 2UWEF 3JV0A 3H6JA 3V0WH 2PTTA 3QRGH 3VWJB 3LD8C 4OZ4B 3T2OA 2E8YA 5DMGD 5F9OH 5C0DB 5BS0B 3UO1L 1LEIA 4HS6A 1C08A 3JVGC 4Y5YB 3KJ6H 3ARFC 4N8CL 5HHVH 5GJSL 2YPVL 3RIFF 4HUMB 2C4XA 2XNAA 3HRZA 4GMTL 5GRXG 1SYSB 4ESKA 3Q5YA 2HAZA 1P5VA 1K8IA 3I6LE 1EV2E 3ARGC 5DI8A 1W2KT 5DF0A 5FM4A 1U8OB 4IBLT 1UEMA 4TNWF 3SCMD 1T20A 3I6LD 1UZ6E 4TUKH 4LCUB 1MIML 4KZEH 3TYFA 2HRPH 2RAMA 4UOJA 5DO2D 1SM3H 5I8OL 3ZL4L 3MRHB 4R6UA 5D72H 5GGVY 3O3UN 2FLRT 3I9GL 4LDLB 4JM2D 2QQNH 1FFNB 3MV8E 1EX0A 2DWEA 3H3KA 1YYLL 4AIZA 1CBVL 3MBXH 1JWMA 5AZ2H 5J6GA 1FZMA 2FBJL 2RJMA 3EZ8A 3O2WH 3SCMA 3CH1A 5D2LF 5CD5C 1O5DT 3ARUA 4MCZB 2AEQH 4Z7WE 1T66C 4HZLA 5AG9A 4EXKA 2ITDB 3QEQD 4XPBH 4YO0A 2A73B 4JM2A 1RSFA 1KB9K 4QHMA 1A6TA 4I0PB 1TENA 3LVEA 2NY5L 1NBZA 1Q9KB 4JY4A 5F1NA 4XP6H 2VXQH 4LAJH 3IYLW 1VERA 4Y0GA 3HC0B 4JZNB 1R3JB 4DVRL 2AEIT 2BFVH 4HWBH 5FGCB 3QEQA 3V8OA 2PTVA 3EDDA 4Z7WA 5F7KC 4M7LL 1A9EB 2RIKA 5EBWB 1KCUL 5F9DC 2M8XA 5I1GH 4LQ1A 2P8MA 4XMLL 2HLAA 2J2ZA 4I5BA 3WKML 5FYLL 4G6FD 4PGJA 2BY0A 3LRHA 3MJ6A 3MLZH 1NANH 1FL5A 3BAEL 1ZLSH 1Q72L 1T0MB 3PXJA 2PTUA 4OZFG 1KEGL 4QY8B 5D71L 1LDPH 1L7TH 4JZOB 2FYYA 5CZKA 2IH3B 3DPBA 5DT1L 1T1YB 2D31B 1KOAA 4KV5E 1BOYA 4U31A 1FL3A 5F7LB 3RWGB 2V7HB 3A67L 1U91A 2XY1A 3KS0H 5C0BD 4DOHB 3BIKB 3FOLA 3ZE0E 5L88H 4URTB 2Y6SD 3F6IA 4PJBF 5E00B 5I15H 4WI7A 3QIWB 3V4UH 3EOBB 4LF3B 3THMH 1YQVL 1YY8B 2Q7NA 3AAZA 1VPOH 3DO7A 3VGDA 5LVEA 4OT1H 1ZT7A 4X5XB 3M1BA 2OLDA 4NQDB 4XCFL 5IROA 1JHTB 1T1WB 4PRBB 4GMSL 2IADA 5I0DA 3SO3B 4WUKL 4ONHA 5FGBC 2ADGA 2Z4QA 5TFSH 5C0BA 4U1HA 1ND0B 3HB3C 1W8NA 3VRJB 2W65B 3M8OH 5IMKB 3FAWA 1OAKH 4DN3L 2LU3A 2APVA 2BXZA 3L1OL 4NRYB 4U49A 4PRIB 3HAEA 5C0FA 3MCLH 5FA3A 1W0VB 1OSPH 1MRCH 5DD3H 3VFWB 4UT9L 1YECL 4F57L 3T2NL 1CGUA 2IALA 3MO1B 4UBDC 1AO7E 5E2WL 3QUYB 4HS8H 5KANG 4OUOA 1HSAA 1ZSDA 4XAKE 1Q0XH 3X17A 4JFEB 4KC3B 3MRBB 2VDMH 4XAKD 4UT6L 4Z5RA 2PR4L 1LO5A 2C3GA 1F58L 2AEWA 3RU8H 1MWAB 3PF2A 4GKNA 5F88A 3BXNB 2LE9A 4PBVC 2Y5EA 3WFHA 4RGOL 2DQCL 1BQHA 4AMKL 4OLUH 4WDIB 2A6DA 3HMXH 4Y4KC 4WI5A 1NJ9B 1F5WA 5DRWA 3O2VH 4U1MB 5ESAB 4NZUL 1ZEAH 4OFVA 3BWUC 1YEDB 1S7RA 1A1NB 3L7EA 3TIEA 3OTTA 1J1XH 4KVCH 3AREC 5ENWB 1DDHA 4Z0BH 3BPOB 4HCRA 3BGFB 3BO8A 4HG4K 5IEKB 1KIRA 3CVHA 1UCTA 3L3DA 3I6KB 1NDMB 4K55A 2X9YA 4YFEA 1IEBA 2E7LA 5EUOE 1RZKC 4GW4A 3VWKD 1IAIL 2B5IC 3ZDYE 4RWYL 5IBUG 4HJGB 1UCBH 4HWEH 4HLJA 1EHLL 2AVGA 3JTSA 4NZRH 4UDTB 2DQGL 1IBGL 4M9OA 4JO3L 4ONGL 5CBAB 1BEYH 3QZWA 2DD8H 4LSSL 5AWNH 1W0WB 3KPNB 3BGMA 4NBXB 2OXGA 3HNVH 1WWCA 2LFGA 2ICWJ 1KXTB 2C1PB 1ZVSA 2EZ0C 4QXTB 3VWKA 5L2KD 1JUFA 3IDXH 3RBGA 2PXYC 1MAKA 3ULSA 1Q38A 5EUOA 3AVEA 2J6EL 2VWEC 4PLJC 3SKNA 1I75A 5DXWA 3CPLA 2EDYA 3E3QC 3H42H 4CADA 4LASL 5E2UL 3MRFB 4FQLL 2R0WL 3FT3B 1F6LL 5FOJA 5C09E 1KB5A 5KW9H 4R96B 3AS3A 1MVFA 1GPOL 5C09D 5L2KA 2ICCA 4XB7A 5LAXA 4PV8A 1Z9SA 2Q7YA 4RGMC 4OZHE 3MNVA 1MCLA 5MP6L 1M6OA 2VDKL 3IFNH 1JWSB 3ZKMC 5H2BA 2XWBB 4XVJH 3V6OA 4L8SC 4LU5L 2R0ZH 2OSLB 4RMQA 2VQUA 4PTUA 1YN6B 3GSVB 2ZCHL 5C09A 1KJVB 3LKSA 3ULUC 4TVPL 5I73C 2D7OA 1WBZA 1IKFH 3GUTA 1XIWB 4GAYA 1G9ML 5ETUB 1NGXA 2VL5B 5ALBH 3RJQB 3IJSB 2HA1A 1JYXA 3GDBA 4HIJA 5D7IE 4GSDH 4IDLA 1KN2H 5K9QG 3IFPA 2FX7L 4E9LA 4CRPA 3QBTB 3WS6A 5HDLA 4ZNEE 4KKBC 4WNQB 4X7TA 1CFSA 4KPHL 5E6ID 4J3SA 4CN1A 5GJSH 1JGDA 3MUGB 3B43A 3K1KC 1RJYA 5F21B 3S37H 3TBSA 3G5VB 1CD1A 4GMTH 5GHWL 5E5RB 2JB6B 2CDFA 2Y07L 4X99A 5D1ZC 2MQ3A 4XNYH 5D7IA 3M07A 1FLTX 1MRFH 1P7QD 3MYZA 5IQ7H 4OD3H 4X6DB 4ZS6C 2H41A 3FMGH 5KSVA 5GGVH 5E6IA 3W0WE 4ZNEA 1UKSA 4X80L 4ZMAT 5EZJB 5KSBF 5I8OH 2VDLH 3N1FC 3UMTA 3ZTNH 2X4NA 4PJAF 2YSSA 3RWCA 1N6QH 3OHXA 3W0WD 5DLMH 4Y2DC 2DLTA 4P4KB 1CBVH 1IZKA 1OARL 5MEOA 3SOBL 2UVEA 1UXWA 2FBJH 2ICWB 4QXUH 2VXSL 1P7QA 3MMEB 4JLRB 3CLEH 1NBYB 5E0QA 4HC1A 4YQXL 2NY4C 4P3DA 3I02A 1XF2A 2J4WH 5SWQB 1A7QH 5HDQL 3C5ZD 1P9MA 2JCCE 5DMKA 3W0WA 3G5YA 4KVNL 3GSNH 3OXSA 3DSNA 4R2GD 5F7HA 4OGAC 3RWDB 2P8PB 2GIYA 1DQQB 1UH4A 5CIPH 3V5DA 3P9WB 4M48H 1MUJB 1L6ZA 1SJVA 1X5XA 1LNUB 1QG3A 4G8GD 3CFKA 1U8QA 1KCUH 3C5ZA 6FABH 2R9HD 5KG9B 3WLWC 5GGRB 4D0BB 4QF1B 5HYSA 4CW1B 1A7RH 3BAEH 1ITBB 4LIQH 4RMVA 5K59F 5EZLA 1OTTD 1GGIH 3P73B 3WEXA 4G8GA 1WBYB 5JOEA 4BUGA 3O6LH 3BH8A 3D0VB 5ABDE 4WRLA 3BVNB 1AY1L 4Y89A 3ZKSD 2BX5A 3MBEC 2GJZB 3OZ9L 3T0EB 4Q9QH 3B3IA 1E27A 5D1XB 2R0LL 3GK8H 4W4OC 2P7TB 5FM5O 2M2DA 2H2SD 3RNKA 4JQVC 2JK5B 4HUVB 3OQ3B 3SY0B 2CXGA 2B0SH 4ZFZB 5H8DA 2VLLA 4LVHB 4CVUA 5JZ7C 1EO8L 1NUDA 2R15A 5SV4A 1VA9A 5E8EB 4RMUA 5IVXB 1DQJB 5BS0E 1F4XH 2BOBA 4QRQB 2OL3L 5T3XE 1QBLL 4QEGA 2YK1H 5BS0D 1NGYA 5T3XD 3H3BC 1BQLH 1U3YA 2VXVL 4Y2OA 1N59B 1NCCL 5SX5H 5GGTL 1NSNL 1NLDL 2Q76B 1MAJA 3ARSA 2BVOB 1P1ZB 4KJPD 3GIVB 1Q9OB 1NFIA 5I74C 4HIXL 5BJTA 1I85C 1TQBC 1OTSD 1T83A 5DJ2A 4XNUL 1GVIA 3KPOB 5BS0A 1ZGLA 1MFAH 4X83A 1PY9A 5E8PA 1EXUA 1UZ8B 3HZVB 4MHHI 4HBCH 3I85A 4GAFB 2G75B 2GT9A 1JNNL 2JJSA 3GHEL 3QULA 3U7YL 1UC6A 2LU7A 4N8VA 1GGYA 1UWGL 4I18A 5DJ6B 3MV01 5I1JL 4OD1H 4Y8AA 1IM3A 1LO0H 1ZHNA 4HH9A 1TVHA 4IRJD 2A6KA 4OUUA 2WUBH 3NPSB 4LP5A 3QO1A 4NOFA 4NZUH 4L4VE 1LE5B 3ULVH 1JPST 1DUZA 1VFAA 1T4KA 4HWZA 4L4VD 3MRIB 1DVFD 1FRGH 2C1OB 5DGRA 3SDDD 4FXGB 5TF0A 5IB3B 2F19H 4MCZA 1ACYH 2W0FA 3QCTL 4I3GA 2MHAA 3I50L 1IC5L 4OLVL 3V5KB 4OAWA 4J4PC 1DEEB 4IRJA 4MVBC 5AUMB 1N4XH 3U0PB 2A73A 2FGWL 5IFHH 3GJFH 4X5WB 4UU9B 2R2BB 3IJHB 3F7PC 1WBXA 4L4VA 4ONGH 1DVFA 3H0TB 3SDDA 3EAKA 1AXIB 4LAQH 3HC0A 1NAML 1EHNA 3KYAA 4F7MA 3HE6D 3CFDB 1HKLL 5DJZB 2CRYA 3FQNA 3GMRA 2A1WH 2DQEH 5IBUB 3ILPB 4N5UA 4NN7B 3E2HC 1QSEB 1A5FL 4EDXB 3J7HA 2H32H 1KJ2B 2OZ4L 4AY0A 3P0YH 2GEEA 1D6EA 5DUPL 3GGWB 2B1AL 3EHBD 4AM0A 5CGTA 3BIBX 4RQQB 3DHJA 3HE6A 4NQDE 1YMHA 3UTQA 4PJEA 1OY3B 3TN0B 4G7VL 1BOGA 2CUIA 1IARB 3CFJB 1T1YA 1PGRB 5BZDB 1IEAB 1CXKA 1RD6A 2W0PA 3ZDXF 2V7HA 4Z0XA 1EFXB 3O3BB 3QA3A 3FOMB 4GKOA 2ATKB 4M8VA 8CGTA 2KUTA 4OM0H 2VDKH 5EO1B 5FXCH 1FNLA 3BPNB 1TJGL 4J2XA 1BFVH 2ZCHH 3EOTL 5DHVH 3SDCC 2A6JB 2FR4B 3MRGB 1TNMA 4XBGB 4LNRA 4MJ4A 2EO9A 2EDNA 1WAAE 1PX4A 1AGEA 4I1NB 1MHEB 3UDWA 5ICYB 4HK0A 1LEKB 3BKYH 2DQDL 1AD0A 3HKFA 3Q3GA 1KJMB 1X6NA 3RKDC 1CE1H 1W0VA 4MNQB 3VFWA 1DLFL 5C07B 5JW3H 3AXLB 3DRTA 3KPQB 5ECJE 1TZHB 3LV3A 3VXTB 3CFIC 4TSBL 1AQKL 4G8EB 2NW2A 3RVVD 4M62L 1WAAA 4K3EH 4LPUA 4HV8B 3RVXC 3EYOB 3U1SH 1T22A 1F6FB 1H3VA 3G5ZB 3QUKA 4FQIH 4F3FB 5CFHA 1GYAA 3O6FB 4KI5F 4ENEC 3BJ91 3FCTB 1OGAB 4WO4D 5EIVA 1U58B 2FO4B 2GAZB 4DJMA 3ARDB 2WLZA 3GMLB 5ANMB 1EDQA 1CLZL 5HYSG 3RWHB 1OARH 1IQDB 4JN2B 3HMXA 1UADC 1NL0H 1RU9L 5IB5A 2IFFH 1ZVHA 1UWXK 3LQAC 3UZEA 1HH9B 4FHBD 1K5NA 4PYGA 4GXVL 5D5MF 4HMEA 4G6KL 3MNWB 2VLJB 1RULH 4WO4A 4N0CC 4X9IA 3UTZA 5HDQH 2EE3A 1XGTB 4FQ2H 1UENA 1BECA 3SO3C 5IEKA 1VADB 3I6KA 1FNFA 5DYOA 1XGRA 4K9EH 1NDMA 4RGNB 4O5LH 2A9NL 2AKRA 1DL7H 4LMQE 3DECA 5F7NC 2G5BA 5E2JA 3K1DA 4YC2B 4F7TB 4UDTA 3BEVB 1UJTA 2ENSA 4XTRD 5J89A 4HXBH 4MNGA 2Q86A 4PJHB 4PJ9B 4MX7A 3TCLA 4JPWL 5CCKH 4G6JH 1YEIL 2YPLD 4KK6D 2XZAL 2H1PH 3VXQA 2F5AH 2CLZB 1DANT 1X4ZA 1P4LA 5E99H 3JWOC 1AI1L 2CR3A 4BH7B 1BHGA 2JIXB 1BZQK 1S5HB 1Z9LA 3GHBH 4V2BA 2I5YH 1YEHL 5IESH 1C8PA 2PW2B 3FT3A 1U3ZA 3PGDA 3G08A 1T21A 4JRYD 5JTWA 2YPLA 2UUDH 4YZFF 1TZGL 1OT2A 2D9QB 5F7EH 2EXYD 1IL1B 1TJIL 4JQXC 5T1DL 1SBBA 3QI9B 4JFQB 3ZT5A 3VXRE 3GMMB 4XP4L 1QSVA 2IBBA 4MQTB 4U6YB 1JWSA 3TVMC 2V7NB 2VIRB 2VDQL 3VXRD 1TXKA 3NIFE 4UQ3A 1XCQA 2OL3H 1MREH 4ZUTA 4JRYA 3VE0A 1B2WL 3BGFC 2WWKO 2W91A 3GSVA 1A2YA 1UXSA 2DQTH 4LLWA 4Z7QF 5C0IA 3GSUA 3JV6B 5SWSA 3SKOB 2DTMH 1X5LA 4JB9H 3TEUA 3PIQA 5ETUA 4IMLB 3IJSA 2HG5B 1S7VA 3VXRA 4X6DE 4OZIF 1R0AH 1KTDA 1QD0A 4AG4L 3DYOA 2KL6A 4P0DA 1G6VK 4HXAL 4BUHA 4FFWD 3VFOA 5TPWH 5JXEC 5EOCH 3L95A 1JNNH 3BN3B 5I9QC 5L8LB 1XF5A 2BNQB 3WL9B 3W9DA 5J3HD 4CMMB 1XGPB 2XTJC 1U8JB 3RX7A 1SEQL 4LEXH 3KVQA 1CZ8L 2ZKHL 4EI5D 2NY0C 3WSQH 2EDDA 4YDIL 2FSEB 3T1WA 3P4LA 5B4MD 2ZG2A 4G80A 3IRZA 4PR5A 1BZ9B 1J1OH 1OCWL 3SDYL 1I9IH 5GSVA 5EB9A 1I4FB 3VFTA 3MMEA 3QPQD 4D0DA 4GQ9L 4DUWA 4JLRA 3QDGD 4ELMB 3I50H 3IDMB 2YOCA 5I17B 3WNMA 4EI5A 5C8JB 1Z0MA 5FYLE 1DLHA 1IAOB 4XT1C 3MLPA 4X5LA 4P3CH 1RIHL 4BQCA 4DVBA 4HBQA 5IIEA 5FYLD 1I3RB 2XKUA 4ODUA 1U42A 4K7PH 1BFSA 4R4NC 5TH2B 2NY6B 1FDLH 4JG1L 4G7YL 1NAMB 3QDGA 4XWOD 2FL5A 1AD9A 1VENA 3MGOA 1V7MH 1ORQB 3MCG1 3S36H 3HUJF 1FNAA 3R0MA 3V9FA 1R3LB 3BYTA 1EJOL 3Q1SH 3UTSB 3T0DA 2OK0H 4QRTB 5IK3A 4D0BA 3L3KB 3AS1A 1HHIA 1GC1L 1OAXL 5FF6B 5CJ5A 1PG7L 3MOQA 2X42A 3T3ME 5JDJA 3MRCA 4EXPX 1V05A 4N0UB 3FO1A 4DGVL 3D0VA 1ONQA 2D4FA 4G7VH 3EDJA 1R3HB 5F3HA 4NKMB 5HGHB 5IVXE 5CINH 1LEGB 5HHPA 4X7CC 4XNMB 2X5PA 3M17A 5ISZB 3U0TA 4XHJD 1TTGA 3EOYG 1QSFE 1SJEB 4Z7UB 5HGDA 2VOTA 3SDAB 4QO1A 4GG8A 1HSBA 4AENA 4A2MA 1QSFD 5EO0B 3DMMD 3UYPA 3SY0A 3HG1E 5CEYA 2EEAA 4X4XA 3RBSA 5AZEH 3HG1D 3OBAA 4YHMH 4HFUL 5B3JE 4KK9D 4X8XA 2CIKA 3RWEA 4ALAH 2WAHA 5EU5B 3HRPA 2O5XH 2X4TB 3KJ4C 1RIVL 2LVCA 3C87A 4NKOB 3RL1B 1NMCB 4EI6B 1QSFA 2JB5L 1C5BL 3DMMA 1FH5H 2V2TB 2CIIB 2XWJB 2XA8H 4JKMA 1CLYH 3NZHH 1YEGL 4UT7H 3KYOB 4B0MM 1MVUB 3HG1A 3Q48A 4PRNB 4X4YA 2BRRH 1P1ZA 4P5TB 4RA0C 1FYHB 3LDBC 1WEJH 2K7QA 1UVQB 4LARH 5IVZB 5IB1A 5CSBA 4JZJC 4F2MB 1C12B 1AQKH 4U1NA 3KPOA 1JHLH 1HHKB 5FUZL 1WISA 2AV1A 5GS1A 2DM7A 2MCPH 4HIIB 4J3VA 2J8UF 1KPUB 4XPAL 1NFDE 4ORGB 3ZT6A 3P4OB 4HGMA 3CZFB 3H9SE 4KGLA 2WBJD 4ZUUA 25C8L 3UTOA 1RMFH 4ZPVA 2FJHB 3HPLB 4H0GA 4ERSL 3H9SD 2BVPA 5MI0C 1XR9A 2CD0A 1MEXL 4LLAA 1KSRA 1WSST 3O81A 4Y7MA 3OL2A 2XG5A 5LGHL 3EIFA 3G6DH 3TFKC 2OJZL 4J6RL 4OCSL 4X7EC 3DWTA 3G6JF 4GXVH 1S9VA 2WBJA 4DEPC 4XRCA 4M5ZL 4FZ8H 1NFDA 3W11C 1MFEL 4OBRA 4OF0A 32C2B 3H9SA 3MRIA 2C1OA 1BVKB 4WHYH 3WDJA 3SBWA 2P45B 2VQ1A 1AGDA 3B8YA 3BFOA 1DUYA 4KTDL 2A9NH 3LPWA 1I1FA 5IKCA 1RFDL 1QSEE 1PSKL 5BXFA 4X5WA 4QRRB 5CZXD 3QP3A 1A7OL 2R2BA 3GBNL 3IS1X 2Y5TB 3IJHA 2QBWA 2H2PC 1YPZF 5H35A 1KN4H 5DJZA 5HI5C 3V4PL 1BWMA 1HOCB 2XXCB 3VFMA 1BBJB 1TVDA 4FFVD 4TSCH 1MCRA 2A6IB 2NR6C 1XT5A 5CP7B 1Q9LB 5BOPA 1GAFL 4QRSA 1JF5A 3CLFL 3OB0K 1TJHL 1ZLVH 1G6RL 1EFXD 2H32A 2J6EA 4G6AD 3MRMB 1NC4D 4NQUA 2DQUH 4XPFL 2MKWA 3GMPA 2K3TA 3C60C 2OXHA 4AJ0A