1FG9C

3:1 complex of interferon-gamma receptor with interferon-gamma dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
210
Chain Sequence
VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTERFERON GAMMA
total genus 29
structure length 210
sequence length 213
chains with identical sequence D, E
ec nomenclature
pdb deposition date 2000-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C01
4MQXD 5AUMA 4MS8D 5A2LH 3DX7B 5KVGL 4WUKH 4WDIA 3VU2A 1XAUA 5ACZA 3HUJF 5D70H 5TQ0H 1HHIA 1UH4A 2WUBL 5CD5D 2AV7B 1L9NA 2XTLA 1Q9KA 2W0KA 3ET9F 1HNFA 4PJEA 4WFGD 4ORZC 1GGIL 3D39E 2E6JA 7FABH 2AQ3A 1KLGB 2DDQL 3I9GH 1UYWL 1KC5H 3LPGA 2VTFA 4ODUA 1ES0A 3TO2A 1I7TA 4D2NA 1JF1A 4Y5XB 3KPPA 2YPKA 1KB9K 1E28A 4TPRL 4Z8FH 3ARVA 1G6VK 1DLFL 1IM3A 4PJ5D 3O11B 4U49A 3F7PC 1HHKB 1GOFA 2NYYD 3DX8A 4YJZL 4PLNC 4QOKB 3MRPB 3OKOB 4YK4B 4RIRA 5JOPE 1K4DA 1EHLL 5TGBA 1ZA6B 1AGDA 1NEZA 3RWCA 4RNRA 2IPKA 2CXGA 2GITA 1HIML 4ZNEE 4RGMB 2F53B 2APXA 4G6JL 4UB0H 2H2SD 4M7ZB 1A3LL 5J11B 3D2UB 2WUCL 3EOAB 1FFOB 2W65B 3VMOA 3IRZA 1WQVT 2I26N 3SE8H 1I75A 2D31B 2Z4QB 4K3GA 2Q7NA 5IQ7H 4HPYL 5F9OL 3OKKA 2ICES 1WWWX 3L3GB 3RHWF 4GXUN 3LKSB 2NY5L 1XGPA 4XC1H 1AQDA 5J57B 4HT1L 1P4BL 1QFWL 4OJFL 4W68A 2JCCE 3Q0HA 1RIHL 1CN4A 4V1DD 3KPQA 3C2AH 3GJFH 4JANA 4PV8B 2NY1C 2EZ0C 2H6PA 4M5ZL 1JNJA 1YUHA 1FYHB 3DX9A 3I3BA 3UTSB 3VH8G 2Z4QA 3AM8C 1CL7L 5T3ZH 2JJTA 1P1ZA 1HEZB 3L3OB 2JIXD 4JPVL 1NGWB 4OD2B 4HV8A 2C3XA 2R4SL 4AIXA 4P2YA 1NAMA 3C5SA 2QJDA 4WW1B 2IH3A 3MRCA 1YEHL 2B8OT 4X9GA 4V1DB 5DSCA 2MPAH 3CFCL 3NGBB 1T03H 4XP1L 3EFDH 4UBDC 3F5WB 3KPRD 5F7LB 3WNNA 2HT4C 1TITA 4JHAL 3IJHA 3PWPD 1WBXA 3GHBH 3DMMA 4ZS6D 4DCQB 3NZ8A 4KMTH 1GJIA 5DQ9A 3GHEH 1CLZL 5FF6B 1BVLA 2XA8L 4RA0C 1JK8A 1KPUA 1MOEA 2G75B 2VZVA 4WWKC 1P53A 2AVGA 5DXWA 4YBHA 5LCVL 3X11A 1I7UA 3IDJB 1A7BA 3ALWA 1CICA 2XTJC 1IGCL 4NWUH 4BQCA 5I76B 4ALAH 2AV1B 4UIKH 5DGQA 1NGXB 1KSRA 3OG6B 4G8EA 1YYMH 4FXLA 3THMH 3VFGL 4QXUH 5BMFH 4JKPH 5EO0B 3MUY1 4MA8L 3UJIH 5K9JH 2FH6A 4OLXH 1F11B 4MJIB 3L3HB 4U1MA 4F7CA 1WBZB 2DQTL 1MHHB 4JFEA 5FFLA 3VFGH 1SYSB 3QPQD 2CUHA 2Q7YA 5JMRA 3IXAA 4HAGA 2X70A 3K0WA 2NMSA 1BMGA 3CSBA 5E8OA 3QNXB 3ILPA 5IHUL 5C08B 3HPJB 3WKNA 5EPMB 2A6KA 1ADQA 5LGJB 1NBVL 1IGCH 1KELH 2AQ2A 2O5ZL 3LPWA 1BVLB 2HJFA 4JM4H 4OZHE 3JZ7A 4Q6IB 3GSVB 1BAFH 4JPKH 3W9DA 5E2TL 3GSNA 3FQXB 1VEMA 3FN0L 4NNYB 4PJBA 3P73B 4HWEH 4GLRH 2V2XA 3DVNB 3FT2A 1LEKB 4I9WD 5AAMA 1F90L 1OGTA 3OJDA 4DN4H 1T0NA 5I66B 1QR1B 2OI9C 3MO1B 3VI3F 1NAMB 1WCQA 5JTWA 4XP1H 4S1QH 4P99A 5KAQF 1U2CA 3WFHA 5FCUH 3NTCL 2D4FA 2R4SH 1TIUA 3CFJB 3EDJA 1HHJA 4JCLA 4EQ2A 5HGBA 4Y2OA 1SYSA 4MNQA 1KB9J 3E3QC 3UZVB 1X7QB 4MNQE 1NL0L 1H8SA 2EC9T 3HC0B 3U36B 4TVSa 2H2PC 3MO1A 4EXPX 3CFBA 2VABA 4LCCB 3WIFA 2V5YA 1I1YB 1T4KB 2IAND 1RIHH 2P8LA 2PYEA 3EKCA 1INEH 3QO1B 5FHBH 3AXLB 4M9OA 4XC1L 3MROA 3HA0A 1F42A 1AKJB 4XPBH 1RZFL 1MCSA 7CGTA 5I71C 1S5IH 1NCTA 3MLZH 1NC2A 5E8NA 3G6AB 5IMKB 1UH3A 5DA4A 2EH8L 4HIXL 3QNZB 4I13B 1FVDA 3DXAD 2X1PA 3OAZH 4XVTL 4KUZH 3TT1L 1MHHA 4JFEB 1QLRB 4FQPA 2AERT 4QRRE 1HIMH 1S7VA 1T21A 1IZKA 2H32H 2R0ZL 2R0ZH 1EFXB 4UQ2B 1KBGH 3QB7C 5KSUB 3TA3C 1X5ZA 4K3HA 2YA2A 5C07D 1K8IB 4OUUA 1FAKT 3CVHL 1OSPL 4LEXH 1BOGB 4Q9RH 2ADGB 2IFFL 4IOIB 5L9DL 3IXTA 2O5XL 2DMCA 5E8EB 3IETA 3MUGA 4Z7OF 3V0WL 4F57L 2CH8A 5D7KD 4FXKA 4M5YH 1GGTA 2C4FU 2KQNA 4H1LG 2QHRL 3VWKC 3DLQR 1H15A 3WEXB 4ZXBC 5HYQA 1NGYA 3O9WB 1OLLA 3I9GL 3TO4A 5DQ9B 5CEXB 1S3KH 3QWQB 4IHOA 3BYTA 4LSSL 4DOHE 1JGVL 4DEPB 1IAOB 3VRLE 2G60L 3DIFA 1M4KA 4I5BB 3BGMB 2OSLA 4PJ7E 3GB7A 3FN9A 3VD7A 1OF2B 3O3EB 1UKQA 1T0PB 5IIEB 4YAQA 3RY6A 1R3IL 1WBYB 2CDFA 5FM4A 1LWRA 3HC0A 3QA3B 4OV5A 4HG4K 4H25A 3HRZB 1WIOA 3REVA 4Z5RA 3VWJC 2Y9RT 4PJCA 1OAUL 1EDQA 3DX9B 1YEGL 2AXHA 4Z7WE 3BGMA 3TIEA 1PJ9A 1S78C 1FNSH 1ND0B 5DHYB 4S1RH 1HZHL 3MOAL 5TE6H 2WNGA 5GISH 1B6DA 4B53A 5I1CL 3T0ED 4M61B 1CG9A 1V05A 3DTXA 3E8UL 5E2TH 4HKJB 4QTHA 3RGVB 2JB5L 5F93C 5D8JH 4UINL 2JJSC 3LN4A 2FJGA 1CFVH 3H8NA 1UM5L 3WJLC 4OGXH 4F2MB 4MCZA 1NUFA 3BQUC 1B9ZA 4TSCL 1J86A 4AEFA 2Z9TA 3CUPB 4Z7WF 5KJRH 4J3UA 2CRMA 1FPTL 3MODH 1UWGL 2W9LA 4OZFB 4PJEF 4JJ5B 2BHYA 4OTXH 4RNRB 4QHKJ 4LOUD 1UB6B 2BSTB 1WISA 3MGTA 3MNVA 4MZ3A 4OGAC 5ESQA 5TQ2L 3VFOA 1JUFB 1XIWD 2V5MA 3S4SA 1QLEH 4WDIB 3V52L 4WHCA 4G6FD 1QSEA 2DBJA 2J12B 5DJXB 5FYKE 1DANT 1I9RL 2J8UA 3BISA 3NCCB 2DYPB 1RY7B 4AT6B 3IKCB 1F3DJ 1N6QH 5EU7E 3BT2H 3ZT5A 2ARJQ 1G7JA 2C1OA 3QIUD 2AJSL 3AMLA 1ZSDB 3BIBX 4PRNA 3SDYH 3VXNB 1LD9A 4W6WB 4N8CL 4H8WL 5GGTA 4W6XB 3LB6D 3LQAH 3QRGH 4JHAH 1DR9A 3NFPA 5C3TA 3TJHD 3B2VH 2QQLH 3CJJA 4GT7A 5B38A 3T1WA 3B9KC 1DQJB 4MNQB 1J1XH 4P46B 1ZLWH 2UV3A 5CJXC 1QNZH 1ZGLM 1V7NH 5DHVH 4KQ4L 1TZGL 3QEUA 4KK5D 1OWWA 1REIA 3MRFB 1FQ9C 3UYRH 4OKVA 3IDUA 3L3DA 3I6LD 5FGBC 4NDMA 3HNTL 1WBYA 3BIKB 5DK2B 4M5ZH 4JAMA 4QXTA 3LEXB 5DHXB 2D7TL 3ILQC 4OF8A 5CMAA 4JJHA 3PP4H 3TA3D 4CGTA 4P2RD 5SWZB 4KKAC 1RUMH 5F7MC 3KPRA 1IC4L 4HKBA 1NMAH 3WFBL 2ADIA 2HVKA 5T1DL 2E7LA 4NBXB 4YO0B 4HF5H 2KZ1B 4CJ0A 4JLRA 4DQOL 4UAOB 4RZCA 1V5JA 3VXOA 2OL3A 4O58L 1ZS8A 1NAML 4Z7NE 2IADB 3TH2T 1AR1C 4X4ME 3UTTB 4CMMA 1FRGL 4GBXA 2VZTA 5H35B 1I1RA 5DJ8B 3RIFK 4PLOB 2ESVD 3BRFA 1SEQL 1HYRC 2C1PB 4OD3L 1YEKL 1DQDL 3JBG7 4NQEB 1HH6A 2GSIA 2PW2B 1D6EA 4PJCE 4NQCD 1ED3B 1NDMB 5E6IA 2BY1A 2XY2A 4JHBA 5JHDB 4ODXA 3U79A 1JWMB 1K6QL 1UYWH 1QBLH 4ZUWB 1HNGA 3MJ6A 4QGYA 4APQC 3MV8D 4F7CB 1NGQL 4FZ8L 1DEEB 3DV6A 2X4RA 4JRYA 4BSVB 4YBLC 5KSBE 3QIUB 5F96L 3ARFD 4N0YL 3AY4C 3E2HC 3KS0J 1JMXA 2D0FA 2XTJE 1ITBB 2YHGA 4O9HH 3OG4B 5HGAA 1Q9OA 4Y1AE 3HAEA 3AY4A 1CQYA 3L5WB 1KENL 4PBVC 2CO7B 1ZWIA 4WW2A 1A5FL 3DRTB 2D03L 2A2QT 1EZVX 2ATKB 3MLVL 1T2QL 1CF8H 3LHPH 1A6UL 1AHWA 4UZGA 4YDIH 5DEGB 5SV4A 2GKIA 3DNKA 5A3ID 1UADC 2D9QB 5DJZA 2IJ0C 4TOYH 4N0UB 4Y2DC 1ACYH 3N85L 1P84K 5LWYH 2VDMH 5IB2B 3BQUB 4U1JA 1MRFL 5C0GA 5C6TH 5CEYB 3C5ZC 4OZHA 1I9IL 1GHFL 4MJ4A 3UPCA 4ZFGH 2BVOB 1OGAE 1DBAL 3SY0A 3MJ8A 2BJML 2V17L 5I9QB 1NGWA 4OD2A 3TT3L 3L5JA 1WT5A 4YBQC 1B4JL 3GSWB 3RI5K 3F7YB 3ZSTA 3CPLB 1VA9A 4JFPA 2AABL 2BFVL 4J6RL 4IIQB 3M1BA 1NKRA 4PR5A 3H9SE 3VD4A 1WBZA 3UC0L 1TNNA 1C5BH 5EBMA 4PP1D 2OTWA 5KVEL 3SDXA 1EEZB 3LD8C 4M7KL 1VPOH 4PG2A 3EZ8A 3W39B 2NY2D 1PGRB 3GMQA 5C0FB 1WFTA 4ZUVB 4WI3A 3C6LB 1T6VN 2EICA 2R4RL 2AXGB 3MUHL 3MLPA 1A6WL 1Z5LA 3NA4A 4X80L 5HYFA 4JZOB 1A0QH 1QACA 1ROWA 3MRJA 3O3UN 3L3IB 4TVPD 5HGDA 1I85C 1GZPB 3O6LH 1KJ3L 3WCYA 3V5HA 2VXQH 1N5YH 1A7OH 4C83B 1MFBH 1BEYH 3PABB 3RPIB 5SV3A 1NGZB 5CSZB 1T1YA 4P4KD 4R3SA 2X9WA 1R5IB 3EOYG 4DZBA 5IHZA 3C08L 2Y36H 3VI4F 3S7GA 2CIIB 1G7QA 3N06B 4EN3B 5I1LB 4YE4L 1ZA3A 3MLSL 3U7YH 4JQVC 4JPIB 2BHZA 4LEOB 12E8H 3CUPA 3EYOB 1R3KA 3C60D 4LNRB 1FDLL 1JPSH 1RPQA 3QO0A 2FATH 1J8KA 2VDRH 1JI2A 5B3JE 3RKDC 2YD1A 2PNDA 4KK6C 1YYLL 1A22B 4RRPA 1CVSC 1ZHNB 5IVNA 3DYPA 1IGYA 4EVNA 1QO3B 3QFJA 2C7UB 5JW4R 2DWDA 3LIZL 5FYLE 4XBEH 4OFPA 1A6AB 5GZOD 4K94C 2VL4A 5MERA 1NC4B 2OR9L 1HYSD 5A2KH 3BWUC 1AXSA 2YPVH 2DQJL 3KXFD 4BZ2L 4K7PH 3P4NA 2VMFA 3ZDZE 4QXTB 1AQKL 1CFQA 2VLKA 3U0WL 3ARDD 3REWA 2B2XH 4XI5D 3VDCA 2A77H 4LLWB 3RL2B 2VQ1B 4XPFH 1IKFH 3G6DH 1JPFB 4MD0A 4UT6H 2AS5M 1MCWW 3FO0L 4LEOA 3S35L 1UGNA 5KTEH 5D7SH 1OM3L 2FL5B 3HR5B 2ITDA 1IAIM 2YPLA 1VADA 4L3EB 3SKMB 4G43A 4MDIA 1MQKL 1FIGH 5FAAA 2VISA 5FKPA 1S7QB 5KSAD 5GS1B 1WTLA 1BLNB 1U92B 2CKBL 4EVNB 2APWA 3EYQD 4FABH 1TPXC 1S8DA 3T4AB 3TFKC 3ZE0E 4U1LB 1NUNB 5T5NF 2JELL 1JBJA 4LQFL 1K2DB 2GY7B 3MRGB 3SPVB 4LDEB 4J3VA 3V4PL 3WJJA 1PKOA 5ESAA 1DCLA 4K3EL 4X6CB 3IDMA 1ONQB 2BVQA 3VI3E 4YH6A 4JPIA 2F5AL 1T5XA 4TNWF 4XWOD 5IESL 3L1OL 1I1AA 3WIIH 3QHZL 3P0GB 5FYLD 5I8OH 1HHHB 1JL8A 4P4RA 4WENB 3MLRL 1MJUH 5FA3B 4G6FB 1SJVA 3PV6A 4K7PX 2OK0L 4FS0A 2F5AH 4U1KB 5HHME 4JFOB 4KMLB 5IVOA 1D5BB 4ZS7L 4Z0XB 4P57A 3U48A 1MFAL 4PJCB 4ZUWA 3QNZA 4HFWA 4KHTH 1LNUA 3OXSB 1Y0LA 4PJ8C 5D7JD 1NH6A 3GSQB 1RIUH 4V1DE 1QLFA 1P7KB 1A6TB 1EO5A 4K3DH 4NO0A 2NY7L 5CZVH 3TO4C 5D9SA 4FTVD 1BD2B 4YWGH 1RULH 3S5LB 5BV7H 2ZJSL 3AREC 1OCWL 3VGEA 5T5NG 4JY5H 1MLBB 3ZDXE 5I18H 1CLYL 2P48B 2Z92B 4GKSA 2ZCKH 4MQ7B 2H2SC 3JWOH 1P9MA 4JO1L 3KHOA 3GJFA 5AEAA 5T1KB 2NY2C 4K9EH 2VXUH 4Y88A 5HHXL 3UP1A 5C08D 3DUSA 3MLTB 3QQ4A 5I1GH 2WIIB 1KLUB 4L8BB 1R5VA 3KR3H 4WHTA 2ZG3A 1KB5B 5IFJA 1KCVH 2COQA 4KI5F 4PJFB 4R26H 1J0HA 4PR5B 4G9FD 3UTQB 5JIIA 4XPFL 4JPWH 4KTEL 1MREL 3O4LE 3BZEB 2EC9U 3QG6B 2BSRA 2NY5C 4OZ4A 5CILL 3C6LC 3L3KA 4HFUH 3K74B 3ZTNL 4HF5L 1UWEL 3UZQA 2OR9H 1WJ3A 3F7RA 5FGCB 4BSWB 3MRNB 4OLVL 1MIML 4FTVB 1U0QA 3OJMB 4G42B 1CDGA 3P0VL 2F53E 2ARWA 2QHLA 4YDLC 1OTSD 3MV9A 3VW3H 5J6HB 1ZGLA 3RZCD 4LCUA 5ACMA 4ZDHB 3PWUA 5EFIB 3X13A 3TYFA 4RX4A 1W2KT 2DWEB 4OKVB 3SGDH 2NY0D 3O8XB 3GMOA 2JJWA 2FATL 5ADOH 5JLZB 2AP2A 4PRPE 5H37G 1ZLWK 3VGGA 4FXGB 3DYMA 4OKDA 3IF1B 4RFEA 1OAQH 4UV4L 1QFOA 2DS4A 4XXCC 1KN2L 2BNQB 2XYCA 3WNMA 4YBLB 1Z9SA 2ZCHH 4FQ2H 1Z3GH 5GGRA 4TVPL 1IL1B 1KACB 2Y06L 4XXCA 4F8QA 3R1GL 3QFDA 4NWTH 2XTJD 5EO1B 3BZFA 4WVRA 2OP4L 4LSUH 3PDOA 4Z95H 1X44A 1IQDA 3SDYL 4UDTA 5I76A 1GIGH 1FLTX 4QRRA 5E9DB 3JWDL 1Q94B 1BVKB 3BKCH 2J5LB 2OJEB 3LKOB 5KW9H 1CU4L 4XNMA 4HIIA 4XVJL 5DT1L 1WWCA 1A14H 2YPLE 3PWUB 3G6JA 3B9VA 4PY7A 4XX1E 1T0NB 5GZND 1ZHLA 3GBNL 3GIZH 3MGOB 5C0BB 4AH2A 5C0JB 3QUYD 4NCC2 4M4RA 5C0CA 1UXSA 3KLHD 5KSAC 1FHGA 1QLEL 2AJZB 4PIRF 4WFGE 4J3SA 3MYJA 3EYQC 1IGJB 1YPZB 5D2NB 5KW9L 1Q0XH 3MLYH 3P9LB 4QTIL 2MCPL 3EDDA 4I0PC 4LASL 4HUUA 4TSCH 3GZKA 4WI8A 1GHFH 4YEEA 2Y06H 4JR9H 3P4MB 1CICC 4JKMA 4XWOC 4XNQB 1RQ5A 2XIDA 1SJEA 1TJHL 4Z9KB 3CSGA 3WNPA 2NTSP 3ECBA 3ZKND 1XF4B 4NCDA 3UAJD 2DD8L 4YK4C 5I1CH 5FUOH 1C5CH 3OV6A 3OKEA 3QDMB 4PJ8D 5TE4H 3QJFB 4Y4FD 3LEXA 1U3ZA 2OTUA 2Y7QB 3X3GH 4AENB 1JNHB 1PVHA 5C70A 2IGFH 5GJSL 4F7TA 3DMMD 5LBSL 5C2BH 1R0AL 4MQSB 1N4XL 1TVBA 5FKAB 5A16B 5FKPB 3EO0A 1NEUA 1AI1L 3LZFL 5DD6A 4AEHH 3NN8A 1UXWA 4P46A 4PY8J 3UJTL 3QIBA 1IJ9A 2Q20A 1E4WH 5DD1H 4TSAH 1VACB 5E5RB 1PYWB 5TDPA 2E8ZA 5CP3A 2AXFB 4S1DD 3HUJA 5BRZE 3IJSA 2GJ6B 3QI9D 5KVDL 4N8VB 2LU7A 3V5DB 5CZXD 3HI1A 3I02B 1N0XL 4G8EB 2NY1B 3CDGB 5DQJB 3RQ3A 4HKZB 4G8GD 4HPOL 4QRQB 1V8HA 3K81A 4L8CA 3QUZD 4CMHC 4PYGA 1ZVYA 4ZO8A 3WN5A 1I1CA 4G7YH 2H41A 4Y0GA 5I1GL 3KPQB 2GIYA 2ZCKL 1HINL 2ZUWA 5DFVD 3LRHA 3WFZA 3FB5A 3EOBB 3WSQL 2DQGL 1EFQA 1EHAA 1UQSB 3Q5OA 4ZXBD 3B6SB 4JEGB 4U3CA 4YDKH 4MD4B 2DQDH 5HVHB 1MNUH 1IAKA 2EH8H 3CVIL 1MCHA 5IROC 3QP3A 4LP5A 4ZQKA 2CKNA 3KWWA 2OR8A 5D93B 5E6ZA 3TBVB 2YWZA 3ZHLA 1FORH 1QYGL 5IHZB 5TGBB 3OKDA 2A6DB 5GS0L 3QEQA 3X14A 5I19L 4QXGL 3P9WB 2HFEA 2HJLA 1U8LA 2F58H 3P30H 4POZD 3VWJD 4D0DA 5KANG 1KEMH 2F5BH 5BO1L 2XXMB 4YHYB 2VOTA 3KHQA 2PXYC 4UILL 4G8IA 2XTJB 2Q86B 3GO1L 1NL0H 4JVUA 4NOBA 3Q3GB 1R5WB 1H5BB 3LKQB 2CKBH 3GM8A 2X4QB 4HW6A 4MAUH 4MJIA 4E41A 1QSEE 1T5WA 4NPYB 1GPOL 4NKOA 3ZE1F 3U4BL 5JZ7C 4ISVA 3NPSB 4W4OC 2JCCF 3QUYC 5E7BA 2VLRE 3ESVF 3RFZC 4AIZB 2D7MA 4OCRL 4WI9A 5E8DL 3VFSB 1KJ2B 2CK2A 2VL5B 4I9WE 4YHYC 1FL3A 5DD6B 2EC8A 4BELD 4JVPA 4A2MA 1OAKL 3QZWG 5BQ7A 1UENA 4I2XA 4PJ7A 5LKNA 2CUIA 4BZ2H 5J8OA 1A7PH 5EOCL 4JFQA 4KFZC 5EUKA 1RK1A 1T7ZA 3Q6GL 1WITA 1M05A 4RRPG 1F8TH 4I77H 5DJAB 3PDOB 4K8RC 4KJQD 1BWWA 3ZE1E 5C0GB 2DB8A 3MRIA 1CT8A 1GGBH 5BS0E 3DWTA 4LLUA 1T20B 5HVHC 4NQDB 5ENWB 4BKLB 4ZS6C 5I15H 5DRZB 2Z8WC 2DJ4A 3HMWL 2OMBA 1AD9A 3ROOB 1FO0A 3DRQA 3HFML 5D7JB 3SE3C 4IIQA 4NRYB 2EO9A 3OMZA 3F12A 4R2GB 3DO7A 5MENE 3BGFB 5IB4A 5AUMB 2ZCLL 2EXWC 3PXJA 3KJ4C 3GMLB 4UV7H 1MFCL 4EUPH 4L29B 2EIZA 1IEAA 1UCBH 2XZQL 3O2DA 3MRQA 5LCVH 5D8JL 2JB5H 1P69B 5FM5O 1TZIA 4YHZH 4ZFFB 3GMMA 2HLAB 2R69H 2OXGA 4APQA 1NCDL 1MSPA 4X98B 3RUGB 2VZ3A 4Y5VA 2VE6A 3I6GA 2X4NB 5JW4M 2ERJC 4GAYA 1XR8B 2EIZB 4LIQL 4Y4KD 3GSXA 3N50A 2AAVA 3F7VA 4NBZB 5DI8A 5JHDA 4ZO7A 3RUGE 5ID1A 1YEHH 2UYLB 1T7WA 3KJ4B 3JSSA 2JTDA 1J0YA 3NIDF 3W0WA 5DR5L 4LCCC 3UTPE 2Q76B 1E6JH 5E6ID 3IDIB 3KPOA 1WLHA 2PO6B 1CDJA 5ID0B 3OKOA 2PTUA 3L6FA 5EA0H 4JFFD 4M7KH 5DO2C 5KS9A 5B4MC 1T7XA 3EHBD 2WK2A 2G60H 4GMTL 1FGVL 3MMEB 1QPPA 3FFDA 2AEIT 2C26A 4LDLB 1E28B 3VFNA 1XCQA 5EBGA 3LS4L 2VDKH 4QXGH 1ORQB 1XF5A 3ME0A 1G9NL 3QR2A 4GXUM 4LRNH 2YBRA 3FQRA 3M17B 5F9OH 1IAMA 3JVGC 4N1CA 4J1UA 3ARWA 4RFOH 1DVFB 5JR1L 5BS0A 4OFYA 2G5BB 2V2TB 1RSFA 4QHMA 1PX3A 3HUJB 5SWZA 5LWYL 2E27L 5DJ2A 4WWKA 1F4WL 1EK3A 5B8CB 3EYUL 1LEIA 4LCIH 5DK3A 2BVEA 3QUXD 4KY1L 4QOKA 3ARDB 4C58B 5FYJE 5CHNA 5D2NC 1RIVL 2X10A 5AYUL 3TBTB 4NRZA 3W81A 3FO9A 5LAXA 1GRWA 1U8KA 4G7VH 1X5AA 5BV7C 3L3KB 4HIXH 3SDAB 1XGUB 3MRFA 2XZAL 1CGSL 4F9LC 3AB0C 2Z31C 5I17A 4WI6A 2FJHA 4EN3D 1Y18A 4PJFA 4U1IA 5DDHA 4IRSC 5F96H 1INEL 3ECBB 1CGTA 3SKOA 3AAZA 4P3DA 3CAFA 5HGGS 1GGIH 1AGCB 4DCQA 2E9IA 5I73B 5CIPA 4U2YA 3BP6A 5IW6B 2VAAB 3G5VA 3PNWA 4DUVA 4HBQA 5M95B 4NUJA 5I1HH 4UI2A 2I60L 2UWEF 3NZHH 2YA0A 2BSED 2I07B 4EIGB 5DD0H 3AB0B 5E08H 4M6AA 1G0XA 3UO1L 2J8UF 1NMCC 1IGJA 1DSFL 5LBSH 5C2BL 4GW4A 1VGEH 1JTTA 2FEEL 2IPKB 4RGMC 4XP4L 3SCMA 3TGXA 2DLGA 3VXSE 1PYWA 2DJSA 5TDPB 5C0CB 1F90H 5KBNC 3FN3A 3O3DB 4HGWB 4HS8L 4M93C 1NDGB 4ZUTA 5INDB 1AC6A 5GGQL 4OF3A 3KGRA 4C54A 4F7TB 4RWYL 4IRSA 3DSFH 3GJFK 1TJHH 2XZQH 3VRIA 4L9LC 1MCNA 1YNKH 4JDZB 2EDLA 4WGWB 2EXWD 5C8JA 1MWAA 3EYVA 5CKAA 1CD1B 3LRSA 5F1OB 2HKFH 1L7TL 4X0KA 1DQMH 1RUML 3QDGB 3I6KB 4XVUC 4MMXC 5IJKC 1S78D 3QUXA 3SQOH 1LE5B 1VDGA 2GJ6A 2UZXB 1QHOA 1X5YA 4IS6A 2ADJB 4MWFA 4PRIA 3BWAB 5DRNA 4WI4A 1WC7B 5CSBA 1DFBH 1KFAH 5ADPL 2X9YA 5LGHH 4G9FA 1FYTA 1FZOB 1HQRA 1T2XA 2DLFL 4FXGA 1EZVY 2AK1L 5BW7C 3IAPA 3VGAC 3SCMD 4UIKL 3GBNH 4FN0A 4HUXB 2DLHA 2HT4D 4QYOB 4JVWA 1A14L 5BVJA 1NJ9B 2IANA 3ARQA 2Z93B 3QHTC 4ZUUB 2UZIL 5IWLC 2D2OA 2YD9A 3CDGA 5DVKA 1IC5L 1U3HA 1WZLA 4OIBA 4Y5VC 3RL1B 4LOUC 4OGAD 3OKNA 1B0RA 4O00A 1A9BB 2DF3A 1LO4H 1NLBH 4P2OC 5J13B 3D0LB 4TVPE 3FTGB 4XCCL 1U95A 4NWTL 1NGPL 1IKNC 4N68A 1ZLSH 4NJ9H 3QBTB 2F53D 4JRYE 3TBWB 1S7SA 3IU4H 1NANI 1CK0L 3HLAA 2X9XA 2XXCB 1L7IH 4UAOC 2A1WH 3CPLA 4ZYKB 5I0DA 3VCLB 2DQIH 2FIRT 5HI3D 3LRGA 4GRWB 1BHGA 4WO4A 1F45A 4FNLH 4U1NB 2BOCA 5DHVB 3V6OA 1R5VB 5HBBA 1RV6X 4PJ5B 4JY4B 3ULUE 1ZA3B 2P5WA 3O3EA 4OZHB 4K94L 1BFVH 1EFXA 3S88L 1B3JA 3U83A 3IT8D 1P4BH 1QFWH 4JFYA 4RBPH 2YWYA 3FT3A 1Z2KA 1EEYB 3MV01 1MCQA 4MCYB 4DFHA 5BZWB 1QQDA 2HJFB 5ELIA 1YMHA 4CU7A 4OF0A 4IOFD 1L6ZA 3C09B 4Y89A 4KROB 1YEEH 5EU6B 3MBEC 4FXKB 4UINH 1YY9D 2B0SH 1U58A 1T04A 2HRPL 1JGEA 3T0VA 5CBEB 2JCCA 2NZIA 1WAAA 3FT3B 5D7JA 2VUOA 1G7MB 3MRKA 2ZUSA 4F37F 1D9KA 5GISL 2NW2A 2VDOH 4XNUL 3QXVA 4XP4H 3KR3L 3Q1SH 3QUYB 2DQEL 2M26A 4R2GC 1KGCD 4LAQL 1QRNE 4HWNA 1KJVB 4WJ5A 4PGBA 1KPVA 4PY7B 1INDL 2DKSA 3WDHA 1JWMA 5IJVA 4NC0B 2E6QA 1OGAB 3Q6FB 4HGMA 5I1HL 4KXZH 2X4TA 3H9YA 1LDPL 2X5PA 3E6HB 2VISB 2EIBA 1F4AA 1J8HA 2CSPA 2V2XB 3GFUA 5M94B 1RUQH 5T33L 2P7TA 1CXEA 2ZKHL 4XAKE 1WCBB 3N1QC 8FABB 1TTGA 3KYAA 2QHRH 2ENSA 2P4AB 4P59L 2HJKB 1MJUL 3TBSA 1AI1H 3V0WH 4F57H 2HKHH 2X4QA 4LLWA 3RL2A 5I1EL 5DJDA 2H3NA 2IPUG 4IIQC 1S7XA 1KJ2H 3TBYA 4KXZI 2B39A 3X3GL 4XVUD 2OJZL 1RIVH 3BWAA 4HHAA 5AYUH 3EAKA 2JELH 4QRPE 4PGEB 3LD8B 1NCAH 1BQHA 5CGTA 1EVUA 2R2CA 3NCYS 4M7LL 4OAWA 2WIIA 3K46A 5E00B 3F8UB 3ARSA 4Z7UB 4L4VD 4KKLD 3CVHB 4D0CA 3W11D 3KNBB 4GAJL 4F9PC 2XWBA 3ELAT 3RY5A 4MJ2A 4NQUA 5ALBL 4U1LA 5E2UL 2W65A 5E8PB 5EZJB 3BKYH 1JF5A 1K3IA 1SM3L 2GTZB 3LSOB 3HB3C 3QYCA 1D5XB 2WBKA 1H3UA 1FL5A 4S1SL 4ZUTB 4U05A 5INDA 4PBWD 5ITFA 4UT6L 5DGRA 4Q6YA 3BSZL 2MCPH 4HGWA 1HSAA 4JQXA 5F6IB 1BZ7B 1CXIA 1FGVH 4K94H 4KI1A 5D2LF 3VD9A 1AQKH 5FA3A 1RFDH 3UZEA 4P48A 4X5WB 3AS2A 3U6RB 5KSBB 3C5ZD 3TNNB 2JE8A 1LE5A 3H3KA 1G84A 1PG7H 1D9KB 2P24B 4EDWL 1YNTA 3DETD 4XBEL 1F3DH 3NTCH 3QDGA 2NY3C 4OGZA 4P5TA 3PL6C 4L8DB 3BDYL 1BJ1H 5HI3C 3MV8B 1B0WA 5J3HC 4M6NH 2IALB 5E4IA 3JV4B 4OGYL 1KIPA 1LO4L 1JGLH 1TCRA 1U8QA 1IC5H 4PY8I 4D0BA 4RSVA 2NXYB 2G2RA 4MDIB 3O9WD 3DMMB 5IJKA 3SDDB 3HNVL 1JIBA 3OAZK 4ELMB 2FLRT 2GW5A 1AFVH 4FFYL 4YHIB 1EHXA 5E5MA 4KQ3L 4FQ2L 1XFPA 3LCYA 5HHNA 5C0DA 4CDHA 1N26A 3C08H 1LK3L 4PJHE 4R7DA 4PJBF 5DK2A 3NMEA 4G5ZH 4KRMB 4D9LL 3HI6H 4RISH 1C08B 2AK4A 4EBQL 2XICA 5T3ZE 4ODSL 4WNQB 4N9GA 5IVZA 3WKMH 4NO2B 3DI3B 3H9HB 5E5MB 4LGPB 1NFDF 4RMQA 4YHIA 2WWMD 3FB8A 2Y5TA 4WUUB 4OBSA 4TSBH 5F89B 3HZKA 1A9EA 4NKMB 5E0QA 2IAMA 4FHBD 4HD9A 3MBEB 4XCYA 4NQDE 3RVTD 1HXMA 5C0AD 1H3VA 5EOCH 3MRJB 5KVEH 3O6FD 3SKUD 2FJHB 1SBSL 4KK9D 5JW3H 4AQ1B 6FABL 1MWAL 3QWOA 5FOJA 3FFCB 3RWHA 3SKJH 3GEWB 3TZVB 4KTEH 1OAKH 4X4YB 3STLA 1FFOA 5D7LB 2YMXL 1RHHA 5MEPA 3EBAA 5IOPB 2HT2C 2A73B 1G7LA 3TNNA 2I07A 4MNGE 3IJSB 4GAFB 1SVZA 5I1LA 2FIKA 1DE4A 2JK5A 4L3AA 2VIRB 4MB3A 4DGIL 3JV5A 4DGYH 1G7QB 2I9LB 4BZ1L 4GUPB 1NEZB 4I5BA 3RWCB 3EFDL 2GT9A 4HIHA 3VRJA 3DECA 3UO1H 4HK0A 3EO9H 4R4FL 2QQKL 2W0FA 3OR7B 1MAMH 1QG3A 4F9LA 5JPNA 2NXYC 2X4OA 3QDJA 3CSYB 4HIEB 3NZHL 4U1IB 5DDHB 3KPSA 5HGDB 5BV7L 2QADC 1EIBA 4KDTC 1GZQA 5EUOA 1GOGA 5ACLA 1FG2B 1UA6H 4YEFA 5DLMH 3U2SA 3LHPL 3MLVH 4FG6D 3SDCD 4D8PA 5IBTH 4MA1C 1XGUA 2D03H 4U31A 2AXGA 1DQLL 1E4XH 2DM2A 1XMWA 4DKEL 5H35A 3DI2B 1A7RL 2XT1B 3H0TB 5GS0H 5DUPL 5FDWA 3PL6A 5JOFB 3WIHH 1T1WB 1CS6A 2VERN 3CXDL 3G08B 3VMNA 4XPAH 5IK3B 5DUPH 5JDSA 4GSDL 1EBAA 3HZYB 1NEZG 1XF3B 3MSPA 4EUPG 4JFDE 3ARYA 3BKJL 2WAHA 4MHHG 3WHXA 4PJDB 4LQFH 1PLGH 1UA6L 1RUPL 4WRLA 3STZA 3TBSB 3WSQH 5HHPB 3IGAA 5TF1H 1UKTA 5JORB 4O4YL 5CEYA 2VH5H 2E27H 1NFIB 4PTTA 4KDVA 3VFVB 3CGTA 3PNWB 4XMKL 3B3IA 3FFDB 2X7LA 4Z7VF 1DQDH 4LCCA 1S7RB 3U0PB 3MRRB 1EV2E 3U30C 3G04B 1HXYB 1BWMA 4U1NA 1IEAB 3PL6D 2GFBA 2H45A 3D1MC 4ZUSB 2OJEA 4YXHH 3LS4H 1X6NA 3V9FA 1D6EB 3X3FH 1HHJB 5EZLA 3U82B 1Q72L 4CNIA 2AJVL 3ARFC 5CP7B 2X44D 3HZYA 2J5LC 4QNPF 2VC2L 5EO1A 5T5FL 1EH9A 4NNXA 2DQJH 1HXYA 1DN0B 3NFPB 1KLUA 4TSAL 1TVHB 3WFBH 5BVPL 1CFNB 1INQA 1T21B 3E1F1 1C7TA 2VAJA 1MRDL 1I8LC 3MR9B 2BK8A 1S7WA 4LCWD 3VFMA 5BS0D 1A6ZB 2NY4D 5CBEA 2AQ1A 3V4VH 5A3IC 1SY6L 4QHMB 1XT5A 4ODXB 4NQCE 1O0VA 5IKCA 1XR9B 4ODSH 2ICEA 4K71B 5I8EB 5B22A 4I2XE 1SJHB 4LIQE 2CDGB 5FK9A 4PJIF 2WSKA 3HAEH 1WSST 3QXAB 3VFMB 1UKSA 25C8L 3RU8L 1MAJA 4JFYB 3U9UA 3DRQB 3FMGL 1UCBL 4MSWA 1J1XL 5JXED 1FNGB 1BQHG 1JMZA 3R8QA 1CQKA 4LLYA 5GRJL 2Y23A 1EO8L 3P77B 1FJ1A 4EUPA 5J12C 3BPCA 5C2UB 4H8WH 1MIEH 1N5YL 5DS8B 4NN5C 3ZMRA 2YD3A 1ADQH 4R4BA 1MRCH 3T4AA 1I8KA 3DXAA 4JDVB 4L3ED 4S2SB 3FRUB 3U9PL 1A0QL 2J8OA 3WHE1 4G8GB 4HBCL 3HZVA 5IT2H 1M71A 3BP4B 5FYKL 5GS3A 1JNLH 3WYRA 1RU9L 1A6WH 1FO0L 3VXRE 3OR7A 2MKLC 2X4NA 4NOFA 5MHSE 1BZ9A 2CXKA 2HFEB 2LTQC 4P0DA 1A6VH 3RDTD 3CLEL 4HC1H 3U7WL 3GMPA 4Y4FB 2O61B 4DZ8B 1F3JA 2A38A 3V52H 3DURA 2CLZA 4NBYB 5IB5B 4FFZL 4LSDA 1DVFC 1WTGT 3MCKB 4XX1G 4U33A 2ZSVA 1I9JL 3HRZA 1WF5A 4NO5A 1OT2A 3F65A 3LEVL 4M7LT 3H42L 3U46A 3VJ6A 4RAHA 3HC4H 3P11L 3REWB 2R23B 1U8OB 5FGBA 2V17H 2BCKB 2HTKC 4Z78A 2DLEA 1FL6A 1ZT7A 4Q0XL 4R6UA 3HN3A 3FL7A 4TQEL 4RDQG 1UM5H 5DWUH 4CKVX 5FGRA 4MAUL 2J7LA 3B5HA 3BHBA 4OZFG 3U1SH 1IGIL 4X4ZA 4R0LC 2VDQH 4GKZB 2CDEB 3EZJB 2HTLC 1YMMD 4TOYL 2W9EL 4X0KB 4YDJA 4OQTL 4WTZA 5ESAB 3ULSA 4X6CE 5EIQA 2XY1A 1HZHH 4J3WA 2VLMD 1CF8L 4ODWB 2OJZH 4MAYD 1I85A 1F6FB 4M00A 4N0FA 4YHOH 3FT4B 4Y16D 1DLHB 3TWCL 4PRDA 1WEJL 5ICXA 3HPLA 4NZRH 2C3VB 2ITCA 3SGKA 5IMOB 4JFFA 4HUVB 5KSBA 5CHNB 2K9UA 2X2YA 3BKMH 2VXSH 5JIHA 4LPXA 4G43B 1JUFA 5BVPH 3DGGA 4W4NA 2NR6D 2AK4E 4K2UL 1M1SA 5GRUH 1FL6B 3OKYA 1U8NB 5TDNA 5JW5A 1PZUB 1DZBA 3OX8B 4HQQL 2ATPA 2ITCB 5LGKA 4HH9B 1LDPH 1QBLL 2AJYH 4ZAKA 3WNLA 2FD6L 4JO2H 1KTDB 4UT9H 3O2VH 4GW5B 5J1AB 3D69B 5GHWL 3ULSB 5JW4Q 4NM4H 1F3JB 3CVHA 3NIGE 4F7MB 3VXUB 1AIFB 2FEDD 4JE4B 4HS3B 1IT9H 3O4OC 4QCIB 2WM0A 5CEXA 2JJTC 1TLKA 3CFBB 3NAAH 3BZDA 1M71B 3O2VL 5JPMA 2PYFB 4PG2C 4IRJA 3V95A 4HPOH 5FO7B 2WIMA 2AJYL 3AFLA 4ZFOA 1DANU 5J89A 2NY7H 1J12A 4KU1A 1RUPH 5FKAA 1BGXL 4KTDH 5B3JF 3BEVB 1VGKB 4K8RL 2BY0A 5CJOH 4EOWL 2DAVA 4ZXBA 2B0SL 3SGEH 2IH1B 1WZ1L 4NKDA 1JI1A 4K55A 2ATPB 3NPSC 5D5MF 2IMMA 3EJZD 5C0BD 2EYTB 3BMWA 2D7PA 2W59A 3WIHL 1AGDB 4KRNA 1JZ6A 2P44B 1MJ7L 3GSNB 1IGTB 2GSGA 4XZUA 1E4XL 1ACZA 1GH7A 5B21A 1RZJC 3HS0A 2R56H 1HHKA 3NFSL 4J7RA 5J11C 3ARED 3QEGH 1KIPB 2GJ6E 4Q97A 4G8GA 4J1UB 4EZMA 3L3IA 1A3RL 4KUCF 2PYEE 3PUCA 4PJ9D 1KLFA 5J9PA 3S96A 1A4JB 1A8JH 1YA5A 5BXFA 2R8SL 4FABL 1P5VA 4JFEE 5CCKL 3EYFB 4HDIB 3SJVA 1CDBA 4LVEA 4XB7A 1E4KA 2A1WL 1R3JA 1L7IL 5L8JB 3MA7A 5AG9A 4LSRH 3T1FA 5A2IH 2HJKA 3EO9L 4EKXA 1C16A 5DWUL 1S9XA 1PAMA 5AAWA 4P9HH 1PDKA 1Q0YL 2GEEA 2H1PH 3AUVA 4NJ9L 3RDTC 2XG4A 3SDXB 4JRYB 3WUWA 3U4EA 1QZ1A 3EDKA 3S35H 1HKFA 3HZMB 3WBDA 4ORGB 5FECA 5GQBA 43CAB 1UZ6E 1EFXD 4HWUA 2UYLA 3GSWA 4CVXB 4JHWH 4FFWC 4OF6A 3HG1D 2EO1A 2YK1H 4HK3J 1KTLB 1FN4B 5CKGA 5DZOA 5E1AB 2ESVA 1BVKA 2NTFB 1CD9B 3QPQC 3O3BA 3CFIC 1CFTA 3QUZA 4HC1L 4P5KB 4GBXD 3HZMA 3RZCC 5LXGL 2EH7H 1JHTA 4MVBD 4XC3H 5ECJE 1Y6MR 5DJYB 4PJHA 4HWBH 5HYSB 1CU4H 5TQ2H 3L7FA 5M7QA 1S9VA 3V6FB 3T1FB 1GIGL 4POYA 5HDBF 3LMJL 4OZIA 4OZIE 3Q3GA 2OP4H 4D9LH 5ILTL 1YYML 1EAPB 1FG9C 5GRJH 43C9A 1JHLL 5TE7H 1L7TH 3CIQA 3RA7H 1QVOB 5CJ8A 3P9MB 2DRUA 3S34H 3WL9B 2Q8BL 4YE4H 5I16B 3C5JB 4RQQA 3SO5A 4PJ9A 3G04A 3VXUD 5JOFA 4DAGL 4MB4A 1QBMH 3D0LA 2HJLB 1P4IH 1ZK9A 1SY6A 4X5XA 4O2EB 5GGQH 4Z7VE 1CXFA 2AJZA 5FYJU 2XA8H 1FZKB 2IC2A 3AREA 1HDMB 1CGVA 4A6YH 4HS8H 3O6FB 3QEQE 1NCBL 4JKKA 4UUJB 2GK0B 4E42B 4ZOBA 3M45A 2PUQT 2C4FT 2HG5A 3NACL 5BVJB 4J12A 3O6LL 1N0LA 4PJ7F 5SWSD 5TH2A 1MQ8A 4N0RA 3HCVA 4HX1A 5FGSA 5JHDE 5C1MB 1LO2L 1MCIA 2YUVA 1HE7A 3OAUL 1X5XA 4U6YB 2LE9A 1EMTL 3W5NA 5FOBA 1FBIH 4JM2F 2ESVE 3IXAB 1CFSA 5C09A 1PG7L 3MRMB 5T1MB 5C71A 2YSSB 2VKXA 1P4LA 4QT5A 1BQSA 2F54E 4I1NB 3QFDB 4OCWL 4JY6A 1C5BL 5I66A 1YQ2A 2IBZX 4GS7C 3KPMA 3IDGA 4Y16A 4OIIH 4NNXB 1YQVH 1YN7B 2EDWA 1I9EA 4JPWL 3PWNA 4ZOAA 1CE1L 4Y4KC 2XACC 3HE6B 1KOAA 2NY5H 2B1HL 1CICB 3FAXA 4NQDD 3UTSA 1OARH 4HPYH 3ZKMD 2VN4A 4IM8A 1FCGA 1FYTD 3AU1A 3SE8L 4BYHA 3EJZC 5F3HA 3QAZC 1OAXH 5FYJL 1N3NA 1S5HA 4P2QA 1OSPH 3HS0B 4MCYA 3MRRA 1IBGH 4G7VL 1A3LH 1IAII 4L9DA 1ACYL 1CGYA 4XRCB 5EU6D 1JGUH 3L7EA 1YJDC 4PD4K 4L8SB 1ZT7B 1HHHA 4P4RB 1DQQA 5EUOF 2B7DT 4LCIL 1X5HA 4QHUB 4LPTA 5J6GB 1H3XA 3BKJH 2VSDA 4MXVF 5DMKA 2P5WD 3STLB 1UT9A 5KZCB 1C5DA 2YRZA 5ALCL 4GQ9H 2PR4H 2D0GA 5DD3L 1S7TB 3EGSB 4O9HL 1U9KA 1YUHB 2I25N 3IDJA 4ZFOB 5GRVL 5GIRA 3UBXI 4P59H 1T22B 4XAWH 1QFHA 2IPTL 3TPUA 4Y19D 3QH3A 1CCZA 1YNLL 2F15A 4N0YH 4X6DF 5CLTA 2DQUH 5D1XD 5FHBL 5FXCH 1B6UA 3DTXB 4LGRB 1WAAE 5IBTL 1RURH 7FABL 4KK8C 4OM0L 2YEZB 1PQZB 4X7SH 5D1QD 3BP4A 4L3EA 3D5OF 1HQ4B 3L5IA 1X3DA 1G7PA 3QIWA 4GW5A 5J1AA 2Z91B 5DUBB 4RGOL 5TQ0L 5JORA 1U6AH 1E6JL 1G6RA 3MV7E 4R7NB 2NXZB 4TNWK 1JPFA 3F58H 5DFVC 3QO0B 4EN3C 4PJDE 3KPRE 3PXHA 4R4FH 4PJXF 5ITBH 3CZFA 1HEZA 2BVTA 3L3OA 4JRXB 3U6RA 4IRSD 4M7ZC 4JGMA 1MJ8H 2Y4SA 3PWPB 2W0FB 5IFHL 1A47A 2BY3A 2VLRA 5D4QA 5F7FA 5I8CA 4F7PA 1A7NH 3NCFB 1UXSB 4DN3H 3DIFB 4S11A 3IFLL 3WS6A 5DURD 2VNCA 2DM4A 2X42A 1LEGB 2E6PA 3PQYA 1BAFL 2C3VA 3DROA 4GRMB 2MCG1 5D7IF 3LKOA 3KDMA 2BNRA 1YEEL 2GTWB 2DI9A 5IHBA 1I7TB 2LU4A 4UV7L 3MXWL 2WW8A 2DKMA 3P77A 2EDQA 4HH8A 4LQ1A 1S9YA 4JZJB 4HS6B 1QTYT 5DEZA 3V6ZA 1VCAA 1FFPA 1IAIH 5JOPD 2OYPA 2DQTH 4UDUB 5JHDD 2O26U 1FNGA 3TYGL 3FAWA 4JM2B 5I2IA 3RGVC 3SE4C 4PRBA 3BH9B 3QIUC 2MHAA 2VDRL 4N8VG 1R5IA 2HWZL 4RDQF 3BH8B 4DZBB 1F2XK 5DMIL 1T1ZA 5ICZA 5KOMC 4BFIB 3K2MC 5DC4B 4CDGC 4EBQH 2BCKA 2AI0L 1MI5E 4PJIA 2QADB 3NCYP 2BSSA 3RWFB 1M7IA 1A7QH 4HLZG 5GGSY 3NPZB 4JFFE 3MLSH 1DL7L 3QA3A 4KQ4H 4HXAH 5HDLA 1CK0H 5DRWA 5DVLA 2KL6A 4QHUA 3FONB 2MKWA 3MREA 3HNVH 4BQ9A 5K59E 1U42A 2GK0A 2X4RB 1B88A 2BNUB 2NXZC 3QRGL 2K3TA 3DSNA 1NLBL 4KMTL 3MMEA 4CU6A 4ZTPH 4FTVA 1OLZA 2SEBA 4FMKA 3L95A 4YIQB 2VABB 4I18A 3VRLF 2VXQL 2BERA 5KS9F 3D2UD 5DC9B 2ED9A 4FQQA 1T03L 2MPAL 3CFCH 1CXKA 1Y18B 4HHAB 4OF7A 4OFYD 1QRND 5C0IB 2FH8A 4G8FB 4NHUA 1HSBB 3ZYJA 3ULVC 1ZWIB 5HHMD 4R96A 1CL7H 5F7HA 4MNHA 4GS7B 4HEME 4F80A 1LGVA 2IANE 1R24B 2F8OA 5I1KH 1DFBL 4EEEA 3C2AL 4N8PA 1RZGB 4RGNC 4X5WA 3ARDA 3MLUL 4J6RH 4NNYA 4PJBB 3WS3A 3GSOB 4P5MA 4HUMB 5T1MA 4P5KA 2HFGL 3TT3H 1RUKL 3U2SB 4M6ML 4TRPL 2OL3H 5C09D 4ELMF 5EU6A 3HE6D 3O8XA 1AY1L 4RBPK 1KTLA 2HVKB 5C08E 5EO9B 3MV11 3IVKA 3ALPA 1K9TA 4AG4L 4XMLH 2IALA 2HYMA 3KPNB 2RAMA 3M17A 1RK0B 2NX5D 5H94B 4BQ6A 1HH6B 4YHPB 2FB4H 3N85H 4D9QE 1FNEB 3QQ9D 4YHNA 4N5ED 2J4WH 1PFCA 1T2JA 3VXQA 1HCFX 1FNHA 1UCTA 5CMAB 3R06B 3FQUB 4XB8A 5F9WB 2DQCH 4M7LH 4N9OB 4MLIA 5IVXF 3DV4A 3ULVL 2RJMA 4S1RL 2AEPH 4CMMB 4X7FC 5EO0A 4LK4A 2NNAA 3VG9B 3ZYZA 4Z7UE 3RDTB 5J06A 3IDIA 2AGJH 3MBXH 1FNEA 4LP4A 4U6XA 1DLFH 5BXFB 1J1PH 5EUKB 1NLDH 2CLVB 3BXNB 4P3CH 1I7ZA 2X4SB 3IJYA 3S97C 5ID1B 4MXVE 3O41B 1KCRL 4GMSH 3LDBB 4Y8AA 4RGOH 2ADIB 1PQZA 3MXVH 1MCFA 2DDQH 1NGQH 3VGDA 1P5UA 4NHCH 4NKMA 2L4OA 4C56A 1JGVH 4EIZC 5I1IL 4U1JB 3U0TA 3V0VB 5FYKU 3WS6C 2OI9B 2YD5A 4KDTA 1K6QH 5L6YH 3MREB 3MRLA 2WUBH 1E4WL 5DD1L 4WNQA 2EE2A 4JDTL 4S0TD 2LVCA 1GGCH 5I16A 4HJGB 5KVGH 1RUAL 5L9DH 5ALCH 2DQEH 4MD4A 4KRPB 2R0LL 3RWEB 4OCMC 3WD5L 3DRTA 5GSVB 2NQCA 4YC2C 2Q7YB 4Y7MA 4MXWL 2ADFH 5B39G 5IF0B 1E27A 4IRJB 4AQOA 2Y5EA 3ZE2E 3IDYC 1UM4H 2HH0L 2J8HA 3KLSA 4NC1C 3UROR 2XWTB 2EXYC 1S9VB 3RGVD 1T5XB 3KPTA 4XVTH 3S3PA 3CSPA 1A9BA 5B3NA 1QFWM 2Z31B 2HLFC 3FQNB 1CDIA 3T2OA 1TQCC 4F15B 4M93B 1MH5B 4MJID 5IMLB 3FQTB 4DKAA 3RWIB 3ZKSD 4KVCL 4E9LA 1T04B 3X12B 4KRPC 1OARL 5BW7A 3IKCA 5D7IE 4JGJA 4MA7L 3DVFA 3ULUF 1HWGB 3SE9H 5TDNB 5E2VL 5HHNB 4G9FB 1BFVL 4NNPH 3FZUD 1EA9C 4N5UA 4PJ8A 3VFUA 3A6OA 4OCWH 3HE7B 2FL5A 4JJ5A 4AIZA 1U8MA 4H26B 3WFDH 1D5ZB 3GNMH 3QCUL 5GGTL 1WK0A 2GTZA 4GXVL 3MOQA 5T1LB 3FFCA 4JRYD 3WN5C 3HB3D 4J4PD 4U2ZA 3MJ7B 1U8HB 2BHUA 4JZOA 4Y19B 5KS9E 5KG9A 4XAKD 5EU4A 3TNMA 4NC1E 3I3DA 3QDHA 4KKNA 3D39A 3PP3H 1FP5A 3QPXH 5E2WL 1HHGA 3GMQB 5AWNL 1U8JA 4A6YL 2YN5A 1ETZB 1TDQA 3FN0H 3RY4A 2UZIH 3LB6C 4WW2F 4NQSB 1XGPB 1F3RB 4R0LA 5TJWK 4LAJH 4ONHA 4DAGH 2G5RA 3TIEB 3DETC 5ACZB 3PG2A 1X5LA 3K80A 4YNYA 4LHQB 3KYKH 1DL7H 3OHXA 3VFWA 3GBML 1MCRA 2DOCA 5MEQB 4OFDA 1IAKB 1BF2A 3SDAA 1CD0A 2AK1H 4KJPD 2VN7A 4HMDA 2YN3A 4YR6A 5E94B 1C8PA 1KFAL 4PJGE 4WTXA 3QQ9C 1J8HE 1JYNA 1YMMA 1JGDB 3GGWB 4LL9A 3TYGH 3NCJH 3FQWA 4DZ8A 2VWEE 1U95B 1JV5B 3S37X 4PRIB 4I4WB 2CQVA 3GSNH 2ID5A 3PABA 5KOVC 1BF8A 3ZTJG 4CN1A 1AD0B 4OGXL 4YXLH 3HMXL 4FFVC 3WHE0 3L3JB 5I0ZA 4J8RB 5EC1B 4JHWL 2P8MA 3HRPA 3IXTB 5D7KE 2J6EL 5JQHC 3AXLA 3E8UH 3NIDE 5I30H 5L8KB 4U6TA 1T0MA 3O2DH 2FEEI 5F7EH 2E8YA 5L0QC 2NNAB 4PJBE 5DFWH 1JNNL 3GHBL 3TVMA 1UB5A 4H26A 1FNSL 3R8BB 4WHDA 4WCYL 4L4TA 5CD3A 5F70A 2GCYA 4X8JA 1JTOA 1UB6A 1W0WB 1XGRA 2BSTA 4X9IA 3DBXB 4G80A 4RMSA 3AS1A 3CMOL 4QRTB 5GSVA 3JVGA 5DEFA 3BP5B 1KEGL 4K7FB 3GMOB 4LU5H 1OCWH 3AVEA 2ZJSH 4ENED 2G9HB 2I60H 4PJGB 3SDDD 4MJ5B 3HNSH 2HA1A 4U0RB 2AEWA 2FCBA 1GGYA 5CZVL 3LN5A 4UILH 3TA3A 4M6OH 1MWAB 3EYVB 4RGNE 4XPTH 1RJZA 2JF1A 3BUYB 4DTGL 2FJGB 3LN4B 2R1WA 1OP3H 3LAFA 5D7JC 4Y4FA 4HT1H 5D71H 4AIOA 4XNXH 4DVRL 1CDYA 1PY9A 4N0UA 3UTTA 3DX6A 1QFPA 3ULVE 1Q38A 4P23A 4NO3B 3H7BB 1QYGH 2GJZA 2KH2B 4M61A 1T1XB 4Y1AA 2E7LC 2A0LC 1IRAY 1MY7A 2A6IB 3SHSA 4FRWA 3CVIH 1YEDA 5BZDB 2ED7A 1YY8B 2ZZUT 4XHJD 4YZFE 1J18A 1P7QB 4FG6C 4U1MB 5HHQB 5HXMA 4NGHH 5FUCE 3BRGC 4PJXA 32C2A 4GKNA 3UPRB 1ZLVH 4IMLB 4H1LB 2XQYK 4FQ1H 1CVRA 5EULV 3FZUC 4HSQA 1I8IA 4MSWB 5F1SA 4X98A 1I3UA 2W92A 1CT8B 1DEEA 4B5EA 3SKNA 4MQ7A 6CGTA 3PV7A 1OL0A 5FYJH 5D1XA 1I8LA 4X4XA 1HH9B 4OZGA 3C6LD 4H8WC 2QTEA 3VWKD 1AGCA 4PJAE 4F33A 1KTDA 3MRNA 4G7YL 5F1IA 3OJVC 1H0DA 3MA9L 3M8OL 5JO5B 1UC6A 1QPXA 4TPRH 1ZV5A 3O3AB 1RZFH 3UPRA 2B1HH 4IRZL 3OKMB 1D5MA 4QRRB 1G6RH 1IKFL 3VFPB 2YRPA 4KZDL 4OIIL 4S10A 1UACH 4AEEA 2UVFA 3BH8A 2R9HC 3QEHA 5IK3A 2NY2B 4K7PL 3UTSE 4TYUA 2PCPA 2A6JA 5I1DA 2NY0C 2WV3A 1QRNA 4ISVB 3SGJA 5FO8B 5J1TC 4PJ9C 5KN5A 1RZIB 4AEHL 3DO3A 4PJFE 2E5EA 2VXSL 4HS6A 1QFWI 2N7BA 2HFFB 4WUKL 5FCUL 1M7DB 4BA8A 4QXWA 5CJBA 1NFDE 1U8PA 4YHPA 3S96B 1J11A 2DIJA 2FYYB 1FG2A 3NIFF 3RTQA 2V9QA 5HYJE 4PJ7B 2WP3T 3GSQA 4HAFA 5FV2A 2A6KB 1NCBH 1KV3A 5ISZA 4JO4H 5DEFB 3HI5L 5FUOL 2IWGA 4OQTH 4DWHA 1LO3H 2GK2A 5ISZE 1S7RA 4PBXA 5C0CD 2MTPA 2DD8H 12E8L 3B5GA 5BV7B 2VDQL 2I27N 4EDXB 4YFLI 2WINA 3B9DA 3U7YL 1KJ2A 3O6FA 3PGFH 2QSCH 5HD8D 5ANMA 1QUNA 3FONA 3WDJA 4OCXH 4OZGE 1MHEB 3A6CL 2Y1VA 3V7MA 2ZCLH 2MSPA 1JHLH 4JG1H 4P2QE 4FFVD 3C5JA 3MA7B 3RP1A 1RVFL 4X4YA 2XN9B 1A7OL 3LRSB 4D3CH 1FVEA 3P40A 5JXAL 1FGNH 1CR9H 4OLUL 3WFHB 4MJ6A 1ZXQA 3RKDD 3LKPA 3O2WH 4L5FL 3QUMA 4L3CB 5HSFA 1NC2D 3O4LB 1MAKA 3B8YA 5DRZA 1FV1A 2J88L 3L7FB 1KT2A 2D9CA 4IDLA 3U7WH 3CX5K 4NC2B 3HZKB 3GIZL 4ETQA 3Q6GH 2XPGA 3VE0A 1BJMA 2Z92A 2FR4B 4L5FH 3F5WA 5FYKH 5E9DE 1RJZB 1CFTB 3UC0H 1YMMB 1Z9LA 3O3BB 5DA0B 4ZMAT 3U9PH 5EUOB 4QYOA 5KSVA 4Q9QL 3CU1A 3GHEL 2BFVH 3LV3B 5IMMB 3UAJC 1MCWM 3WHXB 5DJXA 1P1ZB 3GUTA 3OPZL 4QOKD 2VZUA 5IP4A 2ZG2A 1EO8H 1LE9A 1MCEA 4WV1A 5EWIL 1NBZA 2HN7B 4YNYB 1CGWA 5FA4A 1Q0YH 1B0GB 1V3MA 2V5TA 2FECL 2GUOA 4OCXL 4P9HL 2FHBA 2PYFA 4P5TD 5K33A 4FP8H 2P49B 3SDAD 1I8MB 5IEKB 1OSZA 1DVFD 5AZ2H 4BKLA 2W07A 4HLJA 4UV4H 1IM3B 1DBBL 1WICA 1AKJD 2M1KA 3BD3A 4UT7L 1OOAA 1VHPA 1NBYA 1A3RH 4NCC1 5KG9B 3QJFA 3RX8A 1NSNH 3JWOC 2Q86A 2BVUA 3D85D 3ZE0F 2EYSA 3QI9C 3TJEH 4OJFH 3HI1B 3VMPA 3UYPA 3BP7B 4JY6B 2ZSWB 1MRDH 1ODAA 5FGCE 2ZPKH 1IGTA 5CS7A 4NFDA 2YPLB 1VACA 5J1SC 5AZEL 1MIMH 1MVUA 1EXUB 2R1YA 3TZVC 1OVZA 3KLDA 3ZTNH 4Z0BL 4BH7B 1H3TA 2DQDL 1MFEH 3WUWG 3L5XH 3D25A 2BZDA 4H0GA 3V4UL 3U46B 1UACL 4O5LL 4MAYC 1D5XA 4LVNB 3MRDA 1FLRL 3MJ8B 1MHPL 1VFBA 4AEIL 5GS0C 2XKSA 3QUKA 5IIEA 1ZT4A 3QNYA 1OTTC 3P4NB 5DMJB 1KCVL 4X4MA 1NBYB 4YXKL 2XPGB 4PS4H 1CYGA 1HDMA 4P23D 2V7HB 1MF2H 2X4PB 3BZ4B 5BRZB 4K9EL 5E1HB 2NR6C 2KPNA 4PB0H 2G2RB 5C6WH 2VLJD 1F4XL 3AAZB 3FOLB 4M9PA 1KCLA 3QFJB 3W39A 2B4CH 3G6JB 1CLYH 4H1LA 1UH2A 1PBYA 3AM8A 1XIWB 1MY5A 5ETUB 3U36A 1FRGH 1MCDA 4JY5L 4WI5A 5HHQA 3FRUA 3IFPB 2FLBT 1W72A 4GKOA 1MHPH 4YWGL 3GMNA 1RJLB 2LQRA 2BNQD 3I2CL 1ZHKB 3LKRB 3NCEB 1CDUA 4PLJD 4O5LH 3S6CA 4GAGL 5KVDH 3IYLW 1E0OB 3VG0H 4DQOH 4HQQH 1PKQA 5ABDE 5D5MA 4KK8D 4J3OC 2KDGA 4ZS7H 2V6HA 5AZEH 4L4VA 5D70L 1TVDA 3U4AA 3JV0A 5L2KD 4ONGH 3PHOA 4JRXD 5HYSA 1WCBA 4OLZL 1IC4H 35C8H 3W0WE 1OP5K 3RZCB 3WIIL 5DQDL 3RWDA 3SBWA 5B8CA 4ZFFA 1T1YB 5IESH 2W38A 3ETBF 4XXDA 3TN0C 1KNOA 2I9TA 4MDJB 5FK9B 1K8DB 5DURB 5HDOA 4YHOL 4LHUG 1E6OL 2AXJA 2G9HA 4PJGA 1EO7A 3O41A 3VGBA 5K9QI 5E8PA 2BXZA 4V2BA 3QDMA 4WW2C 1HH9A 4OZGB 1Z5LB 3E2HB 1FAIH 2R0KL 5F9DC 3PWJA 1KTKE 2Q3AA 1V7NL 1FZKA 3AREB 1TNMA 4FQCH 4LARH 3TM6A 2E7HA 3G6JF 3MFGB 4WFEE 4Y19E 5KS9B 4IMLA 4BSVA 4LKCA 3SJVD 2DI7A 3LQAL 2PXYB 1JRHL 4KZEH 3TCLA 3TEUA 2DI8A 1J5OL 3G6DL 4GRLC 1FIEA 2YMXH 3FCTA 4GFTB 2R23A 5ITFB 2AW2A 2CDGA 3IFOA 2A9NH 2YKLH 4JRXE 2YPVL 5D96B 3H7BA 2PW2A 4WY7L 3GRWA 4HZAA 1JF6A 4B0MM 1DUYB 1WIPA 2C5DC 4GG6B 4YXLL 1A9EB 3C09C 3MCKA 5E4EC 4L4VE 1VB9A 3MFFA 4I3GA 3ORJA 3ZLQC 4APQB 5C92A 4GKSB 1BFSA 3PGDB 5FIEA 5DK0A 3O45A 5C07B 4X7EC 4TSBL 3GGWA 5DT1H 4B50A 3T77A 3NCJL 4PJHF 1SJEB 3QCTH 3JWDH 32C2B 3NA9H 4CVXA 5I1JL 4ZXBB 3CK0L 5KJRL 3DXAB 1SYVB 4JDVA 1JPGB 1KPVB 3T0BA 5IB4B 1JZ7A 2OBGA 3QT2A 4YO0A 4FQLH 1W0WA 1XGRB 3A6CH 4JKWA 5EC2B 4RWHA 1N8ZB 3G5YA 4KQ3H 4CW1A 3LEYL 4UBDD 1T1WA 2F54D 4P23B 4MXQC 1HOCA 4PV9B 3VXRB 3WO3B 4F3FA 1S7UB 4BZYA 3S5LG 2WLZA 5IB3A 5J0BA 3VFTA 1S9KC 5EBWA 1SMAA 3TNMB 3FB6A 5E2WH 1I8IB 4ZAKD 4C59B 5DO2D 4Y4HD 5B4MD 4OGYH 1HCVA 1GZQB 3ZHDA 1NANH 2FZ3B 4CU8A 4ZO6A 5E1AA 4CL7A 3QXWA 3P0YL 4PJXB 4LMQE 5C0EB 3MQIA 5GZOC 3QAZB 2DWEA 3TP4A 5E6IB 4N8VA 1CLOL 3K8MA 5F7DA 5EBLB 2AEQH 1K8DA 3INUL 3JUYA 2F53A 4HKXB 1U8NA 3S36X 1UWXK 4DUXA 4YHKH 4P23C 4NQVB 2A6IA 1CDHA 3PDGA 1U3JA 1PY4A 4QY8A 3HE6C 3BH9A 1VPOL 4OZFA 2VC2H 4MWFB 5D1ZD 1OPGH 4IMKC 4S1DC 3WJJC 1MREH 4GG8B 1Q72H 3MOBH 3SE9L 4MNHB 1G9MC 1A1NB 1T83C 5SX4I 3RWHB 3FT4A 5GRWA 5JIPA 4MYWB 4N0FB 3QFJE 3JTTB 5F88A 3UDWA 3WV0A 3LPFA 4X7CC 4NUGH 4YHLH 4NZJA 2F19L 3S35X 3VGFA 3N1GC 2H6PB 4KVCH 4R0LB 1GC1C 1MCOH 3TYFB 2VXUL 1XIWA 5CJQH 4Q9RL 2FRGP 1KB5H 2NPLX 1QSEB 3D3VD 1H0DB 4KJWD 2A83B 4I4WA 3SGKC 4I18B 1BIIB 4XZUB 3DHJA 1AIFA 2VH5L 2ZP0T 3RL1A 3OKDB 2VR5A 4XHQA 2QKIA 3WLWC 1JZ8A 1NKOA 1MLBA 2HH0H 3RZWA 4YDIL 2BC4A 1ZT4B 4I0PB 1WIUA 1HILA 4ZAKB 2ICWB 4K7PY 3VJ6B 2LVEA 4KKCD 3ROLB 1WT5C 2EECA 4LBEA 1N5AB 2PW1A 4K71C 4R9HA 5DYOB 2DTMH 4ZSOB 3VCLA 2XFXB 2ZUQC 3ZDZF 3HE7C 5CIPH 5L7XL 1S5IL 3T0EE 5I8OL 2IAMC 4JDTH 3UTZB 3U0TB 3V0VA 1Q9LB 2H2PD 4G9DA 3W9EB 1BECA 4DVRH 1LDSA 3GM0A 5D71L 2YEZA 4FQXD 3SQBA 4XP9H 3FTGA 2FGZA 2W91A 3VH8B 4P3DB 5MI0C 4C83A 2VLRD 3GJEB 1ONQA 2IBGA 2L7JA 5HDBE 1IGYB 1ND0A 5DHYA 5HHVH 2E9BA 2GQHA 2Z8VC 4GRLD 3V6OC 5C0NC 2J2ZA 4NN5B 5C8JB 3OXRB 3QZWB 2FEDC 1IQDB 1JYWA 4EI5B 3D3VE 5IVXE 2JLLA 5J7CC 1I3VA 4X6DE 4IRSB 5D72H 1YC8A 4M8QA 5C9JA 4S1QL 1OQOA 3B9KA 15C8H 3DV4B 4QRTA 2WANA 4D9RD 3UJJL 2AEPL 4KRPD 3QIBB 1LEIB 3T2NL 1JNNH 4MMZC 3FO0H 1W8OA 5GJTH 3BIAX 3HUJE 4HZLA 3CH1A 3TO4B 3BDXA 4JN2A 2A77L 2CIKB 6FABH 1DVFA 1JZ4A 4JM4L 2EDOA 3UXFA 2FHFA 4L4TE 1J05A 4XMLL 5AD0A 2VXTH 3OKEB 3O6ML 2X89A 2YXFA 5IHUH 3VE0B 3QO1A 2EDJA 3LIZH 2OL3L 5HVFB 2XKUA 3RNKA 1YN7A 1SEBB 3CLFH 4MXQD 1INQB 2D7NA 3AS0A 1CFNA 1DDHA 1B4RA 2P5WB 5AG8A 3SKOB 4OAWB 3RI5F 3WFEH 2BDNH 2LAGB 4LVOB 5BMFL 3OGCA 2UY7A 5F7YC 5FEBA 3T8XA 3D87B 1AGBB 4HKXA 1FDLH 3ZL4H 2Z8SA 3RWEA 1PZ5B 3WUZA 5D7IB 4OCSH 4U3XA 4PRHA 2MQCA 4NWUL 5LQBL 2VQ1A 3EYOA 4ZDHA 2CDFB 2BVOA 4LSVL 1HILB 3T65B 4HIJB 1X5KA 1JFQH 3K1DA 4DFIA 1IGFH 4XCCH 1NCCL 1U3HB 2ICCA 3G5VB 3FQNA 2EE3A 1YPZE 5D2NE 4KJYA 4JQIH 1J1OL 1F6AB 4X6EA 2C3HA 4P49A 1NCCH 1FZJB 1JWUB 5FUZH 2NCMA 4BK4A 1QO3A 1QKZH 1FYTE 4GKNB 5KSAA 1MCKA 3WFCL 4AY0A 2RR3A 3JUZA 1QVOA 4LSVH 3SDCB 4WU7A 3VXMB 3TBYB 4L4TD 5JNYB 2DL9A 3O81A 4Z0XA 4A6YB 2ADGA 4C4KT 2F54A 3PHSA 3SGDI 3UX9B 1F00I 2DLFH 4KJWC 4KROC 3QG7L 3KJ6L 4QF1B 4AJ0A 4FQIH 1YY9C 2FBOJ 3GBLA 5IFAH 3MRLB 1EEZA 4WFHE 1QP1A 3RTQD 2P7TB 3MODL 4TNVK 5D1ZB 3IDNB 4FQJH 4ZPVB 1FC2D 1IVLA 1DP0A 3WNKA 1NUDA 3JV6A 4JDZA 1T7YA 1LK2B 2ZOLA 4Z76B 1KXQE 1EGJH 3KPNA 3MXWH 4U6YA 2ZG1A 3Q6FA 1TCMA 4XWGL 4I2XB 2ZUUA 3ZDXF 3OAYK 1MRFH 1Q9WB 5F71A 4DK3A 2GSIB 1CWVA 4M7JL 1BQLH 4E42A 4I48B 1BBJA 1VKXB 1A2YB 1MLCB 2EDNA 1HKLL 5EH1A 3SKNB 2GCYB 4FQXC 4BSJA 2Q1EA 5GJTL 3DMMC 3MOAH 3SDDC 3T2NH 4Z77A 5D7LD 3VXPB 1CTNA 4DN3L 4NKOB 2IADA 3G5YB 4ACPA 4M4PA 4TULH 2OR7A 4QLRA 3EDFA 5IF0A 3QEQD 1IQWL 1KENH 1N2RB 3NCBB 4KHXL 1OQXA 4IDJH 4KK5C 2MJWA 2MNUA 3DO7B 2NY6C 2HT3C 1AXSB 3K8LA 4LSPH 3OGCB 3VXUE 1I1AC 4ZFOL 3IDYB 4KDWA 2G75A 3BGAA 4ERSL 2C4XA 2YA1A 4JZNB 1A1OA 5DMGC 4DOHB 5HYSG 3IAQA 1RUQL 3DX6B 3FOLA 3L95B 4OM1L 5I1IH 4L1DA 3QDJD 3A6BL 1RURL 1SVCP 3S3SA 2X05A 3ZKMC 3MCG1 4ERSH 3S98A 1EHNA 3QNYB 2BNRB 1C5DB 1QSFE 1C08A 2AK4B 1YJDL 1FN4A 3SEPA 1OGAA 1IGMH 3WXVL 2MMXA 3BEVA 4JG0L 2YC1B 3ARBA 3OB0K 3ZYIA 2APFA 3HLAB 1TXKA 4JFOA 4QEGA 2W1NA 4YUEH 1CTOA 4PV8A 2PXYA 4BFGA 3T2QA 4L4TB 5CD3B 4PRBB 3WUWB 4NQSA 1UFUA 5I8CB 3CFEA 2BMKB 4O58H 5FO9A 2OX5A 2AKRA 4NN6C 2BVQB 1AXIB 5E99H 3T09A 3VXNA 1GL4B 3LKSA 3IU3B 2R1XB 1LP9F 2AJ3B 4R7NA 3UTTE 1LP9B 4NT6A 5EOCJ 1MCOL 3QSKB 3MNZA 4W6YB 1IZJA 5CEZL 3VRIB 4POZC 5DQJA 1VERA 2KZWA 2VLJA 4XPBL 3MV7B 1KLGA 2J6EA 2Y72A 2WMPA 4NP4L 4QNPE 2VDKL 5DJ0B 1PEZA 4TTGA 1CE1H 2KUTA 2X09A 1IARB 3T0WA 3HMXA 5EN2A 5I75C 1KNOB 2I9TB 5GGRY 4BH7A 4MAYA 5IFAL 1KCUH 1WZKA 4U1SA 4F58L 1QA9A 3VFRB 2I9LA 3ZKQD 2JIXB 3M1BB 4AYFA 2MQ3A 3TBVA 5JQ6L 4UTBL 4AL8H 2OM5A 3DX7A 3EYSH 4JRXA 4Q7DA 2CR3A 4YHKL 2CMRL 2QBWA 2IH3B 1BBDH 4PJGF 5C0EA 5C7XL 1KN4L 4UOW1 3MRBA 1FBIL 1QBBA 4CUCA 3LKNB 2VLKB 3RVUD 4ZYKA 4ODWA 2DLIA 4JFED 4QGTA 2AJUL 1NGPH 1EVTC 1JP5A 1IM9D 1JCKA 2QKIB 4HK3N 2B5IC 3H6JA 4JANB 1BX2A 1X5GA 3RGVA 3SE4A 4ZPTA 3PQYB 2XZCH 5CJ5A 2PETA 3RTQC 2L0DA 4PRAB 5FV1L 2DQHL 3PJSB 4Y5YB 4HGKC 1ZHNA 2FX7L 2Z0BA 3FB8B 3ARBD 1BJ1J 3NABL 3FO1A 4OCYL 2O5ZH 4HXAL 1TMCB 1KELL 4HIJA 1XH3B 3S34L 3VGHA 1HI6B 1A7QL 5HYJB 4RA3A 4YX2L 4UOW0 5TE7L 3CZFB 3H7LA 5F7WC 3FO9B 5LAXB 2OS7A 4HULB 5IEHA 1YMME 2E3VA 5DMIH 4EJ1C 3CK0H 3HFMH 4OCLC 3T0AA 4Y5XC 1IILE 4PJHB 1UWGH 5BOZG 1MVUB 3JWNC 5I15L 3BVNA 1HQ4A 4HWBA 1J8HB 4IMKA 5C0JA 5DJAA 2IQAA 3WE6A 3EO0B 5EU6E 1DQML 2ZOKB 1U8QB 3BAEH 3O6MH 3D0VB 1JZ3A 3S37H 4JO3H 1GGUA 3AROA 1ZSDA 1YNKL 4PRNB 3QCVL 3ZT7A 5C9KA 2X4SA 3IJYB 4AM0B 2VDNL 1A1MB 3EGSA 4X6FB 2YK1L 1ZHBB 3BN9D 1UZ8A 3HAEB 3IS0X 4HEPG 3D18B 3V7AG 1I4FB 1U8IB 3ISWA 4PP2B 5F9WC 1YEGH 2NW2B 4GRWE 4PJ5E 4X7TA 5E8DH 1CZ8L 3WXWH 5L2KA 2HRLA 4WWKB 4RFEB 5E03A 1JPGA 4OZGF 1D5MB 5DD0L 5E08L 2ICEB 5I8EA 5T3ZL 5T3XH 1BFTA 4EI6A 3IDXH 2N7AA 4AENA 1XR8A 3P9LA 4GAYB 5HDQH 1YPZA 5D2NA 3VD3A 1DUZA 1W0VA 1QSFB 4C56E 3TH4T 3ULUC 4DW2H 3EO1B 1OF2A 3QEGL 4OM0H 2R0WH 1IC7L 4JFDD 1MHCA 1S3KL 4G9FE 3V6BR 1YEIH 2ERJB 1UG9A 4XP9L 3RVWC 4Y16B 4X5XB 2X40A 4JHZA 4PRHD 4ZSOE 3UBXB 1I7RB 3TV3H 5IQ7L 4OLZH 1BOYA 2VXVL 4N5EC 5L2JB 4GQ9L 3LKPB 5GGVL 4FMFA 4ENEC 3S36L 1T89C 4JM2D 3GI8L 5HVGB 4LEXL 4P3WA 2B20A 4UTAH 3ES6B 5DS8A 4PRID 2X1WL 4X99B 5DJDB 5JHLH 1NMBL 1Q9OB 3TCXA 3L3HA 5B38B 4LCWA 1S9WB 2NX5A 1FZJA 1JWUA 3MYJB 4YAQB 2BC4B 5T3XE 4YIQA 1R3HB 2UWEA 3QXUA 4UUJA 3ARZA 2P1YA 3BD5A 4JB9L 3PWVA 1JHTB 3DUUB 4PUBH 1TZHB 5FDYA 1KB5L 2R2BB 1IT9L 3EO1A 1EJOH 4KKLC 5JR1H 3IF1A 3QUKB 4RFOL 1DBML 3C8DA 2DYPD 4Z8FL 1I7UB 5HGHB 5HYQB 4MJ5A 5IG7A 4LRNL 1XR9A 4UT9L 4M3JA 1ZEAL 3RGHA 2OQJA 3E6FA 5E9DA 1KC5L 1F02I 1MCLA 4LCUB 1EAPA 1AKJA 1YQVL 2E7BA 5TPWH 2X70B 3NZ8B 3F12B 4QWWC 4GMTH 4JN1H 3WO4C 1XGQB 3TCLB 1OD7A 3O0RL 4U1GB 1J9CT 1RJCA 4M1CC 1ZANH 3KYOB 3BD4A 3UJTH 4WI7A 4PGCA 5EU3A 3RNKB 4LHUB 4OZ4B 5CJXA 3R0MA 2N56A 2OL3B 4O02H 5DVMA 2NY3D 3OR6A 2RHEA 1CLCA 5TE4L 2BOBA 1JK8B 5DUML 2EIEA 4RMWA 4D0DB 1IM9B 4HWEL 4O51B 3RWGA 2FX8H 1F6AA 2ZOKA 4MDJA 4UT7H 5IW3A 5J6HA 1ZGLB 3VH8A 3B43A 2SEBB 1DQTA 3P4MA 4NFBA 2EDTA 3TJHC 4GH7B 4ZG1A 4PTTB 3VFVA 4NQCB 3GMMB 5IB1A 4ZUUA 3B9KD 1KXVC 2XFXA 5CINH 4FQXB 5EOTB 4Q6IA 4LLQB 3MRCB 3C2SA 4LCWB 4NIKB 4NPYA 3V6OE 5EORH 5EC2A 4PRHB 4LFHG 3OPZH 3N0PB 2DN7A 1JTPA 5I1JH 1IMHC 3LMJH 1D9KC 1SHMA 4K3JL 3LEVH 5IM7B 3ARGC 4NRYA 4G8IB 5K9JL 4U1KA 5L2KB 1BIHA 3SCMC 2Q3ZA 4AMKH 1FE8H 2WWMC 2DBLL 4XC3L 2NZ9D 4IEFB 3V6FA 2EH7L 4QCIA 1B0RB 4NQDA 3QUXB 1F8TL 4JFZL 1QFUH 2J88H 3WO4B 1A7PL 1UZ8B 5IM7A 2D0HA 1NGXA 1RU9H 3QISA 3I50H 2A9NL 2YKLL 1DUYA 4XVJH 4GG6A 3LN5B 3TA3B 3BKCL 5T1LA 2X1OA 3FO2B 4PB9L 3FJTA 5JA9A 4LLYB 3KLAA 3BW9B 3QDJB 1WFNA 1TJGH 5BQ7B 1F4YH 3PWPE 2WQ8A 1B2WL 4HFWB 2Z35A 3LS5H 1FVCB 1BD2D 4Y4HC 1W0YT 1UM6L 2I24N 4TVPH 4K07A 2AK4D 4KWUA 4LSRL 2BY2A 2GYSA 3QIWD 1YEJH 1GAFH 5EOQH 2Y6SD 25C8H 3D18A 3RU8H 4LVNC 5IEHB 3TH3T 5CCKH 5C9JB 2BOBB 3HAEG 2R8SH 3CZJA 5H37H 4EI5C 1RMFL 2DKUA 2IQ9H 5IGXH 4H5SB 2YPKB 5HHOB 3CMGA 5EU4B 3EYFA 1CGXA 4KV5F 1JRHI 3RIAF 1A6ZA 3MROB 1M7XA 1ORQA 1N59B 1AE6L 1XF5B 1GCFA 2VITB 3OSKA 4P2OB 5J13C 3VGAB 1QRKA 3DUUA 3I02A 1T7VA 3P30L 2F58L 3VXME 1UJTA 3VWKA 5FF6A 3V2AR 4P5TC 4PRAA 3BHBB 1LO5B 1I8MA 2R15A 35C8L 3P0VH 2V2WA 1K5NB 4W70A 3QEQB 1AC0A 2ED8A 5HYIA 5C3LD 3F7QA 5DVNA 1G9NC 3SCMB 5MENB 4E41D 1A4KA 1UXWB 3EFFA 1MNUL 2H8PA 5T5FH 5DMYA 4WUUD 2PN5A 3REVB 2HVJA 4YDKL 1U91A 4GAGH 4LPCA 2IH1A 5DMKB 2AJVH 3A0OA 1G6RL 3ZDYF 3NFNA 4QHLB 1MCCA 4FQXA 5EOTA 4IRZH 4QWWD 1OGTB 3OJDB 2MQ0A 4R90L 3QHFL 3MRHA 5CUSH 4GG6F 3NAAL 5SX4H 1U3YA 1G9EA 3OGOE 3QXTA 4PYHA 4M1CD 5IB3B 1EJOL 5HHXH 1NCWH 5ETUA 3TZVD 1IFHH 4MLSA 1P84J 3L9RA 3O8XC 2H9GA 4PS4L 3O9WA 1TCRB 5GHWH 3KYNA 4XPGL 2EDXA 1RULL 3RTQB 2YD8A 1I7ZB 3CFJA 5HGBB 1TENA 3T3MF 4L8DA 2H3NB 1PEWA 3L5XL 3VFNB 4KHTL 3PV6B 2FSEB 4Z0BH 1XF1A 4RMRA 4LKCB 2Q6WB 5GRUL 1K8IA 2DJUA 3MCLH 4K2UH 1QR1A 2UUDH 4KC3B 4XPAL 1U8MB 3C5ZA 5ANMB 2PCPB 2ZPKL 3JWDC 4HLZH 4LLUB 5HY9A 3K3QA 3DGGB 5LVEA 3GIVA 4Y4HA 5DJ2B 2KQMA 4XNXL 3NN8B 1ZHBA 4XTRC 1M05B 4HWZA 3Q5TA 5CWSB 3EDEA 4XBPA 3GSVA 2NY4C 1IEBA 3HG1A 4I3RH 2R0WL 4EI6B 4CVZA 4HIEA 1XGTB 1D9KD 3IFNL 4P4KB 5EZJA 3FQRB 3X12A 2ZNWA 1U3HC 2CLVA 2P46B 4JZJC 1UJ3A 4R4BB 4PGDA 5HJ3B 4L4JA 3U1SL 5EOQL 4LHUA 1FIGL 4JCMA 3CMOH 2Z31A 4M03A 1UM6H 1RZGA 4RFNB 3CCHA 5FM5M 4B41A 2Q6WA 4DGIH 3L6FB 4GLRI 4I3SH 4GBXC 2BNQA 1AHWB 1PSKH 2VDLH 4LASH 4OFVA 4N0CC 2P8MB 4IRJD 1A4JA 3GSRA 4R4ND 3RIAK 1QEWB 3SKJL 3GUTB 1Q0XL 3MLYL 3IVKB 4DGVL 4NN7B 2VKWA 4LF3A 5IBLC 4FFZH 1MI5B 1I7RA 1LO0H 2VE6B 3I6GB 4X6EB 1J87A 1JV5A 1MCPL 2XKNA 4X4XB 3GSOA 1JHKH 4P5MB 4XBGB 4RCAA 4X7DC 3OQ3B 2GAZA 1FE8L 4H0IA 2Y6SC 3H9SD 4LHUD 3S5LA 1BD2A 3BIKA 3PF2A 1FFRA 1D5IH 2XI9A 4NDMB 1G7IB 1MRCL 4WW1A 5D6CB 4K3JH 3WKML 5D5MB 1MIEL 3QXDB 3S4SG 3W2DL 2QLVB 4MZ2A 5EORL 3TN0A 4G5ZL 1WFUA 1QD0A 1XF3A 1RI8A 2JIXA 4M43L 3GK8L 2ARJA 2HTKD 3D48R 3GIVB 1LK3H 1FO0B 1E4JA 1JZ5A 1P9MC 4LCYA 4OLWL 3FMGH 3ULVF 2GJZB 2Y36L 3UBXA 2ORBH 5FDWB 3WDIA 3PL6B 1G7LB 5I74C 2E7CA 1V7ML 3O6KH 2XWJB 4M62L 1KIUA 5AWNH 4MA3B 4JO4L 1MFBL 1JPTH 2HTLD 2VITA 5ADOL 4DK6A 4XVSL 5I8KH 1V3KA 4DKFL