1FG9C

3:1 complex of interferon-gamma receptor with interferon-gamma dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
210
Chain Sequence
VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON GAMMA
publication title Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 210
sequence length 213
chains with identical sequence D, E
ec nomenclature
pdb deposition date 2000-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg9C01
3FFCB 2XKUA 3U9UA 3PF2A 1N6VA 4PJAE 1HHKB 4LHUB 5IVZA 3ULUL 2EYSA 1V8HA 2VDOH 3CIQA 4WHTB 4HS8L 3WL9A 4ZO6A 3WIFB 3MO1B 3QHTC 5AZEH 2ICES 1G7HA 5TFSL 4XCCH 3RZCA 2Z35B 2VZ3A 4YIQB 3QFDB 2ZSVB 1FDLH 3QUZD 2IF7A 2MQCA 3S34L 3TFKC 4R97B 1AI1L 4OF8A 4WCYH 1OGAA 1IKFL 3CFJB 1HHIA 5ICZA 1NDMB 1T89C 4I0KA 4M6AA 5DD6A 4XWOC 3VXTA 4Y16A 1JRHL 3I3BA 2BVPA 3G5ZA 2NLJA 2YPLA 3RUGB 5FM4A 5JDSB 5FYLE 4OZ4B 1B90A 3LQZB 3RJQB 4HQQL 5DJ0A 5IHZB 3KHQA 3CSYB 4PRNA 3OXSA 2GK2A 3TYGH 5GIRA 5EIVA 5DEZA 1NGYB 2AJYL 5KZCB 1A2YA 2CO7B 4GQ9H 3SJVB 1BQUA 1KEGL 3VXRB 5BRZA 3KWWA 2O5YL 4OGZA 3R06A 4J6RH 3LZFL 4NC2B 5D7IB 5HPMB 1M4KA 3LMJL 3U4BH 4R7NB 4XVSL 2PW1B 5C07B 1A5FH 2X4PB 3MRLB 5HY9A 3GDBA 4HIHB 1UKSA 1AD0B 3ALPA 1H3TA 3KYKH 2EEDA 3CDFA 4MHHG 5D2NB 4CVXB 3BXNB 5I73B 1BPVA 4X4YA 3CFCL 2QHLA 4BQ9A 4OCMC 5E8NB 3CXDH 5HVGB 1HCVA 5B8CA 3HMWH 2JJTA 4P2RD 5DMIL 4X98A 1LVEA 2PXYC 4DW2H 3IRZA 5FUZL 2MFNA 4HFUL 4OD1H 1MI5A 4JJ5B 4FFWC 5HD8D 5JW4Q 2VABB 3MUY1 1A9EA 1E0OB 2E7BA 4OZHE 2QQKL 3S35L 4IRSA 3HPJB 3EYFB 1RK0A 3QEHA 4PJ7B 1FYTB 3O8XB 3HLAA 4X6DB 2EKSB 3DO7B 3O2WH 1T7WA 1FH5L 3O3EB 4JM2C 1CDBA 1F3JB 1ZA3A 1U8PB 1LEKA 3SE4A 3MV9D 1Q9OA 4MDIB 2W60A 5C0AB 4KDTA 1T2JA 3BJLA 3ILQD 1ZLVK 4FQCH 2MTPA 1J1XL 5IFHL 3BISA 5IT2L 2MJWA 3CLEH 3V6FB 4TOYL 4ZD3L 3BVNA 1KXVC 4QNPE 1QYGH 5IBTL 1NBQA 2R0KH 4Z7QF 1KPUB 5LKNA 4DTGL 3KJ6L 3DRTA 1UXSB 1XCQA 1EUTA 1OCWL 4LIQL 4NHUA 5FYKU 1TNNA 1D9KA 4GW5B 2JJSA 3REVB 5JHLL 3O2VH 1BLNA 5HPOA 1NCDL 2R9HC 1AD9A 3L3IB 3PXHA 4LSVH 5EZJA 4IRJC 3S35X 4XCFL 4XMLH 2HG5A 4MB4A 4QRPD 2XA3A 1GOGA 3NABH 4PG9B 2B1AH 4G6KL 3VH8A 1CQYA 2ZPKL 1NCTA 5BW7A 3QNXA 2NW3B 3S6CA 1J0HA 1Y6NR 4M7LT 2JCCA 5MENA 3E6FB 2H9GB 4M6MH 5JW3L 2X10A 3HUJA 4LFHD 3HNVH 3FFCA 1KFAL 2ZCKL 1UM4H 4UT6L 2VLKA 3RKDC 4PB9H 2EXWC 4LHUA 3C09C 5ITBL 4C59B 5GS1C 4GO6B 4YZFF 3SDCD 4WV1B 4M93B 3MO1A 1IEBB 1JGEB 1JZ8A 2VRAA 1C5DA 4PTTB 1DQDH 3JV5A 2Z35A 4WFEE 3QFDA 2ZSVA 2NY1D 3RTQB 4BQ6A 4G5ZL 3RZWA 3MFFA 2FBJH 3F65A 1X6NA 1NDMA 1Z9MA 4PRBA 1RJLB 5J7CC 4PD4K 4PJXB 1VEOA 5DO2C 2UZIL 3DSFL 1UWEH 4YE4L 1G7JB 4OZ4A 1P2CB 2DQDH 3LQZA 4PJEA 5LG1A 3WS6A 4ACPA 3CSYA 1G7QB 1MY5A 2LFGA 1YEIL 3BSZH 4HGWB 3VXRA 3BW9B 2DQTL 1SQ2N 1EHAA 3QCTH 2EE6A 1JNHB 5HPMA 5D7IA 5LXGH 1YEGL 2PW1A 2X4PA 4WW2F 3MRLA 2UY6A 3GGWB 4HIHA 1AD0A 4MA7H 3ZTNL 1U93A 1G6RL 4APQA 4BA8A 4Y2OA 1I1FB 2NY4B 4I18A 5EU4B 1CK0L 3VXME 4Z7VB 1VPOH 3BXNA 4CVXA 5CBAB 1WZLA 2R1WB 3NPSB 5E8NA 5CUSL 2DQCH 1EV2E 2VR4A 2Z8RA 4P5TB 1KLFA 1QKZH 1EDQA 3FOMB 1R0AH 2I5YL 5HYQB 4HJJH 2ENSA 2GJ6A 4OKVB 2W92A 2ADGA 3T3ME 4OGAC 1T2QH 3BGFC 1RZFH 1SM3H 1U8KB 4KUZL 4PTUA 4R8WL 4YDKL 4JFPA 4DCQB 3CVHH 2VABA 2UWEE 2RGSA 3K8KA 3E2HC 5T5NF 5I1GH 3HPJA 3EYFA 4PJ7A 1ZXQA 4HG4K 1OD9A 3GIVB 3WS3A 3ULVE 1YECH 4XZUA 3D85B 3O8XA 4MQ7B 2FWOA 5D7SL 2CUIA 4F9LC 4X6DA 1YUHB 4TVPH 3VU2A 1MAMH 2EKSA 4QF1B 1LK3H 3MRPB 1RUPH 1JIBA 4JE4B 2EDFA 3M17A 2M8XA 2CMRH 4GRMA 1F3JA 3L1OL 1U8PA 2GQHA 5C0BB 3GO1H 5FKPB 4KJWD 2AVGA 2X4OB 3VW3L 4DAGH 4TTGA 2EIDA 4NBYB 2I9LB 5DQDH 3WUWB 1G0DA 2HJFB 4BM7A 3MRMA 1RV6X 2JB5H 3ULSA 5C6TL 5HYJE 3QYCA 2PO6D 1KPUA 3QO0B 1LNUB 4ODHH 3EYUH 1UXSA 3MLUH 4PRPB 4XHJD 3TA3B 4S0TD 4TPRL 4TNVF 1AFVL 4Y5VB 1MIEL 4KK9D 4MJID 2PTVA 4HXAL 2HRPL 1XIWB 3SKUD 3L3IA 3P2TA 3N9GL 5GHWH 1G6RA 2ED8A 4L1HA 2N56A 1T20A 1YMMD 2AK1L 2BCKA 5IGXH 4WI9A 4OLVH 2AJSH 3BYTA 4MMXC 1UA6L 4BFGA 1N0LA 1MHEA 3QXVA 3E6FA 3RVUC 2H9GA 3SCMC 3IKKA 2Q76B 3RIFK 3GRWL 3ARZA 3VRLF 5IMMB 5IROA 5ADPL 4NKIL 5ID1B 5IK3B 1A6VL 4YHYB 1QBAA 1R5IA 3WLBB 3RGHA 5HDQH 3WHXB 1UB6A 3B2VL 1XGRA 4WV1A 1YEFL 2HWZL 1OY3B 1P9MC 2K9UA 2OP4L 4YGVB 1IEBA 1V05A 1NCAH 1TJHL 1ZV5A 3O81A 1JGUH 4X0KA 5D9SA 3V52L 4PTTA 2EYTB 4RQQB 2IFFL 4P59L 1KSRA 4FNLH 3DLQR 3RTQA 3HG1D 4WU5B 3F12A 1V3JA 4NC1E 4XPGL 2NX5E 5JZ7D 2OL3B 2NTFB 1RJLA 3BPOB 1WTLA 4LHQB 1HXMB 3MNWA 4B53A 1N5YH 5C09E 5SWSE 4YQXL 5BS0D 2HFFB 3G6JF 1EH9A 5EO1B 1G7JA 4KRMB 1P2CA 1KT2B 1KTDA 1OM3H 5I1EL 3TVMB 1BQHA 4YX2H 2F19H 1G7QA 3NPZB 4OZGE 3WD5L 1XGTB 1MH5B 5EZIL 4AZ8A 1U42A 43C9B 3K74B 2XZQL 3NTCL 3OGCB 2WINB 5GRUH 3BW9A 4NOBA 3NFNB 3NZHL 2BFVH 3QQ9C 4U6YA 2WIMA 4OFPA 4LEOB 4NQDB 3B4NA 2YRLA 2D9CA 3FAXA 3GGWA 1WLHA 4KVNL 3T0ED 1U36A 4XNXL 2VLJA 5EBLB 1OT2A 1I1FA 4Q9QH 5EU4A 4LLMB 3GRWA 4MD4A 5CBAA 1MQKH 1WZKA 2R1WA 4MJ4A 1C1EL 1P1ZA 5TF0A 2DLTA 4DKEH 4P5TA 4AENB 5EO9B 3RFZC 3FOMA 5EU3A 1AGDB 3P3YA 3F6IA 4L9LC 5HYQA 1F4YH 4OKVA 2YD7A 3SKJL 2F8XC 1TPXB 2MCPH 3SPVB 1R5VB 4K3DH 4DCQA 2ICCA 2AQ1A 4NO3B 4ZOEA 5F8QC 3SE3C 2GAZB 5FAAA 2D7PA 3T2QA 3UTPD 4XXCC 5D4QA 1NFKA 4MQ7A 1HYRC 5EUOE 3U2SA 2WBJB 3QCVH 1YUHA 4L4TD 3VXNB 1MHCB 4KVCH 3MRPA 1ND0B 1WWAX 5FGRA 1KULA 5JXEC 1FPTL 4C56E 2ICEB 4JM4L 2R2BA 5C0BA 3ZKSD 5FKPA 5F88B 1AO7B 4XWGH 5FOBB 2OL3L 3FQXA 4Y4KC 1F3RB 1FRGL 4S1DC 2VXTL 1OP9A 1LILA 1RFDL 2DLHA 2ZJSH 4M1DL 4U31A 1HEZA 3R1GL 3TZVC 5HHMD 2PYEB 1DVFC 5CINH 4N1CA 4NHCH 1LNUA 1T5XB 4OLZL 4Y5VA 2IG2H 3T4YB 3KDMB 1ZEAL 4DKAA 4QHUA 3V5DA 1BM3L 3VH8G 3LVEA 3BGMB 3I3DA 5EOCH 4I9WD 1IC4L 3F8UB 4LRIC 2Y23A 4NT6B 4KZEH 4FTVE 4KJQD 5E24E 4WHYG 3U9PH 1RURL 3RVTD 3PQYE 4FHBD 4N0CD 4F7EA 4PLJD 1QPPA 3QIBD 4UMGA 4WNQB 1HINL 5T1KB 1NKRA 4CMMB 3U7WH 2AV1B 4LHUG 4HKBB 4GMTH 2GK0B 1CD9B 5IMMA 1G9ML 3TCXA 5ID1A 3EDFA 3AROA 2K7PA 3RBGA 4QXGL 2AQ3A 4KMLB 2ERJB 2R0ZL 5EA0L 3CH8A 3WLBA 5DJAB 3WHXA 1I1AB 1GGIH 4GXVL 4CL7A 2FSEA 4WWKD 4WUUA 2FCBA 5EDXA 4LSPL 5F7FA 1H3WM 4WUKH 4YGVA 1MCKA 3L3OB 2IJ0C 3LS4H 2XPGB 1J10A 4MXVE 3G08B 1VADB 3EYQD 1SEBB 4Q9BA 2OL3A 2NTFA 3PWPB 3ZYIA 1T03H 2J8UE 2WWKT 2X1QA 1HXMA 3VA6A 2H3NB 3U1SH 3BQUB 3BE1L 2HFFA 5D8JL 3EOTH 5EO1A 5BZWB 3RVVD 4OZIB 4JAMA 1KT2A 3DVNB 2AXJA 3DMMB 3MOBL 3VMNA 4TUOB 5F1SA 4YHLH 3O6ML 1TXKA 5JXAH 3AFLA 4O9HL 3ZYZA 43C9A 4OT1L 1D6EA 3OGCA 1I1CA 2WINA 3MA7B 1Q72H 3NFNA 3RJDA 4EDWL 2NYYC 4RFNB 2RHEA 2XT1B 4G3YH 5F93C 4BJLA 4LEOA 4NQDA 1XEDA 1VGKA 3D0VB 1ACYH 4N8VA 5EBLA 4C58B 5BOZG 4F80A 1QLEH 3MRJB 3ARPA 5CIPB 3VE0A 5AD0B 1G7LB 2V2TB 4R4FH 4AENA 5EO9A 2CLRB 3HR5B 3QUYD 5J13C 1AGDA 3F7RA 3QI9A 3BT2H 1A3LH 4UB0L 3TV3H 3VXOB 3D39D 2BY2A 4NZRH 1ONQA 3M45A 3P30L 3SPVA 2BC4B 1TJGL 1BEYL 1R5VA 1T21B 2OXGA 3MOAL 4K23H 2QSVA 2CQVA 4M48L 4NO3A 1ADQA 3JVGA 2EH8L 2NZ9D 1AQKH 5SWZA 1CVRA 1A1MA 5TQ2H 2YD2A 2C3HA 4D9RE 1Q0YH 1N7MH 4HMDA 2VQ1B 3F58H 5CJ8A 2ESVE 4CU7A 3GSNH 2WBJA 4CDGC 3ZSTA 3VXNA 43CAB 1F90L 1DL7L 3VCLA 2QSCH 1ZLWH 1ND0A 3I6LE 4PJIF 2XRAH 5E70A 2ICEA 5LAXB 4KHXH 3IFPB 5F88A 5INCA 1AO7A 5FOBA 1KCVL 1ZVSB 3U7YL 2FIKB 1LWRA 4I2XB 4CNIB 3SGEH 5M95B 4N0FB 4HUWB 4HK3J 4J3XA 4JFHD 1QSFB 5I19H 3TPUB 4OD3L 4KGLA 1U8JB 1BVKB 3V6BR 2IPUK 1T5XA 3RWGB 1R3KA 5FEBA 5FHBL 4HK3N 5GRWA 1FFOB 4JHWL 2ZKHH 3VFSA 3T4YA 2EEBA 4DZBB 5DJ6B 3MLYH 2PXYB 3LPGA 4XNZC 2APXA 1L7TH 2XIDA 4NT6A 2KQMA 4WI6A 1IZKA 4WW2B 3I50L 4YHOL 3PL6C 4OFYD 4RISL 4LGPB 3B5TA 3PUCA 2R1XA 4JFDD 4XNYH 4WNQA 5T1KA 4RNRA 4FQ1L 3VWKA 4CMMA 1JHKL 1EBPA 2OZ4H 4HKBA 2D3VA 2CR6A 2GK0A 3UROR 4MLIA 4LPVA 1W72A 3JBG7 2FZ3B 4JKPH 4LCIH 4E41A 2OLDA 4JZJC 3QQ4B 4JFEE 1HXYB 4LARH 1T22B 1WF5A 3GMQB 2HT2C 1I1AA 2J88L 1RZJH 1D6VH 3QZWB 3GB7A 3UTQB 5CEZL 4UIKL 1OW0C 3BPCB 1VDGA 4UBDD 1LO2L 1EEQA 4PREB 3N85L 1NCCH 1HH9B 3RIAF 1IFHH 4QWWD 5GRXG 2V2XB 1EAPB 1QA9B 3FJTA 1VADA 1SEBA 1UXWB 2WWMD 3S5LA 4FABH 3PWPA 2D03L 1G7MB 4PJDE 4X6CF 1IZJA 3GBNH 3KR3L 1BQHG 4FQ2L 2H3NA 3BQUA 4AJ0A 4IRJB 4OZIA 2DBLH 5E99H 3DVNA 1WQVT 3DMMA 1OPGH 5GQBA 2UUDK 1OTUD 4G6AD 4WFHE 4PJCF 2IBZY 3AS0A 1LQSR 3MA7A 4RMVA 3T4AB 3DTXA 4PPTA 3GMNB 3GUTA 3MLZL 4IS6A 1JYXA 2EYRA 5CSBA 4MA8L 1CD1B 5D1ZB 2XA8H 1L9MA 1A47A 4ZXBD 1F58L 3D0VA 2I27N 3C09B 2MSPA 5GS1B 1NEZA 1EHLL 1M1SA 1G0XA 3TWCH 3MBXL 1U8HB 3MRJA 2IGFL 1IGIL 5AD0A 4RGOH 5TE6L 2HFGL 3MRQB 4PV9B 1AC6A 1B0RB 5A3ID 2CLRA 2BVEA 2R8SL 3EKCA 3HR5A 4GMSH 2DAVA 3VXOA 2D2OA 1MJ7H 2QV2A 2C4XA 1T21A 5F9WB 4NKDA 5DHVH 5DEFB 4DUXA 2CPCA 5IB1A 3IB4A 1D3CA 2DQIL 4HKXB 1M6OB 3ARXA 3MLXH 3M8OL 4I3RL 4V1DB 2VQ1A 1ZA6B 1GPOL 5JR1L 1PZ5B 2FX7L 3PDOA 3BYYA 3MLSH 4HXBH 4S1SH 43CAA 5LBSL 4GG6F 1V7ML 2G5BB 4MAYB 1OQXA 4X7TB 5FB8B 9CGTA 3QDAA 3OV6A 5LAXA 3IFPA 1CF8H 4N8CL 1ZVSA 3CMOL 2FIKA 3MRFB 4CNIA 3C8KB 2Y1VA 4K9EH 2FEDD 3QUMB 3P0VL 4N0FA 4HUWA 1DEDA 4UDTB 1X5GA 3FONB 1QSFA 3QIWC 3TPUA 3BX7C 5FO8B 2RQ8A 3G6JB 5ANMA 1U8JA 1BVKA 3DPBA 1C08B 4PGJA 4HZLB 5E6IC 3RWGA 3SO3B 3G6AB 3OJDA 3VFUB 4DK6A 3VGHA 5FA3B 1BJMA 4DZBA 5DGQA 5DJ6A 3IDYC 1DSFL 1WBXB 2XZZA 1HHHB 1AGBB 2PXYA 2OCFD 2FB4L 5DTFB 4RGMC 3KS0H 3BGFB 2XTJE 3H3PL 3DOSA 1I9RH 3MX0A 5F8RC 4XC1L 1SBBA 3DRQB 3UJIL 2EDWA 3DURB 3FB5B 3HE6C 2JJWA 3BN9D 1YYMH 1RD6A 1C5CH 3NFPA 2CGRH 1REIA 2FZ3A 5ESQB 2B39A 1UYWH 1R3HA 3EO1B 4PJBF 4XCEB 3QQ4A 4Z7WE 1T22A 4BK4A 2VQUA 4F2MB 5EBWB 4X7SH 4JPVH 5MEOB 2JIXD 3OQ3B 1YYLL 1U6AH 3QZWA 3UTQA 5CP3A 5HHXH 4LF3B 4OZFH 4OIIH 4U6XA 1T5WB 1U3YA 3S98A 2AV7B 2A0LC 3UYOD 4GAFB 2H26A 3P40A 3EDDA 2F74B 1EAPA 2XXMB 3NIDE 1DANU 1UXWA 3QRGH 1A22B 5DJZB 1G7MA 2W0PA 5B22A 2A77H 4Z95L 3VGDA 3OR7B 4ZAKB 3RNQA 4MSWA 4XP5L 5C8JB 4M1GL 5L9DH 4M03A 4IRJA 3VI3F 2OS7A 3VXPA 5IIEB 3QUML 5EU5B 3ZKQD 1NAMH 5T5FL 3ZKXC 5IB2B 1XT5A 2IPTH 1DLFH 4HJ0C 1X4YA 1KJ3H 4TNVK 5F9JB 3T4AA 3CDGB 1EGJH 1ES0A 2P45B 3HE7C 5C08A 4N8VG 3WDHA 2H8PB 3GMNA 3LRSA 1CD1A 4QY8A 3AB0C 2BNQE 4Z7UF 3HZYB 3LKSB 2FGWH 5ISZB 3KXFD 5GS1A 5EFIB 1FP5A 4ZS7H 1X9QA 1MELA 4LSQH 1E28B 3P9WB 4ODBD 1U8HA 4NKQB 3KPQA 3F6LA 4YPJA 3VFWB 4HJGB 4PV9A 2IAMD 3DI3B 4GRLD 3BGAA 1JGVH 3SBWC 3BDXA 5I76A 2CDEB 1SMOA 4M5YL 3V79C 2P42B 2FJGA 1BX2B 3MRIA 2ZWLT 3DX7A 2Q8AL 4W4NA 5BZDB 2X6MA 4OSUH 1AC0A 1M6OA 5DWUH 4LLWB 4P2CG 3TESA 3O11B 5D72H 1DDHA 4V1DA 1ZA6A 2B0SH 3QEUB 4OGXL 2VISB 1HILB 3I2CL 1PZ5A 3GI8L 4I48A 3RX5A 1DQLL 1LO4H 3ARTA 5FO9B 4HIXH 2G5BA 3BP4B 3U82B 3GBLA 4YFEA 5MERB 3VXUD 3OAZH 4X7TA 5EZLB 1SY6A 3UTOA 5T3ZE 3F7PC 2HVJB 1I3GH 4ZMAT 2C3WA 3LHPH 3MRFA 3C8KA 3C8HA 5HGAB 3H9YA 3HNSL 5DMKB 3MRDA 3L5IA 3FONA 4KHTH 4RMSA 1OAZH 4K71C 2IPUG 5FO8A 5GJTL 5L2KD 3OF6D 4NM8H 4W6XB 3G6JA 4P2OC 2BZDA 1C08A 4DN3H 4Y5YB 4HZLA 4PUBH 1SYSB 1RVFH 3G6AA 1VFOA 4JN1H 5K93A 1BFOB 5J06A 1MJJA 1TVHB 5FA3A 1ZHNB 1WBXA 3U30B 2I9TB 1HYSC 1HHHA 1AGBA 4KJWC 4Z0BH 4JFFD 4D0CB 3KPSE 5L2JB 4L9LB 3IDMA 1IM3B 3MRHB 3MYJB 4MHHI 5F72S 8CGTA 4WFED 5SV4A 5B38B 2IANA 3OJ2C 1J0ZA 4BELD 4RGNE 4C54A 1FNEB 2XG4A 3EJYC 2BVOB 3ARGC 2ZOKB 3DRQA 1H5BC 2VDOL 4TTDC 5JHDB 3DURA 3FB5A 3RDTB 4BSWB 5AZEL 4YUEH 4KKLC 1LEGB 4RZCB 1X4XA 4XCCL 3V9FA 1U95B 4F9LA 5ESQA 2IPKB 1I3RB 2Y06H 3EO1A 4XCEA 2IFGA 3NCCB 6FABH 4O02H 1FDLL 2Y7QB 1RZJC 5EBWA 5MEOA 1XZ0B 3BESR 4WCYL 3FOLB 2VDMH 3PV6B 3BWAB 5DSCB 3FO2B 4Y4KB 4MCZA 4GKNB 1FL6B 1B0WA 1T5WA 3O41B 3S5LG 2AV7A 5FUOH 1J8HB 3TT3H 3OAUH 1EIBA 5D7LE 3TZVB 4NQUA 2PETA 3RWCB 3QWRD 5DJZA 3TYGL 2IMMA 3QISA 4LK4A 1IAMA 4GQ9L 3OR7A 4PJIB 3VXMD 3WFHB 4K8RC 4MQTB 5C8JA 5GGVH 3OXRB 1S7VB 1MCBA 1PG7W 4J6RL 1OVZA 3FZUD 3U4BL 5IHLB 5IIEA 5KOVC 2AW2A 1A5FL 3O3DB 5EU5A 3REWB 3WN5B 3KYKL 4AMKH 3SCMA 3CDGA 4XVTH 2H8PA 4IOIB 1NEZG 3CXDL 4H0HB 3L5XH 2WQ8A 3HMWL 3N1MC 3EFDH 1BJ1J 4OJFH 4XCYB 3PABB 3UBXB 3ULVD 1IE5A 4DW2L 3HZYA 3LKSA 1YQVH 5KVEH 5ISZA 4M61B 4X9BA 5EFIA 8FABB 1T1YB 2PR4H 3V6OE 1E28A 3L3DA 4OD1L 5ESAB 3SE9H 2XWJB 1P9MA 4O2FB 3BUYA 1CQKA 4MA1C 2YEZB 2NXZC 2CDEA 5DK3A 2ZUWA 5JA8B 7CGTA 5L8JB 5HYJD 1BX2A 3O2WL 2DLGA 2PKDA 5BZDA 3BZDA 4HULB 3PGCB 1CG9B 3EDEA 2R2CA 2LU4A 4LLWA 3O11A 3P0YH 4BZ1H 4FQCL 1CL7I 2VISA 3ARQA 1HILA 2AJXH 3KPPB 3P9LB 3CLEL 3EOBB 5KSAC 5FO9A 2CDGB 3HA0A 1QYGL 3BMWA 2O5ZH 2R0KL 3BP4A 1EO8H 4JKMA 5J9PB 3NZ8B 3D3VE 5JOEA 4KKCC 2YKLH 4K9EC 1I9EA 2G75B 5F97E 4Y2DC 5HGAA 3O2VL 4X6CB 1R3JA 1A7BA 5DMKA 4LVNB 4RDQF 4HF5H 4C4KO 4LSVL 5BJTB 4Y5YA 4XMLL 5D70H 1SYSA 4JQIH 5B3JF 3NABL 5DC9B 2B1AL 3S96A 1BFOA 5F9DC 1TVHA 5T1LB 2VTFA 4Q9CA 1LK2B 4PJCB 1ZHNA 2I9TA 1ORSB 5J13B 4M6ML 2CXKA 3TBTA 1JFQH 4D0CA 4DGVH 3HNVL 4L9LA 3MYJA 1YN6B 4J23A 3MV7D 5DVNA 3V4VH 3CAFA 2VMFA 5B38A 1UM4L 3CVHB 4CMHC 4PB9L 2NY2C 3MJ6A 3ZDXE 1MLCB 4PRDA 1FNEA 4AEHH 2ZOKA 2IQAB 4ENEC 2NX5D 2AAVA 3SE3A 1EZVY 2XWBA 2M1KA 4XXCA 4AL8H 1T4KB 1LEGA 3ARBC 3T04D 4MNQE 1DQDL 3QZWG 5IG7A 5C09D 5SWSD 2CK2A 2AK4E 2VLMD 2ZUQC 1TCRB 2P5WB 4JO3H 3P4NB 4Y5XB 4NCDA 3L7EB 2Y7QA 1NJ9B 5E2UH 5JXEA 1WAAF 1XZ0A 2ZUUA 1EX0A 2FBJL 1I9JH 3PV6A 4J4PD 4WEMB 1NFDB 5DSCA 3FO2A 1KJVA 4Y4KA 3AU1B 5T3XH 3RVTC 1BZQK 3LH2H 4OCNC 3U36B 2H45A 1FL6A 3O41A 3SGJC 1JN6B 4L3EB 4H88H 4PJ9D 2YPVH 3TZVA 3W11C 3W0WB 1UWEL 1KN4H 1DVFA 4NYLB 4P2QA 1A3RH 2X4RB 5C70A 1Q1JH 2DQDL 2VLLB 3LSOA 3SDXF 4LCWB 4PGBB 1NFIA 3UTSB 4NRYB 4P23C 1WFTA 4GG6B 2HTKC 3BSZL 4LLVB 1DFBH 1URLA 3WFHA 1BD2D 1JPGB 1S7VA 2VJXA 3QCTL 4K3JH 5LXGL 4LRIA 1P7KB 1YY9D 3QEGH 1NC2B 1MJUH 4OCLC 3PL6B 4MA7L 1BWMA 3GMPB 2J3SA 3S3PA 4QOKB 4X5WB 2IMNA 4YEFA 1VPOL 3K2MC 3JWDH 3MRKB 3R4DA 4IOIA 5CILH 5E8PB 3ARVA 2DQCL 3DXAE 5CZXC 3QSKB 3MV8A 1MHHA 3MJ7B 2ZSWA 4JZJB 1QKZL 4XCYA 1R0AL 3PABA 4FFYH 1BZ9A 2DTSA 3FQUB 4HJJL 3BD3A 1T1YA 3P0GB 2GITB 1T2QL 1J88A 4YHKL 1RZFL 1SM3L 2XWJA 4MD5B 4CVWA 1BQSA 3CVHL 3QRFM 1TQBC 2CO6B 4C56D 2P24B 4XGZB 5EPMB 2VQTA 3CFEB 5C0NC 5I1GL 1XGYH 4YBQD 1NC4D 5J1AB 2YEZA 1YECL 3U0PB 1J87A 4TVPL 3VXSB 4L3CB 1MAML 1LK3L 1RUPL 4MZ3A 4PJBB 1T04B 4HMCA 1TTUA 3FFDA 3PGCA 4FOMA 2CMRL 1CG9A 3T3PF 3F7QA 3GO1L 4FZEH 4KK6C 4POZD 1JNLH 4DAGL 4MCYB 4OKDA 1QFPA 3LEXA 3RIAK 5DQDL 2KQNA 4YHNB 4PRIB 3KPPA 3RWIB 5LGKA 3JZ7A 4Y1AD 3EOBA 2CDGA 4CN1A 2JB5L 3RL2B 2H2PC 5GS3A 5F89B 5J9PA 3MJ9H 4FTVD 4ODHL 3EYUL 3NZ8A 3MLUL 3BRGC 4XP6H 2FATH 4U1NB 3CVIH 4X6CA 2F8OA 5GHWL 5GS2H 3MLTA 3QP3A 4U4BA 1CGVA 3H0TB 5IGXL 1B2WH 4OLVL 5FKAB 2AJSL 5T1LA 1S3KH 3MRRB 3QUXC 3HRZB 4UOW0 4R4NC 3ROLA 5CKGA 1ORSA 4HWUA 2YXFA 3GNMH 1WV7T 1YN6A 3OGOE 2A73B 1P4IH 2WAHA 3HB3C 4LGSB 3VDBA 1BGXH 2X5PA 1MLCA 3UMTA 5HDQL 2GIYA 2X4QB 2WUCH 2IQAA 3QG6B 1R24B 2OMNA 1NCAL 1T4KA 1VSCA 1JGUL 3IS1X 2P5EE 3EBAA 2YPLE 1TCRA 2P5WA 4W6WB 3H9SD 3P4NA 4Y5XA 4PGDB 4FNLL 1NJ9A 4OUUB 3IFNH 1A1OB 4E42B 2DRUA 1JRHI 1NFDA 2AXFB 3AU1A 3ZE1F 2PUQT 3TLRA 4ZFFB 5BRZE 3U36A 4CDHA 1JN6A 5CJQH 2HH0H 1N5YL 4U6TA 4ONFH 3W0WA 1IGTB 3JXAA 2A38A 5K9KB 3V6ZB 4NYLA 3GSXB 3CSBA 5E6IB 4LCWA 3IT8D 1OM3L 3LEVH 1P7QD 3BD5A 4PGBA 4YX2L 2F19L 2IEPA 2M26A 3BEVB 2Q87A 4NRYA 3UTSA 1W0VB 4UAOC 4A2LA 4GG6A 5F1IB 4KWUA 5BQ7B 5I8CB 1MCLA 5GRUL 4K7PY 1JPGA 2ADJA 2EDJA 2BFVL 2VDKH 5D93C 4RGMB 1P7KA 1EXUB 2GTZB 5E2VH 5D7JC 3G5VB 3U79A 3ULUE 3L9RB 1PVHA 1JZ3A 2DLEA 3ARUA 1NC2A 3PL6A 3WEXB 3GMPA 1MI5E 4NKMB 4QWWC 5FO7B 4QOKA 3WFZA 4Q9QL 4X5WA 2ARWA 4P3DB 3MRKA 1GIGH 1MQKL 3VFVB 2I26N 1JWUA 4DKEL 1MLBA 3MJ7A 4JZJA 4D9RD 1MVUA 1CGTA 5IBUB 2ESVD 3B9KC 1CIUA 3FQUA 1F4YL 1KTRL 1DBJH 2X9WA 2MCPL 3ZT6A 5SX5H 4GRWE 3DUHA 4K3DL 3VMPA 5DJ8A 5L8KB 3K81A 4J3OC 4OM0H 2P24A 3CFEA 4O5LH 1RIVH 4XMPH 2FHCA 2D7TH 3WCYA 2ARJB 3QCVL 3VXSA 1WWCA 4KVCL 4PJBA 1T04A 1Q0XH 3KPRE 1QHPA 5B39B 3DV4B 3BKMH 5DURD 3U4AA 2CR3A 5IEKB 1W0YT 4MCYA 4JFZH 3OBAA 1J11A 1DBAH 1ZE3C 4OI9A 2ZJSL 4YHNA 4PRIA 2XQYK 3RWIA 3B6SB 3S37H 4YHIB 4J8RB 3VRIB 3RL2A 1KNOA 5F89A 2LU7A 4MS8C 4H0IA 5CINL 4NHCL 1IM9A 3X14B 3H2WA 4MXQD 1RAMA 1TFHA 3HE7B 5F96H 2IG2L 4F57H 1LEIB 2JCCE 5MENE 1JZ7A 2W65B 4XVUC 3FFCE 3QDJB 2ZOLA 3PWJB 1YZZA 5EOCL 4QGTA 1FL5B 4KZEL 5C0EB 4JFED 3H0TA 1FZOB 3HN3A 2DQHH 1T7ZA 5FKAA 3U9PL 1YY8B 3NACH 5B38G 3BMVA 1XCTB 3UAJD 5HSFA 3IGAB 3U7WL 4OCXH 4GMTL 4F7TA 2DYPB 4BQ8A 4ZYKB 4RGNC 5HI3D 4LLQB 2EZ0D 4NWTH 3QEQB 1GGIL 2X4QA 1MCIA 3QG6A 2BNRD 3I02B 1K2DB 1R24A 4P46D 5HYFA 5HHOD 2JELH 2E3VA 2H32H 1ZANH 3T2PA 4WUKL 3NIGE 3C6LD 3GSNB 5EG6C 2VB5A 3RUGE 3LS4L 2P7TB 4FXLA 4PGDA 4LIQE 1F6AA 4OUUA 4HIIA 4EUPH 4ZO8A 3L6FB 1A1OA 4E42A 1QSVA 4WFHD 4KY1H 3SJVE 1ZKAA 1T03L 3MGAA 3VXRE 4ZFFA 1FVCB 5C0FB 1ZS8B 5DJYA 4DOHB 3BD4A 3LKOB 5D2LB 2J6EH 4CJ1A 5D7IE 3U1SL 2VXSH 1IGTA 2Z92B 1ITCA 3QIWA 3EOTL 1A4KB 2DJSA 3V6ZA 3GSXA 5C07E 4NO0A 4P2OB 5ICXB 5E6IA 1HCFX 4JGMA 3CFIC 1SYVB 4YHLL 3VWJD 2AERT 3BEVA 1W0VA 5JXAL 1PBYA 5F1IA 5D2NE 1NGPH 2OMBA 5BQ7A 2N7BA 4HH9B 2EE2A 1Q72L 4MQXC 1OAKH 5J89A 5DQJB 5I1HH 1BBJB 4KRPC 4G3YL 2GTZA 2E7LC 3G5VA 25C8H 3IFLH 1AXTH 5L7XH 1AHWC 3GSOB 1RU9H 1JZ6A 4P3CH 3WEXA 2PO6B 1ACYL 3ARGB 4EI5D 4X8XA 5FO7A 1H5BB 1BHGA 1TCMA 3HE6A 4Q6IC 3JWDC 3MLWH 4P3DA 3ROOB 1QLEL 3MROB 1Y0LA 3VFVA 4PJ7E 2C3VB 4R4FL 4D9LH 1FYTE 2KH2B 3LPFA 3PWUB 3BT2L 1A3LL 4X6DE 3TV3L 1TNMA 3L5WA 5ACLA 4HLJA 4NZRL 5KVMC 5H94B 4KQ4H 2VZSA 4FQQB 3KHOA 3NN8B 4K23L 4JREB 4CVUA 1AQKL 4AY0A 2J2ZA 4AIOA 5TQ2L 4HC1H 1Q0YL 1N7ML 3F58L 1ZGLB 4IMLB 3G6DH 1ZLVH 3GSNL 2E5EA 5KVDH 2ZNWA 2QSCL 4H1LA 3I75B 2FEEL 5TDPB 2XY1A 1HQ4B 1MCWM 1QSZA 2XRAL 4R2GC 2Q1EA 1XR9A 5B39A 3DV4A 4U7KA 4Z18A 3ZKND 4KHXL 4X9FA 2YWZA 1AKJD 5IEKA 1WIUA 5I1AA 1WTGT 5IV2B 1WWBX 2C26A 4OZGA 1YPZF 4P48A 5HI5C 4J8RA 5I19L 2V5MA 3HG1B 3QJHB 2XTJD 5IEHB 1CLYH 4PRAA 3X14A 4N90E 3SDXB 5BMFH 3HE7A 3MNZB 1S9KC 2ZKHL 1LEIA 4KXZI 4OLEA 2VO5A 3HPLA 3T1WA 5BOPA 1S7RB 3MLYL 4KI5C 4UQ2B 3QDJA 1NMCB 5BS0B 3PWJA 2FR4B 1CT8A 4OTXH 1L7TL 3E6HB 4NQCD 5GGSY 2HAZA 5C0EA 1FZOA 1ZHLA 2G5RA 1YY8A 3DVGB 4RX4D 1TZHB 1XCTA 4XNYL 3IGAA 4MA1B 2OZ4L 5F7LB 4YBLC 3SBWA 2DYPA 4O58H 1KYOJ 3UO1H 3RVWD 2AI0H 3SN6N 1P7HL 5D1QD 5F1KC 2W59A 3CNKA 4JKPL 35C8H 4LCIL 2X2YA 3B9VA 4LARL 5DHVB 3T0EB 3QEQA 1EAJA 1RZJL 1D6VL 3I02A 3FO0H 4G7VH 1ZLWK 5EUOA 2VXVH 3GSNA 3S7GA 1NCUA 1FV1B 5KSAB 1NCCL 2NY0C 5HHQB 5MEQA 1P84J 2P7TA 2NY3C 5D1XC 2A1WH 1IFHL 3ZKMD 4ORGB 5FGBC 4KTDH 4FABL 3RWEA 5DYOB 3OKNA 5C0FA 4HZAA 1ZS8A 3C5JA 2F8VA 3GBNL 1T2XA 5D2LA 5GGTH 1FFPA 4ZFZB 2Z92A 3BZFB 4X9GA 4P2OA 1EFXD 2DBLL 3ARWA 5E99L 4X5LA 1OPGL 2DKMA 2BNQD 5IVOA 2HN7B 1F3DH 2CKBA 2JJVA 2NY7H 4HH9A 5C0DB 4N5ED 1JNNH 5DQJA 1BBJA 3JSSA 5DXWA 3WNLA 3N1FC 3JV6A 4ZS6C 2XA8L 3GSOA 1ZVHA 4CMHB 5IFAH 2NY2B 1FZKB 3D2UD 1W8NA 3VGAC 4WEBH 4UOW1 4J2XA 3ARGA 1IAKB 1H5BA 5DA0B 1KC5H 4MB5A 5TF1H 4FMFA 2OZ4A 3TWCL 3WUZA 1QFWM 3ROOA 2MOVA 4OZHF 5CCKH 4RGOL 3VXQB 2C3VA 3ZSSA 4L29B 4LU5H 1A21A 4JFYA 4YDJA 4GMSL 4P5MA 4G8GB 2D7OA 3WIHA 4G6MH 5E6ZA 4PP1D 1MJ7L 2AJVH 4JDZA 4X83A 4J3WA 2VNCA 2EDLA 1W0WB 5C86A 4J12A 4OZFB 3HS0A 5C0BE 1R3LA 5GSVB 4LVOC 3MUZ1 4UZGA 2YK1H 4HSQA 4U05A 2YR3A 5T3ZD 3QIBB 1IARB 3IRPX 1CLOH 4UQ3A 3MLXL 3Q2CA 1C16A 4Y4FD 4PBVC 1ZGLA 4IMLA 4QNPF 4CN4A 4Z7OE 3MLSL 4S1SL 4HXBL 4NFCA 2J8UA 4P23B 5TDPA 1KTLB 2VERN 1HQ4A 5GISH 3HZMB 4L8SC 4KI5F 5B21A 4WWKB 3B3IB 1CF8L 3VI4E 3L5HA 5LGHH 4XB8A 4Z0XA 4K9EL 3I6KA 5HXMA 1WCBA 5MHSE 4UIMB 1U9KA 1NAMB 3W82A 5HDLA 5LQBH 2WANA 1A7PH 2PTTA 2ITCB 3TNNA 5IW6A 2GKIA 3MBED 5IEHA 1JZ4A 2WLZA 4P4RB 3MNZA 4EN3C 1MJ8H 1D5BB 2DMBA 1QBBA 3LB6D 4ZTPH 2R1YA 5DFVC 1Z6JT 4YC2B 1S7RA 4UQ2A 1KCUH 3LN4B 2FR4A 4CN6A 2I07B 5J12C 3OJVC 1YDPB 3MR9B 1RUQH 4J3UA 2FJHB 1CICC 1JPTH 1I9RL 3MCLH 4NPYA 4HBCH 4WUUE 3DVGA 4EZMA 5EN2B 4P5KB 4OFIA 2MWCA 2BMKB 4MJ5B 3WJJC 4G80B 4FFZH 1YYML 3BDYH 3K8MA 2B2XH 1C5CL 2VWEE 3I9GH 2CGRL 4HPOH 1UYWL 1PEWA 4L9DA 5DHVA 3T0EA 1FZMB 4X7SL 4JPVL 4YGAB 1HHJB 1AGEB 4LDLB 1U6AL 4ODSH 5HHXL 1OAXH 3HZVB 5CJOH 4OIIL 4PBXA 2Z8SA 5GZND 4PBWD 1FCCA 1FV1A 4W4OC 4D9QE 4KROC 1TMCB 5KSAA 5HHQA 3D39B 4HCRH 1HI6B 1ZVYA 2IH3A 4WO4C 3QRGL 5DYOA 1UCBH 3VRJB 2OYPA 3MUJA 4MGXA 4CU8A 4Y2DA 2A77L 1JPFA 3GHEH 2LVCA 3PHQB 3SDAD 5L9DL 2FHBA 2OTUB 3EHBC 3A0OA 3JTSB 3BZFA 1X7QA 4QRQB 4BKLB 4MYWB 4NQDE 4TRPH 1B6UA 4JZOA 1BWWA 4KKNA 1NAML 2YD9A 5ITFB 3GSVB 2IPTL 4Q58C 1CS6A 1DLFL 5CJXC 5F7MC 1J1OH 1KJ3L 4XNQA 1HE7A 5C0DA 4J4PC 1VACB 1EGJL 1PYWA 5SWQB 2VAAB 1EEYB 3VD5A 3P4MA 1WZMA 2OQJB 4UI2A 1FZKA 3T3MF 4HLZG 2FGWL 3JV4B 2W38A 5FGCB 3MC0A 4ZS7L 1PD6A 4LSQL 2LU3A 4ZODA 4URTB 2Z31C 3VFRB 1N8ZB 3EOAB 3ARBA 1NUNB 3VXQA 3O45B 3ULVF 5D96B 4MVBD 1MWAH 1S7QA 3PXJA 1JGVL 4G8GA 3RHWF 1C5BH 2E9BA 4PJFF 1H15B 2P1YA 1W0WA 2RFXA 4OZFA 4GKOA 3CUPA 1LE9B 1NGWB 4OSUL 2C4FU 3SGJA 1ZT7B 1AO7E 3NCYP 1RMFH 4H1LG 5DWUL 5ILTH 4Q7DA 5D72L 4Q9RH 3WXWH 5EIIB 2B0SL 4IOSD 5B39G 1JUFB 4WGVB 3RPIB 3ALXA 2DBJA 2X41A 4YAQA 1P5VA 1LO4L 2PYEE 4PJDA 4HIXL 4WHCA 4P23A 4UAOB 1KTLA 2JKXA 4X4ME 4OFKA 2WLYA 3UZEA 5GSRA 1IMHC 1UM6H 3B3IA 1X5ZA 4G42B 5GRJH 1KCSH 4UNVA 1I3GL 4FN0A 5TDOA 5D93B 3LHPL 3QDMA 1PLGH 4UIMA 5D7JB 1NAMA 4NBXB 1S9YB 2AEQH 4KHTL 2SEBB 1OAZL 4PLOB 3C60C 4YBQC 3WHE0 3FT3A 4NM8L 2ITCA 4NNXB 5CP7B 4DN3L 3ARRA 1E4XH 2FD6H 4ODXB 4PUBL 1EGJA 1WK0A 2LAGB 3BKCH 1RVFL 1IQDB 5KG9A 2BSED 4JN1L 1JI1A 2X89A 4G9DA 4JCMA 1IAIM 1OSZA 4KK5C 1JMXA 1YEDB 3E0GA 3KPMB 3LN4A 4Z0BL 4G43A 3D9AH 2I07A 4E41E 4MNQD 2PW2B 4ZUUA 1YDPA 2VL5A 3MR9A 4XH2B 2FJHA 1VCAA 4JKKA 2YPKB 5EN2A 2FLBT 1FNHA 2VDLH 1BFTA 4WRLA 2DQFA 3D18B 4MJ5A 4G80A 2Z93B 3VD3A 4YUEL 4MNHA 2IH1B 5J11C 5ERWB 5D7KE 2Y06L 1UKTA 4Q0XH 6FABL 1FZMA 4O02L 4UINH 4NJ9H 1HHJA 3PWPE 2VDML 4LPTA 4XI5D 1AGEA 3B2UD 5EBGA 3A6CH 3HZVA 2ENYA 1DP0A 3OAZK 4NQTA 3HC0B 5CD3B 5FUOL 3QIUD 4W70A 3TT3L 4XP4H 3WS6C 5L6YH 3BO8A 4OZIE 4ZPTB 3OAUL 2YUVA 4HFWA 4HMEA 1HI6A 1AGCB 1BZ7B 2QHRH 5DJCB 3R8QA 4Z7QE 5IW3A 3VRJA 3JTTB 4DFHA 2A6KB 2R29H 5GGVL 3DGGB 1MCEA 5I1LB 2YWYA 3PHQA 4Z5RB 1TZGH 4F33B 3JTSA 3DXAD 1MSPA 2V2WA 4N9GB 5A2FA 3BI9X 3DYPA 4G8FA 2XTLA 2VC2H 1FORH 1YPZB 4U1KB 3GSVA 5D2NC 3N0PB 2E7MA 3GFUA 3QUXA 5I73C 2EDOA 4AH2B 4KUCD 4AMKL 1RSFA 3CK0H 3CXHJ 2Q86B 3KYMA 1KIUA 1QUNA 4XVTL 1GRWA 4A2MA 5ENWA 1J0IA 2X1XR 2EDXA 3L5XL 1EEYA 3SO5A 1KXTB 3DX9B 3P9MB 3EFDL 3QPQC 3DVIA 1OARH 4OJFL 1TIUA 5KVEL 1GAFH 1YQVL 1FZJB 1MCDA 1U58B 3IDGB 3JV4A 3QO1B 5CEZE 3UTTD 5JW4M 2PR4L 5M7QA 3SE9L 3KLHC 1AIFA 7FABH 1PAMA 3VFRA 1N8ZA 5DC0A 3EOAA 2VH5H 4YZFE 4Y19D 3O45A 1F2XK 1EUUA 3W5MA 4UV4H 5EO0A 3VGGA 5JNYB 3QJFB 3WKNA 4MA3A 3CJJA 4OD2B 1DQQA 4U1HB 1H15A 2EXYD 1XF4B 5FM5M 5A2LH 3DI2B 1LE9A 1NGWA 4KK8D 1ZT7A 3ZT7A 2DL9A 4EXPX 4XCNB 4LBEB 4CADA 4GLRH 4J3TA 1WUNT 4I2XE 1NKOA 2EKJA 2XN9B 3GKZA 2W0FB 3P0YL 4BZ1L 1KPVB 4KZDH 5EIIA 4HV8B 1JUFA 3L7FB 1QSFE 3CDYA 2AJXL 5DUPH 2KZWA 2GY7B 2O5ZL 1EO8L 1KIPB 2RAMA 1T6VN 3FT2A 3O4LB 4NP4L 1EEZB 2AJZA 3QA3B 2YKLL 2DLIA 4JO1H 5ESVB 1YJDH 3FQRB 1HSAA 5D7JA 3PWNA 2MHAB 1AHWB 1NGXB 1S9YA 1WITA 3Q5YA 4HF5L 3RZCD 5EC1B 2SEBA 3BJ91 4OF7A 1KJMB 4NNXA 1F00I 5D70L 1U2CA 4OI7A 4JQIL 1IQDA 3MRNA 1OGAD 4ZUSA 4HIJB 4NZTH 3OL2A 1YEDA 1A7QH 2EDDA 1QO3B 1JFQL 3B9KA 4DGVL 4Y16D 4LOUD 2YPLD 5KW9H 2A74B 1T80A 4PJ5B 3V4VL 3PP3H 4XH2A 3SDDC 4NO2B 3RX7A 4DZ8B 1QQDA 3FB6B 4AK1A 1Z9OA 1WT5C 3Q5OA 2YPKA 4TNWF 3IJHB 4AEHL 5C3LD 5BRZD 2Z93A 4AL8L 2Z4QB 4PV8A 5GRVL 4OI8A 3CX2A 4JO3L 4F58H 5DZLA 4PIRF 3W9DB 5E2UL 4R2GB 3KXFB 4CJ0A 4PLKD 4N1HB 4WW1B 4OIBA 4HUNB 3SKNA 1I9JL 1NMAH 5BVJB 5T3XL 4ZOAA 4ZSOB 2JE8A 1HNFA 3LH2L 5HGDB 3MJGX 4WU7B 2IAMB 4M7LH 2KBGA 5CD3A 4H88L 3TO4C 5HI4C 2YPVL 2XKNB 2DQJH 1KN4L 1A3RL 1R5WB 3HAEH 5CGYD 3ULUD 1Q1JL 2WBWB 1BZ7A 5DJCA 3E1F1 1MI5D 2EH7H 4RBPH 2EZ0C 3JTTA 2FBOJ 1U8NB 1DFBL 2ORBH 2A6KA 4Y4HC 3DGGA 4Z5RA 3OHXB 4IRSD 4GAYB 2O26U 4K3JL 3MCKB 3X12B 4N9GA 3WXVH 4Z78B 3QEGL 2NY4C 1MJUL 1RIHH 4U1KA 1I7UB 5FA4A 3VXUB 1T0NA 1GOFA 3BZEB 4XPFL 2HT4C 1UKQA 3KPSA 4ONOA 2Q86A 1CBVH 1P53A 2VKXA 3JWDL 4YBLB 5CILL 5IOPB 4AM0B 2Y6SC 3VG0H 3VRLE 4FFYL 4CVZA 5L2KB 3RAJH 1FZJA 1U58A 4JLRA 3CZFA 1I8IB 3QO1A 4NWUH 3LN9A 3PP4H 4EI6A 3E8UH 5GRVK 4HK0B 1MEXH 2P4AB 4U0RB 4RRPA 4ZO9A 2PYFB 4AYFA 4RIRB 1D9KD 1XGYL 4V1DE 4OZFG 2H6PB 2HKFH 4JFFB 5D1XB 1RZGB 2QSTA 4GW1A 4OD2A 2YC1A 4U1HA 5ETUB 5SV3A 2X7LA 4ORZC 1UVQB 1U8QB 4HWBH 2BY0A 3ZHLA 3STZA 4XCNA 4LBEA 3FTGA 1FIGH 5D7LA 4FZEL 4XHQA 3VFTB 4NDMB 2XN9A 1IAII 2W0FA 3H7LA 3RGVC 1JNLL 5MEND 1KBGH 4HV8A 2N1KA 3L7FA 4JPIB 3B43A 4ETQB 3G6JE 3TP4A 1HSBA 3TA3C 2LQRA 2VLKD 3MJ9L 3O4LA 4LHUD 5J56B 2EE9A 3RWFB 1H3VA 2BOBB 3QA3A 1VKXA 1AR1D 4XP6L 3BZ4A 1JK8B 5CAYB 3KLAB 1XIWC 5ESVA 1N3NB 3H9HA 2R69H 4U33A 2E7LA 2FATL 5B4MC 3CVIL 3DSNA 4HUXB 1AHWA 1NGXA 4L8BB 3VG9C 1PY9A 1WBZA 2IWGA 5EC1A 4HKZB 4I0PC 2VZTA 4AIZB 3VGAB 1KJMA 3P4OB 2OSLB 1IJ9A 4Q6IA 3OB8A 4YXHH 4O51B 2N4IA 3HRPA 1B2WL 1S8DB 4HIJA 1S3KL 3MREB 2R4RH 1CE1H 3TJHD 3S8WA 1K4DB 5MP6H 3FKUS 4K7PH 2LE9A 3GNML 3B9AA 3OKYA 3S4SB 3GMOB 2A74A 1P4IL 3LRGA 4PJ5A 4PB0H 3DX6B 1BGXL 4NO2A 1A6TB 1DANT 3IAQA 4DZ8A 3FB6A 1BOGB 3VFMB 2R4SH 1EERB 2WUCL 4I5BB 5KZCD 4KKBD 3TIEB 1RZIA 5TPWH 3VXRD 4W81A 2D31A 4LRNH 4QTHA 2VWEC 4TN9A 3T0AA 2YOCA 1MFAH 1KIRA 4G8IB 3W9DA 4L8SB 1EA9C 3BPOC 3IFNL 4WW1A 2GFBB 3W2DH 1RIUH 4APQD 4PJFB 2P44B 3WO3B 3ARDC 3D48R 1UEMA 4WJ5B 4ZSOA 3OG6B 2NZIA 4NNYA 1N6QH 3BP5B 5HGDA 1HZHH 5CJQL 4WU7A 5HJ3B 2HH0L 3KLDA 4ONFL 4IM8A 4O4YH 3PNWB 4PJ8C 4OFDA 3TVMC 4OQ1A 1WIPA 3MJ9A 1R5WA 3D3VA 2GJ6D 1H3PH 1T1WA 3LEVL 1Z5LB 2YUZA 1VFMA 5D5MF 1U8NA 3AS3A 3MXVH 4Y88A 5HGGS 4Q97A 1TDQA 5TJWK 1OAQH 4ZPVA 2JK5B 1Y6KR 3OHXA 5MI0C 2VDKL 4FMKA 1CFBA 5J12B 3MCKA 3F5WB 3X12A 5E2VL 1HWHB 4KQ3H 3O8XD 5ISZE 5H8DA 4BK5A 5JOFA 1I7UA 5I0ZA 4LLYB 5J3HD 1G9MC 5IKCB 4BZYA 3JUZA 1GIGL 3IS0X 5IOPA 4AM0A 5DGRA 5J57B 5FXCH 2VDRH 2YZ1A 4LKCB 4NQED 1TPXC 3IKCB 2H2SC 4ODUB 1YA5A 4ZDHB 4BH8A 1I8IA 1T66C 1U92B 1DBJL 2H32B 3K2UH 1RUMH 5I71B 2PYFA 3MGOB 1LO5B 3UC0H 4LSDA 4OM0L 2AK4A 2R0LH 4O5LL 3LRHA 1RIVL 4XMPL 2D7TL 4Y7MA 5D1XA 1RZGA 3MUGA 3L3GA 4N9OB 3WFCH 4EUPB 2VDNH 1H9VA 3MV7B 5EBMB 5FGBA 4MJ6B 4WO4B 1UVQA 4XBPB 4DEPC 1U8QA 3T1FB 5DK0A 1Q0XL 4XPAH 4N90D 4UOJA 4GFTB 3VFTA 4UU9B 3BKML 4NDMA 1C12B 3GJFA 1VEMA 4JFZL 3SHSA 1DBAL 4JPIA 2YBRB 3S37L 3STBA 2BSRB 2FRGP 5DHXB 2YD6A 3JWOH 3UPRB 4PRHB 4A6YH 5F6IC 2MMXA 4JQVC 3RWFA 4K55A 2OR8A 5F96L 2BSSB 4C83B 3KLAA 1ED3B 3EGSB 5E00B 1N3NA 4F57L 1SEQH 4FXKB 4HUXA 4L8BA 3SDYH 5IESH 4DGYH 3CC5A 4OLYH 1UH2A 4HKZA 5ACZB 4AIZA 2HLFC 1KB5H 5IB4B 3P4OA 4JY6B 1GHFH 4GXUM 3RTQD 3X3FH 4O51A 2Z31B 3MRCB 2DQHL 2NPLX 1S8DA 1UADC 2XY2A 3NACL 5JHDE 2CK0H 2W91A 5IB5B 2DMKA 3UJJH 3DO3A 1BD2B 1K4DA 2MNUA 5SX5K 4OCXL 4J1UB 4PJHF 2I60H 2A9MH 3HCVB 1D5IH 3GMOA 5AAMA 3S4SA 3D6GA 4I3SH 3DX6A 1MREH 5E9DB 3OX8B 1A6TA 4HHAB 4NWTL 3J8F7 1BOGA 3UP1A 3VFMA 5K9QI 3FHAA 1UJTA 4I5BA 3S37X 2OR7A 3UTZB 1A7RH 3TIEA 4YJZL 2JELL 2FO4B 3O6LH 3LEYH 1ZANL 1H0DB 5GZOC 3VGEA 4Q2ZB 1QSEB 2BSTA 3TBWB 5IW1B 3NIDF 1K3ZA 4NCC2 3RHWK 2X4UB 2Q6WB 4L8SA 4ONHA 1VENA 2QL1A 4WFGE 3VFNA 2GFBA 2VLJD 2DI9A 4U1IB 1NLDH 2Y07H 1Q38A 4KY1L 4WJ5A 4TUJB 4U1SB 3OKOA 3EO0B 4WI4A 2J6EL 5HJ3A 1AQDB 5C71A 3MJ8B 2VXSL 1NC4B 3PNWA 2P46B 4P5TD 5DLMH 4XBEH 3GZKA 2FL5B 2ATPB 1DQMH 4ELKB 1KF9B 1XR8B 3DHJA 4EN3A 2OR9H 1XH3B 4M43H 5KBNC 1A6UH 3EO9H 4RFNC 4F8TA 4YXKH 2JK5A 1IBGH 1OAKL 5LCVH 1CD0A 3OZ9H 3TCLB 1KCLA 3MV8E 5I1HL 3I85A 25C8L 3IFLL 1AXTL 5L7XL 4Y1AB 1RU9L 3FN0H 1CICA 4KKAD 4P3CL 1ZGLP 3B5HA 4ZOCA 1DQJB 5IKCA 1CWVA 3MLWL 3WJJA 2EDKA 1N59B 3S88H 5C0BD 1OHQA 1IGJB 3IXTB 5FDWB 5JO5A 5J11B 2R23B 1EJOH 4OCRH 4D9LL 4RRPG 4JO2H 1NGZA 2HRLA 2P49B 2GJZA 4ODUA 5DMGC 1CCZA 1K4CB 4N0UB 3WV0A 1U92A 2ZCLH 3BH9B 4M7KH 3EJJX 4KQ4L 2H32A 1E6JH 4OFVA 3MODH 2ID5A 1LO5A 2P5EA 3BPNC 5E08H 1UZ8B 4X7CC 5B3NA 4CAGA 3B83A 4W4OA 2DKUA 4HC1L 1CTNA 4ZUVB 2D9QB 5MHSD 2AABH 2OJZH 4EUPA 3G6DL 1DCLA 3IFOA 1X44A 3MV7A 4V2CB 5EBMA 1DBBH 4MJ6A 4WO4A 5KVDL 3CCHB 4YFDB 2F54A 15C8H 2J6EA 5SX4I 1G84A 4LCYA 2XFXB 4UU9A 3V8OA 1P4BH 4X6CE 1A9BB 1I8LC 3GSRB 4Y89A 4EQ3A 1E4JA 3AREC 2BSRA 4L1DA 3H9SB 3MV11 1ZT1A 1II4E 5CJXA 3AC0A 3TF7C 4PRHA 2JB6B 1CLYL 3FL7A 4PLNC 5BMFL 4J4PA 1T1XB 2BSSA 4WUUD 4PJCE 4C83A 1ED3A 5E00A 3QULA 2Q3AA 4FXKA 2AKRB 5D6CB 1MNUH 1ZWIB 1QPXA 4IOFC 4C57C 4NRXB 3QFJB 4I3GA 4OTXL 5IB4A 1BBDH 4WW2C 1CDGA 4S2SB 4IDLA 4WHYH 1JV5B 4X4XB 1P7QB 2HMID 2Z31A 2D7MA 1WEJH 1KOAA 1FAKT 1GC1H 5IB5A 1XF3A 2XI9A 5CD5D 4B5EA 2F53B 5KSVB 1BD2A 3EAKA 4HS6B 4J1UA 4TVPE 3SOBH 4O58L 3UO1L 2AI0L 2P5WE 3C08H 3CSPA 4D9QD 1ZT4B 1W2KT 5E9DA 35C8L 1F8TH 1HNGA 4LSSH 3CU7A 4HHAA 2XYCA 5GGVY 3HHRB 2BHZA 1CFTB 3FB8B 4JFXB 2C7UB 1NDGA 2GT9B 1NFDE 3FO0L 3UTZA 3Q0HA 4G7VL 4HC1A 1KN2H 4PGEB 4X6FB 2FO4A 2GY5A 3P73B 2FHFA 4L3EE 2VXVL 4PY7B 4B50A 4QRRD 4Q2ZA 1QSEA 5LVEA 3W0WE 4P57B 5I66B 2DQUH 3KPRA 4NQDD 4LCWE 2A1WL 1L7IH 1IEAB 2QLVB 3UTSE 4QLRA 4GG6E 4KTDL 4TUJA 4L4VB 4PYHA 4U1SA 3O6FC 3EO0A 4M9OA 4XAKE 5GGTL 1M7XA 5F7KC 1AQDA 3MJ8A 4DUVA 3OKEB 3C60A 1NC4A 2A9NH 5C6WH 1ACZA 2K7QA 1ZHKB 4R90H 2IBZX 3QI9D 1FO0B 4PP2B 3GMLA 4FQHB 2DMCA 1FVEB 1XR8A 4QOKE 3MA9H 4JPWH 3ZTJG 2NY7L 5F3HB 3BP7B 2ZG2A 1B4RA 5SWZD 3OG4B 3TCLA 1JNNL 5D1ZC 2GSGB 2W9LA 2MKWA 4J7RA 1HHKA 4KTEH 4MNGB 2VIRB 3SDDB 4WHTA 2WBJD 5IFAL 5AZ2H 5EULV 3WIFA 4WEBL 1PSKH 5FHAH 1A1NB 4AQOA 1DQJA 5C9KA 1KC5L 4UNUA 5TF1L 2A6IB 5A1AA 2GW5A 1N59A 1YN7B 5CCKL 4YIQA 1IGJA 3BIBX 5FDWA 3V5HB 1BAFH 3KYOB 3LDBB 1S78D 2NY6D 4NZUH 4LU5L 3CFJA 1K4CA 4N0UA 4NJAH 4G6ML 3VXSE 3DETD 5F9WC 5F3BB 3BH9A 5EU7E 2AJVL 2WUBH 1HIMH 4PJBE 2VR5A 4TNWK 3RNKB 2BHYA 2QKIB 3SGDH 3WFDH 5IFJB 5JDSA 3RUGA 5JOPD 2D7QA 1UZ8A 4Z7NF 5DRZB 3NVQA 2YK1L 1U8OB 5DZOA 3VDCA 3TO4B 1CLOL 4AEEA 5IHZA 4ZUVA 5DD3H 5DHYB 3PJSB 4PRIE 4HUMB 3RX8A 1NGYA 2Y72A 4MAYC 5DJDB 3SJVA 3CCHA 2F9BT 5M94B 4JY5H 5KAQG 1VESA 2DM4A 5GGTA 5GISL 4JDTH 2BNRB 4P46B 1R6VA 4R7NA 1MCPH 2KZ1B 4Y4HB 5HHOB 5C07A 5T1KD 5LGHL 3VWKD 2DQTH 1Z9SA 5KS9F 5I30H 2NXYD 3DWTA 5LQBL 1RK1B 5D2NA 4E41D 1A7PL 2JTDA 3SO3C 3VI3E 2IADB 1ZOXA 2X9XA 5IM7B 4DN4H 1I1AD 4PJGF 5F9OH 3SY0B 4XTRD 1MJ8L 2BVYA 5FFLA 2AKRA 4ZTPL 3MLVH 5D5MB 5D6CA 2HT3C 2V5YA 1KCUL 1QNZH 1CXIA 4NRXA 3QFJA 4G9FB 3U0TB 4JJ5A 2Q7YB 1FGNH 5D7KD 2Z91B 4S2SA 4H8WH 1RUQL 2CXGA 1JV5A 1WZ1H 1P7QA 2AEPH 5C0GB 1JPTL 3MCLL 3S4SG 4HBCL 4XPTH 1G1YA 1FYTA 2DM2A 2DL2A 2VLRD 3PWPD 4MDJB 3VFGH 2F53A 1MWAB 3VFOB 3EYOB 2JJUA 4HS6A 4FFZL 3O9WC 4WFFD 3BDYL 3DO7A 3BQUD 4P2YA 3I9GL 1ZT4A 3O3EA 4OLUH 3LKPB 4HPOL 4K94H 4FS0A 3DMMD 4MDIA 1CFTA 3FCTB 5C0AA 4JFXA 4EI5B 2C7UA 3NA4A 2GT9A 4PGEA 1VFBB 4ODSL 3MLRH 2APFA 3ZDZF 3RGVB 3V6FA 5I1DB 1OAXL 3IDXH 3P4LA 2D7NA 5CJOL 2C3XA 1RZ7H 3ZYJA 5E2JA 4P57A 5I66A 1RY7B 3KNBB 3L3HB 4GW5A 4HCRL 4IHOB 4XP1H 4ZAKC 3REVA 5CKAA 4L4VA 1UCBL 1DN0B 4TPRH 2K3TA 5FCSH 1RZKC 3GHEL 1NBVH 3VG9B 3OKEA 4I0PB 4HGKC 3V0WH 1BF2A 4PG9A 2ICWB 3WNMA 5DRNB 4JO4H 1RULH 1ZHBB 4TRPL 2NW3A 3TFKD 3CZJA 1FVEA 5JIPA 1NSNH 5FF6B 3RA7H 5CEZD 4PY8J 1J1OL 2XICA 5F3HA 5BV7H 1OTSC 4L8DB 4XWOD 4CKVX 5F7UA 5JQHC 2L7UA 2GSGA 4B7IA 4DGIH 3EOYG 4FZ8H 4MNGA 5HYIA 2VIRA 4K3GA 3SDDA 2QBWA 2P43B 3MPCA 5I1CH 3MZGB 1WT5A 1QP1A 1FYHB 5T1MB 5TDNB 1A1NA 1FG2B 1JGEA 5EOTB 1BFSA 3ECBB 2A6IA 4LEXH 2VZOA 5ELIA 1MFEH 4S1RH 3V5HA 3KYOA 1V3LA 4LAQH 1MWAL 1ZLSH 3VMOA 4ELMF 4NQSB 1QSFD 4O2EB 4PJHB 1C5BL 2WBKA 3LKNB 4NQCB 4E9LA 1WISA 4O00A 1XGQB 2D4DA 3ARDB 3RNKA 1MHPH 4PJXA 5DEGB 3VD7A 4B0MM 4EUPG 2QKIA 4LQFH 3BKJH 3IAPA 1U8OA 2XQBH 3QG7H 1RMFL 3NCBB 1TZIB 1LDPH 2NMSA 3TO4A 5ILTL 1GZQB 2C9AA 4PJ8B 5FGSA 4Q9RL 3DVFA 3WXWL 1U8LB 2FEEI 2PXYD 2OJEB 4HCRA 5D1QB 5DJDA 1MAJA 4FG6C 1HN1A 4HGWA 1EVTC 4LNVA 4ZNEA 1JNHA 4FFWD 2NR6C 1MUJB 1BIIB 1UM6L 2VXQH 4FQXC 3V0VB 3SGEI 4Y4HA 5GRJL 1KCSL 5KSBF 5MI0B 5IBLC 1PLGL 1DUYB 3QDJE 1XFPA 5KN5B 1H3UA 3QCUH 3D0LB 3EJZD 4Y5YC 2AEQL 4K3HA 1RK1A 4Z7VA 2IADA 5IM7A 1GOHA 1E4XL 4QEGA 2FD6L 4JM2D 5I16B 1QRKA 2HTLC 3BKCL 1NMBH 1HDMB 2V7HB 3U30C 3SY0A 1NANH 1CXHA 3THMH 3ET9F 2AXHA 2X70B 5D5MA 1EFQA 5E0QA 1J9CT 4G9FA 3CLFH 2YA0A 1U8KA 3D9AL 2BY3A 3L3KB 2O5XH 1EFXB 4LMQI 2Z91A 5DT1H 4O2CB 5JLZB 5JA9A 3QEQE 1NCBH 2YS4A 4U6VH 1CFSB 3KPLB 3RDTC 1GC1C 3GIVA 4MDJA 3D85A 2VDLL 2L4OA 3PIQB 4QF1A 1UZ6F 2R9HD 3BWUC 1EHNA 4IRJD 3LKPA 5HDBF 4NNPH 3CFKB 1GXEA 4DEPB 4Q0XL 1BMGA 3D2UB 5C6PB 4UINL 4NJ9L 2X4OA 2ADFH 1VFBA 2I9LA 3WUWA 5H35B 3RGVA 4DOHE 3G5XB 3A6CL 2X4NB 5D2LE 2HJFA 1ETZB 2R39A 3LOWA 5C08D 1VEPA 5AUMB 1R3IH 3QO0A 3OWEA 4XP4L 5L6YL 1LE5B 3KNBA 4PRPA 3TA3A 3L3HA 2V9TA 1CGUA 3RKDD 3U0WH 2EXWD 5F6IB 2QHRL 5F1NB 1XIWA 4N68A 1XF2B 1F4HA 2R29L 5I15H 4I0PA 4Y4FB 1TZGL 5E5UB 2ICWA 3WN5C 4JGJA 5DRNA 4XC3H 4LMQE 2VC2L 1FORL 3UDWC 3LPWA 3CH1B 2Q76A 4UT7H 1X5YA 3NFSH 4L8DA 3CK0L 5B3JE 3U6RB 3VD4A 5IK3A 4KJPC 1UB5B 5DO2D 4PS4H 1D5ZB 4V1DD 2J4WH 5CSGA 2ED7A 5EOQH 1OARL 4GAGH 4OCYH 1U8MB 3MGTB 3N1QC 3T77B 1GAFL 1LHZA 1J7VR 5FYJD 2NY5H 5T1MA 5TDNA 1FG2A 3DX8B 3CX5K 3ECBA 1U3HC 4P9HH 1AGFB 3T08A 1ULVA 7FABL 2EYTA 4RQQA 1S7WB 2VH5L 4U49A 4K7FB 1K6QH 4X80H 4WU5A 1JTTA 4UV4L 1ADQH 3OSKA 3ZHKA 4O2EA 4PJHA 4Y8AA 4J3VA 3LKNA 3F62A 4NQCA 5ADOH 1XGQA 3ARDA 3WIIH 5DEGA 1PKQB 2EDQA 3TN0C 5DDHB 2VSCA 5J3HC 4NIKB 1TZIA 3WFBH 5JORB 4JJHA 1INEH 1GZQA 1OGTB 4PJ8A 3TVMA 3HAEB 3PWVB 4KZDL 1U8LA 2A83B 2EEAA 4M3KB 5BO1H 1XGTA 1MH5A 2OJEA 1Q94B 3DHMA 5DUPL 4EXKA 3HG1E 4OGAD 3TC9A 1ORQB 4LKXB 2IAND 3ZO0A 1K8IB 4HPYH 3SDXE 1MUJA 2DI7A 3V0VA 5C0CD 1NUGA 5F7NC 4WI5A 4IRZH 5A2JH 4LVNC 3HUJF 4JO1L 4DQOH 3DYMA 1RZ8B 4BSJA 2ARJQ 4U1GB 3JUYA 5KN5A 3D0LA 2GTWB 3FT4B 4LLMA 5TE7H 3CFBB 3C5ZC 1JWSB 2EE3A 3MNVB 1DLHB 1JTPA 5I16A 4XPHH 1HDMA 2V7HA 2O93L 1OQOA 1D7FA 2WQRA 4NZTL 2X70A 1H3XA 4ERSH 3HC3H 1A7QL 3F7YB 5K9OB 3ZE0E 1NLBH 3CGTA 5FK9B 1JPSH 3L3KA 5KW9L 1P6FA 4H8WC 5JLZA 1CXFA 3T0EE 4NQVB 4M4PA 3MRBB 1EZVX 1UCTA 1W72H 3LS5H 2NW2B 3BPNB 2GAZA 3KPLA 4X5XB 1S7SB 4DVRH 3PIQA 4XAWH 1MHCA 3ZMRA 3MV01 5HVHC 3AMKA 5FECB 4Y5XC 2GJJA 4PJEF 4K94C 3QDGB 3CFKA 4F58L 3RWJB 1E6OH 1YC8A 3FQNB 3HZKB 2VE6B 3LQAH 1V3KA 5H35A 1NMAL 2AGJL 3G5XA 2X4NA 3RVUD 3SCMD 3B8SA 1ETZA 2PYEA 3T3PE 1MVFA 4M7LL 4NFDA 3AREB 3O0RH 1LE5A 4X4MA 2DQJL 1FNLA 1UJ3B 3KDMA 4JQVA 5ISZD 2B7DT 5F1NA 2R0WH 2AS5M 1A6PA 2EH7L 1H8SA 2MPAH 3ARYA 3BGMA 1XF2A 1IGMH 2ORBL 1AE6H 4GBXD 4BQBA 2OTPA 1JZ5A 2BRQA 1NBYB 3WXVL 3SQBA 4D3CH 2HJLB 3RVXC 1FL3B 3EFFB 1RIHL 5KS9B 3CH1A 2AV1A 3ARFC 3HNTH 4JZNB 3PP3K 4BUHA 2Y5TB 1CBVL 2X40A 5JMOC 2QJDA 4FP8H 1UB5A 4PJGB 2EIZB 1FFNB 4PD4J 3WLWC 5DJAA 1D5ZA 2CIIB 4JRXB 2YUWA 3VG0L 4G8GE 1K8DB 2LAAA 1U8MA 3MGTA 4ODTH 2O61B 3WJLC 3RAJL 4TULH 4NWUL 4AEIH 3DX8A 3PP4L 1GH7A 3E8UL 4FFVC 3L3OA 2IC2A 1MEXL 3WMSA 1AGFA 2J7LA 5E95B 1L6XA 2XPGA 2X1OA 1GJIA 1IEHA 1CDHA 4BYHA 1VFAB 1I7ZB 3QQ9D 1KELH 4K7FA 5C1MB 1RPQA 2HLAB 3G08A 1MRDH 3QXWA 2HKFL 2V17H 4XB7A 5EU7C 1I3VA 1N4XH 3OR6B 4Q6YA 3QXDB 4JQXA 3V4PH 4NC0B 1PKQA 4HWBL 3O6FB 5FYKD 5I8OH 5DRXB 3FMGH 4FQJH 5BZWA 1FIGL 3QWOB 5JORA 1DUZB 4LSUH 3SQOH 3QDME 3VDAA 3GSUB 4TUOA 1OGTA 2GI7A 3HAEA 3PWVA 4RBPK 2A83A 1KBGL 3VJ6B 3HFMH 1Q94A 3QUZC 1QFWH 1ORQA 1U3ZA 3ARSA 1K8IA 1X5JA 3Q6GH 4IDJH 4ZTOH 2R69L 1RZ8A 4AG4H 2P47B 3G5YB 2J12B 1QR4A 3QIUB 4MJ2A 4HG4J 3FT4A 3CFBA 1IC7H 4KPHH 1JWSA 1FHGA 4U3XA 3MNVA 5CIPA 5HVFB 3NBNA 1G7LA 3QNZB 5JXED 4YXHL 4QRSB 2CJUH 2V2TA 1FVDB 2BVTA 2DM7A 1S9WB 2W9EH 3ES6B 2R4RL 1NL0H 1CE1L 1FFRA 4Y4KD 3HC4H 3IU4H 4JEGB 4W68A 4S1DD 3F7YA 5MP6L 4K7PL 2H41A 1EPFA 2BC4A 5FK9A 3TZVD 4PB0L 1DVFD 4M3JA 4NQVA 4P2QD 4L8CB 3MRBA 3ZL4H 4JFQB 5GGRB 2NW2A 2R4SL 4K2UH 4WFGD 1OLZA 1S7SA 5DUMH 5TPWL 3BRFA 1ROWA 2QADD 2DDQH 4LRNL 1S5IH 5FECA 4LCCC 4UTBH 3WUWG 2DQGH 2X09A 3QDGA 1MFAL 4XPBH 1PKOA 1GZPB 3RWJA 3O4OB 4RAUB 1AXSB 3FQNA 4ELMB 3UTTB 2X05A 4I2XA 5HD8C 4IMKC 3HZKA 2VE6A 3W2DL 1RIUL 1FCGA 5HGHB 2NQCA 4KC3B 4N0YH 1AH1A 1INQB 2RCSH 2LABA 1HKLH 3P11L 3ZE2E 1N6QL 1I8LA 1FN4B 4OAWB 4Y19B 1HZHL 4KRLB 3M1BB 3AREA 1IAOB 2FX9H 4E5XB 3MV8D 4O4YL 1SJVA 4MD0B 4A6YB 1FFOA 3H6JA 3TBSB 2EDEA 4JPKH 1WSST 4K7PX 3FO9B 3LAFA 4M6OH 1Z2KA 3MXVL 3ILQC 2FLRT 2PCPB 4RMRA 1OAQL 1KB5B 4OQTH 2R2EB 5KSBB 3WFEH 1LP9F 4WW2A 1QHOA 4KQ3L 2VKWA 4RMWA 2HJLA 4LLDB 3U9UB 5I0DA 5FGCE 5KS9A 4IBLT 4QT5B 2EYSB 2C4FT 4JFOB 3O9WB 1DBKH 4PJGA 3WL9B 1FFNA 1HXYA 2EDYA 2YMXH 5FYLD 2CRIA 2CIIA 3GMQA 4JRXA 1MCCA 2VDRL 2WNGA 1K8DA 3T0DA 2P8LB 3LY6A 4RMTA 3GMRB 2DIAA 3BPCA 4P9HC 3IF1B 1MRFH 3K2UL 1RUML 2G9HB 4PREA 1OGAB 5I6XC 3UC0L 4LSRH 1HH9A 3ELAT 4P3WA 4CW1B 4EIGB 1NGQH 2NYYD 2NCMA 2R0LL 3GHBH 1YMHB 2V2XA 1QA9A 2KUTA 2HLAA 5IF0B 4FQLH 3VXTB 4Z7OF 3G5ZB 2NLJB 3WFCL 4JRYB 2VDNL 3OR6A 3QXDA 3OAYH 5FIEA 3SDCC 3O6FA 3OXSB 1CXLA 2VN7A 5FYJH 4XPAL 1QG3A 5T1LD 3QWOA 3NCMA 1DUZA 2Y5EA 1X5IA 5E4EC 2ZG1A 1SY6H 5EZOH 2BXYA 3VJ6A 2NY1C 3R06B 4DK3A 2ZZUT 3FRPA 1TTGA 1M71B 2RJMA 2AEWA 2EICA 3JWOL 1J05B 4A6YL 2X1WL 1TJIH 1HHGB 5D1ZA 1SEQL 1MCQA 3SDYL 5IESL 3QIUA 4TVPD 1A64A 2N7AA 4DGYL 4OLYL 1F4XH 2XKSA 1KB5L 1S9VB 2P5WD 4OB5H 5IUSA 1GHFL 3X3FL 3MRQA 4YK4B 3QNZA 1B0RA 1S9WA 5A43C 3K1KC 2CK0L 4UV7H 1A9EB 3UJJL 3NAAH 4IRSB 3B8YA 2I60L 2A9ML 3QEHB 4IJ3B 1D5IL 3W0WD 1T3FB 4I3SL 5GGSB 5DEFA 2Y25A 1MREL 3TEUA 4XP9H 1DQTA 4EDXB 4HKXA 4LCWD 4P4KD 4XVJH 1UENA 3UTSD 1JYNA 5FYJU 1A7RL 2Q20A 5IHUH 1FLTX 2R56H 4XAKD 3O6LL 3ZYOA 3LEYL 1LEKB 4N5UA 2DICA 3MFGB 4MAYA 1T7VA 3EZJB 2W0KA 4Z9KB 5FB8A 1VHPA 1IAIH 4RAUA 1AXSA 2YD3A 2C5DC 3C87A 3DARA 4ELMA 4W6YB 3PL6D 3LQAC 4FQXB 1EK3A 3QUMA 4X7FC 5HHVH 1NLDL 2Y07L 5HGHA 4QOKD 4UDTA 2HFTA 3UX9B 1INQA 1XCQB 2DWDB 2EC8A 2J1KA 4OAWA 3M1BA 1RZKL 4YPGB 1BLNB 5DLML 4XBEL 1AD9B 3O6KH 1CXEA 3FQWB 4L3AA 3VFUA 4N1EA 2HT2D 1YPZE 1DQML 4HAFA 5EZJB 3FO9A 3S36H 3RY5A 5KTEH 2OR9L 4M43L 3KJ4B 1A6UL 3EO9L 4ZFGH 2PCPA 5DTFA 3BKYH 4YXKL 3UYPA 1IBGL 1KB5A 5LCVL 3OZ9L 5TE4H 1F6FB 5KSBA 1EO7A 1PX3A 4QHKI 3HUJB 2PO6C 4GOSA 1I1YB 1D5XB 1AXIB 3FN0L 4LLDA 3O3BB 5BCAA 2FO1A 3VXSD 4XHJC 4M9PA 2QEJA 3KG5A 2VLKB 1C8PA 4KK9C 2YA1A 3BDBA 4YH6A 4QT5A 2Z8VC 4JFOA 5DQ9B 3S88L 3O9WA 1JHTB 3K3QA 4MWFB 4OCRL 1EJOL 4P0DA 4F2MA 4JO2L 1C5DB 4PRID 4M6NH 3RRQA 2P8LA 1UWGH 3O3UN 2KL6A 3GMRA 1FQ9C 2ZCLL 4JREC 4LF3A 5T3XE 2VUYA 4M7KL 3IF1A 2A6DB 2DJUA 1TENA 1E6JL 2G9HA 3MODL 2MQ0A 1IM9D 1SVZA 3ETBF 1MFDH 3MFFB 5E08L 2DWEB 2E7CA 2YXMA 4CW1A 4PRBB 1IKNC 2AQ2A 2XN9E 4LASH 1YMHA 5I18H 2F74A 5J8OA 4TSBH 2XXCB 5IF0A 2AABL 2OJZL 1PGRB 4JRYA 2QQQA 3CPLB 1DBBL 2B20A 5HVWA 1JWMB 4ZAKA 4I1NB 3HAEG 4PJEB 5CLTA 5JW5B 3O4LE 15C8L 1WFOA 4R0LC 4JB9H 3QT2A 4LPXA 1P4BL 4AQ1B 3T2NH 5IB2A 2A6JB 3QWQB 5F9JA 1M71A 1FSKC 3TYFB 5JZ7C 5E8DH 1RJYB 1J05A 3SE8H 5FM5O 4H26B 3WYRA 3X11B 1U93B 4APQB 4ODVH 3TM6A 5F6HI 1HHGA 4I18B 1NMCC 1YEEH 5FYKH 1MNUL 1MIMH 3PWLB 4PJ5E 3GEWB 4KH2A 1S9VA 1BFVH 4WIQA 1QRNB 5BVPH 3U83A 1BBDL 1IGCH 1LO3H 5EC2B 3VFWA 4U2ZA 1U3HB 2GJ6B 4HJGA 1H3GA 2ADGB 1WEJL 3B5GA 4F3FB 4PTUB 5T1DH 4JFPB 4RA0C 1GC1L 5GJSH 3TNMB 1MFCH 4EVNB 4P49A 3SOBL 2LV4A 5T33H 4JVPA 3T0EC 1T3FA 3C08L 3QIWD 3WS3B 5GGSA 4XZUB 4NO0D 4PY8I 4EDXA 1F8TL 3EJZC 2FWOB 3KXFE 4LSSL 5E6ID 3WNNA 3TN0B 4OF6A 1PJ9A 1U41A 3QEUA 1CI5A 1KN2L 3M17B 4ZSOE 1PY4A 4GRMB 4NSKB 3WKMH 4OZIF 2IBGA 5MERA 3X17A 5EZLA 4NQEB 3BN3B 2DQUL 2HVJA 1L7IL 1CTOA 3MRMB 3HTLX 3ULSB 1CU4H 4FQXA 3W9EB 1OAYH 3HE6D 2DWDA 4HW6A 4KI5E 1EO5A 4LHJB 4NKOB 4HS3B 4YPGA 1FC2D 2A9NL 5IVXF 3C5ZB 3BAEH 1BP3B 1T83C 3FQWA 4R90L 5EU6B 4G6JH 1G6RB 2QQLH 3VXUE 1AJ7H 1T20B 2CKNA 2BCKB 3MA9L 1N2RB 4JPWL 4DKDC 5L2JA 1IM3A 3MRHA 4WENB 1MHEB 2ZG3A 2A0LD 3BFOA 4WI3A 4WTWA 4KTEL 1U3JA 2BVOA 5L2KE 1I1YA 1D5XA 4YO0B 3UCRA 3O3BA 5JHDA 5AZ2L 3RDTA 4BSWA 1PSKL 1U8IB 5FHAL 1A7OH 1R5IB 4JRWA 4RZCA 1U95A 1UB6B 1YC7A 2CIKB 5DQ9A 1XGRB 1JHTA 4TSAH 2IPKA 1I3RA 4LP5A 5HVHB 4MWFA 1BAFL 4JFFE 4X0KB 4OLWH 5D9SB 4NZUL 3FOLA 5HHPB 5T5NG 4NJAL 3BWAA 4KJQC 2CLZB 3NCEB 2WUBL 2A6DA 4HJ0D 1HIML 4GKNA 2E8ZA 4N0CC 2DN7A 4KRNA 4PLJC 3F12B 1J8HA 3QIBC 2E6QA 4JANB 4QRUB 3WFDL 5ALCH 2DWEA 3HE7D 4XNUH 1LD9B 3NH7H 2AEIT 3NGBB 4KMTH 2VXUH 3FQTB 2X1PA 3EIFA 4LVEA 4JN2B 3RWCA 5DD3L 1RHHB 3MNWB 2X4TB 4PYGA 3QDJD 5I1IH 3CPLA 5FYLH 1JWMA 3AXLB 4PJIA 3GIZH 1KTDB 5K59F 3Q1SH 4JY5L 4WWKC 2OX5A 5JW5A 2R2HB 4ZUWB 3OXRA 1BQHB 1BREA 3FRPG 4JDTL 3CSGA 1MCPL 1MCHA 3O3DA 4LPUA 3REWA 3WN5A 2A6JA 5FUCE 2DYPD 4U6YB 5CBEB 5I30L 3UDWA 3EYQC 3ARFB 3TYFA 2CLVB 1RJYA 5CZVH 5E1HB 5BV7B 4ZUTB 3ZHDA 3ESVF 4DN4L 3QEQD 2VLJB 4H26A 3X11A 2DJ4A 5F9OL 1NUDA 4M4RA 2XOTA 4YC2C 3NIFE 4MD4B 3UBXA 1KB9K 3MLVL 4M61A 3RVVC 1F2QA 1P1ZB 4KV5E 5F7WC 8FABA 3PWLA 1QNZL 1IC5H 2VOTA 3PDDA 5ESAA 4O2FA 5EU3B 2HVKB 1QRNA 1FGNL 4JM2F 2COQA 5EC2A 3QAZB 1LP9B 4H8WL 1U3HA 5I9QC 1WZ1L 2AEPL 3QB7C 4F3FA 1DE4B 4YHKH 4XPTL 1DTUA 1J18A 4L5FH 4U1JB 3VFGL 3TNMA 4EVNA 1SBSH 4DVBB 5KJRH 2UVFA 3LKRB 1FAIH 5LWYH 4PG2C 4OLUL 5EORH 4P2OD 3O2DH 4K94L 3DYOA 3U2SB 3TN0A 2ADIB 2FH6A 4PJFE 3L5JA 5H2BB 3TH3T 3MLRL 4NSKA 3P9LA 1HYSD 1MFBH 2R2BB 4HIEB 3IDXL 3QUYC 1QBLH 1RZ7L 3FQXB 3QUZB 5I1JH 5SX4H 4NQEA 1SJEB 3HI1B 2YHGA 1HEZB 1FLRH 3PQYD 2G75A 4XP1L 3EJYD 3C6SB 3ARGD 4D94A 1CD8A 2NZ9C 3W9EA 1YEJH 4TTDD 1J0JA 2EDTA 2L0DA 5GRYA 3EDJA 4MX7B 4KKLD 1NBVL 5BJTA 4MZ2A 4NKOA 4HS3A 4QHUB 5IJVB 3V0WL 3C5ZA 1JZ2A 2GHWB 3V5DB 1G9EA 3V7MA 4JO4L 1RULL 3WSQH 3X3GH 5EU6A 4ZNCD 1LK2A 4PJCA 1NSNL 2XACC 4HDIB 3RA7L 1CLCA 3H8NA 1N2RA 3RWDB 5BV7L 1S7UB 3IYLW 4JHZA 4F7EB 6CGTA 1J1PH 3QDHA 3CVHA 5DD1H 3S3JA 4DGIL 4FZ8L 4Z7UB 4YO0A 1MRCH 1GYAA 5EH1A 5I1CL 5L88H 2EDRA