1KBGL

Mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN H-
publication title Crystal structure of an MHC class I presented glycopeptide that generates carbohydrate-specific CTL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kbgL00
3QA3A 4PJEF 4PJIA 3OR6A 3MYZA 1WAAE 3IU3A 3PGFL 1AY1H 5C07A 4TRPH 1UM5L 3GSUB 3UBXG 3QHZH 5DZNA 3SDAA 3W9DB 2CSPA 5AG9A 3AREB 1EAJA 3MA9H 1RUQL 1N6VA 1XGQA 4HFUH 5ESVB 1MCQA 5GRZA 1F4XL 1CGVA 3D0LB 2VDML 4U49A 2GAZA 3B2UD 1ZVSB 3IAPA 2E6PA 3FOMA 2WQRA 4MS8C 3LKSB 3IGAA 3QEQE 3C60D 4WW1A 4GW4A 1XGRA 3RJDA 4Z18A 2VZOA 4PJEA 2M1KA 1R0AH 1AR2A 4KY1L 4F8QA 3MROA 1EERB 3R0MA 2O61B 1AGFB 3V6ZB 5EZLB 5F1KC 1B0RA 2VN4A 4LNRB 2NY6C 4R2GB 2C3GA 4DW2H 3DMMA 4HJ0C 5HHOB 4N0FB 1Z0MA 4E42A 1QR1B 2R2EB 5EN2A 2QSQA 5DQDH 1QEWA 4P46A 4D3CH 3L3OB 2XFXA 2PTTB 1D5XA 5F9JB 2X4SA 1NL0H 3FT2A 2QJDA 1YEEL 1DVFD 1NBQA 1D6VL 3BKML 4MQXD 5DD1H 2NY3B 3VXOA 1LEIA 2OYPA 3M45A 5KANG 4LIQH 4KI5D 2VQUA 3EO1A 2Q76A 5FKAA 4C4KT 3LH2L 4YDIH 5C0CE 3WJLA 5IVZB 1FG2A 4NC1C 4NKMB 1SJHB 1Q9OB 4N5ED 5IBUG 5BOPA 1MEXH 2G5RA 5DURD 4XNMA 4JEGB 4KROD 3NZHL 1I9IH 4MJID 3ARGB 5KBNC 4G9FE 2CIIA 4MJ4A 5KSBB 3FB5A 2N56A 2FBJL 3BJ91 3ALPA 5DJ2A 1BFTA 1WT5C 4Y16C 2AI0H 5LWYL 2DDQH 1PSKH 3GJEA 4XPGL 4UUJA 1MQKH 4MAUL 3QQ4B 4Y1AD 4JFEE 3MX0A 1A6VL 3NFPB 1AO7D 3VRJB 1RULL 4Z7WF 3QXDA 5E7FA 2NY2D 3ZYOA 1KELL 3EYFA 2NY1C 2VDQL 4J3WA 1F90L 3G6AB 1LNUB 1AHWC 2E5EA 4RCAA 2G60L 1DN0A 3T1FA 1I7UA 3SGJC 3VWJA 3OZ9H 4X6BA 4RMQA 1JZ3A 5IB5B 4L4VB 4FFVD 4ZUVA 1YNLL 3CH8A 1NCBH 4XGZA 4PJIB 5EUKA 4I2XE 2BRRL 3AUVA 2JB5H 3IU3B 1EHAA 1NCAL 1C7TA 4HGKC 2PW2B 1NJ9A 2HMID 1S7RB 5I8EA 4Z7WA 4LHUD 1RZKH 2X4OA 3TO4C 5HGDB 1PX3A 2AJSH 2CDEA 1M7XA 4HULB 1T1YB 3L3IA 1JHTA 4LLDA 3OXRA 2VC2H 4JFHE 2XN9D 4TUJA 2A77L 2P5EB 2GAZB 4P4KC 4K7PX 5CEYA 1DBBL 2IH3A 2L7JA 1MJ8L 3FOMB 4XMKL 3VMPA 3OJDA 4CDHA 3F5WA 3GRWA 1OAYL 3UYRL 1G7IA 1MCSA 1F8TH 3P9MA 5K9JL 4Z7OF 1F4HA 2I60H 3S3PA 3BE1L 1OLZA 5I30L 1D9KD 2LABA 1WC7A 3L7EA 2ITCA 4I77H 3D18A 1JVKA 3SJVE 1X5ZA 5IB3B 3BD4A 1B0RB 3X11A 3ULVD 5EZOL 4L8BB 3FFDB 2ARJQ 4E42B 5I1LA 1MREH 4MAYD 4XCNB 4QRUA 1QEWB 1U3HD 3O81A 1IGMH 5FYLL 3L5WA 3G5VA 3B6SA 1V8HA 4NNXB 3P77B 1IQWL 2PR4L 4JHWH 4MLSA 4UBDC 5BZWB 3OKDB 3FT2B 1J9CT 2X40A 2NY3C 1EA9C 4EVNA 2AERT 3HE6C 3EIFA 4R8WH 4GOSA 3ZKNC 3WL9A 1RUMH 3T09A 1GOFA 3SCMB 1IAMA 4WNQA 3G04A 2OJEA 4YEFA 3GSXB 3QUML 1QLFB 5EU6D 5ACMA 1NDGA 5ESQB 4NNYA 4NBYB 1F45A 2EH8L 3QIBD 4ZPVB 4DTGL 5A3IC 4XNMB 3FFCE 4IBLT 1OY3B 3V9FA 4S1QH 4NBXB 1NCTA 1SVZA 2CGRH 4XVSL 3HUJF 3BMVA 3X17A 4PBVC 4HUKB 1H3XA 3R0NA 3VG9C 1OGAA 4X6CB 5HYQA 1VACA 3UJTH 5GZNC 4WFHE 4PJXE 5F7LB 1II4E 1X5AA 5ETUB 2CKBL 1BQLH 2Q1EA 1TTUA 4UUJB 4OCYL 2EEDA 2R2BB 4Y2DA 5BO1H 2OI9B 4Q58C 3RBGA 2DMCA 2DM2A 4F7PA 4QRPD 3MLZH 3TA3B 4A2MA 5HY9A 3T65A 1IC5L 3BN3B 4MQTB 2H45A 4OLXL 5DJ0B 1QNZH 4XNUL 1L6ZA 3FN0H 1CTNA 3VWKC 5BZDA 2XKNA 1DBKL 4J3SA 1N26A 4RMSA 1MRCL 4GKNB 5TFSH 3SE8L 2G5BB 2KQNA 3HG1D 4XXDB 4KKNA 3UTSE 2EE9A 3FRPG 4MSWB 3ZL4H 3FB6A 4M9OA 3KPSD 5ITBH 4FXGA 1UB6A 3WIFB 3HUJA 1M7DA 4LCUA 5HI5D 5IVXF 3GKWH 4PJGE 1QLRB 4WUKL 3UTTA 4LEXL 1N0XL 3D69A 5AD0A 1U92A 3UBXB 4LU5H 2R1XB 4KKLC 3BEVA 5T33L 2FX9H 2X4NA 1X6NA 3CLEH 3O3AA 5D5ME 1MHCB 5EBMB 3RGHA 4XGZB 1Q0XL 4WCYL 2XI9A 3SDAC 3L5IA 4AEIL 2AQ1A 5IVOA 2F19L 4M62H 4HBQA 5EO1A 3VXMA 4JANB 4PRIE 1GRWA 1Z6JT 4PBXA 1GXEA 5CBEA 2CDEB 4NGHL 4P23B 4CW1A 5FV1L 5EPMB 3TBWA 4EIZC 5GJSL 1KT2A 4OAWA 3RVXD 5DVNA 3HKFA 1LWRA 3EJYD 1XGYH 3EYOA 2VITA 5C08D 4QHUA 4Q2ZA 4W70A 3OJMB 5IVXA 1AH1A 1G7IB 1MFCH 3RPIA 3BZEA 1DEEB 3BSZH 1OSPH 4QWWC 3T0DA 4R6UA 1GC1L 4NCC1 1ADQH 3NIDF 3CVIH 4MNHA 3T4AA 3L7EB 4D0BA 3ZE2E 4M1DL 4CN6A 3IKCA 3DMMC 1P2CB 3OHXB 3R4DA 4YHML 4M6OH 2J6EL 5DEGA 3IDYC 1A6WH 4P46C 4LQFL 3WNOA 4WU7B 4P2QB 4XPAH 3LKOA 1MQ8A 3KPOA 4FFYL 3MRBB 4PRHB 4TOYH 4LVNB 1NH6A 4M61A 4DN3L 3UXFA 1CT8B 1PKQE 3AS0A 4GBXB 4JFDB 4PV8B 4OLWH 1FP5A 5FM5O 1FNSL 2Z8RA 3AFLA 2EXYC 3EJZD 4AH2B 4XX1G 4OIIL 2FJHB 3CPLB 4X7FC 3NA9L 1A7NL 1INDH 3GJFB 2EXWD 3PP3H 1F2QA 5IMOB 3WJLC 2NW2A 3O4OC 4M7KH 3RZCA 1BEYH 5IBUB 1KGCE 4WEUD 4NNYB 4R3SB 5EIVA 4OT1L 1AFVL 2F5BH 4U1JB 4LLYA 3GGWA 4WVRA 1P6AB 3MRPB 5ISZB 4PRBA 4LKXA 5IMMA 2EE3A 5HYJA 2N7AA 3D9AH 1Q94A 3PDOB 1CICC 1LO5A 4PYGA 3ZKXC 2OZ4H 2VDLH 1JGLH 1ZVYA 4C4KO 3MC0A 2QHRL 4R97B 4L8DA 4X6EB 4N0CD 2B1HL 2GFBB 4PRPA 4GS7C 5D1ZB 4UILH 3DNKA 2VLLA 1I3VA 2OCFD 3LD8C 4OBSA 2AK1L 3V6BR 4MJ2A 1Z5LA 3BDBA 5EA0L 1ZXQA 4BA8A 4NP4H 4XH2B 2NXZB 5F7HA 3T65B 4FQJH 3DVGB 3MQIA 5HHMD 3FRPA 4XPFL 1ZSDB 5BZDB 2DQCH 4I5BA 4RMVA 2APVA 3QWQB 1ONQB 1KNOA 1Q72L 5J56B 1FZOA 4OGAD 2FLRT 3B43A 3VWJC 4JFXB 2EYSB 4K94L 1RSFA 5ADOL 2CDFB 1FQ9C 3MRIB 1FDLH 2R0ZH 1W0VA 2HT4D 4JJHA 4LCUB 4YHLL 2H3NA 1NFKA 3ZHLA 4XBEL 4FQQB 3MREA 3UTTB 2IALA 1GIGH 4RGNE 4WFGD 1U92B 2YKLH 5CUSH 3VFOB 1MIMH 5CLWA 3ARVA 3B9KD 4C83B 3MV9E 3MYJA 4OD1H 1Z9LA 4OJFH 3L3KA 3REVB 4WWKD 5D8JH 3NPZB 3LRHA 4LRIA 2ENYA 5J1AB 4MXQD 1NFIA 1CL7L 5HVGB 3VFSB 1B3JA 3CCHA 5E6ID 1UENA 1XR9B 3RWGB 3RDTA 5DJYA 1JPSH 3MRFB 3IDNA 3NH7H 3GIVB 1JPTL 3BH8B 2IG2H 1NFDF 5C0DB 4CNIA 5FEBA 3DURB 3EYOB 5HVFB 4HIEB 1JPST 3UTPE 4IRJA 4J3VA 3QWRD 3F6LA 3BZEB 3RJQB 1E28A 1JF1A 3MRLB 4YIQB 4HS8L 5IGXH 4CVXA 4ODXB 3IDMB 3RWHB 1QO3B 4Z7VB 3NCJL 4D0BB 5F8RC 1SY6L 1G9MC 4BQ6A 3STZA 4N1EA 4MJ6B 2BJMH 5JPNB 4PLOB 3B9EA 1IZKA 3KWWB 5L9DH 1CFQB 5A43C 1M71A 5E9DA 4X6DB 5IIEB 4X4ZA 3KLSA 1U8HA 1NUDA 2FWOA 1I3GH 2CUIA 1A2YA 2IADB 5GGVL 5LKNA 2V17L 2WBJD 3U0WL 2YR3A 5D7SL 43C9A 1MAML 3KPOB 4PJ7B 4JLRB 1WAAF 4M48H 4KDTA 2XWBB 3WXVH 1NFDA 4I8DA 2OTUB 3RWCA 3LN4A 2P24A 1SJEA 4HD9A 5J3HD 4U3CA 3MLSH 4CVWA 5I16A 5HJ3B 2C3HA 1P4BL 4N9GA 3SE4A 3P4NB 1FZMA 2D3VA 1RHFA 5H8DA 1XIWD 4HDIA 3RX8A 4EQ3A 2QQLH 4HT1H 5DTFA 3O41A 1QFHA 2PCPB 1ETZA 3IF1B 2LU4A 2JIXA 4LKXB 5CSBA 3V0AC 3MRNA 4ZO6A 1F3RB 2ZG2A 1U93B 1UZ6F 2ZUVA 4MYWB 3O2DL 1U8KA 5EULV 1WAAA 3BGMA 2XG4A 1FVEB 2DLFH 3B8YA 5C09B 4V1DE 4PRPB 4Y2DC 2NX5B 3BT2H 2VLLB 5J4MA 3QCTH 1DEDA 2CRZA 3VGAB 1IC4L 2GJJA 1SJXA 4MCYA 2MCPH 2CKBA 3CFBB 2HN7B 3U7WL 4K7PL 1EX0A 3QUXA 4OI7A 3RWJA 1GZQB 2B4CH 2VXVL 3HFML 3JUYA 1E27B 2PW1A 4ONHA 3HI5L 4GAYA 3E6HB 4HKJB 1T66D 1FBIH 4HH9B 1S7QB 5BOZG 4FQIH 2ZOKA 1T1WA 1G7JA 1YMMB 2XWJA 4I48A 4E5XB 4KZEH 3QEQA 1GGIH 4HWBL 3MSPA 3BKYH 1VERA 3JWDL 1T21A 1RJLB 3GI9L 4Z0XA 2R2CA 2DLHA 2O5XL 4PGBB 4QRSA 1MCOL 1UQSA 1VFAA 3JWOL 3TWCL 4NPYB 5T3ZE 1A7OH 4P57B 3CX5J 1D5MA 4PB0L 3EFFA 2CK2A 1P84J 1KJMB 3OX8A 3L3KB 3MLYL 1CR9L 4J7RA 3JBG7 3V5HA 1U6AH 1CS6A 4NO0A 5LXGL 1R3LB 2GHWB 3O6KH 2HWZL 1MJUH 4J4PD 1J0JA 2D7TH 3KJ6L 3RUGE 3FO1A 5DWUH 4Q9QL 2HJFB 4U1LA 2AEQH 3NIGF 4KJPD 3IDNB 3QUYD 5J8OA 3GMMA 1IC7L 5E95B 4NQED 4WY7H 1C5CH 1V7NH 4LSSH 5HSFA 4OD2B 4OZIB 4ZFZA 4HC1H 3VFUB 5I74B 3WLBA 2FH6A 5GGRY 4UNUA 5C0CA 2QSCH 4IRZL 1QSEA 4NZJA 2ARJA 5FYKD 3BGAA 4LVEA 1KLGB 4JFYB 3TO2A 4I4WA 4QOKB 3STZB 3OG6B 2F53A 3S9DB 3A67H 4X80L 4G6JL 2QKIA 3NACH 5I1EL 3DARA 4G9FA 3EYQC 4Y4HD 5CJQL 3EGSA 2WM0A 3G5ZA 2PYFB 5IFJB 3DX9B 4HXBL 2YMXH 1TJHL 5C0AA 2FEEI 5EORH 2WBWB 5E4IA 3IFPA 5T1LB 2D0GA 4KVNH 5IB1A 1RK0A 5E1AA 2XG5A 5CHNB 2JJTA 5E56A 1IL1B 1CFVL 4U7KA 4MWFB 3RZCC 5I16B 1OWWA 4G5ZL 4N9GB 5DD5L 5JW4Q 1IM9A 5FGSA 3CFJB 4MNQA 1LE9A 1FYTD 3QDHA 1QP1A 1O7VA 4HH8A 1K8DA 3DIFB 1JZ2A 5TDNA 4D8PB 2OJZL 4JM2B 3BQUB 4ODVH 3TPUA 3QUMB 1PDKA 4PJ5E 3BP6A 5TE7H 5TPWH 4POUB 2FECI 3GMPB 4AIZA 2JIXB 5ACLA 1CLYL 2MHAA 5GS3A 1GHFL 4JKPH 1JHLH 2XIDA 5HGBA 5F7YC 4MJ5B 5T1KA 4WO4D 3RWIA 3RNKA 4C59B 3GJFK 3B83A 1U8KB 1OAZH 3BPCB 1PYWA 4I2XA 4FQXB 3LKQB 4JZJA 5EU5B 4FA8A 4NQUA 5JDSA 3SHSA 3QI9A 3VGAC 3EYUH 4EI5D 5M95B 2HA1A 5HHXL 1CTOA 2VLKD 5GGRB 2CKBB 3UTQA 1UH2A 3D39D 5IBTL 4Z76A 1OARH 1A9EA 1DQML 1CU4H 1A02N 1TQCC 2C4FT 2GJ6E 2YPLE 4I0KA 2Y36H 4NN6B 5FK9B 1T1WB 4R0LA 1IM3A 1Q1JL 7CGTA 5I76B 1E6JH 2HVKB 2NY0B 4XCFL 1CQKA 2CUHA 3TCLB 5HGGS 3HAEH 3ARFB 5CZKA 3SKNB 4M5ZH 4XC1L 1MHHB 4PREB 4HUXB 2DJSA 4KUCF 2AJUL 4EDWL 2W38A 1U9KA 3X14B 4QRSB 2D7OA 1NDMB 3U4EB 2VMFA 3AY4A 3BD5A 4MX7A 1U41A 2I07A 5F88A 2O5ZL 3VMOA 5ERWA 4MB4A 3EFFB 1NCCL 3S36H 4XP9H 2BVPB 3QIWA 4HGWA 2VH5H 4J3UA 4PP1C 1XF1A 3B9VA 3VFTA 2D2OA 4M1CD 2GSGA 4J3OC 3HC0A 3RDTC 1X44A 3GRWH 2H2SD 3OQ3B 3VXSE 3MV8B 4U1LB 4AEHH 1IAOA 3MOBH 3QO0A 4HV8A 4KK8C 3HE7B 3GMMB 2A73A 3FQTA 2Q7YB 4IRJC 1AI1H 3O6FB 2ZSVA 4DN4H 1F4AA 5FYJH 3IJSA 3U7AA 5D9SB 4ZFZB 1MIEH 4KQ3H 2BVQA 1G9MH 1DJSA 3BKJL 4JRYE 5C0CB 4LLMA 1IE5A 3GIZH 3B2VH 1LMKA 2P7TA 3HRPA 2QADB 4EKXA 3FFCA 4O9HH 1P53A 4I4WB 4OLVH 1R5VB 2X7LA 5EO9B 2ZNXA 2R23B 1MWAA 4O51A 5DJCB 3OKOB 3U9PH 3F7QA 3V4PH 4G9FB 3RWFA 5E8PA 1UM6H 5DRZA 3V4VL 1TJIL 5CAYB 3VG0L 3G5ZB 1UXWB 3QJHB 2D0HA 1A22B 3AS1A 4KDTC 4QO1A 2DBJA 4JFEB 1CDJA 3ZKMD 4NKOB 1YY8B 4MHHG 5HGAB 2OSLA 1OT1A 2VQ1A 3GSOA 3OKEB 1A0QL 4CMHB 2VLRD 3ULUF 1FNGB 4QTHB 2R0WL 1AGEA 2F54B 3I6KB 1QG3A 3FO2A 1TZGL 4L9LB 5I1KL 1E4XH 3K46A 4P5TA 2C26A 2ZUSA 3F7YA 3UTSA 2A1WL 5TDNB 4XPHL 2ZKHL 3UP1A 3AU1A 1HIMH 3BP6B 2P8PA 5I75C 5T3ZL 2FR4B 1SEBA 5DI8A 3RWEB 5DGRA 4GG8A 1RHHB 3RWIB 1SM3L 2MSPA 3GB7B 3RNKB 4LRNH 4J1UB 1MPAL 1WWCA 1IEBB 4G42A 5J11C 3K2UH 1W8NA 5C0FB 3N9GH 5KANI 3NCBB 1KTLB 5HGHB 5DS8A 1A3LL 1R5IB 1I7ZA 2DWEA 3O2DA 1C5BH 4PRIA 5DHYA 3QUXC 1J1XL 4NCDA 3SOBH 2FHFA 1ODAA 1QYGL 3L95B 4JE4B 1JZ4A 1H3GA 1U0QA 3UTQB 1CXLA 1A14L 1MFBH 2FATH 2HVJA 3LV3B 1C5DB 2DQUH 5I19L 3FONA 1DSFH 1P5UA 1SYVB 3BPOB 3UC0H 4R0LB 5I18H 5E1HB 2VSDA 1Q0YH 4HPOL 4M9PA 3OMZA 1NAMA 3QJFB 3KLHD 1OPGL 1J5OH 3EAKA 1E4XI 5GGVY 3E6FA 1MLCA 1S78D 3V2AR 2J3SA 1S7WB 5JXAH 3MOAH 4HWBA 5J6GB 1ACYH 3OG4B 1WBZB 3MBEB 5BV7H 3SJVB 3MMEB 2JK5A 4FXKB 2IFGA 1RMFH 4APQA 1CK0H 4NKIL 3GSVA 4Q9BA 4J2XA 1XGUB 3C87A 4LSRH 1BHGA 5TF1L 2VRAA 4KJWD 4MXWH 5HHVH 4MGXA 4Z7UE 3QAZC 5FO9B 4TUOB 2WWMC 1IAOB 3O4LE 2XT1B 5CS7A 1MH5A 4F7MB 3TH3T 1YQ2A 3QUZB 3V5DB 3QQNA 4UB0H 2WP3T 1KC5H 2X9WA 4LCWE 4UQ3A 3IJSB 4LSUL 2E7MA 3JV4A 2W9EH 4LLQB 4S1SH 4LSQH 5DJXA 2W0LA 2BVQB 2HTKC 4BFEA 1OQOA 3T2OA 3P30H 3RP1A 4LCIH 4LPVA 1PG7X 5F97E 3CK0H 2P7TB 4F33A 4MCZB 3IRZA 4K7PY 1NSNH 1CLCA 12E8L 5DT1H 4O51B 5DYOB 3H42L 1R6VA 2LVCA 4UAOB 2NLJA 5CJOH 4PJ9A 3TNNA 4PJDE 5DUPL 4Y5YA 1T7ZA 4RWYH 2ICCA 2GY7B 4PJXB 1F6AB 4IDJH 2YUWA 2WINB 3WFHA 4EUPH 3TF7C 3IJYA 5I8KL 1DTUA 1KTRL 2F8XC 3C8HA 4ONFH 2PO6B 4X5LA 2OSLB 5I9QB 2WK2A 3HMXL 3LQZA 5IR1B 4G8GE 3RA7H 3QDJE 2HFGL 3IFLH 2VQ1B 1CFSB 1KYOJ 3SDXF 2KKQA 4O2CA 5F89A 2BNQB 5GHWL 4OUOA 4G6KH 4JFOA 4R96B 1I9JH 1BWWA 1KN4H 1RUPH 2VYRE 4KPHH 3KYMB 2FIRT 4JFZH 1WZKA 1OP5K 4OFVA 3UAJD 5JOPD 3TT3L 1PZUB 1A9BA 4KRPB 5K33A 3T0VA 3QG6B 1BWMA 1DQTA 1YEJH 3PQYE 4R90L 2BVUA 4I0PB 5L88H 1QSZA 4PJGB 4GG8B 4KJQC 4UNVA 1YQVL 2FX8H 4JZJC 5D5MB 1NANH 2VWEC 3FO0L 4ODTL 1HNGA 3QI9C 1YYLL 5FHBL 1P7KB 3GHBL 3MV9A 5IFHH 4P59H 1KIPA 1R3KA 1ZANL 2ICWA 4E0RB 1KJ2A 4YDVB 5DSCB 1MRFL 2DMBA 5DHYB 3WXWL 3C5JA 3SDXA 1HXMB 2PYED 4NQSA 4QY8B 1SYSB 3PABB 1UB5B 1YECH 3QCUH 2HVJB 3SEPA 5TDOA 5JIPA 5IMKA 1CXFA 3QUKA 2KDGA 5D7JA 3MXWH 3L3GA 2GUOB 3QRFM 3FONB 4FZEL 1IGCL 3MOQA 3TZVD 3O3UN 3UCRA 4ZAKA 1IT9H 1R3IH 4JN2A 4D9QD 3DSFH 5TQ0H 2IAMA 3DROB 3Q3GA 3U4AA 2YD4A 4FQ1H 3E6FB 1N3NB 3OKNA 3MV01 3AY4C 2Y06H 3MJ8A 5E5MB 2IPUG 1XMWA 1IQDA 2NTFA 5DVOA 1K6QL 5A2JH 3ES6B 2YRPA 4XMLH 3S3JA 3F12B 4Y0GA 5CD5D 2YUXA 5EWIL 3QIWC 4GRLB 3IDUA 3U1SH 2IANE 1FL3A 1NANI 1QRNE 1I7RB 5CZVL 3TV3H 3SDYH 4RISH 5DA4A 4BUGA 1YEIH 3ZTNH 3EFDL 1AXIB 4WHYH 4JREB 1PKQB 5DD3H 3KPRB 1VFBA 3OGOE 4LSTH 4TTGA 3D85B 4R7DA 1CGYA 2E7LA 4DVRL 1VGEH 2OXGA 4RSVA 4OCNC 5C2BL 5EIIB 3MRGA 2FGZA 4HKZB 1O5DT 4LCYA 3D0VA 2WSKA 4JFFD 3PE9A 4KQ4L 2Q8BH 5DJXB 3B9DA 4ZYKB 5GRJH 3S98A 4KHXH 3TJHC 2UZIL 2I9LA 3OKMB 1V3MA 3WSQH 4WUUD 4NOBA 1E4WH 5IEHA 3H9SE 4Y4FD 1L7IH 5KVDH 4YXLL 1TTFA 1DUYB 1MY7A 4FTVD 2H2PC 4Y19B 2X42A 3PWPA 1LP9E 2J88H 5IVNA 3EOYG 2NLJB 4ZPTA 1T3FA 4LEOB 1A6AA 3W82A 1D5BA 4BFBD 3BZ4A 3C2AH 3DBXA 1A5FH 3GBMH 2FHCA 1M6OA 2VISB 4XTRD 4J23A 1A1NB 2R4SL 1DQLL 4ESKA 4G8EB 4W6XB 4HUMB 4UT9L 1PKOA 1BD2E 3TN0D 4MS8D 4H1LG 1MAKA 4TSBL 1F42A 4P5TC 3RUGF 3ZZ1A 1N8ZA 3U7YL 3LB6D 5GGUA 3WN5A 5HHNA 1AQKL 4XCEB 1JGEA 4OF8A 3CNKA 3T0BA 3I9GH 4DVBB 5EU7C 1EBPA 5IESH 1XZ0B 5DHVA 3O2VH 2BNRB 4F2MA 5FO8B 1RU9H 4QXGH 4HJ0D 1TXKA 3VFRA 4DGVH 2VDNH 5ICXA 2D7MA 5C0BE 4U1IB 4RQQB 1EJ6A 3T2NH 4QRRD 1Y6KR 5B39A 1KIPB 1JI1A 3ULUC 1HHKB 1A47A 1U8QB 3DTXA 4JFQB 1KG0A 2ICWB 4RGMB 4EQ2A 4FQCH 4LASL 5T5FL 3D25B 2F9BT 4ZTOH 4U05A 1AIFB 4NQSB 1ZT4A 3RUGA 1C16B 2A9NH 3S34L 5GS0L 3RVWD 4OUUA 3HNSH 3FCTB 5IFAH 4MQ7A 3CFKA 4HWUA 4FOMA 3L3GB 4M7ZB 3S35H 1PVHA 2AXFA 5JOFB 5DEFB 1KFAH 3WO3B 2F15A 4L8CB 4K07A 1KB9J 3RIFK 2IAMB 1RZIB 4IMKA 3T0EB 3W0WE 1A1MA 2Q86A 2UVFA 4DKAA 4ZS6D 3MJ8B 1FE8L 4EBQH 5IW1A 2NTFB 1BF8A 3C08L 4HJGA 4APQC 3JWOC 2X1PA 3LHPH 4GMTL 3MLXL 2ATKB 1HKLL 1JGDB 2GJZB 3UTZB 3Q6GL 1JNLH 3MLPA 2BCKB 25C8L 4MXVE 4E41A 3HR5A 2B39A 2VXSL 3PL6D 1YN7B 4UV4H 5L8KB 4Q9RL 4BKLA 1CD1A 1BFVH 3I2CH 3IJHA 3VFGL 5I1JL 4Q0XH 5FECA 3QFJB 1IGJA 2FD6L 5E70A 2WIIB 1JWSA 2YSSA 1FNAA 1M1SA 1TVBA 1FO0A 1AE6H 5J9PB 3O9WB 1VFBB 3U36A 5IOPA 2W0KA 6CGTA 5GRUH 1WCBA 2GIYA 4JN1L 3OKKB 5DRXA 2ATPB 3VXRB 1F00I 3C6LD 4AY0A 1H3VA 4RAUB 4WFED 4YUEH 2YD8A 4X8JA 1QQDA 1H9VA 1K5NB 1PGRB 4PJ5A 3ILPA 2H9GB 1MF2L 5HDQL 4TVSa 4NJ9H 2WP3O 4FQ2H 3U2SA 3SQBA 4PJ9C 2XOTA 3L5HA 3M17B 4Y5YC 2A6KA 5EBLB 3ARED 5EC1B 1ZEAL 4H26B 3QEUA 1X5JA 2VJXA 1PY9A 5D6DA 4V1DB 2Q8AH 2FJFA 4ZDHA 4X7EC 3MBXH 1DL7L 3M1BB 4HLZG 2V5TA 5CCKH 3S97C 1G7QB 3BN9C 3KPLA 1OSZA 5ALBL 3VD9A 1XF3B 4UOW1 4F8TA 1I1AA 1EMTH 2GJ6A 1U42A 1U8NB 2YPLA 3QG7H 2WANA 2DWDA 1UEMA 1S5IH 3VCLA 1CLOL 3MLTA 3TBYA 4R2GD 3W9EA 3JWNC 5TE6H 1OTUD 4LGSB 4MA1C 3R8BB 4RGNC 2H8PA 2W92A 4ZSOE 2DI7A 4YZFE 1F4WH 4UT6H 4XNQB 4L3AA 2I9TB 5ICXB 2OBGA 4YBQC 1BBDL 2IPTL 2XNAA 4P9HL 1P69B 1ZT1B 4ZTPH 1JNHA 1AGDA 4DZBB 2IBZX 1PBYA 4UBDD 4N9OB 2NY3D 5MHSE 4TNVK 5HVHC 1DBJL 3WS3B 1OTSC 1DVFB 4QYOA 1WBXB 2G9HB 1ZT4B 1MCWW 1S3KH 2ADFL 2Z4QB 5D7JC 1EFXB 3VXSA 4EIGB 4OUUB 3KHOA 4XNYH 1LO3H 1JCKA 4EN3A 2XRAL 5HYSA 2BSTA 1BVLA 4S2SA 3DUHA 4ZAKC 1ED3A 5K9OB 3LDBC 1PG7L 2EYTA 4YDJA 3S88H 4BK4A 4XHQA 3K81A 1XCQB 1A1MB 2Q86B 5A3ID 1INQA 5K9QG 1XH3A 2VLJE 4JRYA 5CJ5A 3ARGD 5HDLA 1GGTA 1L9MA 5DC0A 1Y6NR 3HS0B 3WDJA 3H7BA 1KENL 3R1GH 4MJIB 1FORL 2EDXA 5D2NB 4K7FA 4NYLA 5GZND 2DIJA 2KBGA 4J6RH 5KW9L 1CIUA 4AM0B 1N4XH 4LFHD 1B0GB 4LLWA 4Y1AB 1X5LA 4KVCL 1Y0LB 4MDIB 4WIQA 3LEYL 4BKLB 2HLFC 4U6VL 4Y4KA 5JIHA 5CEZD 1JN6A 4C57C 2B0SL 3TT1L 1QVOB 5SWSE 1DQJA 2E7LC 2YSSB 4WU5B 1WBYA 1E6OL 3SDDA 5K9KA 4L3EE 3GI8L 3TEUA 3M07A 4Y89A 4UIKH 4HK3N 1MFEH 4OM0L 4F58H 2VDOL 2YS4A 4ZD3H 3EHBC 5D7LD 3NZ8A 1ZS8A 4L4VD 1NCWL 4YAQA 3IDJA 4PG2A 1CQYA 3IKKA 1EAPB 4XAWL 2LTQB 1IAKA 1AGCB 2NTSP 4M6NH 3A6CH 1Z3GH 3RI5F 4KKLD 3ETBF 4ONGH 4BH7A 3WIIL 1EGJH 1T89A 3SDAD 5EOCL 5DRNA 3SE9H 1NCDL 1X7QB 4OSUL 4BQ8A 1OVZA 2I24N 3UJIH 3QEUB 4MNGB 1FRGL 1NPUA 3GFUA 3OKLA 1BOYA 1CGTA 3BYYA 4ZDHB 4NN5C 2P5ED 5JHDA 1HH6A 3JTSA 4H1LB 2EEBA 3NFSH 3QWOA 1FN4A 1GGYA 2W65B 4FP8H 3K74B 1NGPH 1OSZB 4LIQE 4K3HA 1KV3A 4JKMA 1RUAH 5DFTA 3NCCB 1ZGLP 1BMGA 1IKFH 3WN5C 4NJAL 1DDHA 4Z78A 2VXTL 3O45B 2GSIA 3MA7A 5JPMA 4GMSH 1IAIL 3FT3A 5C8JA 4JCMA 1EEYB 3DMMD 4G8IA 5E00A 3A6BH 4K9EL 2MNUA 1UM4H 1EEZA 4KV5F 1U95A 4OV5B 5D72H 2QQQA 4P46D 1O0VA 1QFWL 1RZ8A 3ULUH 3QQ9C 1MCPH 1U3HB 3UPCA 2DAVA 5T3XL 2A83A 1V3KA 3AXLA 1QBBA 4GG6E 4DQOH 2R1WA 4XCYA 3HC3L 3SCMD 5A1AA 1JP5A 4F57H 4PJDF 3AB0B 4Z7UA 3LN5A 1NAMH 1RZFH 3PWJB 2IQ9L 3CFEA 3VXSB 4LBEA 3W11C 4JQIL 3U4BL 4HCRH 4XP5L 3FQWA 3WNMA 4PRNB 4WHTB 2A6IB 1BVLB 4S2SB 3O3DA 4JPWL 4LCWA 2R9HC 3C2SA 4IMKC 1JUFA 5CINH 5F71A 1KULA 4EXPX 1NAKH 2CLVA 1HZHH 1XH3B 4PGEB 4NUJA 2GW5A 5DFVC 5EU3B 4YHIB 3HZVA 1I9RL 2A74B 5GSRB 4K7FB 4WTXA 3VW3L 3C8KA 2Z93A 1U91A 1G6VK 5DRWA 3SKMA 3SKJL 2IGFH 4PJDA 4LLWB 3JV6A 3S5LG 2M2DA 4JKKA 4Z95H 2VN7A 4GAGL 1KB5A 2XWTA 3SQOH 3V4UL 4WEBL 5GGTH 4Y8AA 1UJTA 3QEGL 5J1SC 4NO5A 1TVHA 1U8JA 1XGTA 2A6JB 4G8GA 3QDJA 1UKTA 5EO0B 1X9QA 4I9WD 5DDHA 3PHOB 3WJJA 4HUWA 5B4MC 2DQGL 5HI4C 5KVMC 3K8MA 1A7BA 2AW2A 2LTQC 3KPSB 3Q5YA 1LQSR 3HZMA 1CI5A 5AZEH 3O11A 4EI6B 1YJDC 2X05A 2EDJA 4HQQL 5SWQA 3QDGE 1KPRB 4G6AD 4BSVA 3EO0B 4GKSA 1UYWH 5F3BA 5CZXC 4XI5D 3DUSA 5HD8C 3ZT6A 3VXPA 4I1NB 3PQYA 2SEBA 4BQBA 1RK1B 2Z31A 5F8QC 4PGDA 3P11L 3MRHA 1OCWL 3DRTB 4UQ2B 5FFLA 4U1KA 2C1PB 1KJ3H 3KXFE 4F37F 5D6DC 4P23D 4XP4L 1BPVA 3FTGB 5DXWA 3ZKQD 2Z92B 3K8KA 1H3PL 3CFCH 3PGDB 4GFTB 1KBGL 3CJJA 1BJMA 3EYSL 4AQ1B 3WNLA 5JXEA 1HH6B 1QFUL 2KPNA 4NRXA 4PJBE 4U0QB 1UZ8B 3QWOB 4OBRA 1G9NC 3AM8A 4P48A 1I1AC 1NBVH 2RB8A 1QKZH 3EBAA 2RCSL 3D5OF 5IF0A 1GL4B 4M7LH 4HJJL 1IVLA 3IS1X 5E99L 1JZ6A 2VZSA 4FQLH 1A6TB 5BVJA 2CO6B 5DLML 1KCLA 3IETB 3WYRA 3Q6FB 1UT9A 3QHZL 5FDWA 4P3CH 3I6GB 4BH8A 4PRHD 5GS2H 3MA9L 4FS0A 1P7QA 5HDBE 1DLFH 1DUZA 4XPTH 5L0QC 3KYAA 2A83B 3VRLE 2IANA 2F58L 4JDTH 4GBXD 2YRLA 2VXQL 3AB0C 1LP9F 2EIDA 1ZHKA 4HEPG 3HI6L 4ORGB 1L0QA 4JG0L 3DVIA 5CMAB 1TZIA 2ZG3A 1KTDA 3MRJA 4Z7UB 5DJ8B 1MSPA 3S6CA 4DUWA 4EN3C 3GSWA 4N8VG 4Z5RA 4B7IA 4OKDA 3O4LB 4KC3B 5EFIB 5IV2A 2A9MH 2X4QB 3H3BC 1D7FA 3AVEA 4OFYA 4X8XA 1FIEA 1R0AL 2UYLB 1G0XA 4JO1H 3BWAB 1RY7B 2VTFA 3FZUC 4TPRH 4CU8A 1H5BB 5TH2A 5ICZA 5L2KA 5KTEH 4RBPH 3QDMB 4OD3L 2M8XA 4JO3H 3FL7A 5E8DL 1MLBA 2HRPH 1S7UB 5DQDL 3S5LA 3STBA 2LV4A 4D3CL 4NQVA 5BJTA 5ITFA 4NZRL 2ZUQB 4I18A 4UNTA 1LP9A 5DRWB 4R26H 2GK2A 1IZJA 5FAAA 1Y18A 2EDTA 1NL0L 2Z8VC 1IFHH 2NXZD 1YEHL 2IPUK 5ESAA 4Y4KC 4IRSA 3L5XL 4PUBH 3IT8D 1UACL 5T1MA 1PW3A 5DD1L 2ZWLT 1NGWA 4PJCF 4LIQL 4RDQG 3IFNH 1TVHB 3SDDC 1HSBB 5HHMB 3EO9H 1A4JA 4G8GB 1L4IA 1KIRA 5DO2C 3V6FA 4YDIL 2DICA 3I6LD 3WFBH 5D93B 2DL2A 4HUWB 3T8XB 4BUHA 1MJ7L 2MPAH 2ZCHH 4PG2C 3DSNA 1MEXL 2F5AH 3UTTD 4XMPH 2DQDH 5H35B 3DRQA 1I9IL 4G6FB 4PS4H 1FZJA 4BSVB 4L3CB 3MO1B 3WDIA 1T89C 2XN9E 3BP7A 2VZTA 2JJSA 5C3TA 5F6IB 3PQYB 5I2IA 3B9KB 2Z31B 2AI0L 4TVPL 2DDQL 3VXMD 1PSKL 4X4XB 1MQKL 4TUKH 5KSUA 1W72H 1WISA 3LEXB 5EOQL 3TBTA 2AP2A 3HC4H 5ALCH 3F62A 3QNXA 3CXDH 4RFEA 4OCSH 3VFPB 1FL6A 5E6IB 5BQ7B 1H8OA 3S37H 2ZG1A 4QRTB 1CFNA 1NBZA 4YGAB 4MXVF 1NC4A 2WUCL 1NCNA 3CMGA 4LDOB 4OZ4B 2ZCKH 2QQKL 1SBSH 3MUGB 5CD3B 2P46B 4NC1E 4GUPB 5FKPB 2E7HA 4NDMB 1QBAA 3KJ4C 3MR9A 1FJ1B 3OZ9L 3DV4B 4Y5XB 1TVDA 4KMTH 5KS9E 2NY7H 5E24E 5E2UH 2X4TA 3OKYA 4ZUUA 5ACZA 3W0WA 2JCCE 4DZ8A 2OL3L 5JLZA 4OV6F 4GAFB 1HWGB 1UWXK 2Y9RT 4JO4L 1YDPA 2DQJH 4JZOA 5A2FA 4OKVB 2WW8A 3GHEH 1TMCB 1ZT7A 3EYQD 5ICYB 3EZ8A 2AKRB 2V7HB 1FFNA 2AJSL 1HDMA 1N6QL 2FJGB 5GIRA 2X2YA 5JW4M 3CFDA 4LGPB 3DO7A 1D5ZB 1QRNB 1TZHB 4N8VA 2VC2L 2YBRB 2R0LH 3L9RA 1OAXL 2JB6B 4DEPC 4P5MA 4L4TE 4XVUD 4RDQF 1UKQA 5KVFL 4FABH 4DJMA 3CVHL 4PJFE 1YEDA 1F8TL 3WHE0 5IV2B 3G5XB 4GAJH 2H26A 2I60L 5E08H 1VSCA 2BOCA 5KSAA 4PG9B 1L0XA 4LLVB 2VDRH 3DX8B 3P0VL 4K3GA 5F44A 4OB5H 4ZUTA 3RY6A 4ZQKA 5T1DL 2XXMB 4D0CB 2RJMA 3GJFH 5KOVC 4OQTH 3PNWA 5FCUL 1FNLA 5TE4H 1DQQA 1Z2KA 3HZKA 3H9SB 2CKNA 1U8IA 4PRPD 2NX5D 5J7CC 4CVZB 1IGML 1RZ7L 2OLDA 1LP9B 1G6RH 2P5WB 4P3DA 4KKCD 3RWDB 1I7TA 3DWTA 4J3XA 4JHWL 2YA1A 4YZFF 2KL6A 2DYPA 5ESAB 4HKBB 1I3RB 5C0GA 4BZ2H 4WW2B 5C7XH 1CDBA 4X6FA 1RUML 4IMLA 4QT5A 4XP1H 1BBJB 3CUPA 2ESVE 2QR0B 4MA3B 4NKDA 2Q3ZA 3ZSSA 4U1SA 3ESUF 3WJJC 4YWGH 1YMMD 2EDLA 3ARYA 4LPXA 4U7SA 1BD2B 2YA0A 1ORSB 4X99A 5L6YL 1MI5E 1XEDA 1TCMA 3GMNB 1ZLVH 3TVMA 1WZ1L 1CGWA 4S1QL 4S10A 4JGUA 1MUJB 2CGRL 4PJ8A 5F6IC 1FZJB 1QBML 4YR6A 3LQMA 2Z31C 3QZWG 5ADPH 2YPVH 5F3HA 2Y5TA 1OM3L 2RHEA 2MFNA 5LCVH 5DK0A 1TJGL 2DLEA 1BQLL 1K3ZA 3BZFB 3G6DH 1UA6L 4H8WC 5FA4A 2EECA 4PP1D 3TNMB 5FB8A 2D31A 2R0KH 5C0BB 4OGXL 4ZNCD 4I3RH 3P4MB 4WI7A 3KLAB 3QNXB 5JXEC 1J88A 1G9NH 3RDTD 3V52H 1HQ4B 1EHLH 1QNZL 4NZTH 3FN0L 4WHDA 5EZJA 3AM8C 4KK8D 4OLZH 4H0GA 1NBZB 2WIMA 3HB3C 1A4KA 1NC4B 5TFSL 3MLUH 4UIMB 3VE0A 4P2OA 2ORBH 2WLZA 3ZL4L 1HINH 4KU1A 1UM5H 2CIKA 2V2TB 3INUH 1HHJB 2AJZA 3GKWL 2Y7QB 4HLJA 4HZAA 3T0AA 4QOKD 5IB2A 2AAVA 4LU5L 2LE9A 5IJVA 4LOUC 3NPSB 3CLEL 3ZE0E 5JIKA 2VLJA 3WMSA 1M7IA 1HCVA 3MNZA 5DD6B 4HS3B 1BQHG 1N64H 2MJWA 1ZT7B 3MCKA 5KSVB 5J6HB 1BGXL 1ZV5A 2UVEA 4NFDA 4P3WA 5INCB 1FSKB 4E9LA 5FYLD 3BESR 3DO7B 1P1ZB 5MEQB 2K1MA 3ARXA 3U0PA 3IDIA 2VIRA 1OTTD 4X7DC 1S7SB 3JV0A 1XGYL 3MXVL 3QQ3A 4I13B 4IIQA 4G80A 5SWSA 4G8FB 1LVEA 1YEDB 2RBLA 4I3SH 1MFCL 2BVOA 4JRXA 3BSZL 3TH2T 3WNPA 3BQUD 4NZDA 3BPNC 3CLFH 1M05A 1ADQL 3EYVA 1NLBH 2HLAA 2JIXD 3CVIL 4P5KA 5EU4B 2J2ZA 4P9MH 2H6PA 3TIDA 3KPNA 1MCKA 2DD8H 3BIAX 8FABA 3CU1A 4EDXB 1QHOA 5KJRH 4M6OL 2YC1A 1FL5B 2BX5A 2J8OA 3PNWB 1A6WL 1D6VH 4WO4B 1XGPA 3BKMH 4FQXD 4I18C 2C9AA 1KEMH 2BVTA 4XPAL 5I73C 3NN8A 1HHHB 4BELD 3S36X 4ERSH 5BXFA 3FB7A 4IRSC 4TOYL 3LH2H 1DP0A 4BYHA 4OLWL 3OXSA 5IKCB 3LAFA 3D39B 3BH9B 5EIQA 4ZXBA 1INDL 1OP3H 3EDDA 3BGFC 3NZHH 2GQHA 4GG6F 4M7KL 5EDXA 4NO2B 1A7QL 3GO1H 1PEWA 2NY0D 4NQCA 2F5BL 3QEQD 3ARFD 4HS6A 4KHTH 4JQXA 4HG4J 5LWYH 3X3FL 43CAB 3TVMB 3PHSA 4AT6A 2FH8A 4MAUH 3L3JA 3F8UB 3QZWA 3DYPA 4GW5B 2EC9T 1BX2A 4ENED 3DOSA 1CIDA 1JV5A 2JJSC 2OZ4L 1RULH 2VDLL 1FIGH 1JGLL 5SWZE 3K0WA 1KELH 4PR5B 4ZSOB 1JBJA 2R1YB 5DK0B 1F90H 3FJTA 2PXYA 5GS1B 3D2UA 2IJ0C 3L3DA 3VGEA 3BFOA 4H5SA 2IQAA 4NP4L 5IB4A 3ARBA 2G60H 4FQJL 4LK4A 4NNPH 4GG6A 3HE7D 4HKXB 2DQCL 4DK6A 4UINL 2YUZA 3U30C 3VE0B 1CE6A 4UOW0 4XRCB 2DQFA 5BS0A 5I8CA 2LU3A 5C0CD 4F15B 1WIOA 5IUSA 2JJVA 5MP6L 1FDLL 2R0ZL 4LSPH 2HTKD 1N2RA 2OMBA 3T77A 2AK4E 1T7YA 1HKFA 4H0HB 1CLZH 4S1DC 3L1OH 4OFKA 5IB2B 2YKLL 1BQHA 4WGVB 3D3VA 5IJVB 3V6OE 2DQIL 2LAAA 2VLJB 1MIML 4G9FD 3IYLW 1IRAY 4OJFL 1HILA 2UY7A 3GK8L 4H20H 1VFMA 5D8JL 3EDKA 4U1NB 3H0TB 4XMKH 4JFED 1OAYH 3AAZB 4ZFFA 3BP4A 5C70A 4RAVB 1T6WA 1JPSL 3NH7L 4KK5C 4N90E 4YNYA 1HHGA 2IG2L 5I1IH 1LK2A 4YE4L 4F37K 2VLRB 4U6YB 1K8IB 5GPRA 3UPRA 4U1HA 3WO4C 1OP5H 4P0DA 2H1PH 2NY5C 5KSAC 4L3EB 5IGXL 2H41A 3QEHA 5I1CL 2IBZY 1M05B 4XVTL 5ENWA 4YJZL 1CGUA 3RY6C 3UEZA 1T7WA 3MRCB 2ED8A 5MENE 1IQWH 1K4CB 5IG7B 2PR4H 2BJML 1IEAB 4KTDL 4QXTA 4EZMA 5L9DL 1XF2B 1UH4A 3JVGA 5JZ7C 1A7PH 1G7MB 1UVQA 2HT3C 3HPJA 3NIFE 5KVEH 5I0DA 1RVFH 4QHLA 1ITBB 3KXFA 3CZFB 2GT9A 1KPVB 2C3VB 2GI7A 4XWOC 4KI5F 3Q2CA 4DGIH 3BUYA 4JFHD 1BVKA 4DTGH 3MRRA 1YZZA 2CLRB 2AVGA 3CC5A 5K9QI 4AL8H 2B5IB 3VRLF 5C3LD 4XVSH 1G1CA 1TDQA 3FHQA 1LDSA 1U58B 4GJTB 4ZODA 3GSQB 5DMKB 1W2KT 5HHQA 1GAFH 3O2WH 5J12B 2QQLL 4HT1L 3O6LL 4Q7DA 4AK1A 1ZLSH 1UKSA 5FYJE 3U46B 5DQJB 4NQXA 5D7KE 4D9RE 2APFA 1JYVA 1CGSL 4G43A 3DECA 2IPKB 1OGTB 4PJ8C 1FHGA 3L3JB 2CMRH 2CLZA 1J0YA 1GYAA 3SJVD 1HEZB 1J87A 3PWLA 1FNFA 4M7JL 1I1YB 4O58L 3MGOB 5EB9A 3TFKD 4OLXH 1KLUB 4UTBL 1CDUA 5FYKU 5IEKB 5GRYA 4YFLF 3WUZA 3AMKA 2PXYB 3QCTL 1MRCH 1F3JA 3C6SA 2MKLC 4Z7OE 2WQ8A 3OAUH 2XYCA 4JDZB 4PTUB 1GPOH 2QL1A 5FHAL 3GMQA 1EVTC 2X09A 1WFNA 4PV9A 4WUKH 4LEXH 1FBIL 3IAQA 4P2OC 1ZHLB 3HMWL 3EOBB 1S8DA 2XA8H 5I6XC 2BFVL 1OAQH 2AV1B 1TNMA 3MJ7B 1EVUA 3K4ZA 4KUCD 4NKQB 1ZLUH 3ULSA 9CGTA 1Q0XH 1UGNA 1JHKL 4FQHB 4NRZA 1X4YA 4KZEL 2IWGA 1GGIL 2GK0B 4XBPB 4KRMB 4GRMA 1TPXB 3BX7C 2BSED 1GVIA 4MMXC 2BC4A 3PWVB 5F7NC 3FFCD 3Q48A 3NBNA 1A7OL 1CF8L 1AO7A 2NNAB 5DUBA 5C71A 4BFIA 4ETQA 5GRXG 1OL0A 5MERA 4LKCB 2KZWA 3SGDH 4NZUH 3O3BB 4WFHD 3LKPB 1U6AL 2FEEL 2OL3B 5DJZB 1IGFL 2X1WL 3O6KL 1MJUL 4HUNB 5F21B 3TYGH 2D7TL 2VL5B 2PO6D 4ZFFB 3LPGA 4KGJA 2YK1H 5DWUL 2AXHA 2AEQL 3QXTA 3BISA 1GC1H 3RY4A 1ORQA 2GTZA 4YNYB 2BNQD 4IIQC 2NY4B 2EYRA 4M1DH 4POZC 4P2RB 4WY7L 1C5CL 1V7NL 4LSSL 4Q6IA 4PJAE 4U1HB 4HC1L 3OV6A 5EC2A 4X7SH 3UTSD 1WWWX 3ILQC 4XBGB 2QSCL 2FECL 5CILH 3CVHB 3ZT7A 2VAAA 3ULVF 5ENWB 4I0PD 4FFYH 4ODSH 4R4ND 1O7SA 4MZ3A 2IC2A 3I85A 1S7XB 4DN3H 3PGCB 1F11B 3QDGB 1CFTA 3PIQA 3NACL 4CL7A 5KS9F 5IHLB 4HGMA 2AV7B 2XN9A 3DUUB 3NA9H 4XC3L 3HPJB 2NXYB 2J5LC 1CE1L 1KIUA 1BZ9A 4EOWH 1N5AB 5DMYA 4JO2H 4QHLB 5EORL 5IQ7H 4KVNL 3VXUB 1BZ7B 4FFWC 4N0UB 4ZFOA 4ZXBC 3MRDB 2PYEB 3FHAA 2XQYG 2B5IC 5LQBH 4M93B 4ZUSB 1ZLWH 3RIAK 1XF5A 4PJBB 3GMRB 2R8SH 5C0IA 2DKUA 4JQXC 2V9TA 3QBTB 2YWZA 4MAYA 4ODVL 3T04D 1G7HA 5IM7B 2OQJA 3ROLB 1E0OB 3DGGB 5TPWL 2N7BA 2Y07H 5F1SA 5KS9A 2ZJSH 2XPGB 4XAKE 1J8HB 1CXKA 2Q6WA 1NLDH 3VXTB 4Y88A 3E1F1 3WDHA 3N1QC 5I1DB 2W0FB 1OAZL 2PXYC 3GMLA 4YK4C 3EYUL 5JR1H 1CD8A 1VEOA 2AS5M 3ARBC 2FX7H 3MUZ1 4Q9CA 4HK0A 2ICEB 1LE5A 3QYCA 4K3DH 5D70H 1HHIB 1LEKB 1AQDA 3KPRD 3RHWF 2V5YA 3THMH 3DVNA 4XBEH 1CU4L 1J8KA 3U9UB 3KPMB 4X7TA 4ZO9A 3SDCA 4L4TA 2YXMA 2MQ0A 2Y36L 1I8MB 1ES0B 1IILE 2DQEH 4MD0A 5DJAA 2D03L 5JW4N 5CSZA 2C1OA 3IXTA 1T1ZB 1TQBB 1KGCD 1EEUA 1WCQA 1HYRC 4TSCL 4PJFA 1TPXC 5HYJE 4NN7B 1HI6A 4GRMB 4M5ZL 5D7IF 2Y6SC 4CN1A 2BC4B 5IQ9A 1QTYT 4WUUB 4Y19D 1CL7H 4QRPA 1DLHA 3MLRH 3SY0B 3OAZK 3ECBA 4FTVB 3WFEL 3S36L 4B7LA 3MRQB 2LFGA 1MJJA 1ZE3C 1IGYA 2H32A 3MGTB 3RL1A 1S9YB 2VH5L 4K3EH 1RZKC 1ZHNB 4YEEA 3HG1A 2FEDC 1V3JA 2P48B 2ADIA 4F7TB 3GRWL 3VFNB 2VL4A 5KZCD 4AEHL 1VEPA 3MOBL 1T1XA 2YD2A 1ORQB 3BN9D 1SY6H 2I25N 4P4KA 4RFNC 2ESVA 4YO0A 4JY6A 1G7PB 4W68A 5FYJL 1F3DJ 1I1FB 5D7IA 4AMKL 1MIEL 2YEZB 3I3DA 4KQ3L 5EC2B 1G9ML 3S35X 2B2XL 4PJHE 1BFOA 5JO5B 3ZE1E 5GGQL 3OJ2C 2I26N 4U6XA 1MI5A 3GIZL 2V17H 3B3IA 2DTSA 2BNRD 3P4OA 5C0JA 4OLVL 4RGND 1ZA6A 2NY6B 3JVGC 5C9JA 3BP5B 2VERN 1IAIM 3FQRB 3U9PL 3B2UC 3V4PL 1TCRB 3MV9D 3FB8B 1KF9B 2HFEA 4QRRB 4S0TD 1QFWM 4XP6H 5E6YA 4WHCA 1R5WB 4K2UH 2J4WL 5L2JA 5ANMB 5E8OB 4KJYA 1EPFA 3GUTA 4OFPA 1FAKT 2CDGA 3N1FC 2UY6A 3IFOA 2W60A 2VZ3A 1NC2B 4WV1A 1E4XL 4CJ0A 2BSSB 3TBVA 2IAMD 5B22A 4PLNC 3T0ED 1LILA 5L8LB 2HJLB 5BRZE 3V5KB 1HIML 1BLNA 4X5WA 5CP7B 1GGCL 1CG9B 5E9DE 1DANU 1YYMH 4PGCA 4MD5B 1T20B 4MQXC 4LRNL 3C9NA 3VH8A 1CBVL 1QPXA 4YHNB 5I1HH 2JCCB 4LPTA 3K2UL 3KYNA 2HFFA 3IVKA 1QUNA 4TNWK 4KI5C 3N9GL 4Z0BL 4Y16B 4CGTA 5D6CB 1C5BL 4HWZA 4K8RH 3ME0A 4HK0B 4A6YA 1FGNH 3I75B 4U6HA 4UDUA 4GRWF 3QFJD 3DJ9A 4N5EC 3RGVA 1MFBL 2FATL 3O9WD 3RU8L 3GI9H 3JWDH 4WENB 4KROC 2O5XH 2DQUL 2NY1B 5EH1A 1T0PB 4L4TB 3P73B 3TIEA 5TGBA 4JB9H 1DSFL 3TWCH 3UC0L 5IW3A 5DJAB 5I18L 3S4SG 1AHWB 4PGJA 1Q0YL 4PJFB 4PB0H 1J5OL 3QH3A 2HJKB 3EHBD 4LF3B 1M4KA 3C5ZA 3V0WL 1NGYA 3M8OL 3TESA 3PJSA 3FT4A 5LXGH 5D4QA 3MOAL 5JXAL 2ADGB 4PD4K 2UZYB 2EKJA 2NY2C 1LEGB 3MJ9A 4CVUA 3MNVA 1EXUB 4XPBH 3V95A 4Q9QH 1RMFL 1XF4A 2C7UA 32C2A 2FYYA 1HWHB 3HAEG 4JZNA 4LCCC 2IFFH 3VJ6A 3IB4A 2EIZA 3KPQA 1NEZB 4V1DD 3RL1B 2COQA 3A6OA 3TO4B 2FLBT 1S7TB 5HHVL 3LKRA 3HCVA 3HLAA 1KCVH 4ALAL 2UUDH 1ZHBA 1IBGL 2EH7H 3QRGH 1AKJB 3IS0X 5F72S 1B6DA 2V7NA 4Q6IC 3O0RL 3IRPX 4FFVC 5JNYB 4P4KB 1HH9B 4UB0L 2GKIA 2VO5A 1PZ5B 2ESVB 5A16B 1JK8A 2EDYA 4FG6C 4G6JH 4X80H 5HYFA 1DR9A 2W9EL 4MB5A 1UZ6E 4S1SL 3BO8A 2HMIC 1K4DB 2XTJE 3P30L 4LCIL 1JMXA 1J11A 4OZHF 4DCQA 1NGXA 1FNEB 3TPKA 3CK0L 4HC1A 4WWKA 3BEWA 4HXBH 5GRVL 1FPTH 1TJHH 5C0JB 4OCRL 3C5SA 5DT1L 5T3ZD 4XZUB 1N59B 3ROOB 4O2EA 1HNFA 5SWZA 3G6JE 1AD0A 3L6FB 1LK3L 5FF6B 3QQ9D 5FOJA 4RWYL 3MFFB 4IDJL 5DD5H 4R4BB 1P9MA 1T7VA 1XR8A 3KYOA 1FYHB 4M8QA 4PY7B 4ONFL 3BAEL 5BCAA 3CDGB 2OJZH 3HE6B 1EFXD 4NT6A 5CSGA 3I50H 1UXSA 3IFLL 1ZAGA 3OR7B 3CMOL 3W11D 2RAMA 1DBAH 1IGIL 3IFOB 3ULVC 4MA8H 1I9JL 1KN4L 4BSWA 4HX1A 1QSEE 2UWEB 3FQNA 4KPHL 1G9EA 4MAYC 4JFZL 5AUMA 2F53E 2FHBA 1DBMH 4OZFB 2GTWB 2Z91A 1YEJL 1LO2L 2AK4A 2EKSA 5FM5M 3K4DA 5L88L 5E8NA 5DFVD 1CICA 2NW3B 3I3BA 5HHXH 4OGYH 1JIBA 4LVOC 3V6OA 2FX8L 3VG9B 3O8XA 3NIGE 2J8UF 3LKNA 5C0AE 2HFFB 3T3ME 3KDMA 3VFWB 1DQMH 5IFHL 4J8RA 1YY9D 4HWEH 3L5JA 5LBSL 1JRHH 3X12A 5MEPB 1FG9C 1Q1JH 2DIAA 1XIWA 2FL5B 1TETH 1U8OA 5EUOB 3QIBC 5CJ8A 5DJ6B 1OF2B 2YD3A 3QCUL 2OP4H 5CWSB 5E94B 3NIFF 3S4SA 3SDCC 5DQ9B 3HHRB 4TN9A 1LO0L 4XCCH 3VWKB 1JMZA 4MNQE 3IDGB 3LOWA 1RURH 4OZGB 3WUWG 2O5ZH 3H9YA 5B4MD 2DMKA 1IT9L 1R3IL 2F8VA 1WQVT 2MWCA 1ZGLB 3FQUA 3PWNB 3QXAB 4YC2C 4QHNA 4FQ1L 5D7LB 2D4FA 3H8NA 4IJ3C 4F3FA 4PJ5D 5I15H 2ZPKH 4OI8A 3FT4B 4HEME 3QA3B 5K59F 2J8UA 2HT2D 3OR6B 3HAEA 5CZXD 3TBSA 1NKRA 5MENA 4XMLL 5C07B 2VWEE 5CBAA 1KCUH 3SDAB 4YHZH 2BNUA 4YHPA 4POYA 1KUMA 1RZJC 3U1SL 3QHTC 4ODBD 3P0GB 1XGQB 3FQXA 4DKFH 3SDYL 2ZUXA 4RISL 5D2LF 4P4RA 1YEIL 1JRHI 3QPQD 3W39A 3ZTNL 1V05A 1ZHBB 3BKJH 5DA0B 5HI5C 4YHOH 4B50A 4KXZH 3RTQA 5KN5A 2V7NB 4LSTL 2VB5A 2CJUH 1VGEL 2X70A 2GJ6D 3IGAB 1AR1C 4ZUWA 3K4AA 4WW1B 4B41A 3O3EA 4GW4B 3RY5A 1XGRB 3PV6A 2Y72A 5GRJL 4PJEB 3DLQR 1TJIH 5B3NA 3VG0H 3MROB 1S9WA 1JZ8A 3WSQL 1L9NA 4NIKB 4A2LA 3DMMB 5I71C 4J4PA 5KVDL 3PHQA 3CDFA 5C92A 4NC0B 4TTDC 5EN2B 2AGJH 3RVXC 4LVHC 1IC1A 2J88L 3IDYB 4QRQA 4P46B 4MVBD 5D2LA 2XFXB 4N1CA 3EJYC 3QUYA 1AD0B 1D5XB 4MQSB 5SWZB 5AYUH 2X4SB 1N5YH 4NQEA 1A5FL 3GBML 5F1IA 1G1YA 3BZDA 4L29A 1QSFE 1D3CA 3VXOB 3MZGB 1LEIB 4NT6B 3VXSD 2X4UA 4KKBD 2G75A 1FFRA 4ELMF 4KXZI 4WV1C 3EO1B 2Q76B 5FKAB 3ESVF 3CD4A 1J18A 3O4OB 4Y5VA 4EUPG 1FG2B 3CXHK 5GJTH 5MI0C 5DHXB 4Y4HA 4NM4H 3I02A 4JRYD 1RIUH 4PP2A 2IBBA 5IESL 4PJAF 4YPGA 4JQVA 3O2VL 2AK4B 2CIIB 1RU9L 4QXGL 3FB5B 3HNTL 4XHJC 5DR5H 5IP4A 1CICB 3ZKXB 1QYGH 4DGVL 5C2UB 5DJ2B 3FO9A 3GJEB 3T2NL 1AC0A 5ILTH 1WFTA 4YH6A 4GS7B 6FABH 3SO3C 3PP3K 3LD8B 4FQCL 3DXAE 3QXDB 3RGVC 4ELMA 1OPGH 1FYTA 4D0DA 3EYFB 1JNNL 1REIA 3QSKB 3WUWA 3S4SB 3KPPA 3SDDD 5IFAL 4JGMA 1DFBL 1VKXA 2B4CC 5I17A 5B8CA 4N8PA 5DO2D 3S35L 3C09C 1KFAL 1T22A 1DN0B 3T1FB 4PJAA 5CIPA 1EBAA 1I7UB 3C5ZC 5JUEH 3VWJB 1UJ3A 4N0CC 4NKIH 4X6BB 5EU7E 5IJKA 1J12A 4ZNEA 1OAUH 2K3TA 1AP2A 1MHEA 1BAFL 1DN2A 4ZUVB 1RD6A 4F7EA 1AGBA 4L8SA 1JL8A 2VABA 2ZZUT 4EBQL 5C6PB 5EUKB 3VD4A 5A2LH 1F3DH 5BMFH 4FQPA 2BP3A 1NJ9B 3LHPL 5LAXA 2FB4H 4Z77A 5I8EB 4Z7WB 3PWUA 4NM8H 5EOTA 1RZGA 2X4OB 2V9RA 3ULUE 1JNLL 5ID0A 2DOCA 1DE4A 4OGAC 1PLGH 3FRUA 5JTWA 3L3IB 1HK6A 5F9WC 4LSUH 1JHTB 4LLDB 3OXRB 1BFVL 5KOMC 4HMCA 4TUJB 2HKFH 2HT4C 3LZFH 5SX5H 4QHMA 4YDLC 5CEYB 3RTQB 2IH3B 5HHOE 5JW3H 4K23L 1Q9LA 3OJDB 3F5WB 5GRUL 1F6LL 2HAZA 3Q0HA 1YC7A 5C0EA 1G7LA 1MCNA 1WITA 2JTDA 3P9MB 4OM1L 4G7VH 3O3EB 5E8EA 12E8H 4YX2H 3LS5L 3MLWH 1WC7B 2ITCB 2UV3A 3NCEB 2BOBA 4WWKC 1JZ5A 4WHYG 4YUEL 3D18B 4YFLI 3ARPA 3MJ6A 3IU4H 2DQTH 5IBLD 3X11B 4GO6B 4NJ9L 5D1XA 2MTPA 5I1LB 1NCUA 4QRUB 2FO4A 3HMXH 2YPKA 1A7RH 1PFCA 3VD5A 4ODUA 3L5WB 3G5VB 3B6SB 2AJVL 5C0ND 3KNBA 4QCIA 1P9MC 5GHWH 2X6MA 3WLWD 4AEFA 2XKSA 2Q8AL 2F8OA 5FUOL 5EOCJ 3SPVA 1WK0A 4EVNB 3MBXL 3MUJA 2W1NA 3WL9B 3QO1A 3ULVH 4WNQB 3TT3H 4EUPA 3G04B 2X4UB 2OJEB 3MACH 3O4LD 2G75B 4LARH 3BKCL 1NDGB 4JG1H 1EMTL 1FVDA 2X4PA 5JQ6L 3IAGC 5GS0D 4LCWD 3TYFA 1S5IL 2ZSWA 3UZEA 3FO0H 2KZ1B 1RJYA 4ODTH 1NGZA 2Q20A 2XQYK 3GHBH 5TE6L 3WIHA 1C8PA 3QDMD 3BHBA 4HBCL 1FGVL 3V6OC 1JF5A 1IARB 3O8XC 4PJHF 3ZE1F 1F4WL 1FFQA 1OGAB 5HYQB 1VACB 5GSVA 5DMIL 5J3HC 4ZTPL 1UWGH 2D9CA 2X5PA 4YXKH 1UWEH 4Y2DB 2EDEA 2ILLA 1XIWC 4F7PB 1WF5A 1IGCH 4HIJA 5HY9B 4GSDH 1WEJL 1MAJA 2ZUUA 3KG5A 4L4VE 4ZS7H 5FO7A 3DETC 2D7NA 3L3HA 4D0DB 1S3KL 2XKNB 4NRYA 3QIUA 4KH2A 4G8GD 4X0KA 3QXWA 4XNYL 5DD0H 5CJXA 1LO3L 2YZ8A 3S37X 5E2VH 5LGJA 5FGCE 3FB6B 5H37H 1WIUA 5F7DA 4HF5L 4FXGB 1UB6B 3S88L 3HUJB 1M7DB 1CZ8L 3G5YA 4G6FD 2KH2B 1CYGA 4PJHA 3D69B 5AD0B 1H15A 3LSOA 3BEVB 2W0PA 2H32H 2P5EE 4DK3A 2X4NB 1RZJH 3O3AB 3PQYD 3FN9A 3STLA 2Z31D 3VRIA 3X13A 3EFDH 4J6RL 3MUY1 1A6PA 5EO1B 3VXMB 1T66C 3P0YH 4ZOEA 4JAMA 5ID0B 4TSAH 4NSKA 3SDXE 5CBEB 1I1RA 1K2DA 4CW1B 2OMNA 3TBWB 5GZOD 1B6UA 2FSEA 2XZAH 1KT2B 5FUCC 5JXED 4OAWB 4X9FA 5GXBB 3RTQC 2JLLA 5E2JA 1YUHA 3G9AB 1YEKL 1D5IH 1T4KA 4R9HA 3HB3D 1T2QL 2EIBA 2VITB 4DGYH 4QHUB 4Q2ZB 4OLUH 3GMOA 5GRWA 1Q9LB 3MLVL 5IVXB 2XXCB 4NWTH 4KAQH 1G7LB 3RPIB 4YXLH 1RIVL 4Y2OA 3QNYA 1MFEL 4F58L 1GGUA 4ZD3L 1KSRA 3GSNH 4OFDA 1MWAL 4G9DA 4KK9C 4MNHB 3T4AB 1P5VA 2EDBA 3IKCB 5I66A 5BRZA 1EV2E 4J4PC 1Z3GL 5CLTA 4PRDA 2B1AL 4ONGL 5DEGB 3VDBA 4FNLL 3QUYC 2FO4B 3SE9L 1YC8A 3WS6A 2EDNA 4UT9H 4AZ8A 3T2QA 3LKOB 4GW1A 1P7QD 2A0LC 3GSRA 1ZA3A 3UJIL 3QB7C 2IAND 3KNBB 2XZQH 5CP3H 1EIBA 1QRND 4JFPA 2EZ0D 4M61B 4DUXA 2LAGB 3U7YH 3ZKSD 3DHMA 1FV1A 4C56E 4N8CH 4W81A 1AQKH 3NFSL 4MDJA 5IW6A 5IHZA 4EUPB 4FP8L 1NGPL 4ETYA 2OR7A 4ISVA 3RBSA 2NW2B 4Y5VC 3RZCB 5C6WH 5BW7A 4FMFA 4M03A 4LLYB 3CSYA 1PEZA 4OFYD 4Y4HC 3GGWB 4N5UA 4R7NA 4PRBB 4AJ0A 2XZCH 4GMSL 2C4FU 4JQVC 4PTTA 5HYJB 5IMMB 5JA9A 3PWPE 3A6BL 1Q94B 2YD6A 1LO5B 4J12A 1UM4L 3N1PC 5T5FH 3H9SD 1MFAH 2P8MA 2DLIA 5D72L 4BK5A 3ULUL 4L8DB 4A6YH 2P5WD 2DI9A 4RZCA 3CH1A 2ICES 1B9ZA 4I9WE 5E6ZA 5H94A 3JUZA 1Z5LB 1A1OA 4ELKA 3NFNA 4DQOL 2JE8A 4PB9H 4F57L 3G6JF 3GBLA 1YPZE 3E0GA 1NAML 1RZFL 3IXAA 1JE6A 4GKZA 4I5BB 3QIUB 4L1DA 1KNOB 5B8CC 1T03H 1QSVA 1BD2D 1TQCB 1FE8H 1FZOB 3OGCA 2GCYA 1C1EL 5C0RH 1UJ3C 3PP4L 2VLME 4CADA 5IJKC 5FUZH 1QACA 4NHUA 1W0VB 2R56L 3RQ3A 2H3NB 3MJ9H 1PQZA 3P9WB 1NAKL 2A6DA 3Q6GH 3MREB 1N7MH 4L8SC 4PJHB 2IALB 25C8H 3QFDA 2VXSH 5HPMA 4GRWH 3WEXA 4IHOA 1MCDA 1RJZA 4AG4L 3X13B 3MYJB 5BV7C 4YGVA 5MEOA 2IGFL 5C0BD 2OX5A 1T04A 1A3RH 4U33A 2X9XA 3G6JA 4NSKB 5HYEA 1K2DB 1NFIB 4Z95L 3SQOL 3OPZL 3CCHB 1FFOA 3TZVA 2RFXA 1OD7A 3RDTB 5DJYB 3T3MF 1NC4D 3LN9A 4RFOH 4CNIB 2CRYA 1AC6A 5CJBA 4MA7H 5E4EC 4IRJB 1BIIA 4P2QE 1E28B 1CVSC 1JF1B 2BVYA 3QNYB 1ZGLM 1GZPA 4CVXB 1ZEAH 5AZEL 4NO3A 2EICA 4JJ5A 4JFDE 4S1DD 1F6FB 1UYWL 4M1CC 5D1XC 3WD5H 3HI1A 1CGXA 1M71B 2X10A 3QCVH 3U6RA 2AEWA 5E9DB 2XTLA 2PTUA 3G08A 2DLGA 4E41E 1U8HB 2FWOB 1KJ3L 1A2YB 2X4RA 2X41A 4UDTA 5JHLL 1ZA3B 43C9B 1TIUA 5ISZE 2W91A 2EO9A 4IS6A 3NABH 3RVVD 1NFDB 1HSAA 3RWCB 3LN4B 3H9HA 4RGOH 5T3XD 2P24B 1FV1B 2V5RA 4KK5D 3TLRA 4PD4J 1CLOH 1SJEB 4MDJB 5IK3A 5IW6B 2P8LA 2AQ2A 1FZMB 1IGTA 1NBVL 5J13C 4HDIB 4Y4FA 1JNJA 5DTFB 3O41B 4M5YL 3KYKH 5FA3A 4M7LL 5D96C 3BXNA 4DKDC 1ETZB 1S7VA 4U1MA 1BBDH 4X9BA 1QFPA 1TLKA 2Y23A 4P9HH 1KJVA 1H8NA 3VD7A 3MRNB 5I75B 5DJDA 3LMJH 1C12A 4RIRA 3UO1L 2IMNA 1VADA 5TF0A 3N85H 1CCZA 2V9QA 4WTZG 1DBJH 1KJ2L 2P8MB 5JZ7D 4XB8A 3BGMB 3KHQA 5J11B 4KKAD 1MY5A 3VA6A 1R3HA 3TN0A 1DLFL 3CH1B 4XPTL 5T5NF 5L7XH 4JDTL 4JDVA 5H94B 1J0KA 4ELKB 3NFNB 3D1MC 4JHBA 4MCYB 2GY5A 1AXSA 4BJLA 3QUXB 3RWJB 4WDIA 3QIUC 1KCSL 3T0WA 5CJXC 1AD9A 2PW1B 4ONHB 4GAYB 1BM3H 4AIXA 4QLRA 2ZOKB 3ARRA 5HHPA 2DTMH 2AJ3A 5INDA 2A9ML 3OGCB 4WI5A 1G7JB 2XWJB 4JY5H 4I48B 4HPYH 3QEQB 3TVMD 4CADB 2JELH 1S5HA 2LVEA 5KW9H 4NHUB 4Z0XB 1T21B 4JO1L 4O4YH 3VDCA 4TPRL 1KEGL 2DM4A 2XTJB 1UQSB 1VFAB 4KVCH 1YMHA 3CSBA 3D48R 2NZ9D 4U6VH 1HYSC 2ADJA 2HRPL 1D5MB 3JTTA 3WNNA 4QF1A 3OX8B 2V5MA 4R26L 3V5HB 4NO0B 1JPGA 2W9DL 5ID1A 4UU9A 3T4YA 3B9AA 4GXUM 4IM8A 4N0YH 1ZMYA 3ZHDA 1YN6A 4FFZH 4Z7VE 5C86A 3KLHC 2OTWA 3FO1B 1MCFA 4OM0H 2RFXB 1WVZA 1I4FA 3B5GA 3QAZB 1S78C 1NCWH 3GKZA 3IFNL 1QSFA 3EO9L 2APXA 5F9OH 3QXVA 1ND0A 3FMGH 3WFBL 1U8PA 3WIIH 1DQDH 2EE6A 1BOGA 1SMAA 4IOIA 4HAFA 5EOCH 3WLBB 2MPAL 2ZCHL 1GZPB 4PJ7E 3L7FA 1QSEB 4PLKD 2ARJB 3LIZH 1S9XA 4XMPL 2DQDL 2BMKA 1LD9A 3TO2B 2KQMA 4X98A 1FRGH 5I1GL 1X6LA 5GQBA 2VLJD 4KJWC 1OHQA 2F53B 3V8CA 1T5WA 3VGGA 2QKIB 4CMMA 4O5LL 1WICA 3ZDXE 5FOBA 3WS6C 3U6RB 4LFHG 3EGSB 4O2FA 5D1QA 1I8KA 1W72L 3HA0A 2X4RB 4M43H 1EGJA 4NFBA 3SGEH 1EUTA 3JSSA 3S96A 3WFZA 1R24A 4U0RC 5C0AB 5ALCL 5FYKH 3IFPB 3CXDL 4OCSL 1Q9WA 5IB1B 3MRKA 4DAGL 1RK0B 3QPXL 5E1AB 1V7ML 3DXAA 3S37L 3C6LA 1VPOH 2J1KA 4CU7A 5SWSD 2ZCKL 5BW7C 1SBSL 1PY4A 2P1YA 1IM9B 5GRVK 4L3ED 5C09E 3RAJL 4D9LH 4MNQB 3GSUA 1LE9B 2NX5E 3U83A 1K8DB 3W9DA 3ILQD 3TPUB 2NY7L 3AREA 4WTZA 4RNRA 4AIZB 4G7YH 1KJVB 5T3XH 1L0YA 2MHAB 5ESVA 5HGBB 2I27N 5T1KB 3P9LA 3HC3H 3D0LA 2DQJL 3U48A 4YHYC 1ZVSA 3GHEL 3UZVB 4I2XB 1PYWB 3LEVH 4NQTA 4WJ5A 3W2DL 4JZJB 5JDSB 2OK0H 3QI9B 4XP5H 5JHDE 1F2XK 4R4FH 1VA9A 3SGEI 3TCXA 1CDIA 3UAJC 3DHJA 4Z76B 2BDNL 3OAYH 2EDOA 1CDCA 1A9EB 5CIPH 1AGFA 4FABL 5EZLA 2ERJC 4LNRA 2QEJA 5HHPB 5E2TH 2AJ3B 4OI9A 5HHOA 4N0FA 1IM3B 3DX6A 1QR1A 2R2EA 5E08L 1I9RH 1UC6A 4U1GC 5DMGC 4HCRA 3L3OA 2PTTA 5KSBF 2VDRL 1CDYA 5F9JA 3UDWA 2XTJC 1UG9A 4WI6A 3TM6A 3JXAA 3H3PH 2ZP0T 4GAGH 4QTIH 4MX7B 3V4UH 2I07B 5F88B 5TE4L 5LGHL 3DVFA 5ERWB 3QEGH 3WCYA 4W4NA 2AJYL 1NMAH 2PXYD 4OZIE 3QIWB 3CX5K 3CIQA 1G6RL 2XQBH 4HGWB 5LJYH 1J10A 3VFTB 4TVPD 5IT2H 1FO0L 5IVZA 2GSGB 4L5FL 4BFGA 3TZVC 3HC0B 5DUMH 4F7CA 3H2WA 4NKMA 4ZFGH 1UCBH 4NFCA 1SJHA 1Q9OA 2DQGH 2VNCA 3QO0B 3EDEA 4FZ8L 4XP1L 4QOKE 4HV8B 5FIEA 3LVEA 4X4YA 2D7QA 4EXKA 1QSFB 2A73B 3FQTB 4HQQH 1BJ8A 3ARGA 5GGTA 3QP3A 2ZSVB 1HQRA 4YWGL 5KSBA 3B5HA 3VA2C 2O5YL 4XWGH 4NC2B 1YJDL 4AYFA 5CD5C 4KV5E 4JM4L 4S1RH 4PJIF 3WE6A 4W6WB 3QQ4A 4LLMB 1AJ7H 5AWNH 4AENA 4ZG1A 3NFPA 2Q3AA 2Y6SD 3RNQA 1LD9B 1GGBH 1JFQH 5FYLE 2QTEA 3FFCB 3VRJA 2X7LB 4KTEH 1KBGH 1MWAB 5ADPL 2YPVL 4WTWA 3RWFB 5LCVL 5E8PB 4O2FB 5DRZB 4YQXL 3G6AA 4KZDH 1LNUA 3G6DL 1G0YR 3S96B 2L7UA 3BPLC 1XT5A 4I3RL 3EOTH 3OB8A 1G9NL 3V52L 1EHLL 3O6MH 4NZTL 2NY4D 4P2RD 4OLZL 1OW0A 3GSOB 1VGKA 4L4VA 5IB5A 4N1HB 1AGEB 1CN4A 3MLUL 2MOVA 5DLMH 2R29L 4Y4FC 5F6HJ 3FO2B 3CGTA 4JPVL 2ORBL 3WIHH 4L1HA 1HINL 4P5TB 5EBWA 2PW2A 3VI4E 3BUTA 3F7YB 1S7RA 3UTSB 3INUL 3AU1B 5HGDA 3LS4L 2BHUA 2P8PB 4HFWA 3RVUD 1INEL 4RNRB 5F7EL 1YEGL 4M4PA 1SEBB 4Y7MA 5DI8B 3RL2A 1T1YA 1EZVX 2F58H 3QDGD 2VXQH 2NCMA 4XTRC 3HI6H 4Z7QE 3P9LB 2P5EA 4JG0H 4G42B 1N64L 1UCTA 4I3GA 1X5YA 1QZ1A 2EDWA 2NXYD 4WJ5B 3TN0C 5DS8B 2HTLC 1I7ZB 2DWEB 3KXFD 2DJUA 3VXUD 4PRIB 3LB6C 5B39G 2DF3A 4LAQH 4DKEL 1NMBL 3WHE1 1S9VA 5IB3A 4X9GA 4OFIA 1OAKL 3KS0J 2X44D 4M3KB 4I3SL 4L8BA 3FFDA 4OD3H 2IH1A 3DX6B 4UI2A 4XCNA 5E8DH 1NAMB 3WKNA 3CLFL 5JIIA 1NLBL 1MLCB 2NR6D 4NZRH 4NNXA 4P9ML 4X6CF 1J8HD 3P77A 1JPFA 2DD8L 5BZWA 5KJRL 3OKDA 3MV8E 1U8LA 1YEHH 5TDPA 1WFUA 3L5XH 1UACH 5F7KC 3GNMH 3UJJL 2JK5B 3SCMA 4APQB 2APTA 1FVCA 3GSVB 3RVWC 1KEML 3GSXA 4CAGA 1QLFA 4ERSL 5ESQA 4WFFE 3LY6A 3GDBA 3DGCR 1BIHA 4F7CB 4ZPVA 2E9WA 5IWLA 1MJ7H 3UROR 1MH5B 4OQ1A 1QBLL 4C56A 4X4YB 4ZS6C 3NVQA 4RAHA 3K1DA 1HQRB 1HOCA 3GO1L 4UQ3B 4LMQE 3JV4B 4X6CA 1CD9B 4KHTL 1GJIA 1YPZF 5ETUA 4TVPH 2DQHL 5L2KE 3WE6B 5EOQH 4AENB 2R2BA 2E9BA 3RNQB 2DBLH 4OCWL 2QQNH 4NHCH 4F33B 2VDKL 3TA3A 3PL6C 1FIGL 5IROC 5DJ0A 5D1QC 2F54E 3TNNB 4PJ9B 4Y5YB 4KK6C 5KVGH 3RPKA 2WUCH 4GKNA 1I8LA 2G5BA 2QQKH 3OF6A 4XXDA 2EC8A 1IMHC 3WFHB 1DANT 4MSWA 3IJYB 1OB1A 4NNPL 1W72A 2YZ1A 3GZKA 3WIFA 3C6LC 3LQZB 5KZCB 1QLRA 3T08A 1VGKB 1T80A 3UBXA 4Z8FL 1F58L 2R1XA 4O2CB 5F89B 4O02H 1YPZA 4JFOB 5JMOC 1MHCA 5EBMA 2OL3H 4H25A 5C6TH 4FG6D 3I84A 2BRQA 4JO4H 5EBWB 3S8WA 3AREC 4LSPL 4JANA 2FNBA 1A9BB 5FGCB 2APWA 1CLZL 4HFWB 1N6QH 3L1OL 4P23A 2NY6D 1WIPA 5EPMA 3RL2B 5E5RB 4MA1B 4WEMB 1NKOA 1T0NA 2Z8WC 4RGNB 4RMUA 1OAXH 2R4RH 4HWNA 1WLHA 4TQEL 4PJCE 3AC0A 3MV9B 5KVFH 4H20L 3IDXL 3CVHH 1MFDL 1R3KB 1FLRH 1KJ2B 2FGWL 1DEEA 3C5JB 3SDXB 1RJCA 1I8IA 5HVHB 1RFDH 4R2GC 5I1IL 1OTUC 3P0VH 5TDOB 5IMKB 1P2CA 3QUKB 3OHXA 2R2HA 5D7JB 1S9VB 1P4IL 3MFGB 2AJXL 2Z35A 5T1DH 1NC2D 4HUUA 5FCUH 2H1PL 2IH1B 4S0SD 4ZAKB 3K80A 4JN2B 5SX4H 3LDBB 3Q3GB 4WU7A 3UDWC 5HYSG 4P2QA 2DLTA 4M8VA 1RZ7H 2AABH 2YD1A 3OKNB 4G6MH 4WRLA 3MRBA 4PY8J 4PRHA 3E8UL 1JPFB 1CT8A 1U8LB 1IQDB 2WMPA 3P40A 5TDPB 3ZYIA 4JFDA 4GBXA 4PV8A 2OR8A 3DYOA 4NWUH 4OLYH 4AH2A 1A7PL 1KB5L 2VXUH 2FJHA 3CPLA 4Y16D 1FVCB 3GJFA 1FL3B 4OQTA 5IMOA 2VDPH 3N1MC 1QPPA 5KVEL 1RVFL 1PX4A 4R3SA 4U1JA 1CXIA 5AG8A 3BDYL 4M1GH 5L6YH 3MRPA 1G6RA 5ISZA 4DGIL 2NY1D 1WZ1H 4YDKH 2P47B 3SDCD 4L4TD 3ARGC 4C56B 4YXHL 4AL8L 1JWMA 4R7DB 1EO8L 3PDOA 1QBMH 3MRGB 4CUCA 1GAFL 3O2WL 1HOCB 4LCYB 3D0VB 1SEQL 1ZLSL 3OTTA 4X6EA 3H6JA 1OM3H 2EO1A 2GFBA 3T0XA 5D1ZA 1TJGH 2B20A 3HR6A 5SX4I 2I9LB 3NAAH 1UA6H 2CMRL 5JMRA 1SHMA 3OB0K 4OGXH 1L7TH 5IEHB 4XH2A 1J05A 4H8WL 3PWPB 2BNQE 3DVGA 3LQAC 3MODH 4ZPTB 1T3FB 1ZSDA 1A6AB 3TO4D 1D5BB 1ONQA 4H88L 3RX7A 3BZ4B 3DBXB 4KWUA 3N06B 1M6OB 3BWUC 3CU7A 2EYSA 4JFXA 1AKJD 2CDFA 3OAUL 1OB1B 1NGQH 1GPOL 1W72B 3MRIA 5B38G 4NN5B 1OW0C 3K3QA 2C5DC 5K93A 4FQQA 4P4KD 5A2IH 2ESVD 3OSKA 2FIKA 2XA8L 5C9KA 5CEXA 4K3JH 1YPZB 1OAQL 2ENSA 3VFOA 1AR1D 4Z7VF 4H25B 4MLIA 1KYOK 4C83A 1N8ZB 4BQ9A 1VB9A 7FABH 4NQDE 5GGUB 3REVA 1ZTXL 3WN5B 1ZK9A 5HHNB 1MI5D 1JGEB 1BGXH 4UV7H 4X6DF 5J1AA 4HIXL 5DHVB 3VFSA 3SN6N 4F2MB 4V2CB 1A6UH 1T0NB 3VFRB 1XR9A 1B4JH 1B2WH 3RWGA 3MRFA 4PJ7F 4TTDD 5IHUH 3GIVA 4JHAH 4NZUL 3BH8A 2E27L 5E0QA 5C0DA 1OT2A 4U2YA 4W4OA 3DURA 4UTAL 5B39B 4HIEA 3MXVH 5I8OH 3TYGL 3DTXB 1KG0B 4M6MH 3ZDXF 3MRLA 4YIQA 3HE6D 1EFQA 2YK1L 3ZKND 2VOTA 1MRDL 1LDPH 4HK3J 4ODXA 3IDMA 1I8IB 3RWHA 1QO3A 3RUGB 4Z7VA 2XACC 1QRKA 4MJ6A 3PV7A 4MQ7B 3CFKB 2R2HB 5JPNA 4GXUN 1WSST 2Z35B 4HUUB 3KWWA 1CFQA 2AXFB 4X7SL 4X6DA 3KR3L 5AZ2L 5IIEA 4HHAA 1VEMA 5CILL 1MHPL 2IADA 15C8H 4DOHE 4LSVH 4ODSL 4PJ7A 4JLRA 3UYPA 4O00A 5F7UA 3MV11 2XWBA 5IW1B 1EK3A 3Q5TA 5HI3C 2OTUA 4XHJD 1LO4H 4HJGB 3SCMC 3N50A 3KPRE 3ABZA 4M4RA 4XVJL 3MRMA 5HJ3A 3P4NA 2JJUA 5F96H 4JPKH 1FZKA 5F93C 2IEPA 3ZTJH 4EOWL 4E41B 3HR5B 4JO2L 1A7QH 5IQ7L 1TTGA 3OWEA 5IWLC 1CD1B 2PCPA 3BDXA 3RGVD 2D4DA 1J1PL 3IJHB 1F5WA 1G6RB