1KBGL

Mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN H-
publication title Crystal structure of an MHC class I presented glycopeptide that generates carbohydrate-specific CTL.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kbgL00
1YN6A 4N5ED 3WFBL 5L2KD 4YFEA 3D0VA 1I85C 2CUMA 4TQEL 2VDPL 1RMFH 3PWLA 4OF6A 3LS4L 4NQDD 4NIKB 2W9EH 4EIGB 3LN5B 4Z18A 1OP5K 3DROA 2W60B 2FEDD 3LDBC 1ACZA 1K4DB 3QISA 3GJFA 3MLWL 4YDLC 4ZXBA 3BZ4A 2X4UA 3OF6D 4JZOB 5AG8A 3MODL 1JWUB 2ORBH 3V0VB 3UAJC 1FRGL 3WE6A 3R06B 3JV6B 4GBXB 3WHE0 3MXWH 4KTYA 4F7CB 3ZDZE 3C5SB 2RQ8A 4PBXA 1Z9LA 2X89A 1QHOA 4EI6A 4ORGA 2B0SL 5HI4C 4C55A 4RGMB 5FOBA 1M71B 5MEQB 4ZPTB 1D5BB 1OWWA 4KTDL 4FHBD 1DVFC 4Z5RB 4NC1C 2Z31A 2E6JA 5ISZD 1YYLL 5GRZA 4WI5A 4JN2B 3TH4T 2VXUH 5TQ0L 4E42A 2FATH 3LKSA 4IOIB 4OZFA 3O8XC 1DP0A 2X10A 3WFDH 4KK9D 5C92A 4MA1B 2O61A 3NFNA 2XYCA 1KEGL 2VLRE 4Q9BA 3LPGA 3TYGL 1DBJL 1UH3A 3GSVA 3WEXA 4NSKB 4JDVA 1E28A 1RZ8A 3RU8L 2E9BA 4LVOC 3OAUH 1JTTA 4XX1G 2EC9U 3L3IA 5I8EA 1JRHL 2R29L 3FQRB 2PN5A 1QFWH 2AK1L 3FL7A 4G8GB 2QBWA 4HBCL 4TPRL 3RWCA 3S4SA 1I8LC 4NWTL 5A2JH 3S36L 3VDCA 3SE8H 2BHZA 3BGFC 3TLRA 5FGBA 1KGCD 3GBLA 3QEHA 2ATKA 3RDTB 5A3IC 4PJFB 4YX2H 3ROLA 5CIPB 1G7PB 4HK3N 4I3GA 1RUPL 1RZ7L 3LIZH 3B9KC 1QSFD 5LBSH 3V6ZA 4IMLA 4JFDB 3OR6B 4J8RA 3ZMRA 1P7KA 4I3RL 2P24A 5C09A 4HK0A 1J0IA 2X7LA 1GH7A 5D1XD 4KROB 5DEZA 3RZCC 5CEYA 4XWOC 2GSGB 4XNQB 1KTDA 3WN5B 4YWGL 2CUHA 5FHAL 2CR3A 4DWHA 3QXWA 5DTFA 4X6DF 4C56A 2YPLB 4HEME 3BP7B 1JI1A 4ZUSA 2ZKHH 1KIQA 3G08B 3Q5OA 4OD1L 4GMSH 4Y5VA 5GJSL 4GRLB 5DSCA 4HF5L 4JVUA 5IW6B 4XCEA 4UIMA 4NP4H 1NCUA 1QSVA 4L8DB 4AQOA 4YR6A 3LRSA 5DRZA 1A4JB 4RISH 1TETH 1G9ML 1Q94B 2O26U 4NZUH 1KIPB 2YD2A 4X83A 3PE9A 3K80A 4RAHA 4Z7QF 2MCPL 3HG1B 1CFVH 4GO6B 4FP8L 4DN3L 3IDYC 3PV7A 4OCWH 2CGRL 5JUEH 4KRPB 1FO0H 4F9LC 3KS0H 1A1NA 2M1KA 5F88A 4ELMA 1UZ8B 4BM7A 4ONFL 5I8KH 2G75B 1MCCA 5SX5H 1FJ1B 5AG9A 1MJ8L 5DT1L 3OKEA 4BH7A 2ITCB 1G7IB 3MLZH 5INCB 1BM3H 3H42H 4R97B 2W0FA 4JFPA 5D5MA 1RY7B 2W9DH 1JZ5A 1D5MB 4JM4H 1NBYB 15C8L 2GT9B 5HHMD 4LEOA 1DEDA 1QG3A 2Y07L 4NRXB 3CLEH 2VZOA 3NAAH 5IQ7L 2V9TA 3IJYB 2QR0A 3FB5A 2J1KA 5MEPB 3KG5A 4JG0H 4M9PA 5HDLA 4NYLA 2JJTC 2Z91A 1A3QA 1XGPB 4W6WB 4Y5YA 3V2AR 2GCYB 1A3RL 4M93C 2HKHH 4W81A 4DVRL 1R5IB 2W9EL 5AYUH 5KSVB 4HC1L 1RULL 4O2EA 4JY5L 5HD8D 2Q20A 3GDBA 1SM3H 3NPSC 1KN4L 3LKRB 3QFJB 3OGOE 2C4XA 1CD1B 3QCVH 3FFDB 3MGTB 5IB1B 4EN3D 3I6LD 1YEGH 3T1FA 3ZL4H 2FR4A 4NQSA 4HWZB 4MCYA 4KZEL 3UZEA 1MI5A 1YC7A 2D7PA 4MJ4A 3KDMA 5T1LD 5IVXE 5TDOA 1NAMA 2GJ6D 5I0ZA 4YDJB 5DI8A 1DQJB 1QOKA 3VXOB 1FH5H 2YZ8A 4DEPC 3E3QC 4HG4K 1K3ZA 1IGCL 3EJYD 1F8TH 1BBDH 2Y6SD 5DC9B 3OWEA 3P73A 4U1HA 4H25B 4WW1A 3CCHB 2YPKA 4F80A 4BUHA 3MJ9A 1CT8B 3GIZH 3IU4H 5KSAB 5ESAB 4RAUB 1F6LL 5HHOB 1EHXA 3Q6GH 4QHKI 1B4JH 3D69B 4OZHE 4PJBB 1BVKB 3D85A 4AEHL 5D9SB 3K1DA 5BRZD 1DQTA 3ULSB 5GGUB 3S37H 4DZBA 1ZTXL 4N8CH 3QUYD 1ITBB 2IBGA 4QT5B 5IVOA 4X6BA 5DVNA 4JB9H 1VEOA 3W5MA 4PJ8A 5H2BA 1CN4A 1ETZA 1WUNT 5J13C 4NZTL 1Z5LA 2QHRH 3ZZ1A 5T1KD 1BLNB 3BISA 5CCKL 1N64L 2ED9A 2X4QB 5GRUL 3X14B 3D2UB 1WWWX 3VRIB 1CK0H 1CVSC 4JO3H 2BRQA 3GMOA 2X4OA 5CJQH 2EC8A 4HCRL 2NCMA 4LASH 1LO4L 2OJZH 2OXGA 2UUDK 4GFTB 1NCTA 3BH9A 4O4YH 3HR6A 3HB3D 4PJXE 5DMIH 4NKDA 4QRRD 5LBSL 1TMCB 4ZPVA 3SCMB 2LVEA 1AXTL 1GOHA 1XIWC 1FAIL 1A1OA 1RJLA 1DQQB 5FK9A 2QADB 3QXAB 5KOMC 3CUPA 3ZKMD 4G9FE 4W4OC 3QUMB 1CFSB 1T22A 1TZIA 1BD2E 2XNAA 5E00B 3QI9D 5EPMA 1JIBA 3R4DA 5H35B 4OFYD 1W0VB 1NL0H 3D3VB 1UB5A 5F6IC 3QIBA 1V05A 3LEVL 2EH7L 3K7UA 2JJWA 1ZLWH 3MLYH 1KSRA 5DQ9B 2ZKHL 4ALAH 1KT2B 1WSST 4LSQL 3DX6B 1Z3GL 3OKDA 1HYSD 2VL4A 2P44B 4HDIA 4LCCB 3OXSA 1VKXB 1DL7L 2J8OA 1T0MA 1WAAA 5I74B 4NP4L 2EIEA 5F8RC 4HWBH 1FG2A 1IBGH 4JZNA 1LMKA 4E41E 1GL4B 4NZUL 1TVHB 4NO0A 1PKQA 2OSLA 2ID5A 1YUHB 3MCLH 5BJTB 1ZHKB 3WCYA 4NCC1 5GIRA 2B20A 4TULL 3P77A 2MPAH 3HAEG 4LU5H 5D70L 5JUEL 1FO0L 1R3LB 3GJFH 4P57A 2FYYB 3H9YA 2IH3B 1KC5L 1DUZA 1U8JA 5JXED 3LZFH 2IPUK 1CG9B 1K5NA 1FSKC 3CFDA 1MEXL 1P2CA 3WV0A 4HJGA 4PJ9B 5E8DH 1OGAD 2Y72A 1T89A 4HEPG 2ADJB 3CFKA 3SDAB 4NKIH 1F5WA 3T3MF 2VIRA 4JM4L 1D6VL 1K2DB 1V7MH 3QIWC 5I75C 1XGTA 1LO3H 1QSEA 5I9QC 1F90H 1I1CA 4ONHA 3UTSD 3G6AB 5IHZA 2FH8A 5D1QC 1QACA 2R8SH 4YHLH 5JW4N 1I1YA 1YEKL 1CXEA 5TE6H 4OZFH 5IB2B 2F9BT 4K94L 4RBPH 3QEQE 3AFLA 3THML 4YHKH 4LHUB 2J6EL 2RFXA 1ZT4B 2IG2H 4BZ1H 2HKHL 4JM2A 4WFGD 1R3KA 3ULVF 2EE6A 4Z8FL 2DYPB 1K9TA 4YH6A 2NY3B 1NUNB 5EC1B 4CKVX 2B8OT 5F7UA 1YEEL 2NW2A 5IQ9A 3VXQA 1A5FH 4HHAA 1N8ZB 3BD3A 2R2HB 2RIKA 5C9JA 5CJOH 3V6OC 2EE9A 1W8OA 4JJ5B 2CQVA 3WHE1 4Y4HC 5K9KB 4N8VA 3HS0A 4TRPL 5IOPA 5IW1A 5IIEA 3OXRB 3QG6A 5JLZA 1R24A 3ARTA 4CMMB 4LRNH 3HAEA 3NIDF 3FKUS 3PWJA 4WI2A 5BOPA 3BO8A 1YEDB 1IKFH 1F6FB 4BUGA 3HZYB 5D5MF 4Q0XL 3DV6A 4PJCA 3RPIB 3FRUA 3TN0B 4OZGE 1MCBA 3FCTB 4MQ7B 3TBYB 3GIZL 3IU4L 1A9EA 4R2GC 5FDWB 4FQ1L 2CD0A 4OD3L 4XPBH 4I48B 4LQFL 1ADQA 1J18A 4HD9A 1UXWB 2P5WD 1H3PH 1MIEL 1OL0A 3B2VL 3WIFB 3BESR 4FMKA 1NCBH 2PW2B 2VYRE 3EZ8A 1IRAY 4KC3B 1OTUD 5JIKA 4XB8A 4OFDA 3BHBB 3MBEC 5DK2B 3AROA 1E27A 2HTLD 5F21B 4LSUL 4KJWD 4WU7B 1KELH 4YXHL 1U92A 3QJFA 3VD5A 2VC2H 3FO0L 3O4OC 5C0CA 4M5ZL 2BDNL 1Z9SA 3WNPA 2OJZL 3QXTA 1ZLUK 3DVIA 4BZYA 3PDOA 1XCTB 5DMIL 3S34H 3V6FB 3PWUB 1SEBA 2ERJB 3FZUD 2R0KH 3X17A 2W60A 3HUJE 2KUTA 4WWKD 2WINB 4PP1C 1OAYL 3QRGH 1PX4A 1IQWL 1U41A 1C5CL 4WV1C 4PV8B 3HNVH 1F4WH 5FO8A 1JWUA 2W92A 4GMTL 1ND0B 4P9HH 3DMMC 2A0LC 4WTZG 1H0DB 2HJFB 1T0PB 3W0WB 3C5SA 4ZUUA 3GNML 4I77H 4X7SL 2CO6B 4LCCC 5GS0L 4U1NA 5IW3A 3SDXE 4LCYB 5IVXB 3SQOL 5L9DH 4JRXA 4ZFOL 1M71A 4JPVL 4P46C 4APQA 1CGXA 4ZPTA 1D5BA 1UWXH 4ELKB 3QPXH 1VESA 4R9HA 2IQ9L 4Z5RA 3RY5A 5J3HD 3ZE1F 3CVHB 1WFUA 3DX7A 3BGMB 4NO3A 4WTWA 4JN2A 1T7YA 4PB9L 4ZUWA 2VXSL 4IOIA 3ULUD 2EDEA 4ODUB 4BFIB 4OZHB 1D7FA 1FZJA 3F7YA 5GXBB 5ITBL 2WBKA 1I7RB 4HAGA 1QVOA 4OB5L 1VGKA 5HGBB 3U0PB 3VFMB 2DLGA 1S5HB 1IC5L 4G8FB 5FYLH 4NSKA 1AGCA 1BJ8A 1T5WB 4BQCA 4LLUA 1EGJL 3DSNA 5FKAA 4HJJH 5E94B 2EECA 5EFIB 3QDME 4G8GA 1C7SA 3VE0B 5IK3B 1M1SA 3LD8C 3U0WH 2I60L 1LEGB 1OPGH 3N1QC 3QHFH 4RDQG 1KCRL 1NAMH 2EXWD 2XTJE 3RDTA 3U1SH 1OF2B 1J5OH 2RR3A 5C0AD 3B8YA 1E4WL 4GS7C 3ARFA 1S7RA 3GKWL 4JFDA 1LO3L 1CLYH 4M7ZB 4NN5C 1FFOA 3OR6A 4ETQB 3MJ9H 3CVHL 5E6IA 2VLJE 3L5WB 3FMGL 4HUXB 5DVLA 1VPOH 1BFSA 4JKLA 2GSGA 4G9FB 1DCLA 4XNQA 4WTXA 1RVFH 1JI2A 4GQ9H 1BD2B 1N2RA 1RIVH 2F5AL 4GRWH 4MZ3A 2YPLA 4Y4KB 4EI5B 3BP7A 3BE1H 2D31A 4J3UA 4QXWA 5D2LF 1CICC 1FYTD 1F3JA 5BVPL 3GO1H 3PDDA 4YDIL 1MLCB 4FQQB 5E03A 5LG1A 1GGCH 1KPVB 2ADFH 5TE4H 3TN0C 5C0FA 1OW0A 1Q94A 4HUMB 1NC4D 1ACYH 3O3BB 2AI0L 3F62A 1KIPA 2ZOKB 2H1PL 3KNBA 4H20H 4LRNL 5IHLB 4XBPA 4EDXB 4X99B 1YMME 4N5UA 3WJJA 2PTVA 3UJJL 1Z6JT 1N4XL 1UEMA 4KRMB 1U8LA 1TNMA 1Q1JL 2DIBA 2IBBA 2HT3D 1WIPA 4U05A 4HS8H 1FJ1A 3FQUA 2H32A 4PYHA 4UT7H 1JNLL 1CDGA 2KQMA 4QRPD 5EBWA 1G7IA 3GI9H 3L1OL 5HGHA 5KZCD 3FT4B 5AAMA 2PW1B 1NGQH 2IBZY 3VH8G 2VDKL 1ES0B 4L3EE 4JFXA 2NY5L 1Y6MR 4YHNA 1NBVL 4S2SA 4OKDA 2NMSA 2H8PA 2W91A 1MLBB 5B38B 4WUUB 2EE2A 4QNPE 2GT9A 1BGXH 4R4NC 1MFAL 4HMCA 3KHOA 5CJ8A 3IJYA 5T5FH 4N90E 3RWGB 1Q0XL 3RUGE 3EHBC 4UINH 4JFED 3T0ED 3QEQB 2HLFC 4MWFB 2GW5A 3I2CL 1R5IA 3PWNB 3S34L 5HYQB 5KSVA 2Q87A 1SJVA 1ZA6A 2R0KL 4YBQC 1LK2A 1FLTX 1NFKA 2ARJQ 5ALCL 2H3NA 2P8MB 3QFJA 1I7ZA 3OGCB 2I9TA 2YOCA 4HW6A 3DX9A 1RZKL 3MGTA 3QUZD 1CGWA 2HP4A 5KG9A 1LDSA 4HWZA 2NY4C 4NN6B 1XH3B 5D7IA 4P3DA 4P9HL 1J8HD 3QHZH 2G2RB 1CXLA 1CBVL 3BFOA 4I77L 1NSNH 4JFQA 4Q2ZB 4L8BA 5E0QA 5CJXA 2Z31C 2DD8L 1S7WB 4YDJA 3LQAH 1HOCB 3Q3GA 4PJIE 2R2BA 1WTGT 2ZCLH 1UKQA 1MJUL 4DN4L 4GW1B 3P11L 3QCUH 1BFVL 1RUKH 4P5KB 3WFHB 4AZ8A 4P5TD 2G5RA 1IGYB 4HGWA 3IDGA 5C3LD 4RX4D 1CT8A 4H0GA 4OZGB 2HVKB 2VZSA 5E5MB 3BXNA 1OQOA 5HHOA 1XGRB 4L3AA 3AAZB 3Q2CA 3KLHD 3GI8L 4R26H 4M1GH 5C08A 4ZFFA 3EYSL 3ULSA 2VLKE 3I50L 5I16A 5GGUA 1ZVSB 4QT5A 1YEFL 5TF0A 4JO4L 1EPFA 1MVUB 3G6DH 3AGVA 3KS0J 3W11C 5FGBC 1A64A 5HI5C 1BLNA 3OMZA 5FV1L 4LSVL 2XA8L 3F58L 2HMID 3IS1X 2BVYA 5CD5D 2YUVA 2BJMH 4PJ5E 3U0WL 1YPZB 1OPGL 4LCIH 2C3HA 5DXWA 4PTUB 3S3PA 1FPTH 1J5OL 2DI8A 2Y06H 4F37F 1TQCB 4JG1L 1UA6H 2JIXB 4W6YB 3HAEH 4PD4J 1C16B 1AO7E 3QIUC 3TVMA 4NZRH 1Q9KB 3WS3B 2HRPH 3KVQA 2Y1VA 5CLTA 3TT1H 3HUJB 5HGDB 3BT2L 2NY5C 3TPUB 4CVXA 5A1AA 5T3XE 1DQQA 3JV4A 4XP5L 5F7DA 3SKOB 3PHQB 3TP4A 5INDB 1J8KA 4K3DL 3QUMA 1CFSA 5F8QC 2IADA 1ADQH 3ARDB 5EUOB 2FX8H 4NGHH 3T8XA 4DKFL 1RIVL 2EH8L 2PTTA 3MRRB 1KYOJ 3SDDB 1PX3A 4LHUG 1W0VA 4OT1L 2YSSA 3SDXB 1I8IB 2YWZA 5DQ9A 3C5JB 3O9WD 3S7GA 2F15A 3G6JE 1KT2A 2R9HC 2Q76B 4QHUB 5D6DC 4M3KB 5AZEL 3FT3A 4FMFA 2GTZB 4RFOH 4HUVB 4O2FB 3D9AH 5D6CB 5DD5H 5TE4L 1JNNH 2ED8A 3T2OA 1WTLA 4XNYH 4CMHB 1HIML 1ACYL 1RZKC 5EORL 1YUHA 5BJTA 5FO9A 4XMLL 3Q48A 4P9HC 2VLRA 1I4FB 2PTUA 5SV3A 2DLHA 3O6ML 3QUXA 4PJFF 3S35L 3UAJD 3EOBB 4XVTH 3UYPA 3PHOB 1PG7L 3HMWH 4P2OD 3FQXA 2Q7YB 3VFTB 4XCCH 4U0RC 2R23B 1CG9A 4G6FD 4UT7L 1JF1A 4XP4H 1XF1A 3QDMB 5GS1B 2O5XH 3GI9L 3TIDA 2C5DC 4G8IB 4PJ9A 3MFGB 4JRYB 1KACB 1OD9A 1YNTA 3SDAA 5CEZD 5SWZD 1CQKA 4ZYKA 4LSRH 2ZNWA 4N0UE 1DVFD 2HJLB 3BN9C 3DPBA 3QDGE 1BGXL 5IF0B 1JK8B 2H2PC 4Y5YC 5J12C 1O7VA 4NKOA 2J5LB 3G6AA 4HMDA 1EEYA 3EKCA 4QXUL 4W68A 4NZJA 5I1LA 1WBXA 1W72A 5KVDL 3EO0B 1N7ML 5IB2A 3TA3B 3S88H 4LSTH 1TTGA 3LPWA 2EEBA 1DFBH 2NY6B 2XZAL 3O6FB 1ZLVK 5JPNA 3JBG7 5EC1A 1MCFA 3C60B 4OQ1A 3QO1B 1HHKB 3QUKA 1TNNA 4JFZH 4XVUC 4OGYH 5BS0A 3NCJH 5BO1H 3BWAA 3M8OL 3D18B 2A83A 4R4BB 3ZDYE 3QHZL 4JJ5A 4XNUL 3VI3E 3NZHL 1D5XB 3LQAL 3QP3A 5IB5A 4KK5C 4F3FB 1I8KB 4RDQF 5GGSY 4XB7A 4YLQT 4CMMA 1J9CT 5CGTA 1JVKA 3KPRE 5IEKB 1YMMB 3HZYA 4M8QA 5HDOA 4WNQB 4OJFL 4XWOD 3DVNB 1XFPA 1B9ZA 2C1PB 1RK0B 4M8VA 1ZVHA 1CU4H 4PJ8C 1UFUA 5J6GB 1UXWA 2ARJB 4R26L 1YEJL 4LVNB 4QHMB 4O58L 5EZIH 4FXKB 2BY1A 1WWBX 3S97C 4IOSD 2OR8A 4FTVD 4L3EB 5C9KA 5JHLL 1KXVC 2BRRH 2EDFA 2RAMA 5JOFB 4ZAKA 3G04B 3B6SB 3C8KB 4ZTPH 3SJVE 5GGQL 3AS1A 5DK2A 2AXJA 3OQ3B 3RKPA 4ZQKA 2DL2A 4IMKA 4HXAH 4J6RH 1M7IB 2A74A 2ESVB 3CFBA 4P23B 4WU7A 5JO5B 4Z7NF 2NY2B 4QRTB 4HIXH 3SKJH 2F74A 3ARPA 2NY1C 1I1FB 5C0NC 4PRBA 4IIQB 4KKCC 3EYOB 2EDYA 2BSTB 1U8HB 1K6QL 5JMRA 4BJLA 1OCWL 2VXVH 4HUUB 1N5YL 5MP6H 3HI1B 4NZRL 4OSUH 1NAKL 5EWIH 4ENEC 3ARBD 2HRPL 4S1QL 2WINA 1AR1C 4J3SA 3U30B 4AIOA 3J7HA 3SN6N 5I15H 3CZFB 5CJ5A 2HH0L 1PYWA 2CDFA 5FAAA 1XT5A 2AGJH 3I6KB 2X9WA 3SO5A 4DUWA 2H32H 4F7MB 4LLVB 1AFVL 1KCKA 1H0DA 2HJFA 2J8HA 4NGHL 1UM4H 3W9EA 1T03L 4LIQE 5IVXA 4KQ4L 5F71A 2WUBH 4PJBF 1WBZB 1WWAX 4UI2A 4PTTA 5F7YC 4PJIB 1FNGB 3V7MA 3SKNB 4L4VD 2EEDA 2W0KA 5HHVH 4CMHC 2ZUTA 4DOHE 2IBZX 2B1AL 3WXVH 5JW3L 4M62H 3PXHA 4ELKA 4K3EL 3Q6FA 4NQTA 3R1GL 4FQCL 3DRQB 3DYMA 1T1XB 1QO3B 3BGMA 4K71B 1I1AD 3D9AL 3NA4A 4R90H 5DD5L 4MNGE 1VADB 5DJ8A 1AGBA 2EYRB 4XNYL 3QEUA 1A4KB 2IPTH 3ILQC 3NIFF 4ODUA 5DJCB 4BFIA 4MB3A 4OZHA 5B8CC 3QAZC 1T83A 1CZ8L 1EX0A 3CNKA 4W70A 1FZMA 1CFTB 2YRLA 1MNUH 2Y5TB 2Q3AA 2VLKB 4JCMA 2F54E 1IKNA 3DURA 3RX7A 5HGBA 3HA0A 4JPKH 4G8FA 1X5FA 3TO4C 4RGOL 1E4XL 3KPSD 5ANMB 3V0AC 3K74B 4CADB 1KJVA 3LQAC 3REWB 4QWWC 4Q9RH 4MAYC 3NCMA 1NC2D 5EFIA 3O4LD 5GSRB 4EVNA 4OUOA 5KS9A 2GSIB 3VE0A 1JTPA 4JDZB 4LAQH 3P4OB 4Q6YA 4PJHE 4Z0XA 3QT2A 4PY8I 1OF2A 5TF1H 1WGOA 5IBTL 4OIIH 1PSKL 1A7QH 4OCSH 3TA3C 3RY6C 2E7BA 2V5MA 3ZDZF 1AO7B 4PJXA 3KXFE 4OM0L 5B38G 4JM2C 3W39A 5I8OL 3GSRA 3MRHA 3L5WA 4PRPD 1UEYA 2XFXB 4HUXA 4GW5B 4ZFGH 2D7NA 1LE9B 4JDTH 2P48B 8FABB 4FQLL 1XZ0B 3BP4B 1BD2A 4ODBD 5CP7B 5D93C 3HTLX 4I5BB 3MR9B 2AEPL 5FXCH 3T77B 5ALBL 2X4TA 2C1OB 4EUPG 3LB6D 1QKZL 5CWSB 5AUMB 2FHBA 5BO1L 5I1GH 2VDNL 2QSCL 1BIIB 3M17A 1KPVA 5IFAL 1IJ9A 2YEZB 5J9PB 1T66C 4HIJA 2QKIA 1KLUB 1JZ4A 3DTXA 1JUFB 2ICEB 2ZOKA 4JANA 1I3GH 3E6HA 3TBSB 4E41A 5GZOC 4UAOB 1XIWD 3KYMA 2BSRA 4X99A 1S9WB 2AJZA 1FVCB 4JFFE 1EEZB 1N5AB 1UYWH 1E6OL 3RVWC 3NBNA 3HN3A 2WBJC 5DMKB 1HHJB 5C0BD 4J12A 2FSEB 5IFHH 1HXYB 5LVEA 1WZ1L 3OKNA 3IT8D 1TXKA 4OFKA 3QUMH 2VXTL 1QEWB 3TJHD 5EZIL 4NUJB 5AZ2L 1INEH 2MQ0A 3TJEH 1ES0A 4Y19E 3PGDB 4P2RD 3IJHB 1N6QH 5K9OA 2YZ1A 4WVRA 1S9YA 5JOPD 2BRRL 1QLFA 2NYYC 5DD3L 1PDKA 1MLBA 1GAFH 4N0UB 1XGYL 4PJGA 4Y8DC 3BMVA 5FYKD 3MNZA 3G5YB 4QCIA 4G7VH 1UCBL 1HH9A 4QGTA 3VXPA 5J4MA 4HIXL 1HQRA 1OTTD 2P8PA 2NZ9C 3B43A 3CFJA 4LEXL 2DRUA 2VQUA 3UTTE 12E8L 1BECA 2BNQE 3DIFB 3VA6A 5F1NA 4DVBA 2SEBA 4KK6C 5MP6L 1WIUA 1HILB 3NCEB 5I71C 5D71L 5EIIB 1G7JB 5KANG 4J23A 4DCQB 3UJTH 4AENB 5EBLB 2XRAL 4RQQB 1UM6L 4BSJA 4CU8A 3PGFL 2AGJL 4HFUL 1ZANH 1ZHBB 3NABH 4N0FA 1XH3A 3C5ZB 3KLDA 5A16B 3SDYH 4EN3A 4APQC 2AK4D 4J3TA 4N1EA 4OFVA 4X5XA 4FFZH 2VN7A 5FKPB 4PJDE 5E99L 4Y16B 4BFGA 4GW1A 1U3HC 5HHVL 1F3RB 2BVUA 5D1QD 3WFHA 4P5KA 2CLRB 3UYOD 4M62L 5EU5B 3KPRB 1IGYA 5GPRA 4RNRB 4AH2B 3K8MA 3S3JA 2HVKA 3IFNL 3EOAB 1VEPA 2DQHH 1W72H 1E0OB 2X1PA 2IPTL 1HXMB 3HHRB 3V52H 4X4YB 1ZVSA 2X5PA 2J7LA 5DJAB 4NT6B 1CDHA 1MVUA 4PRHD 1RFDH 3F65A 5C07D 3PQYD 3GSNA 3MOQA 1IM9B 2JB6A 3SJVB 3GMPB 2VISB 2CPCA 3MRCA 5E8PB 3NPZB 1L6XA 1G84A 2CH8A 3ARFC 1MCPL 3JV5A 5EBMA 4P4KC 4PLJD 4X4ZA 4LAQL 4B7LA 1S78C 2VH5H 4PTUA 4WO4D 5E6IC 5CGMA 3VG0H 3HPJA 5T3ZD 1YEHH 2ATPB 4M7LH 5TF1L 2B2XL 3QO0B 2R0WL 3L3HA 1A7QL 1C16A 3O2WH 4IRJC 4K2UH 1DBBL 1OTSD 3MLRH 4R2GD 5D96C 4Y4FD 1Q9KA 5IVXF 5HYFA 1ZSDB 5HVHB 6FABH 3QXVA 3TYFA 4G6KH 1JHKL 5TJWK 2W0LA 4XH2B 4PGEB 4YPGB 2OL3L 4QXTB 3PHQA 4DKEH 4U1KB 1AI1L 4RMRA 3MOBH 4KH2A 2W38A 2JCCE 4HUWB 1RI8A 5EB9A 4ZG1A 3MBED 3L95B 3SDXA 1I8IA 2AJYH 1X7QB 3FFCE 4WEUD 4OZHF 3ARGA 1YY8A 4LPTA 5TH2A 4BKLB 5C2UB 3IB4A 2Q76A 4L9LA 4DOHB 4DZ8B 2OTWB 3T0XA 2AS5M 1T20A 4TVPL 3L3OB 4LFHG 3WJJC 5F9WC 1ZLSH 4O2FA 4M4PA 5D7LD 5D6CA 1I9IL 3LEYL 4MS8D 4MNGB 1N6VA 3KYOB 2A2QT 1XGQA 5TGBA 4PP1D 5DFWH 3IKKA 2FBJH 3GGWB 2UV3A 1MF2H 4PUBL 3AREB 5L7XH 2YN3A 1I4FA 3LVEA 2F54B 2HA1A 4JREC 3EOBA 1G0DA 4HAFA 4G3YH 3VMPA 4KHXH 3DMMD 4F58L 2XA3A 2IAMD 2KPNA 4X80H 3VFPB 1MWAL 1UC6A 5GS1A 3QDMA 4NNXB 3ZKXC 4G8IA 3PJSB 1INEL 1CGVA 1P4BH 3OG4B 2D03L 3TJEL 4HS3B 3MROA 1RHHA 2DTMH 3UX9B 3VXME 4G5ZH 4BA8A 1CE6B 4IDJL 4M6ML 1HEZB 1MY5A 1I9JH 1G7HA 1A6VL 2A1WH 2RCSL 5IF0A 1JK8A 3S36X 3BQUB 3FQNB 4UZGA 4HGKC 3KXFB 3GB7B 3V95A 5FB8A 1RV6X 2VLJA 1DN0B 1U8NB 1E4KC 3EO0A 3MRPB 1DBAL 5C1MB 3BP5A 1MH5B 4IHOB 3S6CA 4JCLA 2OLDA 1F6AB 1LO5A 5HDQH 3VG9B 1LNUB 4U2YA 4MB5A 5ETUB 3RGHA 3WFEL 4PBWD 2A73A 2X2YA 1MRCH 5GHWH 1HHKA 1XF4B 4LHJB 3TWCL 3L5HA 1F97A 2Y23A 3DSFH 5KVEH 4R4BA 4XVSL 5HVWA 4LDEB 2UZXB 3EAKA 3VXRD 4NBZB 4Q9QH 1PAMA 5E8EB 3T0WA 4KUCF 1TZGH 2GJ6E 3VA2C 3MRQB 4L8SA 4Z6AT 2EXYC 2HFFB 1Q9OB 5IEKA 5K59E 3GJEB 5I1HL 4HFWB 3GK8H 3U4EB 2GFBA 1AH1A 4JFFB 1YMHA 4DTGL 2R4SH 1SHMA 5IVNA 3DVNA 1MFEH 5EU3B 2DQHL 3GKZA 3QFDA 3DXAD 3BPNC 2P5ED 3MO1A 1U8MB 4X7EC 4FNLL 4J7RA 4MJ6B 5GGVL 3O45B 1U58B 3EDKA 2NW3A 3DNKA 1CICD 4L3EA 4Y19B 4KK8D 1RFDL 3D1MC 2D3VA 1HHIB 5JOFA 3VD9A 1NGZB 1R6VA 2NXZC 1YYMH 3A6CL 4F2MA 4CGTA 3L3JA 4PBVC 1OAUL 3LKOB 1HSBA 2OI9B 4NBXB 1DBML 3VWJD 2DQUL 2XZZA 4XRCA 1S7UB 1QRNE 3BKJL 2HT4C 3RL2B 4PLKC 2J2ZA 5JO5A 4HPYH 4IJ3B 5CINL 4M03A 3RUGA 3EFDH 2R1XB 1CGTA 4IIQA 3EYOA 2BSTA 4UV7H 1JYNA 4M7LL 4TNWF 3CSGA 3QQNA 5FO7B 3CXDL 3UTTB 3O2WL 4HUUA 1MCOL 4OV5B 3HI1A 4K9EH 3GBNL 4O2CB 4Z7UB 4QOKE 1U3YA 1RIHH 2E7HA 1MCSA 3I3BA 4D0CA 3ETBF 4QRUA 5IFJB 4QTHB 4WWKA 5HPOA 1Y6NR 4KXZH 4P2QE 4XHJC 4ONGL 4N0YH 1K4CB 1I3UA 3I6KA 1F4XH 5J6HB 1VFMA 4KKLC 3HE6B 1S5IH 3NZ8A 4KVNH 1AXSB 1JGDB 2FJFA 4OZGF 1VEMA 5D7JB 4HXBH 2X6MA 3QWOB 3G5XB 1YEIH 5H37H 1A14H 1FORL 4LLYB 2HG5B 3B5TA 2J8UA 4R4ND 1WBZA 4HKBB 1FNGA 4PJIA 2F53E 3SKNA 5DJYB 3EW3B 4PJDB 3ARQA 1VFAB 4KFZC 5IWLA 3EHBD 1CFQA 4G6AC 2MHAA 3DRQA 4ZXBD 3DGGB 3WDHA 1F3DJ 1T1XA 1BQHB 1CDYA 4H8WL 5DJDA 1IT9H 1B4RA 5IEHB 4HKJA 4LRIA 1HKFA 2HLFD 3QUXC 2EYRA 5BV7B 1UGNA 4POYA 1IFHL 4JGMA 4K23L 5DJCA 2R56H 2X40A 5D1ZC 5EIQA 1FGVH 2FBJL 3EDJA 4JFHD 1CFTA 2VLKA 5E8NB 5FECB 4FQXB 2X89D 4RRPG 4OI7A 1TITA 3T0VA 1AHWC 3I75A 3C9NB 4CADA 3REWA 4MB4A 4KHXL 1BHGA 3CMOL 3ARYA 3F7VB 2UZIH 3B3IB 5GSRA 4AJ0A 4P59H 5KN5B 2ZUSA 2IH1B 3HUJF 4OM1L 5T1MB 4D0DB 4JO1L 3P4OA 2CK2A 4PJ5A 5HHXH 5C0RL 2V7HA 3VXTA 3IFOA 1ZHNA 4UT9L 3A6BL 5E2VL 5EUOF 3CLFH 3KPNB 2VDMH 3ARRA 1EV2E 4FABH 1ROWA 3BIAX 3RJDA 1UCTA 1K8DA 2R0LH 1QSFB 1D9KC 2CKBA 3SDXF 3K0WA 4L5FL 4X4XB 2Z4QB 2XFXA 2ZSWB 4P9ML 2DQDL 4KUZH 4GW5A 4G42B 1L7IH 1LE9A 4PG2A 5BV7L 5DK3A 1JV5B 4JQIH 4NFBA 2VXQH 1M4KA 2VZ1A 3CU7A 3VWKA 8FABA 4KKNA 5D1XB 3I84A 3W11D 1RJZA 1V5JA 5I8CB 1XZ0A 3BP4A 3RGVC 3X11B 4KI5E 4Z7QE 5CP7A 2O93L 4HH8A 3MR9A 5IJVA 2JCCB 2VZUA 4YFDB 1YECL 3SDCC 5ILTH 5CLWA 4P5MA 5GHWL 1U95B 1QYGL 2JF1A 3DUHA 2HKFH 5E4EC 3GSNH 5E24E 3G6JA 5CWSA 2NY0C 2X1QA 1HQ4B 5AUMA 3BRFA 3OKKA 2AEQH 3VW3L 5I1CL 5D8JL 3V0WH 2DBJA 4ZDHB 4XZUB 5FM5M 5C09D 2W07A 2DBLH 3L7EB 4Q9QL 4YHYB 4FZ8H 2ZG2A 2YEZA 4XC3L 4RWYL 1KLUA 3MRKB 5HYSB 1JUFA 4U7KA 1A21A 1S9WA 1T80A 5JDSB 5E95B 3B8SA 4WFED 3RPKA 3MJ8B 4M7JH 1EEZA 1KJ3H 1EJOL 1N5AA 3GK8L 1KJ2L 5LQBH 4GUPA 3OX8B 5DMKA 5DS8A 3UDWC 3I6GB 5IM7B 2FSEA 3PL6A 4ZTOL 3P3YA 1OP5H 2EYSB 4ZAKC 3RHWF 4JY6A 3IVKB 4YK4C 2R0ZH 3RBSA 4JHWH 3MNWB 3IJHA 3ELAT 4U6VL 3PWVA 4B41A 4H8WC 4HQQL 2DDQH 4ISVA 3VXMB 2VQ1B 3CFEA 2M26A 3I85A 1KFAH 2D7QA 3ALXA 1JHLH 4DGYH 3TT3L 4KY1L 1FZOB 3QDGA 4R96B 3RTQA 3G5YA 1EHAA 3IRZA 5HHMB 4LPVA 4N5EC 43C9A 1A6AB 4KV5F 5FGCE 1BQUA 1DN2A 4P49A 4MCZB 1A6PA 2IALB 3LN4A 2WUCH 4YDVA 4QLRA 4FQJH 3TCLA 1YNLL 4JJHA 2CSPA 2ADIB 4OGXL 2FEDC 1IQDA 3DIFA 4UV4H 5FF6B 4ERSH 2XWBB 3BEWB 2YD7A 3ZKND 4JR9L 3CXHJ 2DQJL 2D9CA 4N0RA 3PABB 2OTUA 3DVGA 3T04D 3TO2B 3WXWH 1DQDH 4LGSB 1IILE 1TJHH 3RIFK 2D7TH 3SGJA 4DFHA 3NIGF 3OG6B 2GQHA 1ZHBA 4S10A 4JQVA 5A16A 3C5ZA 1J0JA 3U7WL 1KB5L 3D39E 2DM3A 3KPMB 1OAQL 3TV3H 1QFWM 3LMJH 3HZKB 4HXBL 3BN9D 1A14L 1FCGA 5LXGH 2H2PD 4W4NA 4Y1AE 5FKPA 5EOTB 2GJ6B 3ZDXE 4Y16A 4YHIB 4KGLA 3CSYA 3HPLA 2CLRA 5EU5A 5FYLD 5D4QA 1S3KH 4ODVH 1T83C 4AH2A 1AD9A 1C5DA 4KK9C 4GG8B 5D72L 1C5BH 2YD6A 3JWNC 4L29A 1PJ9A 4F37K 1ZE3C 1MELA 2IFGA 3D25B 4JKWA 2NTFB 5FYKU 1TLKA 2W65B 3BIBX 1MI5D 4XBEH 2R56L 3S5LB 1FGVL 1P84J 3VDBA 2FEEI 2J4WH 2YXFA 5DJAA 1MFNA 3WJLA 2X05A 1NMCC 2YPVH 3AC0A 4XVUD 4URTB 1MHPH 3QUYB 3WSQL 4M3JA 4TUKH 1S8DA 1SJHA 3CK0L 4K8RH 4LL9A 4B50A 1EH9A 3D6GA 3MX0A 3SJVA 3PGCA 2UZIL 3IYLW 5JORB 3S37X 5E8PA 5T1KB 3REVB 2BSED 2MSPA 4JRWA 4DKAA 5IESH 2WWMD 2IWGA 2G9HB 3EO9L 3UBXB 5K33A 1TIUA 1EFQA 1I7UA 4LSPH 5F3HB 5HHXL 3WFZA 2V2TB 1NDGB 3VJ6B 3W2DH 2ATPA 3D85D 2VZ3A 5FA4B 3X3GH 3QO0A 1AKJB 2ILLA 2VWEE 2X4SB 3PIQB 5HHNB 1DUYA 1MFDH 4PGCA 5HGAA 2CJUH 4PJIF 4PJ8D 2QV2A 4Z76A 2FX9L 4KKBD 1T21B 2E7LA 4RGNE 2AKRB 3H3PH 4NO2B 5DUML 5E2WL 5SWSD 1ORSA 2AXFB 4P2QB 5F44A 1TJIH 3MRIB 4YC2B 1N3NB 3BPCB 1C8PA 4U1KA 3VXSA 5E5RB 1SY6L 2VKXA 5DHYB 1AGFB 5LCVH 4FA8A 5DJ6B 1X7QA 4NM8L 2JJSA 2NXYB 4IRSA 4YO0B 3GSNL 1WFTA 1NJ9A 5ESVB 3VFWB 2OTWA 2NLJA 4PRAB 1A3LH 5F3BB 3M45A 5C0ND 1XEDA 5FYJE 5GJTL 4FZ8L 2E9WA 2OZ4A 5IP4A 3OR7B 2Z93A 4HBQA 4JAMA 4LARH 4ENED 1NUDA 4CVUA 1T04B 4G80B 4NKMA 1KB9J 2EIDA 4OCLC 1KJ3L 3NGBC 3RKDD 3VXUE 1FGNH 3QIBD 2XZQL 3R8QA 2W0PA 5EZOL 1IZJA 1QR4A 3NH7H 4I4WB 4AG4H 1TQBB 4NNXA 1IAIH 3DLQR 3UPCA 4FZEH 4OCRH 1FV1A 1LEKB 2EDHA 1JGEB 4H1LG 1WCBA 4HX1A 3UO1H 1F2QA 4FXLA 3ULVE 1FBIL 2DDQL 4PJHA 1R3IL 1HEZA 1R5WB 4FFYH 4OTXL 1G6RB 4JHAL 1P4IL 4G6MH 5IB3B 5GRWA 5DJ2A 2WIMA 3BQUA 3H0TB 1A7RH 1JBJA 1MAJA 4XX1E 2DQFB 3KXFA 2FL5B 1CCZA 1YNKL 5GRXG 3I02B 3IXTB 4L4TE 2H9GB 2D0GA 1DN0A 3G6JF 4YBLC 1U8NA 2WUCL 1BWWA 4R7DA 1KTLB 4UV4L 5ACZB 4ERSL 2EDXA 3ULUH 1CI5A 1EEUA 1ONQB 3AU1B 1F42A 4EN3C 1IEHA 4UTBH 4QRQB 1DEEB 4S1SH 3FOMB 1NLBL 5H94B 2PO6B 4OZIA 5HI3C 1GJIA 5GS2H 3STZB 5CMAB 4BZ2H 5LGHH 1QSED 3RVTD 3BRDA 4GSDH 4YNYB 3C6SB 1HH6B 1XF2B 3SE9L 1KIRA 2Y6SC 2OM5A 3TF7C 4XAWH 4YXKL 3KPLB 1IGFL 5KVGH 2OTPA 1FLRH 1Q9OA 1V7NL 3GJEA 5TQ2H 5MEND 1RU9L 3V7AG 2Y36L 2CKBH 1B0GB 3WO3B 2UUDH 4X9GA 3V5HB 3BYTA 3QUYC 5T3XH 4FQ2H 4JLRB 1U8MA 3I3DA 4H88L 5F9JA 1X5GA 4DQOH 1BMGA 3O2VH 4V2CB 4MJ6A 4ZODA 1J7VR 3TH3T 3O45A 3MA7B 3SGEI 3U2SA 2EDNA 3NCYP 4S0SD 1HHIA 2CRZA 2V5SA 4LOUD 5FCSH 3FB8A 4NUGL 3LKOA 2DQIH 4LKXA 3MBXH 3GM8A 4QYOB 4F15B 3U36B 2DQEH 1UACL 3CX5J 3RL2A 2P46B 2ZJSL 1SQ2N 4HWEL 3QZWB 4F9PA 4O5LL 1A0QL 5FGCB 3HB3C 3T2NH 3H3KA 3ZLQC 4GXVH 5E8OB 1XF3A 3U4AA 1OVZA 4RZCB 3RVWD 5TDPB 5ENWB 3SQBA 3BH8B 5E7FA 5FO7A 3UTTA 2BNQA 3VI3F 1FFNB 2HWZH 4NNPL 4W6XB 3P4NB 3UYRL 5C71A 2X1OA 1A6ZB 5F96H 4A6YA 3IU3A 1T1WB 3MZGB 4TTDD 5CD3B 1X5XA 3IDXH 2CLZA 4NM4L 3ARBA 4OLVL 4KPHH 3QI9C 1K3IA 1K4CA 2Q86B 1IC7H 3ARGC 4JY4A 5J6HA 4K3JL 1CDJA 4ODTH 4MSWB 3P40A 1MFCL 5IG7B 4U6HB 1AXSA 5L8LB 4L9LC 5D7JA 5F9AC 1BFOA 5EO0B 1N6UA 3MRFB 1OAXH 2LAGB 5HGGS 1HYSC 2HG5A 2I07B 3C6LB 1VB9A 4Y1AB 2WIIB 5JIIA 5DJYA 2BHUA 4R0LB 3P30H 4L4VA 3GSQA 4D3CL 5DD0H 3F6LA 4XNXL 4KMTH 3DGGA 5C7XL 1REIA 2NZ9D 1BQHA 3DHJA 5IEHA 3DV4A 4XNZC 5I76B 1BOGB 3QDJE 1J05A 1QNZL 3PDGA 2X9YA 4LARL 4L8CB 2FO4B 2FIKA 1MCDA 2DQGL 4QHKJ 3U83A 5DUPL 3E2HC 3ZTJH 5FEBA 5L6YH 3IFLL 1IAOB 3JTSB 5HYSG 4FQXA 5JXEC 3OHXB 1FGNL 4PD4K 5ACMA 1HN1A 4TSBL 4JRXD 4GXUN 4KDWA 4U1JB 1WITA 5I1IL 3QG7H 2XTJC 5ITFB 1INQA 4LBEA 5KN5A 1EA9C 2IH1A 2QQLH 3WKML 3CPLA 4FZEL 1A6WL 2L4OA 3QJHB 3N06B 3VFUB 4PR5A 1P9MC 2XV6B 1P1ZB 2ICWI 4R6UA 4R8WL 2QQKH 4KKAC 3R8BB 5B39B 1KYOK 4FFYL 2Z8SA 5SWZE 5I1EL 1I1RA 3KPNA 4D8PA 4NC1E 1KCUL 1DLFH 2V7NA 5JXAL 2XACC 1JYWA 1ZT7B 2Z4QA 3PWPE 3O3DA 1GZQA 4G42A 4UQ3B 2XKSA 4OCMC 5I30L 5JZ7D 1GGIH 4RGNB 1G7LA 4G8GD 4AL8H 2BERA 3F12B 4K8RC 2DL9A 4Y5XB 3P9LA 4WW2B 3V6BR 3DO7A 1FNEB 4GKZA 5HXMA 3ULUL 1CD0A 3X11A 2A9ML 4ACPA 2AXGA 3T4YB 3RDTD 2JCCA 4S1SL 5ELIA 2L7JA 1H5BB 3MUJA 4AT6B 3L5XH 1A7BA 1IGJA 1U95A 4LVHB 2QQQA 3FFCA 5I1KH 3ARFD 4CRPA 3V8OA 3CH8A 3D5OF 1HCFX 3FO1B 1UJ3A 2VDLL 4BZ2L 4JFDD 5LGHL 3VI4E 4MYWB 1LVEA 2VERN 3NFSL 4MNHB 1S78D 2VITB 3P0YL 1Y6KR 5E6ID 4ZDHA 4L3CA 4XZUA 4YHPA 1T5XA 1J12A 2XG4A 2VAJA 4YQXH 3Q1SH 2ITDB 4JKMA 5LAXA 2Y9RT 1FLRL 3F5WB 5MERB 2UVEA 3P4MA 2VLMD 5CHNA 2YPLD 3HI6L 1WZKA 2DMBA 3VXUB 3OX8A 1ZGLM 1ZLUH 1SJXA 2Y5EA 5IM7A 4LLDB 2XPGA 1RURL 1U8OA 3V5KA 1DE4B 2EYSA 1CGSH 4TOYL 3SO3B 1GC1L 5DMGD 3IVKA 2NX5E 1KN2L 4XGZB 4QRPB 3X12B 4LCWE 1PG7X 5KZCB 5BMFL 2V6HA 4RWHA 2QSVA 3ALPA 3HKFA 2VQ1A 4LIQH 3U6RB 4YAQB 4KJWC 1VGEH 4RFNC 2VOTA 4NDMB 4R96A 1RUAL 4ZO7A 1MCNA 4NRYA 3MLXH 1DR9A 2GEEA 2QQNH 3RAJL 4AMKL 3SBWA 3IDIA 1UJTA 2ZSVA 3IAPA 2IALA 3BVNB 3FO9B 4L4TB 4X7TB 2OZ4H 3FAXA 1OAZH 3FZUC 4HWNA 1UWGH 3MYZA 3OAZH 3V4PH 4JPWH 4OFPA 4C83A 4WWKC 4OCYH 2AEWA 1WEJH 1X5JA 1QP1A 3BEWA 3GMNB 4HKXA 2LU7A 5K9QG 4YE4H 5DK0B 3O41B 5ESQB 2V17H 5JA9A 3V4VH 3IXAB 5IT2L 5DD1L 5KVFH 3HE7A 3IDXL 2BNUB 4M5YH 4A2MA 4TSCH 2HLAB 1QLEH 4BYHA 4PRIE 3KPMA 1GOGA 1NEZG 3EYUH 5IWLC 3RNKB 1J8HB 4UQ2B 4XPFL 4E0RB 3C2AL 4RFEB 2BSSA 5J3HC 3EDEA 4LRIC 5LKNA 3SOBH 4OIBA 1G9NH 1NGPL 3T3PE 3OKYA 3OJ2C 1PZUB 4JGJA 4X6FB 5DF0A 4AEIH 1J0ZA 2YC1A 3ULUC 2ENYA 1NANH 3QFJD 2EDWA 2A6JB 5KTEH 4ODHL 2VQTA 4Z0BH 3DUSB 3N0PB 3D25A 4I0PB 2WZPD 2VDRL 43CAB 2W65A 4OLZL 3KLSA 4DAGH 2CLVB 2B4CL 4WY7H 3A67H 5E1AA 4PS4L 4ZOCA 3DHMA 4M48L 3S5LA 4I18C 4IRZH 3UP1A 1HKLL 4XXDA 4P3CH 1GXEA 1MIMH 4TYUA 1OAKL 1L7TH 32C2B 2WP3T 1QBLH 2DLFH 1J87A 2OXHA 2X42A 1MVFA 3B9DA 5EOQL 4Z7UF 2EXWC 5D2NC 3REVA 2GY5A 1QRNA 1MQKH 3RWDB 5JPMB 3HC3H 3K1KC 1HWHB 2G9HA 4R3SB 1Q9WB 3DRTA 5HHOD 3UBXA 3E3QE 1AGDB 4KAQH 2YD8A 2WP3O 2V9RA 3VCLB 1NDGA 3DI2B 3VJ6A 2AVGA 4Q58C 5C08D 3EYFA 1ED3B 5TDNB 5JIHA 1IM3A 1DLFL 4P48A 1S7XB 4Y5XC 3VWKC 2Z8RA 3E8UH 3DOSA 4Y2DA 3IETA 4QOKA 4DW2H 1KLGA 3ES6A 4U6YB 4PJDF 5IB4B 4NQEE 2AKRA 3MCKB 1GGIL 2AXFA 4P2QA 1IL1B 1K85A 3VFOB 3N85H 3U9PH 4L1DA 1H8OA 1N3NA 2QSTA 1M6OB 2OYPA 4YJZL 1IGIH 3MREA 3L6FA 4KWUA 3B83A 1J11A 1IVLA 4QTIL 2NXZD 5EOCH 1U93A 4RA0C 5DHYA 1JNJA 4G43A 5DJ6A 5HYEA 5IBLD 4Y2OA 2EO1A 2HT4D 3SKMB 1BQLL 2F53A 1K8IB 4WI6A 3TVMD 3O9WB 4XI5C 1LO0L 4LNRB 5BQ7A 3GBMH 3N1GC 1KPRB 4ZS7H 5EUKB 3RBGA 3MYJA 2R4RH 2XZCL 4XNMB 2QADD 3L5JA 4FXGB 1OGTA 1KCVL 1LD9B 3WLWC 5FHBH 3QDJB 4GW4B 3PL6C 1TVBB 3L7FB 3KAAA 1B0RA 2HT3C 3GUTB 4LPWA 4WHCA 3LDBB 4NKQB 3WMSA 4XHJD 4YDLB 5J1AA 4KZDH 4A6YH 1IGML 2BX5A 3W82A 4OLYH 4EQ2A 4XCYB 2FDBP 2EIZA 1CGSL 4R4FL 3JWDH 5C3TA 3EUUA 1XCQB 2EICA 1RZFL 3R0NA 4NQVA 1LEKA 4G6FB 5CAYB 1OSZA 5GRYA 2BVQB 1FL6A 3EFFA 4FFWD 2AJXH 5I1AA 1R5WA 5I17A 1QA9B 1G6RA 5SWZB 2H26A 4KHTH 5IB3A 1MAMH 1ZXQA 1DVFB 1U2CA 2A6IA 2VLRD 3L3GA 2JCCF 2YRPA 3H0TA 3MLXL 2AP2A 3QUXD 5EULV 3T0EC 4M43H 2QQNL 2G60H 1A7PL 2H9GA 3VXNB 3TH2T 2XN9E 1A1MA 2E27L 3CVIH 1R0AH 1QTYT 1O7SA 4CJ1A 1KUMA 4MD4A 3O8XB 2OZ4L 1VACB 3QZWG 1B6DA 3SGJC 4RIRB 1KTLA 4OCYL 1JF5A 2EDLA 4PJ9D 3FT2B 5BZWB 5GGVY 1HK6A 4JQVC 3AU1A 3QUZC 3SDAD 1FNSL 4QRQA 2FGWH 3FOMA 5EBGA 4LVOB 4HIEA 1U9KA 1KCSH 2PO6A 3D0LA 4GRMB 1UB6B 4BFBD 2BY0A 3STZA 1NLDL 4M5YL 5FUZH 4N8PA 5GRJH 3JTTB 5DDHB 3C6SA 1HH6A 3BGFB 5ACLA 1S7VA 3LSOA 4JHBA 1R3HB 1HSAB 1RZGB 3T0DA 2Q8BH 3CMGA 1NMAH 1YDPB 1TJGL 4OZ4B 1AIFA 4P5TC 2DQTH 4M1DH 3B9KB 1KJMA 1A2YA 4MHHG 5CEZL 2X70B 4UNVA 3WIHL 2NY3D 3NFPB 1ERNA 1T7VA 5J57B 4MD5B 5IHBA 1B0GA 3WJLC 5KTEL 3GHBH 3V5HA 2BOCB 5BS0D 4CW1B 1C08B 4TNWK 3RZCB 4KJYA 3QQ9D 3BZEB 3I3EA 2AV1B 3INUL 1RJYA 3MV9E 3SHSA 2AJUH 1V3MA 4GQPH 4WGWB 4HIHB 4J1UB 5AWNH 2NX5B 3EBAA 4LCWB 3MA7A 2J3SA 5GGSB 4NN7C 1MIML 2VUOA 4X5WA 5CZVH 1L7TL 3UZVB 1AJ7H 3AXLA 5CD5C 1QBLL 1W0WB 2LQRA 3QA3A 3TBVA 3V6OE 5TE7H 4K7PL 1EO5A 2EEAA 4QYOA 5E70A 5DMYA 3OJDA 3JWOL 2R69H 3LS5L 4BK4A 4PIRF 1MQKL 2R1WA 1T2JA 3HFML 5ICXB 1J1XL 4KMQA 5E8OA 3CIQA 3FONB 5DFVD 4RZCA 3IF1B 5TDPA 4YUEL 3VGGA 3TBWB 1IEAB 4JEGB 1FFNA 5B39G 1FVEA 5MEOB 1A6ZA 4HG4J 2AAVA 4NJAH 1T1WA 4ZAKD 5GRVK 4M7KL 5CD3A 1B6UA 1SJEA 1S7SA 1IARB 3ZYJA 3U82B 2F19H 4Z7WE 4IRSC 5K59F 3QQ3B 1P69B 5IG7A 4TSAH 1T0NB 1MREL 4PRIB 3D39A 3O9WC 1OOAA 1CF8H 3BPOB 4HH9A 6CGTA 3TBTB 1KBGH 1MRDH 3K3QA 4XPGH 4Y1AA 2JTDA 1F4YH 2PCPB 4POUB 4OLUH 4HS6A 1G1CA 1QR1B 3LEXB 4LLQA 4POZC 5KAQG 1AXIB 4ZS7L 5FYKH 2R4RL 1JWSA 1FNFA 2BOBB 2NY7L 3PP4H 5I76A 1CL7L 1MPAL 2DS4A 2WV3A 2FB4H 4M93B 1X5ZA 1AQDA 2PYFA 4P2OC 2AJSL 2BZDA 4GOSA 3OHXA 2ZCHH 1VFOA 2DI9A 5KJRL 3NPSB 5JR1L 1A6TA 1HNGA 1T2QL 3D3VE 1GPOL 4N9GA 4A6YL 1JWMB 4NJ9L 4Z78B 4DGIH 1S9KC 2GY7B 1DZBA 1KG0B 5E08H 4WEBH 2P49B 1ZT1B 2R39A 1ZLVH 4HLJA 5ITFA 4WUKH 3QPQD 3FQWA 1RZJH 3DWTA 5DQDL 2PNDA 2HFTA 1NC2B 3O4LB 4HUKB 5FUCC 3QJHA 3VFUA 2VL5A 4DEPB 1FVDB 1P1ZA 3WS6C 4XPAL 1EAJA 2AJXL 2CK0L 2WNGA 3WNOA 1JZ8A 4OUUA 4KHTL 1BQSA 3N9GH 1PY4A 1R3JB 4I9WD 5C2BH 5ICYB 3QH3B 1MQ8A 4JPIB 4OCXH 3OL2A 4M43L 2G60L 3UXFA 3ME0A 1UWEL 4MA7L 2F8XC 4WU5B 1YN7A 2B1HL 2EDOA 3LKQB 4NQEB 2IGFH 4WW2A 3ILPA 1EO8L 3BDXA 3FQTB 5F9DC 1RQ5A 3WFCL 2B39A 1RUMH 2WMPA 1AY1H 3JWOC 2FH6A 2VABB 2FGWL 3MV7E 1H5BA 1TCRB 1DSFL 4AT6A 4M02A 3W81A 5J13B 4OLWH 1H8SA 2I27N 3IDNB 4TVSa 3RHWK 3TZVA 3K4ZA 4LP4A 1NCWH 3FO1A 2D0HA 1XF5B 5HY9B 2VITA 4O02H 2AERT 1HDMA 1MHEB 4O51B 3RRQA 2CIKB 2H41A 4PRNB 1HHHA 3UJIH 4YXLH 2CKNA 2OP4H 4M1DL 2Z0BA 2ITDA 4G9FD 4OIAA 3KWWB 4X6CE 3VGFA 1BD2D 3F5WA 4OCNC 5T3ZH 1XIWB 2K7PA 3VXUA 4XWGH 5E2UL 2VTFA 3J8F7 3GHBL 1C1EL 1FL5A 1ZEAH 4RMSA 5C0BB 5HVGB 1JFQH 1BJ1J 2P5EE 4KRNA 5DWUL 2I5YH 4DKDC 3T4AB 2R2EA 4XBGA 2PYEE 5F6IB 1DQML 3FTGB 4WI9A 4EOWL 3HRZA 3JVGC 5DEFB 3C09C 4WHTB 4E41D 4D9LL 4K3HA 3IDMB 4YAQA 2EYTA 1AJ7L 3L3DB 3BMWA 1BZ7B 4NDMA 5IHUH 4U1SB 4KI5F 4QY8A 1ZGLA 4Q6IA 2VZVA 4KQ3H 2AJVL 5CKGA 4BSWA 25C8L 5FA3A 4E9LA 1G7MA 2IANE 3BVNA 4KUCD 2XN9B 2X4PB 4MDJB 1A6UL 5GS3A 5SWQB 4MDIB 1U8QA 1EAPA 4PJ7E 3ARBC 3BN3B 4JZJA 3EOTL 4WI8A 2AV7A 5DK0A 4MXQD 5EO9A 5DLMH 1LO2L 4AM0A 4D9RE 1PBYA 3BPOC 4X4MA 3MRBA 2HTKC 5FCUH 2BNUA 2DN7A 1FSKB 4L4JA 4UIKH 4Z77B 4I2XA 1U6AL 3RVVD 1MSPA 5SV4A 3QR2A 3RNKA 4NBYB 4UQ2A 1UVQA 1VFBB 5JQ6L 4E0RA 1M7DB 1O5DT 1ZWIB 4JN1L 1F4YL 3QEQD 1KNOA 3QIWB 2P43B 1G7QB 1MCQA 1N59B 5C8JB 1G6RH 5I75B 4MLIA 4X6FA 1I1AC 5I9QB 5I19H 4M61B 1RMFL 3SPVB 4JFYA 5D1QB 3IKCA 1CGUA 3D48R 3DETD 1CLOH 2A6JA 3ESUF 2M2DA 2Z92B 5FYKL 1OP9A 1MCLA 4EDWH 4Z9KB 4HJ0C 4I0PA 1NGXB 43CAA 3SE3A 5JOEA 1EHNA 4QRSA 4WFFE 2FB4L 2ORBL 3MV9B 1IC4H 1ODAA 3MXWL 4XMPH 3W0WE 7FABH 5HI3D 2R1YA 3MRJB 2V5RA 2ZCHL 4NWUH 1D6EB 3BOVA 5B4MC 2QLVB 1FNAA 1T1YB 1O0VA 2A6KB 2OR9H 3FB6A 2C7UB 4PRHB 2EDBA 4PP2A 4WEBL 4DUXA 5C07B 3MRDA 4WUKL 2XIDA 1RZJL 2Z35A 4TTGA 5HYJE 1HYRC 4Y4HB 4R3SA 1N0XH 4OF8A 1CS6A 3JSSA 1UXSA 3VCLA 5CBAA 2YMXH 2VXUL 2FATL 3WLBB 3VH8B 5TDNA 3WFDL 4MAUH 1NMBH 2LE9A 5C2BL 2HRLA 4K7FA 1D5ZB 1WV7T 4HLZH 1H15A 3MLTB 2EIBA 4F33B 4R2GB 5SX4H 2P7TB 4I13B 5IB4A 3ZDXF 2BVOB 4CN4A 1BVZA 4U1LA 3DI3B 1IL1A 3HNTH 3OAUL 3MNVA 2A38A 3VFOA 4Z7WB 2QJDA 5SWSA 1M6OA 1QFWL 1RUML 1UJ3C 5ID1B 4HV8B 2EZ0D 3ROOB 3VFVB 1GIGH 2F58H 2IFFH 4FG6D 3LB6C 5FM8A 4Z7OE 3SE8L 3B2UD 2IQAA 4OBRA 1SYSB 1CDCA 1I8MB 1AQKH 4OLWL 2JIXD 3MBEB 3SKMA 1J88A 2BNRE 3BKMH 1K8IA 4YX2L 3GSXA 1NCWL 3H7LA 1KTKE 3STLB 2EDDA 2YK1H 3LIZL 3MUZ1 5DYOB 1NCCH 2ADGB 3ECBB 1KPRA 3B9VA 3CJJA 1XR9A 4R7NB 1FO0B 4CU6A 4HIIA 3O4OB 5HPMA 4FXGA 4CN6A 5CJBA 1I85A 3ARDD 3P9MB 1YY9C 4CVZB 3QDJA 4ZO9A 3L7FA 5DRWA 1AE6H 1BOYA 5T3ZL 3MMEA 4OF0A 3WHXB 5CEXA 1H9VA 2FIRT 2XY1A 1P7HL 4KXZI 4WV1B 3ARGD 3H8NA 4C56E 5DJ0B 3TJHC 5J11C 2VLLB 5JMOC 4KU1A 3DMMB 4UT6H 2DAVA 3NA9H 5EN2B 4GMSL 1PD6A 4C58B 1XCQA 2I5YL 1CIUA 4GLRH 4BH8B 5I1JH 1VCAA 1I7TB 4UTAH 5IMMA 1FNHA 5F1KC 3SBWC 4AYFA 4WW2F 1CFNA 4RISL 1TETL 1WK0A 2OK0H 4P46B 4LLMB 4X6DB 1QA9A 2E9IA 3GSWB 2Q8AH 1FAKT 3DX8A 4C54A 4PY8J 1U91B 5D7KE 5IHUL 2L0DA 1OTTC 3OAYK 1NKRA 5D2LA 1UH2A 4XTRC 1CFVL 3AMKA 4OCWL 5KAQF 3PWPA 2Z8VC 3OZ9H 4ELME 1VACA 9CGTA 1B2WH 1XR8A 1MAKA 3HE7C 3QDMD 2UYLB 4TUOB 5I8KL 1P4LB 1RZJC 1GOFA 1QD0A 3MLZL 4GKOA 3ZTNH 1BM3L 3H42L 2XTJD 1Y18A 1P53A 3S96B 1WBYB 1CDBA 2GITB 3MV7B 3KYKH 2W9DL 2VRAA 1UB6A 1AP2B 3O3AA 3A6OA 1FL3A 4WUUE 3QNXB 5DURB 2ICWA 4WFHE 2LTQC 3GHEH 2FO1A 4UIKL 2DJSA 5B22A 4YHMH 3LD8B 5ADOH 3CLEL 3NAAL 3HNSH 1WFNA 3E6FB 4KKAD 5EOCJ 1PFCA 2VLJD 4G8EB 5EU6E 2PXYA 2OBGA 3WUWG 1HSAA 4FRWA 3VXRB 3VGAC 1U36A 3DUUB 3V4UH 3MJ7B 1LILA 1TDQA 4BQ6A 3OV6A 4JG0L 5AD0A 3H9HA 4GS7B 3RY4A 4NOBA 1X6NA 4X6CB 5DFTA 4BQ8A 3QQ4A 4NN5B 5J1SC 1F02I 3FHAA 3NFPA 5T5NG 1TTUA 5AYUL 4MD5A 4HK3J 1JPTH 4K8RD 4AQ1B 5MENA 1TENA 4FQHA 2BOCA 2O5ZH 1C08A 1SM3L 2JELH 2OJEB 4TNVF 2AV1A 3OKMB 3QCVL 5T1DH 1YEGL 3ZL4L 1E6JH 4M7LT 3DXAB 1MI5E 2P5EB 2NNAB 2NX5A 3GSOB 4U1IA 7FABL 5J56B 35C8H 2PYEB 4NWUL 4LCWA 2GAZB 3KPTA 4NHUA 3GSUB 1TTFA 5IJKC 5KSBE 4XXCA 4X8XA 1JHTB 1RK1B 1FH5L 1CICB 1W0WA 5DA4A 1YMMD 4PLJC 2PR4H 2XY2A 1F8TL 1BBDL 3CDCA 4H26B 4U1MA 4WO4C 3BJLA 5CILH 5IGXH 1MCJA 2VUYA 1EIBA 3IAQA 1N0XL 1ZA3B 5FYJH 1MJJB 4Y2DC 1R5VB 3UPRB 3LV3B 1OTSC 1NGYA 2IANB 4GT7A 4WGVB 4KVCH 4DFIA 5BZDB 4AIZA 4Y4FC 3FONA 1YZZA 5I18H 3Q6GL 4PJ7B 1B4JL 3TBWA 1IEAA 5CBEB 3EYVB 1NMBL 1U42A 5MEOA 1QLRB 4L3ED 3S37L 4N8CL 4KTEH 4D0BB 3N1MC 2AJ3A 5E6ZA 4JB9L 4P4RA 5C0IB 4ZFOB 4PFEA 1OB1B 3TIEB 2QHRL 3QQ3A 4P23D 1T0NA 4OAWB 4N90D 4CDGC 2NY2D 4PRIA 4OI8A 3K2MC 2F58L 2YD3A 2DJUA 1CK0L 1J1PH 1UH4A 1YPZE 3TBTA 5GZNC 1JNHA 4JO3L 2ZCKH 1P84K 4ZOAA 1H3WM 1BJMA 3ULVH 1EXUA 5CJQL 1YN6B 4LASL 5E9DE 3D0VB 3RX8A 4O4YL 3PWLB 2YK1L 2ZUQC 3LEXA 4OLEA 1NCCL 3LN5A 4MS8C 3U7YH 3DROB 1K4DA 4IM8A 3GJFB 2BOBA 4ZXBB 4KDVA 1T4KB 4PGZA 1QFOA 4JZOA 5JHDE 3V79C 4EBQH 4NZDA 3V0VA 3IFPB 3R06A 1PW3A 3JV6A 4GBXA 4XCFH 3MACH 5EUOE 4F7CA 2IAMC 1CR9H 4J3WA 4Z78A 1NL0L 3KJ6H 2W9LA 4ORGB 3MLYL 3DARA 2NY4B 4ALAL 4HULB 5ADPH 2APXA 5FOBB 5MEQA 5TPWH 4S0TD 2CDEB 4ONOA 1WAAE 3OAZK 1UM5H 1NUFA 2Z31B 5HYJB 3EO1B 3BAEH 4JKPH 3O0RH 5MHSE 2JJUA 4HWBL 5DRXB 5EG6C 5F1IB 2CXGA 4MQXC 5KSUB 1UKSA 3MV8E 3LKSB 4OZFB 3BZDA 1IBGL 2OK0L 1M7XA 3ABZA 1JCKA 2Q8AL 4IBLT 1NFIB 2VLKD 1R3JA 3MCLL 2O61B 3NFNB 1MY7A 1ULVA 4BELD 1NQBA 1F00I 2MPAL 5GS2D 3CZJA 4LU5L 4WU5A 3WEXB 1E28B 1RZ8B 2YRZA 3L3IB 1PY9A 2HJKB 3LZFL 3FQRA 3FQTA 3QWRD 1TVDA 1CLZH 3RWCB 3S4SB 3SGKC 1GGTA 1W8NA 4JRYE 4PJ5D 2BVPB 2WQRA 2NQCA 5E8DL 1TCRA 4DK3A 2FGZA 1KB9K 3KYKL 4NKIL 4EXPX 4PJFA 4Y89A 5FM4A 5CIPA 2BNRB 1G7PA 1X5KA 1XF5A 5FGRA 2BFVH 1V7ML 3VFRB 3V6ZB 3ARWA 3GHEL 1X4YA 3K81A 1JPFB 1NH6A 4IMLB 1MHEA 1LEIB 4LNVA 1F90L 2YXMA 4J8RB 4PRNA 5T3XD 2DB8A 3UC0H 1P7KB 2DQCH 4MQTB 1PEWA 2P24B 5C09B 1U2HA 3QYCA 4HK0B 4YHLL 2R8SL 4WTZA 3HZMB 3VWKD 4PV9B 2BP3A 2X7LB 5EA0H 5TE6L 3QIUB 1I9RH 5CEYB 4KI1A 1JYVA 4YHKL 1KTDB 3WN5A 5M94B 2IG2L 4BZ1L 3MUY1 1WF5A 1FE8H 3CSPA 4WWID 4KV5E 4C56B 4YDKH 5MI0C 1A7OH 4X98B 4ZUSB 3HC4H 3TC9A 3O81A 1UZ6E 1KIQB 3SGEH 3G08A 2YHGA 1A5FL 4KK8C 4GRLA 1E6JL 2ICCA 3LHPH 5IW6A 5CJOL 2E3VA 4XCEB 2ARWA 1CD9B 4XC1H 4UIMB 4L8DA 3VWJC 1C7TA 4UB0H 5DEFA 3LRSB 1A4JA 4XI5D 2NPLX 4MXWH 3KYAA 3RI5F 3NIGE 1G1YA 3OPZH 4OKVB 3WIIH 2C3WA 4B0MM 4NOFA 1IKFL 3HG1A 4HC1A 1JGVH 3VU2A 3WLWD 4QXGH 4U3CA 3U7AA 1YJDH 3PL6D 2XN9A 4ZNEE 4FFVC 3OJVC 1A1NB 4MDJA 4ELMB 3PUCA 1UZ8A 1ZHLB 2G75A 3VI4F 5L88H 2MOVA 4XPBL 4M6OH 5E5UB 2ITCA 4KJPD 4BH7B 1E4XI 1H3PL 3LH2H 3PG2A 4RMUA 1NCBL 2DLEA 5INCA 4B7IA 2W0FB 1LP9E 2E8ZA 1LK3H 4U0RB 2XTLA 5FV2A 1IAII 2A77H 3WDJA 1D5MA 3QDGD 3RTQD 1NBYA 2DWEB 4XP9H 4Z77A 4NRXA 5FGSA 2ESVE 2QR0B 3OB0K 2ZG1A 5EU6B 1KELL 5MEPA 1GRWA 2AQ1A 2YKLH 2ZCKL 4PRDB 1VA9A 3KR3H 5C0CE 4NYLB 2VC2L 4ZXBC 3QIWA 2Z91B 1XGPA 1G7QA 5C8JA 3ESVF 4Y5YB 5J12B 2GCYA 4NRZB 3SPVA 1WWCA 1SVCP 5F7FA 5LWYH 3LY6A 4EUPB 3QNYB 1D5IH 1Q8MA 3QRGL 2OMNA 3LKRA 4I3SH 4Z95H 3HNVL 1V3KA 1F4WL 2JE8A 1CD1A 3C5ZD 3FFDA 5IB1A 3T2PA 1MFBH 3MV9A 1KEMH 1NPUA 1MI5B 4HT1H 4ETYA 3MLUH 1INDH 5TDOB 1NCDH 1NAMB 4HCRA 5DI8B 4Y16D 1DQJA 3P9WB 3VXOA 2A6KA 5KSBB 4J3OC 4JKKA 5L9DL 4YHOH 2IMNA 1PLGH 3KPRD 3V6OA 3MGOB 3P73B 4U1HB 3MA9H 1URLA 4H25A 3CCHA 3FRPG 4XPHH 2YPKB 3QPXL 4Y4HA 2VWEC 4XAKE 3I9GH 5KSAA 1JGUH 5ESAA 4RAUA 1Z0MA 3RIFF 3D69A 4PJBA 3VH8A 1BVKA 5D9SA 1SEQH 1ZKAA 3LKNB 1EMTH 4GRWB 1BVLB 4F33A 5ANME 3RNQB 5FYLL 1ZV5A 4X6BB 5IBUG 1IM9D 3SJVD 2BVOA 2N4IA 3T3PF 4PJ8B 1TPXC 1Z5LB 2FD6H 3TZVC 3F7RA 3MZTA 4HJJL 2X4QA 3X14A 3D2UA 1BF8A 4HV8A 3VFVA 3MOAH 4ODXB 3ROOA 3VRIA 2WM0A 2FHCA 1SYSA 8CGTA 3QHFL 1NAML 2A6DB 2DLTA 3U1SL 3WFBH 4TQEH 4LLWB 2VDPH 3BH9B 3RWEB 5E9DB 3LS4H 5DYOA 4ZPVB 1CLYL 3SCMA 2NY1B 1FO0A 3MLWH 3UC0L 3U79A 3MJ9L 1QBBA 4PYGA 1CFBA 4UDTB 2FHFA 1RJLB 1EEQA 3CC5B 3MODH 5FK9B 3OBAA 3P9MA 3QXAA 1VPOL 5JHDB 5EA0L 3CUPB 3VD3A 1PGRB 3T09A 3VXSD 5I6XC 3LN9A 1T22B 2JK5B 4MJIE 1J0KA 1S7QB 2XNAB 1RVFL 4Y5VC 2X09A 5E00A 2GJZB 4GQ9L 3H9SE 5HHQB 5H35A 4WV1A 1FE8L 4IRSD 3V8CA 5DJ0A 1JPSH 3D3VA 2B0SH 4JFOB 3BE1L 3ULVC 3O3EB 5EN2A 3DX6A 3OKDB 4KTDH 5F1OB 4HDIB 4LCCA 3GO1L 3OXSB 4D2NA 1VKXA 1YYLH 1I7TA 4OGZA 4Q6IC 1GGCL 1OM3H 4S1RH 2ADFL 4UB0L 5A43C 3O11B 4JZNB 4POZD 4LLMA 3MV8B 2I25N 4NCDA 2J6EA 1TVHA 3EIFA 4NO0B 4WCYH 4H20L 4ODSH 4JZJC 5F72S 1ZHKA 1KEGH 3SE4A 5GIRB 4F8TA 3TYGH 1DBJH 3HLAB 2WLZA 1MJ7H 3ARVA 3B4NA 3PXJA 1R3LA 3RU8H 3ZKNC 4P57B 2FYYA 2IH3A 3U4BH 4J2XA 5B8CB 1DUZB 3QAZB 4XP1H 1DBKH 2UYLA 1JRHH 2R29H 2XWTB 4HS8L 2AK1H 3WDIA 4B53A 4HBCH 4TPRH 4NWTH 3LH2L 3TO4B 3S36H 1P2CB 3KJ4C 4HJGB 1NGQL 1FQ9C 2EDTA 3U46B 3S96A 1KPUB 3MV7A 2ADJA 3CFKB 4MJ5B 4NNYB 4MAYB 1AP2A 3NACH 1LK3L 2VIRB 2A77L 3AMLA 1SMAA 3BQUD 1RZ7H 1T1ZB 2MNUA 1K2DA 4K7PY 3KXFD 3ZHKA 4NQCE 1XGTB 1QSEB 1I75A 5T5FL 1UENA 2RB8A 4JGUA 2XXMB 4ONHB 3ISWA 4I3RH 4UINL 2V2XB 5E2JA 4D94A 3KR3L 4Q9CA 4WDIB 2MKLC 3UCRA 3BPLC 3SE3C 4LHUA 4X6CA 4YWGH 2RFXB 5FHAH 1ZT4A 1QQDB 4HGMA 4JM2B 5F6HJ 3AS0A 1R3KB 5LWYL 4TUJB 2DYPA 3L5IA 2H2SC 2FLBT 2COQA 5AYQA 2NW2B 5IQ9B 3BDYH 1MHHB 4OD1H 3VXQB 5GJSH 5D7IE 1N8ZA 2R2HA 5D93B 5C9JB 2E7MA 4LAJH 2PYEA 1KTRL 1L0YA 2GAZA 1NSNL 3GSUA 3ZKQD 5K9KA 1NCDL 4N8VB 1G9MH 5IOPB 3CSBA 5IIEB 3OXRA 2WWMC 3QG6B 3MGAA 4OGAD 5JLZB 2ZCLL 4HKZB 5CIPH 5DVOA 4ZSOE 3PWJB 4S1DD 3BO8B 1YEDA 2MCPH 4H26A 4JFFD 3RWFB 3QCUL 1RUKL 4FP8H 3BIKB 1RPQA 2ZWLT 1V3JA 4PJCB 3RPIA 3FRUB 1LE5B 3TN0A 3FCTA 4MQ7A 4AEFA 1MJJA 3UPRA 1R5VA 3LV3A 3TBYA 3WL9B 5FDWA 4X9BA 5JDJA 4PJ7A 1MJ8H 5DT1H 4I48A 4MNQE 3EYVA 4KKBC 4M1GL 4KJQC 3WIFA 5A2LH 4OZFG 2PW2A 2YUZA 2WBJB 4Y19D 4D0BA 1J1OH 1AGEB 1LP9B 3G6DL 4ZFOA 3BHBA 1OB1A 2Y07H 3LOWA 4TVPE 4MLSA 1F4AA 5E4IA 4HWUA 2XKUA 1IAIM 2HT2D 2BJML 1LWRA 1U92B 3QJFB 4YGAB 1ZS8B 4LCIL 3S4SG 4NO5B 3QXDB 1FPTL 2B5IC 4KMLB 4PGDB 2BNQD 5C0CB 3UTTD 2Y06L 1UA6L 1A3RH 4CAGA 4DVRH 4YFLF 3PDOB 1XCTA 3V6FA 3PWUA 1IC1A 1SEBB 4HC1H 4XVJH 3RFZC 2D0FA 1RULH 4JY5H 3TT1L 3LQMA 1KN4H 1T4KA 1EGJA 1EBPA 4PV8A 3WNMA 5DEGB 3RKDC 3HE6D 5FO8B 1H3VA 3QIBC 3CU1A 3IFPA 1WISA 5D7JD 2KL6A 4KZEH 1ND0A 1ADQL 4O00A 5I71B 1WZLA 4OQTA 2HTKD 2FX8L 3W0WA 4ZUUB 3NCYS 3UTPE 3WUZA 4U1NB 4LCYA 1JPSL 3GZKA 3BKCH 2ZUUA 1H3UA 1IGCH 4JRXB 4APQB 2CDEA 4V1DE 4LPUA 4U2ZA 5HYJA 3CVHA 2GYSA 3EO1A 2RBLA 3DX7B 3K4AA 3SY0B 4RFOL 3IJSB 4P99A 3QDAA 1J10A 5CUSH 4NO3B 5DRXA 4S1RL 5F1IA 1OM3L 5KSUA 4IOFD 4Z7WF 1JNNL 4ZUWB 4D9QE 1U3HB 1ZMYA 2QHLA 5L0QC 1NFIA 1FZJB 3F7YB 4FQXD 4WCYL 4AEHH 4ODSL 1NANI 5E2TH 2CDGB 1I7RA 4HJ0D 1ZTXH 1QVOB 5BXFB 1AR2A 1VGKB 5E56A 3U0PA 3VFMA 1MJ7L 1S5HA 1AGCB 3N1FC 4XVTL 2VAAB 1T5WA 3HMWL 1T89C 4JVWA 4LLUB 3U4BL 3BUYB 4NZTH 2HVJB 2HJKA 4XP1L 1DBKL 5FKAB 5CCKH 1N64H 4M9OA 4XCCL 5E94A 4M1CD 5GRUH 5B4MD 3BD5A 2J12B 4XP4L 4Q74A 4PJAE 2O5XL 5IK3A 1EFXB 3AB0C 2BVPA 3HZVB 5DHXB 3RVTC 1LEGA 1BPVA 2DMCA 4M6AA 2PXYC 1X5HA 3H9ZA 4HCRH 3MJ6A 3NACL 1LO4H 4LSRL 2BNRA 3RVUD 3ARFB 1S7RB 2UWEE 3VFRA 3MRMB 5I73C 2QL1A 1JPFA 3EDDA 4P4KB 1LEIA 1AXTH 1FFOB 1NFDE 1B3JA 4ETQA 1FAIH 5E6IB 3T0AA 2BY3A 3HZMA 2QSQA 4PV9A 4IRJB 3QIUA 3S88L 4DK6A 2V2WB 4LSTL 4G9FA 5D96B 1IEBB 3HR5B 4MGXA 4MJIB 1DFBL 1N2RB 4U3HA 4UMGA 1JYXA 2P8LB 3H9SB 3FFCD 3MRLB 4OF5A 3LEVH 4Y4KA 2EH7H 4EI5A 2UY6A 4X98A 5BS0E 1WCQA 2D31B 4XXCC 4JFZL 3BDYL 4OGYL 4LSQH 1F3JB 1Z3GH 3NCJL 5KBNC 1Z2KA 2MKWA 4CL7A 1JE6A 4LOUC 1DL7H 3GEWB 2FWOB 1MLCA 4FQQA 1T6WA 5C0FB 3O3BA 5D6DA 4OKVA 3KNBB 4XBPB 4EDXA 1A8JH 1U0QA 4TULH 5F9WB 5C6TH 4C59B 4ZFZB 1YY9D 5D70H 1U8LB 5CSZB 1KC5H 1T2XA 4CNIB 2Q3ZA 4YGVB 1ZHLA 3FQUB 2H32B 1CU4L 4OF7A 4TTDC 5EZLB 5EBWB 5HGHB 3FT4A 1MEXH 4JREB 1QFUH 2PW1A 4WIQA 5F7EH 5F93C 1J1OL 3VXMD 4JFXB 2D4DA 4YHNB 4S2SB 2H8PB 4X6CF 4ZTPL 1P6AB 1D6VH 3WO4C 1JMZA 5B38A 2DWEA 4WUUA 3WYRA 1XGUB 3ZKXB 2XXCB 3MRNB 1V8HA 4NQCB 4HXAL 4J6RL 2H45A 3RWGA 5EU6A 1FP5A 2YN5A 3SKJL 4PRDA 4A2LA 1YEKH 4XTRD 4K94H 3THMH 2J6EH 3QEQA 4NRZA 4MWFA 5L2KE 2VXVL 3PWNA 4GBXC 3LKPB 4XVJL 5HYQA 4NQDE 4Z7UE 4Z8FH 1ZA6B 2EKSB 4OBSA 4OSUL 3HE7D 5EWIL 1LK2B 4EUPA 3QNYA 4Y88A 5LGJB 1JP5A 2H3NB 2P8MA 1I7ZB 1YEEH 3OGCA 2I9TB 3DX9B 2VR9A 1CIDA 5I15L 4QHNB 5KG9B 4LKCB 3U9UB 3KLAB 5D7IB 4RGMC 4P3DB 2G2RA 1I9EA 1UM4L 1NBZB 5B3NA 4JFQB 4Q2ZA 4L8BB 4BSVB 5C6PB 1S7WA 4PJ7F 2HFEB 4TRPH 1HOCA 2JKXA 3Q3GB 5EU7C 5KSBA 2WUBL 2R2BB 3BKCL 3V7AE 4MJ2A 3MGOA 4ZSOB 3WXVL 4Q0XH 4MA1C 4HGWB 1RJCA 3IDGB 3MXVH 3WD5H 5ISZE 1NBQA 5E5MA 4OZGA 3EOYG 5CUSL 3E0GA 3BXNB 1XGRA 2OL3B 4R90L 4K7PX 4FQ1H 4OD3H 1ITCA 3AAZA 2C26A 2QEJA 5DZLA 4LQFH 1MIEH 3B2VH 4MNQB 5C08B 4ZFFB 5E2TL 4K3GA 5I16B 5JZ7C 2OMBA 3LKNA 4I9WE 1MNUL 1BVLA 3RNQA 4JPKL 3SEPA 5HTSA 3BPNB 5I66B 1G9MC 4Q9RL 5L8JB 3RDTC 1QRND 1S9VB 5KS9E 1KULA 3OKOB 4N68A 4ODXA 4LSUH 1QSZA 1EO7A 4YXHH 1X6LA 2Y4SA 1YPZA 2NXZB 1X44A 1P7QB 2A6DA 3FO0H 1AKJD 4M5ZH 1KGCE 4JHZA 2BDNH 2XQBH 4Y0GA 4OIIL 2JIXA 4LLWA 3RWEA 5E9DA 4KROC 4OCSL 1KCLA 4Y2DD 1BF2A 4LMQI 4QOKD 1QSFE 3TVMB 5DVKA 4UBDD 3WS3A 3WN5C 3BX7C 1OAYH 3HUJA 1IQWH 1C5CH 3QULB 1JL8A 4P2QD 5HGDA 3TPUA 4UDTA 4C4KT 4CVXB 3CC5A 4ZFGL 3JV4B 5F7DB 3PHSA 4JDTL 1MWAB 5JHDA 3SKOA 5INDA 4GMTH 1BIHA 2IADB 3ARDA 2JK5A 3C2SA 1S7QA 5EUOA 3DECA 4G9DB 3T8XB 4GRLC 2GJZA 4GG6E 3GNMH 4X7SH 2PTTB 3SDDA 3MRRA 5HHQA 5GS0H 2NXYD 2YSSB 5B3JF 4C4KO 2F53D 3SQOH 3EJZC 5DMGC 1CGYA 1NKOA 3C5JA 4JFOA 3ZE0E 1YC8A 5I2IB 4JPVH 1OW0C 3O3EA 4QHUA 1NCNA 2X4RB 5GZND 3ZSTA 2DKSA 5I1GL 2IQ9H 4V1DB 1ZOXA 3FT3B 2C4FT 3BWUC 5F1SA 1FFQA 2GTZA 4LMQE 2YUWA 4P2YA 4F7EB 4HUVA 3K8KA 3MLSH 2XQYG 4PB9H 2VXSH 3O11A 5IMKB 4KRPC 3B5HA 3MV8A 2BK8A 2ICWJ 1I3GL 5ITBH 1CDIA 4N8VG 3SGDI 5FO9B 2YA1A 1NUGA 4ZUVB 3HLAA 4OB5H 2VLRB 4Z7OF 5C6TL 5JW5B 1UYWL 1IC5H 3AVEA 3QUXB 1GHFH 3PHOA 4R97C 3RZWA 3FQXB 1EGJH 5B8CA 5IFHL 2Q7YA 5D1ZB 2XWTA 3VFTA 3X13B 2R23A 1GVIA 1JF1B 3QUML 1KF9B 5GGRY 3TIDB 3TO4A 3MUHL 4PJAB 1QFUL 1AHWB 4OQTH 4JRYA 3QDHA 2I60H 5F7EL 3U46A 1KCRH 3TNNB 1KPUA 3GMQB 4NNYA 4MJ5A 5KW9H 1YNTB 2Z8WC 4TNVK 1N6QL 4MAYA 3QNZB 4ZYKB 4PJGE 2HJLA 3ZKSD 1GAFL 1E4WH 2WAHA 1T1ZA 2X41A 5HHME 2UWEB 3GKWH 4MQXD 4NFCA 3MSPA 3OSKA 4ESKA 4NKOB 5J7CC 1EEYB 3CVHH 4G7VL 1NFDB 5DC4B 4MD0B 3FMGH 5I1LB 1WBXB 3K2UH 1W72B 2V2XA 5J0BA 4WDIA 3TA3A 3RY6A 1VERA 3PP3K 5EIVA 3S9DB 4KI5D 1D9KB 1QQDA 2DLIA 2C3XA 2F5AH 3O6FA 4MVBD 5JPNB