4OFPA

Crystal structure of syg-2 d3-d4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
200
structure length
197
Chain Sequence
DPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKEIKNIYSFIASQNDNMAEYECRANNSRPKRKAMKLEVNYPPASVELFGESNIRYGSSANIQCKSLPSNPASQITWIINGRSVPTPTQREFVVENGIVSSSNVSVHSNELSVEAHQINVECMATNPEGSSAKQHVIKIIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
molecule keywords Protein SYG-2
total genus 28
structure length 197
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA01
4ENEC 2GCYA 1G1CA 1A3RH 3GKZA 1WBYB 2JIXA 4XXDA 3ARFB 2CR3A 4YR6A 1H5BA 3DX8B 1ZT4B 3GSNA 4LAQL 4KKLC 3WFZA 1HE7A 2FO1A 2AXGA 3EO0A 4KQ4H 4HUWB 1U8OB 4LKCB 5CKAA 4ZO8A 1UH4A 5F7WC 3GSNH 4PLOB 1I1CA 4XWGH 1A14H 1R3LB 5IMLA 1JN6A 3ABZA 5A16B 2VUOA 5DC0A 4K3EH 5KAQG 1H3XA 4YNYA 1GJIA 4JFDB 1OY3B 2VXTH 1I1FB 4PJ5D 3T77B 5FOBB 3LS5H 3UYPA 4E41B 4XCEB 1BJ1H 5TE4H 5I2IA 5D6CA 2MOVA 4OLWL 2DS4A 1V3LA 5CILH 2W0FB 4HIIA 3ZKXB 5ID1A 1G7HA 4PJCA 3T09A 2R0LL 4AH2A 3WHE1 2R69L 3L3HA 4G43A 1A4JA 5HYJA 1JPFA 1CLOH 4L9DA 3VFNB 1D6EA 5J1AB 5EU6B 4GG6E 1S7XA 1G84A 5KSBE 4APQA 5H35A 4DOHE 2YPVH 3L3OA 3QUZC 1V3KA 5A40E 3ILPA 2WUBL 5C7XL 1B2WL 4JRYB 2BY1A 2Z8RA 3ARFD 4WV1A 3M1BB 4V2CB 4HKBA 1OAXH 4HBQA 1A6VH 1SY6H 5C2UB 5IW1A 1RAMA 2QSTA 1RIUH 3WIFB 1NFIB 1I85C 5KVEL 4M93C 4Y5VC 5DI8B 1SQ2N 4J1UA 4ONFH 3V9FA 3NPSB 4GQPH 5L6YL 1WWAX 4DZ8A 4WHDA 1RPQA 2FDBP 4MNQA 4PJDA 3ZDYF 4YE4H 3SGEI 5IGXH 1OTSD 5DUPH 4NZUL 1AIFB 1YC7A 1ZHKA 3BIKB 4HX1B 5GSVB 3VI3F 2R2EB 1N59A 4OFDA 3P0VL 4Z77A 1KELH 2VISB 3U82B 5C9KA 2F15A 3FFCB 4K71B 3DIFA 4NQDE 4JFXA 4TSAH 3VWKA 1TJHL 5EC1B 3MZGB 2DQEL 1FAIH 2Y7QB 1YEJL 3CFEB 1XGYL 1LO0L 3MRIA 3TO2A 3PV6B 1R3IL 3VD3A 1UWXH 3A6BL 2AXFB 3O0RH 1LILA 1QUNA 4FFZL 2UZIH 3CXDL 1BD2B 4P5KA 3FOMB 1BIHA 2GTZA 5I73C 2VR5A 4OV6F 3P73B 4OD1H 2N4IA 2MHAB 4UTAH 1D5IH 1HKLH 4Z8FH 4XB7A 4UT6L 3GB7A 3T0EE 2C1PA 3W0WB 1HK6A 4ORGB 2NY2C 2IADB 3NN8B 3X11B 3S5LA 5ICYA 3GRWA 2ORBL 1OF2B 3D69B 4PJXA 2VDOH 3VRLE 3F58L 4M5YL 4RWYH 4XVUC 1ZT7A 3QQ9C 3WO4C 2D4FA 4LBEA 4QHUB 2HLFC 4PRPE 2BMKB 4TNWK 1KIRA 3FQUB 4LDEB 1FL3B 1T7VA 4GSDL 1FPTH 2ATPA 3C8KB 5D1ZC 4Z0XB 2R8SH 4WIQA 4NCDA 1UZ6F 2AGJH 43C9A 1RZ7H 4K8RH 3RUGB 2VN4A 1DQDL 4P2OA 5ADPL 1G6RA 4DGYH 3VXPB 3STZA 5EU7E 2W0LA 2X6MA 2X4OA 4TPRL 5MENE 3L7FA 2UWEB 3O2DL 4Z0BH 2X9XA 4R7DB 2EEBA 2AEPL 3T2OA 3BAEH 3RWFB 4PJAA 4LL9A 3ILQD 4OFVA 2CK0L 5MEPB 3VG0L 4JRXE 5EOCJ 5I8KH 5K59E 2PYEB 3QUMB 3QHTC 4U49A 1PG7X 2BCKA 4X6CF 1GOFA 1NL0H 5JR1H 5IBUG 1QTYT 3DECA 2C7UA 1TNNA 3TC9A 2PNDA 3RAJH 1A6WH 5BW7C 4HHAA 1QOKA 2X09A 4KH2A 4XPFL 5C0DA 4CAGA 3QCUL 1QRND 2Y9RT 1IKFL 2FRGP 2PN5A 5DTFB 4OI7A 1UVQA 1DE4A 1UXSB 5JZ7D 2RFXB 1G7PB 3N0PB 2D7PA 3NOIA 2QQKL 1F6AB 4KI5F 1KCUL 3U6RB 5JIKA 5CWSB 2WWMC 2BDNL 3NIGF 1MY5A 5J3HD 2MQ3A 4K07A 1XH3A 3PF2A 3BOVA 4N9OB 4XP4H 1NUDA 3SDXF 3UDWC 1FZMA 5D7SL 3IDIA 3TA3C 1BD2D 1MRDL 1QR1B 4S10A 3EOAA 5ANME 2OJZH 4Q0XL 1ACZA 1P7QD 5JW5B 1B3JA 2YPLD 5ITBH 4IOIB 2XTJC 5CS7A 5HHVH 1PX4A 4FFWD 4LCWA 4X9IA 1WFTA 3RY4A 5KTEL 5DJCB 2RIKA 2VLRD 2V9TA 3JSSA 3MR9A 3PWNB 5F9OL 2IPKB 4N8VG 1KCUH 5C0CE 4JHWL 1BWWA 1EERB 4UB0H 2Z31C 4ODTH 3GHEL 3DYMA 1DQLH 4X98A 2VE6A 2VZTA 3SCMC 1WWCA 3OWEA 3KLDA 4HGMA 3H9HB 2H32B 3NA4A 1CBVH 4YDIH 5EUOB 5E4EC 5SWQB 3NGBB 4LGRB 5TE6H 4JO1L 3MYJB 3TWCL 4D9RD 4BQ6A 2JELL 3SDAD 1PG7W 1A9EA 1DQJB 3EYVA 2Q3ZA 3OKOA 3V6OE 2C3VA 1M71A 1PAMA 2OL3H 4YDLB 5J6GB 2DOCA 4LVHB 2C5DC 4OD1L 1W2KT 4QHKI 4OZHA 2BVPA 4OZ4B 1CLYL 3LIZL 1KEMH 1CR9H 5I8EA 1F97A 5I1KH 1ZGLP 4N8CL 1FDLH 1EAPA 3KG5A 2HLFD 4OFPA 1AQKL 2NY6C 1P5VA 2ZCKH 2NZIA 5ADOH 1J5OL 4WU5A 4ZXBD 4FFYH 4DZBA 3UPRA 1ACYL 4WW1B 1DVFB 5JQ6L 3MV7B 1YEFH 1KIPA 4PTTB 4PGCA 2QHRL 4KY1L 4N0YL 5I6XC 2QKIB 4TSBH 2EDKA 3PHQB 5C0JA 2WANA 1FVEB 1BOGA 1YN7A 4QHNA 4NC0B 4JDVB 4I0PC 2ZUUA 3ARUA 1WBXB 1KNOB 3NIFE 1XCQA 4ELMF 4Y16C 1XGUB 3OKNA 3D87B 3MROA 5C9JA 5E08H 1JK8B 1ZAGA 4LPCA 4NKIH 1OLLA 1QKZL 4E9LA 4Q58C 2HRLA 4EI5C 1YPZB 2BNQA 5KS9B 2DJ4A 1FH5H 4Y5XB 4DAGL 5CJ8A 5IB2A 3CFKB 1EGJH 1DSFL 4FA8A 5HYFA 1JGEA 3O6KH 1JCKA 4XPBH 32C2B 3L5JA 1RSFA 3IF1B 3LKOB 3RWCB 3O9WA 4LP5A 1GCFA 1JZ8A 1LO4H 2E8YA 5D7JC 1TJIH 5FIEA 5I74B 2NXZC 4OCXH 2BVQB 2PO6A 1VDGA 4LCUB 4K3HA 2EDRA 3BIAX 4OLWH 5CILL 4HK0A 4OZFB 1IEAA 5CGYD 3V5HB 4PRHB 4PJXE 3EYSL 1JVKA 1E4WL 4L9LA 4HH9A 1YEKH 3CSGA 2X4QB 4UQ3B 3DMMA 2GY5A 3U9UA 4PJFE 4KZEH 1ODAA 1G9MH 4I8DA 2OLDA 3DYOA 2GYSA 5ADPH 1UWGL 2VDRH 1UB5B 5E2UL 4WFHD 5D2NC 4R2GD 4LKXB 4NO3B 2WUCL 4LEXH 2A6JA 2I25N 2DQEH 5DF0A 3U0WH 1ED3A 7FABH 5AWNL 2I9TA 2AEIT 4ZS7L 1CL7L 4ONGH 3MCLH 4JAMA 4KK8C 2J2ZA 1GGTA 3OZ9L 3QEQB 4PRBA 4HWEH 1OTTC 3PL6D 3BN9C 3QAZB 5ILTL 4E41A 1HHKA 2DTML 4PJGB 1MHCB 4XCEA 4YE4L 5D6CB 5I2IB 4KKCC 1NC4A 4MHHI 1U36A 4OCRH 4ODVH 4PJFF 4CUCA 5DJZB 1DBMH 3GM0A 4HWZB 1GVIA 2OR7A 2APFA 1IM9B 1CL7I 4OQTL 2VDNH 5HYEA 1V8HA 1MLCB 3HE7D 3G6AB 4P46D 5ALCH 1ZA3A 3RY5A 5I1HL 1A6ZA 5K33A 3RWHB 1GIGH 2VDPL 1QFHA 2V2WA 3RWDA 1JHKL 3QUXD 1I7ZA 1T83C 3SGJC 3ROLA 4WV1B 4Y2OA 3S5LG 1H9VA 4AENA 3H7BB 1A6UL 1T0MB 1ZHBA 2P5EB 5HYJD 1CGUA 2BSSA 1ZLWK 1NFIA 4G7VL 2NLJB 2X4TA 1MCBA 1F4YH 1TTFA 3RRQA 1NAKL 4NQUA 4UOW0 4F58L 3A6OA 1YJDL 3DV4A 3MODL 4DZ8B 3QEHB 3D85A 3MV8B 3QQ3A 4PJBA 4KWUA 5DRNA 2EO1A 2EYTB 2ZUTA 1MUJA 2DQDH 2R15A 4HX1A 5DS8B 5HYIA 5FCSH 3ESVF 2VISA 2WNGA 5C6PB 1SJHB 2XI9A 4DVBA 1XT5A 4G7YH 4NO5B 2W9EL 2Y7QA 2D4DA 3CFEA 1MAMH 1NBVL 4ZOAA 3V6OC 4JCLA 4O2CA 1TPXB 5KSVB 1LDPL 4JFFE 3PQYE 4XI5D 1LP9B 4I9WD 4RGND 4WUKL 4Y4KA 1LK2B 3BKYL 1UKSA 3VGHA 4FFZH 5I75C 3FQTA 2J6EL 1TVHA 1IGML 1WVZA 5HHPB 1C5DB 4NQEE 5D6DC 4Y4HC 5KVMC 1CFSB 4JQVA 3TFKD 4QRPE 1WCBB 3OPZH 4IRJB 2DQTL 4F7EA 1TCRB 5INDB 4KV5F 4C4KO 3NN8A 3X11A 4LVOB 2ERJB 2VZVA 3GI8L 4U0QB 35C8L 2V5RA 4MJ2A 3PE9A 3P11H 3U2SB 5E6IA 5EO9A 1OP3H 3G6JA 3ET9F 4FQXA 2YD2A 2MCPL 1LDSA 3RDTD 5I66B 3LIZH 2BOBB 1CG9B 1FL3A 2YMXH 4U1SB 3MJ9L 4B5EA 3F6LA 5E8NA 1EPFA 2EIEA 3EYOB 4OZHF 3UX9B 2WIIA 2VXUH 4JFEE 1BVKA 1BLNB 1BQUA 3P4LA 2VDLL 4HXBH 5BZWB 4UU9B 3O4LE 5F1SA 3BGFB 1YYMH 1WSST 3QWOB 3BKJL 4IOFD 4PD4J 1IGIL 2NPLX 3T2NH 3V4UL 4FQHB 4MNHA 4WDIB 5JNYA 2M2DA 1IM3A 4MNGE 1NMBH 4NZUH 3SKUD 4B7LA 2D2OA 4KDTC 4KKBD 5ACZA 2VLKA 3ARBD 3E6FB 5F97E 2XV6B 1NBZB 2ZSVB 1OARL 2HFEA 1DQLL 5GGSB 1ZLVH 2IC2A 2Y72A 4ELKB 4XZUB 4NWUL 1MFAL 4L8SC 4NCC2 5HGHB 1XF3B 3RHWF 1JFQH 1WAAA 4IRJD 3JV6B 1DQMH 3HE6B 5DMIH 3QZWB 3I6KB 4TULL 4K7PH 2I27N 5GSRA 1KB5H 5E99H 1B4RA 3HRPA 4GLRI 5JXEA 3FQRB 3SKMA 1KPVA 5B3JE 1CE6A 5F9OH 4Y5VB 3BGFC 1DE4B 3OJMB 1XIWD 2HJFA 1G7PA 1R24A 1OSZB 5D96B 3U1SL 2A9MH 1EXUB 3O8XB 1KLUA 3OKLA 3VMOA 5D72H 1A7RH 3LQAL 3HNTH 1TFHA 2C4FU 3VWJB 5ESVA 1G7QB 4XNXH 4XP1L 4P4KA 1QSVA 4HUUB 1LO3H 4DTGH 4JDTL 3I9GH 3O81A 2IAMC 1HSAA 4WI8A 1WWBX 4JHZA 2VNCA 1KTLB 4QRTB 1D5ZA 4J3VA 1R3JA 4Q9RH 4M7JH 4FQPA 3ULVH 2ITDA 5EZJB 1TVBA 1MF2L 1B4JH 5EOQH 4PJAF 4XWGL 4LLQB 5B8CC 5H94B 4DK6A 3KS0J 3NCYP 5FF6B 1OTTD 2ZUXA 1T22A 4UNUA 3G08A 1CXKA 4MAYC 4PJ7B 1RUAL 1BWMA 4XMKL 3MRJA 3EOBB 4MSWB 4HPYH 1N2RB 3ULSA 1RZIB 4C56D 4LCIH 1EK3A 1NCBL 2SEBA 4N90E 2DMCA 3SGDI 4HW6A 4FN0A 1UC6A 4X98B 1X5LA 1Q94A 3PDGA 5L0QB 4KY1H 3KDMB 5C0RH 5E8EA 1JGLL 1MJJB 3ARZA 7FABL 4WWKD 2GSIB 5I1LA 5FDWA 1J11A 2EZ0C 2IH3B 2RJMA 3SDXE 1N5YH 3O2DA 3MRKB 1T89C 1S7WA 3MYJA 4IBLT 3S3SA 3RIFK 1NGXA 1TJIL 1C5BH 3LN4A 3DVNA 4P3DA 4OJFH 5B3JF 2AW2A 3MGTB 4OAWA 4U1GB 5F1IA 3O6FA 5DMGD 1RZGB 4FP8L 1NMAH 4NQCB 4U7KA 4OBRA 1GIGL 2IF7A 4IRSB 5JLZB 2VLJB 1QBLL 4L3EB 5IF0B 3TO4C 4PD4K 2VDKL 1F90L 4KKNA 1QQDB 4TSCL 4F37K 4XB8A 3EYQC 3DVIA 4MDIA 1I7UA 2DWDB 5EFIB 3JV5A 2QTEA 2OZ4L 3MRQA 3TBSA 3CZFB 5T3XL 3LMJL 3UTTB 5AZEH 2AJVH 3HC3H 1KIPB 5LWYH 3RL2B 2H26B 4K7FA 1EFXA 4PJXF 2NW3B 3VXUE 4BQ8A 2B0SH 2X4UB 4ZPTB 3GUTA 1MWAA 4FQIH 1BOGB 4IM8A 2EDOA 4MMZC 4HF5L 1TQBC 3VXSB 1E6OH 2W9LA 2J6EA 4RX4D 2VC2L 5DJDA 2OTWA 1NCNA 1Z2KA 1HH6B 1AE6L 5TE4L 1MHEB 3WFHA 4HCRA 2F19L 5F7KC 5CIPB 1MF2H 4EUPB 3MROB 2BNRE 1QBLH 2ESVD 1JK8A 5I8CB 1CE1L 5CBAA 3FQXB 1CU4L 3GJFK 4NN5C 2IBZX 2E27L 3OHXA 4X7SH 1WUNT 4H25B 4ERSH 3SE3C 2X1PA 3QUYA 4LLDB 3CFKA 4TRPH 3B6SA 2HJKB 4Y2DD 1XR8B 3FN3A 3QNZA 5IT2H 2QQNH 2JIXD 3MUGA 1FYTE 4MD5A 4PGDA 4HWUA 3ZDXF 4O2FA 4MCYB 5D9SA 1MFDL 3K1KC 4JFQB 3VWKD 3MV9D 4U1JB 3IDJA 4JREB 4POZC 4MS8C 3LQMA 1OAQL 2Z91B 3NIDE 4X4YB 3BO8A 1K3ZA 4I0PB 1UADC 5DHYA 4DGVL 3CXHJ 3DOSA 4F15B 3V5HA 5CMAA 2IPUG 3GMOA 1J18A 5GS0H 4JGMA 1LMKA 4YFEA 3O9WD 2YD4A 1U8KB 4V1DA 3MJ9H 4L29B 4LHJB 2ZP0T 3ARBC 3ZDZF 4HS3A 4MVBD 3CC5A 4GAGL 4OM1H 1J87A 2YD8A 4HSQA 4KJPC 1MCJA 1R5VB 1LO0H 3PJSA 3BPLC 2IMMA 4OB5H 4XNUL 2LU4A 5GGTH 2A6JB 2PXYC 2XICA 5EBLB 4FXKA 1PEWA 5I8KL 3RY6C 1MRCL 4CVZA 2GITB 3E6HA 1WEJL 3QO0B 5EPMB 3LKRB 2VR4A 3MJ7B 4LSQH 1IGJB 5F9AC 3G5ZB 4YPJA 3CIQA 1KC5L 4ZOCA 1P84J 3CJJA 2FLRT 4PJHB 3MFGB 5JMRA 2QL1A 4Z78B 3IKKA 4M61A 1YMHB 2WBKA 2HH0L 3ULUD 3LKQB 4EI5D 3QUKA 1Y18A 1OPGL 2CLRB 3GJFA 4PUBH 4WUUE 2DBLH 5C08B 1BGXL 3TA3D 1DSFH 1Q9KA 4DVRH 5EOQL 3OB0K 1ZA3B 3G5XB 4P23D 4DGYL 4M7KH 4RISL 5EO0B 1WIOA 3NFPB 1E4KA 1B2WH 2OSLB 5BS0B 2DLGA 1I7ZB 3FN0H 1FYTB 5ID0B 1L9NA 3MLWL 4M7LT 4JRXD 5E6ID 1ZHLA 4L8CB 4MB3A 1F4HA 4XI5C 4M00A 3ZE2E 3K4ZA 4F3FB 2DRUA 2BSSB 4YFLF 3UZVB 1CTOA 3OF6D 4WO4C 4BZ1H 4JDZB 1MIMH 1RZKC 3V95A 1IAIH 1DN0A 3CPLB 3O11A 4TQEH 4XP9L 2AEQH 2GT9B 1CXLA 4HUXB 5E95B 5BXFA 4JM2A 1T21A 2W0PA 4P2CG 4FOMA 2EYTA 1DBBH 1MUJB 1HWHB 2NY3C 1I7TB 3U4EB 3BW9A 3HI1B 2V7HB 3N1QC 1W72A 2F58L 2Q76B 4R8WH 3OJDA 1U58B 2I5YL 2VZOA 4ONOA 3B9KA 5I1AB 1BP3B 2F53E 4XNZB 1EIBA 2H3NA 5T1KA 1RZFH 3L9RA 2RAMA 4QHMA 3B2VH 4CBPA 1FG9C 3C5JA 2CKBB 5DQDH 1C5CL 4NWTH 5IESL 5IROA 2IJ0C 3TN0A 2GSGB 3ZT6A 3CUPA 3S35X 5E5MB 2DAVA 1RQ5A 4HIEA 3PQYA 4AEHL 5C0CA 3V4VL 4WI6A 3RNKB 4Y5YB 1JF1B 3EAKA 2N7BA 4X5WB 4K2UH 3QAZC 5BQ7A 4MJID 4GAGH 3EYQD 4JKPH 2P48B 3FB6B 4GRWF 4L3CB 1SMAA 4KU1A 3RWIB 1NEZA 4ODUB 4XPBL 5CINH 4B7IA 1FZOA 3GNML 5JHDE 5E6IB 1JP5A 3I6GB 4JPIA 5ANMA 1NCWL 2H2PD 3OXSA 3C09B 2DLHA 3SGDH 2ICEB 1D5BA 3QEQD 1WZLA 3C60D 3L3JB 2WK2A 4PJIF 4Z7OF 1KF9B 1CD1A 5IBUB 3ZHDA 1XGYH 5IVNA 2WIIB 4S1QL 2XN9B 2DM2A 1GZQA 4D0CB 4U1LB 4XXCA 1A3LH 3GMPB 3IU3B 4ONGL 4X7TB 1NGYA 1IM9D 1WZMA 4HLZG 4NO0B 3RDTB 3OAYK 3ARGB 4R3SA 5D2NE 4WDIA 1EEYB 4ONHB 3GSXB 3BKMH 3KYKH 4HXAL 4D94A 4KROD 3O41B 1KOAA 4JFHE 4ZUUB 3ZKND 2DYPD 2R4SH 1J0ZA 1UWGH 5JDJA 1KLFA 1NBZA 5GJTH 1U3HC 5FCUH 1K4DA 5J13B 1JPSH 3U0PA 3BDYH 1NBVH 1AHWB 1PKOA 1SJVA 1GPOH 4G6JH 3RNQB 4P48A 5E94A 3UJTH 3W0WD 4WFFD 4M8QA 3GSVA 3P4NA 3EKCA 2H9GA 3WV0A 3BH9A 3EOTL 3VE0A 1D7FA 4RMTA 4XMLH 3U4BH 3VRJB 3MRLA 1IAIL 3GM8A 4MB4A 4Y5VA 3RFZC 4FQ2L 4RX4A 3PNWB 3R0NA 3LCYA 4FTVD 1P7QA 4YJZL 1OSZA 3FZUC 3BZDA 2VAJA 4LHUB 4YXLH 4G8FB 3D2UD 5I73B 4HJGA 1EXUA 3O8XA 3QEUB 5I15L 5F3HA 1F4YL 3PWUB 5H37G 3LS4L 4TUJA 3LZFL 1CYGA 4TTDC 3HMXH 3FFCD 1RZKL 3A6CL 4KXZH 4P4KB 4X8JA 1HSAB 3QIBD 4PJEF 1ULVA 3VD7A 3D9AL 5IFJA 5IB4B 3ZDYE 1JHKH 1KTLA 3D2UB 1I3VA 2EZ0D 2FATL 3IDYB 1EZVY 4Y19A 1H3PH 1KV3A 5EWIH 5MHSE 4XBPA 4XC1H 2H41A 4PG2A 1IEHA 3CNKA 2ITDB 1QSED 5EZJA 1JYXA 5TJWK 4G3YL 3S34H 3IAPA 4LLQA 4N1CA 4YXKH 6FABL 2ZUQC 3F12B 5JORB 1QRNE 2XA8L 3O6LL 4XNQA 3VA2C 1HOCA 1TETL 5CD3B 1OT2A 3FO0H 5E8PB 3KPOB 1N2RA 2VZUA 1K8DA 5L2JB 1A7PH 4LVEA 4ZXBC 2E3VA 4KMLB 2NY5H 4OIIL 1QFWM 2ENSA 5HGAB 12E8H 3GBNH 5L6YH 3OPZL 3BQUB 4R7NB 1Z3GH 3EDDA 5JPMA 2ZUVA 4MA7H 5IGXL 1I3GH 3D39B 3GSRA 1CICA 2DQGL 1LP9F 1YN6B 1OT1A 1RURH 4HMCA 3IT8D 5ELIA 1VFUA 4M6NH 1FORL 4JY6B 5DDHB 5FDWB 2B4CL 1DQML 2E7HA 5EU6E 4GG6B 1LK3L 4U2YA 3MRHA 4HKXA 1AD9A 4MXVF 5IQ9A 4UUJB 2XQYG 4P5TC 1DBML 3HZKA 2X40A 2JCCB 4K3JH 4N68A 4PRPA 4YC2B 3LHPH 1HCVA 3RX5A 5FEBA 3O6FB 1LD9A 5I76A 2DI8A 4PRNA 5KVFH 1YEKL 3MV8E 4UIKH 2HFTA 1EEZB 4WU7A 5J1TC 3RVXD 4YZFF 2JJTC 2VZSA 1QQDA 2XY1A 2AABH 3QUYC 4ETQA 2AK4A 3IJYA 4BSVA 4E0RB 3OL2A 1YJDH 3IFPB 3KPMA 1F90H 1LP9E 2LABA 1ZWIB 5CGTA 2WUCH 3MRQB 2E5EA 3ARYA 2CJUL 2EYRB 3K8KA 1RD6A 4TVSa 5HVHC 2DM3A 3BH8A 3GSWB 1KGCD 5K59F 4JLRB 5DC4B 4I2XB 1CFNB 1YQVL 5CZXD 1FGNL 2X4SA 1RY7B 2DQIL 1BJMA 3SDCA 3KPSB 4G6ML 5T3ZL 4Z7QF 4U1HB 4D9QE 5C0BD 1I9IH 5JXAL 4M7LH 5DMIL 1BBJB 4FZ8L 3V0WL 2OR9H 4NQDA 1BAFL 3HI5H 4O58L 4PP1D 1EFQA 1CS6A 4Z7WF 5GRJH 3SQOL 5KSAC 2J8UA 3OHXB 4H25A 1C5CH 1HH9B 3U36B 1U6AL 4PRID 4NQTA 3BPOC 1M7DB 1YECL 5FUOL 4PY7B 5HY9A 1FO0B 3SO3B 1DR9A 4MD5B 2D9CA 1M1SA 1NBYA 2VUYA 5KVEH 4N0UB 1O0VA 2WMPA 4CVXB 3NCJL 3IDJB 1AR1C 5J12B 4NNYB 4DEPC 5DXWA 1I9IL 2EECA 3V7AE 4RAVB 3WFDL 4YHZH 2AI0H 4Q9RL 1FNEA 4LU5L 2F5BL 4X8XA 1NQBA 1B0GB 5FCUL 1I7RB 2HH0H 3JVGC 4C56B 4C55A 4KKLD 3V6ZB 4UMGA 4WUUB 4J3UA 1CIDA 4P59L 2E9WA 3B43A 3HNTL 3LQAH 4I13B 4IRSC 5JQHC 3SN6N 4P2RD 5DJXA 1VERA 4G5ZH 1FNSL 2A1WH 2NY1D 3DX7B 5K9OA 3UZQA 3M8OH 3CZJA 5JHDD 1PSKH 2MCG1 5SX4I 5DUBA 4XNMB 1DP0A 2OI9B 1ADQA 1KIUA 4EUPH 5ITFA 1EZVX 4LOUC 2VDPH 4CVZB 1I1AA 4BJLA 3NFSL 1IGJA 5D1ZD 4X6BB 2NY1B 8FABB 5T1KD 3HE7A 4P46A 5C71A 4PJ5E 1JZ7A 5IV2A 3SPVB 5IWLA 2WINA 2NNAB 6CGTA 4K9EH 2R8SL 5ENWA 1J1PL 4WJ5B 3MQIA 2VH5H 2UVEA 5E2WH 3QFJB 3MLVL 4L5FH 1H5BC 5EU4A 4CN6A 4Y16B 3QXDA 1LE9B 1I8LA 1U92B 4AT6A 2DQDL 2FD6L 3G5XA 4CDGC 4PJ5A 1XGPB 5SWZA 3MRCB 5E6YA 5EA0L 1TDQA 3CX2A 3KPRB 4JFOB 4JKLA 1MRDH 3F8UB 2WWKO 4KPHH 5IESH 5DJ8A 2D0FA 3LKSA 3P0GB 3DYPA 4NZJA 1ZVSB 2X4NA 3U1SH 2AK4E 2BVOB 2B20A 4UILH 1U8LA 4RWHA 4KFZC 3LSOB 4OZIE 2LVEA 4GRMB 3GHBH 1XZ0B 2AJ3A 1BVLA 1DN0B 3CPLA 1ZS8A 2NX5A 4O2EA 2VXVH 1ZOXA 3EW3B 3RU8H 1ZEAL 1ES0A 4JFPB 5JUEL 5DA0B 1EHLL 3TEUA 2HFFA 1AGDB 3BP5A 1QLRA 3ZT5A 4MCZB 3ARFA 4F7CB 5EO1B 4JG0L 3SDDC 2GJJA 3C2SA 3MRDA 2IEPA 5FKAB 5FO9A 3TH2T 1VGKA 3JV4B 1NH6A 1U58A 1EHAA 3EUUA 1BECA 1A2YB 4JN1L 1A6WL 4PTUA 4IHOA 4QTIL 3OAUH 3T3MF 3BRFA 3EJJX 3PDOA 3FHAA 1JRHH 5ICXA 3JXAA 1LEIA 2H3NB 1Y6KR 5T1KB 5KVFL 2FBOJ 1UM4L 4MJIB 5HHNA 3S34L 1BFSA 1L6XA 2P24A 4JHAH 2FL5B 5DD5H 4LLWA 2GSGA 1MEXH 4YNYB 3HG1D 2FB4H 4GW5B 1I85A 1MIEL 1JJUA 4HIEB 1F3JA 4M6NL 3MREA 4Y5YA 3UCRA 1JF1A 1RFDH 3TIDA 3VGDA 3VFPB 5KANI 4XNYH 2EH7H 3DX6A 1IT9L 4EOWL 2VMFA 5JPNB 5HYJB 4L3CA 2LV4A 4OCYL 3RWIA 4MVBC 4ODUA 3S36L 3ARPA 4U05A 5MEQA 5EU6A 5H35B 2KQMA 2PTVA 3I6GA 3WD5L 1AKJA 4DKDC 1W0WB 2HKFL 3HNVH 4MD4B 2JTDA 3BSZH 1D5BB 3JZ7A 4LVNB 1CICD 4ZO9A 2CPCA 4APQC 2X4PB 4ZD3H 4MA8L 3ULUH 1A7NL 4L1DA 5TPWH 1FV1A 4LMQI 4W70A 3SDXB 5I1JH 4AMKL 3RWGB 1GZQB 4JCMA 5DUML 4MZ2A 4DCQB 2AK1L 3IU3A 3BPCA 1RFDL 5DI8A 1CN4A 5E2WL 4FHBD 3AU1A 5DD6A 4EJ1C 1M7XA 1OB1A 4ONHA 4EOWH 2F19H 1KUMA 5C0BE 5SWZE 2E7LC 3HR5A 2ZOLA 4P5TB 2EXYD 3BHBA 5L9DL 1OW0C 5JOPD 3UTQA 1OAZH 1AXSB 5EOTB 3KR3H 5HD8D 4Y5XC 4HT1L 2NXZD 3TGXA 1VADB 3OKMB 4EXPX 4ODBD 5LVEA 3FL7A 1INEH 1AHWA 3CAFA 2EC9T 1F8TL 5E94B 3H42L 3GIZH 3PGDA 4JGUA 1DQQA 1EJ6A 5GQBA 3FMGL 2A83B 4NBXB 4Y0GA 1UH3A 5JW4M 5DEZA 1BAFH 4P4KD 2BNRD 3HMWL 3U0WL 5HDOA 4G7VH 1OTSC 4TSBL 3DBXB 3PNWA 2MHAA 4IMLA 5CKGA 3RU8L 1QFUL 4YHNA 5HHXH 1QHPA 4G8FA 3BAEL 1T66C 4O02L 4R4FL 5IFAH 3L3DB 4RFEB 5ICYB 1OF2A 3I50L 4HPOH 2AI0L 4WHTA 3IDXL 4PB9H 5DRZA 4OLEA 1A21A 1KBGH 4R4BB 1PY9A 4RGNC 2CIKB 1HHIA 4JY4A 4CU6A 3QUZD 5GJSL 2ZCLL 4QHUA 4HF5H 5GS0D 3KPSE 1IKNA 4XBPB 2WBJB 2QJDA 4V2BA 3I85A 3IFLH 3C5ZA 3B2VL 4WWKA 5D1XD 3RZCA 4X7FC 4F15C 5A1AA 4JY5L 5JORA 2GFBB 3Q6GH 1FCGA 3RA7L 5AUMB 3VXPA 3S4SG 4M48L 3ARWA 4QHLB 3OG6B 5FOJA 3WS6C 3L7FB 4XPGL 3UTOA 4EDWL 3QRGH 4DN3L 1QD0A 2HG5A 4W6YB 4HG4K 4PJ7E 1BZ7B 2BOCB 4PJ7F 3V4PL 5FGRA 5JPMB 5J12C 1GGYA 4HV8B 4OF5A 1WT5A 1CGWA 2QADB 2YEZA 3O6FD 4YAQA 3GSRB 1OPGH 1CICB 5GZND 4U2ZA 3AGVA 4X7CC 5FV1L 4HDIA 4MD0A 4RGNB 2YN3A 3RL1A 3WIIL 1E4XL 4S2SB 2R39A 5FUCE 3VXNA 3FFCE 4UUJA 4QY8B 4PRDA 5I1IL 2Y07L 1GZPB 2ZUYA 1P6AB 3BYYA 4NHUA 5CEYA 4HHAB 2NY4B 3V5KB 3DTXA 3CK0L 1JWUB 4CN4A 3B9EA 4RRPA 3BKJH 3S3JA 1S7RB 3MSPA 1EBPA 3P9MA 4FTVE 1MH5A 5DR5L 5C8JA 3K81A 2OI9C 3TO4D 5EU7C 4KDTA 1X5YA 5EU6D 5IHZB 5JO5A 3KPMB 4KK5C 5DHVB 4R4FH 4WVRA 4WFFE 5HDBF 4JR9L 3BVNB 3DROA 4CDHA 5I19L 1MFAH 3O3EB 4PBWD 2ZG3A 4FTVB 3CXHK 3IDIB 3GSWA 4HULB 4JFFB 3H0TA 1YEHH 3KJ4B 4LSRH 1N0LA 4UAOB 1RU9H 4U1HA 4H20H 4PJEB 3O6ML 2E9BA 3IRZA 1B6UA 5FYJE 5TPWL 1IC7L 2NTFB 5KAQF 1A1MA 4KI1A 4KK6C 4XMLL 5CP3H 3QIBB 4FABH 1H3GA 3PXHA 4LLYA 4F7PA 2VDLH 3PWNA 4UQ2A 5J56B 2DQCH 4JN1H 1A64A 3HB3C 4R97B 1PBYA 2Y25A 3MNVB 4ZAKA 3P30L 4AEEA 1HNFA 1T1ZB 1HHJB 1X44A 4ZUTB 4P2QE 1QSEA 4KRPB 3SKJL 1CD9B 1IGFH 5F1OB 5EB9A 3MV01 4CVXA 4V1DD 5SWQA 1PGRB 5FKPB 1I9JL 1DBBL 2BNQD 2Z92A 4L3ED 3RVUD 2X1QA 4Y4HD 5IQ7H 1LQSR 3AS3A 1MCPL 3ESUF 3L1OH 5BZDA 4QXGH 2OX5A 4KJWD 2AEQL 3GRWL 1A9EB 1DQJA 2Z0BA 4XCFL 3EYVB 3B8SA 3MLTB 3QPQC 1GAFH 5B38A 4WUUA 4ODXA 4Y88A 1L0QA 2BVPB 3U0TB 1JPGB 1WK0A 3GIZL 2EXYC 2FD6H 5I8EB 3W81A 4PJAE 2P45B 2NTSP 5DJXB 2VDOL 4QRRB 1E4XI 5BMFH 3DX7A 1GGBL 4L8BB 1GGCL 5A43C 4GQ9L 3D9AH 4XNMA 1BZ9B 2G60L 2Y5TA 4WW1A 2CRMA 5F96H 1U8IB 3GSUA 5IG7B 1Y0LB 5EZIH 1DDHB 2DQIH 4WFED 3VRIB 3VFGH 4KHXH 1CQYA 5JMOC 3HAEA 4X6BA 3BZ4A 5C07A 1HHHB 3PXJA 1HILA 4NQED 3P0YH 4PREB 2XWTA 1QYGH 1KNOA 4HAGA 2NY2D 1XCQB 1R3KB 5ENWB 1XGUA 1U2CA 3IGAA 5DGQA 3S97C 5C9JB 5GXBB 2R69H 4QRSB 1SMOA 4D0DB 3GJEA 5TF1L 4RA0C 2NX5E 2B1HH 4YIQA 4DGIL 4CL7A 2DKSA 3FMGH 1R6VA 5GGUB 1X6LA 5F70A 2ARJB 4BH7A 5HI5C 2XY2A 3WJJA 3IKCB 2ZSWB 2VXUL 5SWZB 1HI6B 2RCSH 5MEOA 3S36H 1I3UA 32C2A 3FO1B 4G8GB 4HWBA 1H3VA 3PIQB 2ICWI 5FB8A 1N3NB 5D7KE 3LKSB 1U41A 1I8IA 3UXFA 4EN3A 2EEDA 1YMME 3MNZB 3VXRD 3TJHC 3IFOB 2Z93A 3HUJA 1EJOH 5C0GB 2BSRA 4GRMA 4QXUH 3VU2A 1IFHL 4N0CC 5D8JH 2G5BB 2YPVL 1QLRB 4XHQA 3V4VH 3HNSH 1WLHA 2WP3T 4MCZA 4F7CA 4XHJC 4PJGE 5GRUH 4F7TA 3BRGC 2P42B 1P4LB 4YK4B 3KWWB 2ICES 4Y4FA 4ELMB 1A2YA 4PTUB 3QI9B 5LGJB 4IHOB 4JZJB 3I3EA 3PDOB 4DW2H 2XQBL 4G6JL 3QPXH 4NZTL 5BRZD 2XA8H 1EDQA 4LQFL 4MJIA 2VN7A 5EOCH 3QWRD 2FSEA 5E2UH 4JR9H 4MNQD 2O26U 1TZIA 2CDEA 4F7MA 3UYOD 3M17B 2Z31B 5CGYC 5CCKH 2VXTL 5TGBA 5C0AB 1OTUC 4K55A 3X3GL 3QEQA 3MRBA 4PRBB 4HUKB 3ZYOA 5GRXG 1JZ2A 4DKEL 5BS0D 4I48B 3UMTA 5DQ9A 4UV7H 4JEGB 1P4BH 1QFUH 4TQEL 2MJWA 1XIWA 1DBKL 3PG2A 3FONA 3ZYJA 3S36X 4OCRL 4ODVL 4N8VB 2AXHA 1QBAA 4P59H 3SDYH 1JNJA 1YMMD 1X5IA 3ARDB 3MV9E 4PJCE 3TLRA 3CH8A 1BX2B 1F8TH 4UZGA 4LSTL 5KOMC 1EHNA 4MD4A 3W9EA 4FMKA 2YUXA 4LDOB 2VIRB 4M3KB 3O3AA 1NCUA 4PG9B 1Z9SA 3TCXA 3DHJA 5HGDA 3V79C 1CF8L 4L8DB 4RZCA 4U0RB 2R2HA 2P5EA 1IAKA 5B8CB 5HYSB 1X5FA 3BISA 3VGAC 3B9KD 1KEGL 3MXWL 2FHFA 5I8OL 1KJ2H 3QQ3B 5BJTA 1KCSH 4XP1H 4LLVB 3WYRA 4D0BB 4GRLA 3I3BA 2Q6WB 1FBIH 3PWLB 4HS8H 1QBBA 3RIAK 3OAUL 2CDGB 5I18L 3QZWG 4Y4KD 2OMBA 1FC1A 5GJSH 3RWEB 4TSCH 5SX4H 2F9BT 1F11B 5E9DB 4IIQC 5I0ZA 2F74A 3UYRL 1F4XH 4YR6B 3VXSE 1EGJA 3VFUA 4YHKH 1BM3L 5CHNA 1RUKL 4EIZC 1OAKH 5CP7A 1RK0A 4KGLA 4Y4KB 3QULA 5E6ZA 1Z5LA 3K2UH 1TVHB 1XR9A 3MC0A 3QJHA 4Z95H 1E6OL 3RZWA 3KPRE 3WFDH 3NZ8B 3TH4T 1ZVYA 4Y19D 4N0UE 1FSKB 4IRJA 3AMKA 2A73A 4FQXD 5I74C 3RIAF 1V3MA 3LRSA 4RFEA 1VFAB 5DQJB 2FJGB 4P23B 5TE6L 4FQIL 2LU3A 4U1NB 4L3EE 5T5FH 2NY6D 4YFLI 4UNVA 2A0LD 5FOBA 4V1DE 1KTRL 3TJHD 4GW1B 4MX7B 4R2GB 3TT3H 2C3WA 1JF5A 1O5DT 2QR0A 4Z7WB 4JY4B 3VGFA 1LO4L 5IOPB 4LLMA 1S5HA 1JRHL 4O00A 4U3CA 3L3HB 3EGSB 5DFVC 3VFMB 4I4WA 3C5ZB 5C09D 4AY0A 4MS8D 3GDBA 5GRZA 1S9WA 3C9NA 3RZCB 2Q7NA 2HN7A 3HI5L 1S7XB 1BVKB 4APQB 1BLNA 3NIFF 1I9EA 3KYNB 3L5WA 1T2QL 5JW4R 4HLJA 4O9HL 4QHLA 2W91A 1ZEAH 1MI5E 5JUEH 2R9HD 2ADFH 2OK0H 4MNHB 5FYJD 1GC1H 2Q87A 1S7VA 2ESVA 1OD7A 3M1BA 4ZSOB 2PR4L 3G5YA 4P9HL 2MWCA 2ZZUT 2VLJE 3V8CA 4Q0XH 4YAQB 4OD2A 1S7UB 4XP5H 1LO5B 1AFVH 4PFEA 4YDVA 4ELKA 5AZ2H 3RL1B 4FS0A 2D9QB 5L7XH 4NQVA 5HVGB 5HYQA 4HCRH 1GZPA 1AIFA 4KKCD 4NHUB 2R23B 4J23A 1R5WB 2R2EA 1A1NB 1IGMH 3IJSB 1DEEB 4AJ0A 3FFCA 3DIFB 1UCBH 4OM1L 3T65B 3QDJA 1TENA 5EC1A 2HJFB 3PP4H 4Z7OE 1QNZL 3TO2B 2YK1L 3BD4A 4L9LC 4CRPA 3UAJC 3DMMC 5DHVA 5JOEA 3T0EB 5GGQH 4R2GC 3VWJA 1FZJB 3BVNA 3DROB 4ZFOA 1VHPA 5FM5O 5AZ2L 1RUPH 3P40A 4MA7L 5C09A 2C1PB 5CJOL 4UINH 1DBAL 1UJ3C 1FAIL 3AB0B 4X80L 2BNRA 4JFFA 3CVHH 1X4XA 3N9GH 4TOYH 5ITBL 3AREA 4IS6B 2BXYA 3U7WL 1HXYA 3QCTL 1KJVB 3S5LB 3VXOB 3SKNA 3PDDA 3OGCB 4OI8A 2H45A 2OTPA 4HGWA 1TVBB 2OR9L 4LSPH 5GZOD 2GJ6D 4I2XE 1KIQA 4Z95L 3C6LA 5FF6A 3GMRA 1LEGA 1FHGA 4WV1C 1OAYH 4F7PB 4WW2A 4ZO7A 3RPIB 5KG9A 1SVCP 1KIRB 3OKKB 1MFBL 3C8KA 4Z0XA 4RBPH 2V5YA 4GLRH 4GOSA 1PEZA 2AV7B 1KN2L 1KFAL 4FZEL 5M7QA 3ZE1E 1T1ZA 5BV7C 1I4FA 4ZUTA 3NAAH 4FQ1L 3STZB 5K9KA 1TMCB 1QSEB 2XRAL 4PJ8B 5K9QG 3KDMA 5E8EB 2UWEA 2VDNL 1N5AB 5KANG 2BVYA 4CNIB 3GIVA 5FKPA 1NSNH 3UJJL 4YK4C 1LEKA 3RWFA 5DJ6B 3CVIL 3LN4B 5DZNA 2OJEB 4OCLC 3UO1L 3V0VB 5I1GL 2MKLC 5EUKB 2VAAA 2JF1A 3U4BL 1IZJA 3MOBL 2NY4C 5B38B 4YHYC 3WXVL 4PGJA 2VLJA 3K2UL 1D5XB 4X6FA 5EBMB 3H3BC 1KFAH 5DEFB 1X5GA 5F6HJ 1I7UB 1JZ5A 1IAOB 1A6AB 3ROOA 2R1XB 3AB0C 1OD9A 3C2AL 3MLRH 1BZ9A 2ZKHH 5DD3L 1TJHH 3UTTA 4ZUWB 5IG7A 1NL0L 1SYVA 2KZWA 4P9HC 1KCRH 3UZEA 5IIEB 4X80H 1H3UA 5GHWH 4M9OA 3QCTH 5IJKC 2DTMH 4BSWB 4Q6IB 2CO6B 1WAAE 2P43B 1QLEH 4OFKA 4XMKH 3O2WH 3R8QA 3WJLC 4WUKH 2NW2B 4QRSA 5I8CA 4EDXA 4ZFZA 4Y1AD 2J6EH 2ARJA 1L4IA 4BH7B 3UROR 3QXUA 1T03L 4E41E 1KJ3H 4LLDA 5T5NF 1QFWL 1XR8A 4LCWB 4OLZH 2FX9L 5HPOA 4JFDE 2X70B 2X1WL 4O2FB 5F1KC 2OQJB 4LRIA 1VCAA 1OAKL 4KVNH 4HFWB 4OT1L 4ZS6C 4Z18A 2XPGA 4MQXC 3O3BA 1F02I 2CO7B 4K7PX 3D18B 5HXMA 4HMDA 1MCIA 4XBGB 4PJBF 1T5XB 2KKQA 1KC5H 2FEEI 5C0GA 2Y23A 3MNWA 4X4YA 1LE5B 2NY3D 5DHYB 4F8QA 3IU4H 3HAEH 3FO0L 1AGCA 5EC2B 4I1NB 2DLIA 1AC0A 3MLYL 5LXGH 1HKLL 3RBSA 3BQUD 4Y4FB 4L4VD 1FG2A 3CC5B 5I1EL 1Q38A 3OKOB 3WIHH 2QSVA 1VFOA 1M71B 1MJ8L 3VFRA 3QPXL 4NZTH 5CIPH 2KH2B 4OV5B 3WIHA 3V0AC 3ULVL 3SOBH 3QRGL 3LKRA 5C0AA 3IXTA 1MRCH 4TOYL 3QIWC 4JM2F 4QF1A 1MI5B 3JUYA 4KKAC 3SE8L 5JXEC 2GJ6E 3UPRB 2DKMA 3QDAA 4PJIB 3Q6FB 4BSJA 1KYOJ 1XMWA 3VW3L 1YY9C 1B90A 5BS0E 3IS0X 5F72S 4JM2C 1F3RB 5KZCB 4PJFB 4LRNL 3CFCH 3TBTB 2AK4D 2P8LB 4XAWL 25C8H 4PJGF 2OR8A 4LK4A 4MAYB 3H3KA 5D7JD 4JG0H 2VDKH 2ZKHL 5TH2B 1ACYH 4PJBE 1BEYL 5A2LH 1AR2A 5IHLB 4DVRL 5TQ2L 3RJDA 3CU1A 4HZLB 5BS0A 4YHKL 2IGFL 3WLBA 3RX8A 5LGKA 3G6DH 3DGGB 2BNQB 5JIHA 5ACLA 4L8CA 1JGDB 1YDPB 3DRTA 4C83A 4RDQF 3LY6A 2XA3A 5DJAB 4BFGA 5L8LB 4U1KB 5HI3D 1PKQA 3ZDXE 3REVA 4JDZA 3L3IB 4A6YL 1DBAH 1DANT 2EEAA 4BH8A 1H15A 3QNXB 3BX7C 3O9WB 1I9RL 3GMQA 3F7YB 3INUL 1SEBA 3BE1L 1OM3H 4AEIL 3VD9A 1NAMA 5J06A 4HJ0D 1FNFA 1T21B 1A47A 3MXWH 4G8GD 1I7TA 3QDME 4NUJB 5M95B 5C0EA 1PDKA 2CDGA 4RDQG 1W72B 3RP1A 2FX9H 2WLZA 3IJHB 4LSVH 3RWEA 4OZFA 1K4CB 3VXRA 1JI2A 2NY0D 5ETUB 5I1AA 1A9BB 3D3VD 2W38A 4PRHA 2HRPL 2R1YB 3MV9B 5FA3B 2CK2A 2UV3A 4S0TD 1LDPH 4X6CE 2F74B 3ZKMC 4QHMB 3MRMB 2KPNA 3VFUB 1MJ7L 2JJUA 3DMMB 1WZ1H 2FEDD 3U9UB 3C5JB 1MI5D 4X4XA 2X2YA 4ZFGH 3D5OF 3OXRA 4S0SD 2DIJA 4HJ0C 1Q0XH 4HCRL 3QULB 4P99A 4P0DA 4BM7A 1OAYL 1JPTL 4OCNC 5T3XD 4WEBH 1Z5LB 1ZA6B 2DQJH 5E5MA 2V9QA 1IQWH 5FYLL 2BRRL 2H6PB 3F6IA 4MQ7B 1CDUA 2HFGL 1OAQH 4RWYL 3IDMA 2YOCA 4R96A 12E8L 3GBNL 1GGUA 1JI1A 5EU5B 5IMKB 5D7JB 3MODH 4P23A 2Z4QA 1VFMA 3O45B 3QDGD 5EZOH 2O5XH 3G9AB 3MBEC 3DUHA 1FFQA 3MO1B 3MRGA 3S37X 2QR0B 1L0YA 5DWUH 1C1EL 1NC4B 5DK3A 5IOPA 3TVMA 4YXHH 1PZ5A 1XF4A 3Q0HA 4R4NC 5C07E 5FYLE 5D5MA 2CKBL 1SBSL 2K7PA 4LQFH 2IGFH 3DUUB 1AGBB 5F8QC 5I1GH 2XN9A 3DSFH 2ZNWA 2VXSL 3O9WC 4QCIA 1NBQA 4P3WA 3BP6B 4GBXC 4J8RA 4QWWC 1NGYB 1CDGA 4NO0A 3TWCH 2V2WB 3FQNA 1S9XB 1JNNL 2PXYB 1EEYA 3FTGB 3ROLB 1A1OA 5CJXA 2ESVB 4W4OC 3C6LD 5HGBA 5KW9H 2EO9A 1U8PA 4X4ME 1B0WA 3DMMD 2YSSB 5D7IE 1S7UA 3NABL 3WFEL 4H8WC 2A74B 5FGCE 3VXMB 3QISA 1KCRL 4YDVB 1NFDA 5KSAD 3DV4B 4ZFOL 3PWVA 4ZOBA 5I19H 1Q72L 3MV8A 4ZYKA 5IQ7L 4PJBB 2JLLA 4LIQH 5LCVL 3HFMH 4GMSL 2VLME 4OZGF 5C3LD 3QO1B 1T03H 4KI5D 3VE0B 2W65A 5D7IA 1IC4H 1V7NH 5DS8A 3VRJA 5BMFL 5KTEH 4OFIA 1NMAL 1G9MC 1FDLL 1WBZA 4B53A 3C6LC 4UT7H 3MLUL 4J3XA 4GKNB 3T65A 3R06B 3R1GH 1NFDE 4P57A 3Q6GL 3QXVA 3QJFA 5FHAL 1NGZB 1FQ9C 2Y06L 4L4TB 4LHUA 5FO7A 1BBDL 5DJYA 2EDTA 2F5AL 2LTQB 2FNBA 1DZBA 4BFIA 3L7EB 4JKMA 5C08D 3TBWA 1KCSL 3QP3A 1FZJA 4RAUB 3V7MA 4NRYA 5CZVL 5GRUL 5D1XA 3RZCD 1ZGLA 2CLZB 3QEGH 5C09B 3OR7A 4ELME 4NRXB 3QHFH 2BNRB 2XFXA 2FECI 4F7EB 1J8HB 1IGFL 1RIHH 1QVOA 1HXYB 2PTTB 5AWNH 4F8TA 3A67H 4KZDL 2IFGA 4HGWB 2VR9A 4ENED 1Y6NR 2BSED 3B8YA 2QADC 4ODTL 3F12A 3C6LB 1UB6A 4FXGB 1T83A 2J12B 3GMRB 1YEDB 4TVPL 5D6DA 3AY4A 3MA7A 3WKML 1JBJA 4WNQA 3RPIA 1CWVA 4FQXB 5I66A 4PJIE 5F7DB 2BOBA 1K8DB 1FSKC 3LQZB 5L2JA 2O93L 4JPKH 1U8MA 2PO6D 3KXFB 1K8IB 1HIMH 3HB3D 5E1AB 1IZKA 2B2XL 3UJIH 4CW1A 3MRRB 3BXNB 5DO2D 5BZWA 4OIBA 4PRPD 5KN5A 1T3FB 1AR1D 1MFDH 4ZDHB 3N06B 4OSUH 3VJ6A 2OXGA 1CD0A 1IM3B 1YEGL 4WTZG 3MRHB 2IPTL 1MCSA 1EHLH 5ACZB 4LPYA 5BVJB 3ZE2F 4PV9B 1J05A 4U1IA 2F54A 3HZKB 5JZ7C 1AXTL 5IJKA 4PRPB 3U9PL 4DKAA 2HFEB 4J3WA 4XVSH 3QIUA 3RVVC 4JRXB 2APTA 4AIZA 3BDXA 4BYHA 4GO6B 1XF3A 3MBXH 1JTPA 2VLKE 3FB5B 4OZGE 2XOTA 3HE6A 4X9BA 4BUHA 3QZWA 1WFNA 1GGIL 1P1ZA 3D48R 3A6CH 1IAOA 2WM0A 3NFNB 4R4ND 4YGAB 4HUVB 1KPVB 1XF2B 1ZWIA 3DV6B 3W0WE 4PGZA 1J9CT 4FQCH 5IVXB 5CJOH 2VLLB 3MFFA 4N5EC 1KULA 4D2NA 4QRRE 1CQKA 4NQDD 3MX0A 3PHSA 5IVOA 4JZNB 4Q6YA 4XH2A 4JLRA 3ZSTA 1CFNA 1K6QH 2W9DH 1EVUA 5KVGH 4H8WL 2YWZA 3CFIC 5MEND 2OBGA 1QG3A 3UPAA 1LNUA 1RULL 2WAHA 1T1XA 3EFFB 2L0DA 3MBXL 4QXTA 3LAFA 2UZIL 3CXDH 4EDXB 3NVQA 5GIRB 4KXZI 4FP8H 1C16B 5CEZL 4KRMB 5T1MB 1N64L 3WFBH 2L7UA 1Z3GL 1G9ML 2E6JA 1K5NB 1A7NH 3GBML 4BQCA 1LVEA 2E8ZA 1S7TA 4OLXL 3P11L 2FR4A 4PY7A 5HY9B 1FO0A 5C6WH 3G08B 4PJ7A 3NTCL 3BESR 1S9YB 2D31A 2OQJA 4J3TA 3EOBA 4MSWA 4M6ML 3KJ6L 2GQHA 2XPGB 2SEBB 5D96C 1NMCC 3VMPA 4JE4B 3QIWA 1QRNB 5F6IB 2XTJB 3SJVE 5F21B 1YZZA 4PJEE 3Q3GB 3SEPA 2IH3A 4LGSB 1M4KA 1AGCB 3TFKC 1RZ7L 4K8RL 3AUVA 2DIBA 1Q72H 1S7WB 1M7IA 4ISVB 1MQKH 3UBXA 1MAML 3LZFH 5CUSL 3B5GA 3DVNB 1HN1A 4P3DB 1J1XL 1L7IH 1FG2B 2GUOB 1NJ9B 2BVTA 3T0AA 1A5FH 4DJMA 4LSVL 5D4QA 1BFVL 2FGWL 4IRSA 5JLZA 4YZFE 5F8RC 4JG1H 4OV5A 5T1LB 4KK9C 3ES6B 3QEGL 1ITCA 5ITFB 3I9GL 1CGVA 3SE9L 3DHMA 3L1OL 2D7NA 4B50A 2DWDA 4ZTOH 5EFIA 1T1WB 4DKEH 1DUZB 3O4LA 4A6YH 4FZ8H 5E0QA 1DLHA 1F3DH 4PJIA 4QYOA 1IILE 2YR3A 2P1YA 3DO7B 5DJ0B 1OHQA 2H26A 4MXVE 4YBLC 3K74B 3MRFA 1YY8A 4NO2B 4EVNA 4QOKA 4ZPTA 3HG1E 4YEEA 1JPST 3UTTD 3VXSA 3KPQA 4Y16A 5DJDB 2Q8BL 1RMFL 4HEPG 1U92A 2VZ3A 4PBVC 2XNAA 5TH2A 5EZOL 3FRPG 4EUPA 4LIQL 4RNRB 3CCHA 4HUMB 3FQXA 4PRAB 4W6WB 4ORZC 4NQEB 3WBDA 1JUFB 1BIIB 3B3IB 3G5VB 4IDJL 4K3DL 3UTZA 3GMMB 4I0CC 3RVVD 3HMWH 2J5LC 4QRUA 3QUYB 4XP4L 4C83B 2ZOKB 1IQWL 4GS7C 4JO2H 1KN4L 4UAOC 5ESAA 5GPRA 1KEGH 1XZ0A 3WNLA 2AJ3B 1IVLA 1N4XL 3D3VB 2BC4A 4OZGB 5CSZB 4MCYA 1Q1JL 1ZS8B 4D9LL 2EH7L 2H32H 2QV2A 5D9SB 2O5ZL 1NAMB 1URLA 1A0QL 1QR4A 2GTWA 3WNOA 1IL1B 1NUFA 5B38G 5F9WB 4HUNB 5EO1A 1JF6A 2IH1A 3G04B 2BNUA 2Z91A 1T20B 2N7AA 4Z7QE 3LH2L 3DURA 5FGSA 2VQTA 1K4CA 2X9WA 4G9FA 2ZUSA 3CLFH 1DQDH 1LEIB 1U3HB 1D6VH 3GMOB 1DFBH 4MA8H 4LASL 3I02A 2XTLA 4V1DB 5L88H 5ICZA 3MJ9A 4NSKA 2D7TH 3ALPA 5C0BB 2ARJQ 3LD8C 1RK1A 4F9LA 4DN4L 5JW3L 1IGTA 5E2VL 5BO1L 3ZZ1A 3CFBB 3AXLB 3WXWL 2IAMB 2YWYA 4G8EA 5CJ5A 4MB5A 4WY7H 1YMMA 5B3NA 1IBGH 5EZLB 4MQ7A 5D1QA 4P5MB 1J1OH 2YS4A 2G9HA 3F65A 4FXKB 3TIDB 4PJ9D 5FYLH 2E7CA 5BRZB 2KL6A 1MWAL 5EPMA 3L6FB 3MUHL 1RZ8A 4XRCA 2HJLA 2AJXH 4JREC 4PJ8C 1IT9H 3STLB 1N8ZA 2MFNA 3O6KL 4PJHA 1JZ4A 4OQTH 5DVNA 5E6IC 5C08E 1INQB 4Z78A 3FO2B 5FYKD 2V6HA 1PW3A 5DK0A 4F9PC 4K94H 3LKQA 4FABL 4WI3A 3BJ91 2X4PA 2P8MB 3HZMA 2G75B 4HIHB 1AGBA 2HA1A 3FT2A 4X6DB 3RQ3A 1NMBL 4G6AC 5E5UB 4JM4L 1CXEA 4R26L 4X6DF 5I1JL 4DCQA 2GKIA 5I9QB 3BPCB 4ALAL 2OJZL 2HLAB 4YLQT 1A7PL 1U0QA 5GHWL 2ESVE 3FQNB 5TF1H 5IP4A 1DBKH 3FKUS 4FZEH 5E9DD 3J7HA 1F4AA 3IDXH 3FCTA 4AM0B 3VFOA 4D9RE 1YNKH 2YSSA 4F2MB 4F3FA 4JFYA 4WGVB 5E03A 2XACC 5EOTA 2DLFH 1VADA 3OKMA 3QDJD 3BUYB 4PRIB 3VXMA 5EBGA 1P9MA 3OX8A 4Y2DB 4UT9H 5D2LB 5EORH 4I3RH 4ZYKB 5A2FA 2VL4A 5IMMA 3G9VA 2JIXB 3PGDB 1DQQB 4XCYA 1FL5B 1H5BB 3DX8A 1I8KA 5EOCL 3QWQB 1W72H 3UDWA 5B21A 1TPXC 1UCTA 3B9KB 4NOBA 1G9NL 4HUWA 2ICWA 1U8OA 3WCYA 3QJFB 5C2BL 1NGZA 1KJ2L 2EIBA 3VXSD 4X5LA 4HBCL 4ZUVA 2NY1C 2VB5A 4PJ9C 1U8QA 4YHLL 5E4EB 4MJ6B 2FX7H 5E8OB 2IBZY 2R0ZL 4LQ1A 5DRXA 4KDWA 3C5ZD 1MVUA 1VEOA 2E9JA 1ND0A 2PR4H 2CLZA 4P2RB 2XZZA 2AJXL 5C0CB 1P5UA 5FYKL 4NRXA 2XFXB 4PYGA 2J3SA 1RJZB 4XCNA 1G7HB 4PJCB 2VDRL 4L4TD 4LSTH 1G7IB 1P69B 4GMTH 4C54A 1H8NA 4UDTA 4H88H 1MRFH 3NCMA 3TN0C 3VFNA 5J1AA 1R3IH 5F88B 5T3XE 4C56E 4JPIB 2E9IA 5ANMB 5AUMA 1UZ8A 3ZKNC 1ADQL 1IMHC 1AH1A 4K94C 3LQZA 4IRJC 1DVFC 1U8MB 4XVUD 2BVEA 4OLVH 2HG5B 2V5TA 3SBWA 3H6JA 4A2MA 3OB8A 3PWPA 3ARVA 4CW1B 3BXNA 3PGCB 2UVFA 5B4MD 1CGSH 2AAVA 4HV8A 3W11C 3GMPA 1MCCA 3ARDD 4KUZL 5CGMA 1WWWX 5KN5B 1MY7A 3DO3A 4W4NA 2EE6A 3KGRA 4KI5C 5ERWA 2FECL 3RDTA 2C4XA 4J3OC 4X0KA 3QDMD 4M43H 3V7AG 4GMSH 2ARWA 4GW4A 4PY8J 4WWID 4LSSL 4S2SA 3MZTA 4YHZL 5CAYB 2G5RA 1AO7A 2GJZA 2NXYC 4PRDB 2O61A 3KS0H 2CUHA 4RFOL 5LG1A 5GSVA 4MA3A 5H37H 1N59B 4LPXA 1E0OB 3OAYH 5C0AD 3QIUB 1XFPA 5IBLC 1MREL 1CIUA 3LN5A 2HTLC 2AQ3A 5DUMH 1HEZA 4JVWA 3RNQA 3BEWB 2BFVH 1TQBB 4OGZA 3FB5A 3P4NB 3ARFC 2AXFA 4KRLB 3LEVH 3INUH 1XF2A 5E2JA 2ATKA 2R0LH 1C12A 1Q0YL 2VLLA 5GGRB 4EI5A 1TQCC 2UWEF 3T0DA 3EDEA 3W0WA 1YQVH 5FUCC 3RVXC 3AS0A 4XH2B 2FLBT 2IADA 2DMBA 2DQUH 4TUJB 2R4RH 5T33H 3BPNB 1MCNA 5F6HI 3AROA 4N8CH 1A4KB 1T1XB 1ZT7B 3EFFA 2NTFA 1SYSB 5IBLD 1TZGH 4Z7VB 2EDBA 3T0ED 3P77B 3D2UA 1PQZA 4Y19B 4LLYB 3GK8L 2P7TA 2MPAL 2BMKA 1C16A 1A3LL 3N1PC 2V17L 4GAFB 4DFIA 5T1MA 2I07A 4BZ1L 3PGFL 1BPVA 3ZYIA 2HFGH 5C92A 3UAJD 4CMHC 1G9NC 4KK8D 3RBGA 5A2JH 1NCBH 5I8OH 1D6VL 3FQWA 1VKXA 1X6NA 2FR4B 1G6RB 1ORQB 3OKYA 1CZ8L 4UOJA 3BKCH 1VGEL 4YDIL 1UJ3A 2AP2A 3KPOA 3T0XA 4R8WL 4F57L 3AREC 1KBGL 2ZWLT 1U2HA 3BQUA 2NY4D 4OLUL 4PJAB 1QRNA 4JFHD 5BZDB 4RGOH 4NYLB 3AM8C 1RIHL 3EIFA 3OKDB 5MEPA 1CVRA 1YN6A 2DLFL 4M4PA 4U1MA 1C7SA 2PYEE 1C1EH 4U4BA 4EBQH 3FO9A 2AK1H 1M7IB 3TIEB 4YO0B 3KYKL 3N1GC 3IXAB 4H1LG 4GXVH 1FNHA 3S37L 1MLBA 1PSKL 3A0OA 4QTHB 1FZKB 3U7AA 2VL5A 4GH7B 1JMXA 1W0YT 2J7LA 5IVZA 5JQ6H 4AL8L 5HHME 1ZTXH 3ZE1F 1CLZH 1GPOL 2YUZA 3HUJE 1R3HA 4LASH 1I1YA 4FFWC 3RUGF 1T1WA 2X1XR 5F7MC 3BZ4B 3QFDB 1XGRA 1RULH 5LCVH 1QSFE 3B2UD 2AQ1A 4PREA 1H3TA 4WI2A 1X7QB 1F3DJ 3DO7A 1GXEA 2UUDH 1UWXK 3CD4A 1X4YA 5IKCB 3PP3H 4EVNB 3QUXC 4P2YA 4D0DA 4I2XA 2CKNA 4HC1L 4DN3H 4YIQB 4ODHL 1IQDA 5I16A 5GGUA 3SDCB 4M3JA 3QI9C 1VPOL 3DWTA 3FHQA 3HMXL 4KROC 4F33A 5IB3B 4MLSA 4XTRD 3IKCA 3T08A 3OF6A 4M1DH 4O4YL 4OB5L 1LO2H 3MCLL 5MEOB 3NZHL 5DJCA 3FO1A 4G8GA 1ZT1B 5DURB 1YJDC 4LSDA 3MLXL 1A7OL 4NWTL 1S8DA 2N1KA 4HK3J 3MV8D 3JTSA 4G6MH 5T3ZH 1A6UH 2JK5A 2ZOKA 5DJ2B 3HUJB 2AQ2A 1M7DA 1HXMB 2BHUA 1MFCH 5ESAB 3V0WH 1P2CB 1WTLA 5HI3C 4EN3C 4KZDH 3D3VA 5CSZA 1Z0NA 1OWWA 1BF2A 3TNMA 1DTUA 2GAZB 1YYLH 5F71A 1X5AA 3RGVD 3F7VB 4UIMB 3EFDH 3V6BR 1T20A 4XNXL 5LGJA 4JZJA 5HSFA 4DFHA 4GXVL 4LLUB 3SGKC 2KBGA 3LV3B 1NGWB 3TBVA 4GRWE 3QIBC 3D25A 3W9DA 3UJJH 5KJRL 4M5YH 1JZ3A 4ACPA 3MLZL 3VFVA 3MLUH 4NKOA 3F62A 5T3ZE 4LF3B 3AXLA 5GZOC 3TZVC 2IQAA 3MRBB 4FQXC 1CDBA 5EZLA 4WI5A 5SV3A 1B6DA 4I18B 2HTLD 3HCVA 4PGCB 4DOHB 4JHBA 4YGVA 1JHLL 4L8SB 1I1AB 1XIWB 4LARH 1NGQH 2RBLA 4N8VA 1FLTX 3R0MA 1D5MB 1KG0A 2YD3A 3PL6C 2FO4A 4LFHD 4JN2B 3STLA 1QPXA 2DQFA 2F53B 2CD0A 1BX2A 1CLZL 4IDJH 4K3DH 3W9EB 5DK0B 4Y89A 3M07A 3SGEH 4GKZA 3NZHH 3E1F1 1RV6X 4YBQC 5MP6L 4IOFC 4PG9A 4JG1L 4OD3H 5DMKB 4IJ3C 3HE7C 1Q9LB 4P46C 4PGBA 1NLBL 1IAKB 5B8CA 3I50H 1IC4L 1V7NL 4O5LH 3RGVA 5HYSA 3KPRA 1P6FA 4B41A 3MUY1 4JFOA 4MNGA 2YRLA 4I18C 4Y1AA 4NUGL 4WO4A 4XAWH 5KVDL 1N26A 2BVOA 3KLSA 1Q0YH 4JJ5B 2Q6WA 3NCFB 3VFTB 3QUYD 1HHGB 4ZAKC 4PLKD 4HZAA 3ECBB 4GQ9H 3WHE0 2W60A 1Z6JT 4S1RH 4Z7VE 2AABL 4XPFH 4GRLC 4Y2DA 5D2LA 1IC7H 5C0FA 1AGDA 3BP5B 5SV4A 3HC4L 2Y36L 1HSBB 3T8XA 4OGYH 1I8KB 4UQ3A 3TT1H 3LQAC 3MRDB 1I3RA 3CK0H 1UACL 4LCIL 1OOAA 1FFRA 1G6RH 3IDNB 2I24N 2EC8A 3QNYB 3QXAB 3ULUF 4FQCL 4GJTB 1MJUL 2CSPA 1MCOH 4LCCC 2VQ1B 4OLXH 1XR9B 1KT2B 5DLMH 3CGTA 4U31A 4RA3A 2AV1A 3ZE0F 4NFCA 3FFDA 1ED3B 1OGTB 2J8OA 2I9TB 4DGVH 5I71B 4PB9L 3LRSB 2Q8BH 1FL6A 1H3PL 1I3GL 4NQXA 2YD7A 1QHOA 2PW1B 3WUZA 5IEKA 1FGNH 4U1NA 1BZQK 2AJUL 1EHXA 1ND0B 3K4DA 3MACH 5E1HB 3H7LA 2OTUB 3MXVL 3MREB 4MJIE 1T2XA 4PJGA 2R0WH 4H5SB 5KVGL 1PLGL 1VSCA 2XQBH 2VABA 4A6YB 1TETH 4KQ3H 4JHAL 5DJZA 3BMWA 1RUQH 3IAQA 3TPUA 3HA0A 4HWZA 3L95B 1VFBB 5TDPA 5LWYL 5MEQB 1VESA 2HN7B 1FFOA 4BFBD 5F88A 3BJLA 1MRFL 1EFXD 2BFVL 1W0WA 2P4AB 4JQXC 1A6ZB 1UZ8B 1JWMB 4PIRF 4Y5YC 3DRQA 2EKSB 1N6QL 1ROWA 2PO6C 1NANI 4UBDD 2F54D 2GEEA 1FH5L 4KTDL 4ODSL 1D9KC 2YPLE 4AENB 3R8BB 1YPZF 1E27B 5JA8B 1CGYA 2H1PH 2NLJA 4OZFG 4YXHL 1OB1B 1HINL 4BZYA 1UM5L 3TVMC 2V7NB 3D85B 1AY1H 2ED9A 4IRSD 2B7DT 2CXGA 5DRNB 1HKFA 2NYYD 1JYVA 1QO3A 2FCBA 2B5IB 2MQCA 4EZMA 1JZ6A 1I8MB 4UBDC 4HFUH 4O58H 4M1GH 3EOTH 2AJZA 1F4WL 4R0LB 4DVBB 4HAFA 4MWFB 3VGGA 3FB7A 4KAQL 4WFGE 1F2QA 5D1ZA 3GMNA 3IFNL 3T1FB 3WLWD 4Q97A 2LVCA 3MV7E 5FA4B 3VXMD 2ITCB 3EO9L 3WE6B 4M6OL 4JJHA 1MPAL 2HKHL 4LDLB 4M7ZB 3FT3A 3QB7C 4XAKD 1OP3K 4IMLB 4KRPC 5J8OA 2CLVB 3V52L 1S9VA 5ISZA 3ISWA 1NC2D 2VXQL 3QDJE 4UNTA 1HYRC 2M8XA 5T1DL 4QLRA 3RTQD 2PW2A 1UACH 3RY6A 1J0YA 4H1LA 4U3XA 3HC0B 3PHOA 3OKEA 4AQOA 5D7LA 2BK8A 3MLSH 1T04B 1OTUD 3T2QA 1A4KA 3UEZA 3OZ9H 3TBYB 2A6IA 1SYSA 2BRRH 5EO9B 4HLZH 5HTSA 3ULUL 1F2XK 3VH8B 1J10A 2ORBH 2VITA 4TUKH 1X5JA 5BO1H 1TZHB 2P7TB 3G6JB 2K9UA 1AP2A 2A2QT 3C6SB 1CG9A 4MNQE 4PJDE 4K23L 4JQIL 3GK8H 4J12A 1FIEA 5E8NB 3BZFB 3EYOA 1K3IA 4LPTA 4OCYH 3HS0A 4NUGH 5BRZE 2GFBA 1BFOA 1VKXB 5MERB 4N0RA 4XX1E 5K9KB 2DICA 4LU5H 3MA9H 5EH1A 1UH2A 4FQHA 3UYRH 3BZEB 4WHCA 2BOCA 1LEKB 3F5WA 1OGAE 1KENH 3U7YL 4F57H 4GG6F 3T3PF 5I30L 4Q6IC 3F7QA 1D3CA 1WIUA 2FBJL 3OKDA 3ZHKA 5C3TA 1FVDB 1CK0L 2EC9U 3V6OA 4MA1B 4LPWA 5EUKA 4U6HB 4U6VL 4KRNA 3U46A 3TV3L 3CVHA 5IT2L 4YXLL 1DBJL 3JV6A 2QQLL 1X5ZA 4M1DL 1DANU 2B2XH 3UJIL 5JDSB 2XQYK 4NRZA 5CEZH 5L8KB 1J0KA 3H9YA 2XTJD 4AQ1B 3FQRA 2ZJSH 2R1XA 4ZS7H 3ZHLA 2IALA 4GT7A 5FYKH 2MQ0A 3CDGA 3P9MB 3DXAB 5F7EH 2LE9A 3EDKA 4PGEB 4Z76B 2CH8A 5SX5K 1NDMA 1R3HB 5E56A 4X9FA 1O7SA 3QHFL 4M43L 3VI3E 3EDFA 1G7QA 4X6CA 2YD1A 4HUUA 4MXWL 1HQ4A 4YHOL 5J9PA 4FTVA 3EYSH 3QWRA 1CICC 4OUUB 4QWWD 4R9HA 4AMKH 4EXKA 5IKCA 3GMLB 3C5ZC 4QRTA 1R3JB 4OLVL 2NY5L 1A22B 1FJ1A 1RZFL 1Y6MR 4F33B 3KPNB 3KYAA 5IMOB 1A7RL 3LS5L 1SBBA 4PJEA 4JM4H 4PLJC 5H94A 4LNRB 1L9MA 2AJSH 1A1MB 2X70A 2GK2A 1KLGA 3QIBA 1BQSA 3LEYH 4FQJH 3UC0L 5EU3B 2LAGB 1U8HB 1NANH 2HVKA 3SDDB 3VXQB 4YHIB 3ULSB 3KNBB 1S8DB 4OCSH 2ZCHH 4J7RA 2DJUA 3D18A 1LHZA 2IBBA 2JK5B 3OJ2C 4RGOL 3MNVA 5D93C 4ZAKB 1MCOL 3B9KC 5BV7B 4KTDH 1U95B 3TZVA 2B0SL 1P2CA 3WL9A 3HFML 1JFQL 4E42A 3BMVA 1J86A 5E00B 1A6TB 3ARTA 2EIZB 4LCWE 3NCCB 5EN2A 5J1SC 5GGVL 2M26A 2GSIA 1NMCB 5SWSB 1A02N 2LAAA 2DL2A 5I15H 2GAZA 3P4OB 2WWKT 4QHKJ 1CBVL 1DBJH 1OCWH 3O2VL 4M03A 4OLYL 4AYFA 2DMKA 4RAHA 3MRNA 3PGFH 4KROB 3MLTA 4OAWB 4D8PA 4LLUA 9CGTA 2HTKC 3WNNA 3FB8B 2OL3A 4ODXB 2DD8H 4L3EA 3LRHA 1SM3H 4BKLB 4WI7A 2AS5M 2DYPA 5I71C 5KSAA 3IS1X 3KPPA 3VFVB 1RURL 1C5BL 4QRRA 4O5LL 1NKOA 3BWUC 3ZTNH 5HD8C 1NGPH 3WHXA 4L8BA 1U93B 3DJ9A 1YEJH 1KEML 4LCYA 3L5XH 5HI5D 2Y5TB 4Q2ZB 3ORJA 4GRWB 4I18A 2VSDA 4Z6AT 5D70L 1NPUA 4OFYD 3WLWC 1KPUA 2WBJC 3NMEA 4L8SA 3HE6D 4NM8H 2E7MA 2X4RB 1T6WA 4XXCC 3VA6A 4BZ2H 3U48A 3TBTA 2IFFL 4ZAKD 2OTWB 2QHRH 4N0YH 4MAYA 5KSBB 1E28A 1UM5H 2DQFB 5AD0B 2F53A 5CIPA 2PKDA 5CEXB 3IGAB 4Z7UB 5HHMD 1S7SA 1W0VB 3B9VA 5HDLA 3H9SA 4HZLA 2ZNXA 1UEYA 1XF5A 5F9WC 5TQ2H 2NY3B 3HR6A 1QSFB 2HMIC 4N0CD 1A7QL 5DMKA 2FB4L 3B6SB 1G9EA 4FRWA 5DJAA 1U8NB 2H8PB 1QFOA 4JM2D 4U0RC 5J6HB 2R29L 2XZAL 3RGVB 4W81A 3SDCD 1IEBB 1G6VK 3L3IA 2CXKA 2JJVA 1EMTL 3PIQA 1H15B 2V9RA 3F7YA 5FB8B 3EYFB 4NKMA 1YUHB 5MHSD 1IGCH 4RIRA 5F44A 1U3HD 4EN3B 1FYHB 4WO4B 2W92A 2JJSA 1FFNB 2IPTH 2E6QA 1AGFA 5C0IB 3BFOA 35C8H 1INDH 3IJHA 2QQNL 3DETC 2W60B 1WGOA 3Q5YA 4I0PA 3VXRB 3TO4A 1RIVL 4QRRD 3C8DA 1ZXQA 4HKZB 2GCYB 2Y6SC 5CMAB 5C0FB 1JHTA 5DRWB 3UJTL 4Q9CA 3N50A 4H26A 4OGXH 3VCLA 1PG7H 4L29A 3KWWA 3MJ8B 4KC3B 4HS3B 1F5WA 1OSPL 3JWDH 1CFTB 2NQCA 5AYUH 2AXGB 3EJZD 3V8OA 1GHFL 4LKCA 3IB4A 1KT2A 1R5VA 2VKXA 3WUWG 4KHTH 2AV1B 4K23H 4PG2C 1MJUH 1W8OA 2UY6A 3L3GA 4X4MA 3KYOA 5IMLB 1JN6B 1TZIB 2VO5A 3HMXA 4F7MB 3M17A 5L8JB 4TN9A 4S1SL 3E6HB 2WW8A 3MCG1 5D7JA 3MJ7A 4JFDA 4NQXB 2PW1A 5IEKB 3ARQA 1K6QL 3O45A 4NZDA 4NN6C 4O4YH 3ZL4L 1U42A 3BUTA 4TNVF 1I1FA 3HTLX 2OS7A 3T77A 3S88L 4UINL 5LAXB 3MO1A 3MRGB 15C8H 1MQ8A 3EZJB 5AZEL 4EUPG 5ID1B 1ZV5A 4NNXA 3OQ3B 2VXQH 3GSQB 1RUAH 3I2CH 3KHOA 4G43B 3QUKB 4KHXL 2CLRA 1WITA 5C08A 1J7VR 2YK1H 1Q9KB 5TDPB 1AQDB 3ARDA 5TE7L 5HPMA 3BD3A 5IB1B 1X3DA 2CQVA 3NFPA 5C09E 2F8OA 2FJHA 2JB6B 1CE1H 2RGSA 4JRYA 2GI7A 3FTGA 3QQ4A 3RVUC 1A1OB 2EKJA 5MI0B 1RUMH 4YHMH 3BT2L 3TCLB 3DNKA 5CZVH 5IW1B 1A0QH 3P9WB 1DJSA 1FNSH 4N5UA 1E27A 4HMEA 4GSDH 4LRNH 5DMGC 4XT1C 2A74A 1P4IL 4L4VB 1NFDB 3EYUL 3IDGA 2GT9A 4Y8AA 4XCCL 4HUXA 4EBQL 3CDYA 5DSCB 1DL7L 1AGEA 3W82A 4WW2F 1MCLA 4GRLB 3QO1A 4MQSB 3S96B 3BW9B 3HI1A 3H8NA 1QO3B 1J8HE 1VPOH 2R29H 3OJDB 1EBAA 4MXQD 5JIPA 2YPKB 4FFVC 5HYJE 3QQ9D 1WISA 2A6KB 4MAUL 4JFXB 3VWKB 3WNKA 2LFGA 2VTFA 1PX3A 4HWBH 4I5BA 5FECB 3L9RB 3GMNB 3T1FA 1V7MH 2BZDA 2X1OA 3PV6A 1U8JB 5FA4A 2ITCA 2CMRH 2FZ3B 4HS6B 5DJYB 1BD2A 4P5KB 3N1MC 4YHYB 2F53D 2GTZB 3RI5F 5CZKA 3TBWB 1KTDA 2KDGA 2VLMD 3EO1B 4L4TE 3X12A 4EEEA 3EO9H 4DEPB 1ZANH 1FLRH 5D2NA 3C60C 1ZGLB 2CLVA 5ISZB 3TA3B 3GB7B 1TXKA 1C7TA 4X5WA 4XP5L 3NCBB 3OG4B 5DZLA 4FNLL 5DMJB 1MCPH 1VFAA 4PR5A 1XF1A 2B1HL 5JHDA 5DQJA 3D69A 4G6KL 4PJXB 4OZIF 5T1DH 5HHOD 3OKEB 4UOW1 3S7GA 1T04A 3ILQC 1R5IB 4YDKH 3X3GH 1MFEL 3TBYA 2IAMD 3BI9X 4GW1A 4FXGA 4MXWH 4Z7WA 5E7BA 2J88L 2ICEA 4LOUD 5F7DA 4PJ9A 3L3JA 3HE6C 3EGSA 2D3VA 3GI9H 3KXFA 4I4WB 3BZFA 4WFHE 2BRQA 4D0CA 1BFOB 5F7EL 1SY6A 4Y16D 3KYNA 5D7LD 2DD8L 3L5WB 4JVPA 4KJQC 4M6AA 1RZKH 4ZDHA 3VJ6B 4WUUD 4X83A 4ESKA 3ARGA 5I18H 2Y36H 3I2CL 3O2WL 3BZEA 1OARH 4AZ8A 1CD8A 1MCQA 2HT3C 3P3YA 4ZSOA 4U6TA 5BVJA 4PV9A 2JELH 1IGIH 1JWSA 1CL7H 1E4XH 2F54B 4NP4H 5DEGA 2KQNA 2DJSA 1LO5A 3DGCR 3SY0B 4PP2A 4HWEL 1KB5B 3QT2A 3GHEH 3BWAB 1T6VN 4JRXA 4OLZL 2Y06H 4MLIA 3QFJE 5D2LE 1TZGL 3BT2H 4HWBL 3E3QE 3SHSA 4EQ3A 3DUSB 3BH9B 1J12A 3QIWD 2ZCKL 1R5WA 3JWOH 1KPRA 1K9TA 3MRLB 5CCKL 3ZKMD 2CDFA 4N0FB 4TSAL 1AE6H 2RFXA 4PGEA 1G0XA 2MTPA 3AS1A 3SDYL 4WTWA 3TVMD 4HJGB 1I9RH 2D03H 1T5WB 2ENYA 3QEUA 4ZQKA 3V5DA 4JO3H 4R90L 4G8IB 5FO8A 1A7OH 4NHCH 5CWSA 5DQDL 3VFWA 3GRWH 4OUOA 3K1DA 4X6CB 4FNLH 3T3PE 4I77L 1UQSA 1JRHI 1WT5C 5J9PB 4QXTB 3O6MH 4RMRA 5IB4A 5J11C 1JNNH 1NEUA 5ADOL 1J5OH 4KK5D 1QR1A 3EOAB 3NBNA 5EULV 3VXOA 4Z7NF 4ODSH 5ABDE 4H0GA 5GGQL 2CUMA 4IOIA 1SHMA 2IG2L 4NQSA 1KIQB 4TUOA 3WS3B 3GNMH 1TTGA 4NKDB 4XNQB 1EVTC 4GG8A 3MR9B 3QBTB 2BJMH 3OKKA 3LVEA 3BPOB 1UEMA 3VW3H 4LSUH 5HGAA 5CBEA 2AV7A 3HNSL 4Z7NE 2XKSA 3QIWB 1N5YL 2XXCB 2VE6B 1I4FB 1T7ZA 4E42B 4LAJH 4M62H 1H8OA 5E00A 5GZNC 3D39A 1A6TA 4ZD3L 5EN2B 1RJLB 3SDDD 3RJQB 5DDHA 4CNIA 3GIVB 2XWJA 4I3RL 4PJDF 5CJXC 5DJ6A 1BGXH 5CJBA 5IQ9B 1CDCA 2CKBH 2YRPA 2C3GA 3WIHL 1QBMH 5D7LE 2GUOA 1WFUA 1FCCA 4GAYA 5I76B 2VAAB 1HYSC 3FB8A 4PRNB 2DLTA 2OL3B 3VXUA 4OZ4A 4OZHB 3MJGX 1JTTA 1XAUA 3VWJC 2Q86B 3A67L 4MJ5A 1BQHB 4NN6B 4YPGB 4M62L 2RB8A 5E5RB 1MIML 3PABA 5AG8A 2C3XA 3QDHA 4NNPH 5D8JL 4QKXB 4Q2ZA 3MV7A 4C57C 1XGQA 4XCCH 3IYLW 3DXAD 3MRFB 3BH8B 3K8LA 3MBED 3MLVH 4UTBH 4HPYL 1KYOK 2QKIA 4AK1A 1BD2E 1ITBB 5IIEA 3I84A 2W59A 1FVEA 3SE4A 1YN7B 4QHNB 3FOLA 3KPQB 5FYJU 2P8PB 2YZ1A 4JRYD 2C1OB 5IW6B 4JVUA 4S1SH 3TYGL 3IRPX 3VGAB 3Q5OA 5CFHA 4ZS6D 3TNNA 4BSWA 3OKNB 1XCTA 4ZXBA 4Z7UA 4NQDB 4RNRA 4UT7L 3MBEB 4FG6D 2ZJSL 4WTXA 2WP3O 2Q20A 2RCSL 1BIIA 3B3IA 2P5WA 3GMMA 4OD3L 5AYUL 4Y5XA 3TJEH 3QCVH 4E41D 3X14B 1M6OA 2D7MA 4P4RB 1JGEB 1UXWA 5D93B 4OKVA 3CMOH 2J4WL 3IF1A 2AERT 1G7LB 3WS6A 1YUHA 3O3BB 2RQ8A 3BEVB 1B0RB 1T5XA 5F6IC 3S88H 3I6LD 5DD1L 3MNWB 1FNEB 3V4UH 3E3QC 4L5FL 4HK0B 1TIUA 1YNTA 4CU8A 4G9FB 4HKZA 2BJML 4U7MA 1PZUB 1OP5H 3EHBC 4LEXL 5EIIB 3UP1A 3V6ZA 4TVPH 4C58B 2X4QA 3GI9L 3D39E 2W9DL 3T0EC 4WEMB 5I9QC 1CLCA 5I75B 2Y6SD 1B88A 4K8RD 2YC1B 5K9OB 2X7LB 1UB5A 1QKZH 3NA9H 4Y4HB 5DUBB 3U4AA 5D1QB 3VFRB 1JNHA 4QRPB 1G0DA 3ETBF 2DN7A 1QSEE 3L3GB 1ZE3C 3KYOB 2ADIA 4RBPK 1IBGL 3NGBC 2IANA 4I0KA 5HDBE 3RZCC 2VSCA 2ED7A 3BE1H 3TV3H 1RZ8B 3IXTB 3AMLA 4JAMB 2YA0A 2Z35A 4G5ZL 8FABA 4QF1B 3MRPA 1MI5A 1AFVL 5LAXA 3LKPA 1N8ZB 3Q6FA 5EORL 1EV2E 1HHKB 1MHCA 4BELD 4LSSH 1CFVL 1IC5H 4H1LH 3GSOB 3BKYH 3KAAA 1F42A 5HGGS 3NH7H 3GSQA 3O0RL 2XTJE 2P8LA 3SJVB 3O2DH 3WKNA 2IWGA 1KACB 3JWOL 3KPTA 2HWZH 4OIAA 3C5SB 1YNLL 5HPMB 5C0ND 2VLKD 5IB1A 4B0MM 3RHWK 1G6RL 5TE7H 4ZTOL 4P2QA 4GBXB 4CU7A 2JB6A 3RWDB 1FRGH 1ZLUH 3LS4H 4YHOH 2P5EE 3DX9B 4U6YB 4AM0A 1JGDA 3DRTB 3H7BA 4BA8A 4JFYB 2BXZA 4YQXH 4P3CH 3X13B 3C60A 4BZ2L 3REVB 4NJ9L 3LRGA 1BVLB 4X9GA 4KTEL 4PLNC 4BH8B 1TCMA 3GMQB 3O4OC 5H2BA 3QEHA 4X5XB 3TM6A 3QHZH 3THML 3HUJF 4OF6A 1AGEB 1K85A 5HJ3B 5DURD 2OZ4A 4QRPD 3LEYL 2EDQA 2J1KA 4MZ3A 3JV4A 3QXTA 1SBSH 2YPKA 2EDXA 5ETUA 2A6KA