4OFPA

Crystal structure of syg-2 d3-d4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
200
structure length
197
Chain Sequence
b'DPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKEIKNIYSFIASQNDNMAEYECRANNSRPKRKAMKLEVNYPPASVELFGESNIRYGSSANIQCKSLPSNPASQITWIINGRSVPTPTQREFVVENGIVSSSNVSVHSNELSVEAHQINVECMATNPEGSSAKQHVIKIIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein SYG-2
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
total genus 28
structure length 197
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA01
1OCWL 4Y5XB 2MOVA 1KB9J 5HVGB 4UI2A 4N0YH 5I8OH 4NNYA 3O45A 4PBVC 5H94A 2DJSA 1PKOA 4LHUD 1U6AH 2VRAA 1Q8MA 4KI5F 3K8LA 4CN6A 3N85H 4X4MA 2R29H 4XGZA 5MERA 1QFWI 1JUFB 3LDBC 4X7SH 2FD6H 2CPCA 3CXDH 1A7QL 4X6BA 4ZSOA 4F37F 1I1AD 4PJDE 4K7PL 1V8HA 5D7JB 2VLLB 2VLJD 5EN2A 2Q86A 5E1AA 4JVWA 5AZEL 2FR4A 2Q3ZA 2GJ6E 2G5RA 1OGAB 1OQXA 3VXUA 4NO2B 3GSUB 1XGPA 1A6VH 3MA7B 1IJ9A 4MJ6B 4OD2A 4XXDB 2NTFA 3S5LA 1ORSB 3NIDE 1NGWA 1F2QA 2UZIL 4LEXL 3SDDD 4M7JL 4KGJA 2PW1B 3IU4H 3O3EB 4AL8L 4KK8C 3SPVB 3NA9H 3SGDH 5GS1B 1CTNA 3TJHD 3EJJX 5D4QA 2HJLB 2C9AA 4HXAL 2A1WL 3U7YL 3HE7D 2BNUA 4J4PA 4X0KA 1J0IA 1FZKA 3EGSA 5B38B 4OFVA 3O4OB 1KSRA 3S34L 2X4TA 2Q76B 3EFFA 1AD0B 2IADB 4MHHI 1IAIM 3FO1A 2ENYA 3X3FH 2AGJL 3Q48A 1OAKH 2EYSB 3RBGA 1CXLA 4Z5RB 1G9NH 2FX9L 4ISVB 3ARFD 3WJLA 4GW1B 5I74C 1N4XH 1SHMA 1F6AB 1U8JB 5I6XC 2GFBB 1A1MB 5LGJA 2AEWA 2HWZL 1LEGB 1CDHA 4WV1A 4I77L 2PTTA 1JI1A 2H32A 2ZUXA 4E41A 4UAOB 3NZHH 4TTDC 4RDQG 4F2MB 2MHAB 1RSFA 1NMCB 2BSTA 3CFEB 3S36H 3DV4B 1DQTA 1IM9D 1DLFL 3G6JF 3RDTB 3UJIL 3TF7C 3DRTA 4PGDB 5DJDB 2WWMD 2OL3L 3QXAA 1F90L 3KWWB 4Y1AD 1XGTB 4HPYL 3ROOB 3QUXD 1F3JA 4OCYH 3BPCA 1ZKAA 4GKNA 4P5KB 1HHJA 5BS0E 4UT6H 3V6FA 2WK2A 4JQVA 5I1DA 1N5AA 4R96A 4UT9L 5C0RH 3QWOA 3BIKB 5IWLA 3VXNA 2C1OB 5IJKA 4KXZI 4MNHA 3F58L 3QUMB 1BAFH 3OG4B 4K8RC 2DBLH 1FVCA 2EKSB 2YD9A 3IB4A 1XIWA 4JFXA 1LP9A 3SDAC 4NKQB 5J6HA 3IT8D 1U42A 3O8XA 3RWEB 3HMWH 4KMQA 1CYGA 5EC1B 4I48A 4L3CA 1OTSC 1QFPA 1EZVY 4KHTL 5E00B 3RRQA 2W91A 2FEEL 2JIXD 4BH8A 4IS6B 1HIML 3P4OB 1H3PH 2I26N 4OF8A 1ZE3C 4GG6B 4LGRB 3ZDYF 5CEXA 5F1NA 4IMKA 5I18H 4JREB 3VU2A 3P9MB 3FFCB 1F4XH 4GXUM 4QY8A 1TTGA 4GO6B 5E8PB 2H32H 4NQVA 2ORBH 2O5YL 3B2VH 5KOMC 2X41A 3QHFL 5T1MA 4H0HB 4NKOA 4UTAH 4EI5C 5J57B 2ZUVA 2VITB 4Y4FB 3T3PF 5C2BH 3BHBB 5DD1H 4JPKL 3NPZB 4NRZA 3L1OL 2BVPA 5EU4B 3ARDC 2V5SA 3LMJL 1T0PB 1LO2H 4OCMC 3I3BA 3HFMH 3B43A 5GJSL 1MCEA 4RISL 4KZDL 1U8HB 4S2SA 4CN4A 4U1NA 1JPST 4K3EL 4MD5B 3M17B 4OZFG 2JJUA 4PJGA 1IC7H 3QO0B 1T1YA 4N1CA 4HULB 4ELME 5J6GA 2F5BL 4OAWA 1H8OA 3OR6B 1EEYA 4DJMA 4XP5H 4JPWL 4RQQB 2HFGL 3BD3A 4PUBH 4ZPVA 4BQ9A 3DTXB 2R69H 2AJVH 3HNSH 1S8DA 5IVNA 3SOBL 2CGRL 2R4RH 4N68A 3RVVC 5L2KA 4H25B 3PWVA 3DX6A 3BOVA 4NGHL 2MCPL 4DGVH 5BZWA 4XP6H 5SWQB 5JIHA 4RGMB 1DBAH 3RUGF 3ARGC 2FEDC 3FQNB 2I60H 5TF1H 3TBSB 1NL0H 3U30C 4APQB 2W0KA 1N8ZA 4N9GB 5E2WL 3WEXA 4HGWB 5E94B 3QIWB 3ARRA 3FB6A 1QBLL 4MNQB 4H0IA 1FL3B 3KJ4C 4MA8L 5ESQB 3HRZB 5F9WB 2XY1A 3OXSA 2C7UA 4L4JA 4RX4D 2QEJA 3I50L 3RQ3A 5JHDE 3F12A 3D5OF 5HI3C 3GBLA 1JIBA 3AVEA 5DD6A 3WNMA 2I5YH 2VDOH 5TH2A 5D2LA 2VZSA 1FNFA 4OGZA 4Y2DA 3QDHA 3HZYB 3T0EE 4GXVL 5TDPB 3DIFA 4PJ5E 4UIMB 1OAZL 2HLFD 2XRAH 25C8L 3VXPA 4JRWA 3NA4A 3D18A 3JUZA 5CLTA 3REVA 3IDIA 5IROC 3QHZH 4LSUL 5HHNB 1S9XB 5K9QG 5IFJB 3BYYA 2CKBB 4PBXA 3FQXB 2F54E 4FZEH 5FGRA 4FMFA 5KVDH 3DI2B 3BDYL 1M6OA 4WEUD 4KI5D 4HMDA 4U6YA 3T8XA 4J8RA 1AR1D 3UAJC 1K85A 4AENA 3FONA 1Y6MR 2ESVA 1BZ9A 1KJ3H 1NEUA 4L4TE 1KB9K 3ULVC 3DMMB 4LVOC 4XPHL 3OGCB 1GZPA 1L4IA 1QBML 5JORB 4PGBB 3HI1B 4ETYA 1TCRA 2Y36L 4I3RH 6CGTA 4ODHL 1ONQA 3B9KB 4P59L 4KTDL 1A6AB 2J8UE 4OKVB 5F6IB 2HT2C 1A4KA 4CVXA 4NZUL 5C0BB 3KXFA 4GOSA 5C9JA 3SE8H 3CXHJ 4KK5C 1MHEA 5FHBH 2GTWA 4M3KB 5IK3B 1QG3A 4H88L 2Y1VA 1AGFA 4BH7B 2BNQA 3ROLA 4Y5VC 3WIFA 3L3KA 1WWCA 4FTVE 3FTGB 3VJ6B 9CGTA 5ICZA 2VL5A 3RWGA 3IXAA 2PYFA 2EZ0C 4D3CH 3B83A 2NW2B 3W11D 5L88H 2N1KA 1YQ2A 2E9WA 4AEEA 1H15B 3EOTH 3V79C 3IJSA 2PO6B 4PR5A 3VXQA 2F5AL 4RFNC 1AKJD 3EO1A 4D8PB 4WFHE 3KPRD 3JUYA 4KROD 5EO9B 4ZXBB 3STLB 5EBMA 5D8JH 3DV6A 3FT4B 1K9TA 3BWAA 3GSXB 3MACL 4JO4H 2EDYA 4Z7UB 4HJJH 5J11B 3RGVB 4LPCA 2NZ9C 3I75B 3SKOA 4MSWB 3IDYC 4HHAA 4QCIA 1QO3B 5F7KC 1JV5A 4PREB 3D85A 4LLWB 3BZFB 3VWKC 4WY7L 2W0LA 4TUKH 3MV9E 2Z31C 4P9HH 2YXFA 4LPVA 1EEQA 4YHYC 4FQJL 4MA7L 1T20A 5EWIL 3MRLB 4YIQB 4NUGL 5JHLH 1MEXH 5F7UA 2GI7A 1S7QA 1FLRL 5E56A 1NDMA 3RI5F 2G9HB 1LDPL 5FA3B 1RIUH 5CJBA 4K94L 4LL9A 2ITCA 2OR7A 1X5HA 2VDRL 4Y4FD 3PV7A 4R0LB 2CMRL 3WUWG 4OTXH 3VFTB 3C60A 3LSOB 1KG0A 2QHRH 5GRVL 3ZTJH 4GAFB 3VE0B 3EJYC 5GSRA 5E8NA 1TCMA 1GHFH 2P7TB 4BUHA 5FOBB 5C07B 3ES6A 1PKQE 4JO1L 4JRYD 4XCFH 3V0WH 4L9LB 4R4BA 1JMXA 5DGQA 1VADA 3P0YL 5DJYA 5HJ3B 3DUUA 3K4ZA 2XNAA 5DGRA 2MJWA 3A6OA 4PJDA 3MRNB 1EO5A 1QQDB 3DWTA 3O81A 4F3FB 5C0FB 4Y5YB 2GJ6A 1J1XL 4QXTB 4XI5D 5FGBA 1UH4A 5DMGD 2X1WL 2Y07L 3IDJA 2W38A 5ETUA 2IQAA 1J8HB 4HS3B 2WBJB 5FYJU 2DWEB 3BPLC 2GKIA 3TNNB 1NFIB 5D1QC 5DMIH 1J05A 3OR7A 1VPOH 3JV4A 4ORGA 2GQHA 3P0GB 5FYKU 3DO7B 2HLAB 3I2CL 4NKIH 4P23D 1A7BA 1XGQA 1HKLL 2QQKH 1B0WA 4XC3L 2X10A 5FYJE 1G9NC 1MHPH 1YNKL 4QYOB 5BZDB 1JNLL 2H2SC 4NWTL 4ODBD 3AB0B 4GMSH 3WS6A 4YDKL 1YJDL 2NXZB 1RMFL 43C9B 1FNEA 2ZP0T 1ZA6A 4LSSH 3JV0A 1MVFA 5E2VL 2Z8VC 1YEJH 3KPLB 1EFQA 5KG9A 1PYWA 4HLJA 1JZ3A 1UWEL 1AGDB 3MV11 3X14A 1T4KA 4OLYH 4F7CA 2J5LC 3UTTB 4R7DA 5I8EA 1QKZL 2R56L 4DKDC 1UZ8A 1T1WB 3DYMA 5L6YL 4XNYL 3BIAX 2D31B 4L4VE 1SEBB 2H6PA 3G08B 5FO7A 4LF3B 3CZFA 3KLHD 1DCLA 5IHBA 2YR3A 3PG2A 2EE9A 4R2GB 3RGHA 1A14L 1MJ7L 1JWMB 3D9AH 1EERB 4BFGA 1G7MA 5C09B 5BS0A 2EDWA 2X4NB 4LAJH 1SBBA 1IAMA 4FFZL 1MJJA 2E9BA 43CAA 4JE4B 3BVNA 5EPMB 3GMMA 3IDNA 4HWUA 5GGSA 2VLJE 2H45A 3DGGB 4K7FB 3ULSB 1FYHB 4IBLT 3GB7B 4RFOH 3RTQC 2JJTC 1OVZA 4KY1H 4Y4KC 2VWEC 4HDIA 1CE1L 1DUZB 5GRUH 2HT3D 5F1SA 3M1BB 1XT5A 4OQ1A 3QI9C 1AGBA 3DMMD 3JTSA 4D0DA 5DHYA 3WSQH 4UINL 5IQ9A 1RJZB 1FVDB 5T5FH 2Q8AH 3VFNB 4OCSH 1X5KA 1JZ2A 4S1RL 3QO1A 1EO8L 5MHSE 3R0NA 3BKCL 4YZFE 3T04D 2XFXB 3RKPA 4M1DH 1PSKL 3TCXA 5FUCE 3ZSSA 1FG2A 3QISA 3GUTB 1A7OL 4Y16B 1XF4A 4OSUL 2N4IA 4NWUL 3IDMB 4J3VA 3HG1D 3Q5YA 3LHPL 5ANME 3AC0A 2AJSH 2YSSA 1QFOA 3MREB 3OSKA 5FO8A 4PIRF 5F7DB 5DD5L 3VI3F 1DQJB 4U6XA 1IC4L 1CDIA 3CH1B 4XPAH 4HH9A 5MEOA 3RGVD 5GRJL 3LS4H 5D1ZB 2XV6B 4LLUA 4XP9H 1T5WB 4J7RA 3S35H 5EUOF 3VFOA 1FO0A 3GMOB 4ZAKC 3OF6A 1FV1A 2N56A 5C0GA 3PXJA 5TQ0L 4Y1AE 5EU3B 2B0SH 2Q7YA 3GIZL 3QR2A 1FN4A 1GOHA 1A1NA 3O6LL 2D7NA 4OCNC 3W9DB 4ELMA 4GRWF 1IGIL 2CIKA 3BZEB 1A3LH 2J1KA 1MREL 5HI4D 4FRWA 1QFUH 4G80A 4PJ9B 5JMOC 4MD4B 4D9QD 1B2WL 1N59B 3HZMB 4AH2B 5IF0B 1WZKA 4WWKD 4Z7WB 1LO4L 5FUZL 1NCBL 4O51A 3ESVF 3CVHA 1WC7A 4OIAA 2CK2A 4ZTPH 5IVZA 4PPTA 4NQXA 1QACA 4K8RL 4HUWB 4S1SH 3CXHK 4KKCD 2A9ML 1XR9A 1YC8A 5B21A 2VABA 4K3JL 4MJ5B 2OL3B 3O9WB 1UWGL 3GM0A 3V7AE 2EYTA 4Y4HC 1CG9B 3BSZH 1ITBB 1DQLL 1JPFA 3HLAB 5FGSA 3VFUA 1AD9A 1IRAY 1J8HD 1HSAA 1KN2H 3WDHA 1K8IB 2A2QT 3OX8A 2WBJD 1BVLB 1DQQB 4MXWL 1NEZA 2W60A 3TYGH 5DVLA 5K9KA 1F11A 2AVGA 3MRDB 5HHXH 5JHDA 1MQKH 2VKXA 1FO0H 5IG7B 4KMTL 4Y88A 3DECA 1WCBA 4HG4J 2H8PA 4I0PB 1MFDL 4CADA 4BYHA 2QADB 1GGBL 2DL9A 2NR6C 1EMTL 1KXTB 2HKHH 3EFDH 1QLEL 3D39B 2MPAH 3MLUL 4MJIE 4S1QH 3T0EA 1T3FB 4HLZG 4Y8DC 3W39A 5FM8A 1F6LL 4PJ5A 4TSAL 1CBVH 5M95B 2MNUA 1IMHC 4HIEB 2F54A 2JELH 1HINH 1S9KC 1ND0B 3S98A 4PLJD 1JHLH 3TNMA 3WHXB 5IT2L 2EDHA 2KH2B 1FDLH 3CVHH 3QUZD 3VFPB 5A2IH 2Y7QB 1IGML 1KGCE 1KPRA 2ADFH 3G6AB 1J0HA 1SVZA 4L4TA 3UTQA 4LQ1A 5GGUB 3KYNB 1R3LB 4PRHD 3GMLB 1JPGB 3CX5J 4J12A 4OLVH 4RBPH 3UTPD 3OKDB 2J8UA 4M5ZH 4QT5A 1CLOL 2XY2A 3RBSA 3A67L 1C1EL 4G9DA 3GJFK 4X6DA 1UT9A 2A77L 1UEMA 4ALAH 4FQ2L 4FXGB 4P3WA 3QCUL 4FTVA 4XVTH 1MCCA 1CFNB 2Q3AA 3UPRB 3ZKND 1LO0H 3OTTA 2YKLH 5JZ7C 1YUHA 2AXFB 2DL2A 3FO2B 3MV01 5FO9A 1YEKL 3VGAC 2FNBA 1IKNC 5EIVA 1RUPH 2C5DC 1U2HA 5GRWA 1TZHA 2KBGA 2Z92B 3P73A 1INEH 4NQCD 5EIQA 2O93L 1JGEB 5AZ2L 4XCEB 5T1KA 2VNCA 1NDGB 5TQ2H 4YFEA 1P4BH 3FB7B 3HE6A 3PQYB 1BD2D 4GLRI 1P4IH 5HHQB 4K2UH 1RUML 1A6PA 1D9KB 5DUMH 2VC2H 2ADJA 3H6JA 1E6JL 3BE1H 3MV9A 5DMKB 2FBJH 3U4BL 4DZBB 4POZD 3HR5B 4J6RL 5I1EH 2NNAA 4LLVA 3TGXA 3ESUF 2WANA 1CU4H 4L8DB 5HVFB 2UUDH 2X5PA 2ZUWA 4G5ZH 2NY3C 5E8DH 3MGTB 4KI5E 3FT2B 3MROA 2NW3B 3FQUA 1JGVL 3WN5A 1Q0YL 1Z9OA 1KACB 3P4MA 5DJCB 2AW2A 3QQ3A 4AT6A 2ATPA 1G0YR 3FOMB 3M45A 4ZFFB 1NBVL 1ACYH 2WAHA 4GJTB 4OM1L 3I02B 1C5DB 4KRPB 3MJ9A 3K3QA 5EU5B 1PKQA 4D0CB 2D7MA 3DHJA 4IOFC 1BQLH 3TZVC 4Z0XA 5CAYB 4QXGL 1GGYA 4PJIB 3ULVL 3MUZ1 1KCSL 1Q72H 4P4KD 1HH9A 2N7BA 1WT5C 1KIRA 3GSVA 1AP2A 1BQUA 4HUUB 2VE6B 5H37H 1IGCH 5BVJB 4P5MB 4YGAB 3EO0B 4PGEB 3V6ZA 4IRSA 5IESH 1OD9A 5IVXB 3T4AB 2GY7B 3PIQA 1BGXH 4O4YL 2BSED 3EDDA 5IHUH 3LN4A 3VXRD 4NM8L 2R39A 4OV6F 5HGDB 2AABL 4K3GA 1G7IB 1S7TB 4MVBD 2V7NB 3EHBC 5I2IB 2FLRT 4ZOBA 2ZUQB 5D7KD 1ITCA 3SKJH 4XCYB 2QSCH 1I8KA 2AKRA 2VJXA 3MLYL 4ZYKB 2IPUK 2H3NA 2EDBA 5IFAH 3RIFF 4LPWA 4NRYB 4ZUTA 1UJ3B 3LKNA 3QJFA 4UV7H 4NCC2 2SEBB 4DQOH 4JZJB 3KHOA 1HSBA 1CD1A 4QHNB 5LBSL 5EFIB 2VZUA 3C6LC 2IJ0C 2IBGA 5ENWA 4LLQB 3MRCA 5I1HL 3SDCB 1RUKL 5HGAB 3G6JE 2Q20A 3MJ9H 4P2RD 1T7XA 2X4UB 1XF3A 3RKDD 2VSCA 1UXSA 4HUVA 1QBAA 4R6UA 5M94B 3KAAA 2A83B 4KHXL 4YH6A 3KPMB 2WNGA 2W59A 3AREB 4Q9CA 3NZ8B 1OLLA 1ADQA 2FDBP 3DNKA 1BMGA 3N85L 4U7KA 2VQ1A 4DUXA 4LHUA 1F00I 5FYLL 2BC4A 5F9AC 5TF0A 1NGQL 2OQJB 2Q87A 1RUAH 1FE8H 4JRYE 4XHQA 2LTQC 3RU8L 2FH6A 4MXQC 4ZFZB 3MRHA 4IIQC 3F6LA 1G9EA 3FO0L 1ZT4A 1R5WB 5DQDL 1I1AA 5DA0B 4I0KA 3WNKA 2VLJA 4JANA 3MRFB 1A6VL 3D3VD 5FYJH 5B3JF 1M7DB 4S0SD 2AP2A 1D5ZB 3L7FA 1D5XB 1VFBB 4JZNA 4R90H 2NCMA 2OJZH 1LE5B 5FYKH 4P49A 3BP5B 3NGBC 3BH8B 4ZDHA 1KB5A 4OIBA 1QLFB 1BVZA 4KWUA 4U1HA 4JFYB 2PXYD 4RIRB 4PJ8C 2GK0B 1OHQA 2FLBT 5L0QC 3MNWB 3HE7A 3NN8B 3Q1SH 1MRDL 1YEGH 3U1SH 3PGCB 4P99A 1S78D 3CDCA 2P8PB 1KFAH 1LNUA 1GL4B 1OB1A 4GBXD 1EEZA 2D03H 3LB6C 5ANMA 4LCYB 3B4NA 1NGPL 1UC6A 2WWKO 5I1AB 3ARFA 1ADQH 4KTYA 5T3ZL 1II4E 4JPIB 5DT1H 5C3TA 1QR1B 1TNMA 4RGNB 3NZHL 5I76B 4JQIL 3BEWB 1T04B 2IPUG 3Q6FA 4HG4K 2VZOA 4S1DD 3T0AA 3D0LB 3PQYD 3VMNA 1KTDB 4FQCH 2ERJC 1MRFH 2V5MA 2BHZA 3PXHA 4H1LB 1IM9A 5F9JA 4PP1C 4PJ7B 1JHTA 4JFOA 3TYFA 1MVUB 4LSPH 5HYIA 3DRQA 3BGFB 4Y1AA 1OOAA 4Z8FH 3TJEH 2X09A 3UC0H 3PNWA 5BXFB 5DTFA 3MBXL 3ZKXC 5IEKA 1MFAL 3I85A 1TVHB 5TDOA 2E7HA 1Q0XL 2VIRB 5LGKA 3BZ4A 1K5NA 1P7QB 4XWGH 3DHMA 2ZCHH 3MOQA 4HQQH 3BT2H 1F8TH 1U3ZA 2ED9A 4XMKL 1WIPA 3BGAA 1BQHA 3LKOA 4MDIB 1P7KA 2R8SH 2E6JA 2AQ3A 1MIMH 4FNLL 5SWSB 3LIZL 3ARBB 3MRQA 1MH5B 15C8L 2ARJQ 3WXWH 1QZ1A 3VRIB 1RZ7L 2I9LB 1JRHL 2JIXA 4YHLL 5C0BE 4JG0L 4R97B 1AQDA 2YMXH 4LIQL 4POUB 1CZ8H 4HCRL 3QQ9D 5IOPA 4M43H 1J1OL 1KJ2A 5KS9B 3C5ZD 4XAKE 1Z0NA 4HBCL 4M62H 1JNHB 3RY6A 2FO4B 1KTLA 5EBWB 2B39A 5D6CA 3VXTB 4Y19D 1N6UA 3RJQB 1F5WA 5F7EL 4M61A 3CUPA 2M8XA 4YHZL 5ERWA 4GQ9H 2YBRA 4M7LH 1TZIB 4UB0L 5C2BL 5HYEA 3RVTD 1T2JA 4XCCH 3QZWA 2DWDB 4RAUA 4YNYB 5DZNA 5HGBB 5FECB 3PGFL 4I18B 8FABB 4LSDA 4NZJA 3AU1A 4KKBC 1X5FA 2ZWLT 3LD8C 3KPSD 4MJIA 2DLFH 1ZHLB 1PD6A 1VEMA 3WIIL 4B50A 1IEAA 3NIGF 3PP3H 5IB2A 2P47B 2QV2A 1BZ7B 1I7TA 4G6MH 4P46D 4XVUC 1R3IL 4OV5B 3OAZH 3STZA 4HJ0C 4Z7VF 1KPVA 1MCKA 4NP4L 3D25A 3MFFB 4W4OC 1KCVH 3R06B 2HT4C 3T4YA 1KT2B 4X9FA 2Y6SD 3VCLA 4G6JH 1ZVSA 4HZLB 3G5VA 4D9QE 1HK6A 5ICXB 1T2QH 4UUJB 1G84A 2YA2A 1XGUB 3GI8H 3HPLA 4OZIF 3CFDB 3WFBL 5GS3A 3MRBA 3RA7H 1QLRB 3H7BB 3IAQA 4I3SL 2NY4B 4HUKB 4MB4A 1CFVH 3PL6C 5EU7C 3C6SA 4X7EC 5I74B 5I1LA 2AV1B 3BPOC 3H7LA 5LG1A 2C3HA 1EHLL 4MCZB 4KK6D 2DQCL 2C4FT 3WLWC 4I4WB 3L7EB 3I3EA 2RQ8A 1JL8A 1IM3B 3BZDA 4RA3A 3SHSA 1J8HE 4JY5L 4NO2A 2NY0C 3BGMB 4QHUA 2NY5C 1QSFB 4XXDA 1ZHNA 2APBA 4RX4A 2PW1A 3O3EA 1S3KH 3V8OA 3SPVA 4HKZB 5IMLA 4HIHA 3IRPX 5AWNL 1GPOL 3DXAD 3TLRA 5BMFH 1H5BC 1QEWB 1K8DA 4LNRB 2R2EB 5IBUB 4FQXB 2VDNH 3NFNB 2DB8A 3OJDA 5B38A 1MFEL 1JZ7A 2J4WL 3TV3H 3QHZL 1M71A 5JW4N 4L8SC 3TVMB 3EUUA 1V7ML 3SDAB 3BMWA 5E7FA 4ZUWB 1NMBL 3DJ9A 2F8VA 3ISWA 4GW1A 3X13B 4NJAL 1CK0H 1U8JA 4XTRC 3Q6GL 2GFBA 1UEYA 1A1MA 2XWTB 1ZOXA 1NGZB 3MV7D 3LQAC 1LEGA 1P6AB 1MOEA 3OV6A 4O2FA 1I3GH 1RI8A 3P30L 1YEIL 4DUVA 3G5YA 4F2MA 2MHAA 2CLZA 3U79A 3PJSA 3CFEA 3O3DA 2OZ4L 5IBLC 2ICWB 2YUXA 4AIZB 2P8LB 3S88H 3U46B 3RVWD 3RX8A 3ARPA 4N90D 1FFNA 1XGTA 3ROOA 4LCCB 3ZSTA 4OCXH 4YR6B 3ZT7A 2VXUL 3BP6A 3PWPB 5IEHB 5I1JH 1RZKH 2EICA 1D3CA 5EORH 1VACA 3BIKA 3AXLB 2B4CL 2C1OA 4LSRH 4M1CD 2O5XH 5F70A 3BO8B 3ARDB 1K6QL 3QUMA 3DX7B 2MQCA 4BSWB 4P5TB 2ZPKH 4X5XB 4WO4B 2IPTL 1AKJA 4TNWF 5JQ6L 2JCCB 2EE3A 3OL2A 1HXYA 3JTTB 1VGKB 1NLDH 1YY9C 4M02A 2XZQH 4HKXA 5EC1A 3WN5C 4KTEH 5HPMB 3QXTA 5IMMA 4PLKC 3LN5B 3GNML 5B39G 1OTUD 3SE3A 1BD2E 1ED3A 2OTWA 5CZVH 4LCWB 2CUMA 2FYYA 1I8IB 4X6CB 3FQWB 5D71L 5FM5M 3VXMD 3P9MA 3CFCH 4AG4L 5FF6B 4IM8A 3UYRL 2VLRB 2AS5M 5J3HC 5LKNA 5E8PA 1IKFH 1HI6B 2GUOB 5E6IC 2CDEB 4HV8A 4YQXH 1PW3A 1X5JA 2ICWI 3S4SG 1XGYH 3G6JA 4IRSC 1JYXA 5C1MB 3P9LA 3WHE0 4Y4FA 4MHHG 3ULVF 1U93A 4HPOH 1IT9L 5D2NE 3BHBA 1Q9OB 3ARGB 5IHLB 3OPZL 3C5JA 3MJ8B 3IVKA 3U30B 4U1KB 5EH1A 3TPUA 4PB9H 4HWEH 3N1GC 5IMOB 2Y9RT 1L0YA 4JRYA 5E08H 2VSDA 1YNLH 4B5EA 4ORZC 3KJ4B 4Z95H 1I8LC 3LCYA 4KKAC 5F1KC 1U8HA 3TT1L 3S36X 3QUMH 3RL2A 4OZHF 4MD5A 4KK8D 5DVNA 4WJ5B 1E4XL 1U95B 1W0VB 3N1PC 3O6KL 4X80H 5IW6A 5DQJA 2ADIA 2NY7L 1Z6JT 5B4MC 3IRZA 2NY1C 5I1IL 2Z35B 1R0AH 4RQQA 4WU7B 1NANH 3EJZC 1TIUA 3BX7C 1QFHA 4UQ2B 2ILLA 5CBEA 4W6YB 3DBXB 3NACL 4P23A 1TQBB 4KDVA 5D7KE 1DSFL 4ZOAA 1VKXB 1HH6B 4CMMA 4H25A 1NCWL 4LSTH 2HFEB 1RV6X 3B5TA 4RDQF 4JKPH 4OQTL 2OSLB 2WUCL 1GIGH 2L0DA 4IRJC 5SWQA 1T2XA 3LRSA 4N8VB 5KN5B 2HP4A 2V7HB 1FIGH 5K9JH 4NZTL 3VI3E 3T08A 4Q6IC 1IGTB 5D93B 1UACL 2DTML 1IAIH 4JVPA 3TBSA 4MDJA 4APQA 1EVTC 2H1PH 5IB5A 2YEZB 3DPBA 2X9YA 2XA8L 4K07A 4PJBF 4OLYL 3OXRB 5HGGS 1VDGA 4IRZH 1FL3A 3X11B 2A6JB 1NMAH 2QQNH 5IGXH 3HRZA 1TNNA 2KPNA 3NCJL 4KVNH 3G5ZA 3CFJA 4YHIB 4P2RE 5EUOE 2DQIL 3UO1L 3LV3B 1EAJA 2EH8H 1FCGA 1TPXB 4P2YA 3MJ7A 1A9EA 1VFAB 4KUCD 2BERA 2B5IC 1A7NH 1ES0B 2WBWB 3HNVH 1KJMB 2HKFL 2XTJB 3W81A 3TO4C 4GW4B 3HZYA 4BFBD 5TDPA 4TSBL 3AS2A 4K8RD 3QEHB 5LQBH 3GMRB 3E8UL 4KDWA 4LU5L 5E5MB 2W0FA 1NCDH 1ZVYA 5HHNA 3SDAD 5IFJA 4LAQL 3SE4C 2CKBA 2XN9D 4HEME 3FQXA 3MCG1 5I17B 5E5RB 3VFRA 4RRPG 3G04A 2E27L 2V17L 2D7TL 1N5YL 1EJOL 5DR5L 1RZGA 1BVKB 3FB5B 4CBPA 2X4RB 3D3VE 1D6VH 2WQRA 4PV8A 1CFBA 1T22B 3P11H 3Q5OA 3QDJD 2HVKB 1OP5K 1AGCB 1NSNH 3DMMA 5GZOC 1OM3H 3A0OA 2QKIA 1AQKL 1JPSH 3CDGB 5JORA 5CJQH 4PGBA 1NKRA 1MPAL 3LS5L 5E99H 1A6AA 2R0LL 4OKVA 5BRZB 3I9GL 5AG9A 3L3JB 5C0BA 4FFVD 4O2EA 4LPUA 5IK3A 5D6DC 1MAKA 5HYJB 1MCPH 4ZO6A 4QGYA 4EI5D 2AJUH 2HH0H 3PWPD 5KSAC 3FTGA 4A6YL 1KULA 3VJ6A 3WFHB 4E9LA 4HC1A 4V1DB 1FCCA 2PUQT 4M7KH 5IKCB 1NUNB 3TBYB 2NW2A 1Z2KA 3ME0A 2AJZB 5D1XC 5DJ0B 4S10A 4RA0C 3JVGA 4NNPL 1HHIA 3ARDD 1H15A 4H5SB 1T7YA 1MCRA 5T5NG 4Z6AT 2IBZX 4M1GH 3IJYB 2YRPA 4O58L 1PGRB 4XB7A 4G6AC 5IB4B 3I6GB 4JO3H 3STLA 4ZXBA 5DEFB 1ERNA 5ALCL 2DLIA 1QBBA 2EDOA 3RGVA 3TIDA 1L7IL 4MSWA 3PQYE 4OCWH 3I3DA 3RX5A 2CKBH 5DYOB 3QG7L 4PREA 4LLWA 1QSEB 3U0TB 4F33B 5CKAA 5IB1B 2VN7A 3STBA 1Q9KB 3IFPB 3GK8H 2EIBA 4DKEH 4YIQA 2VLRD 1BM3L 2B2XL 2ZCLH 2DQTH 4WW1B 1ZTXH 2AEPL 4AIOA 3VG9C 1I1YB 2G9HA 3RVVD 3V0AC 5DJ8B 5DRNB 2QSTA 4NKDA 1U8IA 1PX3A 2IPKA 5MENB 3B9EA 5DRZB 4HIXL 5GRYA 4R0LA 3S37H 1RZ8A 2ARJB 4WW2C 5KANI 3VFTA 3MLZH 1KCUL 2NTSP 2FEDD 2Z4QA 3TFKC 2XQYK 1FHGA 1TQCC 1YN6A 3V52L 3VE0A 1R3HB 1HCFX 1B0GA 1U8OB 1E4KA 5I75B 2ENSA 4EDXB 3NABL 5HPOA 4HC1H 1ZLWK 4PJEF 4OLUL 3JBG7 1DLHB 5ACZA 1PX4A 4NQSB 1Y0LB 3CGTA 2DF3A 1AE6L 3MRNA 5HI3D 1RZFL 2X42A 1FBIL 4DZ8B 5C0FA 3E2HB 1J8HA 4Y19E 4HS3A 4G8GB 2WBJA 5JOPD 5DD3H 4BKLB 5GGSY 3V4PL 1PBYA 4ONHB 2ZSWA 1HOCB 3DO7A 4YHNB 1HHKB 5FK9B 2J6EL 2I07B 2IC2A 4TULH 2BJMH 3K4AA 4Y5XC 4ZD3H 1MCWM 1LP9F 4Q58C 2Z91B 4QYOA 1I1RA 4TPRL 1D7FA 4Y0GA 2Z8RA 5BV7L 1IEBB 4NO3B 4GKZB 3BJLA 1IQWL 3GEWB 2NZIA 4D9RD 3UAJD 5C86A 1D5MB 3MOAL 43C9A 2AERT 3QI9B 1NCAH 3GSNA 4F7PB 3ULVD 3BAEL 1JHLL 1CGSL 1KC5L 4QRTB 2QQLL 4FZ8H 3KPLA 4B0MM 3O2VH 1GAFH 4HXBH 3AY4C 4U1GB 1AGDA 1VENA 2HT2D 1U8PA 5D7JC 5IV2B 2IAND 1YMMB 3O11B 3SBWC 3QUZA 3KR3L 4NO5A 4KK5D 1MJ8H 4U3CA 2X4OA 4I3GA 3RWFB 2VXVH 3L5WA 5K59E 1ZGLM 1I3VA 1I3RB 1FFPB 2EZ0D 4LPTA 3RAJH 4LF3A 1WZ1H 4CVZB 5I71B 5GS1C 3DSFH 2F9BT 1HHGB 4JB9L 2X44D 1FZJB 3JWDC 1FZMB 1KIPB 1UVQB 1MY7A 4DW2H 5EPMA 3O4OC 5DVMA 1DZBA 5F3HB 2P44B 3Q2CA 2OP4L 4K7FA 2AEQH 2R1WB 1RUPL 3CFKB 3PWNA 5EOCH 1DVFB 3GB7A 3KPOB 4PJGF 4N0FB 2JF1A 2XQYG 5J1TC 4YUEL 1E27B 5ADOL 4GRMA 3M1BA 3VWKD 4IDJH 4OJFH 4ZFGL 5ICYB 4OIIL 2Z31D 4XMLH 4TSCH 1RJZA 3FAXA 5TQ2L 1FVDA 4ONGL 5KVFH 1A21A 5HYSA 3QFDA 1IQDB 4L8BA 4L9DA 1NFDF 3GSNH 4PRIB 4UU9B 5DUML 2VC2L 1KPUB 4ERSL 2NY5L 1BD2A 3DXAE 3LKQB 5F1IB 3B6SA 1F3RB 1NMCC 1V3JA 1EHNA 1C5BH 5HYJD 2XFXA 4F7EB 3RDTC 1M7XA 1KV3A 5FYLD 1MCOL 1CL7L 3HKFA 1TJIH 3GDBA 5AUMB 4V1DD 3EJYD 3IDMA 1HKFA 3U0WH 3MV8B 3GSQA 3SDXB 5DJXB 2VN4A 1GGIL 3MREA 2EYRA 3QEQD 2F58L 4R4FL 3C8HA 5F7DA 1HILB 1JYWA 5JOFA 5TFSH 1NC4D 1BX2B 1XF5A 3VFVB 1DJSA 3MV7E 4UTBL 4KVCL 2K1MA 5D2NA 5BO1H 2BRRL 1K4CB 3EYQC 2RB8A 3U9PL 3P4NB 5SX4I 4GSDH 1RFDL 1VFMA 4JHAH 4WTZA 5BVPH 2J3SA 2AI0H 2W07A 3HZVB 5D1ZA 3ZT6A 3BKJH 5L8KB 4CNIB 1T5WA 3LQAL 4DCQA 1QSED 1OF2B 2W9EH 1ZGLP 3GMOA 4NO0D 4PJ7E 2CJUH 1ZGLB 5D1QD 2DYPD 4N90E 4P4KA 5B3JE 3EYVA 3GMPA 5JIIA 5JUEH 4WUUB 1JNNH 3W9DA 3N50A 5I0ZA 5DO2C 5F9DC 4XPBH 5FCUH 2CUHA 3ARYA 1CR9L 2XTLA 1OCWH 3CSPA 2DQGL 1Q9WB 2H2SD 4MD4A 2EDKA 1UKTA 4WTWA 4F58L 1N59A 5T1LB 1E6OL 1YN7B 5IF0A 2X4PB 3CC5B 5T3ZD 3IFNL 1QSZA 2FIKB 3KG5A 4BM7A 3BW9B 3E3QE 2QSCL 4RMSA 4RSVA 3V4VL 1J87A 2XWJB 4HUWA 2YC1B 4J3UA 1A7QH 2H9GB 4WI9A 4HIJA 3ECBB 1ZAGA 1P2CA 4K7PH 2OL3A 1L9NA 5AZEH 4D9LL 2DQDL 2HN7B 4R3SB 4LSQL 3VXME 3HLAA 2R15A 4AIXA 3P3YA 5JO5B 4YHOL 4G8GD 1BVLA 3RX7A 5ADPL 2UZIH 4LEXH 4M7JH 4AL8H 2MCG1 4H8WC 5EUOA 4P2RA 2OI9C 1WZLA 4ZFOL 5IG7A 4C59B 4HXAH 4I0PA 2A1WH 1U8QA 2EE6A 3U7YH 2ZUYA 5KVGL 3PDGA 4OLZL 4OUUB 5DMJB 4YFLF 1XCTB 3RTQD 4O5LL 4KFZC 1ZXQA 4JFDB 4Y4KD 3S34H 4GKSB 3BD4A 2J7LA 2DKUA 4DTGH 3QI9D 3ET9F 2AGJH 1HWGB 1TETL 1MHCB 4RNRB 3WNLA 4NZRL 2QSQA 2FX9H 5DDHA 4HIEA 3S35X 3OKKB 3QCVL 1Y6NR 5IW1B 4X9HA 4YC2B 1CDGA 5SX5K 3ULUL 2HWZH 3T65B 4APQC 1FZOB 3D3VA 2J88L 4I77H 3VFPA 3K80A 2OLDA 3TA3B 3QIWC 5FYKL 4QWWC 3DGCR 3ELAT 4QRRD 5GGUA 3KYNA 1R3LA 4EI6B 1DLFH 4MA3A 3GMLA 3UJIH 1FLTX 1JPGA 1OLZA 3LH2H 2OL3H 1AHWC 1F90H 3OKDA 5GGTL 4HWZB 3FO9B 4K3HA 5I30L 4HPYH 2GAZA 2IF7A 2PXYA 4JHZA 2B8OT 1OAXL 2QR0B 4QNPF 4MJ2A 1JYNA 3S96A 4FXLA 2CLRB 1VCAA 2VZ3A 4UT9H 3H0TB 1MLBB 1R24B 1F4HA 5TDNA 1CFNA 3UPRA 1CXEA 5F7YC 5I8CB 1Z9LA 5HHOD 4L3AA 1OP3K 3F58H 1Y18B 4PJDF 2DIJA 2AXFA 1XIWD 3EOAB 1WBZB 2MWCA 5EU6D 3PWUA 4UV4L 1LWRA 1L7TH 1MHHB 4ZAKD 4HKJB 5EO0B 3WKML 2NX5B 1JGEA 3TIEB 3C5SA 3NIDF 2D7OA 1WLHA 4HUMB 4KHTH 4XCEA 4X9IA 5FHAH 1Q9LA 1UM4L 3SCMB 1CE6B 1FC1A 1NDGA 2G75B 3X12B 2X4SA 3PQYA 2QQQA 4QLRA 1IGJA 2RBLA 1D9KA 2JJVA 1H3WM 5F8RC 3HAEA 4PG9B 2W92A 3B9KC 3HI6L 5F6IC 5C8JB 1T1ZB 2B7DT 4DZBA 1NCCL 2A6IB 3GI9L 3HR5A 4J3WA 1LGVA 1OSPH 1KCRL 1JMZA 2BDNL 2O5YH 3WXVL 2XZZA 2FATL 4DGYL 3QHFH 5E1HB 2RIKA 2KKQA 1T0NB 1HHHB 1I7RB 2CO6B 2PYED 3FT2A 2OXGA 2NW3A 1S9VA 3G6DH 4X4XB 4EN3C 4X5WB 4JPKH 5DJCA 3D0VA 4TVSa 1UXWA 2ZOKA 3QDJE 4ZFFA 2PO6C 2X1QA 4Y4HD 3QHTC 2O5ZL 3L1OH 1SYSA 2YN5A 3GGWB 3NMEA 3O0RL 4JFPB 4OZGF 4CVWA 1UFUA 1NCNA 1C5DA 4PYHA 3LMJH 1NBZB 3C6LB 5EU5A 4D0CA 1BJ1J 2DM3A 3QA3B 5GJSH 4RISH 4KZDH 1DBKL 4RFEB 4QHKI 4Z7NE 1A0QH 3QUYC 4K3EH 2E7LA 1SM3L 2VE6A 1OGTA 3C8DA 3MLXL 4P5MA 2F5BH 3F7PC 3C5ZA 3PWPE 4N1HB 4PGEA 3QNZB 5CWSB 3H9SB 4EVNA 1EVUA 4ODWB 1NCTA 3T4AA 5D7LD 3SGJC 3FMGL 4EQ2A 4JPWH 2VDML 3BKYL 1U91B 3IFLL 4Y19A 2NR6D 2HFGH 5I16B 3H8NA 4XNUL 2X1PA 5T1LD 5HGDA 5ID1B 4PGCA 3MBEB 1S7TA 3N06B 4YXKL 3OHXA 1N0LA 3SOBH 5LWYL 2GTZB 2CGRH 3HAEH 3HI5L 4ZS6C 4JHWL 5I9QC 3BP7B 2JCCE 1N64L 4IIQB 4XPTL 2DLFL 3DX8B 4XCYA 4NGHH 3V6BR 5KAQG 2MCPH 3OGOE 5SWZB 1Z5LB 4ZYKA 3LPGA 1K4DA 5J12B 5DEGB 3CFBB 1DN0B 3MRKA 4LCWE 4P46A 4L9LC 4X6CE 4LFHD 1CFSB 1ZWIA 4QHNA 5DVKA 5CJ5A 5EFIA 4MMXC 1N3NB 2CQVA 3JV6B 1FG9C 3TCLB 1QBLH 3WLBB 2VLRE 3VFWA 2BVUA 4U1LA 1FAKT 4MA8H 4NQDB 1BECA 1ORQA 3WFCL 4A6YB 3P40A 5HGAA 4ZQKB 3UYPA 1SYVB 2Y72A 4N9OB 4Y5YC 4RAVB 3O6ML 4GW5A 4PJHB 1KEGH 4LLMA 3GI8L 1X6NA 1FNGA 3WNPA 5LJYH 1BFOA 4IOSD 5L8LB 1EK3A 3KPMA 2XQBH 4HT1L 2O61A 2AJ3B 4XBPA 4F9LC 4LDLB 1JZ4A 1DL7L 5JZ7D 4GXVH 1N6VA 1UQSB 4M8VA 2OR8A 1OAZH 25C8H 1NGXA 3X3GL 1S7UA 3QDAA 3DOSA 1QFWL 2B1HL 4LSUH 3K46A 2DRUA 3AB0C 3L3HA 4CUCA 3BDYH 2NXZC 1DBBL 3MA9L 1YEDB 4OBSA 3Q5TA 3TBWB 4LLDA 4JDVA 3RNKA 3BN3B 1G7QB 2VR4A 1D5XA 1VFBA 4XPHH 5JOPE 1QBMH 1AFVL 2FX8L 2XICA 4XVSL 1XH3A 3BP5A 3KXFD 4ODHH 3BH8A 4P59H 3SGEI 2QTEA 4KTDH 3WMSA 1XZ0B 4NZUH 4HBQA 5KW9L 4JFYA 2BNQD 2R23B 1FQ9C 2GK0A 3DXAA 1PFCA 3WNNA 4H88H 4NOFA 2CKNA 3QIUB 2Y06L 2NY3D 5MEPB 4ZODA 5DI8B 4XNMB 4YBQC 2CH8A 2XG4A 2BVQB 2ICWJ 3D1MC 2R0KL 4R2GC 4X6EA 5KSUB 3EIFA 1LD9B 1L9MA 2C4XA 3QWRA 4MA1B 3ULVE 1HQRA 5C08B 4QXUL 4YEEA 5FB8B 2GCYB 5I1AA 5CZXC 2IAMB 2F5AH 4G6FB 4IOFD 3TZVD 4RWHA 2D7QA 1DQML 1Y6KR 1A7RL 1QR1A 2IANE 3MV7A 3QXWA 1K3ZA 2NX5D 4E42B 3WE6A 1I85C 2HRPL 1VGEL 4OFKA 1GJIA 2A74A 4BQ8A 5D70L 3D0LA 4YO0B 2XZCL 1KTDA 5B8CB 4N1EA 5J7CC 4H1LA 5IFHL 4WY7H 4JQXA 4CDHA 4RZCB 4ZNEE 4PJ7A 1CVRA 3KS0H 2D4FA 4FQJH 2W9DL 4MA7H 5ACMA 2PF6A 3V2AR 5EWIH 2HFFB 4I5BB 4NUGH 4HS8L 5I1JL 3EHBD 1NUFA 5BV7B 4HX1A 1FLRH 5E2JA 4I8DA 2K7QA 5BXFA 1LDPH 5EBGA 2P24A 4F9PC 2VDKL 1GOGA 4OGAC 2XT1B 4K94H 4FMKA 3RWJB 1TVBB 4Y16C 3OKMB 5A3IC 2VDRH 1SEQH 2VIRA 5DXWA 2CMRH 4M8QA 4N5EC 2BOCA 3JWDL 3O41A 1YPZB 4AEIL 1CQYA 1TENA 2XYCA 4W81A 3VH8G 4HJGA 2FJGB 3UTSB 3ARBA 4JO1H 3C6LD 5DF0A 1MH5A 4DKFL 3GSWA 4FQ1L 3VRIA 4PG2C 2I9LA 1REIA 5BRZE 3P0YH 1KNOB 4PJBE 4FQPA 2J8UF 1PEZA 5HI5C 5HYJE 1JN6A 5FYLE 3CNKA 4LGPB 4M6NL 1J1XH 4XH2B 3MLRL 2Y07H 5DUBA 3VXMA 4V1DE 3GJEB 2BXYA 1BIIA 5EBWA 3ARXA 1FL6B 5I1KL 5I15L 3U4EB 2HTLC 4KI1A 3HUJF 4OB5L 3PDOA 2CDFA 1HWHB 3IETB 2W0PA 3QEQE 1TZIA 3DYPA 5HDOA 4ZS7L 4H1LH 3I2CH 3BPOB 2HVJB 1GCFA 1W2KT 1HKLH 4MXQD 1JFQL 4PJ9C 3BRFA 1MCQA 2DWDA 4XC3H 4YNYA 4HAFA 4I18A 1YNKH 3KPQA 5C0IB 1JNLH 2VISB 3WDIA 4IMLB 3AM8A 4NWTH 3GMNB 1V7NH 1IAKB 1NC2D 3ZE2E 4YDKH 1YJDH 1ZHLA 2FJFB 4PJAF 1RMFH 1N0XL 2D9QB 1QSEE 5EC2A 4GQPH 2A6KA 4OV5A 5E2VH 3FQTA 2DQHH 4WGWB 4QHLB 1AXSB 5F89B 1UWEH 4PRNB 2YPKB 5F3BB 5FOJA 3MFFA 1FPTL 4U0QB 3O9WC 1FFQA 4AEHL 1HQ4A 3DSNA 2X89D 4PJ8D 1MSPA 3HNTL 2BVEA 2R56H 4XBGB 5L6YH 4HZLA 4XNYH 5IUSA 4NN7B 1G1YA 3BRGC 3C08L 1I7UB 3UDWC 1A5FL 1P7HL 1C16B 3MNZB 5T3ZE 3SKUD 3VGFA 1QLRA 3H7BA 3R8QA 4JKPL 3LB6D 4YDJA 5CSZA 1A14H 1MJ7H 5C0NC 4I0PC 4L5FL 4DN4L 3WIHL 2QADC 2AV1A 2XPGB 3FRUB 4FFZH 2EDXA 4MCZA 5EO1A 3FRPA 3S3SA 2DQFA 5HY9B 4C57C 2XZAL 1IM3A 1CE1H 4J1UB 1OAYL 3UBXI 3HPJA 3LZFL 1S5IL 1X5IA 4G8GE 4PP1D 4UINH 4JLRA 3K1KC 2L7JA 1A6TA 5CUSH 4RMQA 4X83A 5HHPB 1F45A 4X6FB 3HNVL 1K2DB 4MD0B 4XP4L 1OW0C 4JRXB 4S1RH 1F3DH 1EO8H 4LARL 1OL0A 1Z9MA 2WINB 3BKCH 4NC1C 4JKKA 4UBDC 4CU7A 4H8WL 2K3TA 1DANT 2ZUTA 1QA9B 1PSKH 3FQRA 3NFNA 3W5MA 2VWEE 1A7OH 3QDGD 1YY8A 4ZTOL 4OSUH 3IGAA 4NWUH 4QRSA 4NIKB 1ZLSL 4YXLL 3LHPH 2FWOB 5JTWA 3SDAA 4LIQE 1IVLA 3ZKQD 3LN9A 4OZIA 3LQMA 1QSVA 2DLEA 3QNXB 4HEPG 1WBYB 5DD5H 12E8L 3X13A 3HRPA 4TNVF 2XWTA 3F7YA 1YMME 1IC4H 2D0FA 5DA4A 4AMKL 1A2YB 4PJEE 4YPJA 2BSSB 5GRJH 4P3DB 3QDJA 4KDTA 5INCB 4QRRE 5MI0B 5E99L 3ETBF 5HSFA 2V2WB 4P57B 3QIBB 4ZFOB 3S8WA 2VH5L 2F19L 4AIZA 1SBSL 3G9AB 3IYLW 3RWHB 1WFNA 1MI5B 4MZ3A 4QF1B 3OWEA 3SE9L 5FKPB 5TQ0H 1MLCB 3EYUH 4E5XB 3KLAB 2QLVB 5DHVA 1BBDL 3GIZH 1EXUB 1T21A 2QJDA 4YR6A 1D9KC 3O6LH 1HNFA 2B1AL 3PWPA 1IGIH 5IEHA 3A6BH 3O6FB 1DDHB 3SKMA 3F62A 1MREH 4KKBD 2ZCKL 1OD7A 4HK0B 4K71B 5HHOE 1B2WH 4ODXB 1F02I 3PHQA 3NAAL 1NLBL 3ARDA 3DX7A 5IMKB 4YLQT 2PNDA 5EU6E 5T33L 3MZTA 4X5XA 1LO4H 4WO4A 5FUZH 1NCBH 4C83B 2OJEB 3MMEB 4XVUD 2RCSL 5ESAB 1PJ9A 2JCCA 4LSVL 5IIEB 4HJ0D 1VGKA 3DVGB 4LRNL 5TJWK 5GIRB 3L6FA 4K8RH 2IQ9L 1Z3GL 3VMOA 1FYTB 3HCVA 2A9MH 3OZ9L 1AXTL 5DSCA 3MLWL 3LN5A 1E4WL 3IDUA 1A6UL 1G9MC 4C56D 4KRPC 4QTHA 4K3JH 4LCWA 4X98B 1UWGH 4NFBA 1LK3H 4X6CA 4QRPB 2ZCLL 3QNYB 2IG2L 4YZFF 1DQLH 1ZT1B 3FQWA 3U0PA 4UT7L 3MCKB 1J10A 5MEQA 4DVRL 1M1SA 2VLRA 1CT8B 1CICB 4MXWH 4P2CG 3SDXE 2CDEA 1MJUH 3BUYB 3M07A 3PL6D 4LHQB 3DVIA 1FVEB 2KDGA 1QNZL 4KMTH 1MCLA 2F8XC 3MOBL 4NKMB 1KLGB 2PYEE 2NLJB 1MFDH 3U9UB 1U8LA 2P5WD 2IGFL 1GGBH 3ALPA 3ARGA 4U1SB 1N26A 3VW3L 3WLWD 1EMTH 2EO9A 1QLEH 2CR3A 1UYWL 3MLUH 3VXSB 4DOHB 5C0DB 4U1KA 2ZUQC 4MCYB 4TSAH 4U1JB 3BPNC 2NY0D 1G7LB 3SDDC 2F54D 5C71A 1F6FB 4G43A 3AAZA 3CSYB 3SO5A 1T89C 4NFCA 4LRIC 3BQUC 2QSVA 1UJ3C 5IT2H 4JZJC 2B5IB 1IGMH 4GRLB 5D7LE 1ZS8B 1DEDA 1NFDE 4CKVX 4P48A 3BH9B 2VTFA 3TH4T 3ZYIA 1DE4B 3SDCC 5CEZL 5JW3L 5EA0L 4HZAA 1EV2E 1T5XA 1PQZB 2EO1A 5IROA 1CLOH 4OGYL 1D6EA 1C1EH 1SMAA 3A67H 3QRGL 3RVXC 3KPNA 1X4ZA 2HFEA 1ZK9A 2A77H 1QFWM 1SJHA 3AREC 3KLDA 5DZOA 4XTRD 3QCUH 4WFED 1XF2B 5CZKA 2V7HA 2IALB 1RULL 4XNQB 3J7HA 4L3EB 1IGTA 1GAFL 2HG5B 2ZJSL 4NBZB 4YPGA 1YEKH 5JW4M 3OXRA 1LEKB 5IBLD 1A4JB 3X11A 3GKZA 5IBTH 2EDFA 3PGDB 5T1KD 4WCYL 2IANA 2XWBB 2BFVL 4YHIA 4WW2F 4Q2ZB 4O9HL 5AZ2H 4JEGB 2CLVB 5C0EB 3WYRA 1IGYA 4Y5VA 5KSBF 1RUMH 3EOBA 1AC0A 1ZSDA 1E6JH 2GJZB 2FHFA 2G5BB 4ZNEA 4M6MH 4GW4A 3U4BH 1BPVA 5TE6L 4ZPTA 5I0DA 4J6RH 4NNXB 4BA8A 3MLVL 1DQDL 3QEHA 3GMRA 3VD5A 1WZMA 5AYUL 1CIDA 1KIQA 4F7TA 3QXDB 3RZCB 4MAYB 1G6RL 1FAIL 1MQ8A 4KQ4L 4ZO8A 5I17A 1EBAA 1TMCB 1Q94B 1YY9D 2ZSVA 5F7NC 5CLWA 3ZT5A 2GEEA 4PLKD 1JGVH 5E8EA 3FB5A 3VFSA 1Q0YH 2C3VA 4KRLB 2VXSL 3VRLF 2DIAA 2HVKA 1NBVH 3VXOA 2Z31A 4OM1H 4NNYB 4PJCF 3K2MC 5DC9B 2BP3A 1MNUL 2F74B 4RGNC 1FRGL 5J3HD 4QXGH 1FNSL 4PRAA 5BRZA 5E6ID 3ULVH 1KCSH 3L3JA 1T0MA 3VG9B 4PJBA 4IRSD 4XGZB 5MERB 2DM7A 1TJIL 1MAML 5HYJA 1P53A 3V7MA 1AGEA 1CGUA 3WFHA 1RZIB 1NH6A 2DKSA 2Q86B 4V1DA 1DP0A 1U3YA 1CGWA 4O4YH 2FR4B 2VMFA 3QBTB 2C1PA 4NM8H 1AIFA 2Z0BA 5IVOA 4X9GA 2AABH 4OD2B 2YHGA 3QEQA 4QHMA 3S5LB 2NTFB 4MJ4A 1G7HA 4K3DL 3SGDI 4U1MA 4KKAD 4KU1A 1NC4A 1WUNT 5DEFA 1XAUA 4DGIL 2NX5E 1ZHBA 5FYKD 5LVEA 2YD6A 4HKBA 3MLYH 3R4DA 4UILL 5ILTL 3O3BB 5B4MD 1FZKB 3EGSB 1P9MC 1PEWA 2NYYC 1GGCL 2NY1D 1QSEA 3KPPA 5GJTL 3U0TA 3EFFB 3EJZD 4JFED 1Q9KA 5LBSH 1RURL 5D1QA 3IFPA 3FO1B 1NFKA 4EUPG 5I1HH 1RUKH 1N6QL 4Q9BA 5CILL 5LGJB 4L4VD 5JIPA 2R0WH 3D2UD 1KN4L 5CJXA 4WV1B 4Q0XH 5DRZA 2CK0L 4IRJD 2PTTB 4NT6A 4KHXH 1DEEB 2Y5TA 1CDYA 4WFGD 4E41B 4QNPE 4JY4B 1MF2L 2BSTB 5FXCH 5A16A 3DRTB 1WAAF 5FYLH 1NGQH 2V9RA 4OLXL 4I18C 5ACLA 3MUHL 3RU8H 4IJ3C 5JPNB 1ZLVK 4OZFA 4RMRA 1F3JB 3T2QA 3AM8C 4N8VG 3BPCB 4GKNB 5IJVB 3FO0H 1HHJB 4F57L 3V6FB 3FFDA 5DQDH 5TE4H 4NQSA 3QEUA 1N5AB 2YS4A 4R96B 4KJWC 2HRLA 3QWOB 5JOEA 2VAJA 5EZLA 4E0RA 1IGFL 4UOW1 3VXNB 1FNAA 3RI5K 3DUSB 4MNHB 3ZDZE 1YC7A 2HAZA 4G8GA 5IHZB 3N1QC 3TO4D 3ZYZA 2P45B 3VGGA 1KJVA 3FB8A 1TJGL 4OCLC 5E2UL 3NPSB 1QPXA 4ONHA 4PRDB 4X8JA 4JFXB 1R5IA 1HOCA 3TN0B 4YHNA 5MHSD 3NIFE 5E6ZA 2D3VA 4I48B 2V5TA 4OT1L 5CIPA 4L3CB 5E8OA 3THML 1U8NB 1S7SB 4FXKA 4BH8B 4MX7A 1UADC 1MRDH 1AR1C 2YA1A 2PR4L 1IEBA 1A02N 4GKZA 4DTGL 1CXHA 3RTQA 5F1NB 2JJTA 2NY4C 4Y4KA 2KZWA 2P1YA 4MXVF 4H0GA 1BWMA 4BQBA 3QI9A 4J2XA 2E7CA 4F7PA 4GG6F 4B53A 1NGPH 2PETA 4TTGA 4NQVB 4HCRA 3LRHA 4XP1L 5T3ZH 5T1MB 4OZGE 5IV2A 3O11A 4JQIH 3DX9A 4PJEA 1DBJL 1I7ZB 4U0RB 4U3XA 3RWFA 1X9QA 5ESVA 1U58A 3CLFL 4K7PY 1JWUB 4OZFH 4QRRA 4QHKJ 5KSAD 3LH2L 3EW3B 4Y7MA 3W11C 1WEJL 4NRZB 3ZZ1A 1BIHA 2VR9A 2YZ1A 3FT3A 5F6HI 4ODVL 1PZ5B 3MSPA 3S37X 3P0VL 5D1XD 4EJ1C 4DKAA 4JPVL 5KANG 3JSSA 4HGMA 4S2SB 4EQ3A 4U1NB 1FZJA 4G6AD 1FZMA 1KIPA 4FQXC 3MBXH 1IC5L 4ZG1A 1T1YB 5JDSB 1MFAH 5F3HA 1Q0XH 1EEYB 4YHML 5HHOA 2R1WA 4WIQA 1DVFA 3TVMC 5CIPH 3KPOA 1L7TL 1RK0A 1QVOB 2ZOLB 4XMKH 4GMTL 5EU6A 3MXWL 4ZPVB 1CXFA 5ICYA 4ZAKA 2ICES 5FHAL 3BD5A 4FNLH 3LIZH 4LCIL 3T2PA 2F8OA 15C8H 3QDMD 1WVZA 1RZ7H 1IFHL 2EC9T 4EEEA 1JRHH 3PWVB 3K1DA 4YHLH 3DX6B 4UU9A 4JG0H 4DVBA 4YE4L 1KPUA 4KDTC 5AG8A 4JDZA 4XWOC 2XA3A 4LIQH 4WDIA 3LKQA 5BZWB 2F53D 4HCRH 3OJ2C 1U3HB 4KV5F 1PG7X 1J1OH 5HGHA 4HBCH 1OSPL 3NFSL 2KQNA 4C4KO 2K9UA 2YPLB 2P5ED 3QDGE 5DURD 1N8ZB 1S7VA 3ZE0F 3TFKD 3WEXB 5F7EH 2FZ3B 4LCCC 4YHZH 1AC6A 3FB6B 3SDXA 2X40A 3MJ6A 5DJXA 1P5VA 4UB0H 3J8F7 4AK1A 4AEFA 3G6DL 3REWB 2BNRD 1S7WA 5HD8C 2C7UB 4JY6A 5ITBL 1BX2A 1CLYL 2PYEA 3PGFH 3ABZA 1R6VA 4MJID 1FNLA 4XI5C 6FABL 4P5TC 4Y4HA 1I9RL 4WO4C 5DD6B 5JXEA 3O2DL 5D2LB 3WIIH 2VL4A 4Y2DB 5TGBB 5C7XL 5CD5C 5BW7C 5ISZB 1A0QL 4Z77A 1R3IH 2AK1L 5INDB 3BKML 5C92A 3D18B 4XHJC 3HB3C 2OI9B 4NP4H 1IARB 4U6HA 1KGCD 2ADGA 2C3XA 3NVQA 4CW1B 2P42B 4N8CL 1INQA 1M6OB 4KUZH 3WUWA 5D7LA 4U6YB 3U82B 3JWNC 2R2BB 1NFDA 4J8RB 4U7SA 4AENB 3FONB 2ESVB 3L95B 5T1LA 4C54A 3EKCA 1YPZE 3WFBH 1OSZA 3ARQA 4QRQA 2VUOA 4PJFB 4I3SH 2LVEA 1TXKA 1IC1A 1ZLUK 4CJ1A 4CVXB 1U2CA 4DK6A 5C9JB 2YC1A 2GTWB 1EHLH 2IBBA 5D7JD 2H9GA 4HF5L 2OZ4A 3TO2B 1AGFB 3ECBA 4C56E 3ROLB 3WIFB 3L3KB 2DQCH 1LO3L 1OGAD 5ICZB 3U2SB 2VL5B 3RWGB 2PYFB 4OI7A 5T3XL 5HVWA 5ITFA 4R3SA 1H0DB 1G9ML 4HUXA 4JY5H 5FCSH 4Z0BL 2Y4SA 1AHWB 3IJSB 3VXQB 2GHWB 2EC8A 1KEGL 1MCIA 5EU7E 4U2ZA 5EBMB 3DV6B 3DARA 2XQBL 4MWFA 3BWAB 2QBWA 5AWNH 1GPOH 1LILA 3HHRB 5E9DB 2P5WE 1MUJA 4KQ3L 4HHAB 1G7JA 3QJHA 4QCIB 3OAYK 3IS1X 4OUUA 5CMAB 3VA2C 4ODTL 3SDYL 1JV5B 3D85B 2DQUL 1HEZA 1MFEH 4Z7UF 5FUOL 1IAOB 1TQBC 2J4WH 4WTZG 4CGTA 1F4YL 3IDXL 1IKNA 3MLTA 4N0CC 4LK4A 3MO1A 1T20B 1V7MH 1WFUA 1I8MA 2ED7A 1NMBH 2AV7B 4YGVA 1NDMB 3OKKA 4NJAH 5IW1A 1OTTC 1S7XA 3Q6GH 2OM5A 3N9GL 1G6VK 5D93C 5FAAA 3T65A 2ITCB 1KB5L 2XI9A 2FX7L 1EA9C 4LMQI 1GSMA 4Q97A 2P49B 3C60B 1WQVT 3P30H 1YEIH 3QQNA 4GH7B 4HS6A 4HWNA 4NRXA 3RDTD 1KG0B 2J2ZA 3AGVA 2OZ4H 5GSRB 3MTRA 3P2TA 3EDJA 2VDLL 2VOTA 1ZV5A 4ZMAT 2LE9A 2EEAA 3FO9A 1TPXC 5FDYA 2NY6C 3UP1A 4WI7A 3RPIB 1VADB 5DJYB 4BZ2L 4FHBD 2VXUH 3HUJE 5D7SL 2XNAB 2XTJC 4WFEE 4NHUA 4WHYG 3H0TA 4EN3B 5B22A 3EYQD 2PTVA 4YFLI 2GJ6B 5I8CA 2B4CH 3WO4B 2R2HB 3MYJA 5ETUB 5SV3A 4I0CC 3QRFM 1K6QH 4P2OC 4OGXL 3RL1B 3MNVA 2IPTH 1J05B 5JQ6H 2EXWC 3TZVA 5HYQA 1MHHA 4NSKB 4NN6C 4PJAE 5EO0A 1F4WL 1WT5A 1XGQB 2NX5A 3QUYB 1FL5B 4FABL 3NBNA 3TIEA 4JM2B 4XAWL 3SCMA 1MRCL 3GNMH 2G75A 3X12A 3QULB 1NCUA 5DO2D 4JRXE 1T7WA 4ZUVA 1RJYA 5DJZB 3MQIA 1RZJL 4Q9RL 3PHOA 4OCRL 3MUGA 4QTIL 3FFCD 5DRWA 2WUBL 5D71H 2A6IA 2YPVL 1FNEB 2YPLD 4AG4H 1ZA6B 4OQTA 4G9FB 3UYRH 2CDGA 4XZUA 3MRIB 5KG9B 5I9QB 4G8EB 1SEQL 3X14B 4G8IA 4KPHL 3PABB 5KSVB 1EZVX 4F7CB 1HHHA 1DANU 3EO9L 4R7DB 5H2BB 1EO7A 2VLMD 5I8EB 2VQUA 3N1FC 5CEYB 2H26B 1T1XB 1UZ8B 1IT9H 4UOJA 3BDXA 3OPZH 2H6PB 5E03A 5DUPL 3GGWA 4JFPA 5FO7B 2PCPA 3CZFB 2GSIB 4F15B 1NBZA 3C6LA 1KJ2L 3O3AA 1YNTA 2MKWA 4ZO7A 1A47A 4NOBA 1MI5E 4G42A 1D5IH 3GSOB 4F8QA 1JGLL 3TT1H 5ALBL 5A2FA 1B6DA 1G7MB 5BS0B 4WUKL 3UTOA 4YAQA 4R7NB 1E4XH 1RHHA 1MJJB 5J1AA 43CAB 1W0WB 3BVNB 3O6KH 5CCKL 5GGSB 2NY7H 1IEHA 1PVHA 4NQEB 4FN0A 4PS4L 2YK1L 5I1IH 1U91A 1BBJA 5TE7L 5I16A 1G6RB 5ID1A 1AGBB 3JTSB 3MBEA 4D0DB 1M05A 3NACH 5IQ9B 3TM6A 2GTZA 1UH3A 1RVFL 1DSFH 3ULUE 5CJXC 4KRMB 1B90A 2GSGB 1NCWH 4IIQA 1V7NL 4NYLA 5I1GL 2LFGA 5FYKE 2FSEB 3DX8A 4OQTH 1FYTE 2WUCH 2EKJA 3QO1B 5LGHL 1Z5LA 2DD8L 3GO1L 1NC2A 4APQD 4OLEA 4NZTH 5I75C 4ZUUA 2CRIA 4M7ZB 2DQHL 2AXJA 5DQ9A 3QIWD 1FG2B 1UACH 2DTMH 4M5YL 4QWWD 3CU1A 4MNQD 3L3OA 3T2NL 1UWXK 4JFEE 4QRPE 4AY0A 1XF4B 2XA8H 2RJMA 1N3NA 3JV6A 5I1CL 1TTFA 3WLBA 2IFGA 2Q6WB 5GISL 3CPLB 4OZGA 2X4QB 3NCJH 1VA9A 4A6YA 1SJEA 4JJ5A 5GHWH 4ZQKA 1SYVA 1X5ZA 4TN9A 2M26A 2X89A 3Q3GA 4PJ8A 2DQIH 3UO1H 3E2HC 1RQ5A 4RAVA 2ID5A 5JQHC 1AO7B 3UPCA 4U6XB 5C0JA 1P4LA 1UWXH 4HH9B 3CX2A 3ZKNC 4WFGE 4ELKA 1DR9A 4JAMA 2FGWL 4ONFL 2HKFH 2AJ3A 2YUVA 3BFOA 3VXSE 4LQFL 3LKSB 1DTUA 4HUNB 1FO0B 4TSBH 2OCFD 1I9IL 1FV1B 4YHKL 3E8UH 4LU5H 3K8KA 3H3BC 2MSPA 4LAQH 2Q7YB 5HHMB 1FN4B 1WV7T 3FHQA 3T0DA 1O7SA 3H9ZA 1KELL 4ELMB 2E27H 2V17H 2PW2B 2CIKB 2D7TH 1N5YH 1EJOH 1E28A 5DR5H 4G80B 2NY2B 1S7RA 3EYSH 4DN3L 3TBWA 3L5XL 3WCYA 2FRGP 3VWJC 3QAZB 4OF7A 1ZHKA 4AM0A 1O0VA 3B9KD 5CUSL 1AQKH 4U1GC 1RIHL 3BP4A 2AQ1A 5D5MB 1M7IB 4LKXB 5C0BD 3NCEB 1MPAH 3LS5H 3P77B 1WC7B 2R0LH 3SKNB 3SGKC 1IBGL 1OPGL 3I9GH 4LHJB 5E6YA 3MRGB 4G3YL 4BZ1H 4Z7WF 5DC4B 2R23A 4XAKD 4XC1L 1XR9B 4JR9L 1JTTA 3QIUA 4ETQA 4WRLA 5DI8A 4JCMA 3VD4A 4PTUA 1QD0A 4A6YH 2BVQA 4H26B 2EYTB 4EN3D 5A2LH 4P9ML 5I71C 3QDGA 5KSUA 4Z76A 1A3RL 1LD9A 1UM5L 2R1YA 1JPFB 2PO6D 2HJKA 3VFUB 1AD9B 1B3JA 1XCQB 4NNPH 2UWEB 3OX8B 5FB8A 2GCYA 1UM6L 4ZXBD 1JWSA 1NEZB 4HLZH 2W60B 2LU4A 3CU7A 4O58H 3U7WL 5EIIB 5H35B 1F11B 4AQ1B 3FKUS 3OB0K 3PHSA 5JHDB 5ALCH 3QUYD 1T80A 1DVFC 4LVHB 4PJXB 2H8PB 1L7IH 2BHUA 4YO0A 1J12A 2L4OA 3IKCA 5B8CA 3QG7H 5CSBA 2VZ1A 2C3GA 3T0EB 3EYUL 2J6EA 3ZKMC 1WBXA 3W39B 1R3JA 3MC0A 5FDWA 4QOKB 4C58B 2NXYB 4FQLL 1BM3H 2B2XH 3A6BL 4I5BA 2AEPH 5C6TL 1XFPA 4ZS6D 3SEPA 5H8DA 1I1FB 3RWJA 4PY7A 1TVBA 2FH8A 3OKMA 4HIXH 1EGJL 1KPRB 5GGRB 1V3KA 1KCUH 3OAUL 3V52H 5C07D 3WL9B 2V6HA 2ZKHL 2A9NL 3NABH 2FJGA 2VDQL 3QDME 4QT5B 1MCWW 2I24N 3T1FA 4L1DA 3MRJA 4OLUH 1RHFA 4X6DB 4W4OA 1HNGA 1YMHB 2E9IA 2Q7NA 3GBNL 3B5HA 2GW5A 2W9LA 3LKRB 5JXEC 1LK3L 3AMKA 2CSPA 4C56A 2F53E 1AE6H 3V5KA 1RZFH 1BFVL 1FBIH 3MUJA 2DI7A 3V5DB 4XH2A 1PLGL 2P5EE 1YUHB 1MJUL 2IFFL 5FO9B 4I9WE 4FP8L 3V4PH 5KSBE 1TZHB 2CIIA 3GJFA 3PL6A 3P73B 2OXHA 2BNRE 4M6AA 2J6EH 4O2CA 5GGQH 2V2TB 2P5WA 3E6HB 1G0XA 3ORJA 5C0IA 4TPRH 3HE6B 2NXZD 4IMLA 5BV7H 1A6WL 1IQWH 3MLPA 5GS0C 4OZ4B 5JR1H 2FJFA 4JN1L 1X5XA 3MOAH 3MV9B 3R0MA 4K9EL 3LEXB 3BAEH 1CGSH 1KC5H 3VRLE 2QQLH 2M1KA 1AXSA 3FOLB 2YPKA 3DUHA 3UTTD 1U36A 3GRWL 4PJCE 1RJCA 4CMHB 3ILPA 3KR3H 4PV9A 4EIGB 1BLNA 1H5BA 3MROB 4XBGA 3P4MB 4AT6B 2WM0A 3H3KA 2WSKA 4YBQD 5DJ6B 5L7XL 2NPLX 4GBXC 1YEFL 2P8MA 3MNZA 4R2GD 5BQ7B 5IM7A 5GPRA 4LBEA 1C08A 3LQZB 4L8SA 2B4CC 1PKQB 4F7MB 4GAJL 5C09D 2APFA 2OTUA 3AMLA 4Z0XB 2YD1A 5CZXD 4JB9H 4UQ3B 3HUJA 1AP2B 2AK4B 3V5HA 1A6ZA 1MY5A 4L8CB 3GJFH 3DURA 3V6ZB 5LCVL 3W0WB 2OP4H 4PJIF 1XR8A 1OGAE 4JFQB 4PB0L 3PIQB 2A73A 4HFWA 5IBTL 2GITB 4YUEH 5ADOH 4J1UA 4C4KT 3SO3B 5IVXF 4ZFGH 4OIIH 2FB4L 1ZVHA 4YC2C 5KVEL 4PJAA 2E9JA 4ONGH 3UJJL 4DAGL 3CMOL 4X6FA 3TA3C 1G7PA 4YX2L 5JPMA 4JO2L 4ERSH 2NY5H 2AKRB 4G6KH 4JRXA 4OGAD 4XXCC 4M6ML 2WINA 2H3NB 1ZT7A 5C2UB 4Y16D 5A3ID 3V0VA 4M93B 1MCOH 1CL7H 3LKNB 1S9YA 5DWUL 4N5ED 3QJFB 3RWCA 1UKSA 1V5JA 4HAGA 1HSBB 4LVNC 4U33A 1CD1B 4WI8A 5L2JB 2FWOA 1GGIH 1X5YA 5ENWB 2F58H 3MRCB 4R4FH 4YHPB 2DLHA 3QNXA 3S9DB 1B4RA 5SV4A 1WAAE 4EBQL 4ZUSB 1XF3B 2OX5A 4UTBH 4KVCH 5J13B 1A2YA 2BRRH 1UXSB 3GFUA 2E8ZA 5D1ZD 3U9PH 2BSSA 4UDUB 1RFDH 5HI5D 4M48L 1UB5A 4P57A 4ZFOA 3LQAH 3MR9A 3C8KA 4YXHL 5K59F 2VQ1B 4LHUB 5CD3B 2BC4B 1MI5A 2HTLD 3GHEL 4UOW0 1RJLA 5E6IA 3SCMC 1HYSD 3KLAA 3ZKSD 1EXUA 3MRHB 5HHVL 4EXKA 1ZT4B 4OM0L 1I1AB 1DUYA 4PJ9D 1OP9A 3KYMA 5J9PA 3LEYL 3RWIB 1DDHA 1BOGB 4LLYA 3FRPG 1ZEAL 1JZ8A 1AY1H 1CR9H 1I4FA 4JANB 2DQGH 4HK0A 4F58H 1JGUL 4ODXA 4EOWL 2AJXH 1E6OH 2UY6A 3VH8B 4JZNB 3U48A 4D2NA 3IFNH 3BPNB 2G2RB 1CLZL 1FH5L 3SDDB 1A9BB 2OJEA 3MMEA 1I8LA 1SY6L 5ESAA 3QPQC 1BFTA 1KB5B 3V4VH 1PG7L 4MXVE 2MKLC 5GIRA 5I66A 4PRBA 1GOFA 3PWJA 4GAGL 1CFQA 1FYTA 3BQUB 5J89A 4GG6E 3UBXG 3O9WD 2UYLB 5D7IB 3HE7B 5FV2A 4FFWC 3W5NA 2DM2A 1MCBA 2JTDA 3FFCE 4XT1C 4D9LH 2DQDH 4JFEA 3OKNA 4QRPA 4RMWA 4LSQH 1OB1B 1ETZA 2YPLE 1EEZB 1C12B 3UROR 5ANMB 3KYKL 4YHOH 3WFEH 4FFYL 2EC9U 5ADPH 2R0WL 3ARFB 4J3OC 4V2CB 4CJ0A 5L9DL 1FGVL 4X9BA 1CTOA 3QB7C 4Q0XL 4L4VA 5C0ND 4WU5B 4I0PD 3D2UA 1F97A 4ODUB 2QADD 3LVEA 5F6HJ 2XXMB 4IRJA 3W2DL 2VLME 5GGVH 3DROA 4RGOL 4KK6C 2NLJA 1NBYA 3Q6FB 4JKMA 3D39D 4UDTA 3U9UA 1WIOA 4NPYA 1LQSR 5KVGH 4U1SA 4Q6IA 3INUL 4UIKL 3MBEC 4OLZH 3ZTNL 5GSVA 5C0DA 1IM9B 3WDJA 3T3ME 4O5LH 4NM4L 1PY4A 1E4JA 2X9XA 1JHTB 4JFOB 4MQ7A 5D9SA 3MUY1 3TYFB 3D69A 5ISZE 1X44A 2A0LC 5TE4L 3KNBA 1TETH 3MLSL 3QUXB 4WVRA 3WKNA 2E5EA 4NZRH 5J12C 3NCMA 2ZUUA 1AH1A 4PJ7F 3QCVH 2BY3A 5IEKB 3VDAA 1A22B 3ULUH 2J88H 1K5NB 4UBDD 2E7BA 4MZ2A 3TO4A 4XX1E 3KPTA 1BQHB 3LKOB 3TH2T 1P7KB 4KV5E 1CLCA 1VB9A 3IXTA 1YYML 4PJFE 4JFFB 5GGTH 3VRJB 5I30H 3GKWL 3R1GL 3CD4A 1J5OL 3SE4A 1JJUA 3OKOA 3ZE0E 2JIXB 4YDVB 1OAXH 3T0XA 1RD6A 3W82A 4OD3H 1LO5A 3C9NB 4Z78B 1KJ2B 2ZNXA 3W0WD 2E6PA 3MODL 2H41A 4MNQE 3MXVL 1OT2A 4IHOA 5EZJB 1UCBL 1KBGL 5KS9F 4M61B 3CUPB 3RVWC 1LEIA 3UZEA 1ZANL 4UV4H 2YBRB 4NCDA 5DJ2A 4TUOB 1NAML 1U8KA 4IOIB 4XCNA 3WKMH 3H9HB 4KJQC 3QUKB 1QYGL 4RAUB 1YECL 1UM4H 5D6DA 1D9KD 5DRXB 4WHCA 2CLVA 4Z7QF 5E5UB 4MLIA 3BIBX 5KSAA 5E9DE 1WGOA 1ZMYA 3T77A 3MZGB 1IEAB 3HI6H 3HC0B 5D1XA 1NCCH 1YYLL 3GI9H 1CD9B 3HZKB 4NNXA 4HFUL 1DFBL 3STZB 1KCRH 3ILQC 2BDNH 2CXKA 2J8HA 2JE8A 3BJ91 3OKLA 3WXVH 3QIUC 1KPVB 1CCZA 2FATH 3QQ4A 2EH7L 1JK8A 4DGYH 1HDMB 3D25B 4PTTA 1Q94A 3T4YB 4XVJL 4FQIL 5T3XD 3VCLB 5F93C 4FG6C 3VFMB 1AJ7L 2FCBA 3GBML 4MA1C 4ACPA 3G5VB 3CX5K 4KRPD 4NJ9L 4TQEL 2IAMC 1EUUA 3VA6A 2O5ZH 3HPLB 3UJTL 3O0RH 4WEBL 4JN2A 2VXQL 3MRBB 3HC4L 3QDMA 4JG1L 2F74A 4WI6A 1OARL 2R2CA 1DBKH 3C6SB 3F7QA 5I1LB 4ODSL 2F53A 1SM3H 1WFTA 5B8CC 3MLXH 5KVMC 4QRUA 2FL5A 2PKDA 3TBVA 4WW2A 1LE9A 1RZIA 3FMGH 2P5EA 2VDMH 3BKYH 3IFLH 3HS0B 4BK5A 4XNUH 5BV7C 5KSBA 4P2QB 4QHUB 5CGTA 1ZHNB 4YXKH 5LWYH 2BNRA 1GGUA 3MRPA 3HI5H 4IJ3B 4MNGB 3RVUC 4Z7UE 4JHWH 4X7TB 2DMCA 4OF0A 3ARVA 1N64H 4XPTH 5IMLB 4HIHB 5IB3A 1LK2B 5B39A 4YDLB 1BJ8A 4MB5A 1CGXA 3BQUD 3VI4F 1K8DB 4LP4A 4U1IA 3KYOB 4X8XA 1MIEL 5EULV 5CEZE 4Q9QH 4GKOA 3O3BA 3OJDB 3L3DA 5JMRA 4KUCF 1M71B 5LAXB 2V9TA 3TWCL 1QUNA 2OTPA 2UZYB 4D0BA 2X05A 3SDCD 5JXAL 4G9FE 3S4SA 3CCHB 4YK4C 3VFGL 4WI2A 3OKEA 1WWAX 4KUZL 3WFCH 3KJ6L 4PJCA 4WGVB 2EE2A 4JZOA 2H2PC 4Y5XA 3RVXD 1RIVL 3O6MH 2IWGA 3MRRB 3ARED 3QEGL 4O2FB 4H20L 1DEEA 1WWBX 4HT1H 3QCTL 1X7QB 3G5YB 4JY4A 5C07E 1DL7H 2CLZB 3PJSB 3QXVA 3O3DB 1X5GA 1JUFA 4KK9C 4W4NA 3X3GH 1FFNB 1QFWH 2B1HH 1NJ9B 5JPNA 3AY4A 1RAMA 3RNQB 5D7JA 2HFTA 2VLLA 5F97E 5IJVA 5E2TL 3SBWA 5CJOL 3ARTA 3BP6B 5A40E 1BWWA 3WV0A 4Z7NF 1MFBL 1DBBH 1OGAA 3CK0L 3MA9H 1VACB 1TZGL 3GSUA 3ZHLA 1JZ6A 3MA7A 4MJ6A 5FEBA 4NQEE 1ORSA 5A2JH 3DUSA 1X5AA 2BOBB 2MFNA 5IHZA 1KLFA 1AFVH 2FX8H 5GS1A 3GHBL 4XVSH 1AKJB 5D72L 4PRDA 3KPRB 2HJLA 4KROB 5F96L 3TN0A 1HXYB 2VZVA 4JFFD 5KW9H 4PGZA 4HKXB 3ZDXF 3ZHDA 1U8NA 4NN7C 1XGRB 5IMMB 2Z93B 1S7SA 5B3NA 1JHKL 1ED3B 2JCCF 2Y06H 3QG6B 2LV4A 2Q76A 2OTWB 1AD0A 2IADA 1HCVA 3QWRD 2R0KH 3JWOC 2FYYB 2EYSA 4Z5RA 1RK1B 3RPKA 4ISVA 1YZZA 1EBPA 2JJSC 3HA0A 3U6RB 3V6OC 1F6AA 4QXUH 2DOCA 1CF8L 5F21B 5GS0L 5DS8B 2ED8A 4HV8B 4X6CF 3BN9C 5T1DL 4GUPB 4FFVC 4RGND 3UTTE 4B7LA 3G6JB 1DQMH 3MX0A 1WAAA 1A7RH 1KUMA 4M4RA 3P9LB 3AS1A 3CJJA 2AEIT 1U93B 1I7ZA 2HRPH 1AO7E 2LU3A 4JFHD 1VGEH 2ZUSA 3DV4A 2WMPA 5D70H 3RDTA 1MCSA 4PGDA 5DJDA 1JWUA 4HH8A 5KTEL 2XZCH 3C5JB 5FM4A 3KWWA 3IVKB 5IFHH 3H42L 2Q1EA 3SN6N 4OFYD 3TPUB 4A2LA 4TYUA 4BFEA 3VD9A 3B3IB 1PZ5A 4JFZL 4JRYB 4P5KA 5C09E 2W9DH 4HS8H 3IS0X 3RL2B 4RRPA 5HHME 4JGMA 2VDKH 3IDGB 1P7QD 5JDSA 2AXGB 5IW6B 5DQJB 2ADIB 4GFTB 4KXZH 4CAGA 1NANI 3JWDH 2EKSA 4BQ6A 3S5LG 1QVOA 5I19L 2ZOLA 4AEIH 5SWSD 2NYYD 3ARBD 1UH2A 3F7VB 3RWEA 3WS3B 5CBEB 2Y25A 4KKNA 5E00A 3TT3L 4P23B 5D5ME 4IS6A 4DKFH 3P4OA 4CMMB 4FQ1H 1U0QA 2VERN 4GG6A 4OUOA 5MI0C 4DFIA 1N7ML 2YN3A 2YRZA 2YD7A 3LRSB 3QIBC 1U3HA 2BCKB 2XACC 1T03L 3FFCA 2X70B 1IAII 4M6NH 5ID0B 5DFVC 3CIQA 1CFTB 3MLRH 2YPLA 3OKYA 4MDJB 1WWWX 5IB5B 3WIHA 1CGTA 5I1KH 3NH7L 1C7SA 1EX0A 5I15H 2FZ3A 1KIUA 4OB5H 5F9OL 2UWEE 4P2QD 2VITA 3O6FC 4ZS7H 2V5YA 3G5ZB 3REWA 3CFJB 1JFQH 3QWQB 4K71C 3DO3A 1HN1A 2Q8BL 4FA8A 3MJ7B 1A9EB 5EU4A 1UB6B 4PJXE 4KJWD 1S5HB 1C8PA 3ULUC 3U36B 1D5IL 1S9WB 1N0XH 5TGBA 1BEYL 5ISZA 3NTCL 3M17A 5INDA 4EUPB 1KENL 3QO0A 2LAAA 4QOKE 1W72L 2W0FB 2X1OA 3OR6A 4M00A 7CGTA 2DJ4A 1FPTH 4W68A 3VFRB 4AEHH 2AJYL 3G04B 3G5XB 4TVPL 3HNTH 32C2B 4CW1A 2JK5B 3ALXA 1A64A 1RZGB 3DTXA 2R2BA 3H2WA 2YWZA 3L95A 4PV8B 4Z7WE 1CWVA 3C08H 1CICC 1A5FH 1CGYA 4MYWB 2NY4D 2DI8A 3RUGB 4HMCA 3ZE1E 2QKIB 4WEMB 4PJFA 3OG6B 2HTKC 4JJHA 4YWGL 1H9VA 3O3UN 4MAUL 2EIZB 3P4LA 1GC1C 4L5FH 4DN4H 3WIHH 4U6VL 3ARUA 4X6DE 4O2EB 4R8WL 3DYOA 3I6LD 3L3GB 3FQNA 3TO2A 4TTDD 4N9GA 4HGWA 5E94A 1U41A 5E4EB 3QIWA 2BXZA 2RFXB 3U2SA 1U92B 4MNQA 2XZAH 5ESQA 1QSFD 3EDFA 1OAYH 3HG1B 1XEDA 1H0DA 1NGYB 2HJFB 3LZFH 1S5IH 5GHWL 1HHIB 1AHWA 4DEPB 5E0QA 2GT9B 2NY6B 3ZYJA 5HVHB 4G7VL 4GRLC 1BJMA 4YBHA 4OF3A 4XP4H 5LXGL 4FQXD 3TIDB 3D39E 3O2WH 5E9DA 4LARH 2IMMA 7FABL 5JW4R 4QGTA 2EIEA 4H8WH 3MCLL 1BP3B 1MWAL 4UIMA 5CBAB 5CMAA 2EDTA 1IAOA 3TVMD 4P2OB 4ZTOH 1S9XA 4R9HA 3MGAA 3KVQA 3ZE2F 4YXLH 1ZLSH 1A3QA 2DQEL 2ATKB 4XNZB 1OTSD 2AV7A 1J0ZA 3MJGX 4NN6B 4Q74A 3F7RA 12E8H 2P46B 3MRMB 3EYSL 2DI9A 1CI5A 5I8KL 4NKDB 1U8IB 2IPKB 3RHWK 4AMKH 4XWOD 4RWYL 3OGCA 4NC1E 3RY4A 1RZ8B 3HI1A 2VZTA 3B9KA 2Z4QB 1YN6B 5C0AB 4WWKB 1B0GB 2WIIB 1OAUL 1FGNL 2VH5H 1OAQL 2F19H 2ITDB 4XPFL 1SBSH 4BZ1L 4NHCL 3SE9H 1OP5H