4OFPA

Crystal structure of syg-2 d3-d4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
200
structure length
197
Chain Sequence
DPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKEIKNIYSFIASQNDNMAEYECRANNSRPKRKAMKLEVNYPPASVELFGESNIRYGSSANIQCKSLPSNPASQITWIINGRSVPTPTQREFVVENGIVSSSNVSVHSNELSVEAHQINVECMATNPEGSSAKQHVIKIIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Protein SYG-2
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 28
structure length 197
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA01
3WXWL 2IFGA 4WEUD 5H2BB 2X09A 1HK6A 1D9KD 3O8XD 2FZ3B 1OD7A 2RFXB 3LS5L 3ZDXE 3QWOA 3HZVB 2FRGP 3AXLA 2VZUA 5LCVL 3T0VA 4KMLB 4BJLA 1WFTA 1YNKH 12E8H 2VLJD 1HWGB 5E1AA 1TZGL 3KYKL 1ZOXA 2R2BB 2C3HA 3PDGA 5CD5D 4MD0A 8FABB 2AJXL 1P2CB 1D5ZA 4U1HA 3GMNA 5E5RB 3D3VB 4WTZG 3VGEA 3O3BB 1NMAH 1GGUA 2WLZA 1RV6X 4LVOC 4OLZH 3U9PL 3O3DA 1NJ9A 3SKNB 3WCYA 4PP2A 2EE6A 5DD1H 4ZUVB 1FLRL 1TZHB 4PLJD 5IB3A 4ELME 3QRFM 5IMOB 4LLMB 1B0GA 1NC4D 1AGDB 2HJLA 2QR0B 4PJ9D 1LQSR 4W4OA 4UBDC 3GSWA 2BNUB 4R2GB 1CFSB 4PJGB 1HINL 4JFXB 3T0DA 4KJPC 4JJHA 4L5FL 4HLJA 3V4PH 4OD1H 4ZAKC 5GRYA 1CI5A 3HZKB 1EDQA 2XKNB 4AENA 4L29A 1NBYA 4OZFA 1X9QA 2EEDA 2DWDB 3RDTA 1KGCE 4XPAL 1YYLL 2YWZA 3DHMA 4OM0L 5CZXC 5H37G 4AEIL 2L7UA 4IMLA 5T1LA 3CH1B 3KLHC 4I9WD 3B83A 5T1KB 5M95B 3SEPA 2BERA 2CXKA 1JN6A 3EYQD 3WNKA 3T04D 4MHHG 1ZHBA 3LRSB 2EH8H 1QOKA 4RZCA 5JW4R 1JP5A 5TGBB 2IH3B 2J6EA 4Z7NF 3KPTA 3O3AA 3S36X 4LVNC 2DF3A 3BP4B 5HHPB 1A9BA 4NZTL 3WD5H 4HIJB 1DBKH 1NCBL 5FOBA 1CGSL 2C3GA 3LZFH 3NCEB 4HIEB 4F8TA 3VCLA 3HR6A 5D1XA 1PKQB 5DVNA 5FM5M 5BO1H 2V5SA 2C5DC 5F89B 3S5LA 5DFWH 1XMWA 3ZO0A 3IKCA 1KCSH 1B4RA 1FIGH 3QH3A 4KDTA 4FZ8L 4R6UA 1OGAD 2IPTH 1JFQL 5LGJB 1G9ML 4FTVE 1A3LH 3X11B 1K6QL 1LEKA 1QACA 5E1HB 1Q9KB 2A6IA 3HZMA 4HXAL 4EI5A 1SM3L 1JK8B 5EBMA 4W6WB 3MNVB 1HDMA 4FQLL 4U1MB 1GAFL 2A74B 4GAGH 4XNQA 2N7BA 3VH8B 1ZA3A 1Q0YH 3RUGB 3VRJB 3U0WL 4CGTA 4ORGB 2NTFB 2HN7A 2NXZC 4LLUB 3TJHD 3WLWC 3QUMA 3RDTC 4DGYH 2CUIA 4CDHA 2YD7A 5FKAB 4KKNA 2HG5B 5IF0A 1RZJL 1N0XH 3D0VB 1EJOH 3ULVL 2H26B 3ZKXC 1XGQB 3MR9A 5KOVC 1WEJL 5HGDB 5BW7A 4F9PA 1TMCB 2AERT 4X5WB 3PGFL 3E2HB 1LVEA 1QHPA 1ERNA 5IM7A 4MSWB 4GXUM 2I07A 3WN5A 3DJ9A 3RVXC 2G75B 4J3WA 4KWUA 2V9TA 5EPMA 1KIPB 2J12B 1SEQL 4M1CC 5IEHA 5D1XC 1MQKH 1OF2A 3S96A 1FFPA 4YHLL 1IQWL 3MLRH 5C08B 4KDTC 4N0FA 2AGJL 5K9KA 3S37H 2JK5A 2P5EB 5SX5H 4Y88A 1JJUA 4CBPA 4OLXH 2DLFL 5IV2A 2L7JA 3LQZA 1JPSH 5I6XC 1X5JA 2NY2C 1PSKL 5F9OL 1QZ1A 1LP9B 2FH6A 3D39B 4ODHH 2D03H 4EI5C 4YX2H 4XP6H 3SN6N 2VUYA 2IANA 3RWEB 4R7DA 5BXFB 4NUJB 1L7TL 3EOTL 3RI5F 2W60B 2B1HL 5E94B 1LHZA 2NY4D 2YPKA 4QHMB 3SGDH 1J0ZA 5BS0E 2P5WD 1FJ1A 3U36B 3BEVA 4XPBH 4CDGC 4PRPB 3FOMA 2WK2A 3BAEH 2MQ3A 2Q8BH 4X99A 1RI8A 3VI4F 25C8L 1QYGH 4OCMC 3LKRA 3GSXA 3QXUA 4YXHH 3Q1SH 4I4WA 5ESVA 1MI5E 3I6GB 3SGDI 1LO0L 4P2QD 5BW7C 3EYUL 4F9PC 2EC9U 3EJZC 2O61A 1DUYA 5F71A 5HHME 3DSFH 3GMMA 4XHQA 2CGRL 2FD6L 2F54B 3QFDA 4P9HL 3WN5C 4LIQE 5I2IB 1BD2E 3HG1A 3KXFB 4LL9A 3RIAF 3HMXL 4KUZH 4X7EC 4N8CL 4XC3L 4JM4L 2OS7A 1SBSH 4FRWA 3ECBB 3RHWF 4KTDL 4TTDD 3T77A 2PW2A 1WJ3A 4XMKL 1JHKH 4NM8L 3MV7A 2AKRA 5H94B 1FE8H 3FO1A 3HFML 2VH5H 4HFWB 4DFIA 2A6JB 3RVUC 1QSEB 2WM0A 3UYPA 4PJ7A 4TVPL 5CJQL 2J8OA 1EO8L 2KPNA 3NFNB 1C12A 4PGJA 3H3PH 5DD3L 4L4TA 4XCCH 1K8DA 4K9EH 1ZHNB 3DURA 4JFEB 5I1DA 3BP7A 35C8L 4XVUD 1AFVH 3E6FB 1ZT4B 5KS9B 2W59A 1G0DA 2HTLC 4U6YB 3EFDH 4IOFD 3VXOA 1F00I 2X4QB 2CK0H 3QUKB 5SWZD 3BEWB 3LEVL 1IFHL 3VGDA 1KNOB 2IG2H 3BPOC 3BDYH 2UY7A 2OJEB 4H1LA 4YHOH 4JO2L 3CX5J 2VXQH 1X5AA 4QHUB 3UAJD 1XF3B 3TWCH 3BQUD 1A1MA 4RFOH 3WFCL 5D6CA 5JLZB 3H9HA 3WHXA 3ILQD 1ZANH 5I1LA 4FS0A 5C0GB 2CDEA 5A2IH 4DUXA 1R24B 1HZHL 2Z0BA 1AKJA 4P46D 1CF8H 5I18H 3P4NA 4X5LA 5I8EB 3VFGH 5IUSA 3L3KA 4L9LB 5CSBA 5I75C 1A6ZA 1FFOB 3QEUB 3WUWG 1JTPA 4KK8D 3VI3F 1D5IL 4ZFFB 1MY5A 2CD0A 3OKLA 3L9RA 1H3UA 4HGWA 3ILPA 5EZOL 3EOAB 5HDQL 3C09C 3JTSA 1Y6MR 4WUKL 3O2WH 3OMZA 4U3HA 1EVTC 4U6TA 1ORSB 1GGIL 3I6KB 2A1WL 1RJZB 2WV3A 3VDCA 3DV6B 2BC4A 4KHTH 3JWOL 1T89A 5HYJD 4MNHB 3U4EB 1H5BC 3OGCA 4BH8A 3RIFK 4FQXD 5CKAA 5IFHL 3NIFE 4Z7VA 2OSLA 4Z0XA 5DEFB 3PGDA 5JOEA 2IADB 4YDIL 3UTTD 2EDYA 1J8HE 4O58L 4TSCL 5FM8A 4L4VD 3DROA 4MB3A 1I85C 4PRHB 4QRSA 1KTKE 1QLEH 4C59B 4JB9L 3G04A 5FV1L 2Q7YB 3BE1L 3BPNB 2G9HA 2XZAH 4WRLA 4M43L 5EU4A 1ZV5A 1X4YA 5E2VL 4Z76A 4P3DB 1MRFL 1IGTA 2FEDD 3ARFA 4NNPL 2XPGB 3HUJA 1X3DA 3OF6D 4YK4B 5KBNC 4ZD3H 3EFFB 4M5ZL 1ZGLM 3SGJA 1RZIB 1YEEL 4AIXA 4GG6B 4Y19A 4G7YH 1J1PH 1LEIB 4MJID 4HUKB 5GGTL 2DMKA 2ICEA 4TQEL 3CU1A 5D7JD 1MRCH 3NA9L 4P5TD 3HR5A 3SHSA 2V2XA 4PJDE 4A6YH 3E6HB 2VDLL 2Z93B 4L3EB 4G8FA 3MSPA 3STZB 3CFJB 4FFWC 1WITA 3CZJA 5DRNB 5JXED 3EO0A 2KH2B 5E4EC 5FGSA 5BZWA 1ULVA 3ARGB 3KPRB 3G6DL 3QNZB 3SE8L 1T89C 5I1IL 3ZE1E 3OJMB 3ZKSD 4R90L 1GZPA 4S1SL 1AXTL 1B2WH 2YD9A 4JZNA 3EDDA 2YUZA 1CVRA 2LU4A 3GIZL 1X4ZA 4OQ1A 4BQBA 3AM8C 1YPZA 2BNRB 3SGEH 5ITBL 5HI4D 2VISB 4WHYG 2D7TL 3D3VD 3MRLA 5EU6A 7CGTA 5KANG 2X4UB 1I9JL 2NY3C 2UYLA 3JTTA 4HEME 4FG6C 1UACL 4YO0A 2O93L 4C4KT 4XAKE 2R39A 4U7KA 3ARFC 1QSFA 5IW3A 1NGQH 2AXGB 3SGEI 2DM7A 1BIHA 2GTWB 5L2KB 3SGJC 1ADQA 1RK1A 4OCSH 4ONFH 2YN5A 4PP1C 5KJRH 5CP7B 3I50L 1PJ9A 3V4UH 1QEWA 4OCLC 4LEXH 4P48A 1U3HD 4WFEE 3BWAB 5C0CA 4MXQC 3C2AL 1MRDH 1BECA 2D9CA 4Y1AB 4PLNC 4LHUD 4OCWL 1JPFA 4YHIA 3KPPA 2FJFB 1RULH 4W70A 3BXNA 2OLDA 4LRNH 4X6CA 3SPVB 3CFEB 3M1BA 1EJ6A 4PRAB 3JBG7 1DL7H 3E3QC 4WY7L 1PDKA 4JG1L 3GMPB 4Z77A 3BGMA 3B9KB 3BKYL 4LKCA 4JRYE 5LG1A 3TV3H 2PKDA 3L6FA 2IMNA 5DUBB 1IGML 1WIPA 4WEMB 2ICWI 1N2RB 3TJEL 3RKDC 3AREB 4QTHB 1AXSB 4PREB 1S8DB 4M6NH 4WFFE 4TNWF 3UO1L 3MREA 5DUML 4IRZH 1NFKA 5MP6H 5BVJA 4BK5A 4OFYA 1II4E 4E0RA 1TCMA 1S5HA 3O11B 5DJ2A 5FO9B 3VXTB 4OLUH 5DHYA 2NX5E 3QO0B 1A7RL 4XPHL 1IGYA 3MRQA 4Z95L 2R1YB 5GGVH 1CD0A 1RY7B 5C6TL 4S0TD 3UTPD 5FO7B 3S35L 4I0CC 2NY0D 2IGFL 4XAWL 1ZT7B 2NLJB 4WW2B 5F72S 5FUZH 2HMID 3MYJA 1FV1B 3ULVE 5DJXB 3QRGH 2CJUH 4WHTB 5D7LA 5DQDL 4AIOA 2MKWA 32C2A 3UP1A 5IBUB 1LK3L 3CFBA 1H8NA 2MSPA 4HS6A 1YJDH 2B1AH 3AVEA 5IGXH 1D3CA 3MYZA 3HI6H 1S9WA 4PJAF 5BMFH 3R1GL 2YS4A 2OR8A 5TDNB 4HC1L 4DVRH 3U2SA 1JMZA 3LB6C 3N1GC 1XGTA 1I3UA 4YGVA 2YD8A 5MEQB 5KVEH 4FFYL 4NSKA 4HXBH 5AEAA 4YBLC 1OLZA 4MJ5A 3WMSA 1YECH 3HRZB 5BV7C 1BLNA 5IW6B 2F58L 4ZUUA 2O5XL 3G5ZB 5KTEH 3MMEB 1JWMB 4ENEC 3SKOB 1FVEB 4OKDA 5AYUL 4I1NB 3DARA 2J6EL 1NBQA 4LF3A 1EIBA 5DI8B 2OTUB 2OZ4H 1K8IA 5CMAA 2DAVA 2J8UF 4ZDHB 3M07A 1EXUB 4QRRA 4DGVH 3BKCL 2HVKB 4TULH 5TFSH 3RGHA 2ZUUA 1FDLL 2P5ED 1O0VA 1FFNA 3S9DB 3OWEA 3CFCL 3P4MA 4M1GL 2PW1B 4TUKH 1KIRB 5TH2B 1N5AB 3B9DA 4K07A 5I9QC 4YXKH 3MRMB 2D31B 3DOSA 4M00A 2AJYH 3O9WA 2EC9T 5CBAA 3MXWL 4YHML 3LPGA 2QSQA 4XC1L 3EOBA 4PTTA 3NBNA 5D5MA 1I7TA 4ZOAA 2NY7L 3FFCB 1OSZA 5JOFB 1J1OL 3MV8B 3ORJA 4JFPA 1Q9LA 5JHDE 4MAYD 1NGXA 5MERB 3FB6A 1KN2H 2MNUA 2VLME 1IGIL 5ICZB 4EN3D 1OP5H 3CX2A 4NM4L 1BFOA 5DA4A 4HWBH 3VMPA 1OTSD 2NY5H 1MFBH 4DKDC 3QUML 5GJTH 2EIZA 1ACZA 2X5PA 3CPLA 4IJ3B 4U4BA 1N64H 3IS0X 5DDHB 4KHXL 2F54D 4AQOA 3DO7A 1LD9A 5FGRA 4PBVC 1CD9B 1EH9A 4MA3B 3VFPB 3KXFD 5EUKA 5IVXB 5E03A 1P7KA 4HH9B 4QXGL 4KK5D 1BVKB 2HT3D 4QOKB 3GNML 1RPQA 1R3JB 1OWRM 1RIHL 3JUYA 4C57C 4M3KB 1VFAB 3MA9L 5F7UA 3NOIA 4NC1E 1KJ2B 2R2EA 3RGVD 5EOCH 3UPCA 4OIBA 2YPVH 1NGWA 1YNTA 4ZFGH 5ANMA 2UWEF 3LCYA 4OF3A 1SJHA 5EORH 5IB2B 1MVUB 3O9WC 5BRZB 1RK0B 2E5EA 3OXSB 3WS3A 1YQVL 4HK3N 5C0EA 5KSVA 1HILB 3VMNA 1RUAL 2PO6B 4QXTB 2J88L 3DVIA 4OV5B 2GJZB 5D2NA 2Z31D 4R3SA 2ARWA 2X4TA 4KFZC 5KZCB 1GOGA 3SJVE 4OIIL 4X7TA 3KJ6H 2GSIA 2E27L 2JTDA 1DVFB 3OB0K 2EEBA 4LSPH 4OM1H 3REWB 2VDNH 5TPWL 3QUZA 5JNYB 5EU3A 3BYYA 3KVQA 4JREB 1OAZH 1I9RH 3P9MB 4RBPK 4JPVH 4LGSB 4BZ2L 4O9HH 1G7MB 3ZKMC 2AK4D 3UCRA 3IFNL 2FGWH 1OGTA 3UPRB 5D70H 2XACC 4MXWH 2DLTA 1DE4B 5HGHB 5I1HH 5ACZA 5LJYH 1ZGLB 2PXYD 4PYGA 4GKSA 4WU5B 5ADPL 5HPMA 2AQ3A 1MJ8H 2J3SA 5DS8A 4XNMB 1CLCA 1NAMA 2H6PA 1BFVL 1E27B 2Y06L 4YPGB 3KWWB 2ED7A 4I18B 4JCMA 1U58B 1IM3A 5J6HA 2DD8H 3W0WB 2VDOH 3HC4H 2JJTA 1A5FH 4R8WH 2BMKA 2I25N 5I0DA 1HI6B 1A02N 1KELL 5HBBA 1BAFL 3FT2B 1UWGH 3QQ3A 3V6OA 2EKSB 3QDJB 5J11B 1S3KL 4HKXA 2VDRH 4PRNA 5A1AA 4JQIH 5B39B 3QWRA 2NXYC 5IB4A 5INCB 2DLIA 2X1OA 3DUUB 4N5EC 1RZ7L 1INDL 2OBGA 2AJ3B 5KOMC 2Z35A 4FXGB 5D2NC 4NUGL 4RMWA 3GM0A 4HKJA 1MUJA 1WFNA 2H32H 1OP3H 4RA3A 3CDCA 5CEXB 4HV8A 4LHJB 2HH0L 3BP5B 3ZT6A 3G6AB 4KVNL 3LKOA 5C0AE 1D5BB 4YFLF 3KLAA 5K9OA 1FVDA 3QUZC 1Q9OB 3ULSB 5CEZH 4WEBH 2ID5A 2MCG1 1UCTA 3MJ7A 3QAZB 3L5XL 4XP4L 5EA0H 1EEZA 1FFQA 2G5BB 5C09E 5IHZA 2GYSA 4JO4L 2MPAL 3U0PA 2JKXA 2G60H 1QRNB 4QHNA 3VWJD 2HVJB 1JPTL 4LPXA 3VA6A 3VXMD 4KVCL 1KCKA 1UC6A 4M3JA 1D6VL 4Z78B 1R3LB 1ZLSH 4NCC1 3MOBH 3JV5A 1NCUA 4WI6A 3FQRA 4UILH 2BVQB 2Y36L 5D71L 5KSAA 3WKMH 3MRPB 1I4FA 3V5DB 4OLVH 1QBBA 2JJTC 3ESVF 4G80A 3ARGD 3KPRD 2ERJB 3OAZK 4OZFG 4R4FH 4Y4KA 3V6OC 4G5ZL 4WJ5A 3RL2B 2C7UA 1XZ0A 3KPSA 2ZPKH 3G9VA 1JF1B 2E7LA 2HKFL 1QNZL 3QQ4A 4R7NA 1CG9B 3MCKA 4JDVA 3QDGA 1AO7B 5DJCA 2R1WA 3WE6A 4I48A 4JLRB 1K2DB 5I8OH 3DIFB 1LO5A 1IGJA 3D85B 1Q1JL 3UTSB 3RVTC 1NBVL 1OSPH 1N4XL 4MVBD 4K3HA 5DUPL 1I8KB 5E5UB 5F88B 43C9A 3V79C 5AUMA 2Y72A 5HHQB 1RZGB 3NABL 1RJCA 3X14A 1FYTB 2BFVH 4NWUL 4O5LH 1SYVA 5AWNL 1YEHL 2OP4L 3MLVL 3FN3A 4NO2A 1C08A 1DN0B 3VXSA 1KIQA 1UQSA 1JGDB 1OPGL 2Z4QB 2VZVA 2FJGA 2FCBA 4GRLD 4JFDA 1A1OB 4OBSA 1CTNA 3STLA 5C92A 1R6VA 2YC1A 3QUYC 4MNQB 1MCNA 5ID1A 5JW5A 4YFLI 5IK3A 3VGAB 5KSAC 1OARH 1KACB 4Y1AD 1CVSC 1T21B 4FOMA 1DQDH 2JJWA 3N0PB 3PP4H 5DMGC 5EZIL 2FX8L 5FIEA 2EYTA 3OKKB 3PQYD 4Y4KC 1BIIB 4JJ5B 1P9MA 3OX8A 3ZDZE 3IDIA 4PV8B 4WFHE 4D9LL 4HUVB 1T7ZA 1FCGA 3OR6A 3RZCB 4HK0A 5DJYB 3VXRB 4LNVA 3B9KD 5D2LA 1S7UA 2APVA 5E2TL 4YDKH 4JRXD 3NIDE 1A7QH 2Q7NA 4X6DA 5IR1A 4FQCH 4QRPE 4G7VL 1UZ8B 1ED3A 4LSSH 4PY8I 1NC2B 3DX8B 5IHBA 4RISL 3ARED 4LMQE 5J1AB 4TUJA 3RU8H 2F9BT 3TH3T 3OKNA 1MIEL 3MODH 1F58L 4K3GA 4U6HB 2P48B 3HI1B 2F53B 3HE7C 3RWIA 3TBYB 5E8OA 1PY9A 5GHWH 2R0KL 2VLRA 3VGGA 3TNMB 2FB4H 2BOBA 3EO9L 3WYRA 1NSNL 2CO7B 4XP1H 3SO5A 3GBLA 1RIVL 3KAAA 2VL4A 3WJJA 1JGEB 2X40A 4QHKJ 5T5NF 5EBWA 1KENH 2H3NA 4ZPVB 1BVLB 5E6IA 2IH1B 4PJXB 4IRJB 1TPXB 4NQDB 3WFEL 5CSZB 4RQQA 2GCYB 3FKUS 1ADQL 3TNNB 3BZ4B 2FJHA 4I3SL 1WWWX 4JKKA 5I1JH 5ISZA 4BH7A 5J8OA 1GPOL 2DWEA 4FQHB 1TFHA 4X0KA 4F15C 4DOHB 3I75A 4ODWB 4FHBD 1FH5L 2YKLL 4JRWA 4AZ8A 3NAAL 4PRIB 1G7LB 3UMTA 1ZK9A 1DQTA 4YAQA 4PBXA 3D18A 1MHHB 5DRWA 4K7FB 4PJXF 4NBYB 3SQOH 1I7UB 4JHAL 4OSUH 1TENA 2EZ0C 5LXGH 3BZEB 1YMMA 4MLIA 2XXCB 3RIFF 3G6JB 2VLJE 1FVCB 2P45B 4H88L 5F9JB 5JW3H 4K94C 4U3CA 1P1ZB 4G9FB 3HAEB 2VL5B 1I8IA 4S1QH 4XNYL 4Z7UA 3H9SB 3RTQD 5SWSD 1E4KA 3P11H 3A6CL 1JIBA 5BV7L 3LH2L 1JGUH 4UDTA 1LE5B 4Y8DC 3PP3K 3VXUB 3WUZA 3QG6A 3RNKB 5DJDB 4GMSL 1RHHA 4NGHL 2GY5A 4Q2ZB 4ZSOB 4Y4FC 5FHAH 1JRHL 3Q0HA 3TN0A 3CSYB 3WJJC 5GRJL 5E6IC 4OFDA 4M7KL 1FZKB 1WISA 1BM3L 1NGYA 1H3XA 4WV1B 3KYNB 4ZOEA 1AQDA 1QVOA 3MX0A 3AS1A 1NCCL 1JL8A 3C9NA 5MEND 4JPWL 4PUBH 5C3LD 1OAKH 1OM3H 1MJJA 5I1CH 3T1FA 1E4WL 1R3HB 3FFCD 3ROLA 3N9GH 4JFQA 4Y5VC 4HHAA 4LSUH 4NRXA 2EXWD 1J05B 5EIVA 5IQ9A 1A4JB 4X6EB 2PYEA 3HCVA 3FONB 4AG4H 5HHOB 1R3IH 5J6GA 3HE6D 1W0VA 1W72A 5E9DA 3WNMA 3B3IB 2VN4A 4LRIA 2QQKH 4H1LG 2QSCL 4PJIE 2O5YH 1KPVB 3RWDB 4WO4D 3SO3B 3F12A 2Z91A 4JM2F 1UWEH 3B4NA 3CXDH 3QWQB 1CQYA 1HKLH 2CKBB 2VNCA 1M05B 2R29H 5C07B 3GO1H 3V7MA 4RAHA 3W39A 1NFDA 5ILTH 3ARDD 4Y5XA 2P7TB 1UB6B 3NCJL 1C1EL 4JO1L 1MCSA 1G0YR 4DEPC 2E9BA 3SDCB 1E4KC 3IRZA 1L7IH 1IC4H 3Q3GA 5CIPB 2SEBB 5HYSA 3L5WB 6FABH 2PTVA 4PS4H 4RGMC 3NGBC 4OGYH 2N1KA 4XCYB 3RWFA 3QPQD 2ZSWB 1AQKH 3LVEA 4C54A 4RGOH 1JWUA 1C5DA 4FFVD 4LLYB 3V52H 3H9YA 2F8OA 4G6JL 5GGSY 2APXA 3TN0C 4PRBB 4GUPA 4OT1H 5CEZD 4P59L 5J9PA 1S7SB 3VG9C 5C0DA 1P6FA 2IANE 5JHLL 2W0FB 2DLEA 4S11A 5DMIH 2V17H 5IBTL 1NC4A 4EOWL 4WI3A 3TFKC 3IU4L 3WL9A 1T83C 3INUL 4YZFE 2C3VA 5L88L 2PO6D 1CT8B 3FQTA 4V2BA 1PY4A 3EYSL 3ZDXF 1A1NA 4ELMB 5KZCD 1MLCA 2KL6A 1MNUL 3U83A 1EFXB 1WWCA 1QSZA 1HXMB 3EO1A 4OCRH 3SDYL 1DVFD 3SGKA 4LRIC 4ZS6D 4MQXD 4ODTH 3RL1B 1UA6H 4YHKL 3R06A 3KGRA 4K71B 4UIMA 5GGQL 3GJFA 4Y8AA 2MOVA 2Z92B 4U1KA 3WHE0 5CILL 4ODSL 4ELMF 4RFEA 4Y5XC 1DBBH 4OGXL 4FXKA 4WIQA 1JNHA 3QUXB 1KB9K 3O6KH 1FZJB 4F2MA 4B50A 2YMXL 1DR9A 3HPLB 4ZO7A 4PJBA 1UM4L 2X4PB 1RUPL 4UT7L 1FN4A 3ARBB 3H42H 4APQA 4BKLA 5BQ7B 1MAJA 4XMPH 5SV3A 5DK2A 1ACYL 1SJXA 4H20L 4Q6YA 4L4TE 3HN3A 4LLWA 2CIIB 2LQRA 4RSVA 2ZJSL 5J3HC 5ESAB 5D72L 1NEZB 1DP0A 1UEYA 3PUCA 4LCCB 5IIEB 4LPVA 4IIQC 4B5EA 3DV4B 3BH9A 5H8DA 3B8YA 1Y0LB 4N9GA 3MRBA 5KSUA 2X4RB 3DYMA 2DIAA 2XWTA 3ZKND 3T1WA 4F7MA 4CNIB 1JYVA 2VAJA 1NCAL 5CIPH 3V4VH 3I6LD 2BNQD 1ZVSA 4C4KO 1I1CA 4NFDA 1TVBA 1UYWL 4O2CA 2P5WE 3L5JA 2K7QA 4KKBD 5CINH 5EU7E 2E6PA 4GXVL 3SGKC 3M17A 4FTVB 4Z7WB 3MCLH 3IDJB 4YEFA 2OTPA 4I2XA 3TA3A 2R4RH 4UB0L 4WI8A 3TBVB 5L2JB 2XIDA 3D2UD 1W0WB 3VDBA 4P2QE 5DQJA 5INDA 5DJ8A 2DLGA 4DKFH 4PJHA 3UZEA 4L8CB 1EAPB 3T65B 1MCPL 4P2RA 3MO1A 4YUEH 1J10A 4Z7OE 4N0CC 1AH1A 1IZJA 3UXFA 2WBWB 5D1QD 4K3EL 5F6HI 3DBXA 4LPUA 2GK0A 3BZFA 3VFTA 4BQ6A 4HULB 1KCVL 4APQC 3CUPB 1JZ3A 4PB0H 2D7MA 4GW5A 3IETB 4J3OC 2YWYA 4V1DA 4ZUWA 3T0ED 1U2CA 5T1DL 2HT4C 1SYSB 1CCZA 3HNVH 3GMLA 1NAML 5BZDB 2H9GB 1ZWIA 1WTGT 4CMHB 4OF8A 4Z7VE 1BJ8A 3SCMB 1T2QL 5CBEB 5I66B 5B3NA 5HYQB 5F7WC 1QA9A 2FBJH 2VRAA 1JWSB 3VGHA 4LBEA 4EI6B 4Y4HB 3TZVB 1AO7D 5A43C 4JFZH 1M6OA 4OQTA 4R9HA 5FGBA 1RVFH 1U8LB 4NT6B 3W82A 4JKPH 4Y2OA 1OLLA 3PNWB 5SWZE 1KG0B 4HIIA 1QLFB 2WWMC 2BSED 2HA1A 3UTSD 1OQXA 4DW2L 2DTMH 3HUJE 5IVZB 3VD5A 3N1MC 3DTXB 2DN7A 4JVWA 3TA3C 4JY4A 4HS8H 3T4YB 1JI2A 2WUBL 1NAKL 2IAMB 5FF6A 5F7EL 2VDQH 1JTOA 1FYTD 4Y19E 5CEYA 1F11A 4J3VA 1VFUA 4PRDA 1Q94B 4ZFZB 4X9BA 3PWJA 5JW4M 1B6DA 3OKMB 3GFUA 5GIRB 5LAXA 3MRNA 4M5YL 4LCWD 3L7FA 1KULA 1BQLL 4HJ0C 4A2MA 1BEYH 5EIIB 4M8QA 2GK2A 1KPRB 1S9XB 1KEMH 4OFVA 5EO9B 3RNQA 3QI9B 4NO3A 4XCFL 2W9DL 5EWIH 4HAGA 3WO4B 1H15B 1WCQA 3C60A 5FDYA 1BQHA 4R0LB 4UU9A 5C8JB 2AJUH 4QTIH 3CGTA 1KBGH 1B4JH 2F19L 5E00B 5I8KL 1FSKC 2DI7A 1JGLL 1IC1A 3DVNB 1UG9A 4IHOA 2CDGB 4M62L 3MTRA 4NJAL 1HHJA 2P43B 2JCCA 1ZA6B 2C1OB 1PX3A 1YPZE 5DFVC 1BD2B 2AABH 3RY4A 2MJWA 2AQ2A 3VFOA 1BX2B 3QIWA 2AV1B 4W6XB 1HXYB 5EU6E 4LHUG 5L6YL 1F4YL 3F7VA 1QLRA 2H1PL 4W81A 5FGBC 2MHAB 5L0QC 5IT2L 1JZ4A 4L3AA 2FLRT 1T66D 5CD3A 5A40E 1QSFE 5AZEL 3WIHH 2WWKT 2FSEA 2FO4A 3CMOL 5H35B 5I15L 4F8QA 2CDFA 2F53D 3C08H 2YD6A 1H3VA 4LPCA 1OVZA 4HF5L 5FUOH 3EDFA 4NIKB 3MRKB 3O0RL 1U93B 4K7PL 4NHCL 1JYWA 3UBXA 2FECL 5EN2B 4OZIA 4GG8A 1RJYA 2EDOA 2I5YH 2ZCKL 5AAMA 1AE6L 1U91B 1Z9OA 15C8H 4BA8A 3A67H 2BSRB 4N90E 5FCUL 3IXAA 1FQ9C 1V3KA 5C0CE 4NN7C 1MJUL 3EHBC 1CU4H 3CVHA 3K8MA 3QCUH 5HTSA 4D94A 3GSNB 3IVKA 3QA3A 4GS7B 4GKOA 5C71A 1N26A 4HSQA 5E5MB 3U30C 3C60C 5EU5B 3MA7B 1KYOK 2WBJB 3L3DB 1G7IB 1VACA 4X9IA 2HFGL 1I3VA 4X6CE 1CDIA 1PG7L 2XWBA 3DX7B 3EJJX 3GMOA 4NZUH 1NMBL 3PHOB 1GYAA 3D25A 5DMYA 1JPGB 3VFWB 2VDML 2Q6WA 2DS4A 3HRPA 1S7WA 1B6UA 1DLHB 3WIIH 3V5KB 5H37H 2ZSVA 4P5MA 4P5KA 5FM5O 4PJFF 1KJMB 4H25B 4JDZB 3MXVH 3RZWA 2YPLA 3UTZA 3RA7L 4EIZC 1NUNB 2P44B 5F1IA 4DJMA 1XF5A 4LCIH 1XGPA 4OLWH 5ADOL 1A6WL 2BCKB 4OB5L 1NBZA 5DGRA 3QFJA 4F7EA 4WDIA 3GSVA 2LVCA 3FN0H 1IGCL 4Q9BA 5IBLD 2UZIL 1LDPL 5D93B 3S4SG 4QRQA 1S7QA 2XI9A 2HWZL 1HYSC 1U8IA 4MHHI 2X42A 1WICA 3IJSB 5F7NC 4O51A 5JDSB 4HPYL 3K2UH 4BUGA 5GSVA 2W38A 3MROB 3KDMB 3QB7C 5HYIA 3SDAB 1HHGA 3VXNB 1J8HB 1U8HB 2QQNH 3WS6C 4LIQH 4F57L 4E41D 1WAAA 5ITFB 1J5OH 3OB0H 3PJSB 2XFXA 5D1ZD 5I1EH 1T0MB 1CIUA 3I02A 4RBPH 3DMMD 1U8JB 3LIZL 4JM2D 5DSCB 3FO0H 1DDHA 1JHTA 4UNVA 4WUUB 1ZHKB 2OQJB 2FYYA 2I60H 4HJGB 4HIHB 4Z7NE 4PJCA 1F3RB 4L8DB 1DQMH 1H3PH 1H3TA 2QQLL 4KMTL 3V0WH 4OCXH 4NHUB 4XNUH 4U0RB 4RA0C 1T7XA 4RX4D 2XXMB 5DMKA 1L6ZA 4HZAA 4M48H 5H2BA 4PJDB 3VXPB 2XN9D 2FZ3A 2RFXA 3HZVA 3GSNH 4ZPTA 4ZTPL 3IDYC 3DETC 1AGFB 3BGFC 1MIML 2R2BA 1Q8MA 8FABA 3CNKA 3TBWA 4HDIB 1S7XB 3NFPB 4ETQB 3S6CA 3UDWA 2GSGB 5D6DA 3JV0A 4Y2DD 4KTEL 3SKNA 1L9MA 1Q72L 1MAKA 1NCDL 2PR4L 4FFZL 1FAKT 2RR3A 5IMOA 1HQ4B 4LLMA 3T08A 4IDJH 1HSBA 3WFBL 1AGDA 4U1NB 1PLGL 3LEYL 3PXHA 2M26A 3Q6GH 1YMHB 1KCLA 4NP4L 2BNUA 4YHYC 1DLFL 1GRWA 4KROB 5DHXB 4PJGA 4JFXA 1WZ1L 3HZYB 5C2UB 3HMWL 3WUWB 4MCYB 2ZKHH 4U1IB 1A6TB 3S37X 4KJYB 3HZKA 3DWTA 4JO3L 4YQXH 4AEHH 4XWOD 1C7TA 4ZXBB 3O81A 1H3WM 4ERSH 1XGUB 2DWDA 3HC3H 1MFCH 4AMKH 1SHMA 3KR3L 4V2CB 4HBCL 4UQ3B 3W11D 1W72L 2YD2A 1VDGA 4CVZB 3CH1A 1A47A 4G42B 1V7NH 1OL0A 1EVUA 5T1KA 2BDNL 3MFGB 4CAGA 3LRSA 3O6LH 5DQ9B 2VKXA 3QUXD 4EVNB 2CRMA 2IH3A 1MEXL 5HVGB 1XGRB 3ALWA 4JR9L 2PCPB 4U1LB 5GJSH 3UDWC 1X5LA 2FIKB 5D6DC 3BP4A 4ODVL 2PN5A 1K85A 1GGBL 1ONQB 5F96H 5HHPA 3RWJB 4HIJA 5ANME 3RFZC 4KKAD 2EKJA 3MUY1 4HIEA 3V0AC 2VXVH 2E8ZA 1PKQA 3O4LD 5IB1B 4FQ2L 5F89A 2GJ6B 4LSTH 5C0BB 3VFNB 3DGCR 3WXWH 4U1SB 2BHYA 5LGJA 3VI4E 1IAOB 1ZVHA 2GT9B 4XZUB 3X11A 4X4XB 2F74B 1Q9KA 5LCVH 2XTJC 3QR2A 5TF0A 1LO3L 4KJWD 5F44A 1KN4L 4R2GC 3WEXB 4TSBL 4N8VG 3IXTB 1QD0A 4XT1C 2AJXH 4PGEB 5ETUB 3UYRL 3MNVA 3GI8H 4U1MA 4HWEL 1BJMA 2A74A 1E28B 3VH8A 2NX5B 4MNGE 3RUGA 3U9PH 4UV4L 5EBGA 1SEBB 5GZNC 4NRYB 3MLSL 4Q9RL 2NTFA 4JFHD 4Y16B 1FLRH 2GUOB 2VERN 4XPFL 4B0MM 3V6BR 1VHPA 1BQSA 5FKAA 2P42B 4PG9B 2HG5A 2DJUA 5HVWA 2ICWJ 3VG0L 1K4DB 3D0VA 3KPMB 5F6IB 3SDXF 4JY5L 3K8KA 1ZAGA 3RJDA 1XGQA 3P0GB 3FN9A 5HGDA 3QISA 2E9JA 1TTGA 3ZYOA 2HJKB 2HT2C 4KAQH 2IPUG 1HINH 4MSWA 3GUTB 4NRZB 4L5FH 2ZOKB 5DC9B 4H5SB 2G75A 1KC5H 4DQOL 1EO7A 4P49A 1KIPA 3K74B 4JFFD 4FP8L 3K4DA 4U6VL 3ULVF 1F97A 1NMCB 3VFVB 3L3OB 4Q74A 4YBHA 3U7WL 5DHVA 3P9LB 4KK6C 1VGKB 2J2ZA 1U8NB 2FX9L 1YYLH 3DXAB 4P9MH 4XPAH 5C08A 4AEIH 3HLAB 3TF7C 1CLZH 4JQXA 4MLSA 4HGKC 4KKCD 4Y4HD 3EW3B 1JF6A 4TUOB 4ALAL 1IAIM 3WNOA 1LP9A 4WNQB 5CAYB 3D39A 4G3YL 4YE4L 3MLTB 2HMIC 3RWEA 1DBJH 5BXFA 4CW1B 3QQNA 5KVFL 3AC0A 1ZXQA 2W60A 4M6ML 1A7NL 2A73B 4QHMA 3MLYL 3C6LD 1NCBH 1CGSH 3DX9B 3U36A 4GAJL 5EFIB 3VJ6B 1MCFA 3UEZA 4JGJA 4PRPA 1DBAL 5T3XD 3P0YH 1R5WB 5D7KE 4IMKA 3O41A 1UB5B 9CGTA 3MRHB 2AK4E 1G9MH 2Z8VC 3CD4A 3I6GA 2W91A 1DQLL 5T5FH 5TE7L 4HIXL 2D0GA 5BS0D 3E2HC 5JHDB 2APWA 2EDBA 3OKOB 1TQCC 3QPXL 3ZLQC 1XT5A 5I2IA 3U0TB 4FQLH 5DD5L 5GS0C 1SJEB 4U6XB 1MI5D 5LWYH 3ECBA 3KPSE 4XVTH 4PLKC 3T0AA 2GTZB 4J6RH 4MWFB 3WFZA 1MFEH 5HHMD 5H94A 3VD9A 1CD1B 2B4CC 4HFWA 4WCYH 3QDGE 4ELKB 1PW3A 2J1KA 2A6JA 4JQXC 4JVUA 1QSEA 3MV9B 3TYFA 4UZGA 1ODAA 3PP3H 5GGVY 5CCKL 3ULVH 2J8HA 5DYOB 3VWKB 2YD1A 3NFNA 2FEEL 4Z7QE 5KG9B 2DYPB 5K9QG 3FRUA 4NJ9L 1FNGB 4UTBH 5DD6B 1TZIB 1ZHNA 4JFEA 5DJAA 3PGFH 3QHZL 3E6FA 1Z3GL 2AJSH 1ZT4A 4P23A 3I3EA 5KS9A 3HI5L 4YDJB 2NCMA 1IC5L 4CRPA 2F8XC 1T22B 2D0FA 3ARSA 4KK9C 1OTTC 1JZ7A 2X4QA 4WHYH 1F6AB 4OQTL 1DFBH 3BEWA 1CE6B 1SEQH 3ZTNH 3SKMB 4NO5B 5E8DL 5GISL 3SDDB 2OJEA 2DDQH 4D3CH 1TETL 2X89D 4QHUA 5FYLL 4IMKC 3TO2B 1XF3A 3N85H 1T0NB 3ESUF 2AGJH 2X7LB 3GMRB 5JLZA 1OTSC 3FQXB 2P8LB 1L6XA 4XBEL 5A16B 5C0GA 5KANI 3GIVA 1R24A 1BBJB 4QXUL 2YRLA 4POZD 5F9OH 5I8EA 4XWGL 3LMJH 4LHQB 3VXME 4DTGL 5DVMA 1GGCL 3TCLA 4L9LA 1LEGA 4ISVB 1FFOA 3QEUA 3QULB 1WBZB 1L7TH 4D9RD 2QADC 3EOTH 4KUCF 4XP5H 4R97B 4OZ4B 2WQRA 2X4SB 3EOAA 2LAGB 1QSVA 5I71B 1KB5B 1SY6H 1ORSA 25C8H 5DR5L 3MRFA 2EH7L 4POUB 3I6KA 5AD0B 2D0HA 1HHHB 4X6DE 1RJZA 3ARYA 2D7QA 3DV6A 5EOCJ 3CCHB 2Q76B 5JXAL 3HKFA 4MNHA 3U4EA 3EYUH 3F7QA 1S78D 4QRTB 4WTXA 4FNLL 4X7SH 5DEFA 3DLQR 2Y6SC 2J5LB 2IADA 2W9EL 5D8JL 3OG6B 1ITBB 5HI5C 2FX7H 3BWUC 3JV6B 4S1DC 4PRHA 4PJ5D 4XC3H 4F58H 2Q7YA 3VFRA 1XIWB 2JIXD 5DD0L 4XMKH 5AZ2L 4NFCA 4HMCA 1U2HA 3PL6B 1Z5LB 2DQCL 1G7PA 2V2WA 4G6FB 1I8MB 3HFMH 4P3DA 4LCUB 1XR8B 1MHCA 3LEXB 2XPGA 1W8NA 1YEFH 4MB4A 3EFFA 5DD3H 5DVKA 2W92A 2LV4A 2X9XA 1RZIA 5L8JB 4RWHA 4GG6A 4L9LC 35C8H 3LQAC 1LEIA 4O2FB 5C0AB 1OQOA 3BHBB 2ORBH 4OGAD 3CVHL 2XQYG 2NPLX 3E6HA 3PGCB 4NZDA 2Z93A 1UXSB 3LEVH 1IFHH 4L3EA 4H8WC 3STZA 1MCKA 4M7JL 1B88A 1WT5C 3CFJA 3S3PA 4JO2H 1IARB 5ALBL 5E8EB 3PHQB 5KSBA 5DRNA 2VQ1A 1YEGL 4CMMA 2H2SD 5EZLB 3EYOB 1NMAL 4U31A 3D0LB 4OLZL 1OHQA 1A7PL 2XQBL 5ERWA 3G08B 1HZHH 4Z7UE 3O2DA 5C7XL 4HG4K 1CDYA 4MQ7B 3CFKB 2A77H 2ZCLL 4LFHG 4F33B 5GGUB 5IROA 4JRXE 4ZOCA 2DBLL 3QHTC 1CR9H 3ZTJG 1QR1B 1PZ5B 4LEOB 2EYSB 4QY8B 2DM4A 5K33A 2BNRA 2VISA 2NR6D 3BPNC 2X4UA 5EZOH 5HD8C 2R0ZH 5HDQH 1U95B 5GS1B 4KJQC 1IJ9A 1KB5H 5GS3A 4OD1L 2NY6D 1MCDA 2JLLA 1DUZB 1H0DB 2EDRA 1WFUA 1KFAL 3BN9C 2AXGA 1N8ZA 1BZ9B 5DXWA 2A1WH 2MKLC 4YK4C 1IQDB 1A21A 4LCYA 3JWOH 3OHXA 5L2KA 1KEGL 4PJAE 5I1AB 1CFTB 2O5ZL 5DO2C 3B2VL 2PYEE 5IFHH 4HPOL 1S5IL 1V3LA 5FHBL 1UWXK 1PQZB 4YDIH 4O58H 3W81A 1AY1H 4TSCH 1KIUA 5J1TC 1BFSA 4XRCB 1KSRA 2VLKB 3MGTA 5DK3A 4ZXBD 2OZ4A 5E2VH 3GGWB 2FJFA 3ARGC 1EEQA 4JZJB 4NNPH 3OXRB 4I8DA 4L8BB 2J8UE 1K4CB 3VD3A 3QEQB 4LLAA 3SPVA 3CFEA 5ICYB 4PRAA 4M5ZH 5IROC 3GMPA 1YEEH 4WFED 5BOPA 3O6FD 5DWUL 2OYPA 4PJ8D 1V7MH 4LK4A 1A6UL 1H8OA 4FMKA 1TTFA 5LGKA 5GGTH 5B4MD 4ZNEA 4TQEH 1A3LL 5DUBA 5SWSE 1BOYA 3NA9H 4PB9L 4K8RC 1N2RA 3MNZB 3GHEL 5EUOA 5FV2A 3IYLW 4YWGH 2VDLH 4QTHA 1AXSA 5DTFB 4PREA 4UINL 1S8DA 1YJDC 3IT8D 1A2YB 1B0RB 2XG4A 4PLOB 5K93A 3QJFB 2YXMA 2R8SL 5FAAA 3BPLB 4JRYD 1F3DH 3TO4B 1RUML 3G6DH 2IPKB 4R4ND 3MJ6A 3SE8H 5FO9A 3VXTA 4HWBA 1WC7A 2P8PA 4QRPB 1XF1A 4KTYA 5I76A 2HP4A 1QRKA 3QO0A 4DGYL 5IB3B 5J57B 2VQTA 4YBQC 2R1YA 4WTWA 1AXTH 5LVEA 1J1XH 5MENE 3ZDZF 2HJLB 5FO7A 3T4AB 1EJOL 1JNNL 1ZT7A 2NLJA 1UVQB 4WW2A 4HKZB 2IQ9L 4C56A 1FV1A 3MACH 3K1DA 4UUJB 4WHTA 4CU8A 3IAGC 3C8HA 1EUTA 4GW1A 4IS6B 1A7OH 3KHOA 3KYMB 3QIUB 1CTOA 1UACH 2DKMA 4I3RL 3ARUA 4FMFA 5I73B 1TLKA 1F6LL 4R4BB 1HH9A 4UMGA 5TDNA 1CXFA 3ULVD 1MQKL 2V9RA 2APBA 3RDTB 4PJBE 2A6KA 3B5GA 4GFTB 3PWPD 1CLOL 3B9KC 5MEQA 3I50H 1UM5L 1MHEB 3N50A 3HRZA 3TVMD 2UWEE 2ADIB 3G5ZA 3I2CL 2YD4A 2PTTB 3SKOA 2D03L 2ZUSA 3FO2B 1JZ5A 5AYQA 3GI9H 2XKUA 5IFAL 4XP6L 1D9KB 3O8XB 3LHPH 2VZ3A 1EUUA 5DI8A 2WIMA 1BQHG 3X17A 2HTKC 3TH4T 4OCWH 1AR1C 4RGND 4ZDHA 1EXUA 4NO0A 2VLJB 3Q5TA 2GKIA 5FOBB 4WY7H 1KIRA 5TH2A 1IAMA 1YC7A 3HPJB 3GBML 4JG1H 3JWDL 4PGBB 5TDPB 3IKCB 3BRDA 3TBSB 3WDHA 1AD9B 4J4PA 3MRMA 2D31A 2WWKO 3BKYH 1A14L 4WW2C 5JA8B 3IDMB 1I1AA 4MJ6B 1DEEB 2ADFL 3TJEH 1N0LA 3DSFL 1BJ1H 5JOFA 3MV8A 4HH8A 1FGNH 5HI3D 1PX4A 2PF6A 5TDOB 1MCRA 4PJ9B 5MERA 3GJEB 2VUOA 5ICZA 4KUZL 3P4OB 4P2RE 5KVGL 2FR4B 1D7FA 3HHRB 2HN7B 3UBXG 1JHKL 5ENWA 3QUMB 4XPHH 1V8HA 4X80H 4Z95H 2IQAA 3DVFA 5C6TH 4B7IA 2CRZA 3F7YB 4V1DE 4MX7B 3S35H 4YR6B 2IGFH 5FECB 3RVWD 3SKJH 5DDHA 5LBSL 1QFOA 1TXKA 3MR9B 3QXWA 3H3PL 1VADB 1FZMA 1IAIH 4XCCL 3VFPA 2V2TB 3GRWA 5IVXA 4HH9A 4PJIB 2R23B 3AAZB 1HYRC 1KT2B 4LMQI 4AH2B 1AFVL 1BVKA 5JDJA 4PTUB 5IM7B 1PKOA 1LK3H 4QOKA 3EFDL 3LN4B 3T0BA 1R3JA 3QBTB 2LTQB 3O3EB 2CK0L 1QQDB 3ISWA 1VFAA 4R96B 5GS0L 4B53A 1M71A 1IAII 2CH8A 4OZFH 3R1GH 3STBA 4TVPD 1KJ2A 2IG2L 4HC1H 5L7XL 4NYLB 2VXQL 1WZLA 4RFOL 4OZGE 4N0FB 4J4PC 1OAQL 1M7IB 2B4CL 4FFYH 5FYLE 5IB2A 1MVUA 2X9WA 2IC2A 4S2SB 3FB7B 4I0PA 5BRZA 1S9KC 2ZUYA 1RK0A 3OXSA 4EIGB 1G0XA 1HILA 3LAFA 2QBWA 3I6LE 4QXTA 5TJWK 1V3JA 3H0TB 3BT2L 4OV5A 2LAAA 3VFGL 2H41A 1OGAB 1JCKA 1L0XA 2BXYA 3SDDD 3BKCH 5JR1L 2XOTA 1CICB 1MLBB 5T5NG 4KUCD 1FDLH 2XA8H 3REWA 5I1KH 1FJ1B 4J2XA 4KY1L 5JNYA 3CFCH 3RPIB 4N0YL 2F15A 1G7MA 3AFLA 2DQIL 3D87B 3GK8H 4IJ3C 3RVVD 3SQBA 3UPRA 1UXWB 3SJVD 3MXWH 4KHTL 3P40A 4YHMH 1DE4A 5HGHA 1ZGLA 2ITCB 4X4ZA 1GCFA 2NY7H 3GMMB 4XNMA 5EOQL 3T0EE 2JCCE 2P8MB 1E27A 4YPGA 1FL3B 2N4IA 4I18A 1U58A 2Q3ZA 4NC2B 5I74B 1GOHA 1VESA 3W0WA 1OB1B 2LU3A 4RMQA 2ESVD 5CZVL 1ZEAH 4Z0BL 1HI6A 2AKRB 2VE6A 2XZAL 5JPMB 2WINA 3QUMH 4GRMB 1URLA 3UROR 3FT2A 2CQVA 2EKSA 3QDJA 4LNRB 5CGYD 2D2OA 4WWKD 5EC2B 4QCIB 3OR7B 5B39A 5INCA 2H45A 2MQ0A 4KI5C 2PO6C 4L4TB 4FXGA 4G6AC 3DURB 3X3GL 4OZIE 2R0LL 5D9SB 3IDNB 5CEXA 2DM2A 3GNMH 3PL6D 3G6AA 1RIHH 2CLZB 3VXOB 1CLYH 1D5BA 4GBXD 4HUMB 3MA9H 4PJ7F 1NLDH 1Q0XH 1Q9OA 3QNXB 1M4KA 4HLZG 3ULSA 4JREC 4H1LB 2X70A 4HFUH 4LDOB 2BVPB 2G5BA 5CWSB 1CDCA 1CFNB 2NY4B 4AT6B 2P5WB 2EEAA 2CDEB 3MLUL 5C0AD 1QRNA 2AV7B 1YQVH 1AKJB 1E6JH 3VXQB 1EMTL 4Z78A 2EDXA 1YEIL 3WLBA 5F7YC 1QFUL 3LQAL 4KKLC 4XNXL 4DGIL 5C09D 3NIGF 4I18C 4P2QB 2YPLE 3MRPA 3V5DA 4OIIH 3KJ4B 2E27H 1QKZH 4KQ4L 3EUUA 4HGWB 2E7HA 4HT1L 1JV5B 4H8WL 3ET9F 4JY6B 4JN2B 4QHKI 1ZLUH 3QDAA 3RL2A 1A4KB 5J11C 4BM7A 1ZLVK 3CIQA 3IFNH 1IEHA 1CG9A 2W0PA 1ZLWH 1EHXA 4AJ0A 4OCSL 3OGCB 4ONFL 1XGYL 4KV5F 5ADPH 5KJRL 5DVLA 3UZVB 4JLRA 1K2DA 4Z0XB 3DIFA 3PGDB 4JDTH 3D85A 4BSVB 1EHNA 4Z7OF 2Y06H 4KKBC 3EOYG 1WAAE 3TP4A 5GRUL 4QRSB 1TQBB 3EDEA 4P2OB 2WNGA 1I8KA 1Z6JT 5F88A 5GRXG 1SVZA 3G04B 5HHQA 1RZGA 2DL2A 1MRDL 4XH2B 1VGEL 1KELH 3QAZC 4OV6F 5F6HJ 3L7EA 4Z76B 2Q20A 4OFIA 1IGTB 5SWZB 4ZYKB 4YDLB 1FO0B 4Z7VF 5IVNA 1RD6A 2Z4QA 4FQIH 3KLSA 4LRNL 1RZ7H 1DL7L 1A1OA 3BQUB 4XTRC 2LFGA 4YDVB 2CUMA 4NUGH 2XV6B 1N7MH 4Y19B 4UBDD 4MNQA 3PWNB 4Z6AT 2HH0H 5C3TA 5JO5B 4EXPX 4P46B 4KVNH 1X5XA 3QNYB 4KJPD 1FNEB 3TPUB 1T21A 4ZAKD 4NZJA 3VH8G 2J4WH 2NYYC 3NTCH 3HUJF 3OKKA 4UTAH 2WAHA 3BUYB 2RCSL 3S3SA 4H1LH 1AHWB 1OAXL 2X10A 5JOPE 2V5MA 1PGRB 5M94B 4XP4H 4PV8A 4HUVA 3RZCA 5DJYA 4NQEA 2MPAH 3VXRA 1F3JB 2WMPA 5CZXD 4OLUL 4AM0B 1KJVB 5HVHB 4G6KL 1JZ2A 3O2DL 5D4QA 3KLHD 3UJJL 1D6VH 2D7PA 1UZ8A 5FYKL 2AXFB 2P49B 1NC2A 3DX8A 4CKVX 5GZOC 1VSCA 1NCWH 5HYJB 2Y36H 2BSSA 5FUZL 4U6HA 1ETZA 3HI1A 4FQXB 4FXLA 4K8RL 1GH7A 4Y5YB 3TBYA 5FYJL 5EU6B 5AAWA 1IRAY 3TNMA 1MCCA 3E0GA 5MEOB 4E41E 2XTJE 4XXDB 2UYLB 1YJDL 5HPOA 4YO0B 5IGXL 1QSFB 1JGEA 3HI6L 5IJVB 2HKFH 4ZPVA 1BVLA 5I1GL 1QNZH 1QHOA 3FJTA 1EAJA 4PJXA 4IRJA 4NQDA 3ARZA 1HOCB 1FBIH 1YPZF 5CSZA 1N6QL 2GCYA 1CDHA 1I7RB 1L9NA 2AXJA 3MUHL 3BZ4A 4BZYA 4HXBL 2JELH 1Q1JH 4JKLA 1YECL 4FQHA 4ODWA 1G7HB 5KTEL 4PRIA 3MJ9A 5DUPH 1V5JA 3KG5A 4OTXH 4MJIB 4TVSa 5C6PB 5CHNB 1FORH 4NWUH 4K7FA 3IF1B 4DKEL 3WV0A 2OZ4L 5AWNH 1PYWB 1YEHH 1I7UA 2ADJA 3MLVH 5D7JB 4P5TB 2NXZD 2YRPA 3KPPB 3RZCC 2XN9E 3RDTD 3WLWD 1N6VA 1SMAA 4BYHA 4ZUSB 3BZEA 5TFSL 2VZOA 3LRGA 5IFJB 3G6JA 5T1LD 3HNSL 3M1BB 3GEWB 2APTA 4JPKL 2XQYK 4EJ1C 3BDBA 1FVCA 5F9JA 5J56B 1RURL 3REVB 1FNSH 1EHLL 2OK0H 2DQFB 1MREL 3TLRA 2DM3A 4G9FA 3HAEA 43CAB 2VL5A 1I9IH 3H9SA 4L8SB 1T3FB 5HGBB 1MAMH 1ZSDA 1QFWM 1LE5A 4YPJA 3RVXD 5EZIH 2FX8H 3VXUA 3RNKA 3W9EB 5DJDA 4X6CF 4Q2ZA 4GMTL 3GJFK 4ZSOA 1OWWA 2JB5L 2DQGL 2YSSB 4M1CD 5D1XD 3CSYA 1UFUA 4D9LH 3CMGA 1FZKA 1X5HA 4IRJC 1TPXC 4LAQH 4HWBL 5KW9L 1AGBB 4WV1A 1MFBL 3KYNA 1MCJA 4G7VH 1VPOL 4HS3A 3MLZH 2NY2D 4S10A 1R3HA 5I8CB 3EZJB 1HWHB 1KTRL 1F58H 3T0XA 1J05A 2VLLA 4EI5D 4X6EA 1FPTH 3MYJB 4OCNC 3TCXA 5DLML 4GJTB 4TRPH 1S9YB 3GSQB 3OL2A 1J0HA 5HHOA 3BZDA 3QCTL 5TQ2L 4AEFA 4M7LT 3G5VB 2VQUA 2BY1A 1F4WL 3B3IA 3EO9H 4X8XA 1NSNH 1M7XA 1IEAB 1KPVA 3RWDA 1G84A 4KZEH 3ULUC 1U3HB 1HN1A 2CKBA 1M05A 5C07A 4ZG1A 4LHUB 3U2SB 3FB8B 1ADQH 5CJBA 1EGJA 2YPVL 4YGVB 2A38A 4O2EA 1UB6A 1QPXA 4IRSA 3R4DA 3DHJA 4I3SH 3EJZD 5HDBE 5EORL 3SDCA 5TF1L 4ZODA 5CIPA 1GPOH 2SEBA 4NDMB 1CFVL 1FH5H 2YKLH 3HB3C 4NQVB 3PV6B 2BK8A 3U1SH 2AEPL 2ZSWA 3O4LE 4YEEA 1NGZB 3DYOA 1CXEA 4LLYA 3V7AG 1LP9E 3UC0H 3D39E 3MRIA 4EZMA 1K8IB 4PRBA 1S7SA 2HLFC 4JHAH 4N0RA 4ODBD 3EJYC 4J23A 3QJHB 4LSPL 4WV1C 3RVUD 3T09A 2R9HC 3P4MB 4H88H 1OAZL 4PV9A 1UCBL 3V0VA 3NCCB 1CT8A 3U9UB 3LS4L 2B2XH 4XNYH 4PRPE 4MXWL 3A6CH 2IAND 4ELMA 1WIOA 4XCNB 3EOBB 5BV7H 1EFXA 1I7TB 2HTLD 3LKPB 4JFHE 1HXMA 4WVRA 2ZCHL 1HCFX 1NUFA 3NFSL 2X05A 2QQQA 4F3FB 5IW1B 1CICD 2NY0B 4YIQA 4GMSH 4HAFA 1F5WA 1Q9LB 3SO3C 2VTFA 3PWUB 5GRJH 2DD8L 4M6AA 2Z92A 4M7KH 5CP3H 3FTGB 4P4KA 2N56A 1A5FL 5L9DH 4PFEA 5D96B 1MSPA 1BF2A 2Y9RT 2C4FT 4IRSC 1NCCH 1FRGL 4JPWH 3VA2C 3CPLB 3SDCC 1JHLH 3FOLB 3S7GA 4OUUB 1U6AH 4LDLB 4LAJH 3F8UB 3S4SB 4JFFE 3ARBA 4M9PA 3HG1D 5EUKB 1IGFL 2Y07L 3GRWL 1P7KB 5ESQB 4TOYL 4NQCE 2WUCL 3JUZA 2P4AB 3C87A 4JFEE 2QSCH 4IOIA 3MV7D 2DLHA 5ESAA 4XI5C 5HDOA 5KS9E 4H26B 5E08H 1MWAB 4LCCA 5IIEA 1KJ2L 3DV4A 3TPKA 2R2EB 4MA1B 5C1MB 4WEBL 1VKXB 1Y0LA 5E2WH 2X4RA 1A0QH 3TGXA 4NQXB 2BVOB 3NCJH 1C1EH 4L4TD 4JO1H 5ANMB 1DQJB 4P57B 3RY6A 4CNIA 1F2QA 4ZQKA 4DAGL 2XG5A 5JW4Q 2A9ML 5D7SL 5JQ6L 4KDWA 1UWXH 5J7CC 2NNAB 1FLTX 2IBBA 3OB8A 4YNYB 4FTVA 4R3SB 4ACPA 4Z7WA 1ZLSL 5T3XE 3QYCA 4X6BB 2C3XA 4G6JH 4K71C 3B6SB 4P59H 2Q8AL 3TBVA 3WKML 5L2JA 1UM6H 5JHLH 2VOTA 1MHPL 5DURD 2OCFD 5IBTH 1W0WA 4JHZA 2DIJA 4P4KC 1VEPA 5IJKA 4XNZB 4R4FL 3C5SB 1QR4A 2X4NA 3IU4H 1U41A 1D6EA 4L8CA 1EAPA 3EZ8A 4MAYB 4MNGB 3T65A 1KTDB 5L88H 3VD4A 3V7AE 1AKJD 4EN3B 1F8TH 3LPFA 4S0SD 1VFMA 5C0NC 5GSRA 3EYSH 4P2YA 3ZDYF 3ARBC 4EDXB 3CUPA 4DN3H 2DI9A 3CLFH 3IETA 1OTUC 5CJOL 3WIFB 5HJ3B 5I8OL 1C5BL 1MF2H 5FYKU 3SDYH 1EERB 4KU1A 5BZDA 4YHKH 2H9GA 4RMUA 3SCMA 5CBEA 4FFWD 5GGQH 1IM3B 5I66A 4JGMA 5J6HB 1R0AL 4LCCC 5HYQA 3T2NH 5CILH 5FYJU 1B3JA 5ICXB 2BMKB 2R2HA 4O5LL 1CK0L 1JWSA 4S1RL 4EI6A 1T1ZB 3IS1X 5DZNA 3TBTA 3TZVA 4KJWC 1LO4H 4LLQB 1Q9WB 5EO0B 5C9KA 3RY6C 1X5YA 2YA2A 1ZHLB 4MD4B 5IHUH 4NT6A 1U8LA 2YMXH 3SE9L 1GHFL 4PRNB 4D9QD 5ID0B 3PNWA 3RQ3A 4D0DB 1KG0A 1QLFA 1UM4H 4UT7H 1RUPH 3RGVB 3ZYIA 5JORB 1DQQB 2ILLA 2CLRB 5IVZA 1H5BA 3DTXA 4Q7DA 4H20H 4C83B 1ES0B 2R1XB 4P2OD 2WZPD 1JPST 1RJLB 1XH3B 3T4YA 2IAMA 4MD5B 5MI0B 1FP5A 2ZJSH 4K3JH 1GGTA 3MFFB 1NCTA 2NY3D 1Q94A 4A6YB 2Z31B 1I85A 1MWAH 3OKMA 3PP4L 4P3WA 5IG7B 5IJKC 5GIRA 3ARFD 3W5NA 1NUDA 1YY9C 1U8QB 4PJFE 1KPRA 3G5YA 1YDPB 5EO9A 2DQTL 2XRAH 2V5TA 3QI9A 1UKQA 2PYFB 4XPGL 4Y19D 3B2UC 4D9RE 5KSBE 1H15A 1NCAH 4CJ1A 1BOGB 3FAWA 1BGXH 4YDKL 4R0LA 4OZHE 5C8JA 1A7QL 4FQCL 4GXVH 2AK4B 4X9HA 1A6AB 5E00A 1LILA 1A22B 1CXKA 4CMHC 2F5BH 3DVNA 3FQRB 5FYKE 3SCMC 2CDGA 4M02A 1CDUA 4MXQD 2PXYB 1I4FB 5JUEH 2I9TB 1ZA6A 5IB5B 2C1OA 1BD2A 3C8KB 4KKCC 1Y6KR 3ZSTA 1BX2A 3TZVC 2AV1A 1K3ZA 1HXYA 3NZ8B 1MCPH 4POYA 5F7MC 4XP1L 2MHAA 2V5RA 2UVEA 1MJ7H 4DWHA 4N8VB 3EYFB 3MCKB 1BREA 4PJ5E 1KCVH 3VRLE 1TJHH 1I3GL 5TE6H 2LU7A 5H35A 4EBQL 2IAMC 5EU6D 2AEQL 3MRKA 3RKDD 3U4AA 5B38B 1EX0A 5EN2A 1WV7T 1T2QH 4Q9CA 3AM8A 2HFEB 3VDAA 1F4XL 1QSFD 1U91A 2Q1EA 3NCMA 2IFFL 1YYMH 2BSRA 1JGVL 2R56L 1WBYB 3SQOL 3S3JA 4ZO6A 3O3UN 1NGPL 3QI9C 2WSKA 5DEGA 5F7DB 1F90L 3GSNA 3WO4C 4Z7QF 5E5MA 2FJGB 5EU5A 5HSFA 2ICWB 2WBJA 3L3DA 4R0LC 1KLGB 3V6FB 4GRWF 4DW2H 2JJVA 1EEYB 4OLYL 3H7LA 1F2XK 1F42A 3GBNL 3STLB 2CIKB 4WI5A 4N90D 3THML 4PD4K 2ADGB 4S1QL 5IK3B 4DK3A 4LASL 1NAKH 2RBLA 3L1OH 5C0CD 5F7EH 3VWJB 1JPGA 3ZL4H 3VFWA 3VXMB 3VE0B 1PG7W 3OAYH 1DLHA 3MLWL 4RWYL 1OOAA 2JE8A 4M61B 4Y89A 4ZNEE 3GSRB 2A0LC 3KYOB 3WDIA 4QLRA 3OZ9H 1KJMA 4H25A 4JDZA 4M5YH 4U3XA 4YHPA 1G6VK 5F97E 1BQLH 5EUOE 3IRPX 5ABDE 2AQ1A 3OX8B 3PF2A 5FHAL 4ZMAT 4TN9A 2BCKA 3LB6D 3OR6B 2BJML 5E2UH 1P5UA 3DRQB 5T33H 4URTB 4X6DB 2B5IB 4PUBL 1FL6A 3HNTL 4JFYA 7FABL 3OTTA 5F7FA 5I8KH 4ENED 1JGLH 5F1OB 3IJSA 4LSUL 5JDSA 4QWWD 4M62H 4NJAH 3SY0B 4D0CB 2VKWA 3MROA 3KDMA 5SX5K 4DVBB 5LGHL 4OFYD 3SDAA 3VXNA 1J8HA 1U8HA 3P77B 5ITFA 4C56E 2YRZA 3FMGL 4POZC 5IEKB 5L6YH 1F4YH 1KPUB 2O26U 4GXUN 2O5YL 4X6DF 1T0MA 2H1PH 4GS7C 4K23L 1U8JA 2WBJC 2R29L 4I0KA 3GO1L 5AZEH 4BQ9A 1IEBB 2BSTB 4WUUA 1ZHKA 1Z9MA 1AC0A 2X1PA 4MJ2A 3CMOH 5EBLB 5I15H 4HIHA 3CDFA 4J3UA 3RWGB 4MS8C 1YEKH 3CK0L 4OD3L 4L8DA 4RIRB 5D7LD 4CU7A 3BO8B 3O0RH 4GRLB 3ABZA 4K55A 4K7PH 1MVFA 3BISA 3EDJA 1HIML 3T3PE 4NHUA 4PS4L 3MOAH 1QFWH 2XNAA 3RWHB 3MJ9L 1FAIH 1LE9B 1WLHA 4YAQB 1AQKL 1BBDH 2BHUA 4NZRL 1QO3A 4QF1B 4PJDA 3VXPA 5GGRY 4OT1L 2Q86B 4F7TB 4ZNCD 5FO8B 1CYGA 3WDJA 2CUHA 1QFWI 3PQYB 4OD2B 3ULUL 2QKIA 4JG0L 3ARVA 5D93C 3WFHA 1TJGH 3LKQB 1KCRH 2HFGH 1I75A 4HDIA 1G9EA 1S7XA 4MB5A 1P4BH 4ETQA 4KRMB 4X4ME 3P3YA 2GSGA 1MCOL 1NMBH 4G8EB 5IQ7L 4TSAH 1U0QA 1TDQA 5F1NB 4JRXB 4HEPG 2VDMH 1P69B 3SDAC 3QCVH 3NGBB 4QRRD 1HQ4A 2MFNA 1CN4A 3U6RB 4HK3J 4U1NA 5IMLA 4ZTOH 5JIIA 3GB7B 1A6WH 3OKYA 1K5NB 3CC5B 1YMHA 3SDXE 5GQBA 2YK1H 4P3CL 2JB6B 1NGYB 1RMFL 4Z7UF 5B39G 1IGCH 3F58H 5DA0B 3WFDL 2UZIH 3O9WD 1LDPH 4JGUA 3HZYA 3WUWA 3NH7L 3QDMA 2KKQA 5MHSD 4U1IA 1A6TA 5EOTB 4KJYA 3MBEA 4QXWA 3O6KL 4PJAB 3MNWB 1U8OB 3R0MA 4BK4A 4U0RC 2PYEB 2H8PA 3H42L 3LKSB 2CRYA 2H2SC 3P0VL 3DRTB 1QBML 3FT4B 4UOW1 4UQ3A 1W72B 4K3DL 4MDJB 4CVZA 1INEH 3PWPE 4K2UL 3UJIL 5LKNA 4G42A 1J11A 5IVXE 2GAZB 2FIRT 1FIEA 4NPYB 4QOKE 3IU3B 5DQ9A 1RUQH 3LIZH 4JHWL 4NOFA 5ELIA 4EVNA 5CJ5A 4D8PB 2CKBL 3ZKMD 1IBGH 3HTLX 3E1F1 4GO6B 1XGRA 4Y5XB 2J8UB 1EGJL 2EE9A 4U1LA 2Y23A 2FIKA 4RGNE 3QXAB 1J8KA 3S34L 3RWJA 4HUNB 1J87A 3TESA 5IB1A 5CINL 1J0JA 2GJ6A 2R4SL 3P73B 2W0LA 2R69H 5C0BA 3VFNA 3MCLL 3RTQB 5SWSB 4X8JB 4U1SA 4FQPA 5EB9A 2YUXA 1IAOA 1NFDF 5J9PB 4NN6B 1N5YH 4XZUA 1ND0B 2F74A 2Y5TB 4EXKA 4KROC 3LY6A 2H2PC 5K59E 3IXTA 1MIMH 1C16B 5ACMA 5E8NB 2KZ1B 2NXYD 5F9WB 5ETUA 5C0IB 2Q87A 5EULV 3MBEC 1CL7H 4YUEL 4GQ9L 1RSFA 3WXVL 3S36L 1E28A 2NX5A 5K9QI 1U42A 1SEBA 4KTEH 2AK1L 1AGEB 1P4LB 4PB0L 4Y16A 2GUOA 1NCDH 2PR4H 5MENB 1JNJA 4L1DA 1G6RA 2L0DA 3IB4A 1T1XB 4J8RB 2EYRB 1CL7I 4G8IA 4MAUH 1K4DA 3KPMA 1PLGH 1IL1B 3QUZD 4XBPB 1QPPA 3K1KC 1BVZA 3HE6B 4Z8FH 3Q5YA 2FBJL 1DLFH 2P46B 2HJKA 4DKAA 5HHNA 3GUTA 1DSFL 3W0WE 3HMWH 1WCBB 2ZOKA 1I7ZB 4WO4B 3I85A 4H5SA 1I1FB 4HUUB 3MRGB 1WF5A 3FZUD 4JKPL 3QEGL 3VFVA 2ENYA 3ARDB 1AC6A 2Z8WC 4TVPE 3P9LA 3KR3H 2YUVA 1VGKA 1U8NA 1F3DJ 3DXAA 1D5MA 3HLAA 2UWEB 2H32B 1W72H 4QGYA 3S98A 1KLUB 2GEEA 2VDQL 4LLWB 4XPTH 3D9AH 4L3CB 4M93B 1CQKA 3MRDB 4YC2B 5IKCB 5J13B 4TUOA 2QL1A 4QRUB 5C0FB 3PWVB 1WVZA 1CZ8L 2EDWA 4HBQA 4PJBF 3QWRD 1MEXH 1TJIH 1P84K 3MRBB 5KSUB 4JR9H 2XWTB 1KEML 4CW1A 4F7MB 5I30L 1T1WB 1BF8A 4ODVH 1GGBH 2B8OT 2A73A 4CN6A 4UT6L 3ZZ1A 1KXTB 3B43A 1T2JA 4LARL 3NZHL 4Y16C 3DX9A 5DJ6B 3VJ6A 3I9GL 3RVTD 5B22A 3ALPA 1SY6A 4WI9A 4C55A 1R5WA 3BMWA 5F6IC 3Q6FB 4JKMA 3MRHA 1YN6B 3E8UL 3PWLB 4R26L 5I0ZA 3MUGB 3PDOA 4CVXA 4WHCA 2DL9A 1DN2A 5DC0A 3VRIB 5I16B 1LO3H 5DJ8B 2HRPL 5JHDA 4LSDA 3OKOA 1M1SA 1VFBB 5D7KD 3UYRH 4P2RB 3MO1B 4N1CA 4HWEH 3RX8A 3BPCB 1VB9A 2W0KA 1SJEA 4U6XA 4EUPA 4NBXB 1NMCC 2GK0B 3MLSH 4OI9A 4Q9RH 1VCAA 4MWFA 2ESVE 2NZ9C 5KSAD 4V1DB 4XPFH 4WWID 1CD1A 3WNNA 4ELKA 5JZ7C 3MV9A 2YBRB 4UI2A 3VG0H 1MH5B 3NMEA 5DMGD 4PJHF 4WI2A 2ZNWA 4JY5H 5DFTA 3VWKA 5DYOA 4Y4KD 1RZKC 3BH8B 1H9VA 5K9JH 2HYMA 3K4AA 5KG9A 2DYPA 2I5YL 3QEHA 3GJFH 3QQ9C 1FNGA 3KPSD 5DD6A 1TZIA 2OR9H 4JZOB 3ZTJH 1ITCA 3A67L 1QBLL 3M8OL 4PJEE 4YDJA 4LBEB 3QDGD 1HHKB 1T22A 3MV01 2BOCA 2EO1A 1CU4L 3QCUL 1F6AA 5GRVL 1OAUL 4J1UB 1BJ1J 3HAEG 3U79A 1GOFA 1CE6A 4FP8H 1K9TA 3SKMA 4HIIB 4XVSL 4NO5A 4OZGB 4N0UE 1KYOJ 1F6FB 3JSSA 5AG9A 3TO2A 1T0NA 2FX9H 3PIQB 1LK2B 4RMRA 2X7LA 4LSQH 3F5WB 3OPZL 2BNQB 1WZKA 1T20B 5A16A 3I84A 5FDWB 4MNQE 5DJZB 1BBJA 1DTUA 4ONHB 4ALAH 1GJIA 3VXSD 4G3YH 4YE4H 3MXVL 2NY1B 3BJ91 4OZGF 4N1HB 1C5CL 4JFDD 4XB8A 4ISVA 4ZOBA 3IAPA 1WBZA 3U7YL 3D2UB 2QTEA 5HXMA 3IFOB 1G7JB 4M6MH 4MXVE 1A7NH 3MLYH 4OZ4A 3FHQA 4GAJH 4NQEE 1KB5A 2YEZB 3BD4A 1DBAH 5D1QB 1TCRA 5EC1B 2Z9TA 5AD0A 1HHHA 1A6VL 3QUYA 3VWKC 1CGVA 3QHFL 2GY7B 3CCHA 5HHVH 3BP6B 3Q5OA 3T0EB 2JCCB 5TE7H 4DZ8B 4QRTA 5I19H 4LIQL 2EZ0D 4ZFOB 4KZDH 1J5OL 3VFOB 5I17B 3QIWB 3IGAA 1R3KB 1RZFL 4NC1C 1QLRB 2EIEA 1J86A 5J4MA 4G8GA 3JV6A 1XCTB 2VXUL 1XAUA 3FQWB 1OW0A 1XIWA 3FCTB 4N68A 4OAWA 4XHJC 4HGMA 4NWTH 1Z5LA 5FUCC 1I8MA 5HHXL 2I60L 3GKWH 2JCCF 4QHLA 4RNRB 4HKBA 1FG9C 4LCUA 1XR8A 2ARJB 1DANT 3LEXA 4TPRL 2COQA 5CCKH 5MEPB 2VLRD 3V0WL 1XF2A 5DRXB 2EIBA 4GG8B 2EDFA 2A83B 3JV4A 1G7QA 3LSOB 5SWQB 3HE7A 3X13B 1Z3GH 5E6ID 1RZ8B 4O2FA 5HY9B 2DQUL 3HI5H 2AJZA 2EECA 1IC5H 3BHBA 4ODXB 2WBKA 4CVUA 3CVHB 3S5LG 3PGCA 4R97C 4LCWB 1UXSA 5C2BH 3O4OB 4X6FB 5GISH 1I8LA 5ISZD 5I71C 1VACB 1TETH 4OZIF 5FYLH 4MMZC 1JUFA 5E8EA 1R5VB 5EZLA 3UTQB 1T04B 1S7TB 3D0LA 2IWGA 3IDUA 4XBEH 3D25B 4G9FE 2VDPH 4QXUH 3H9SE 5A3ID 3OKEA 2XZCL 4MQ7A 3CFKA 2OJZH 3LV3B 4F33A 1LO2L 5GGUA 4XWGH 4P5MB 5TE4L 4IDJL 4DTGH 1YMMD 1GGCH 2J5LC 3GSOA 4JEGB 1QR1A 5GRZA 1T5WB 4CADB 1PZ5A 5F1IB 4LEOA 2EYSA 4UV7H 3ARXA 4QY8A 5E6ZA 1T1YB 4UT9L 4M7ZC 1A6PA 4ZSOE 3ARTA 1OW0C 1XIWC 3DNKA 2VXSH 3PHSA 4F7EB 3TEUA 4D0BA 4BSWB 5KVMC 1OT1A 3CXHK 1U95A 1GL4B 3OBAA 1P7HL 1HNFA 4YXLH 1S7QB 4MJ4A 1H0DA 2EH7H 1BZ9A 3ZHKA 1IQDA 1IM9A 2QHRH 4ERSL 5A2KH 3GHBL 5JQHC 1MFCL 4AMKL 5I1AA 3TN0D 1CFTA 4RAUA 1CFBA 2OR7A 5B8CB 4PGDB 5FA3A 5HHOE 1PQZA 5D8JH 2XFXB 3TFKD 4Y4FA 1YY8B 3O6LL 2VLKA 4LQFL 1I8LC 4KRLB 4YHYB 1AI1H 5AZ2H 3AU1A 4G43A 4E5XB 4UQ2A 1BHGA 2DQCH 3SOBL 2PYED 3GGWA 4M1DH 4ONGH 1WQVT 1WAAF 4JZJA 4L8BA 3KPLB 1K4CA 4QT5B 3QEQA 4FQJL 5ICYA 4Y5VA 3C5ZA 1KJ3H 1INQB 4OLEA 1D5XB 3ARQA 5FEBA 1NFIB 1WZMA 1YQ2A 4MA8L 4ETYA 2QHLA 5JPNB 3CVHH 5C6WH 3UBXI 2ATKB 3BSZL 3MNZA 4ZPTB 4DUVA 2DQEH 5FCSH 4PJCF 4NKIL 1PVHA 4JPIB 2APFA 4AQ1B 5DTFA 4LOUC 5GS1C 4M7JH 1A2YA 1B0RA 3TBWB 5ALBH 2R0WH 4FQQB 3GI8L 1YEGH 3QJFA 3S35X 1I1RA 3TO4A 2IPKA 4MA7L 4DN4L 1A7PH 2XQBH 4QRPA 4U7SA 2YXFA 5C7XH 1NDMB 4BQ8A 2ZCLH 3O2VL 2CPCA 5J3HD 1AJ7L 5IESL 2DMCA 2DBLH 1HSBB 3K8LA 4BFGA 4AL8H 5FB8B 3T4AA 1IKFL 3AY4A 4PR5B 4EDWH 5JMRA 3MUJA 1UVQA 3QP3A 3QIBB 1OP3K 4HKZA 1IT9H 1FZOB 4E41B 2XTJB 4UUJA 2VAAB 3KPQB 1SMOA 4KAQL 5IWLA 4IS6A 5D1ZB 2VXTH 3KYMA 3QIUA 3VU2A 1T83A 4E42B 1KUMA 3DMMB 4JZJC 4Q0XL 4JM2B 1KC5L 1KFAH 3T0WA 1CBVL 1NDGB 3BDXA 3MQIA 3QO1B 2WP3T 4R4BA 5D7IA 1NPUA 4HC1A 3C5ZC 1KEGH 4XVJL 2X1QA 2O5ZH 2AEIT 4LFHD 4P9ML 3B2VH 2C3WA 4HPOH 1S5IH 1DBML 1CLZL 5FHBH 3BVNA 5EZJB 4PJGF 3MJ8B 1MHEA 3VFUB 2OL3B 2ADIA 1VEMA 2PTTA 3AB0B 3FO2A 4N0CD 3U4BH 3GSUB 3MCG1 2VN7A 2ZOLB 5C0JB 5T3ZL 2XN9B 1D9KA 3O8XA 1DBJL 2Z8SA 4APQD 4RRPA 3BPLC 3TO4C 2VLJA 1PAMA 3W2DH 1S7RB 2HT4D 1XCQB 4HCRA 3AGVA 3HPJA 4NBZB 4PGBA 5TDPA 3RY5A 3P0YL 4I77H 3QT2A 5DWUH 2VSCA 4UIKL 1XF4B 4NKMB 3TBSA 1ZTXH 4Y2DB 1AD9A 3AY4C 1A6UH 2EICA 4W4OC 4Z7WE 1AD0B 3B9VA 3IDMA 3J7HA 3HC0B 4MJ6A 1DEEA 3GM8A 4PB9H 5T5FL 2NW2B 2UV3A 3GHEH 4NCC2 2P24B 4MDIB 2EXYC 5IWLC 4MCZB 4UINH 4IIQA 1T6VN 3QIUC 4OF7A 5TDOA 5J0BA 2AAVA 4M6OH 4PJ9A 1JBJA 1I3RB 1T7YA 2WWMD 1BMGA 4O00A 3GJEA 1JNLH 3WSQH 5I73C 2R8SH 3P4OA 1RUMH 5LWYL 2FR4A 4P99A 4HLZH 4XVTL 3TA3D 4J6RL 1N59A 1MFEL 4JN1L 4WCYL 1G6RL 1C8PA 2W07A 3F7YA 3ARRA 4MX7A 4YR6A 5FECA 3LD8B 1JNNH 1WGOA 3FAXA 4HJ0D 1VADA 2IQ9H 4P2RD 2V2TA 4UTBL 4GKNB 2BRQA 3RUGF 3RWCB 4PJIA 3HG1E 2R23A 3AAZA 1KT2A 3TIEA 1D9KC 4AH2A 3O8XC 2AJSL 4KC3B 4PTUA 4Y7MA 5BCAA 1P5VA 3KNBB 1TQCB 3LN4A 2VR4A 2UUDK 4V1DD 4I3RH 3O3EA 1QQDA 3MV7E 4R96A 1DFBL 5CD5C 3ZTNL 3PE9A 2A2QT 2CK2A 2RB8A 4D3CL 2DDQL 5DHVB 4KPHL 4NYLA 4PJ7E 3N85L 1CLOH 1M7IA 1UM5H 4S2SA 3FB7A 5DFVD 1QTYT 4PLJC 2OL3H 2IBGA 3O4LB 3I2CH 1RZKL 3BYTA 4IDLA 3H0TA 2AJVH 4LSVL 1UJ3B 2X9YA 3LMJL 1FL5B 3VFSB 1OGAA 4X83A 5IFAH 3KPNB 5IOPB 4PJ9C 4JFOA 5C70A 3FT3B 3PABB 5HDBF 1CS6A 1X6NA 5FYLD 2HJFB 4XP5L 4H0HB 1CICA 3NIGE 4PGCB 1MLBA 4OI7A 1ZS8B 4JANB 3RPIA 3L95A 3IJYB 3GBMH 3JWDH 1SY6L 1LP9F 4X5XB 4OF6A 4UAOB 1KV3A 1RUKL 2CRIA 3O41B 4GW4B 3NPSB 1A14H 1M7DB 1UXWA 2NY1D 3FB5B 4P2CG 1CDBA 2EO9A 4OCYL 2ITCA 4NN5B 4NKOB 2ADFH 3EHBD 2E9IA 4X7SL 3ZE0F 3A6BL 1T03H 4KV5E 2FATL 1E0OB 2P8MA 3C60D 2FL5B 1AIFB 3EYQC 3RX5A 3L3JB 2LTQC 1RQ5A 4W6YB 1FL3A 1CFQB 2FX7L 5LQBL 2QADB 1OB1A 5KVGH 4F58L 2VDKH 1YC8A 5GS2D 3UJTL 5JPMA 4GRMA 4Y0GA 3C5JB 4DZBB 4LNRA 1PD6A 5EC2A 4JFFB 4KGLA 3TYFB 4QCIA 3OR7A 3KPOB 1YN7B 2AI0H 2DQJL 4D9QE 1YEFL 3QIWD 5LBSH 4NQCB 3FRUB 5DJAB 3IFPB 5D9SA 5GGSA 3V5HB 1MCEA 2EDEA 4P23B 3IDNA 4LSRH 2V7NB 3QXVA 2ORBL 5SV4A 3DX6B 3BD3A 3OG4B 2CLZA 1CICC 1TTUA 5GS0H 3BIKB 4G9DA 1WFOA 1HYSD 3QNXA 3L3HB 4XP9H 4NQSB 4F7CB 2VZSA 5DHVH 5L7XH 2BVPA 3MRJB 5L8KB 5CWSA 1OAQH 1CFNA 2B4CH 2X6MA 3H6JA 4AT6A 4Z5RB 2ZUQB 2GI7A 1FHGA 3C6LB 5KAQF 2P5WA 3TJHC 3RAJL 3W9DB 1ROWA 5KS9F 5E99H 4O4YL 4LDEB 2AV7A 3GIVB 3VXQA 1JE6A 2A77L 3BT2H 4HG4J 3CU7A 1CR9L 3TCLB 3DSNA 3TH2T 5FK9A 1DZBA 1LEGB 1OCWL 4P2QA 5F7HA 3MBXH 1NQBA 5I74C 1EA9C 5BS0B 5JR1H 4P4RB 4PG2A 2W1NA 1JV5A 2R0ZL 4KY1H 1E4XL 4JY6A 4JN2A 1KCUH 1KB5L 4N0YH 1A4KA 1HEZA 2DQIH 1FG2B 3O45B 1MI5B 3MRFB 3E3QE 2FH8A 5E8PB 2YPLD 3PV7A 5HHMB 3IFLH 1V05A 3VFMA 4WFGD 2XA3A 3QFJD 5EOQH 3DETD 1VA9A 4BSVA 5HGAB 1T5XB 1AY1L 2YOCA 1DJSA 1UT9A 4P2OA 3VFRB 1T4KB 5CZVH 2G2RB 3IJHB 4YGAB 4Z0BH 4XH2A 2V2WB 1G7PB 2EDNA 4OIAA 2NY4C 5SWZA 4ZYKA 4WUUE 1FO0A 1MHCB 2YN3A 5EU7C 3IDGB 1IE5A 1G9NH 4BZ1L 1TNMA 3MRRB 3BQUA 3U46A 4YDVA 3C2SA 4WHDA 3X3GH 1T80A 2R0LH 1V7ML 3PWNA 2VC2L 1LNUB 3WS6A 3CFIC 3JVGA 3WKNA 4DFHA 3LN5B 5T1MB 5JO5A 2W65A 4LVHB 4P46A 4YHZH 1ZT1B 2BY2A 2ED8A 2MTPA 3KJ4C 3QNYA 1FNEA 1YEDA 3TPUA 1MFDL 4PG2C 4GKZB 2GFBB 4YWGL 4PJFB 5F1KC 4N5UA 2BVYA 3BUYA 2FBOJ 1AHWA 4OF5A 3X3FL 5KSBB 2VQ1B 4FZEL 4CMMB 4GG6F 4TTGA 3UZQA 4TTDC 1WK0A 3CVIL 1F3JA 3OJDA 1BZ7B 4OZHB 3MLUH 2E3VA 5ERWB 1TVHB 4OUOA 4AM0A 1KJVA 2OM5A 3MPCA 4Q9QH 5T3XH 1EMTH 5EO1B 2VIRB 4J7RA 4J3TA 3LDBB 2AXFA 1J1XL 1YEIH 5JOPD 5DT1H 4HX1B 4PY7B 4U1JB 1QFUH 2FWOB 1HH6B 3LQAH 4XNXH 4DGIH 5HYJA 3ZHLA 2QV2A 5KSBF 2XZQL 1TQBC 4P2OC 1GC1C 3MACL 3QXDB 4FQXA 4XVUC 4KQ4H 1FNAA 3TM6A 4Y5YA 2HKHL 4OZHF 2X4OA 4HT1H 3AROA 4H8WH 3UTTA 4IOFC 3QG7H 1HHIB 2XTLA 5MEOA 4DK6A 4XXDA 1A7OL 4L4VA 3UTOA 5BJTA 3JZ7A 4YDLC 5A2JH 2HFFB 5TQ0L 4PJ5B 4K94L 5DRZB