4OFPA

Crystal structure of syg-2 d3-d4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
200
structure length
197
Chain Sequence
DPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKEIKNIYSFIASQNDNMAEYECRANNSRPKRKAMKLEVNYPPASVELFGESNIRYGSSANIQCKSLPSNPASQITWIINGRSVPTPTQREFVVENGIVSSSNVSVHSNELSVEAHQINVECMATNPEGSSAKQHVIKIIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein SYG-2
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
total genus 28
structure length 197
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ofpA01
4KMTL 4OCWH 4JVUA 1DP0A 1CT8A 3P0GB 4NQEE 1QFWH 4Y4KC 3UTQB 4PJEE 5EBWA 1F58H 3H42L 4X5WB 1JZ6A 4M00A 4ZYKA 3K8LA 2FD6H 4L3EB 4GW5A 4D0CA 2XA3A 3OJDB 4M43H 5TF0A 4GKZA 5JORB 3B9KC 5IEHA 1FPTL 1G6RB 1IAMA 4HKBB 4IRZL 5C08D 1HINL 1AI1L 1MFAL 2H1PH 2V6HA 3VFVB 5I8CA 5B3JE 5CILH 5ID0A 1CFTA 1TVDA 1R3KA 3CFJA 3CDGB 1CLCA 4HZLB 2O5YL 4OZIB 4ZOAA 4G6AD 4XP6L 3L95B 3L7EA 4X7FC 3CSGA 4UAOC 1A6AB 4XCEB 2ADJB 2R2EB 1WBXA 3NIDF 2AK4B 2H9GA 3L5HA 1ERNA 4ZSOA 5J13B 4ONFL 2XTJC 4LRNH 4XVUD 2GJ6E 3HE6B 4RZCB 2B5IC 5JIPA 5CGTA 4XPFH 4JAMB 5HHOE 1S5IL 1VFBB 3DECA 1EUUA 2D4DA 1LK2A 4DGIL 4OI9A 1YN7A 2ZUYA 2W65B 2JJUA 1NDMB 3V5DB 3B2VH 1BGXH 2E6QA 3UTPE 7FABL 4JFXA 1H3PH 1REIA 3WYRA 2YC1B 3MRPA 2ZUTA 1JI1A 2KUTA 4PG9B 2LVCA 3SGJC 4Z7WF 5F8RC 3SQOH 3VI3F 1C08B 5K9KB 2NCMA 1I7TA 3HS0B 1WWBX 3KPRD 1MJJA 1EPFA 2P5ED 1PSKH 1QSVA 2ZSWA 4QRPB 1MCHA 2E5EA 2IBBA 1U95A 1DLHB 1FFNA 2X4RA 1VESA 5I1AB 3SGEH 1LVEA 1ROWA 1VACB 4YDJA 3KYOA 1IBGH 1YYML 4C57C 4KXZH 1EHAA 4FQJH 1PX4A 3VFRB 4U2ZA 3MRCB 2AXHA 4PGCB 4RRPG 1WWWX 4H1LA 4I13B 5GXBB 4GT7A 5D96B 2WAHA 3TN0C 3MV11 3FQRA 3MXWH 2VOTA 1RJZA 5EIIA 1CIUA 2WWMC 3MNZA 1IGTB 3O6FD 1A3RH 3GSNH 3RNKB 1NCTA 3ZKXC 3MCLL 3MLYL 4F7PB 2FECL 4NNXB 4PTTB 3MCKB 5T1LB 4U4BA 2Q6WB 4BH7B 2E7HA 3AMKA 3IDMB 4UIKH 5E4EC 1PY9A 3VGHA 4O9HH 2XKSA 4PB9H 5DD0H 1H3GA 4MJIA 3BPLB 3DMMC 3ZKMC 1W0VA 4GBXA 1A0QL 1K8IA 5C6WH 2IFFL 2R23A 4OF0A 1SJVA 1I85C 3K3QA 5EULV 5TE6H 1MF2H 4CDGC 3DBXA 1ULVA 1CFSA 3DV4A 1HZHH 2ICEB 2A2QT 4HKZA 1HXMA 3L1OH 4PPTA 5ISZB 1XF2B 1D9KC 2DQDH 1UJ3C 2X05A 5SWZA 1CDIA 2HVKB 1HQ4A 2C7UA 5L2KA 3DYPA 3I3EA 2X4SA 4G3YL 5GGSA 3GNML 5EOCH 2Y5TB 1QA9B 4QEGA 4JKLA 3GSQB 3MROB 2QEJA 3FFCD 2AABH 5DHVA 3GJFK 2F54B 4TUJA 3WFBH 3WHXB 3E6FA 1JYVA 5FIEA 5SX5K 5FB8A 2NY0D 5FUZL 3A6CL 1NC4D 4IM8A 4BELD 1HWHB 1K6QL 5D72L 3TCXA 2J88H 2PTTA 4EI5C 3IDYB 3DRTB 3LEXB 5F3HB 4PJIE 5GGVH 1QYGH 2NY5C 4PRNA 3OAYK 1A9EB 4J8RB 1CS6A 5I71B 4JFPB 4GSDH 5IVZA 2D4FA 4NKDA 5HHVH 1BBJB 3MSPA 4Z7OF 3Q6GH 4OGXL 3WO4B 3R06B 4JFDB 1PLGL 3LN9A 1CIDA 3MREB 3ARSA 3U9UB 3FN0L 3GSRB 5FYLH 5EO1B 4YHYB 3WHE1 3QUKB 3TO4A 4Y2OA 1UC6A 1JGLL 5TQ0H 3TFKD 3U6RB 2X7LB 3DV6B 1RZKL 1DQDL 4Q0XH 1U8LA 3U7WL 3F62A 5D4QA 1ITBB 4ELKA 2R0WH 2CD0A 4HLZG 3QIUA 1LP9A 2XPGA 1UB5A 2QTEA 1NGPL 2YPLD 3DVIA 1UM5H 3VXSB 2LV4A 2ATPA 2V9QA 4X0KA 4CVWA 5JNYB 2FEDC 3CDYA 2A6KA 4X5LA 3V7MA 4UU9A 5IESL 1LDPL 3MLWH 2YA0A 1UA6H 1A21A 5E1HB 2E9WA 4XPTL 1NBYA 4U6YA 5I8OH 2GI7A 3KYAA 2Z93B 3HB3D 2DQHL 4XP1L 4HWEH 1B0GA 1EA9C 2HJLA 1X5JA 1TETH 4W6YB 3JUYA 2HFEA 1BFSA 4F15C 1YJDC 4X7SH 1X5LA 2MSPA 1UM6L 1RQ5A 2Q86B 5FGCE 4X6DF 2FH6A 4MAYC 2C3WA 1NLDH 3MZGB 5B8CB 3NPSC 3MBXL 1IGCL 3BT2L 3KJ6H 4OZ4A 4BSWA 4ELMF 1R5IB 25C8H 3GSOB 4JFHE 1JNNL 1SYVA 2A9NH 1KPUB 4L9LC 2OK0H 4ODHL 4JZNA 3ABZA 3WHE0 3S3JA 3S97C 3ZE2F 4XCNA 4IMLB 5FOBB 1DUYB 1RPQA 3LIZH 4S1SH 2V2WB 4CNIA 1IT9L 5F96L 2IAMC 3F7VB 1AQKH 1OVZA 4O51B 1RUAL 4KJQD 3BRGC 4M1CD 3QFJB 2JCCA 5JDSA 1HH9B 4EI6A 4LPTA 1M05B 4P2OB 3BJ91 4WI4A 4TVPL 4CADA 4OFDA 3BP5B 4RMQA 4ODBD 3KYKL 4TOYL 1KT2A 3UMTA 1CDUA 1FNSL 3IKCA 1S7QB 3WEXA 3BN9D 1R6VA 2DQEH 4FXGB 1DN0B 1FFRA 1OB1A 4PRBA 4QHUA 3VFTA 1F2XK 4DKFH 2JB6A 4TSCL 3W82A 4Y4KD 2I25N 4PJDF 3ARRA 3DSNA 1YEJL 4TUKH 2BVUA 4YDIH 1J87A 3P0VL 4NM8L 5E9DA 1CXHA 1A6PA 4Y16C 1NBVH 3B9KD 3FMGH 4CN4A 1H3VA 4WHYH 3FQNA 1K2DA 5JOEA 2PYFB 1D6EA 3LV3A 4P23B 3CK0H 2AI0L 3W9EA 1TJHL 4UNVA 2ADGB 1M6OB 1RIVH 3SCMB 5CINL 1FZJB 3JV6B 5GRYA 3ILPB 5ESAA 4OZGE 3IETA 4NHCL 4YAQB 2IBZY 2XTJD 3C60A 4BUHA 1UZ8A 1ADQH 4OD1H 5JMOC 1DBAH 2EC9T 5DUBA 4XNXH 3FQTA 4Z7UF 4Z78B 4NM4L 4JQXA 1UACL 4J23A 5F71A 2P5WE 3EKCA 5GS0L 5IHZA 1AY1H 1FN4B 4TSAH 4QHLB 2R1WB 4BH8A 2G2RB 3ARBB 4QTHB 3ULUC 5E2VL 3AS0A 1GZQA 4NKIH 3HI1A 2G75A 3NFSL 4JANB 2VZTA 3MLRH 3BUYA 3MV8B 4PJCB 1AGBA 5F1NA 3PUCA 5KS9F 5BV7L 3DUUA 4G8GB 4JFHD 3MV7E 4KTDL 3RX5A 4K8RC 4GRLA 5ICZA 3GJFB 3T09A 1G84A 3ZYOA 1N0LA 1QD0A 2AEWA 1NCDL 5J4MA 3QB7C 4LRIA 1P4BL 4AIXA 1SEQL 1NAMA 1U8HB 1M71B 1I1RA 2VDPL 4PJXF 4J3WA 3EFDH 2YSSA 5T5NG 4G8FB 1JHLL 4F7EA 3DIFB 4Z7WA 5CEYA 4I3RL 4E0RA 2R69H 5I1IL 5F7MC 4ISVB 2ZWLT 1GGBH 2KZ1B 5B38B 3B8YA 4GKOA 2JTDA 1I9IH 3F58H 4M6OH 2V9RA 4J3TA 5ACLA 1P4LB 2BHUA 1L9MA 2BC4A 2KKQA 2RGSA 2WWMD 4MD4B 3SE3C 5HBBA 1XCTB 3SHSA 4H0IA 3O6KL 1YEFH 2UWEF 4AQ1B 3VXRB 3CX5J 4Y19B 1L7IH 2OI9B 4LLWB 4Z7VE 3SGKC 1IJ9A 4OZFH 1G9MH 4FZEL 5F7WC 4QY8B 1J1XL 2YWZA 4ZO6A 4UMGA 2P24B 1MHPL 2CIIA 3BD5A 2I9TA 3DMMD 4A2MA 3TWCH 1JGEA 4HIIB 3REWB 1EERB 1U6AH 4NIKB 3OXSA 1PGRB 5BRZD 4NBYB 4P5TA 3V4PH 3F7RA 3BKML 5DFVC 1IM9A 3WXWH 3L9RB 5F6HJ 1EJ6A 1ZANL 5J13C 3AS2A 4LSPH 2GT9B 4LDEB 4NO3A 5B39B 1NAML 2JK5B 2LQRA 4XMKL 1TZGH 1TIUA 3FQWA 4WWID 1C5CH 3OBAA 4PJBB 2PETA 2MCPL 5ESQA 3N9GL 2XNAA 5TPWL 4J3XA 1U8PA 4MDIA 1TXKA 5JLZB 4RAUA 2P4AB 2Y5EA 3NCEB 4P3DB 3SDXF 1A1NA 1RHHA 3BKCL 4NO5A 4L4TD 1F6AA 3HG1A 5EO9B 2P5WD 3DO3A 1HSAA 2J6EH 5LKNA 3OZ9H 1KJVB 2PUQT 4LSSL 3UTSA 3VXTB 1NANI 2GAZA 4LLYB 1MCIA 4L8SB 3ZHKA 1BOYA 4I4WB 5JOPE 2DIBA 1UYWH 4LSVL 3MFFA 4QKXB 5C0RH 4WO4B 2QSCH 2EDHA 4G43A 4JDZA 5GHWL 2HFFB 2BXZA 1A3LH 4JY5L 3ULVH 4RAVA 4ZTPH 2OLDA 1UJTA 2JELL 4Q6IB 5DJ6B 3RGVB 5D5ME 3AXLA 2FNBA 4XB8A 5I74B 3DROB 3QG6A 4K94H 1G7PB 4DK6A 1F11B 3PWNA 4MNGA 5ID1A 5C0FA 3MLVH 1TZIB 3TT1H 1QBAA 4GXUM 4XT1C 2BJMH 3S5LA 4JZJC 3DXAB 1BJ1H 5ESVB 2WUBH 1I3UA 5CP7A 1BVLA 1DQML 2FEDD 3RHWF 1VB9A 1D5ZA 1G1CA 5E8PB 5HHPB 2NTFA 3RWGB 3O4LA 3QZWB 4KUCD 1S7RA 2APBA 5K9JH 1UB6B 3TPUB 4LCIH 1K4CB 1NLBH 4HQQL 3KXFD 3LHPL 1U8MA 3BPLC 5K9QI 1ZV5A 1S7SA 2Q76B 4FQHA 4KKCC 4HUKB 5EBMA 4R4BB 1UH2A 4HPOL 1KC5L 4LSUL 1WIPA 2NZ9C 4FTVD 1E4XI 2PYEE 3MNWA 3QIWC 4PD4K 4WU5B 1K4DB 3OX8B 4PB0L 4R97C 3GMLB 1T89A 4OLUL 1F3DJ 3ULUE 1S9WA 1NMAH 4M62H 5ILTH 4LMQE 1MFBL 4RBPH 5C0CB 3CMOL 1E4KC 2X1PA 4P2RE 1D7FA 4ZD3H 3VWJA 1WBZB 1X4ZA 4F58L 3QDMB 4XNMB 2X4UB 4N1HB 1ZHKA 3C6LB 1T1YA 1R5VA 1CXLA 2WM0A 4LHJB 3KYMB 5IG7B 4LSTL 4X7EC 1U41A 1LE9A 5ETUB 4NSKA 4GS7C 4JVWA 1V7NH 3NFPB 3CLEL 1OPGH 4KK5C 4MJ6A 4UNUA 4R26L 1QSEE 3B6SB 3ET9F 4DOHE 4X6DA 4F57L 1ONQB 3GHEL 4C4KO 1A02N 1SVZA 1MNUH 4K71C 4WWKA 4ELMA 1KENL 3I3DA 3REVA 3VXNA 2HFGH 3OKNA 3ES6A 5C70A 2HMIC 5JOPD 1P2CB 5EU6E 5E6ID 4JHZA 1C1EH 1WEJH 2X70B 1XH3A 4HC1L 5LVEA 2A83A 5B4MC 1CYGA 1YEGL 4PREA 3G6DH 2EDQA 4YR6A 3BO8B 2QBWA 4LU5L 5J7CC 4GRWE 1P6FA 3JWOC 3Q5YA 1MFEH 2HJFB 3L3OB 4D8PA 3GMOB 5T1KA 4WFFD 1AXTL 1A14H 5BS0E 4QXGL 2HRPH 3FB7B 4MMXC 3MUZ1 4UT7H 3MRMB 5EBLA 4Y16D 5GZOD 2QKIB 4R7NB 1H5BB 3K8MA 1I9RL 2IANB 4X80L 3P11H 4M7ZC 4PGEA 4KVNH 1WAAF 4LLQA 3L7FA 2XA8L 5C8JB 3H0TB 4NQCA 1ITCA 4TSBL 3HZKA 3O4OB 3JBG7 5KVDL 1IAIL 1KJ2B 3PABA 5KBNC 1E6JH 3G5XB 5IW6A 4KMLB 5TQ2L 5DRNA 4R0LB 5KW9H 1RU9H 1I1CA 5DS8A 4Z77B 5FO8A 2ORBL 1RVFH 3AREB 3IXAB 5C0IA 4UQ3B 4PJAF 1X3DA 1UVQB 2NY3B 4AM0B 1OGTB 2BNUB 2DM7A 2P7TB 3UDWC 1QHOA 5BO1H 1BQLL 2AQ2A 1KXTB 1X5FA 1S78D 4WEMB 4KTEH 3GBLA 2PYED 5CBEB 4W4OA 1XGPA 3ULUD 4GJTB 1XMWA 3TJEH 1NCCL 2IPTL 3VFMB 5KTEL 5B8CC 3K46A 5MI0B 5CCKH 1U42A 3T1FA 4HD9A 1CDBA 5MENA 4DUVA 4OSUH 2Z92A 4MB3A 5DK3A 2X4TB 5HDOA 4K8RD 1ZLWK 2CDEA 3NCFB 3O2WL 2J8HA 2EKSA 5GIRB 2WBKA 2EYRB 2MWCA 3EJJX 3VFNB 4Z7UA 2BDNH 2AQ1A 2FJGA 4F2MB 3KYNB 3WD5L 3DX9A 3C08H 1CICA 4PRPE 4JRXE 4C54A 2VSDA 1CDYA 4L8BA 4JHWH 3IDUA 4IJ3B 3PP3H 4WU7A 5I1DA 1CGUA 1E0OB 3D0LB 4KV5F 4P2OC 3OKOA 3MR9A 4CUCA 5KS9A 4RQQB 3PP4H 4I2XE 4KI5E 1GC1C 3VGDA 4NQDB 1D5BB 2X4QB 4KVCL 1OP5H 3SDAC 1LE5B 3P9WB 1OGAB 2C1PB 3RKDC 4U3XA 1ORQA 1QBLL 3CFDB 4K3HA 43C9A 4UDTA 1SQ2N 4PJXA 2W91A 5HI4C 2EIEA 5F7EH 5J56B 3G6JF 4L3ED 1Q9WB 4DTGL 1MHEB 2EKJA 2VC2L 1CZ8H 1EMTL 3L6FA 4GG6B 2BP3A 4YNYB 4X9IA 4G9FE 1KLGB 5SX4I 1TENA 2VERN 1RZIB 3V6BR 4E41B 2GUOB 3PGFL 2R0KL 3RWJB 4GMSH 4X83A 1PKQA 4OF7A 1EHLH 1Z9LA 5KN5B 1VKXB 3JTSA 5FYJU 3WNMA 4QXUH 5GISH 1HHIA 3P3YA 3QIBB 2UWEA 2AK4D 4HWBH 4Y5VC 1CLOH 1AR1C 5J1SC 2UVFA 4KDTC 3T0EC 4Q2ZB 3MRJA 4H88H 4K9EL 4E42A 1TQCB 2W9EL 1U8JB 5IQ7H 2CSPA 5CWSB 2XQYK 3WJLA 3AY4A 2HH0H 1MCQA 4KRLB 4F7TA 1J1OH 3HI6L 3VG0H 4R9HA 2AJVL 5E08H 4ZFGL 3ARFC 5MEPB 4WIQA 3TEUA 4HGWA 1NCWH 1C12A 4NO0A 2D31A 4OLYH 3PWPB 5CIPB 5CEXA 2OXHA 3BHBA 5JQ6H 1N6UA 1YY9C 5D9SA 5DUML 4AMKL 5FA4B 5ITBL 1YNKH 4HJ0C 1LGVA 3K0WA 4XVSH 2G60L 2VLJA 1NEUA 3MODH 2HJKB 4QRPD 2HT2C 4A6YB 1AE6L 5CGYC 1L6XA 4JY4B 1VCAA 5F6IB 5D7JA 1KEML 4HKXA 4AG4L 3LY6A 1QEWB 1ZT4B 5DMGD 5J6HA 2P45B 3LKNA 4XXCC 2CLRA 5MERA 3SDXA 3FB6B 1CDGA 1E6OH 3U79A 1XF3B 1KV3A 1Y6KR 4GQPH 2FL5B 4RFOH 1XF5A 1NMBH 3OG4B 1BZ9B 3BGMB 5IT2H 1XIWA 4OGYL 4U0RB 2W59A 4UT9L 3KVQA 2ILLA 3BEVB 5I73B 3SDCC 5I1LA 1OAUL 4PRIB 5BOPA 3D3VA 3PWVA 4R8WL 1XGRA 3D25B 2LTQB 5FOJA 4DEPC 4PJ9A 2ITCA 1KB5A 4KK6D 1BQSA 3MLUL 2DTMH 1INDH 4G9DB 4XZUB 1FAIH 4DK3A 2O61B 3PXJA 2P8MB 5T1LD 3EYQC 1FC1A 1J5OL 2OI9C 2AJSH 1CT8B 1ZVYA 3SN6N 5C9JA 4NRZA 4OFYA 5D70L 4GUPA 4IEFB 4I3GA 5DK2B 4Y7MA 4ZYKB 1T21A 2I07A 2C5DC 4D0CB 4KZDL 4LVEA 1YMHB 4QRRE 4GKZB 4G9FD 4HGKC 4KKCD 4S0SD 3QDJA 5IEHB 5IMMA 4BUGA 5E8NA 4XAKE 3QIWD 5JHDE 4Q9QL 5DO2C 5JIKA 3MACH 4JPVH 4X9GA 3EHBC 1BFOA 2ZG1A 4TPRH 2B1AH 4G7YL 1V3KA 3UJTH 5DVKA 3LEYL 1BJMA 1CFTB 3Q5TA 1T2JA 5SV3A 4UTAH 4YIQA 4NZJA 3L7EB 5CBAA 2GYSA 2QSVA 3RL1A 5ISZD 4N0RA 3S35H 3WFZA 3S4SA 4EN3C 1I8MA 1GGYA 3KPQA 2CPCA 5A2KH 4HV8A 4HCRL 4J7RA 4ZSOB 4YUEL 3V4UL 5GRVL 4RA0C 1CD9B 1MJUH 3D69A 4XB7A 1KLFA 2Z91A 3QHZH 1LK2B 1IARB 3O8XA 4EQ2A 4MGXA 2DDQL 1OAYH 2W07A 2HN7A 5I1JL 4F9PC 2I24N 3D39E 4PRHE 1P84K 2GSGA 4NZUL 4OCXH 1WFUA 2XACC 1JCKA 4C56E 1CD1B 1NL0H 2FB4H 1GZPB 4WO4C 3LS4H 5D2LF 2FJHB 5F3BB 2HMID 4OQTA 4M1GL 1MJJB 3QEQA 4UILH 4XMLL 4POYA 3BAEL 5IFJA 3OXRA 4BFIA 4K3DL 5B4MD 1QO3A 3RZWA 5HDBF 2CXKA 4JFDD 2DI7A 4LSRH 3L3HA 4DGYH 5FYJD 2YN5A 4FQ2H 3TBVA 5B3NA 4WTZA 5C0AA 2X4RB 1BBDL 5JUEL 2C4XA 1MI5A 5I2IB 5I74C 4Y5YB 4PJ5E 3SKNA 3EOYG 1PJ9A 3D85D 4YDJB 4DN3H 3CNKA 3KYOB 4NBXB 4A6YH 1GGUA 2W0LA 4RISH 3BKYL 1FP5A 1KACB 4N5UA 4OFKA 2QR0A 2VISA 3UPCA 3O2VH 3D2UA 4X6BA 1S7TA 2XG5A 2XWTA 3DSFH 4H1LB 2FATL 2AK1L 1LMKA 2UUDK 3LSOA 5AZ2H 5HJ3B 3VXSD 1UKQA 3FQRB 1KLUA 1OARL 1RJZB 5IR1A 1PG7X 5EIIB 1JWMB 2UV3A 4K7PL 2IPKA 3MNZB 5D1XA 1EGJL 3ARGB 1HH6A 4MLIA 3T0EE 2Y36L 1N6QL 1G0YR 4PTUA 3T0WA 4N8CH 1C5BL 4CVZA 1YEKL 3MRBA 2CQVA 3IFLL 3FAXA 4X4MA 3VRJA 3CVHA 2RQ8A 1ZHBA 3ZDYF 5EU7C 2FR4B 1LO3H 3MNVA 3UTOA 4QRRD 5DWUL 3VD4A 2ZPKH 4PV9B 5L9DH 1W0VB 1UWEL 4GBXB 1WAAA 3GDBA 1K8IB 5JHDD 4R96A 2J8OA 4XCCH 3QCUL 4GFTB 2R23B 2OTWA 1WZKA 3FOLB 2PTVA 3F6LA 4ZMAT 3F5WA 3C6LC 3DBXB 4NCC1 1CFSB 2O5XL 4XCYB 3OSKA 3DV4B 4D9RD 1OP9A 4PJAA 1HXMB 4LEOB 4H0HB 3OKLA 3C09B 1KTLA 3FO2B 3HMXL 1CFBA 5DC0A 3ZDXF 1HQ4B 2C7UB 5L2KB 4GQ9H 2X4SB 5GGSB 1LQSR 1NGXA 4G7VL 3I3BA 5FA3A 5JW5A 4TQEH 3NA4A 5L7XL 5DHVB 1R3LA 3VRIA 2E7LC 3FT2B 3VU2A 4HX1A 4JY6A 3E6FB 4PRHD 5DJ0A 2VDOH 5EO0A 4OCNC 3VXPB 5CEZH 4P2OD 2W9DL 4C83A 4GW1A 5FEBA 3SOBL 1RK0A 4FMFA 3PNWB 4PRNB 2VDRH 3ESVF 1GPOL 1WZ1H 3SDAD 5IVZB 3S34L 4LARH 4NKDB 3CLFL 1SYSA 1FO0A 1ZOXA 5FDYA 3RKDD 3OR6B 4X6CE 3OAZH 3BEWB 3FB8B 2ZUSA 2F5BH 2AVGA 4FZ8H 5DRXA 3TBWA 1JWUA 1KNOB 4MA8L 5I1HH 4JDTL 3THML 3RVTC 2HA1A 4HT1L 4EBQL 5I75B 5INDA 1TQBB 2VL4A 1GGTA 4IS6A 4P23D 3QUML 1U8LB 4ACPA 4MNQA 2A77L 1BD2A 1WT5C 2FYYA 3ZMRA 2BK8A 3UBXI 1IGJA 1BIHA 3N85L 3QIUB 2XPGB 4IMKA 1UB5B 4NZRL 4TN9A 1FNAA 2VTFA 5ADPL 2JJSC 3IGAA 4NN7C 2A1WL 2ATPB 5JA8B 3LCYA 4X0KB 4R0LC 4GRWH 4HXAL 4JKWA 2A6KB 1QSFE 1AR1D 3T0ED 1MY5A 5CUSL 4UU9B 3VJ6A 4NGHH 4O2CA 3UJIL 2XN9B 3NIFE 4DGVL 1KN2H 3QI9A 1J0YA 1NBYB 1TJGH 4G6KH 2P1YA 1ZHNA 4U6YB 3ARFD 1CLYH 3FFDA 1U2HA 4U6HA 2WNGA 1FORL 4N90D 1J8HA 3L5XH 5L8JB 3ARBD 1B0GB 3L3GA 1YEHH 2HJLB 4QWWD 4Q9RH 1FYHB 1A9BA 1YY9D 4LAJH 4XBGA 4U0QB 5GGRY 2VH5L 5BOZG 1T7ZA 2AXGA 4KMQA 4HJ0D 1F3JB 4M4RA 5D7LA 2HKHH 1IEAA 4NQXB 1F3DH 1FNHA 4G8GD 5IHUL 4IRJB 1A5FH 2BFVH 5SWSB 3TZVB 1AXSA 5EOTA 5HGDA 4QOKB 5CGYD 3NIGF 1SYVB 3NZHL 3T2PA 4LVNC 1M7IA 1AJ7L 5DXWA 4JZNB 1A7QL 3FO0H 1OP3K 1QRNA 2CJUH 3V9FA 1HDMA 4XCNB 4Y4HA 3S35X 1B9ZA 2EDJA 5KANI 1A64A 2JJTA 4IJ3C 2DLIA 2WBWB 3VD7A 3QEGH 1EBAA 1J1PL 5TF1L 5ICYA 1CU4L 3SDCD 2BOCA 4EUPA 5DJCA 3D6GA 1J0IA 1RZ8A 2JCCB 1JHTA 4N0UB 2J8UE 5JDSB 4EI6B 3TH2T 4CADB 1ZVSA 5HVWA 1I1AA 5C07E 1KT2B 2JIXA 4NNYA 3BP6A 4LCCA 5CKAA 1KG0B 2EH8H 1EH9A 2V5MA 3WEXB 3LKRB 5DMYA 2B0SH 3VXRD 1D5MA 4KJPD 1OB1B 4Y19D 5IBTH 3HAEA 1LEIA 1IGMH 4RGMC 1UQSB 4LHQB 4WI3A 1T03L 2JB6B 1N3NA 5CD5C 2YPVL 3N1MC 1KCVH 4DVBA 1UKSA 5EU7E 1W8NA 3SBWA 1JFQH 1WFTA 4RNRA 4XVJL 5L88L 5IB4A 4QNPE 4KHXH 1BFVH 3OPZL 1JPST 2PXYC 3BZ4A 3UBXA 3P9MB 3QA3A 3FQNB 1K2DB 5DC4B 1BWMA 2EE6A 5TE7H 1D6EB 3EHBD 3LV3B 1EEZA 3WIIH 2APXA 1KGCE 1DEEA 4KTYA 4M7LL 1LEGB 1S7XA 3LPFA 2VDQH 3RI5F 3MRHB 3IT8D 1YMMA 1JN6B 1WZMA 2DN7A 1LO0H 2V9TA 3S37L 3FOMA 1SMAA 2NX5A 3IETB 4M9PA 1MY7A 4Z9KB 5MP6H 5KVFH 1KTRL 3CXDH 1MUJA 5DJAA 1UZ8B 3X3FH 1DLFH 1RIUL 4L8CA 5EA0L 1TTFA 3HC4H 3WSQH 3BGFB 2EDYA 3LEVH 5GRJL 3LRSA 5DFTA 5IF0A 1RZGA 2GJZA 4ZNCD 4KAQH 1F4HA 5JHLH 1R0AH 2BY3A 2ICES 4OZIF 3F8UB 4BH8B 1CGWA 4HWUA 5BXFB 3B9DA 2H2PC 2KL6A 3LKPA 1GZQB 2EH7H 5HYJE 1JZ8A 3HI1B 1MFCH 1F3RB 3ZDZF 1KEGH 3JV5A 1CBVL 4WO4D 4UINL 3W0WA 4XP5H 1AGBB 3IFPA 1DBBL 5E6ZA 3DUUB 2W0FA 2RR3A 1J88A 1RZ7H 4GRLB 5ICZB 5GRUH 2F53E 1A1OA 3S8WA 1GH7A 4CMHB 5LJYH 2X09A 3RGVD 3SO3C 3ROLA 4IOIA 4YDVB 5FHAL 2DKUA 3RDTB 2OL3A 4ZS7L 4ZAKB 4Z18A 4NNPH 3QULA 3BDYH 3CAFA 2NY6C 2ESVE 4JFEA 4F7EB 5CEYB 4RMTA 4DN4L 2LTQC 1LDSA 5D2LA 4HIHB 1II4E 4S1QL 3NGBB 1T0MA 3RX8A 4KY1L 2VLME 1KCRH 3VXMA 2EE2A 4X5XB 4BQ9A 3MJ9A 5DQDH 3LMJH 5EZLB 1CD0A 5JXEA 2BC4B 3JWOH 2F8OA 3EO1A 4M6MH 5GGUA 3RWIB 3KPLA 2VKXA 5FUOH 4KRPC 2XV6B 5IWLA 4XBPA 1Q9KA 5EU5B 1T5WA 1BP3B 3WFEH 3BXNA 2K7PA 4ZO9A 3TYGH 2CIIB 3VCLA 5IMLA 2I9TB 2B20A 1J18A 1EHNA 1MFDH 1QPPA 4H26A 2OJZL 3TP4A 3WL9A 1ED3A 1OT2A 4OB5L 3PQYA 2MKWA 3OXSB 4AENA 5C0CD 2B4CH 3BQUA 4WUKL 4FQQA 3CJJA 3HI5H 4TTDC 3HR5A 2FBJH 5BJTB 2VN7A 3RNQA 3C6LD 1IM9B 1DQQA 4XWGL 2QHRL 1T20A 2XZCL 3GEWB 3U9PL 1P7HL 1B3JA 3HUJF 2N7BA 4WFHD 3ULSA 4D0BB 3FN3A 4LHUA 2ZG3A 4J6RH 3FQWB 4OD3H 1B6UA 5C09A 5ESQB 1ES0B 2XNAB 5KZCB 3O45B 1U8PB 3BDXA 1EFQA 5FCUL 4MDIB 5CSBA 3CFCL 4WFEE 1IQWL 5TJWK 1P6AB 1A1NB 5CJOL 4NQVA 4IDLA 5DA4A 1F6AB 3HG1B 2VXSH 3C9NA 5FKAA 2FEEI 3GM0A 4KJYA 2GQHA 4CMMA 3MJ9L 1DZBA 1FL6A 3UTSB 5ERWA 3J8F7 2GAZB 1FZKB 2X40A 2IFGA 1J0HA 2JF1A 4QTIL 1QKZL 1RUKH 2ARJB 1GHFL 4KFZC 2DQUL 3LN4B 4XAWL 4G43B 3VFWA 4JDZB 5IEKA 4WY7L 4RMWA 4O2FB 4WUUE 7CGTA 3CSBA 3DYOA 4HF5L 2F53D 4RAVB 2YWYA 1Z3GL 4TNVK 1NFIA 2DJ4A 1SY6L 3UPAA 2NY5L 3AXLB 1AGDA 1B0WA 3A6BL 5GGRB 3SE9H 5IIEA 1TNMA 1BJ8A 3QG6B 5I8EB 4HS8L 4JM4H 1NGQH 4OCYH 4OTXH 4JQVA 3D18A 2R0ZH 1I9JH 4LAQH 4MNGB 4GMTH 3BVNA 5ID1B 1ZKAA 4RCAA 4PJFA 1GGCH 1F90L 5IW3A 4GKNA 1R5WA 3SKJH 1K8DA 1BVLB 4XC1L 1OQXA 3BD4A 3QXAB 1BHGA 4N0CC 1SEBB 3L5WA 1LO2H 5GRZA 3B5HA 1D5ZB 3ARED 1G9EA 2NTFB 4J1UA 1FG2A 2NY3D 5E2UL 1AC0A 2IALA 4HBCH 5FK9B 5DD5L 1N2RA 2VZVA 1RUMH 4QGYA 5LBSH 4XPGL 3HZVA 6FABL 4WDIA 1S7SB 4RGNE 5J8OA 4IIQA 5EBMB 5IJKC 3MNWB 2OJEA 1I8IB 1RZKC 2BNQA 2PKDA 1BECA 4OAWA 1U0QA 2ZUWA 3MLZL 4OZHF 5TGBA 1JP5A 5LAXA 4NKQB 4JG1L 5E1AA 4KZEL 1ZHKB 3C09C 3TBYA 4PUBH 1P5UA 1CL7H 1T1YB 4B0MM 1YJDL 1R5VB 5CZVL 4P9MH 4H1LG 1NCNA 4MAUH 3TA3A 3VW3H 3TNMA 1FZMA 3O6LL 2ZJSH 1XF1A 1LE9B 2CDFA 4NSKB 5IB1B 3EO9L 3Q6FA 4P46A 4S1DD 4UV4H 1YUHA 1ZA3A 2V17H 3B43A 4X6DB 4XHJC 3H9YA 1YEEH 4U1IA 3UZVB 2J7LA 2YKLH 3H9SA 3MRRA 4NC0B 4U2YA 5J12B 4NQDD 3HZYA 4WWKB 4ELMB 4I0PA 5HYSA 1IC7H 3REVB 3VXNB 4UUJA 3ALXA 4JDVA 4KRNA 3ES6B 1PG7W 3SPVA 3KPSA 4BQ6A 2CK0L 5GRVK 3HNVL 1OGAD 1T7VA 4OCWL 4ZPTB 5CJQL 2A83B 3WFDL 2JJWA 4PREB 2ZCHL 4YR6B 1QFWL 5C0BB 1FRGL 4WUUD 5IHBA 4M48H 1B2WH 3OAYH 1U58A 2FD6L 3LS5H 4OD2B 4L1HA 4D8PB 4G6JH 5T1KB 2J4WL 3TO4C 2FSEA 2DM3A 2XQYG 4YHZH 3U2SA 5I75C 4F7CB 1P4IL 1OLLA 2B1HH 1TQBC 4FNLH 4WV1A 2R2HA 5EBLB 1ETZA 1HCVA 4UOW1 3SJVE 2BVPA 1CFVH 4HFUL 4JHAH 1IAIM 4DW2H 5LGKA 3OKMA 3SY0A 2YXFA 4PGEB 4P2CG 1PZ5B 4LLQB 1MJ8L 3L7FB 3ARWA 2FX9H 5FO7A 3CFEA 1J12A 3HZKB 2N7AA 3H7BA 1UXWB 3NOIA 3PABB 2C4FU 5IW6B 2CLZA 3GSNA 2OM5A 5DRNB 4PJDB 3PDDA 3T3PE 1SJHB 5DS8B 1MAMH 3MYZA 5FO8B 4UIMA 1CR9L 4FFVD 3W2DL 2CUMA 3PWLA 5C0IB 4G6MH 3RHWK 1FFPB 4O02H 4PJEF 1WQVT 2DI9A 3MV9A 3HNSL 3O3BB 4KHTH 2R1XB 3WN5A 5DRWA 1T7XA 4MMZC 3RA7H 3GKWH 3OJ2C 4KPHH 2YK1H 4NRYA 2FGWH 3ZYZA 1Z9OA 4U6VH 4UQ2A 3HRZA 3OAUH 3TM6A 2DQIH 3VWKA 4AJ0A 2H2PD 5FYKD 3GKZA 3P4NA 2FO1A 5B3JF 1YQ2A 2IG2H 5MENB 1FZOB 1MIML 5JORA 4URTB 2YD2A 3NABH 3NN8A 2XRAH 2Y4SA 5I1GL 1FBIL 2EKSB 3HNTL 4I77L 4LQFL 3TV3H 3QRGL 4LCWE 4U7MA 2FJGB 4PGDA 5D71H 3UPRA 2NY2B 4FQJL 3C8DA 4UOW0 4FA8A 4HZLA 3ULVF 4OZIA 3U30B 1XCQA 5ANME 3IU4L 1SBSL 5A40E 5HGBB 4K8RL 2AJ3A 1G0XA 2NY6D 4PRID 4OCSL 2YD1A 4PJ7B 5HVHC 5F9OH 4MQ7A 3OKOB 1JRHI 1TJIL 2HKFL 3HE6A 1NUGA 4PP1C 4RZCA 4P2QA 5KS9B 2V2XA 4C59B 5DSCB 2VUYA 1QR4A 1NDGA 4FFZL 4XTRD 3RJQB 1JF6A 5BV7C 4RSVA 1AXIB 3ISWA 1MWAL 43C9B 4HAGA 4UDTB 2DI8A 5KJRL 2CR3A 4PG9A 4UTBH 1H15A 1UWXH 4NT6A 3L6FB 5K9KA 4MJIE 1GIGH 5E6YA 4ZXBA 2VLRE 4YC2C 1ZLUK 4QGTA 3QWRA 8FABB 2WUCL 3V52H 3DLQR 1UCBH 1FFQA 1JNLH 4OUUA 5GS1A 4I1NB 3UROR 1RFDH 1MVFA 4N0YL 1C8PA 3QUYA 1BWWA 2AEPH 5AG9A 5I1AA 3JTSB 4TTDD 2BRRL 4FQXB 1G6RL 5FFLA 1HHIB 1CDJA 2UWEB 5E0QA 1A6VL 3VFRA 3C60C 4E42B 5SWZE 5C86A 1ZHLA 2EDRA 5AAMA 1FAKT 3BGFC 4F7TB 1BREA 4YQXL 2BX5A 4R2GB 3S96B 3G04B 4JM2F 1RIHH 4HGWB 4JQXC 1C12B 4NO0B 2D31B 2ADFH 4XP9H 1EFXA 1IC4H 3OL2A 5CMAA 3V4VL 4XVTH 1KYOJ 1P9MA 3RNKA 1I3GH 5CEXB 4F7PA 5F7KC 3SDDB 3KPPA 4NNXA 2O26U 4PTTA 2K7QA 3MCKA 4I48A 5D9SB 5GGVL 2FIRT 3MO1A 5GS2D 4BH7A 4RGOL 4R4FH 3IDMA 3HR6A 2VLJB 1E4XH 1FIGH 3G9VA 2DKSA 3EYSL 3HUJA 1Z2KA 5JW3H 1KTKE 4MNHA 2XZAH 5I18L 4WEBH 5D7JB 2Y9RT 4HKXB 4U05A 1V7ML 5IROC 2ID5A 5J6HB 1IC5H 1CF8H 3CC5B 3BESR 1U8KA 3LKNB 5E99L 2CLRB 2ZUQC 3ARDB 1DBJL 3CSPA 2VLKA 3BOVA 4UB0H 1XF5B 3IFNH 4NOFA 1SM3H 2VE6A 4APQA 3UZQA 2VSCA 4KGLA 2PO6C 5ECJE 4JB9H 5T5FH 5IOPB 1XIWB 1ZLVK 2ZCLH 1MCOH 3E3QC 4YLQT 4MA1B 1LP9E 2DYPB 2W1NA 4QRSA 4V1DB 4HKJB 1RMFL 1XGRB 4S1RL 2F19L 4WI7A 1KIUA 2N56A 4PJ9B 2ITCB 1KB5B 4TVPE 3RPIA 3MXVH 5IV2A 1INEH 4PJIF 3ZTNH 4GW4A 3PDGA 3MROA 4N0CD 4KI1A 5DGQA 3UXFA 1CGYA 1X5HA 3I02B 4MSWA 2F54A 5GGQH 4F8QA 3MOAL 1IL1A 1RULL 2GIYA 5CZKA 3PIQB 3UEZA 3UYRL 5D8JH 4XPBL 5C9JB 3MRQA 4NRZB 5D2NA 1YN6A 3LPWA 1T21B 4J3UA 4HWEL 4MJID 4Y89A 2I07B 1ZEAH 4GBXD 4NWTL 3F7PC 3QDJB 2QQKL 4J8RA 4Y4FC 2M2DA 1QLRA 3VXQB 5IMMB 2X1WL 3IAGC 3P9LA 4JFPA 3P0YL 4ALAH 2DIAA 4P5TC 5E7FA 1KJ3H 2VITB 3R06A 4YDLB 1BFOB 2R8SH 3MREA 3KJ6L 2VXUL 1CDCA 1LEKA 4PP2B 5FECA 5D1QC 3ESUF 4XWOC 4YIQB 3VE0B 3IDJA 1HOCA 5CBAB 4UNTA 4HG4K 1I8MB 3H3PL 5SWZD 2OX5A 1PVHA 2CKBH 4HV8B 4KJWC 5L2KD 2NW3A 3LB6C 3WIHH 4M02A 3D69B 5A2JH 3AVEA 3GI8L 3PGCB 2Z91B 1T1XA 5EOQH 1LO4L 1BVKA 4U1KA 1EO8L 2ITDA 4YWGH 2M8XA 1B4JH 3I75B 1MCWM 3KR3H 2HN7B 2DLFL 2FO4A 4LDOB 1VPOL 4F9LA 2GSGB 4YX2H 4XHJD 2R56L 4OZHA 4JVPA 5LWYL 5AUMA 1AO7A 3K4DA 3ARYA 5C2BL 1CQKA 3NACL 3FRPA 1Q9LA 4JJ5B 1C16A 1I7ZA 4HJJL 4V2CB 4W81A 5KSAA 4Z0BH 5IFJB 3QEQB 3AUVA 2ATKA 1HHJA 2Z93A 1QO3B 2X4PA 3NCJH 4ZFOA 2Z9TA 2L0DA 4JG0H 3L3HB 5ACMA 4YDIL 3TBVB 1SVCP 3EJYD 2DS4A 3EOTL 1MI5B 2BY2A 3TO4D 5E9DE 3QDGE 4NJAL 4L4VE 3SKNB 1W72B 5I76A 1A7NH 1MRCL 2ICWJ 5GGTH 1NUFA 2Y06H 4MQTB 2VISB 5SWQA 3G5VB 4LP5A 4Z95L 2YUVA 3CK0L 3GMRB 5FYJL 3D2UB 5C92A 3C5ZA 3QIUD 1S7TB 2XWTB 2Q3AA 4HJGB 3LSOB 5I8KL 2X10A 4I0KA 1WTGT 1KLUB 4XPHL 4CRPA 1J05B 5HY9B 2E9IA 2V2WA 1TVHA 3KHOA 4ZFFB 1INQA 2NY7L 5D1XB 3Q3GB 1HH6B 1P5VA 3BWAB 1RUQL 2OQJA 2X1QA 4D3CH 4Y5XA 3T0VA 4PTUB 2E27L 4XXDA 4CVZB 1A6UH 3MRBB 1RK1A 3QFJA 5EUOB 4LPXA 3VRJB 3CVHB 1ZHBB 4OZFA 4EDWL 3V7AG 2XY1A 3MNVB 1K5NA 2ZUVA 1T89C 3UC0L 2XI9A 5AZEH 4K3JL 4MA7L 1NMCB 1WV7T 4NZTL 5DUPL 4RWYL 4QT5B 5SX4H 4P3CL 3VWJC 2D7MA 4J4PA 1G6VK 4JFFB 3RY6C 4EIGB 1MIEL 2G5BA 3NFNA 3BI9X 4KMTH 4OLZL 2DLTA 2QQLL 4PJAB 2D7QA 1Z6JT 4NQEA 4PJEA 4XC3L 4HPYL 1HSBA 2PYFA 3OKLB 1KTLB 3H42H 4PJHE 5A2FA 3IDNA 5GS3A 5LXGL 1MVUA 2ADGA 1NGXB 3S5LG 3SCMA 3RJDA 4Z7WE 5MEOB 5JW5B 1KJMA 1FPTH 3VI3E 1K85A 4TVSa 5DMIL 1HINH 3E3QE 5J12C 3VRIB 3WNOA 1MFAH 3PL6C 4HX1B 4JY6B 4WWKC 5DJ0B 5EO0B 2Q87A 2J6EA 5C7XL 4YBQC 2ZP0T 4PYGA 2NW2A 1CG9A 3HPJB 3NBNA 2I5YL 3BZDA 2O5YH 4PP1D 4C83B 1E4WH 1ZT1A 4GW1B 3S88L 1T83A 1RK0B 4G80A 5FKPA 3I9GH 4M6NL 3BP4A 1B6DA 1JGUL 3C5JA 3MUJA 1A7RL 3WDIA 4ONFH 3HCVA 1L7IL 2GJ6A 1SYSB 5T3XD 1FO0B 4G8EA 4ETYA 5HHOA 5DR5L 5J89A 1AHWA 2DAVA 3ALWA 4JKPL 3MOBL 5E9DD 4DGIH 2OZ4L 3TBWB 3OTTA 4WW2F 1JWUB 2ZOKB 3H3BC 3MV8A 1MCCA 5CGMA 2WINA 4AY0A 5INDB 1OAXL 3OMZA 4IS6B 4M7JL 1H3UA 3UJJL 4MNQB 1BD2B 4N68A 2HWZL 1IGJB 1XGQA 1U8HA 4I9WE 1XZ0A 12E8L 4KKAD 2C26A 3FO9A 3G6JB 3U4AA 1NKRA 2DQFA 5B21A 3C60D 3DIFA 3VXUE 4HIEA 2VL5B 3ARVA 1JGVH 3VJ6B 2VZ1A 2KZWA 4NFCA 3CZFB 5B38A 3QI9B 5C0EA 1DQJB 1ZHNB 1YYMH 2JJVA 4Z7VF 1Q1JL 3FFDB 4LVOB 4IRSA 5EFIB 2BNRE 3OZ9L 4MD4A 4XGZA 4Q97A 3B5GA 1J8HB 2YMXH 4W4OC 3VGBA 4HFWA 3L3GB 3O3AA 1FNFA 3GUTB 1EVTC 1X6LA 3L3DA 1A9BB 3V7AE 4XBGB 1WBYA 3ZE0E 5C0RL 4LLWA 4NCDA 5D7LB 5F88A 3HMWL 4WI8A 1IEAB 2FIKA 4GRLD 4QY8A 4O5LL 3GM8A 1AXSB 5EOTB 4M61B 5HGDB 3MCLH 3MLYH 3O2DL 3VFUA 3ULVL 4NKOA 4ZTPL 5CJ5A 4WENB 1M7IB 4K9EC 1T1ZB 4HIIA 5DYOB 2NY2C 4JM2A 4DVRL 5JZ7C 1A7OL 1CICC 1QZ1A 3U30C 3QXWA 3FT4A 4Y4HB 4BM7A 2B39A 3GSVA 3UTTB 2AEQH 4MCYA 3GK8L 1A0QH 5ADOL 3MLVL 3OB8A 5ICYB 3EGSB 4GAFB 5B39A 2H32H 2BOCB 2JK5A 2IFFH 3INUL 3RVVD 4EUPB 5DJCB 3MGOB 4Z7OE 5EU3A 5K9QG 3MUGB 1ZVSB 5IFAL 1TCRA 3BIAX 5JLZA 2JIXB 5I17A 4GG8A 1D5IL 3BP6B 3O4LE 1T0NB 2VRAA 4LCIL 5DJDB 5MEQA 1BQHA 5AYUL 1LEIB 3STBA 3CX2A 2XQBL 3DX8A 3V2AR 4G3YH 3GI9L 1NGWB 3GNMH 4DVBB 2L7UA 4I4WA 4GXUN 3TBTB 5JXAL 4RNRB 3VFOA 4AIZB 5IB4B 1FSKB 4NO2A 3BZ4B 3UBXB 3QRFM 1DVFA 3QA3B 3A6CH 5FUZH 4F7MB 4S0TD 3GSWA 3TJHC 1K6QH 4P5TD 5D72H 5JW4R 1MCFA 5HGAA 1UFUA 2LAGB 4PJIA 2YS4A 4Q6IA 4OLWL 1IM9D 1HQRA 1DEEB 4I9WD 1G0DA 1FFOA 4XMPL 2DJUA 3A0OA 3TVMB 3QNYB 3RX7A 1G7PA 1G9NL 3WJLC 3BPCA 4OGXH 3FOMB 5IFHL 1FVCA 2DMKA 1HEZA 4KJWD 3KLAA 3FN0H 5KZCD 3LB6D 4Q7DA 5DJAB 3W5MA 4L8CB 5ALBL 4WCYH 2BSED 4FHBD 5H37G 3DXAA 4WTWA 5ESVA 4YHLL 1NC2B 3HG1D 2Z8VC 1RZGB 1DQDH 1RZKH 2GJZB 2R29L 5C6PB 3U7WH 3K4AA 3UTSD 4LSQL 4MDJA 5EC1A 3BPOB 3QZWA 1MQ8A 1RD6A 1NGPH 3RVXC 5MHSE 1FL5A 1K4CA 2HRLA 2C9AA 4LF3B 3W0WB 2YZ8A 3IFPB 3ZE2E 2HFTA 4NQSA 3RAJL 5IESH 4ZOBA 1RSFA 4RFNC 1A1OB 4Y1AE 2XT1B 4XPTH 1UH3A 3ROLB 4IOIB 2I9LA 2OL3B 4R90L 5CKGA 2WSKA 4EOWL 5A3ID 4JRYE 1KCSL 4XP1H 3Q1SL 3QULB 4MA1C 3QDMA 5DT1L 2EE3A 1NBZA 3ZTJG 5CFHA 3LQAH 3P11L 3P2TA 4N9OB 5D2LB 2DICA 1H0DA 1MCNA 1UM6H 3N1PC 5EH1A 4NQCE 3MRDA 3KYMA 5IG7A 4XNZB 5IVOA 3M1BA 3QG7L 3MBXH 1IGCH 3BT2H 5ETUA 1L0QA 1IE5A 1JNNH 2E8YA 2G9HB 1IGIH 1T4KA 1LHZA 1MRFL 1W0WA 3O4LD 1MRDL 4M3JA 4ODSL 5HHME 3VD5A 2WV3A 3TYFB 3EO1B 5GGUB 1RURL 1F02I 3DX6A 3KPLB 2XWBA 2AERT 4GRWF 3HC0A 3B8SA 1Q9KB 4XBPB 4LLAA 3BD3A 3RY5A 1T5WB 3IJSB 2FRGP 1IT9H 5F96H 3BXNB 3MTRA 2X70A 1PD6A 1RUAH 3VCLB 5HDQL 2VZSA 1DBKL 3H2WA 4H26B 4YDLC 3RPKA 2I60H 2VAAA 3TN0A 1HILB 3WL9B 1ED3B 2OS7A 3PQYB 4OSUL 2O5ZL 1NAKL 4AENB 2BZDA 2GCYA 1KELH 3GMOA 4TVPH 3I2CL 3QPXL 4FQQB 1MLCA 3VWJD 2BCKA 3KYKH 4YFLF 2VLLB 3QJHA 4EVNA 1PZUB 4G8IA 1AC6A 3RNQB 1FNSH 4JO4H 4JLRA 1QBBA 3EYUL 1T20B 4HWBA 2BDNL 4DCQB 4Z7UE 4O58L 4FFWD 5D1ZA 4TSCH 2APWA 3ULSB 1FYTE 3C08L 3RI5K 2IANA 4LBEA 1NSNL 2VXTL 2BMKA 2MQCA 4PLNC 3O8XC 5C09B 3P0VH 4NM8H 3SE4A 1KB9K 3VMNA 4YEEA 4OF8A 5KVEL 3ARPA 3QNZB 4XX1G 5F7UA 4N8PA 3C9NB 1I85A 5FKAB 4HWZA 1CGVA 4WWKD 4CMMB 4KJYB 4ESKA 1FL6B 1Z9SA 1BPVA 2AI0H 5ERWB 4YBQD 3CH8A 1TJHH 5MHSD 2GK0A 2RAMA 4XPAL 5CINH 1P7QA 1QVOA 2MPAL 2P7TA 5JR1L 4D9QD 2DQJL 2E7MA 1D9KA 1S9KC 3T3ME 1BIIB 2HTKC 3VFWB 4PJXE 4NHCH 5IEKB 1UJ3A 5T1KD 1IKFL 4N0FA 1P69B 1WK0A 3FAWA 1MLBA 5L2JA 2R2BB 3MJGX 3FB5A 1NFIB 4AYFA 3MJ7A 3RP1A 4GKSA 3HRPA 5IIEB 4NM4H 3JV4A 5FO9A 2DB8A 4GMSL 3WUWA 5GS0H 2A6IA 1QBML 1EHLL 3T2NL 1PKQE 4LGRB 5F9JA 3D18B 5E2VH 4QYOB 2QL1A 3S4SG 1GYAA 2EC8A 3BVNB 2R1YA 5GIRA 3TLRA 2EYRA 4EI5A 3NFSH 3WFCH 4LOUC 1N8ZA 4NQCD 5JO5A 3ZKND 4HWBL 4GKNB 3VXOA 4R4NC 5BV7H 3MV7A 1T6WA 3DTXA 4KI5F 2J5LC 2AP2A 4KTDH 2WLYA 3KLHC 3L5WB 1J1OL 4YO0B 3KPNA 1GGIH 3D0LA 2NY0C 1SEQH 3GMNA 1FG2B 4WW2A 3RVWC 1BZ7B 2K9UA 4OFIA 1KJ2L 2IALB 4RQQA 2VDPH 1M7DA 3MPCA 4OLEA 1KULA 1N2RB 4XNYL 5LCVL 3HE7A 3HZVB 1P7KB 4WDIB 1D5BA 1JHLH 5IW1A 4I3RH 3NCBB 5I1IH 3LAFA 1YNKL 1OAZL 5CHNA 2OJEB 4FXLA 2EIZA 1ZTXL 2WANA 3DOSA 1OCWL 2BNQB 5MEND 4W4NA 4WTZG 1HXYB 4OQ1A 3A6OA 5TGBB 2LU3A 1G7MB 1KLGA 5E1AB 2GEEA 1C5DA 1CE6B 1RZIA 3O6KH 3SDXE 1E6OL 4E41A 5C08E 3M45A 2CGRH 5JW4N 2DM4A 3RWJA 2NY2D 4Z7VA 4PJGE 4JN1H 1CICD 1VKXA 3FONA 1ORSA 3TA3B 4FZEH 5IT2L 3TNMB 1FZMB 1J1XH 5F6HI 3HFMH 4WTXA 3QIBA 1F8TL 1F45A 3Q6FB 4Q2ZA 3D3VE 4MZ2A 1YUHB 1ZA3B 3OJMB 1U8JA 4U1IB 5F7FA 2EYTA 3H9SB 3MRRB 4LCYA 4MAYA 1QFWM 3WS6A 5HYSB 3HZYB 4I0PB 3BKMH 4UUJB 2CRYA 4LMQI 3EFFA 3KPSB 1ZANH 3PF2A 2NQCA 2AJSL 2OR8A 4IBLT 4HUVA 3HB3C 1NAMH 3MJ6A 3PWPA 4XMKH 2H3NA 1AD0B 3MA9L 1RZFL 3O41A 1U58B 2MCPH 2OP4L 4JFOA 3N9GH 5TPWH 1KOAA 3IXTA 1E28A 4OV6F 2IAMA 3U2SB 4RIRB 3BKCH 3RWDA 3KPRE 3W9DB 1ZGLA 4WV1B 2R2HB 4A6YA 2P5EE 3VG9C 4JPVL 1QFHA 1I4FA 1ETZB 4HS6A 2H26B 3HTLX 2B1AL 2BVPB 1Q94A 3ILQC 3O6ML 4LSSH 1DANT 4IMKC 5C0NC 3OKMB 3BKJL 3SY0B 2LAAA 4XCFL 3VDBA 4XBEH 1FE8L 2CKNA 1A1MA 1BZ9A 4HEPG 3CFEB 1CLZL 5GHWH 4LNRA 3H7BB 4YHIA 3CDFA 4Z6AT 3DRQA 2CLZB 3GSNB 4JY5H 3MX0A 3BEVA 3VFPA 1NJ9B 2ZG2A 4UIMB 4KJQC 2JELH 4LLVA 4M1CC 3PWLB 4LVOC 4NO0D 1CFQA 3MV9B 4HMDA 3WN5B 5DRWB 4G9DA 4NRYB 9CGTA 1U8NB 1A4KA 1YQVL 2WZPD 1ZE3C 1C7SA 3VWKB 3NTCL 1DQTA 2R15A 3P4NB 2NXZB 3RVXD 2VLJD 1LD9B 4UILL 4YFLI 4E5XB 5DK2A 1DQMH 2ZCKL 4EZMA 3RZCB 5D7JD 1YMHA 4LSRL 5T1DL 4FQ2L 3NN8B 3KLDA 5C0AE 1QFPA 2IGFH 4U6TA 1A7PL 4JGJA 5FYKL 3HHRB 4Y4HC 4HQQH 4R7DB 2NXYB 3QXUA 1C7TA 4PGDB 3UPRB 5E24E 4RFEA 4NN5C 5DEFA 1XIWD 1XCQB 4HPOH 3BMWA 1AQDA 2WK2A 2AJ3B 1CGSL 3GRWL 3D3VD 4OLUH 2X42A 4R6UA 1BEYL 4MQ7B 4PJ9D 1MFBH 4P2RA 3QDAA 1I1AC 3CMOH 2IBGA 4P2QB 5D93B 2V2XB 5JDJA 1NDGB 4F58H 1IC1A 3EDEA 4LCCC 1I1FA 5KSBE 1FG9C 4X99B 3FFCE 3QXVA 3G5YA 4CJ1A 5E2JA 3K2UH 1EAPA 4OFYD 1CD1A 4LSTH 1H15B 2NY4B 4EEEA 2AXJA 1LO3L 1IAKB 3SBWC 4MXQC 4NT6B 1GZPA 3QDJD 1FSKC 2FJHA 4ZXBB 1EHXA 3MRFA 5F3BA 4I5BA 3CLEH 1QSEA 4LVHB 3G08B 4R26H 2D9CA 1WFNA 4F57H 5GS1B 4OUUB 3GHEH 5IK3A 2X44D 4YE4H 1KENH 1DBML 2F74A 5F9WB 3QUYB 4K3EL 5I2IA 5EU6A 4Y5YA 1TVBA 1QPXA 3SE3A 4HC1H 1YEGH 3TC9A 2DWEA 3KNBB 3QQ3B 4LPWA 3FHAA 3LKQA 2F9BT 4LU5H 4HG4J 5IHLB 1ZHLB 4M5YL 3SGKA 5BS0A 4QXGH 4EUPG 1BF2A 5HJ3A 1Y0LA 1OF2A 2YPLE 3O8XD 3MLPA 1QOKA 1EFXB 1JTTA 1JWMA 3ZO0A 1EEUA 4JE4B 5CMAB 4JO1H 3ARGA 1U8IB 3X14A 4X80H 5DJ2B 3JWDC 3T0AA 3V6ZA 3KPPB 1UM4L 4I48B 1OTSD 2EDKA 3HAEG 3MO1B 1X5AA 2XA8H 2VDRL 2GSIB 3ORJA 4TSBH 3QEQD 5KVDH 1IAIH 1JMZA 4LARL 3W11C 3BISA 2FR4A 3HUJB 5TQ2H 4MNHB 5T33L 2HTKD 4PV9A 1G7IA 5C0AD 2ORBH 2ARWA 1MI5D 3UBXG 4OCRH 1U8KB 5J1TC 3K1DA 2OR7A 3FOLA 1HYSC 2VLKB 3BSZL 4KV5E 3BZFB 3MBEB 4K55A 1BQLH 2VE6B 4APQB 5FHBL 3RBGA 4XCYA 1KCUH 3D2UD 2Z0BA 3N50A 1O5DT 4NDMA 5GSVA 4LEOA 3SDYL 3TNNA 1NCCH 2IPTH 3NAAH 5KTEH 4QRSB 3V0WL 3I6GB 3FO2A 3S36L 1K3IA 4LOUD 1CXFA 3MLSL 1MCLA 2PN5A 5JXEC 1DQLL 5D1XD 4R4ND 3RPIB 5IV2B 4GW4B 1PYWA 3O2WH 1QNZL 3KLHD 2K1MA 1I7RA 5IWLC 2IH3B 1KN2L 1LWRA 3BW9A 4Q58C 4MSWB 3FT2A 1KTDA 3CVIL 1IL1B 1TJGL 3EDKA 3I50L 3VXPA 2B2XL 1A2YB 4JGMA 1HE7A 3RVWD 4X6CF 4PRPA 4JRXA 1OLZA 3MRQB 1JHKL 2Z31B 3SE8L 5D2NB 4OJFL 1YN6B 2BVOB 4MB5A 3PNWA 1YPZE 1A6ZA 3OJVC 1QLRB 3HC3L 3P9LB 1HHHA 3RWFA 1S7UB 3BQUC 3OR6A 3F7YA 4JREC 3BEWA 1G7LA 1MAKA 2W38A 3FB8A 3DX7A 3TBSA 5I1KH 4H20L 1FNGA 1LEKB 1T66D 5FECB 4X8JA 1Q0YL 4KVCH 2XIDA 1KNOA 4MXVF 5DFWH 3IDJB 1HOCB 3N06B 3WE6A 3MRGA 5H2BA 1QBLH 2CJUL 5J6GA 1WICA 1QRNE 4WEUD 2GKIA 4DTGH 2NW3B 4X98A 2VC2H 1YNLL 4OV5B 2QHLA 2RFXA 4RBPK 5IMOA 1ACYL 1UZ6E 1JI2A 1T1XB 2VZUA 1BVKB 1Y6NR 4U1KB 2ITDB 4U7KA 3PHQA 3PGFH 2R0KH 2FO4B 5FGBA 3B2UD 1KXQE 5CD3B 1I1YA 3KPTA 1EAJA 4OZHB 3TGXA 2XTJE 5AUMB 1AO7B 2XN9A 5J57B 4TRPL 1Q9LB 1Z0MA 3STZA 1X5ZA 1C16B 4HBQA 1I7ZB 4U1JB 4ZG1A 2BERA 5KSAB 2Q8AL 4K9EH 3ZL4L 2ATKB 1HHJB 5BVJA 5CJXA 3EAKA 2W9EH 3NZ8B 4L9DA 2X4PB 1HNGA 4ZFOB 5INCA 4NRXA 3CMGA 1GCFA 4G5ZL 3HI6H 3OWEA 5E2WL 3GIZH 2AJVH 2HP4A 4B7LA 4ZFGH 5AD0B 2APFA 1F3JA 4ORZC 4S11A 3E8UL 4NQXA 4NN6B 4IRJA 2BSTA 4MQXC 5IVXE 5I76B 4JQVC 5SWSA 3TZVA 4QOKA 4JO2L 2APTA 3K1KC 5SWQB 2A9ML 1F00I 2BSRA 4MNQD 1BD2D 4KGJA 3ILQD 5DUMH 4AMKH 4LGPB 3C5ZB 5ITBH 3TH3T 5C0ND 5I9QB 1DR9A 4LHUG 5D7IE 2G60H 1WZLA 2MNUA 2J8UF 1YMME 1LO0L 1AE6H 1TVHB 4L5FH 1INQB 2NY1B 3ZT7A 1DFBL 2NX5E 4AG4H 4AEEA 1DSFL 5MP6L 1CDHA 3CXDL 1JRHH 3KJ4B 3LN5B 2OQJB 4Y5XB 3QI9D 5HDLA 4XXDB 1MEXL 2BVYA 1PY4A 1RK1B 4ODTL 4QLRA 4HXBL 4N0UA 3BPNC 5K9OB 1PAMA 3X3GL 4IIQC 4OZFB 3V95A 1R0AL 1J8HD 5E6IC 4OGYH 1HYRC 4UT9H 4YJZL 1K5NB 1VDGA 1F4XL 1KG0A 4NUGL 5C6TL 5DD1L 4QNPF 1OAUH 3LKRA 3QCTH 4R8WH 3WFHA 5D7LD 1UQSA 1DJSA 3VA6A 5LQBL 1A7BA 1D5XB 1OL0A 3D0VB 3MLUH 3O6FB 2D7TL 3FHQA 4K7FB 4U6XB 2G5BB 3NFNB 5E2TL 4ONGL 1J5OH 3SKMB 1OAQH 1S5HB 5GZOC 3P9MA 4NQEB 5I15L 4PJEB 1WITA 1QRND 1HSBB 4Y4HD 5D70H 5ICXA 5BRZE 1MSPA 3UDWA 3IDNB 3BDYL 3EZJB 1IVLA 1IEBA 1CL7I 1KXVC 1LEGA 1MVUB 1WGOA 4JFEE 4P46C 3A67H 1JUFA 3MRHA 4YDKL 4O4YH 3QJFB 1KJMB 2IJ0C 1JN6A 3C2AL 4PGZA 4OFVA 4Q9QH 2I27N 1MQKL 4U31A 4BK5A 3VXME 4I0PC 4G7YH 5DQDL 1CVSC 3LEYH 2NW2B 4U1GB 1CG9B 1I1AD 1JPSL 1ZT1B 3PGDA 2JIXD 6CGTA 3O9WA 4LASL 3N1GC 4G80B 5FKPB 3BP4B 4P9HL 4BQBA 1A3QA 5FUOL 3C5JB 4YK4C 4L4TE 1S78C 4HCRH 3PP3K 3HCVB 3JV0A 4YUEH 2GJ6B 3V4UH 1W2KT 4G8EB 5BXFA 5HHOB 1AHWB 3AS1A 3P30H 4MXQD 4WV1C 4PJ7F 3TYGL 4WGWB 2DDQH 4FP8L 1RZJL 3D39A 5I1JH 1JVKA 3GHBL 4NZUH 2WINB 4C56A 3B9EA 1EDQA 5T3XL 4HMCA 3HI5L 4WGVB 2R9HC 1MCBA 1KBGL 3LDBC 4YDVA 1XGQB 3RDTA 3WKML 4M1GH 3R8QA 4ZAKA 1XZ0B 1YMMD 4XMLH 3BAEH 4K3DH 2NX5D 3RUGE 2Q8BL 4O2EB 3FO9B 4P4KA 5J11C 5D6CB 2DQFB 4UDUA 4H8WL 4HIEB 5IGXL 1BBDH 5JUEH 4HIHA 1ZSDB 3JWNC 4PJ5A 2VDKL 2XY2A 1TZHA 2OBGA 2VJXA 3QYCA 3LZFL 4X5XA 5C0EB 1J11A 5HYSG 4RMRA 5EZLA 3ZHDA 5LGJA 4IRSB 4NWUL 5T3ZD 2EDBA 4XGZB 3VWKC 4LLDA 4HFWB 2FATH 2AK1H 3O3AB 3RWIA 5F93C 3L3DB 3RTQA 1WBYB 1NFDE 5DC9B 4PRAB 1OARH 3IU3A 1YEDB 3W0WD 5F88B 5EU5A 2V7NA 3KXFE 2EO1A 5M94B 3W11D 1EGJH 1SJXA 2FIKB 3KDMB 4YEFA 3VFUB 4NKOB 1C5BH 4FTVE 4YZFE 4IOSD 1YEKH 4P49A 1AGCB 1IFHL 4FQCL 4M1DL 4LQ1A 4JM2B 1CD8A 2V5YA 5C0GA 4RDQF 4NUJA 1IM3B 2YA1A 1HYSD 5KSVB 1UWGL 3FT4B 5BJTA 5DWUH 4M5ZL 1NGQL 5BW7A 3GSVB 4JFED 4MCYB 2DWDA 3GZKA 4BFEA 4AL8L 4U1HB 4PJFE 5A16B 3GMMA 3HE6C 3VXMD 5D93C 3BN3B 4D0BA 5EU3B 1E27A 3BP7A 5JXED 1ES0A 1LO2L 3O45A 2O5XH 1QG3A 4PS4L 1TCRB 2APVA 2KPNA 1ZAGA 2AJYH 3V0AC 4KDWA 3OGCB 2X1OA 4CBPA 5I17B 4GG8B 4U49A 3OB0H 4WNQA 4XXCA 4Z7QF 5MEQB 3HMXH 2CIKB 1BQHB 1DDHA 1HKLH 3P77A 3DX8B 3QEHB 4ZXBC 2H45A 1FZKA 4G7VH 3KHQA 2JE8A 4MVBC 1YY8A 1HK6A 2ARJA 5L7XH 5IBLC 1EEYA 3LN4A 1FDLL 3VFOB 3MLXL 4NO2B 2E7BA 3PQYD 3WLBB 1DVFB 5F9WC 4O2FA 3BQUD 5DMGC 3GSWB 5KVGL 5HGAB 4PJIB 3SOBH 4WFFE 4YXLL 3BYYA 1HQRB 3QWOA 3W81A 3LRGA 1AGFA 1FFOB 3PXHA 1GPOH 5GGRA 3S34H 5I19L 3CLFH 5I8EA 2YD8A 3V8CA 4LHUD 2CO7B 1T3FA 4X6CA 1OT1A 5D96C 3AAZB 3BPCB 4MWFB 1FVCB 3VW3L 1HEZB 5C09D 5ABDE 3KLAB 4YXHL 4MA8H 1HNFA 5LGHL 4JDTH 4RX4A 3THMH 1P9MC 4KK6C 4HT1H 4OLVL 4EBQH 3PJSA 3QXAA 1SEBA 4BK4A 1KB9J 3QUMH 3ALPA 3EYOA 4MDJB 5EC1B 4YHML 3N85H 2LU7A 4CU6A 4NZRH 2X4NA 3BDBA 5ADPH 5FK9A 2A1WH 1FL5B 1T7YA 2WQRA 1QSFA 4UAOB 3V6OC 4HXAH 4EN3A 4M48L 5GRWA 1BAFL 4NQSB 1IRAY 4ODVL 1DN2A 1JE6A 3AU1A 3EZ8A 1URLA 3EIFA 3UJIH 2HVJA 1CQYA 1I8IA 5HTSA 1N0XL 4APQC 2I9LB 2F15A 8CGTA 3FO1B 4MQXD 4NYLA 4LLUA 1NBZB 2ZUUA 2AV7B 3EOAB 4L3AA 4PY8I 5I30L 1H0DB 2VH5H 1CFNB 2FX9L 5FGCB 3VGAB 4J3OC 2F5AL 1ZLVH 3MRDB 3QUXA 2C3HA 5IHUH 3M1BB 2NNAA 2XKNB 3UTZA 3CU7A 2GTWA 3NZHH 5IB1A 5EZIL 1T4KB 1VADB 1AJ7H 1W0WB 3EOBA 5C0DA 4G6ML 4BZ1L 2OR9L 5BZWB 3DX6B 4AEHH 2XWBB 1HIMH 5D2NC 3HC0B 3IDYC 4WHTB 1UADC 4KPHL 35C8L 2OSLB 5I71C 2HG5A 5TF1H 4N8VA 2EECA 1QLEL 4ZPTA 4ZNEE 1CU4H 3MGAA 4JQIL 5DVNA 3WO4C 5C0BA 2VAAB 3V5HB 2BNQD 3TN0B 1GOHA 2J8UA 4L8DA 1IGYA 4OD2A 1Q0XL 2GCYB 4YHYC 4L3EE 5C07A 4KKLD 1MLCB 4ZO8A 2BCKB 4KQ3L 3QJHB 4EVNB 3NABL 4G8IB 4ETQA 4F7CA 3CX5K 4ZPVA 4JLRB 3ZKXB 4Z8FL 5EUOF 4BFBD 4M7KL 5D1ZB 1T03H 4YHKL 3P40A 3TA3D 3KWWB 2YPVH 4LBEB 1NGYA 5K59E 2BMKB 4OZIE 5E4EB 1VENA 1PZ5A 1F2QA 5DURB 4XVJH 3DGGA 2R0LL 3DMMB 4P46D 1T1WA 4F9LC 2AK4E 1R3HB 1UXWA 5DJYB 3ZHLA 2EYSA 3H9SD 4PJDA 4MS8C 3MUY1 1FLRL 1SJHA 4HWZB 4H5SA 4I0PD 3IRZA 3KPSD 4M7LH 2GK0B 5KSAC 4OIIL 4HIXL 3STLA 1FFPA 1CK0H 1P7QB 1QVOB 3BZEA 5JQHC 3O3BA 2R1XA 4OZGB 1D9KB 3MRKA 3FQXA 5E8DH 1UJ3B 4PLKC 4N0FB 1AP2A 3U46A 1GJIA 5L2JB 1MLBB 1DCLA 1RIUH 4WHYG 5EA0H 4K7PX 4CVUA 2F8XC 5GRJH 4NN6C 5B22A 3FB5B 1YECL 3V52L 3MJ7B 2BOBA 3EDDA 4GKSB 1JNLL 2YR3A 4QRPE 1FZOA 2E7LA 2P5WB 3JV4B 1WIOA 5FO9B 3CUPA 3WUWB 5EIQA 4P0DA 3C5ZC 2A6IB 4P4RA 5J9PA 5HYJA 5F9JB 2R9HD 4FQLL 2X6MA 4O00A 2R1YB 4EI5B 3OAZK 4NOBA 3QHFL 4KROB 2A6DA 1N8ZB 1CBVH 4MHHI 5JO5B 2ZKHH 4UINH 2NY1C 1QTYT 3HAEH 4CW1B 3VXOB 3MV7B 3VD9A 3DTXB 3ARQA 5JIIA 4Y5XC 5HGBA 5F7HA 4NZDA 3KPNB 1PG7H 4PJ7A 3QQNA 4XP4L 3V6FA 2WBJA 2H6PA 1F4AA 2W60B 5DVLA 5FHAH 4BZ2L 3GMNB 4WW2B 4ZS7H 4PG2A 3MV9D 1UXSB 1G9MC 4YHPB 1M7DB 5DSCA 2A38A 1CGXA 3KPMA 3S9DB 1T6VN 3FRPG 3HE7B 1I3GL 5J3HC 2ESVA 5IW1B 4F33B 4FFYH 4PJ8A 1JF1A 2A0LC 2VYRE 4PLJD 3VWKD 1Z5LB 3IJHB 4HGMA 2NXZD 4S1QH 2XICA 2VABA 5CHNB 2V5SA 4KY1H 4TTGA 2F58H 2EIZB 1E4XL 5D7KD 3LH2L 2WP3T 4ODUB 4WI6A 2FH8A 3SKOA 4P59L 3V6OE 4K07A 4P48A 3O0RL 3WNKA 2J2ZA 5GZNC 1C5DB 3CCHA 3LD8B 2FZ3A 4W70A 4P23C 4WFGE 2CKBA 4Z7VB 2C3GA 5BVPL 1T7WA 3WIHA 1DUZA 3NCYS 3FONB 1ORSB 3SCMC 3U7YL 1TNNA 1UT9A 2D3VA 1L7TL 3F65A 1OAKL 2XTLA 4FQXA 5AWNL 1N4XL 1U91B 4AH2A 5ISZE 1FV1A 1J0KA 2OJZH 1S3KL 4JO3H 4LP4A 3NMEA 3RVUC 4F15B 4OB5H 4A2LA 1WTLA 4JPKL 1I9EA 1JNJA 2JB5L 1MHCB 3HE6D 5C9KA 1XGUB 3O11A 4P2QD 4WUKH 1T83C 2EYTB 3MXVL 4LCYB 4MAYB 5EZOL 2XZQL 2RB8A 1I8LA 3NPSB 1RUPL 3S96A 3LRHA 15C8H 3EFFB 3G04A 4XWGH 2HLFD 5GGQL 4IOFC 2XZCH 2AXFB 2BVQA 4QXWA 4OZFG 2F54E 3U9PH 3OKKA 1X5KA 4HUVB 3S7GA 4L9LB 2AKRA 4HS3B 3ARBC 3ULVC 1H8SA 2NY4D 2H3NB 3SDDA 4QWWC 1NCBL 3O41B 1SHMA 4M93B 4JFOB 4QRQA 4ZXBD 5FYLD 4FABL 5DLML 4L29A 3IXTB 1E28B 3CFCH 5HVFB 1IQWH 4JN2A 1MJ7H 4MVBD 5CJOH 2IAMB 3QWRD 4HLZH 3RWDB 5GGTA 5IBLD 3EO0A 1ZGLB 3FRUA 1I4FB 4HS6B 4OBRA 1L9NA 2DF3A 3MJ9H 2R8SL 1CE1L 1PBYA 4JFDE 1TTUA 1A47A 5IB2A 1Q94B 3QUYD 1JYWA 5FYJE 1NCAL 3CC5A 4ZFZA 1LO5A 3J7HA 5JPNA 1FH5H 3HA0A 3WIFA 4LIQL 4QTIH 3ARDA 5BZDA 2AJXL 1QKZH 3VH8A 1GHFH 1A1MB 4XHQA 5F89A 1A6WL 4XAWH 2D03L 3DUSB 4LNRB 4TULL 2QSTA 4WY7H 4OT1L 4YHIB 3PE9A 1SJEA 5IOPA 1EEQA 4HF5H 3DRQB 4ONOA 5DZNA 3VFPB 2DYPA 1Z3GH 1S9VB 3QFDB 1ZVHA 4JR9H 4V1DA 5D5MB 4LLVB 4LLMA 2PW2A 4HKJA 1SY6H 1OM3H 3VXSE 2NY5H 1CFQB 1KIRA 3A6BH 1EFXD 5TFSL 4Y16B 2PXYA 4HS8H 3ME0A 1X5YA 4P3WA 1CN4A 1EO5A 5DZLA 3JUZA 2NR6C 1VFAA 4WHCA 1A4KB 1WIUA 3I02A 5EC2B 4NFDA 4KJPC 5HXMA 2VN4A 2CRMA 3PIQA 1F90H 4Z0XB 3CSYB 3BIBX 4Z0BL 3KS0J 1EK3A 1H8OA 5EORL 1ZGLM 4UT6L 3K4ZA 3VMPA 2EEDA 3VXQA 1WISA 2P42B 1G9NC 5E2UH 2VITA 4WFGD 2VLKD 5DD5H 3ROOA 1A7NL 2FECI 5FUCC 1FCGA 5GGTL 3W39A 4APQD 4XPGH 3WXVL 6FABH 4AEIL 3S98A 2EC9U 2D0GA 4RFEB 4PP2A 5DEFB 4Z5RB 1XF4A 3VE0A 2CMRL 4X4XA 2PYEB 3B4NA 5FM8A 3TO2B 1AQDB 3L5IA 4D9RE 3NCYP 4X7TA 4MXWH 2D7NA 3D87B 5T1MB 2FJFB 5ELIA 1KN4L 1WC7A 4YGVA 3JTTA 4LEXL 4P2RB 3IB4A 2MQ3A 2B7DT 3NH7L 3JVGA 3X17A 5B38G 5DEZA 4JG1H 4KZEH 3CIQA 4FQPA 3PGCA 1Y18A 1I1FB 1HI6A 1ZS8B 4KQ4L 5KSUA 2CR6A 2VZ3A 2F54D 4YPGB 3I75A 3G5YB 1YJDH 2YBRA 3MCG1 3QFJE 3EUUA 3KLSA 1EAPB 5CZVH 4DWHA 4L8SC 1KB5L 1NKOA 1MH5A 3O6LH 3S37X 2OCFD 2QQNL 5DMKA 3FN9A 1U3HA 4JJ5A 1HKFA 3MRFB 4I5BB 3EO9H 5J06A 1DVFC 1QSEB 3L3KB 4DOHB 3IFOA 3OG6B 5AZEL 4FXKA 2QSQA 4LPYA 4BQ8A 3O81A 5HVGB 5IK3B 4Q6IC 5ITFB 3RGVC 1A4JA 2VDNL 2F74B 3D1MC 1XR8A 3D48R 5BMFH 4MZ3A 2X41A 5EU6B 1GL4B 4KK8C 1TVBB 3HNVH 1W72A 5CJQH 2XXMB 3WFDH 1AFVL 2ZCHH 3PHSA 2DWEB 2QJDA 1ND0B 2C1OA 1G1YA 3LKQB 4GRWB 1FRGH 1P1ZB 3IVKA 2DQCL 3G5VA 4HH8A 3GMRA 1Y6MR 2J4WH 3U36A 5B39G 5BS0B 1J7VR 4HEME 4HJGA 3SKUD 1Y0LB 1DL7L 4HUXA 3QSKB 1OF2B 1P4IH 1M1SA 3PWUA 5CP3A 1J05A 5HY9A 4NJ9H 2RCSL 4ZFFA 2A74A 2QLVB 3SJVA 2GTZA 3U83A 3Q3GA 2V2TB 4HFUH 4XNUL 3BWAA 1AO7D 2VIRB 4UV7L 3X14B 5GJTL 2D0HA 4MS8D 1E4WL 3V6ZB 1KUMA 1BQHG 3I9GL 1MJ8H 5DJZA 1DE4A 5KSAD 5EUOA 1QP1A 2VXVL 1MCPL 1OTTC 3QO1A 1MREH 2E7CA 2MHAA 4N90E 5HYQA 2AGJL 1G7IB 3ULVE 1CR9H 3W2DH 4PLKD 4FQ1H 4PV8A 4OQTL 1CTNA 4Z7NF 4QT5A 1SMOA 4XI5C 3HNSH 4POZD 3MV8E 4PJHF 4PJCE 4JFFA 4G8GE 4PIRF 3C5ZD 3PHOB 5HPOA 3VGAC 3GBMH 4NDMB 4W6WB 2PTUA 5GSVB 2H32A 5F7LB 3TNNB 3OKDB 1EV2E 1FNLA 1UEYA 1W72L 3JZ7A 1QFUL 4IDJL 2WMPA 2NY1D 1MIMH 2DD8H 5E00A 3DGCR 1JGVL 5MEOA 3QISA 1PYWB 2Z4QB 4NP4L 3MYJA 3X13B 1I7RB 5I1GH 1FBIH 3ULUH 3HNTH 4I77H 4LQFH 3BW9B 4LCWA 3QFJD 1KTDB 2UYLA 3QRGH 4MJ5A 4OLXL 3QZWG 2YEZA 2YXMA 3HPJA 4JRXB 4PRPB 5FGSA 1CGTA 1FGVL 1T2QL 5ANMA 4BSVB 2YMXL 3IU4H 1SBSH 3TIEA 4WRLA 4K8RH 5J3HD 1A6ZB 4OCSH 3N1QC 4N5EC 5FCSH 1HHHB 2A0LD 3RWFB 3VXRE 1M7XA 4Y19E 3CVHL 1TJIH 2HKFH 4I2XB 4J4PD 4WW1A 3F7YB 4JZJB 5CSZA 1G7LB 1VFOA 3TBSB 3DX7B 4FFZH 1FNGB 2R4SL 4X8JB 2FX7L 2ZOKA 3WE6B 2EDXA 4NQED 3MRGB 3M8OL 4XNQA 5D1ZC 5H2BB 5GZND 1H5BC 3BH8B 3ZE1F 1MWAH 1MCSA 5KJRH 5J6GB 2Q7NA 5HPMA 2ZOLA 2PF6A 4X98B 5FUCE 3SE4C 2AEQL 1A8JH 2VLRA 4G9FB 3SCMD 3O4OC 2RFXB 3MRLA 4G6FB 5IMOB 5IJKA 2MMXA 2WUCH 3QIWB 4R97B 3PHQB 3G6JA 3RVUD 1QQDA 3AREC 1I1YB 4N0YH 2VL5A 2EZ0C 2R4RL 5L6YL 4PJBE 5E5MA 2NY3C 3CZFA 2BRRH 3C8HA 3RIAF 3VMOA 4DQOL 3ZE0F 1G6RH 4U1LB 3STZB 1WF5A 3HLAA 1DQJA 2DOCA 2DBLL 4D9LL 1A6VH 4IOFD 4BA8A 3IDXL 5EFIA 3WUZA 2GJ6D 5BVJB 4NC1C 5IMKB 5HHOD 4C55A 3ULVD 5INCB 1BZQK 4NRXB 1M4KA 4ODWA 4YQXH 2F8VA 5MI0C 3GUTA 4S10A 4FOMA 3Q5OA 3RL2B 1X4YA 5HYFA 3K7UA 3UTPD 3LPGA 3MV8D 4GS7B 4OGAC 4CU7A 4PR5A 3V4VH 1ZWIA 1JJUA 2BSTB 3ARUA 3F12A 1EXUB 1FO0L 3SQBA 3KGRA 4M61A 5A1AA 5F7NC 2BSRB 4KROC 1JMXA 4K71B 1T1ZA 1IQDA 5DYOA 4RGOH 5GJSL 4PY8J 1PQZA 4MYWB 1YEIL 3EYSH 2FWOB 5I18H 3UTTA 2I26N 1E4JA 5EIVA 1MCWW 5F97E 3R1GH 1V7MH 2W92A 4LCUA 4S1DC 4WW2C 1J86A 3QH3B 3EGSA 5E99H 5EZJA 4WCYL 1OSPL 4DAGL 1DBJH 4AT6B 3DXAE 3D85B 3HE7C 3MGOA 4YPJA 4K2UL 4ZTOL 3MUGA 4IRSD 5DEGA 5FXCH 3RKPA 4JPIA 5TDNA 1T0NA 2NR6D 3GO1L 4NHUB 3SGDI 5DJDA 1BLNA 1RMFH 4M7ZB 4S1RH 2F19H 3WFHB 2DKMA 4JFZL 3HKFA 3UO1L 1NGWA 1T80A 3TBTA 3LD8C 3K2MC 4KUZL 5F72S 2UZIL 4AIZA 3MOAH 1RULH 2DJSA 4JM2D 3WUWG 2XFXA 4Q9CA 4LNVA 5KAQF 4F7MA 3U0WH 4HH9A 3UYRH 1FC2D 4XPBH 2VDML 5C0CE 5ICXB 4LSDA 3QO0A 4FQIL 5HGHA 5ALCL 3UX9B 4QRRB 4B41A 3DJ9A 1IEBB 3QDME 3QIBC 2ADIB 4NWTH 3QR2A 2QQKH 4X7DC 3LQAL 2DQGL 4K23L 1JUFB 1R3IL 2VQ1B 4CN6A 3TVMA 1TQCC 4B53A 5JHDB 3P0YH 4JPWL 4LGSB 1I3RB 3QNYA 5ENWA 3WS6C 4WFHE 4FFVC 2EDEA 3LQZA 2Y07L 1U9KA 2VXUH 2IPUK 3BRFA 1IGIL 3PGDB 2FX8H 1WCBA 3O9WB 4FN0A 3VA2C 1NC2A 4YHOL 1OW0C 1Q9OA 3H3PH 1FVEB 4G42A 4M93C 4TUOB 3GI8H 1LO4H 1EO8H 5JOFA 4LF3A 5F6IC 2WIIA 2I60L 2IMMA 1XR9B 3D39B 1DVFD 2DLFH 5TE4L 1X7QB 4PRHB 1VPOH 1D6VH 3MLTA 3PV7A 4C56B 1KELL 3BE1H 2BRQA 2R56H 5LWYH 4Q9BA 5DQ9A 1RHFA 1CXIA 4FG6C 5H8DA 5C2BH 3NACH 1N64L 1H3XA 1FL3A 4JO4L 1UWXK 4I18A 4AIOA 2ICWI 4HJJH 4KK8D 3SDAB 4U0RC 5HGGS 5JTWA 5I73C 2ED7A 2W0PA 4P4KB 2IANE 3X12A 4ORGA 4EKXA 4UDUB 4ZQKA 3EOTH 3QT2A 3QDGA 1B4RA 4PJ5B 4L4VA 1TZHB 4GAGL 3DXAD 4NJAH 5C0JA 4ERSL 1LNUA 1KCKA 1MRCH 5DK0B 2XXCB 2Y7QA 4XTRC 1LK3L 5LGJB 2G9HA 1VEOA 1H3WM 4Z95H 5FYJH 3R0NA 4LLDB 5C2UB 3TYFA 3OHXA 2EDLA 5I8KH 3B83A 3RTQB 4X8XA 3QP3A 1BMGA 4XPHH 3B9AA 1YA5A 3IU3B 1IEHA 2NY7H 2OXGA 2V7NB 2YD6A 1EJOL 3IJSA 3OF6A 4Y5VB 3T8XB 1OTTD 3T0EB 5T3ZL 1U36A 1RUQH 4NC1E 1F4YL 2E27H 1S7WA 3JWDL 3AGVA 3LKOB 1HILA 3GSXA 4PD4J 5JMRA 3U4BL 5C0GB 4QHMA 4NUJB 3ARFB 2HLAA 3QQ9C 3AM8A 4XI5D 4EDWH 3RIFF 2VLLA 3QDMD 3QEUA 2LU4A 3UC0H 1JPTL 2P8LA 2DWDB 3WFCL 4DCQA 1BOGA 4K3JH 4MA7H 4NZTH 5D6DA 3RU8L 4CVXB 2OL3L 3GMMB 5DUPH 4RWYH 4Y88A 3WV0A 4P3CH 2V7HA 4UI2A 2P8PA 4TNVF 3U4EB 1PW3A 4X4ZA 3WS3B 1E27B 3BP7B 4Y8AA 1MIEH 2PNDA 2CDGA 2PR4L 1GGIL 5DD3H 3AFLA 4OLZH 2QQLH 5IROA 4PBVC 3U1SH 4XC3H 4WNQB 3QNZA 4HPYH 3T3MF 4PJHA 5E56A 3ARTA 1VGEL 3MRIA 3B3IA 1DDHB 2IF7A 1MPAL 2GHWB 3P77B 4NQDE 5LXGH 1ZLSH 3T4YA 2PO6A 1YY8B 2EDWA 5I1EL 5DMIH 1EEYB