3SKNA

Crystal structure of the rl42 tcr unliganded
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
b'KEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVRAGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RL42 T cell receptor, alpha chain
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 197
sequence length 197
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA02
4XRCA 4YZFE 4JLRB 3RWJA 3QISA 3S36X 4XWGH 5HGHB 1MI5D 1I9IL 2I27N 3MRPA 3UBXA 2NZ9C 4DUXA 2XKUA 2R2EB 5HPMB 5CD3A 3ULVF 1KXVC 4K7PL 4NN6B 2WV3A 4R3SB 3RUGF 1FHGA 4XC3L 1VACA 5F89A 3TPUA 1MHPL 4OGAC 2YKLH 4QO1A 2WBJB 3EO9L 4WDIA 3RGVA 2BNRE 3AMLA 1IGJB 3DVNB 4R7DA 1NFDA 2YD4A 1DLHB 5H37G 4DFHA 1HWHB 1XAUA 4F7EA 2XRAH 5HYIA 3HZVB 1D5BB 3EJYC 5CBEA 1IM3B 4GSDL 1F90L 1KC5L 2PO6C 1HHKB 3QIUC 2BVPA 4D8PB 5IOPB 3MRQA 5T5NF 2DBLL 1P5VA 4WY7H 1Y0LB 2NTFA 2Y07H 1P69B 3IJSA 1HHIB 3D9AH 2Y6SD 4YO0A 2W9EH 3VMPA 4XTRD 3U1SL 3RX5A 1NQBA 2HFFB 1DZBA 1U58B 4HMDA 4XB7A 1OGAE 1HILB 2D7TH 4YHZH 3I85A 5JDSB 2VXUH 3KPSB 3ZYIA 5ITBH 1FDLL 4F58H 3FQNB 4S1RH 5IB3B 4OJFH 4XCCL 3BPLB 2I26N 4MD5B 1DBJL 3QUZC 4YFDB 4HV8B 3T04D 4X7SH 4JG1L 4XX1G 4PGCB 3PV7A 2D0FA 5DRXB 5IGXL 1OTUC 4H88L 1AIFA 1XIWA 3INUL 1LD9A 1IGTA 5MI0B 3ROOB 2YBRB 1DANU 4DVBA 4Q9CA 1RK0B 1T4KB 3GI9H 2YOCA 3FO2B 5E95B 4GKSA 5FO7A 3O8XB 3HNSL 4R4FL 3QUYB 1TZHA 2V2WA 5ANMA 3QG7L 1HXMA 3A0OA 2DQGH 3F62A 4X9HA 1RZKC 4OIAA 1TETL 1JUFA 2UWEA 4LAQH 2FEDC 4ZPTB 5JMOC 2C4FU 4ERSL 4HIEA 4XP1H 2AQ3A 1A3LH 4NQCB 1NAMB 4HHAA 3QCTL 2VLLA 1C7SA 1MCWW 2M2DA 4Z7UB 4WU7A 2G60H 2X7LB 5HBBA 4FTVA 2G75B 5FHBH 1RI8A 2EO9A 2NXYD 3IDYB 4HS6B 1UA6H 2A1WL 4GMSH 4U0RC 1DBBL 1FNGA 4PD4J 1QSEB 4P5MA 3NPSC 5B3JE 1BZ9B 2E7LA 4EDWL 4LKXA 1FP5A 2MCPH 5DT1L 4IOFC 2EXYD 2XZQL 1RZ8B 3C8KB 3N1MC 3T09A 3WFHB 2P8PB 3PWVB 5C08A 4R2GB 2KKQA 1ZHNB 3RVXC 2LU3A 35C8H 4Y4FD 3IDJA 3TZVD 4GBXA 4RMTA 1EMTH 3BH9B 4EN3D 5HYQB 1N5AB 1AD9B 4XNMB 2DDQH 1LK3L 4D0CB 1F3DJ 1T89A 2XXMB 1BGXL 1N8ZB 2OZ4A 1YMMA 3DBXB 2X4RA 1UM6L 4NFDA 3TBSB 5I74B 1BJ1J 4XZUB 2R2EA 2D7NA 2CKNA 2GITA 4JDTH 4Z7WB 3QXWA 3C5JB 3UZQA 4LCWA 1QQDA 3RQ3A 3Q2CA 1JZ4A 3FAWA 2GUOB 4G7YH 4HUVB 1N0XL 4NNXA 1NDGB 3L3HB 2J12B 3EOTL 4ZAKD 4HKJA 5E6IC 3BD4A 1RIUH 4O4YH 4OCSL 2YA2A 4QRPA 3VFTB 5BS0D 2E9WA 2C1OB 2XXCB 5HVHC 4KHXL 4Z7QE 4ZUVB 1FL6B 1U3JA 1QZ1A 1IM9D 4GUPA 4PLOB 3BUYB 4G6MH 4AEIH 1KJ3L 2XG4A 2ZG1A 5CILH 1X7QA 3KPRD 2H26B 2J8HA 2C9AA 1I85A 4D8PA 4I3GA 5GJTH 3RZCD 1WSST 1CXHA 4O2FA 5IBLC 3ARBB 4LPYA 5EZOH 4KC3B 3CXDL 1Y0LA 4U05A 1HHIA 1MCCA 1A4KB 1BZQK 4K3DL 3LIZL 1Q0XH 5SWSE 3IDXH 1HILA 2ZSWA 1MF2L 5I8KH 4XP4L 5BO1L 4FNLH 4P5KA 4X99B 2GJ6D 3S5LB 4JFFD 1GPOL 1IAOA 2L0DA 4RGOH 5F96L 5JPNA 3KLHC 3OKDA 1NGPH 1T5WA 2FO4A 1FO0L 4DTGL 4HV8A 4Y4KA 4IS6B 4N1HB 3T8XB 4NZDA 1W0VB 5DRXA 2OL3L 5D96B 3UPCA 1MIMH 2IAMC 1JZ6A 1JTTA 2CQVA 2X9YA 2YBRA 5GSRA 1T4KA 3P0GB 3FO2A 4D9QD 2NYYC 1GCFA 4E9LA 4XNUL 3TYGL 3QUYA 3UTTD 1JF1B 1HHGB 5I75B 3BDBA 3U79A 4NOBA 2I5YH 3NGBB 1VKXB 5DMKA 4FQXC 3TVMB 2W9LA 4Z76A 3OGCB 5JXAH 4KROB 3V6OE 4ZPTA 1FE8H 1CFQB 4X0KB 3IDNB 5DQ9B 2FX7H 1NAMA 3C60D 3HNVH 5CJXC 2ARJQ 4IRSC 1B9ZA 4X6BB 5DJZB 4L8CB 4Z7UA 5D1QD 2LU7A 2IGFL 2PYFA 1U8OB 5J1SC 2X05A 1WUNT 2O5YH 3QO1B 2VQ1B 3SCMA 4AT6B 3N9GL 1KV3A 3BZEB 3TBWB 2VMFA 4JRYA 4HS6A 3W0WE 1AY1L 4UIKL 3VGEA 1UKQA 1YDPB 5JLZB 5J1TC 4BZ1L 1WK0A 1BZ9A 4KUZH 1UWGL 5KSBB 3C5ZC 3CLFL 3LQAH 4QNPF 4Y4HB 3GSXA 2IALA 2P8PA 3OJVC 3EOAA 3V8OA 1IGYA 1HHHB 4M48H 4N5ED 1RIVL 4BSVB 2XT1B 4ZTOL 2NTSP 4G8FB 3CX5K 4WUUA 3BH9A 3WXVH 5HYQA 1OARL 1WWBX 5A40E 4XVJH 5LGJA 4XNMA 4OQTA 3JWOL 1JPTL 1JZ8A 1M71B 3KPPB 4Z5RA 4D0CA 2Z92B 1FIEA 5F9AC 1N8ZA 3T0XA 3T77B 5K59E 4EXKA 3VFVB 4LPTA 3WFZA 4MNHA 2V5YA 3R1GH 1CU4H 3MV11 3S36H 4LCCB 4P2QD 3LSOA 4JR9H 4X98B 2MQ0A 4Z7WA 3C5JA 4Q9QL 3ARYA 2YC1B 3HMXA 2AEPL 4HUVA 3L3HA 2IPKB 3SOBL 3VFTA 1IZJA 4NZRH 2FWOB 3L5XH 1DLFL 1KEML 1U0QA 2D7OA 4ZUVA 2FZ3A 4N1EA 3NVQA 3BUYA 4KMLB 3WL9A 1A9BB 5TPWH 5JXEA 5JZ7D 1CFSA 4OZFB 5DTFA 4HG4K 3DIFB 1G7IB 3L95B 3VXMD 1FCCA 2Y06H 4CVZB 3ARVA 3LVEA 4OF0A 3EO1A 5IM7B 2VE6B 12E8H 1FORL 1MCQA 5EOQL 5KOVC 3PQYB 5C0CB 3BE1L 5CJ5A 3STBA 2F74B 4PUBL 5CZKA 3RGVC 3S5LA 4B0MM 4MWFA 5C3LD 2DLGA 5KSVB 3AM8A 3ARED 1P7QD 4BZYA 4HXBL 5CZXC 4KI5D 2ZSVB 1K2DB 3CVIL 2PYEB 4ISVA 1D6VH 5SX5H 5CZVL 2AJSH 1M7DB 1UWEH 3BKJL 1A7BA 3Q5YA 3QFJD 1B0WA 4U1JB 5IB5B 3KXFD 4HJGB 3RKDD 3WHXB 3AXLA 3G6JB 4PP2B 2MJWA 3ARDD 4PRID 3NCFB 4I77H 4Z7VB 3WXWH 3NPZB 3TO2B 2X89D 3TVMA 4M1CD 4UV7L 3MRNB 1DUYB 4X9FA 1CFQA 4X0KA 3IDNA 5IFHL 4LASL 1AXTL 4TSAH 1GGBH 3ILQD 3D85A 2VXSL 5DJZA 3MLYH 3D69A 5EU4A 2UZYB 3VFRB 3QAZC 1U8OA 5IQ9A 1K4CB 3UTSD 3QHFL 4X6DF 5EC1B 3RA7H 3V4UL 3QO1A 1HOCB 3PG2A 1T80A 4AT6A 1NLDL 1X5FA 4RGNE 1XIWC 4IOIB 3KHQA 2NY2D 4O58H 1YDPA 3RGHA 3FQTB 3OBAA 2CMRH 5KAQG 4NRYB 2XQYG 4AENB 4JO4H 1F8TH 4J3TA 1KTLB 4P5TD 3WJLC 1KPRB 3ROLB 4U1NB 1TPXB 3FRUB 4G9DA 1UACH 1RD6A 1UG9A 3VI4F 3HE6A 4P46A 1HHHA 1JV5B 5HYJE 4BSVA 1EDQA 3KAAA 5FKAA 2K1MA 2P45B 1JFQH 5E2WH 5FAAA 4K3JH 3E8UH 1Q9OB 4XBEH 4DJMA 1WEJH 2IH3B 3DETD 3GI8L 2OSLA 4Y16C 2AJZB 4G6FB 4U31A 2Z92A 3OKKB 1OAKH 3FONB 3T77A 3IXAB 4IRJD 2AI0L 3VFVA 4X5WA 4OUUA 5JW3H 2E7LC 3ZHDA 1NKOA 4PLKD 2DL2A 4LCCA 4PJIB 4X98A 4KKCD 4UBDD 5D5MF 3RWIB 2R0WH 5KS9B 4D9RE 4GBXC 2MMXA 2FD6L 3P0VL 5DZNA 2FJHB 1FN4A 2FWOA 4NKOB 3VXSE 2AEIT 1BQLH 3SDXF 2AV1B 3LQZB 4PYGA 3VXRD 1U6AH 2BVYA 3TCLB 4J4PA 1BQSA 1UVQA 1T89C 3DIFA 4GAGL 1OGTB 3GJEA 2FX8L 2CK0L 2F5AL 4KRMB 3KR3H 3H7BB 1R6VA 2VO5A 3EYFB 1NCDH 2BDNH 5L9DL 5LCVH 1T1WB 1A1OB 3PQYA 5FF6B 1G7HB 5C0CA 4WI5A 1ZE3C 2OCFD 2F74A 3CK0H 1IAKB 1B88A 4XVUC 4NO0A 3Q3GB 3LKSB 5KSVA 2Q76A 2ZSVA 1K2DA 4TTDD 3MOQA 3DROB 3CFEA 1C12B 1VERA 2F53E 3U0PB 5FHAH 3U0TB 3QCVH 1I85C 2GFBB 4LSVH 5L88H 1KB5B 1T5XB 1BBJB 3PWNB 2VR4A 5EU6E 4U1JA 3GMMB 3PJSA 5IB5A 2EE9A 2B2XH 4PP2A 2AJVL 3R06A 1AC6A 3CVHL 3L1OL 5DQJB 2K9UA 4JFPA 2X9XA 4A6YL 2Y36L 1MAKA 1YECL 4LHUB 4XP6H 4M43L 3MRNA 4XMKH 4WGWB 4M9PA 4JM4L 2D9QB 3LD8B 5F6HI 1T66C 1DQMH 1BBDH 1LNUA 3BPLC 3WNLA 4KDTA 4JDZB 3QEGH 2VC2H 3O2VL 3VFRA 1UCBH 5A2FA 2CRMA 1K4CA 4Y4KC 1WQVT 5EC1A 1AGBB 5E2TH 2PXYA 1FFOB 3DI3B 1J10A 1C5CH 5MI0C 4YK4B 3BJ91 3QYCA 1BFVL 3FQTA 1A2YB 3N06B 1T7YA 1EVTC 2OI9B 3QUYC 4OF6A 1MCLA 1QVOB 1QBLH 2NY3D 3O3BA 3SPVA 4ZO9A 5BJTB 2HRPL 3DXAB 3FRUA 2IANB 4ZS7L 3G9VA 1LO4L 1SYVB 3VGBA 3F7RA 1JGLH 1YEIH 5ID0B 4XCFL 5HDQH 5E9DB 4XMPH 5D9SA 3U36A 4LLYB 4TSCL 3IKCB 4MXVE 3MRLA 3KYAA 3HKFA 1JWMA 3LB6D 1RUPH 3JXAA 4UV4L 5EA0H 3SCMC 2BRRL 1GAFL 2FJFA 5I1EL 5L7XH 3IDYC 4H5SB 3MCLH 3OKKA 5SV3A 1YPZA 1M6OB 5EBMA 4HSQA 5F21B 1A7PL 3BOVA 2J5LC 5D7IF 3L9RB 4PLJC 2IADB 2B20A 3NFNA 1T7VA 5SWSD 3RWIA 4KFZC 4S0SD 4R2GC 4WW2F 3ULUC 1YEEL 5F97E 3HUJF 5KS9A 1B2WL 5F8RC 3X3FL 3MBEB 3F5WB 4M5YH 1YEHL 2ATPB 3HFML 2AV1A 3LQZA 1RJLB 4G7VH 4OZHF 3TCLA 4KXZI 3PP4L 3I6LE 3TT3H 3QH3B 3GMLB 3DX6A 3I6KB 5I1IH 3BN9D 3DX7B 5E8NB 4J8RB 1JHKH 3O2DH 3UJIL 3H7BA 1FVDA 4NZUH 5GGSB 4GXUM 4LGPB 2X44D 4YZFF 2R4RL 2N56A 1KIPA 4BSJA 1A1OA 3Q1SL 1N3NA 2DI7A 3MV9B 5FYKH 4FQQA 5FF6A 1BX2A 4JG0L 3VI3F 2VDMH 2MNUA 4Y5YB 4BA8A 1K4DA 1TJIH 4IIQB 4LLVB 2HFGH 4EQ2A 3Q3GA 1ACZA 1G7LB 5EBGA 3FN0H 3JV5A 4GQ9L 5E8EA 4PD4K 2GEEA 1IFHL 5JORB 3QPQC 4LSRH 5JXEC 1KIUA 4I3SL 1YQVH 1OB1A 5I8EB 1BBJA 3CSPA 3ARBC 4WTWA 3W0WD 4KQ4H 3GMMA 5F9OL 1FVEB 1BEYL 2DMKA 5DQJA 2E7HA 5JDJA 3TWCH 1KENL 4XBPB 3QB7C 1KIQB 1YUHB 1J11A 1G1CA 1EGJL 4JM2B 1KG0A 4HAGA 1LE5B 1QNZH 4NGHL 5E8PB 4PB9L 5BOZG 3AM8C 3OV6A 4UOJA 2VLRB 3K8KA 5C0RL 1MAJA 4FXKA 4JDZA 4TVPD 3M17A 1XGUA 2VH5L 4PJEE 1F3JA 1AGBA 5I66A 5LJYH 1IT9L 5D96C 2MTPA 2ORBH 1FFQA 1GH7A 3PDDA 4J1UB 1QRNE 1A2YA 4W6YB 4QRTB 3AY4C 5JQHC 2AERT 3C8DA 4TUJB 1JRHL 3REVB 3K8MA 5A2IH 1C5BL 4PRBB 4W6WB 5IB2A 3H3BC 1D7FA 3ZYZA 2VLJB 3NGBC 2VDRL 2DM4A 4Z0BL 3TVMC 3FT3B 1T20B 2IANA 3DX9B 1IAMA 4KROC 1MH5B 2XZCH 1WIUA 4CU8A 4O5LL 2V9TA 3MRBB 5H35B 4ACPA 3DSFH 5DRWB 3BKCH 5DJDB 3CH8A 4HULB 4EI6B 3JV4B 3HG1E 5L8JB 4ZQKB 4OD1H 2V5RA 1JZ5A 4MMZC 4C58B 2R9HC 3ZMRA 3OTTA 2AK1L 2EIEA 3BIAX 2AGJL 4H5SA 1KPVB 3EO0B 4PR5B 1M6OA 3NTCH 1W2KT 3ARGD 5BVPL 1CLZL 2YWZA 2BSRB 3QDAA 1OL0A 4K7PY 4WWID 5F1NA 5B21A 2IADA 4LVEA 2VISB 3QDGB 4MD0B 4U1SB 3HPJB 2DLTA 2HLFC 5C07E 4ZMAT 2ICWI 4GLRI 4P46C 2B1AL 3MRMB 4UT7H 1NFIA 4WUKH 1EEZA 4M6NH 4YDLB 5C0IA 3PXJA 1SVZA 1U2HA 1E6OH 3OZ9L 2APWA 1FRGL 3QFDB 3G5VB 3BH8B 1GZPB 1RJLA 4NRXB 5D70L 4OUOA 2H2SD 4YAQB 3P0YH 3QH3A 4UUJA 3MRHA 5E1HB 3I6KA 1QA9A 4J8RA 5FGCE 4GXUN 1I3GL 5IHUL 4XCEB 5GGSA 5GGSY 3MLWH 5DURD 5HHQA 4LCCC 1J0JA 3O6FB 1EEUA 3MV9A 4BFGA 2NY1D 2P7TB 3VW3H 4Z7OF 4NUGH 2NXZC 2YPLE 3BMVA 3RNQA 1OWRM 4N0CC 3LZFL 2VAJA 4QY8B 4C59B 1XH3B 4DAGL 1LP9E 4FFVC 1FO0B 1V7ML 2VDLH 3O3AB 2OJEB 4D0BB 4J4PC 4ORZC 5I73B 3NH7L 2OL3B 2VN4A 4ZG1A 4PY7B 3HPLA 3B2VH 1NBYB 1M05B 4DVRH 1TMCB 4RGND 3OKLB 4R26L 5J8OA 4ONGL 5F7MC 2O5XL 3RWHB 3WN5A 4HMCA 2W0FB 4Z7QF 1U36A 3UCRA 3MXWL 5HHOB 4PJXB 3CU7A 3TBVB 4WFGE 5KAQF 5IESL 1JRHI 2YEZB 3U7YH 4JM2A 4YDIH 3JV0A 4NHCH 5ADPH 4WENB 5J11B 5BRZE 1U8IB 5HYJD 1DDHB 3RU8H 4FFZH 1GIGL 5JO5A 1E27B 1ZLUH 4P9MH 5ESAB 5EO0B 1IQDB 2A9NL 3S97C 1CN4A 1KGCE 4NIKB 1RURL 1AXSB 3BISA 3UO1H 4G9FA 1VB9A 2C3HA 5KZCD 1KB9J 1ZGLM 4N0UB 4Z95L 2X4OB 4C54A 2EIBA 2JF1A 4QRTA 4MDIB 4BYHA 1U8QB 4TUJA 1DQLL 1A6AB 3REVA 2AXHA 1MRFH 3O6KL 3I02B 3FZUC 4RFEB 1YNKH 5HDOA 2BERA 4Y88A 2VLJA 5E2UH 1RJYA 3DARA 3OKMA 3FT3A 1N4XH 1KUMA 5E5UB 1MH5A 5D72H 5EB9A 3SJVE 3RFZC 4R8WL 1OAUL 3F6IA 1S9WA 5E08H 2DKUA 3OAYK 3MRBA 4K2UL 3VGGA 3A6OA 1B4JL 1E6JH 3C08L 3FB6B 4YUEH 4D9RD 4QWWD 3JV4A 4YDJA 1HDMB 4KDTC 4GS7B 4PJAE 5C09D 2LTQC 4ZQKA 3VWJA 3WLWD 2JE8A 2PETA 5F1OB 2PXYC 5TE4H 3GO1L 4L3EE 2EYRA 4PRNB 2AK4E 3FO0L 3G5XA 3FFDB 4JVUA 1ZS8A 1KPVA 3U82B 2YWYA 2DM7A 1Z6JT 1M7IB 3G5YA 4ZTPH 2ARWA 2XKNB 3BDYH 1XF4A 2YZ8A 1MHEA 4HD9A 4R4BA 5DWUL 1J5OL 4YGVA 3ZSSA 3AS0A 4BQBA 3OSKA 4MD0A 2FHCA 1FQ9C 4NBYB 4U1SA 3HPJA 1OP3K 1BM3H 3MV8E 1W0WB 2QLVB 3MRMA 3PWJA 1CGUA 1R5WB 1U8NA 1Z5LB 3NA4A 1BQHB 2B4CC 1Q72L 3N85H 3IFNH 1U42A 2YPKA 5C0NC 4KJWD 4FXLA 1I8KB 4NRXA 4PRHE 4YHML 4MXWL 2QR0A 4HZLB 3LKPB 1TITA 1IEBA 3QEHA 1FBIH 2NNAB 2EXWD 3NMEA 5J13B 5I1HL 1TJHL 3I3EA 4OLVH 5JHDE 5FUOH 1MCKA 5EU3B 5EU6D 5EULV 3O9WD 4XCEA 1GHFL 2G2RA 4OB5H 1G1YA 3WFBL 3O6FA 4OM1H 1NEZB 1WAAE 1RIHL 4K71B 5EUOB 4Y7MA 2R69L 1AO7D 3WDIA 2P7TA 4TNVF 4GG6F 5K59F 4N9OB 2QQLH 4MS8D 4QY8A 4ZUSB 1U95B 4LMQI 4E0RB 2P8LB 3RWDB 4XNQB 1YYMH 4ELMB 1XCTB 3OAZH 5TF1H 4BFIA 2ZUYA 4O00A 1I7ZB 1MNUL 2A73B 4K7PX 4L4TE 3VRIB 5GS0D 3EOBA 4F37K 4D0DB 3RI5F 3IAQA 2NX5B 5E6ZA 1FIGH 1W8NA 1WFOA 1DEEA 2QADD 1WJ3A 3NZHL 5C0BE 4PJDF 1K8DB 4WJ5B 4V2CB 2DQTH 3TBVA 5SX4H 1S9VA 2IMMA 2YEZA 2M8XA 2XWTA 5MEQA 3ZHKA 2APFA 1OAQH 2XQBL 3IJYA 1U8IA 5EC2B 5JPMB 1DDHA 1CI5A 3RVVC 4D94A 1MCPL 1RUAH 3MJ8B 5FUZH 1Z3GH 3BWUC 3BAEH 1E27A 2ICCA 2IH1B 2NY5C 4MDJB 2YD7A 1UB6B 4KGLA 5EO0A 5GHWL 3SGJC 3RHWK 2P5EB 5IFJB 4KUCD 4OZFH 2V5TA 4MYWB 1CE1L 4OCLC 3GIZL 5KVDH 4AIOA 2HLAB 3MOAH 2EH8L 4HC1L 2NPLX 5DMJB 3QBTB 4YHKL 3V6ZA 5MP6L 3O41A 4MDIA 5DEFA 3CMOH 1A6AA 1Q0YH 4UAOB 4LPVA 1U3HA 5KJRH 1ZAGA 4CVXA 4JO1L 2P42B 3GMQB 4NZTH 3P30L 2WUBH 5L6YH 3QO0A 3QQNA 3B3IB 3ZO0A 4DN3L 2V7NB 3LD8C 4NM4H 4OM0L 3WNKA 3V4VH 4QXUL 5GGUB 1WZMA 5T1DL 1HDMA 4UINH 3FFCB 4QRRA 5IW6B 1T3FB 5E99L 1WICA 4KWUA 4XMLL 3HZKB 2B1HH 5GISL 2PTTB 4PRNA 2EECA 15C8H 3THML 1KJ2A 4YK4C 1KFAL 4DGVH 1DL7H 1QTYT 4LLQA 4MNQA 3HI5L 2ZUWA 2IEPA 4PJHA 4K55A 1ACYH 4LDOB 4XNYL 1CF8H 2XKNA 4YBLB 4O2EB 2VDNH 4G42B 4RMSA 1BVKA 5BOPA 2UY6A 3GK8L 4MNGB 1A7OH 4V1DA 5MENE 3C09B 5J0BA 4WHYH 1W0WA 2YD9A 1DVFB 1R5WA 4FQ2L 1YEJL 1Z5LA 4P2OA 3X14B 3C2AL 5I9QC 4XNXH 2Z4QB 1F6FB 2XTJD 1NJ9A 1NBQA 1LO0L 4P3DB 1YC8A 1JGUH 5IB1A 1BECA 1ZMYA 3MOBH 5LQBL 1OSPL 3LKPA 5GIRA 1BLNA 2DQEL 3WFEH 5JQ6H 4LLWA 3NCYP 1L0QA 1F6AB 1EERB 4HLZH 2WSKA 1M4KA 1Y6KR 4H0GA 1A6TB 4JN2A 4X7CC 4QHKJ 4I1NB 1ZVYA 4HWNA 2D0GA 3MBEC 1I1AB 1NBVH 2P8LA 3RWDA 4ODTH 2WMPA 2LVCA 5FFLA 1HNFA 5FYLH 5D7SH 2ADFH 4HIXL 5EOTB 2D7PA 1PSKH 4PJCF 3S34L 3VRIA 3S7GA 3HI1B 3MRJA 2XWJB 4D0DA 1BFSA 3LRHA 3OKNB 1RVFL 2DQUH 4FABH 1QRND 5ESQB 1M7XA 3PP3K 4D9LL 5DRZA 3WIFA 1UJ3A 3CVHB 5IP4A 4X9BA 3FOLB 2IBZX 4WGVB 4A6YB 1K8DA 3KYMB 2X4SB 2JJSA 4LF3B 1TVHB 4YGAB 4KK9D 2X1OA 4XPGH 1U8LB 1HK6A 2DJ4A 1VPOL 2Y72A 4XI5C 3MJ8A 1UADC 3HG1D 1A3RH 1Q38A 3D25B 3L3JA 1F11B 4PJFA 4GRWB 1NUGA 4RBPH 1QBMH 5DEGB 1EA9C 1R3KA 2JELL 1OVZA 1FC1A 4DW2L 2YUZA 2WWMD 3WN5C 3I3DA 1KN2H 2HG5B 2E7MA 1ZT4B 3ESVF 1KCRH 5T1KD 1U92B 4FN0A 3GMQA 3W2DL 1IL1B 3RL2B 3DWTA 4JM2C 1OD9A 3B3IA 3RIFK 5AG8A 1HN1A 2DOCA 2AJ3A 5CGYD 5C07D 3WKNA 5T3ZE 2H1PH 4ZUWA 5CEZE 3PNWB 3EJZC 4UTBH 4BQ9A 5GGUA 4I2XE 1EFXB 4F7PB 1H15B 2WANA 1G6VK 5IW6A 2NY5H 3FL7A 3QRGL 5D7LD 2APVA 3HZKA 2VWEC 2PTTA 4M03A 4MCZB 1DFBH 5IF0B 1JZ7A 1OLLA 4K23H 1KB5H 5I2IA 1GJIA 3GUTB 4RCAA 4KVCH 1KNOA 2CD0A 4PG2C 3LV3B 1FV1B 1I4FB 5KTEH 3AU1B 1EBAA 2NQCA 4LEOA 4C56E 1AR2A 2CDGB 5GGQL 5ISZA 3X11B 4NPYA 4RZCA 2F54B 4CRPA 4Q7DA 1DVFA 4QT5B 4OIBA 3FRPA 1CDBA 3ARWA 5TE7H 4LQ1A 2DQJH 2NY4C 3QIWB 1IQWL 5JHLL 4AZ8A 5C7XH 2UUDK 1MREL 2VDPL 1H8NA 4L1HA 3VWJC 5I1KL 2P8MB 4Y19E 4ZUTB 5HHPA 1Q9KB 3JUYA 1J8HB 3AVEA 5F7EL 3CFDA 2OTUB 4JDVB 1GSMA 4FHBD 4M7ZB 4ODVL 4ZYKB 4BSWB 1V05A 3H9SA 1DSFH 3U4EB 3PV6B 1KELL 4MXVF 1KCUH 1ES0A 1MQKH 4JHWH 2ICWB 2P5WA 5H2BA 5MHSE 2F5BL 2F19L 4WFGD 2NY6B 1OPGL 1VEOA 2X1QA 3F7VB 2JB6B 5DRNB 4YDLC 5DZOA 5FM5M 5IVZB 2CDFB 2R0ZL 1I1AA 2VITB 5BRZD 4KJQD 4U7KA 1ZHKA 3EYOB 1AGFA 3X12B 5EOTA 1A1MA 3V5HB 3L7FB 4M8QB 4J3OC 3HI1A 2XWJA 1I9IH 1J86A 1PZ5A 4WFHE 4NO3B 2J88L 4FFWC 4NO2B 2PCPB 1JMZA 3OWEA 5CMAA 4WI6A 4K7PH 3SO3C 3O6FC 5EIIB 1CGXA 4DZ8A 3AGVA 3KYMA 1TVDA 4XC3H 1N64L 4LF3A 1TVHA 1Y6NR 1MHPH 3BGFB 3EO9H 2HT4C 1U8LA 4M6ML 5C9JB 4Q9BA 3VFWA 5T3XE 4DZBB 3LRSA 4GSDH 4QOKB 5LAXB 3O4LB 1VFOA 1F90H 1KC5H 1OP9A 4L3ED 1CXEA 4YR6B 2AK4D 2CH8A 3RX8A 1V7NL 2DBLH 4F33B 4NKIL 1A4JA 3AUVA 1J1XL 4G5ZL 4G43B 4NDMB 1MHHB 2HG5A 1ZT4A 3U1SH 5HD8D 4UQ3A 1IL1A 1G9ML 1HQRB 3D2UA 1W8OA 2H45A 3MV8D 1FDLH 5J11C 5SWQB 1MCNA 4JVPA 1BIIB 1BVZA 4XCCH 3A6BL 2EDXA 1DBJH 1H15A 3GMRB 3ZZ1A 3QI9D 4URTB 5CD5D 4Z8FL 4JG1H 4G8GE 4LPCA 3JWDC 5DUBA 5ESVB 5B22A 4PRHD 5IGXH 4JFDE 3CLEL 1WCBA 5HHNA 3B8YA 5IF0A 4H88H 2RFXB 3I50L 3INUH 4JKLA 3LMJL 3GUTA 1QR4A 1UC6A 1EX0A 2QSCL 2KZ1B 3HNSH 4R4FH 3RDTD 3QG7H 2VR5A 1U3HC 5I16A 4S10A 2X4PB 1I4FA 5HHME 3AU1A 4PJ7E 2CDGA 1TETH 3X11A 1CICB 3GGWB 3T65B 2F54A 4ERSH 1XR9B 4MJIE 1QSFB 3B5TA 4MA1B 4HJ0D 5ITBL 1ZLSL 5D2LB 3QCTH 3QIWA 3UTPE 4NQDA 1SMAA 5LGHL 4GS7C 4JFEB 4MCYB 4A2MA 2P8MA 4X4ZA 1X9QA 5FB8A 1IEAB 1Q1JH 1DBML 4Y0GA 2Z31A 5HHVL 1J8HA 3NN8B 1A1NB 4UNTA 2OTUA 4JDVA 1C5DB 3FMGL 4M1GL 5EOCL 2A1WH 1FZMB 1RJZB 4ZYKA 1NLBL 4BSWA 1EO8L 1B0GA 1I3VA 1AC0A 1DBBH 3GRWA 32C2A 1ZKAA 4PJ5E 3VJ6B 4WHYG 2FSEA 5MERB 3WNOA 2OLDA 2ZCKL 5DT1H 3QXUA 2HWZL 2XZQH 3VXOB 3GSQB 4PBXA 2BSED 1MI5B 3F7VA 3SGDI 1YY9D 3LS4L 5DRNA 4P2OC 2CDFA 2VITA 3KPMA 3MJ9L 1K3IA 1KB9K 5E94B 1RZGA 3EYOA 4OBSA 4YPJA 1R5IB 1GOHA 5BMFH 1RY7B 3L7FA 3D39B 2C26A 3FJTA 1LK3H 2GIYA 3G5ZB 4HLZG 1BGXH 4FXGA 1UM6H 4HKXB 5JNYA 2FLBT 5FYJU 5IG7A 1QO3B 5F6IB 2BOBB 2J4WL 4RIRB 2PCPA 1HEZA 3FB5B 3ARFA 4X6CB 4K71C 4JKKA 5C86A 3SEPA 3S35L 5GRWA 2W0KA 4EUPB 4LL9A 1EGJA 1N0XH 5HI4D 3EOTH 5EWIL 3LKNB 1XZ0B 4OCSH 5C9JA 4KHXH 2DWDB 9CGTA 1W72L 1KJ3H 2ADIB 3KJ4B 2AKRA 3NOIA 3QZWG 4M9OA 1OHQA 4F9PA 3ETBF 2R23A 5D1ZD 3GHEL 4P3CL 3CXDH 4XNZB 5B39B 5C0AA 1EAPB 2H2PD 3V4PL 3G08B 4NDMA 2OMNA 4K3DH 3H0TB 5IMKA 3HC3L 4X4ME 3LIZH 3ZTNL 1FVCA 2IWGA 2GY7B 4CUCA 4OCNC 1F45A 1HQRA 5KANI 1MF2H 4XP4H 5BO1H 5MEND 5C70A 3O9WA 4HKBB 1GPOH 3IFLL 5F96H 4PGBB 3VG9C 2PW2B 3GMRA 1FO0H 2NY0D 1AO7A 2GJZB 4DTGH 1HSBA 3WLBB 1DQDL 5C71A 4NZJA 4KTYA 2OL3H 5HI3D 1KULA 1AKJD 1UFUA 3QCUL 4KZDL 4L8DB 3KGRA 5DDHB 3QIBB 1XFPA 5GJTL 2WLYA 5IEHB 4PV8B 5CEYB 1S7XB 4XNUH 3TYGH 4ENED 3TJHC 5FCUL 1DUZB 4OZGB 1BD2B 2X4PA 1F4XL 3H8NA 2XN9E 3WS3B 2JCCB 1BZ7B 5IW3A 1XGTB 2XY2A 4YC2B 5GQBA 1CICA 3GGWA 3EYQD 3T65A 1XR9A 3SE4A 1T7WA 4X6EB 3EAKA 5IMMA 4XXCA 4JFEA 4MXQC 4J7RA 2BP3A 1IEAA 1AGCA 3N9GH 4HX1A 5FDWA 3ARUA 3NN8A 1WV7T 3HI6L 5GRYA 1AY1H 2LE9A 3MJ7A 1RJZA 4LHUG 4UIKH 4X80L 3SGKA 1QUNA 4Y4FB 3VJ6A 4C83A 5MERA 3GMOB 1UWGH 2DM3A 4OTXL 5FDYA 2RCSL 3CLFH 4ODHH 1WWCA 2OMBA 5C0GA 3L3GB 2OXHA 3T0EB 4OKVA 3C09C 1NGZA 4JRXA 3KYNB 1MJUH 2L7UA 5IVXE 1DVFC 5JW4R 1RIVH 4ZTOH 4P57B 5M95B 3HNVL 4J12A 1EFQA 4FG6D 1MWAL 1OARH 5IFAL 1BFTA 3JWOH 1JPTH 4EDXA 1WTLA 3D39A 3HRZB 5FO9A 5HHXL 3G5ZA 3ELAT 4P2RE 4ZAKB 4GW1A 1KTRL 3W9EB 1QO3A 5CUSL 5BS0B 4ORGA 3ZKMD 4RIRA 2DQHL 1IC7L 1PKQB 1UB5B 2ZKHL 4NWTL 2EEDA 5DVMA 2CR6A 1IGCL 3OXRA 4Q9QH 4ZFOL 1OF2A 3KPRB 3ZT5A 2AEPH 2OK0L 2DS4A 1LO3L 1RHHB 3MUY1 3LKNA 1I1AC 2G5RA 3SOBH 2Y1VA 2ADJA 1BF8A 2WZPD 5CEZD 4QHLA 3M8OL 1DLFH 1KEMH 3M1BB 5FOBA 2VZ3A 2WIIB 2DWDA 3ALPA 4Y5XA 2ADIA 3BD3A 4UDUA 1FG2A 1FSKB 3ARRA 3BQUB 5I18L 2GJ6B 2GI7A 3B9KD 4L3CA 4DKEL 3IETA 1EAPA 2WQRA 2D2OA 1FORH 2J7LA 5DHXB 5EOQH 3H0TA 2C7UB 2DAVA 1WT5A 3BE1H 2DF3A 3ZE2F 3ULSA 4DKDC 4PUBH 4Q2ZA 1ETZB 2KQNA 3W9DB 2BVOA 3MRKB 5D5MB 4HKBA 3VRJB 2FIKB 3QJFA 4PGBA 5IUSA 4HXBH 2X1WL 5DFTA 3CVIH 1CGTA 3UTTB 3WLBA 3WFDL 5CZVH 1EO7A 3VDBA 1QSVA 2RIKA 5IR1B 3WO3B 3B2UC 1ZA6B 3BKJH 3SGEI 3RWEB 3QIBA 4H8WC 3OAYH 5B4MC 3QWRD 5IEHA 3C60B 1RQ5A 4PV8A 4ODUB 1QFUL 1S7XA 4YPGB 5D1QB 3OJMB 4YHNA 5ID1B 1NFDE 1BD2A 2BOCB 4DN4L 4HZAA 3X3GL 1NCUA 4U1MB 3ULVC 1BZ7A 4UV7H 1XGTA 3MLTA 4Y1AB 4WW1B 1EJOL 2VIRA 4LASH 4YFLI 5IFHH 1AXTH 4Y5VB 5CGMA 5GS2H 5MEOB 3PDGA 2VXSH 3U9UB 2F8XC 3QNZB 1II4E 3QNXA 2C3XA 5K9JL 2E27L 1G7JB 3QHFH 3S96A 3V4UH 5BZDA 2CUHA 3OKEB 5CHNB 3MA9L 4N8VA 1IGML 1NLDH 3GSWA 3NIGF 4J2XA 3BXNB 4UU9B 2I9LB 3T3PE 2KZWA 1WISA 3STZB 1L6XA 3STLB 4WFHD 3QDMD 5C0JA 5KSBF 2AJYL 3MR9B 3VWKA 3ZDXE 4IEFB 4F9LA 3MRIA 4RX4A 5FYJE 3T0EA 1CE6B 2A2QT 1QFWM 3SE9L 1XMWA 1T1ZB 4HGMA 4P57A 3QIWC 1HH6B 1UKTA 4UDTA 4D2NA 1I9JL 1VSCA 5CJ8A 1NFKA 5TDPA 2CRIA 4NNPL 2NZ9D 5T3XD 1NBZB 4P2QB 4OCRH 3GI8H 2Z31C 4XAKE 4E41B 3JV6B 4EKXA 3HRZA 3WNMA 3MLZL 4X6DA 4S11A 3RVTC 1H5BB 3FCTA 2AI0H 1A14L 3L3KB 4OGAD 1JYWA 2C5DC 2A6DB 3UJJL 3MUGB 1UWXK 1NGWB 4PRPB 5IKCB 2DKMA 4I18A 1UB5A 4YXHL 3SDAA 1DANT 4LDEB 4FTVE 3RAJL 3EJYD 3S4SG 3VCLB 1RHHA 2F58L 3VXMB 2R1XA 4DEPB 2VDKL 2FD6H 3P0VH 5I1AB 1ND0B 1GGTA 3QEUA 3QIUD 3GDBA 3M1BA 1SM3L 5D71L 4APQB 1AXIB 2PW1B 1DBKL 3VGHA 3L5JA 4L4VD 1EK3A 5TQ2L 4G8GD 1Z9SA 4GAGH 4X4YB 3RTQA 1JZ3A 3BQUA 4WHCA 3WEXA 2FX8H 2CK0H 4QHUA 4XVTL 5C08E 4Z7NE 3AREB 1P7QB 3HCVA 1A02N 5E03A 2E3VA 3ARFC 5L9DH 1EIBA 3DMMB 1UENA 3MSPA 1T6WA 2CDEA 5HHMD 3QUZD 4KK5C 5D7IB 3W81A 5GS0L 3BGFC 4WHTB 1ETZA 1T22A 5HGDB 3W9DA 5D5MA 3VRJA 4MJID 4PRDA 1OTUD 4WW2B 4O02L 5D2NB 1YMME 3EDFA 1AQDB 3HUJB 3KNBA 4KXZH 2V7HB 4PRIB 3D0LB 3GSNA 4BK4A 3IU3A 1R3LB 3K3QA 4B53A 3SDXA 1ZA6A 3BRDA 3UYPA 3I2CL 4LCWE 2BFVL 3FQXA 5DMYA 4OSUL 4X5XB 3G6JF 2DLHA 4Z7VF 2FEDD 1MRCL 2AJVH 4IHOB 3FHQA 3CVHH 3L1OH 5ID1A 4QRPE 4OGZA 1DEDA 2XZAL 3DO3A 4A6YH 1VFMA 2Y36H 3VD4A 4WEMB 2YXMA 4MAYA 3DGGB 5F7FA 1RJCA 1Z9LA 4M43H 4Y1AA 4JM4H 4OT1L 3TGXA 3MCG1 1PG7L 2R56L 3O2VH 1L4IA 4W4OA 1IVLA 4EI5B 1G7JA 3D0VB 4GRWH 1CD0A 1A47A 1AHWB 1ADQA 3RJQB 1AI1L 3PHOA 3BXNA 4UU9A 4IOFD 3BKML 3STZA 1BFVH 3TH2T 2BNRB 1J9CT 2UZXB 4DFIA 1G6RL 3RVXD 3BP5B 3PGCA 3X13B 1BOGA 2HRPH 1AQKL 1CVRA 4K94C 1CE6A 1CICC 4ZS7H 1A9EB 1LO4H 3Q6FB 1HHJB 4MA1C 3LS5L 3JBG7 4XCFH 5EN2B 4IRJB 3SE4C 2CIIA 1HH6A 2H32B 1YN6B 2LAGB 3W5NA 2YXFA 4WFFE 3PXHA 4TSCH 4XXCC 3QUKB 5HYEA 3QDJA 1NBZA 4UV4H 4MB5A 3JV6A 4CADB 2BRRH 2VLKA 3PWPB 5EIVA 1IMHC 1MCJA 1GAFH 2B5IB 5I1EH 1OGAB 4LFHD 4LEXL 4MB4A 1H5BA 1MFEL 1VFAB 3VFUA 3SGKC 5J12B 2GQHA 1A3QA 1A7PH 2A6DA 4PJIF 4LSQL 4PRPA 5EBWB 1L0XA 4LSSL 4KY1L 1I1FB 1YMHB 2JB5L 2UY7A 1YEEH 3ALWA 4KGJA 3VCLA 4NJAL 2A9ML 1B2WH 3X3FH 4KZEL 2DIBA 3D6GA 4JRYE 4JZNB 5INDB 1CGSL 1YEHH 3CFKB 3PP3H 2ITDB 4QF1A 5IBLD 3HFMH 3FT2B 4APQA 2Z9TA 2PW1A 1A6PA 4XP9L 1EEYB 2EYTA 3PP4H 5FV2A 1SBSL 5J6HB 4U6HB 2XQYK 4X4YA 5CFHA 1FZKA 4JY4A 4BELD 1G9NC 5F6IC 1OQOA 3UJIH 3VRLF 3ULUE 2ZUTA 3BZFB 4GKNB 3NZ8B 2R4RH 1BQHG 3DMMA 4GLRH 4WUUE 3Q1SH 4OLUL 2D4FA 3KLHD 4PJ9B 2XN9D 4JG0H 5D7IA 4ZO8A 2HT3C 4WHTA 5C2BL 3BZDA 3PWUA 5DSCB 1WC7B 5KG9B 1AR1C 1GGCL 4WW2A 3W5MA 2IAMD 3HUJA 4GQ9H 1ITCA 3MNVB 3N1QC 3DGCR 1IFHH 4Y5XC 4R97C 4AEHL 5BXFB 2NYYD 4ZUUB 1T21B 3HR5B 4I3SH 2GT9A 1D5ZA 2FX9L 3IFOA 4Z7WE 5DD6B 1FLRL 4OZHA 4P23A 3HB3C 2EDYA 4NRZA 4HIJB 5D7KE 4FQXD 4HFUL 4X5XA 3A6CL 4WI4A 5F9OH 3LH2L 5DI8B 1BEYH 4PIRF 1HZHL 4MJ6A 4RGMB 1L6ZA 5IIEA 2FL5B 2VRAA 3S9DB 1NCTA 4IRSD 1WT5C 1KENH 5ETUA 1QYGL 1VENA 4JZJB 3NAAL 4DUVA 4MA8L 4JQXA 3FQUB 4NGHH 4ODWA 4YQXL 4PB9H 1TQBC 5C0RH 1X5AA 2RHEA 1ZT1A 1XGQB 2VH5H 4EI5A 2Z8WC 1IT9H 1VA9A 5I15L 3QIBC 3C5ZD 4L9LB 2PF6A 4JRWA 4NBXB 5EPMB 1BJMA 5FKPA 2IMNA 4ODSL 5KN5B 4OGYL 1JRHH 4X7EC 5CP3A 1C5BH 4HGWB 1JN6B 5TFSL 1V3LA 4R0LA 1ZLVH 2VDRH 4Z0BH 5BQ7B 3RVWC 2BNUA 4YC2C 1FYTB 3QT2A 1A9EA 1KLUB 4U1HA 1HHJA 4O5LH 3MRFA 1MSPA 5HY9A 3IS1X 5IK3A 1YN6A 3CC5B 4KJYA 4G6KL 2CLRB 3OR6B 2WUCL 3QUKA 2FGWL 4EIZC 4GXVL 4I5BB 2ZNWA 1S8DB 5DYOB 4YHPA 3AMKA 2GK2A 4LK4A 4GAJL 3VGDA 4CADA 2AK1H 3PWPA 4KH2A 1RZ7L 1D6EA 2AGJH 1PDKA 1OGAA 1T7XA 5SWSB 4TNVK 1GGIH 1MAML 5C0EB 2GYSA 3QDHA 5BVPH 1ZWIB 1CLZH 3VWKC 4OFYA 4F9LC 4ALAL 4DCQB 4HK3N 5BW7C 3T0EC 1YMHA 1EPFA 3FTGA 5CSZB 2B1AH 1YEDB 1QP1A 1P4BL 5T1LA 2V2XB 1S7RA 3RI5K 4ZS6C 4F3FB 4FZ8L 3LDBB 3CFKA 4ZSOA 1WLHA 2ITDA 3FT2A 1J0YA 3OZ9H 1FRGH 1W72B 5D70H 3I75B 1EEYA 2V17L 5DO2C 5AUMA 5F1IB 2ZNXA 4Z78B 4FOMA 1KT2B 3O81A 5DJ6B 1I3GH 5IHUH 1I7TB 3RGVD 1CT8B 2IQ9L 4CMHB 3MUJA 4I18C 4MX7B 3MPCA 5EU5A 5CZXD 4Y89A 2P47B 1G7QB 5HGAB 5CKAA 5DSCA 3ET9F 1WC7A 3LZFH 1U2CA 3W0WB 2I07A 3QEQA 4LPXA 2LU4A 3U6RB 4KKAC 4DAGH 1KJMA 3MNVA 1V7MH 4JGMA 2WWKT 1Q9LB 5BXFA 3DECA 1T21A 4GJTB 4HUKB 3NH7H 3VE0B 2DIAA 5E4IA 3H42L 2IJ0C 3BQUC 4R26H 4ONGH 5E24E 4MLSA 2O5XH 3B5HA 3GHBL 4RNRB 1CXIA 5DI8A 4X7TB 1CD9B 2ZJSL 3PDOB 2FL5A 3MXWH 1MCFA 5KOMC 5JR1L 4OIIL 5IESH 1FNAA 4EUPH 5FYJD 2APTA 3BZ4B 3QXDB 1JNJA 4EVNB 3K4ZA 3EFFB 1GIGH 1XIWD 4PG9A 1JK8B 3RIAF 3WO4C 1XGQA 5F9WB 1X4XA 4WRLA 2A9NH 3BYTA 1RURH 2OBGA 1FL5B 4XAKD 5C0FA 4RAHA 3IVKA 1AGEA 3HZYA 3GKWL 4L9LA 5F3BB 2VZSA 5EUKB 4Z95H 4YX2L 3BEWB 1KF9B 5EPMA 1EH9A 1E4XL 3C60C 5BVJA 1DBAL 5KN5A 1SEBA 3RBGA 1XF2A 1KCKA 1QPPA 5F9JB 1DQLH 5KSAA 1I8MA 3HR6A 3O6KH 3E6FB 4H1LB 1A6ZA 1JN6A 1S3KL 4QRUB 4NFCA 4MAYC 3QA3B 2GTZA 3SQBA 1FYTA 4R8WH 3VD7A 4FTVD 1OAUH 2VLMD 2C3GA 4K2UH 4Y5VC 3T4YA 1B4JH 1INQB 3C08H 4JY5L 2GTWA 1MWAB 3ARGB 1LEKB 5DYOA 1S8DA 4R90L 4JFOB 2DLFL 5DQDL 3UTQB 3GO1H 3K81A 3V8CA 3FO0H 5HDBE 3KS0H 2WBKA 5FA3A 3WJJA 5HI5C 1T1XB 4NKQB 2W92A 4OLZL 5C08D 1JI1A 3IGAB 4ZPVB 5DUML 3LKQB 1J5OH 2BXYA 5SX5K 2O5ZL 4GBXD 3BPOC 2YSSA 3L3OB 4G80B 4ZFOB 2X2YA 1VADB 5CSZA 4PREB 5I1LA 2AJXL 1KLGB 1Q72H 3W11C 2R15A 2E6PA 2V5MA 1YMMD 5DURB 2WNGA 3NACL 4YHMH 4MXWH 3I75A 1BIHA 4KK8D 3RWFB 1MPAL 1T0PB 1SVCP 3HAEB 1HSAB 5F1IA 1H5BC 2A0LD 1F2XK 1YY8B 2IFFL 3TBYB 5I1HH 1TJHH 4LCWD 1FFPB 1KT2A 4WFEE 2IF7A 1H3VA 5CJQL 1I7TA 1GHFH 5J4MA 1CT8A 1H3XA 4XVUD 2X1PA 5GRUL 3WFBH 3MLXL 3VFPB 1RIHH 3BVNA 4MX7A 1V8HA 5DD1L 2X4UB 2R69H 3VFMA 3QQ3B 3TNMB 2MWCA 1XF5B 3F58L 3QDMA 4DEPC 1OY3B 3H9HA 4PRAB 3T4AB 3NIFF 5D4QA 1ZANL 2FR4B 3H9YA 3NCEB 1N59B 1YPZE 3U7WL 4APQC 3EZJB 3HTLX 1MNUH 5CSBA 4LRIC 4RWHA 5IB4B 4DK6A 2A6KB 4NN7B 2EC9U 4K9EL 5HYJB 3ZE1E 5TH2B 3MJGX 4RNRA 3ME0A 3AREC 2VABB 4X7TA 3UX9B 4PJXF 1NCBL 1E4XI 1T66D 3DMMC 3NZHH 4UT9L 4NQUA 1I9EA 5I8OL 4LCYA 4PS4L 5JW5A 4S2SB 4X9GA 4FQCL 5CEXB 1IEHA 4S1DC 2N4IA 2X41A 4Y4KD 5KZCB 2XQBH 4EVNA 3VD5A 4WW2C 2Y5TA 4GG6A 3UZVB 1LO5B 4OV5B 1MCPH 1F4WL 4WFFD 4QCIA 5GHWH 5IV2B 2J1KA 3ZKQD 3ES6B 2NW2A 2GCYA 1H9VA 2BY0A 3QUYD 5H37H 1CE1H 2PO6A 3GIZH 4PJCB 5BV7L 5F3BA 4LHJB 2P48B 4U1KB 2EH8H 4HC1H 1RPQA 5MP6H 4YHKH 3NFPB 1QACA 3IXTA 5EU7C 2PN5A 5DR5L 1CFTA 1OP5K 1KCSL 3VXSB 2A6JB 1CL7L 4JO1H 3WIHL 4YNYA 3P30H 3EKCA 4PJDA 2ATKB 1S7UB 4NHUB 2HT2C 4JQXC 2IG2L 4DN3H 3EYSL 43CAB 2OJZL 5C92A 4OM0H 3SCMD 4QXUH 1NEUA 5T1DH 4JRYD 3OMZA 4YXLL 4EI5C 4JFOA 4XMLH 3UTQA 4GW5B 4N0RA 1WF5A 1AHWC 5GISH 3THMH 1MRDL 3LRGA 1KFAH 1IKFL 4PLJD 3HI5H 3CX5J 3FQRB 1G7MB 2QTEA 4XNYH 4OD2B 5I76B 3HLAB 3K4DA 4R2GD 4HUUB 3ULUD 3TIEB 5GZNC 3CXHJ 1J88A 3MBXL 2VZ1A 1DCLA 3MROA 3OX8A 3MODL 2EDJA 3V0VB 4WUUD 3L3OA 1JNHB 3GK8H 4M7KL 2F53B 4JHZA 5K9KB 3TA3A 1E28A 3DV4A 2MQ3A 1YZZA 1KLGA 1YEJH 1O7SA 4FQ2H 3BUTA 5DK0B 3C2AH 3EBAA 4HK0A 1BFOA 2YD2A 5EU6B 5IROC 2ZOLB 2OTWB 1LO0H 1N2RA 4HWZA 2B0SL 3P77B 1GGYA 5LQBH 3RWFA 1OSPH 2GJJA 4UBDC 2HVJA 2Q20A 4WV1A 2G9HB 2VAAB 1YY8A 2IANE 2DQEH 5J12C 5DHVB 1DQJA 4ZO7A 3QXAB 3SY0B 3P4NB 5EUOF 5AYQA 3VFPA 4GRLA 3GBNH 5MEPB 1PX3A 2X4UA 1LK2B 3DUSB 3QQ3A 4NQEA 5CGTA 1XF5A 4JFFE 3RWCA 3QPQD 3K80A 3IF1A 4KKLC 4ELMF 5JXED 4OFIA 2AP2A 1FGNL 4LHQB 5DC4B 3T3MF 3BJLA 4LCUA 1JHTB 3ARBD 4HIXH 4G8EA 2QV2A 2QADB 4M3KB 3S34H 3BWAB 3AB0B 3JVGA 1YEFL 4PB0L 5L0QC 3B9DA 3G9AB 2W1NA 3S35X 1QLEL 3EDJA 1FH5L 1QFOA 1NC2B 5TE6L 2A6KA 2E7BA 2HJLB 1K3ZA 1RVFH 4KMQA 5T3ZL 2BHUA 1WTGT 5SV4A 5CEZL 1J05B 1CDJA 1JPGB 4D9LH 2X4QB 1JVKA 3WBDA 4FZEL 4S2SA 4PJ9C 1FGVL 5K9QG 3MTRA 1C16B 3Q6GL 4PV9B 4YBHA 5JW4Q 1CL7I 3QR2A 3NFSL 1VPOH 5E6IA 5I0ZA 3QRFM 2H3NA 4XT1C 1CDUA 3BP4B 3S88L 2CIKA 3ES6A 3QHTC 1CIDA 4PJCA 3MV9E 5EDXA 2JELH 4RFNC 2ERJB 4X9IA 5EO1B 4F7MB 3TVMD 1S9YB 3VXPB 4DW2H 4EUPG 3ECBB 4KROD 4MD4A 1XR8B 5AWNL 2FO1A 1G6RB 2KH2B 3Q5OA 3CSGA 1GZQB 1F2QA 3D85D 1JZ2A 3TT1L 2A6JA 2QBWA 3B6SB 3U4BL 3W2DH 1C7TA 4I48B 2ATKA 1S7UA 1QLFB 1XEDA 4PTUB 2WLZA 2C3VB 2BNQA 1F6LL 3MLSL 3MLPA 3QRGH 5B39G 3HC0B 4KRLB 1ZHLB 4GW5A 4I3RL 2EIZB 2C1PB 5A16A 3HZMA 4L9LC 4HBCL 2CJUL 4N8PA 3JTTB 4JJHA 4OD2A 2OR8A 3HLAA 2HLFD 4CJ1A 5LXGL 4P46D 1H0DB 4HUUA 3TIEA 5EO9A 1JNHA 4N8CL 5GGQH 2F53A 5K9KA 4TTGA 4B5EA 3SHSA 2VWEE 3BGMA 1I3UA 3ILPA 4H25A 5DK0A 3RY4A 3BSZL 3P4MB 4G9FE 5DK2B 5CJXA 1IQWH 1TTUA 1RAMA 2BHZA 2HJFB 3JUZA 4L29B 5JHLH 1MREH 2VDPH 1UWXH 5I1KH 5JIIA 3P77A 4K7FB 4X4XB 1ZHBB 2OQJB 1MCOL 1IC4L 5F7EH 1D5MB 2VLJE 3O2WL 3P9MA 3WJJC 4ODVH 4YXKL 4F2MA 4WHDA 4HCRL 5DHVA 5E2VL 5I6XC 1FYHB 5H94A 1KELH 4OLYL 1AH1A 2NR6C 2MHAA 2RBLA 2NXZD 4LGSB 3I9GL 3P4NA 4N0CD 2D03L 5D6DA 5T3XL 2F5BH 4HKZA 2F19H 1LK2A 1UYWL 4FFVD 1OPGH 4F80A 3KPNB 3N1GC 4J4PD 2R0ZH 1WBZB 1YYLH 2H32H 3FT4A 5FO8A 4ONHB 1S7QB 3LDBC 5AD0A 4XP5L 2VUYA 1D3CA 5D7JA 4HWBL 4JN1L 1CDCA 4GAYB 1KACB 1YNTB 3DX8B 1JTPA 3OHXB 1NC2A 4NWUL 3QFJE 3PQYD 2HJLA 2J88H 1KTDB 5C0CD 3KXFE 3OG4B 1JPGA 3WUWB 3HG1B 4NO0D 2CGRL 4CMHC 5ELIA 1PBYA 1A21A 3SGDH 3BP7A 3TYFB 3SKOA 3QUXA 1U91A 4TULL 1N64H 5DJ8A 2ZPKL 4MSWB 2V9RA 2PYED 1WBXB 3U0WL 3REWA 2R1WB 1WZKA 4KTEL 4M6MH 1BF2A 4U6XB 1EXUB 3U2SB 2Y7QA 2I9TB 3D18B 4GRWF 3BP4A 3UTSE 2R0KL 4HT1L 4KV5E 4OGXL 4HIHB 1I7UB 1EHLL 1WITA 2Q7YB 3FZUD 1V7NH 2EYSB 3EYVB 5C07B 5GS1A 4NKIH 3VXPA 3HRPA 1D5IL 1J1XH 1XR8A 4G5ZH 1KPUB 3G6AB 1A8JH 4C4KT 2BJML 2GSGA 1ZSDA 1R3HB 4I48A 1G9MH 3QG6A 2R2BA 3TM6A 3DUUA 3OKOA 5FK9A 2C3VA 2PXYD 1RZKL 3QQ4B 4XPHL 1IGFL 3A6BH 3CGTA 2O61B 5F9WC 4Z8FH 5AZEL 3HC0A 3F7QA 4W4NA 3C5SB 1QG3A 1QKZL 4MA3A 3CLEH 2HMIC 2C1PA 3I50H 5IJVB 2IQAA 3LMJH 3JTTA 3CCHA 4KVNL 2YPLB 4A2LA 2QSCH 4WFED 1H0DA 4F7TA 1IBGL 5IVOA 3V6BR 4R7NB 5GRJL 3VG0L 1LP9B 3C2SA 3LEYL 3UP1A 4LCIL 4H0IA 1FAIL 1IKNA 4ELKB 3ZTJG 2EKSA 3MYZA 2CUMA 5C0ND 1S7WB 4QHNA 1OAYL 5T1MB 4LVHB 5J3HC 1XGYL 3SBWA 2X4TB 3HE7A 1ZLSH 2J6EL 3P4MA 4MGXA 5DK2A 3QHZH 5LGHH 5B8CB 1MFAL 3IFPA 1A5FL 1Y18B 2ESVA 3TPKA 3O3DA 3CDCA 1BJ8A 3P4LA 3LN9A 2EDWA 4NQSB 3VXRE 1OAZL 3E3QC 4ETQB 1DBMH 2X6MA 3KPLB 5HHVH 1X6LA 2QSQA 3MGOA 3FMGH 4M1GH 5EOCH 1NLBH 3B5GA 1EO8H 3VMNA 4EXPX 3LN5B 5I1DB 2ZCKH 1UZ6E 1P7KA 3EGSA 1NC4B 2HTLC 4CU7A 1ZLUK 2HWZH 1OSZB 2HN7B 3PGFL 4MJ4A 3WJLA 4QRRE 4BFEA 3LQAC 2KDGA 4HUXB 2DQIL 5KSUA 3TA3C 2ITCA 1FNSL 3ARTA 3KPNA 3LS4H 3ZYOA 5C9KA 3MJ9H 1NMAL 4OF5A 5JA8B 2EDRA 1IGIL 1IAIM 4IOSD 3MC0A 1S7QA 4MNQE 3TO4A 1GVIA 4PJHE 7FABL 3UYOD 1SYSB 2VL5B 4JVWA 4YDVA 1Q1JL 4WV1C 4QYOA 3RIFF 3X17A 1YNTA 2JK5A 4Y16A 1TTGA 3OB8A 4GKOA 4V1DE 1Y6MR 2Z35B 3QULB 3SJVB 2R2CA 4ZNEA 3ZHLA 3DHMA 4LQFL 1UZ8B 2J3SA 4MMXC 4M6AA 3T0WA 3A67L 1LEIA 2J4WH 3O2DA 4F8TA 3LN4B 4GRLC 4PJAB 4LIQE 4P9HL 2WK2A 3S35H 4MSWA 3DOSA 1MVUB 1WBXA 1X5ZA 1AP2A 5KVGL 2AK4B 1S9XB 1XT5A 5EWIH 5F72S 2A74B 1D9KB 3U2SA 3V5KA 3MRGB 3D18A 3KPQB 2G5BB 1W72H 4JLRA 2XOTA 1PYWB 5BMFL 3JVGC 3O6LL 4HIHA 1I7UA 3D3VB 5HGHA 2Q7YA 3WKML 2EYSA 4NN7C 3MV01 3CU1A 3GHEH 3Q5TA 4I13B 4P3CH 5INCB 3JSSA 1DN2A 4P0DA 3V4PH 3QI9B 5HPMA 3H3PL 3HC3H 5ICZB 4RDQG 1BHGA 4R3SA 3ZTNH 1R3HA 1PY9A 1G7PB 4M62L 5HYSB 4RWYL 2MKLC 3IFLH 1ZOXA 2WBJA 4AM0B 5JMRA 4GW4B 4JHAL 3DVNA 1IGJA 1ZTXL 3RPIB 2XWBB 1DLHA 1JL8A 5JHDB 2CLZB 3W82A 2O61A 3RDTB 1DQDH 1FJ1B 3HZVA 1D5BA 4H0HB 2Q86B 3C5SA 1IM3A 2VQTA 4KZDH 3QCUH 3QXTA 3AFLA 1HHKA 4TUOB 5IOPA 2P46B 1PJ9A 2IAND 2YPLA 4I8DA 3OAZK 4HWEL 5FCUH 2X40A 3K46A 4MQXC 1PG7X 4R7NA 1F4XH 4XPFL 2UV3A 4R4NC 2HFFA 4ELKA 4JFQB 1U58A 5J89A 5J6GB 4L4TB 1F97A 4PJFE 3S37L 5D2LF 2HYMA 5JDSA 3KPSA 1LWRA 1UXSB 3FQNA 5IB3A 1CG9B 5F7UA 4QRQB 3ORJA 1HCFX 5F7LB 3ARZA 3D87B 4MD5A 3K7UA 4WWKB 3SGEH 3C6SB 4PLNC 4JHBA 1TCRB 3LKOB 5F7DB 5C0BB 4PGCA 3RJDA 3KPLA 2FEEL 3HI6H 4JB9L 3NCBB 2DYPB 1V3JA 4X80H 3ROOA 2HFEB 1RK0A 1CR9L 4OTXH 3O8XA 2RCSH 4H1LH 1NC4A 3S6CA 3BMWA 3DRQB 3MBED 2HN7A 3TH4T 4DOHE 5HDBF 5I1CL 5A2KH 4JPKL 3VH8G 4JPIB 3RX7A 1U9KA 3QUML 2FATL 4NQCA 1DQQB 3SKNB 1MWAH 3OPZL 5IFAH 2M26A 2X7LA 2FIRT 4NNYB 1SYSA 2G75A 2VL5A 4Y8AA 4LP5A 1D5XB 2ZOKB 4QGYA 3SDCB 5HHXH 3MV9D 5ISZE 2YS4A 3IRPX 5CUSH 4X6CF 1QSEA 2DQHH 1JWUB 4Q6YA 1IC7H 3LN4A 3HS0B 5D6DC 4NWTH 2ZKHH 3RVUC 1LHZA 4ODBD 3CDYA 4ODHL 4XI5D 1IGCH 4NCDA 1RZ8A 3C8KA 2K7QA 3WFHA 1MVUA 2OK0H 3PWVA 1LO3H 3ARSA 1MJUL 4U1IB 5F7HA 1ZHNA 5A3IC 4O2CB 2X70B 1CBVH 1S5HB 4GMTL 3M8OH 4NC1E 3M07A 1ORSB 1DR9A 3H9SE 4TVPE 3MRDB 5GRVL 1CCZA 3KPQA 1ZGLB 5D7JC 4JKMA 1N5AA 1AD9A 1HCVA 3CXHK 3HAEH 1OOAA 3MV7B 2P5WE 3D3VA 1N5YL 4FQHB 1CLYL 1ZV5A 5D1XB 5BV7B 5MENB 5I18H 4DKEH 5INCA 3DBXA 3MXVL 5AZ2L 3TBSA 1Z2KA 3TCXA 4JM2D 4XZUA 4RQQB 3V5DB 5I71B 3K2UL 1NMCB 1RK1B 2H6PB 5L2KB 5GRZA 3EJZD 4WTZG 4KKNA 5ICZA 3QUXC 5DVKA 5F7KC 4AK1A 1G7PA 2GUOA 4DKFL 1NDGA 2GHWB 5SWZB 1T7ZA 4GW4A 3RPIA 2WP3O 2XWBA 4M61B 5JHDA 4G9FD 2CLZA 2C1OA 5T33L 4YDKL 1FL6A 1FJ1A 3WFDH 4L8SB 5DJCB 5FYJL 2H26A 1A0QL 2VLJD 5GS1C 3ARBA 2FEEI 3P9WB 3L5WB 5F70A 2YN3A 1QFUH 2HVKB 4OZGF 3EDKA 3PL6B 4TVSa 4CKVX 4NM8L 1A4KA 3CH1B 1A7RL 2JCCF 2NY4D 4DN4H 4LBEB 3X3GH 2H41A 3BO8B 1KYOJ 2KUTA 5J6GA 3VWJD 1EJOH 4W81A 4X99A 1UXSA 1CG9A 3C9NB 5IBUG 3TIDB 3DVGB 3GZKA 5K9JH 4DGYL 2E27H 2XA8L 4WWKA 3C6SA 3FOMB 3MA9H 4IS6A 5DD0L 5C0BA 4OF8A 3BRFA 1IGMH 3T8XA 1W0VA 2DQCL 4MJ5B 5CCKL 5KANG 5IT2L 1K85A 3ULVE 2O26U 3VFGL 1L7IL 2CK2A 5D8JL 3QDGD 3RUGE 2AJYH 2D31B 3AY4A 5DC9B 3RP1A 4H26B 1IARB 5F6HJ 4C4KO 3UYRL 1JF1A 2GAZB 1HHGA 1IKNC 1VKXA 2EDBA 4RBPK 4B7IA 1KEGL 3OGCA 1LO2L 3SE9H 1X5LA 3SBWC 2MCG1 5DQ9A 3L6FB 3HE7C 4X6BA 3SKNA 3K74B 4AL8L 4L8CA 1I9JH 2VKXA 2ZWLT 3VXNB 1TCMA 4NNPH 1HQ4B 4GG8B 3E2HC 2ZOKA 5KVEL 3GSUB 3MLZH 2VQ1A 3SDCA 4ZODA 1TNMA 3O6FD 1LMKA 1U3ZA 3BZEA 3TBWA 4FQIL 4LNVA 4UQ2B 1A14H 1EV2E 2J8UF 3UJJH 2B39A 1RHFA 2W65B 2C3WA 5JLZA 1F3RB 1JWUA 2HT4D 2OZ4L 3RY6A 4NQDE 2FBJH 4OKDA 5KSBA 3O0RL 4YXHH 3ZDZE 4Y4HA 2K3TA 2UVEA 3RAJH 2CPCA 1X5YA 1ULVA 2F58H 4U1IA 2NW3B 5D6CB 2VDKH 3B9KB 2X70A 5ENWB 4G8FA 3TO4C 1SM3H 5DD3L 1KTKE 3ABZA 5D71H 3QPXL 1ZLWK 4HGKC 1ZGLA 3OXSB 3QQ9C 1DBKH 5TQ2H 3SO5A 1AD0B 4OCRL 2BVQB 4JANB 1PY4A 1M71A 3MV7A 4BUGA 1IILE 4C56B 3KPPA 5D1XA 1MUJB 5DHVH 1ZA3B 4XVTH 2R4SL 5F71A 1T0NB 4KTDL 2E5EA 2BSTB 4RQQA 3V5DA 5IMLB 1BQUA 1OAXL 1RK1A 3QZWB 1A7QL 4BQ6A 5L2KA 4N0YL 1S7SB 4U6YB 4MA7L 2Q1EA 4Y19B 5GS0H 2Q8AL 3WD5L 4QLRA 2YC1A 3WFCL 5SWZA 1RFDL 2JLLA 2IPKA 4O02H 2R2HB 4MQTB 4M61A 4QTIL 5C09E 1HXYB 3HNTL 3MUHL 4FS0A 5TDNB 1XF3B 1OP5H 5DJCA 3LHPL 1A9BA 1ZGLP 3UAJC 3VA2C 1U3HD 3I2CH 4OZFA 2BFVH 3L95A 1G7IA 1UM5L 3U46B 4OSUH 4CVZA 5HGBB 2FLRT 1MRCH 1T1YB 1PEZA 3PL6A 5IM7A 2VE6A 1LDPL 4EBQL 8FABB 1I75A 3CH1A 2XZAH 4NN6C 5IBTL 5GZOC 4G6AC 3OB0H 3VXQB 3P40A 3FRPG 4QRRD 3U9PL 2WBJC 2BMKB 2DTML 3Q0HA 4OT1H 1P1ZB 3C9NA 3BI9X 2ZUSA 3D1MC 3O3EB 4XB8A 1PG7H 4QRSB 2R56H 3QJHB 2DQDL 4MNQD 5C0AE 4B41A 4OFDA 1NAML 2EE3A 2EDOA 2PYEA 3H6JA 3FOMA 1KJVB 1E4KA 4POZC 1M7DA 1AI1H 2N1KA 4MJ5A 1ED3B 3NABL 4WNQB 3BKMH 4V1DD 1MY5A 5DJAB 2ARJB 2CLVB 2D31A 4HJGA 2ZUUA 1G6RH 3WHXA 1QFWL 3G6JA 1TQCB 2VERN 4P2OD 4Z7VA 1AQKH 3TO2A 3NCCB 3DURB 1AO7E 3SDDB 3R4DA 1GRWA 1LILA 4KKBD 2D9CA 1DUYA 3LS5H 1O5DT 3L6FA 3OF6A 2BVTA 4XPAL 2Q3AA 3V7AE 2QHLA 3O11B 3ULUL 4R9HA 4ZFZB 1UQSB 2X4NB 25C8L 4RMUA 1HOCA 1AE6L 5FUCC 4DQOL 4H1LG 5ICYB 4LEXH 1EZVY 1MFEH 4YWGL 4IOIA 4OQTL 4HH9B 2DQFB 1TXKA 3RPKA 1AFVL 1I8LA 4CW1B 2W65A 3QIUB 4NRYA 4LSQH 4AENA 3O8XC 2BK8A 5HPOA 3PWLB 5F8QC 1KTLA 4E5XB 1FNFA 4LSSH 1KPRA 4KY1H 2BY1A 4JFEE 3ROLA 5IJKA 4U1NA 4OZIF 1T04B 4XGZB 3CPLB 3UXFA 2JB5H 4JFDB 5TF0A 4NJAH 2A9MH 4U1LB 1JV5A 3WNPA 4RDQF 4KZEH 3HMXL 1CGSH 3EYUL 3MLRL 1K5NB 1Q9OA 3OXSA 3UC0L 2NX5D 2IH3A 3OQ3B 4L8BB 4XP9H 1AD0A 3S98A 4JANA 4YHIB 5HHMB 1TTFA 1SBSH 5HGGS 5TQ0L 4PJ7B 4C56A 2AJZA 5E8DL 3L3IB 1JYXA 1CDYA 1MUJA 5FGRA 2BC4B 3FONA 4JRXE 4MJIB 3IXAA 2Q7NA 5BCAA 4KI5F 2BRQA 2ICWJ 1BAFL 5IMLA 4CL7A 1G0YR 4IM8A 2H8PB 5GS2D 4JY6B 4CVWA 4PJIA 1S7SA 4OLUH 3L3DB 3RIAK 3NA9L 4XHJC 5EZJB 3MQIA 5C0DB 5C2BH 4U2YA 2ICEB 1J7VR 3EFDL 3FQWB 3MGAA 3N1PC 1F5WA 1GGCH 3HAEG 3VXUB 1D9KC 2R2HA 2FJHA 4PJ5B 5EFIB 4NKOA 1QLRB 3WCYA 1T6VN 4EIGB 1OWWA 4AEHH 3EHBC 4I4WB 5FM5O 4NKDB 3R0NA 3FHAA 4H20L 3TJHD 4AG4L 1J87A 2FX9H 1FLRH 1SJEB 5T5NG 1OGTA 1WIOA 4HFUH 3A6CH 4QNPE 5I74C 3LH2H 4AEEA 1T1YA 1HZHH 8FABA 3EYFA 4XCNB 1CXFA 4HW6A 3MFGB 4U0RB 4KV5F 1T1WA 1QYGH 3C8HA 1QFWI 3VXQA 1G7HA 4JPVL 4MXQD 3NAAH 4MA8H 2NLJB 1CFNB 4YQXH 4TQEL 1IAKA 2DIJA 4S1QL 3O3EA 2XTJE 3LKSA 3CSYB 3QJHA 3LQMA 3DROA 2E6JA 1C12A 3MRRB 1B90A 4N68A 3U0PA 3SGJA 4TUKL 3U0TA 3HMWL 2HA1A 1JP5A 5I15H 2GFBA 4WNQA 1KB5A 3B83A 1T5XA 3PWNA 2CRZA 2YN5A 3MX0A 5ISZD 3DTXB 4ODSH 1NKRA 5DJAA 3BESR 4LLUB 2ARJA 4GO6B 4OGYH 1DVFD 3GNML 5TFSH 5JW4M 4L1DA 4HIIB 4LHUA 5K93A 2MSPA 5B38B 1S78C 3IDIB 3MNWB 5T5FL 3BKYL 3CFCL 4O9HL 1S7VB 4G6KH 1SJVA 1U8MB 2WUCH 4Y2DB 2FGWH 4WWKC 4ZFZA 1UQSA 4GXVH 3H9SD 4NN5B 4NP4L 4GAJH 5JUEL 2XYCA 1BD2E 1RZ7H 1I1YB 1FFOA 2OM5A 2P5WD 3TNNB 4KRPB 3EJJX 1MAMH 2DQFA 2EKJA 2W91A 4CW1A 3KPTA 4AH2B 2I60L 1P2CB 3PWLA 4ALAH 1QVOA 1X5JA 1JNNL 1I1AD 4E5XA 3BN3B 5I75C 5BJTA 1WIPA 1ZK9A 4ONOA 3DXAA 1T04A 4XGZA 3S3PA 3B9EA 4N9GB 2DI8A 2YRLA 4U1LA 1P4BH 1SYVA 2VZUA 4C57C 5ID0A 4XCYB 3IJHB 5E9DA 4FZ8H 4LLYA 3IKCA 4X6FB 4QTHB 3S4SB 2V17H 1NAKL 2P24B 2XN9B 4YHIA 3SDCC 5CP7B 2DKSA 1X5XA 3L3IA 1WWAX 2XI9A 4K9EC 1GGIL 4NCC1 3LAFA 2CKBH 2IQ9H 3RY6C 3FO9B 3L9RA 3L3DA 4Y4HC 2JKXA 1EZVX 4FRWA 4KQ3L 4X6DE 3B2UD 4ZD3H 4FQXB 1J0KA 3VXUA 3MBEA 5LWYL 2PUQT 5B3JF 3F5WA 1DN0B 1JYNA 4IRZL 2ATPA 2YRPA 3WSQL 1KN4L 3DYPA 5D7LE 4IDJL 2X09A 4HF5L 3V7AG 5C8JB 1NCWL 3H42H 5DF0A 1TZIB 1SJEA 5D1XC 5ECJE 5BV7C 3GMLA 3ULVD 5IVXB 4KPHL 3D2UD 3DX7A 3GHBH 1ZVSB 5E8NA 2ZJSH 2AXJA 3VI4E 5GRVK 4RAUB 4LRNL 1NMCC 1PW3A 5LG1A 4XCNA 5IMOB 5JR1H 2Q87A 4OIIH 1NGQL 5I19L 1T83A 2GW5A 5A1AA 5DHYB 4Y5YA 2CO7B 2NLJA 3C5ZB 4IIQA 1MCBA 2APXA 4LLVA 4P2RB 4RAVB 1G7LA 1NH6A 1A6VL 1F58L 5GXBB 5JORA 4L8SC 3MRRA 1XF1A 3GKWH 4K07A 2VDOL 5I8EA 4AY0A 4YX2H 1E4XH 5ADOL 3DTXA 2BCKB 1DBAH 1FFNB 2Y9RT 5D5ME 2F54D 3PL6C 1FVEA 4N1CA 5JW4N 1S3KH 3UZEA 3QIWD 4NQDD 4XBPA 3O3UN 5KVFL 1LE9B 2YPVL 1KIQA 1YUHA 3IDIA 5GJSL 3MRCB 3TESA 3SDXE 1LE5A 3QUMB 2Z31D 4JKPL 5AYUL 5E8PA 4JY5H 1J8HD 1G84A 2VLRA 1U8MA 3RVTD 4HPYL 4Y2DA 1RULL 4XX1E 4R90H 2DLFH 2B4CL 5DQDH 3KS0J 5F7NC 4OFPA 1E4KC 4JE4B 2QKIB 4X4MA 2COQA 3GJFH 4XRCB 5DA4A 4KHTL 3RWJB 3T0AA 1FZJB 4J1UA 5F88B 1FNEB 1A22B 4OLZH 4AH2A 5DUMH 1P2CA 2GKIA 4PG2A 3MRPB 2O5ZH 4PRBA 2SEBB 1T20A 2YD1A 3DX9A 3SKJL 5IHZB 2AJXH 5H35A 1VACB 4XCYA 4LARL 5DRWA 4RMRA 5DJDA 3TPUB 4EI6A 1LEGB 4WDIB 2W0PA 4OFKA 4XVSL 3C6LB 3NACH 4R7DB 4X6FA 5EZLB 5A2JH 3BDXA 1NFDB 4QTHA 1MPAH 2F9BT 4I0PB 4AQ1B 2YK1L 1JF5A 3ARFD 2IFFH 1KYOK 3EO0A 5TJWK 4PR5A 1I8LC 4KK5D 5CJQH 5LBSL 2AS5M 1FNLA 3IDUA 5GRUH 3MLXH 1H3WM 2BSRA 2JJWA 5DD1H 3QDJE 5IJKC 1TPXC 3IJSB 2VISA 3QDGA 2Q6WB 1SMOA 2ZP0T 4YO0B 3F58H 1P7HL 4OF7A 4PJBE 3DI2B 2VLKE 2FB4L 1JGEB 2BY3A 1ZANH 1INEL 2D3VA 1L7TH 3U7WH 2IBZY 5C0AD 3QFDA 3G5VA 1MIEL 3BH8A 1GZPA 1OTTC 1X5IA 5K9QI 1IRAY 3QAZB 4YAQA 1CIUA 2Z0BA 3RWGB 4K9EH 2F8OA 3KYKL 1AIFB 3CAFA 1LD9B 1IGTB 1MY7A 1NCBH 4UT9H 5I8OH 5IMOA 4DVBB 4JQVA 4JQIH 4PS4H 4FQCH 5FO7B 1EO5A 1VCAA 5DFVC 2V2WB 1ZEAL 2WINB 1FCGA 1P84J 2K7PA 1NUDA 1F4WH 4ZXBB 5L8KB 1XH3A 1DE4B 1FO0A 3ARPA 3O3AA 2VLLB 1EVUA 2OJEA 3EDDA 3WUWG 4D0BA 1F4YL 4OAWB 4WU7B 5F93C 1N6VA 2OL3A 1EHNA 4PY7A 5BV7H 1NBYA 1M05A 4FTVB 1INDL 3OKLA 1CICD 2BCKA 1FFNA 2EZ0C 5FGSA 3RWHA 2A83B 2W0FA 4FQ1L 4YFLF 5DR5H 3BPCB 1KCSH 1CL7H 1FNGB 3E0GA 5EBLB 5HHOA 3WIHH 4PJXA 4P5MB 4PGEB 1LE9A 4JFED 4LKXB 4S1SL 2IG2H 1KOAA 3EYSH 1H3PL 2OJZH 2XTLA 3BFOA 1QHOA 4JPWL 5C6TL 4OZHE 5C08B 2RB8A 4YXLH 5I30L 1JIBA 2YRZA 4GKZB 4GBXB 5ESAA 5HJ3B 1IQDA 5EU7E 1AXSA 1MRDH 3EOYG 4P3WA 1HIML 1IKFH 3BIKB 1BVLB 1FZJA 4N0UA 5F88A 1FNEA 2X4OA 4Q9RL 4JRXD 2VYRE 3VI3E 1CD1B 1U8QA 2Y25A 1TQCC 3MBXH 1YMMB 4YEFA 2X4RB 3MODH 2PR4L 2SEBA 3I02A 4NQXB 4RFEA 4M7KH 5IWLC 3SDDC 2MPAL 1CQKA 3DPBA 3GSRB 4HUWB 2JIXB 2GITB 5IHZA 4UNVA 1X4ZA 3D39D 4LCWB 1QQDB 4I0KA 5J1AB 4HJJL 3CUPB 3FB6A 1LEGA 1YJDL 4NNXB 2R29L 3C6LA 2B0SH 4HKJB 5EZLA 4QRPB 1L9MA 3GBML 4I0PA 2BVEA 2J2ZA 1QEWB 3FFDA 4GUPB 1LVEA 3CMGA 1X7QB 1R5VB 1MEXL 4ZOAA 5FGBA 2HT3D 1M7IA 2OI9C 4N90D 4O2FB 5TGBB 1AR1D 4S0TD 2EDEA 4ODXB 2Q6WA 1OTSC 2IPTL 3PWPE 1JGEA 1FGNH 4OLEA 1BQHA 1Z0MA 2ZSWB 4P5KB 3HB3D 1MCHA 1IAOB 5I1GL 4KJPC 3ZDZF 1I8KA 1RZIB 5JPNB 5F44A 1YEFH 4PB0H 5DMIL 3TN0B 4ETYA 3OKDB 4HZLA 3P4OB 3V52L 4LVNB 1T5WB 1QLEH 2FO4B 2YD6A 1FH5H 5TE6H 2NNAA 4WO4B 4Y4KB 3RWGA 4UOW1 5T3ZH 4OCYL 5EU3A 5CEZH 5C3TA 4F57L 2AQ1A 3VXTB 3IB4A 5KW9L 4JGUA 5GSRB 4FZEH 5CJOL 4QKXB 3OAUL 4ZSOE 1NEZA 1RZFL 3GBNL 3MREB 2FYYB 1FGVH 5EUOA 2HTKC 4UOW0 3Q6GH 2WINA 4M3JA 4NJ9L 4FQJH 3NFSH 3MLVL 5DMKB 4Z76B 1U95A 4ZUSA 2CXGA 4E0RA 4XNQA 3QIBD 4ELMA 1XCTA 3VU2A 4ZXBA 1DE4A 3S88H 1I7ZA 1ERNA 4OLWL 2A73A 4OAWA 3CFBB 2PYFB 1BD2D 1OCWL 3RVWD 3B9AA 3SCMB 2NX5A 3DV6B 1F13A 5AWNH 2A83A 4JRYB 2AJUL 3QEQE 3BPCA 1FZOB 2QQNL 3TT1H 3U4AA 5IHLB 5EBLA 4WJ5A 1H3UA 5ALCL 3U4BH 4PGEA 1T83C 2J5LB 4G8IB 4Y5YC 4IIQC 3GMNB 5EZIL 5EC2A 5JPMA 2Z93B 3GSXB 1VESA 2IALB 3IS0X 5JOPD 3EOAB 3MLSH 1IGYB 1QRKA 2IH1A 1T03L 1SHMA 4GKZA 4MDJA 1UB6A 4I3RH 4L3AA 5HJ3A 4WUUB 2P5EA 5IFJA 3VWKD 2EDFA 3BYYA 5E5MB 4HS8L 3CDFA 4HBCH 4RX4D 5LGJB 3BIKA 2CJUH 1BVLA 3S37X 3T0ED 2HLAA 1MFBL 2PTVA 3T0VA 5HYSG 5LXGH 1HINL 4Z5RB 1VEPA 1CD1A 3CZFB 4Z7OE 5J56B 4NQXA 4MNHB 4ZS6D 4N8CH 3GSRA 4HUWA 1CK0L 2ENSA 2JIXA 4RFOL 2E8ZA 3LSOB 3ZL4L 4OZ4B 2V7NA 2IC2A 3BSZH 5DO2D 5J1AA 3CUPA 1UH2A 3ZKND 4Y2DC 4M6OL 4XBGB 3FFCA 4NN5C 3SQOL 1T3FA 1MQ8A 2Y23A 1MCOH 1PLGL 1IC4H 1MELA 4JO2L 3O2WH 2FZ3B 1QEWA 3OL2A 3MLUL 1JCKA 4KRPC 4YXKH 3SDAD 3WL9B 1FYTE 4HCRH 1R5VA 5E2VH 1CFSB 5DTFB 3ALXA 4OLYH 3R8BB 4PPTA 1IC1A 1X4YA 3I9GH 4O2EA 4G42A 1ZLWH 2D03H 5TGBA 4P9HC 5T3XH 3EO1B 1TLKA 4KKAD 4ODXA 4XPBL 4M8VA 1UYWH 4MNGA 4OD3L 3M45A 5JIKA 4X83A 3V0WL 4MVBC 3X14A 1RUQL 2XKSA 5GGVL 2DL9A 3RTQD 2Z4QA 4XP5H 3BQUD 4MWFB 1HNGA 4P3DA 4HWBH 4JN1H 1RZIA 1ZLVK 3TN0A 2XICA 3P4OA 4ISVB 4NWUH 3F7YB 4WO4A 4X8JB 4JO3L 1VGKB 3DJ9A 3LY6A 3VXTA 1A6WL 1F6AA 2CGRH 4KUCF 3BW9B 4Z18A 2F8VA 3JZ7A 4TULH 3MREA 1A6TA 2FYYA 2ZPKH 3AXLB 2PNDA 3U0WH 1B6UA 4KI1A 4KTEH 1QBAA 4W68A 1YYLL 4Z6AT 2R0KH 4CBPA 3D85B 3K8LA 4HT1H 2EH7L 5DVLA 4OGXH 1NSNL 3D69B 1PG7W 5EU4B 3CFBA 1EHLH 5IQ9B 5FM4A 4XXDB 3JWDL 3LPGA 4MAYD 4L5FL 1GGUA 1D5IH 3OKNA 3QDME 4LLMB 4Y1AD 3DV6A 4P59L 1QOKA 1TZGL 5ESQA 2OTPA 2BJMH 1P4IL 3CVHA 4JQVC 1FZOA 4Q97A 3FOLA 3ZT7A 1VFUA 1X3DA 4A6YA 4I9WE 2X4SA 3P2TA 4G8IA 1E4WL 3GMNA 1RZKH 4G9DB 4XPHH 1IGFH 2ZZUT 3VDCA 2Z93A 4JFXB 3HE6B 1UH3A 4J23A 2Q8BL 4P46B 1B4RA 1BWMA 5AZEH 5HI5D 3D25A 5FKAB 1QKZH 1F11A 1YNLL 3UTZB 5I73C 5E5MA 1A6UL 5DEGA 4FQLL 4PJ8B 5H8DA 1R0AL 3V9FA 4KVNH 2OSLB 1MJ8L 1RU9L 4XWOC 1KJ2L 1IBGH 4M5ZL 3CZFA 1C08B 1J1OL 4GG6E 5GRJH 5HVGB 3VG0H 4X5WB 2BXZA 3LEYH 4OUUB 4LCIH 3W11D 1U92A 4LOUC 1FAIH 4QXGL 2EC9T 4YE4L 5GGTL 4U4BA 3QDJD 1CVSC 1GC1L 2V9QA 3RL2A 1OAYH 1XGYH 4OZ4A 4RRPG 4E41D 2J6EH 2VLKD 1R3IL 4POYA 4PJGE 3PNWA 1MFAH 1EFXA 1A5FH 4F7PA 3WDHA 4XBGA 2NXZB 1OAZH 2W9DL 1I8IB 2XY1A 4L4VE 3CIQA 4LIQL