3SKNA

Crystal structure of the rl42 tcr unliganded
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
KEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVRAGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RL42 T cell receptor, alpha chain
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 197
sequence length 197
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA02
1NGPL 4PJIB 2C1PB 4JM2C 4P9ML 3O4LA 4TTDD 15C8H 4O2FB 5DJZB 3UYRL 5DS8B 1A3RL 3H9HA 3AUVA 4HX1A 2ZG1A 4OGAC 3AREC 4N8VG 3X11B 4CVZB 5I1JL 3U79A 2XQBH 4JJHA 1ZEAH 1I1AB 1EEZB 3UYOD 1RUKL 5TH2B 3WS3B 4NRYA 1C08A 1P7QB 2P8PA 2I9LB 5DA4A 3BD5A 3QDMD 1MCFA 1IAIM 1QFOA 1I1AD 2AJXH 4P23B 4EEEA 3DX7A 4YEFA 2DQIL 2YPLB 4QRRA 4TNWF 1OQOA 2UWEE 1NEZG 2DJUA 1QBLH 5TDPA 4POYA 4P23D 1AI1L 3LKPA 2C4XA 3EYFB 2E9IA 3WL9B 5I18L 2YPLD 3VXOB 2Q1EA 1AJ7L 2A74B 1M6OA 3FN0H 4HWBA 2AK1H 4KKBD 3C6LD 4U4BA 5CD5D 1P53A 1FCCA 3HZYB 1G0DA 4WHCA 2HFEB 1MQKH 4QHUB 1FP5A 3NPSC 1P7KA 3MCLH 4ZQKB 1T7ZA 2PCPA 2OTPA 5DF0A 3VFOB 4OKVA 3F5WB 4YDVB 1SVCP 25C8H 4YHZL 12E8L 4F2MB 2UY6A 1BQUA 2H2PC 3ARDA 4JDVB 5CEZL 4NGHH 3PHOA 4XPFH 1HQRA 1NBVL 3OKNA 1E4KC 35C8L 4JFDE 5IB1B 1H0DB 1KFAH 1N0XL 4OD3L 4KMQA 3PWPA 1CG9A 1OW0A 1F4HA 4X7FC 1A6TA 1F8TH 4W4OC 3RY6C 3S34H 1J1XL 1Y18A 1T1WB 2FCBA 5FHAH 1ZHLB 2Z31A 3WJJA 1CZ8H 5ETUB 5FAAA 1KPVA 5D1ZA 1CGTA 5LGKA 5DI8B 4CMHC 1R3HB 1T6VN 5E8NB 1RZGB 3IU3A 4P2RE 3MRMA 1T89C 2MKWA 3SPVA 5HYJD 1I1YB 4X9HA 3WNPA 4U1HA 1QD0A 4YQXH 1IFHH 5FA4A 5T3XH 5F9AC 3WN5C 4OV5B 5K9KA 3B2VH 3ARWA 4U1MA 1D6EA 2FNBA 2X42A 2LU7A 1PX3A 1M05A 4RGMC 5IK3A 3RWJA 4ZOEA 2BZDA 5DJDB 2OK0L 3QEHA 3I9GH 4OZHB 3BEVA 2IAMB 1IEAA 3EDFA 2F5BH 3GSUA 1RMFL 5HHOA 4JQVA 5EUOA 2I25N 5FYKD 4P4KB 4Z7QE 3NFPB 3OX8B 4MB5A 2IAMD 4MAYC 3QIWC 1A9EB 1Q0YH 4ZUVB 1DQML 3V6OA 4P4KD 3HCVB 2D3VA 2RBLA 4KTDH 1WBZA 3ARBA 3P0YH 1NDMB 1YEDA 5TE6H 4PRDB 1X5JA 3UJIL 5CKAA 2AJUL 4D9QE 4KK5D 1I85A 2BK8A 4LLUB 1LD9A 4HS8L 3HB3D 3WFEL 1RZ7H 5F7KC 5EORH 1FN4B 2GT9B 4KROB 5IT2L 1JF1A 4FQIH 1KBGL 3TF7C 5CGYD 4GAJH 2DYPB 3F8UB 5DVMA 2YOCA 3JTSA 1SMOA 2D0FA 4KROD 5C71A 1RZIA 4TSAL 2VNCA 2HLAA 3CDCA 2RFXA 4F7PB 3IAPA 3IRPX 1O7SA 4QHMB 1PLGH 4LEOB 1FLTX 3WFCH 4EJ1C 1ADQH 2BVPA 2R9HD 2XT1B 3S7GA 4KRPC 1OL0A 3SDXB 5GRUL 3TZVB 3BD3A 1JN6B 1MFDL 5J1SC 1CGSH 4AEIH 4NZUH 2C3GA 5EPMB 3TZVD 2JK5A 3R1GL 4QYOA 1R5WB 1G9ML 2NY3C 4O51B 5J89A 3LN4A 2DJSA 1XEDA 4TVPE 1W8OA 4PG9A 5IB3B 4UT7L 1C5DA 1YPZF 1U8JB 3ZMRA 3IDGA 3VJ6B 3DUSB 5MEPB 2C4FU 4HC1L 1IEBB 2BSRB 4BKLA 2JJTA 1NGYB 2OMNA 4NN5C 2HFGH 4D3CH 1JPGA 1U8IA 3BQUA 2JKXA 5B38G 3LN5B 1YEGL 5LBSH 4XPBL 2XTJC 1RULH 3MUGB 4MNQA 2D0GA 4U7KA 5F7EH 2GJ6B 4UIMA 2F54E 5ESQA 4M03A 3SDCB 4EUPA 2GK0B 3MJ9H 1ZA3A 4HIEA 3L3DA 3DV4A 3KPSB 4CMMB 4E0RB 1HYSD 2GJ6D 3SDCD 2ICEA 2A77L 3KPLA 3MA7A 4LNVA 1AY1H 5EIIA 4WUKL 3KPSD 2DQJH 3PV7A 4G6ML 3S96B 1RJYA 5EBLA 1S7TB 2BY2A 1EGJA 4LFHG 3TVMD 5IF0B 1FRGH 3VRLF 3ARDC 3HRZA 2XXMB 1ETZB 1I3GH 4NC2B 5KANG 1JZ3A 4LVNB 1CU4H 2FWOB 5DHYA 1RZJC 2Y6SD 4JPKL 2CDEA 1G6RL 4JAMA 1G7LA 2Q86B 2F9BT 1OW0C 1T5WA 1MAMH 5DR5L 5C0EA 2W60B 1BWMA 4PJDB 2Z31C 3KPOB 5F70A 4M6OH 3WJJC 5JXED 2PYFB 4UUJB 4WENB 4X4XA 1UCBL 5D1ZC 3H3PL 1FLRL 2WM0A 4F33B 3RHWF 4WJ5A 2K1MA 5DJYB 4RGNC 2CIIB 2GEEA 1GHFH 2WANA 4N9GB 1KIRB 2CH8A 4HFUH 3QUZA 1MNUH 4TNVK 4XCNB 4QRQB 2VH5H 4K7FB 4PBXA 2VDOH 1T1XB 4L5FH 5IW6B 5DWUL 2ITDB 3IF1B 3MOBL 2F58L 1RSFA 4YHPB 2NNAA 1NAMH 2OZ4H 3MRKB 3RIAK 1GOHA 3SKUD 2ICCA 4ZTOL 3FQNB 3VXMA 5CS7A 4AIZB 5I1DA 3UC0H 4JQVC 4GRWE 4YNYB 4YEEA 4PYGA 3R06A 3G9AB 5D5MA 4LPVA 5ENWB 4CN6A 1S9XA 3V4PL 2B5IB 2Q7NA 1OAXL 1A47A 1XZ0B 1CE1H 5DHXB 3VFTB 2XY2A 1BM3H 1PQZA 4DZ8B 5JOFA 3GJEA 2W59A 4WFGE 2WV3A 2DM2A 3EOYG 2Q8AH 3V6OC 4F7EB 4JKLA 4I0PB 3T77B 3ARBC 3HR5A 2BY3A 3STZA 3NPZB 4U05A 1JNNH 1KG0A 2H8PA 4H0IA 3OKMB 5HHVH 1H8NA 1I85C 3VRJB 4ODSL 4I0PD 2PYEE 2E7CA 4WI8A 5ACZA 1JYXA 3SY0B 1DLHA 2ZPKL 3OKOA 1UH3A 5B8CB 2DS4A 4M43L 3E6FA 4LSSH 1MY7A 2XFXB 1M71A 5FYJE 5ESVB 2EZ0C 2PR4L 2A6KB 3RJQB 3PIQA 5DVNA 3CLFH 2MSPA 3BGFC 1UENA 4LASL 4LKXB 5FECA 4LHUA 3GO1L 2P8MB 4FQHA 4B7IA 5F9WC 2QADB 3PJSA 4PRAA 2CLZB 2HFFB 3PDOB 4MS8C 4PB0H 1KLGB 4Y5YA 4XHJC 1BQSA 1DBAL 2XZQH 1GGYA 2AJ3A 1VESA 1MCSA 1RU9H 1J5OL 4X98A 2OS7A 2VAAB 3C5ZB 1EO8H 4I0CC 1IC7H 1BJMA 3ROOA 2FL5A 4L4TA 4OF8A 5EO1A 5T1MB 3CXDL 3MRLA 4WWID 1FIEA 3DHMA 1GGBH 1UM4L 3T0EB 3KYAA 3C5ZD 5DD6A 1J1PL 3QUYB 4ISVB 5GHWH 5LXGL 4OZFA 1J87A 1JNLL 3MR9B 3QULB 1YYML 2EDEA 4DCQA 1XF5A 3P9MB 3K2MC 3B9AA 3T0ED 1HKLH 2BVOA 1CICA 1X5ZA 3W5NA 3C09C 3QUYD 1RD6A 1YNTA 3TYFA 1XH3B 4D0CB 1BFVL 4WUUE 5J6HB 3HG1E 3KPRE 2JJTC 1LE9A 1AGDB 1FBIL 1YMME 4NRXB 3BX7C 2VJXA 3BQUC 3FONA 4ALAH 5C2UB 1G7HA 3WE6A 3ECBB 2QQQA 2YRPA 3TBVA 3TH3T 3DVGB 4QXGH 1BQLH 5KSUA 3BD4A 3ULUC 1CTOA 1G6RB 3K46A 4Q74A 3JV4B 4ZDHB 1XGPA 5KVGL 2IFFL 1INQA 3LDBB 5E2VH 1XIWC 3IFPB 4M6NH 2RHEA 4HH9B 1R3LA 2AK4A 4L29A 5ITFB 3RVXC 4QRSB 3TA3D 4OT1H 2DD8H 1NGQH 2DWEA 1F45A 1PFCA 1T0NB 2DM7A 2HJLA 4UV4H 2G75A 2VL4A 4Y4HB 4AENB 1Q94A 4RSVA 3EHBD 5BW7A 5H35A 4F9PA 2BJML 5D7IE 3ARGB 2OJEB 3HC3H 3V7MA 1P5UA 1M7DB 3LCYA 5TE4L 1T22A 4UQ3A 4U1SA 2A38A 2WIMA 4K3JH 3NCJL 5GGTL 2VDNH 1NCBH 4K2UL 4JN2A 3WUWG 1A14L 3VFNB 2Q8BL 4WI9A 4JRXE 4Y8AA 4OF0A 3BJLA 4PJFF 3S98A 3QB7C 3L3GA 3QHFH 1GZQB 4Z7OF 4O58H 1MFAH 4JFHD 4XP4H 1NCUA 1FFRA 1SM3H 3QUZC 1GH7A 2HVKB 1QR1B 2K3TA 2ZOKB 2UZIL 4ZFZA 1A0QL 4L3CB 1D7FA 1UZ6E 2FD6L 3RKDC 1TZHB 1SBSH 4XGZA 7CGTA 4IRJA 4KUCD 4N0FA 2A0LD 4OCMC 4HDIB 2W65B 4NQDB 4XMLH 3CDFA 1NDGB 2VE6A 4JO2L 2F19H 5H94A 2DL2A 4FFWD 4YFLF 1UB5B 4I5BA 1DP0A 5EOCL 3HI5L 4S10A 3FFCB 4NQDD 5DJ0A 3WO4B 3S4SA 3E1F1 3IU4H 3QIUB 4QRPB 1VACA 5CEYB 4U1NB 3FFCD 5SWSE 3OWEA 3AVEA 2NY4B 1QNZH 2QKIA 5C70A 4U6VH 3QIUD 4QRPD 3T1FA 3UTTE 2DL9A 5EC2B 2ZCHL 5E6IB 1BIHA 1AGBA 2ADJB 1HXYA 2UY7A 4PJ7B 2NY4D 4JKKA 1HHIB 2JCCE 3IXTA 3VI4F 1AHWB 3X3FH 1D5XB 4HWZA 3OSKA 5D9SB 4HPYH 3HE6A 4WWKA 4DVRL 4C56A 5E6ID 5DO2D 1RJZA 3NFNB 4G8EA 3U46B 1RIVL 3MLZH 4DQOH 1MQ8A 2VWEE 1WCQA 4JG0L 3W11C 4R4ND 5MENA 4DVBB 5E5MA 3ARVA 2NY7L 1IQDB 5HI4C 4XPHL 3BSZH 5SX4I 1QOKA 1YN7A 1FFQA 4KJWC 4NRZA 2X4OB 1AXIB 5JORA 3QQ4B 1I7ZB 4Y5YC 2I5YH 4OM0L 4MAUH 5JNYB 4NOBA 3UTZA 2BCKB 1NBYA 3CVHA 1I9IL 3LEYL 3STLB 5KS9E 4JVWA 4UU9B 3MXVL 2VR5A 1U3HA 2R0LL 3AREB 4GW5B 4NPYB 1VFUA 1BEYL 1Z0MA 2AS5M 2DI8A 3QIBA 4F7TB 2DRUA 3KS0J 4OGAD 3ARED 2HRPH 5CZVH 1L0XA 1RIHL 1IJ9A 1A1MB 1KV3A 3LMJL 4DGYL 2CXGA 2VZ1A 2WWKT 3L3OA 4MCYB 1CICC 4Z95H 2APVA 3V0VA 1V7NH 3WNMA 1VERA 3ZLQC 3KHOA 3U1SH 5K93A 5GRJH 4FQ1H 1QZ1A 4MZ3A 3HMXL 4HSQA 3QEQB 4OCWL 1OVZA 3TCLB 2YEZA 1LEGB 4WU7B 3D3VA 3BFOA 4PJAA 3BKCL 3H9ZA 4XP5H 5IEHA 3QEQD 4X6DB 2NQCA 5E08L 1I1FB 3MRPB 5KG9A 1Q9WA 3NPSB 4ODHL 5JIKA 4X6BA 5CJXA 4YO0B 1UM5L 3DROB 1R0AL 4HZLB 4PJIF 4YGAB 3VXSE 3EYUH 4MXQC 5D96C 1ACZA 2K7PA 1LP9F 4KK6C 4R26L 2BNRA 5JLZB 3QUKB 3IJHA 4WU5B 2GSIB 4MXWH 4FZ8L 4HFWB 1OGTA 4LAQH 1L7IH 1UXSB 4LCUB 4HWBL 4FRWA 5BW7C 3WFZA 5CSZA 2NR6C 4P46B 4AM0A 3O3DA 3SDYH 5I15L 5IV2B 5BVPH 1R3KA 2V5YA 5JO5B 5FO8B 1YEIH 2YHGA 4LDLB 3DV6B 2QV2A 2R2EB 15C8L 4P46D 3RVTC 3DYPA 4BQCA 3OMZA 5GISL 3CZJA 5CP7A 4ONHB 4LNRA 4YK4C 4F15C 4CMHB 1EDQA 1T1YB 2B20A 1JTTA 3KLSA 5IKCA 3JWOC 5DRNA 2E8ZA 2P24A 5K9OB 3PQYA 1CK0H 3OR6A 4J3UA 2XQBL 2FX9H 2NY6C 1LO5A 1OP9A 5ID1A 1NBZB 5ILTH 1FE8H 3WN5B 3ULSB 4AG4H 1KULA 1RHHB 3RBGA 4HH8A 4JFOA 1J0IA 3WMSA 4RGMB 4AEFA 1FL3A 4YX2H 3BGMB 4U1KB 4IRJC 5DQDH 2J5LC 2VLRA 3OKKB 2DLEA 4W81A 1U8MA 2DJ4A 4DKAA 4MQXD 2A6DB 1QBLL 2ZNWA 3BUYA 1ZLUK 5L88L 4Q2ZB 4Y5XB 4BZ1L 1MLCB 5BS0A 3I6LD 1NJ9A 4MAYB 1S78C 2NX5B 4YLQT 2AK1L 1A7OH 2VIRA 1EBPA 1WV7T 5I1CH 4LPYA 1MQKL 2R2BB 1LK2B 3GUTB 3VFRB 4MAYD 1MIML 2NX5D 5A2IH 3TJHC 4XPGH 1FFNB 4F58H 2VXTH 2D31A 3T4YA 2H32B 1IMHC 4NGHL 1U8KA 2FYYB 4XPFL 2CLVA 1KIPA 1HIMH 2OR7A 4RZCB 4YDIH 3SDDA 4XAKD 3HE6C 4WWKC 1BMGA 5DJ2A 1KFAL 1K5NA 1F8TL 4HKXB 2BSSB 3S34L 1M4KA 4HCRL 4HK3J 1A6AA 3RWHA 1A9BA 2J12B 1KCVH 5A43C 1CZ8L 2ERJC 3U9UA 4A6YA 3Q0HA 4G8FA 3BP4A 3CFJA 3FMGH 3VD9A 1V5JA 3O4LB 3H7BA 4LCWA 3EDDA 4GH7B 1ZSDB 4J4PA 1CLOH 2E9WA 5F9OH 3C6SA 3H9HB 5ANME 5GS1A 1CWVA 4HK0B 1U3HC 5FM4A 1BZ7A 4YQXL 2ESVE 4R2GC 1IFHL 5T3XL 4JCMA 3O4LD 3B2VL 2APWA 3RWDA 4NKDB 1F58H 5TGBA 3EDJA 3QIBC 4P57A 1BREA 1EXUA 4XP6L 4NRYB 3O3AB 5GGQH 1C08B 2BX5A 3RTQB 3IVKA 2P8PB 2FLRT 1TVBA 4HAGA 5I6XC 3I9GL 2F5BL 2YZ8A 4PRIA 1WZ1H 5B39A 4M7KH 3DX7B 2BOBB 4QHKI 2ZUQB 3RTQD 4QRRB 4BH8B 2BVEA 5DMJB 3EO9L 1T0PB 2MNUA 4JRYE 4JFZL 1Q0YL 3WCYA 5E5UB 4TTGA 4QRRD 5IB2B 4KTDL 3DARA 1B6DA 3QZWG 5TE6L 1JMXA 3LV3A 5C0BA 4OFYA 4S2SA 2J8UE 4AYFA 2ORBH 2XTJD 2JE8A 4Z7UF 4OSUH 4HIJB 3F6IA 1P7KB 3U4BH 2ATPA 1GOFA 3ILQC 4I77H 5CJXC 1GC1L 3QDJA 2HKFL 1RZ7L 4PJCE 3ZSTA 1X6NA 2X7LB 3ZHLA 1UA6H 2CK2A 4OKVB 5DT1H 1YPZE 4GAJL 3MNZA 5K9JH 1VPOH 5AAMA 5I30H 3GI9H 2IQAB 4PJBA 3QCTH 1F4AA 5DEFA 3IKCA 4M1DH 2YC1A 1PLGL 3ARDD 4EOWL 4G9FA 3WFCL 3PWPB 1CG9B 4Z77B 3HN3A 4H88L 1Y18B 2ATKA 1WWAX 1ZMYA 4QTHA 5IBUB 3V2AR 4K71C 4HJ0C 4LDEB 3PWPD 2E7LA 3ULVH 1T2QH 2OYPA 1EGJL 4DW2H 2JB6A 1CGSL 2X4PB 1QVOB 1JRHI 4NZUL 4O02L 4PJXA 3IU3B 3MRMB 3OR7B 1I8MA 3VU2A 3SPVB 4FQXB 3GMMA 1D5IH 1JHTA 4HUXA 5J9PB 4NYLA 3T3PF 1X3DA 1N59A 4RGND 5FA4B 3QDHA 1ZWIA 2YPKA 1DR9A 3VRLE 5J13B 1DBJH 3ZZ1A 4OGZA 4JFXB 1C12A 3B5GA 4FQXD 2NLJB 2VL5A 4AK1A 2DKUA 3X12A 3FQRA 1I8KA 3HZKB 5IM7B 1CFVH 2HFGL 3QEHB 4D3CL 4PJ8B 1IGIH 5HHOB 3UX9B 4KI5C 4TOYH 5GS2H 1IC5H 2DQGH 5F8QC 5LBSL 1RULL 2G9HA 2DLIA 4P4RB 4K3GA 1KF9B 4OQTA 1HHHA 4DKEH 4PJ8D 5HHOD 5EULV 3NCMA 1S7RA 4GQPH 3W0WA 3MJ9L 4G9DA 2BC4A 3ARBB 4N90D 2Y36L 3V0WH 5D72H 4HHAB 1YEDB 1OY3B 4M5YH 5MEOB 1ZOXA 3TPUA 2W1NA 3N9GL 2YRLA 1OARH 1AY1L 1MCCA 2Z92B 5DK3A 1H8OA 2DQJL 3ARBD 5DD5L 3MJGX 3LN9A 2R8SH 1FRGL 3DJ9A 4LPTA 1SHMA 1RQ5A 1CU4L 1WAAA 3BGFB 3SDDC 3JTSB 5IFJB 5IBTL 1SQ2N 4ODWA 1MAML 5LGJA 1T04B 5F9WB 1FFOB 2P7TA 3BEWA 3MLXL 3RDTB 3HPJB 4M6OL 1NAKH 5T3XD 3MQIA 4F7MA 3JV0A 3P30H 1KNOA 1KPUB 2J1KA 4MS8D 1GHFL 3P2TA 4J4PC 5KANI 4HFUL 4HUUB 1MNUL 2DMKA 2O61A 5GS1C 2VH5L 4PGEB 2YA0A 3BO8B 2Z0BA 3HAEG 4Y7MA 2VDOL 4LLDA 5DTFA 4HWEL 5IP4A 3C5JA 8FABA 1NKOA 4HBQA 2VQTA 3LRSA 1Z9OA 1NAML 2OZ4L 2B1HH 5D7KE 1Z3GH 4JFFB 4JQXA 4GKZA 4XPAH 3UC0L 1YNLH 2BVQA 1E28A 3OJVC 4JFFD 1JPGB 5GGVY 5BQ7B 2F5AH 2EH7H 5TPWL 1CE1L 1BM3L 2Q8AL 2WLYA 2DQCH 4P48A 2GY5A 3HPLA 4U31A 1LDPH 1JNNL 3A6CH 2P44B 2AXFA 4OZGF 4XCFH 5HHVL 3NGBC 4MNQD 3DV4B 4KK8C 3C9NA 1VCAA 3L3JB 4FQCL 3D85B 2QQKL 1QFUH 2GIYA 5I1KH 4PJHF 4GBXA 4YPGB 5HVGB 4ETYA 4BJLA 1RJYB 3QT2A 3S9DB 3TO2B 3LAFA 3HRZB 5C7XH 3MLTB 3MV01 3D85D 4WI6A 2Q7YA 5CINH 3KR3H 5DHYB 1MCLA 2X4TA 2C26A 2FHCA 2CDEB 4PB0L 4IRZH 4BSWA 4BUGA 5BRZB 4XB7A 1NMCC 4KY1H 3U36B 3VE0A 1J1OH 2XZQL 1INDH 2YWYA 1RU9L 1UACH 1EO8L 3KXFE 1MCEA 3IDUA 4X4XB 4Y1AA 5BRZD 2E7LC 4GG6F 2HMID 3MRJA 1GGBL 1WFUA 3O3EA 3D39B 1XGQB 3GSNH 5GHWL 3NZHH 2X4QB 1ZLVK 4Y89A 5L8KB 5DEGB 3FB5B 1T3FB 5CZKA 4O2CB 2EDLA 2XWBA 3SOBH 4QEGA 3D39D 3CX2A 4YBLC 4MMZC 3ZDZF 2B2XL 2DLGA 4EQ2A 1NGZA 3GMLA 3PHQA 1LMKA 3JWOL 5L8JB 2XY1A 1VKXA 4YHYB 4J8RA 3OJDA 4UI2A 4ALAL 4HIXH 1WSST 4KVNH 4R0LA 5D5MB 3RWFA 4AJ0A 3VXMD 5GGVH 4QXGL 1BQLL 3IGAA 2AV7B 1U2HA 3CFKA 4PJFE 1BQHB 1TETH 1PQZB 2C3VA 3LEXB 4Z5RA 3HR5B 4XVSH 2EC9T 2BRRH 1A6ZB 3STZB 3ZKQD 2H8PB 5E00A 3BDYH 4P2QE 3I02B 4WV1A 1XT5A 3OHXB 3MFFB 5LGHH 2ZSVB 4H8WC 1G7QA 4PJ5B 1DLHB 3OKOB 3P40A 3BJ91 4OT1L 2PTTB 5F7YC 1M71B 2DD8L 2Y1VA 1N5AB 1NGQL 1DQTA 4FTVE 1N4XH 3K8LA 3GHBH 1T20B 4EIZC 1IKFH 3BE1H 3S6CA 3TGXA 2IH1B 3DSFH 3U0PB 3HC3L 1QYGH 4P5TA 2HRLA 2NY5C 1KB5A 4K3JL 1CFSA 2J88L 2VDNL 1NCBL 4J7RA 2R0ZL 3BZ4B 3S8WA 3BRFA 1NAMB 2IH3A 4ONOA 4WCYH 3KG5A 3L6FB 1EJOH 3UO1L 4X98B 3CNKA 4NCC2 3QHFL 1FORH 4O58L 4ZUTA 4XP4L 2CKBA 1JBJA 3K4AA 1G0YR 2OL3H 4LAJH 4PGBA 3VGAB 4ZG1A 5EIVA 5E8PA 5D2NB 3VI4E 4S11A 3WUWA 2MFNA 4HG4J 1G7IB 2JELL 1PKQA 5F9JA 1SBSL 1XF5B 5GZNC 1LEIA 3QR2A 1FYTE 4PGZA 2X40A 3GSVA 5FM5O 5HVHB 2IWGA 1YNTB 2RB8A 2F19L 5JZ7C 3CJJA 3ESUF 4JQXC 4WW1B 2VZUA 4M48H 1MCIA 4N0UE 2Y25A 2HKHH 3GSRA 4ZOAA 5EZJA 2XKUA 4CADA 1LNUB 3T1WA 3UCRA 2D7TL 4KZEL 1VFMA 2LAGB 4XP1H 5EN2B 5KAQG 2AEQH 3DX6A 3HNSL 3G5VA 3IU4L 1G7HB 1KCKA 4MHHI 5IEKA 4DZBA 5DQ9B 1UKSA 3MRFA 1FC2D 3L3KA 5DUBA 5IB4B 3VDBA 4Y16A 1QNZL 5ADPH 2UZXB 4U6VL 4ZYKA 1GOGA 3G6JB 2UV3A 3P4NA 1FG2A 3O11A 3C8DA 4OUUB 2I27N 1IZKA 1LO4H 1INQB 4JM2F 5D96B 5HHQA 1IAOB 5D8JH 4FN0A 4GBXC 3MLUH 4L29B 1JWMB 1YECH 2FEEI 2EDXA 3MLZL 5D70L 4DQOL 1A6VH 1L6XA 3RJDA 3VI3F 4KK6D 2G75B 5EUKA 1Q94B 1IC1A 3BSZL 4CRPA 2EKSA 5F7MC 5HYIA 3SGDI 3UJJH 2ZOLA 3I75B 1BJ8A 1T22B 2DM3A 2I5YL 1C7SA 4ZD3L 1BX2A 3P0VH 5CIPA 1I9RH 4DUWA 3IJYA 5FO9A 4WTXA 1TCRA 4MA1C 4QHNA 1WBYB 1U8PB 4F15B 2CGRH 3CVIH 3FT2A 5HJ3A 4XPTH 5EC1A 4Z7VA 5L2JB 4PJIE 4L8BA 4B7LA 4ZOCA 3RVTD 1G7PB 3MJ6A 4LF3B 1LP9E 3UYPA 3WSQH 2YUVA 2F53A 5F93C 2HLFC 3UTQA 2HRPL 4ZFZB 5CZVL 4FXLA 4MX7A 5HVFB 1EX0A 3VXPA 4JHWH 3A6BH 1DEDA 3FB8A 4YIQA 1V7NL 2QHRH 3FN9A 2X1XR 4XGZB 1TENA 3QDME 4XBGB 5EU6A 4R7NB 1A5FL 3GMNB 5CKGA 3U1SL 4R90H 5L0QC 3LIZL 4KV5F 4FQ1L 4Z0BH 2VE6B 5I75C 2CDFB 5H37G 2HT4D 4I5BB 1FZKB 2O93L 4RBPK 1NMAH 4R0LC 1NCAH 1I3UA 3DHJA 3LH2H 5AG8A 4XP5L 2CRYA 4APQA 3S4SB 1ODAA 1OTSC 3TJEH 3NABH 3SE8L 3SEPA 1VACB 3QO1A 2IMMA 4TUOB 2BY1A 5E1AB 3DMMA 1AD9A 1S78D 3IKKA 5ICYB 1IBGH 2QKIB 3EYUL 3IDYB 2IANE 3FO2A 5F7HA 2YD5A 4WV1C 4X8XA 5TDOB 5MHSD 2P5WA 3L5WB 5LWYL 2H26B 4Q58C 1WLHA 3QNYA 4YDJB 4CDGC 3T65B 3IXTB 3MSPA 1XR8A 2P42B 4MXWL 4X8JB 4HWZB 4P5KA 4LAQL 1L7IL 2DN7A 3HE6B 3PWNA 4WWKB 5DURB 4C56B 3VGDA 2DLTA 5AYQA 5EO9A 5C2BH 4AT6B 3QXTA 4OAWB 1YMHB 5L2KB 4M93B 3SDYL 4N68A 2NTFB 4TRPH 3HE6D 4ODBD 4WWKD 4P5TC 5DXWA 5LAXA 1YN7B 4C56D 4JPVL 3NH7H 3OKLA 4IMKA 2WINB 4PGCB 4R4FL 4WNQB 5JORB 4X80L 4IDJH 3CC5A 5J7CC 3MUHL 5MEND 2EH8H 3UTZB 4HG4K 4K94C 3L5XH 1UWEL 3PWUA 3BZEA 4PRHB 5FOJA 2Y4SA 3AU1B 1UYWL 3SDAA 1CK0L 3ZYJA 3RNQA 1J0KA 3DBXA 1Q1JL 1U3HB 2FX9L 5ILTL 5HYJE 4R2GB 3HC0B 5F21B 1UWXK 3MACH 4L4VB 1QFPA 3LOWA 4PRHD 2G5BA 4LMQE 2KL6A 4FXGA 4AG4L 5EB9A 1V8HA 2FSEA 1QEWA 4M3JA 2ARJQ 2HG5B 1OP3K 1E4WH 3QIBB 1U3HD 5C0AA 4R2GD 5DQDL 4L4VD 2WMPA 4UINH 5I6XB 3VD4A 5EU4B 3QIBD 2NMSA 4F57H 4NDMB 4GMTH 2NXZC 3RNKA 2X05A 4W4NA 2YEZB 5F1IA 3BDXA 5ADOH 4NWTH 2VOTA 1L7TH 1A7OL 1AO7A 2X4RA 3TIDA 3PGCB 4DEPC 5I1CL 2L7JA 3TYGH 3H42H 3DO7A 1K8IB 3INUH 5I66B 2WWMD 2A83B 4Y16C 3D3VD 4U1IA 1Q9WB 5F9DC 4XTRC 3QG7H 4EN3A 4X6BB 4F58L 2RCSH 1TQBC 2VXTL 2OQJA 4I1NB 3R8BB 1J10A 4D8PB 1A4JA 3OF6A 4UT9L 2Y5EA 5IFHH 2YD9A 2Y7QA 1HIML 3K1KC 3GMPA 4MNHA 3P4LA 2ZUYA 4YDIL 3RQ3A 4MCZA 4KTEH 2L4OA 4L9LA 5EU3B 1OGTB 1I7UA 4NNXA 2BNRD 2LU4A 5JHDA 2YBRA 5EIQA 3QEUA 2JB5H 1KCVL 2HVJA 4RX4A 4M1GH 4RDQG 4B53A 3IB4A 4LCIH 4NKIH 2XZAH 1MELA 4N8PA 1CLOL 5F9OL 3OAYH 4JR9L 4LNRB 3AGVA 4KKLD 4ORZC 2Y9RT 2V9RA 5D6CA 2B0SH 4JFYA 3TFKC 4OTXH 3O45B 2P24B 4MSWA 4X99A 4HJ0D 3PQYB 1F58L 4LLWA 4BZYA 2Z35A 5EZOL 2VLKB 1ES0A 5GGQL 5MI0B 1X44A 5JW5A 1AC6A 3PQYD 1EEYA 1WZ1L 4RWYH 4M7KL 2VABA 5DVOA 4RGOL 2VLKD 4PJGB 3QEGL 4LKCB 3G5YA 4EI5A 2O26U 5GRYA 1QSFB 3BUYB 4HLJA 5JDSA 1HKFA 4WHYG 1OP5H 4XNXL 5K59F 1CBVH 1BF8A 1PY9A 4IJ3C 3OB0H 1A1NB 1BHGA 1NJ9B 1YEHL 4KI5D 1QSFD 3UTSA 4APQC 1CCZA 4FQPA 2ORBL 3BXNB 4ZSOA 5FFLA 4OSUL 2MMXA 5DLMH 3VXNA 4I77L 1KIQA 3DMMC 3FHAA 1IM3B 3MRHA 3T3PE 1UA6L 5DT1L 2YS4A 1NBQA 2D31B 2GAZA 1AGEA 5K9JL 1VPOL 1MHCA 4ZPVA 4NN7B 5I30L 4QWWC 1VFBB 1DBKH 5DVKA 3BP6B 1KIPB 4W6XB 2FH8A 4M1DL 3WHXA 3LKSA 4HULB 2EDBA 2RIKA 4RFOH 3ALPA 5CSBA 1WGOA 1T7WA 5D6DA 3CPLA 4NKOB 4IMKC 1TFHA 5GS0C 1MCKA 1KXVC 2VAJA 1T2QL 3ULVL 5KSAA 4DW2L 2XRAH 5FCUH 3JZ7A 4G8FB 5C0CE 4XZUA 3OG4B 5FXCH 1DSFH 1MREH 5EUOF 4LCWB 1OPGH 5IW3A 4HUVB 5SX4H 3C6SB 2ZJSH 3SDAC 5GS1B 4Q97A 3HI6H 2GUOB 3NCYS 4YXLH 1D5IL 1U2CA 2YK1H 2NW2A 1CD1A 1N6VA 4TSCH 3VGHA 2BY0A 5I17B 4LCWD 3DGGB 3RWDB 1I7TB 1QLFA 3QUMA 3V8CA 4GMSH 5TGBB 1BP3B 2P5EA 2DQTL 4U6HA 1KTLA 5JW4Q 1CFVL 2VZVA 4LP4A 1TVBB 4QLRA 3F12A 4NQEA 3CVHH 1UGNA 4L8DA 3QUXB 1IGIL 4PRIB 4TOYL 1IC5L 2DQGL 2B4CH 3JWNC 3FOMA 5FDWB 5T3ZE 3HE7B 3UPAA 4PD4J 4PRID 3JWDC 4POUB 2AJYH 1ZHKA 4DGIL 1H3WM 4R4BA 1DQLL 1LO2H 3V0WL 5D72L 3KYNB 2X4NA 4M5YL 2C3XA 5C0BB 3FB6A 2JJWA 3HE7D 4I3SH 4S2SB 2ED7A 1GYAA 3NGBB 2Q3ZA 4QGTA 1OARL 4NM4H 5I73B 3MRNB 5DFTA 4EN3C 3LQZA 5BMFH 2ATPB 3O6KL 5CSGA 3QDJB 1K3IA 3MRRA 2R8SL 2Z4QA 5C0BD 4OFYD 4F37F 4MD0A 5HHNA 2PXYA 1X5GA 3CSGA 4OV6F 3BPLC 3CU7A 4ZFOL 2H1PH 1A2YA 1MLBA 1QO3A 3QDJD 4YAQB 1SY6H 5GGSA 4PJBB 1XGTB 4L9LC 5EU5A 1D9KA 1JYWA 3HFMH 5DEFB 4MQ7A 1N3NA 3IKCB 2YC1B 2WUCH 1HCVA 1LVEA 1NAKL 5M94B 5AG9A 4YWGL 3O2DH 1HDMA 3IFLH 2VQ1A 5I1GH 2X09A 1YDPB 3P30L 5JIHA 4Z78A 3DUHA 3RPKA 3PWLA 4OZGE 4UT6H 1CXHA 2JB6B 3TNMB 4GS7C 3BI9X 4UBDC 2LAAA 2Z91B 3AC0A 4R97C 2J8OA 4PJHE 4HUXB 5JIPA 4ODXA 4OFPA 1T6WA 4N0RA 5KZCB 4BFIB 4FXKA 2B1HL 1QSVA 1QRNB 4OZ4B 1QA9A 1Z3GL 3ULUF 2DQUL 4HUWA 5IOPA 3SJVA 4FNLL 3S3JA 4XPAL 4KI1A 5IGXH 3VGFA 4P9HC 1V3JA 2DLHA 3FQRB 1I8KB 5HVWA 3HUJA 2DTMH 5KZCD 4KK9C 5BOZG 1QRND 1JI1A 1YNLL 2VXUL 4WW2A 4RBPH 4Q0XH 3U6RB 4EI5C 2GCYA 3HI1A 2F5AL 3T4AA 2EH7L 1BVKA 4HGKC 4OD2A 1T4KB 1IGFH 2G9HB 3O6MH 4GG6E 1PG7X 1NCWH 3A6CL 4G9DB 4U3XA 4JREC 5HGAA 4XCFL 5IVOA 1G1CA 2VXVH 3DXAA 4HV8A 4Y4KA 3IT8D 3MBXH 4OIBA 3TPUB 3VDCA 1IILE 5KSBF 3MNWA 5E9DA 1QFUL 4OZIB 5J4MA 4KDTA 5B3JF 2P48B 1ZT7A 1KCUH 1TVDA 4UDTA 5C7XL 3MFGB 5IVXF 3Q1SH 1AKJB 4GJTB 1P5VA 3ULVD 2PF6A 5BO1H 1BLNA 4IRZL 2ZUWA 1KJ2H 2FO4A 3RWCA 1J8HE 1IAKB 4ODWB 3F7VB 5C0FA 1H3PL 1AKJD 3KJ4C 1G7MA 1J1OL 1INDL 5D6DC 1U3JA 5GSRB 5C0DA 2X4SB 1R5IA 3PE9A 5F89B 4F7MB 3QXVA 5KSAC 1J9CT 4MNGB 3RU8H 4NUJA 2CMRH 4I18C 3MV8E 5DK0B 4JVUA 3GSNL 3MJ7A 1BVZA 1U91B 3NZHL 5FOBA 4F7CA 5D5MF 1JPTH 4LARH 3ABZA 3QP3A 1TZGH 2BVTA 4XCEA 3P73A 4LRIA 5BCAA 3BZDA 3L5IA 3SOBL 2I9TA 1RK0B 3C5JB 4X9BA 4PY8I 1MF2H 5IMLA 3P77A 4IDLA 3GFUA 3LRSB 4G3YH 4OFIA 4A6YH 4PD4K 5IMKA 1UQSB 2R15A 4LCCB 4U1LB 5T1KB 3B43A 5GZND 4P2YA 5CILH 4BFGA 1LK3H 5E4EC 2O5YH 3GSWB 2EDDA 2BVQB 4ZPTB 1NL0H 5T1KD 3MMEA 3FO1A 3QCUH 4ZFOB 4WIQA 5GRVK 1F6AA 1TETL 1K3ZA 2AP2A 1QSEE 5T33H 3FFCE 4XVSL 2BRRL 4YDLB 1H5BB 1MHHB 4MWFA 1CDIA 3U0TA 4UQ2B 4YFLI 3BDYL 3FTGB 4QRPE 2I60H 5LGHL 1KJ3H 3C9NB 1FL5B 5DFVC 4IRSA 4P2RA 1EAPA 3QA3B 2CQVA 2A9NH 2PXYC 4GBXB 1N4XL 3GHBL 2VSDA 3LEVH 4RMVA 1KTRL 2W91A 3K80A 1IKFL 4R96B 3BE1L 4JFQB 4QOKB 2FATH 3SCMB 3DSFL 4PJ7E 5FEBA 2Q7YB 4X7SH 1D9KC 1QYGL 3QBTB 4GBXD 1HQ4A 4ZAKB 2X4TB 4JZOA 1DJSA 1DEEB 2CIKB 3PWVA 2ZWLT 4UB0H 4QOKD 4ZFFA 1HH6B 3GSXB 3SCMD 3T2QA 3H9SB 4LL9A 3VG9B 4RMSA 1U0QA 3T0DA 5H8DA 4WCYL 3O9WA 3QRFM 4ZAKD 1EJOL 4RAVB 4Q7DA 1KC5H 3RIFK 4MA1B 4ZO6A 3BIKA 3H9SD 2A73B 2XV6B 2FGWL 1AH1A 3DPBA 1TPXC 1TLKA 2OL3L 1MHEB 3EYSH 1C16A 3FKUS 1QPXA 1MCRA 1NFDA 4I3GA 1JTPA 4G6AC 2A6JB 1JRHH 3VI3E 4QRTA 1OM3H 3FAXA 5C09A 4H25A 2HLFD 3T04D 1XR9A 2YUXA 3BZFB 3FQUB 4M48L 4OCYH 4LVOC 2HKHL 3GMLB 3PHQB 3FCTA 1IGYA 4OIIH 2EE9A 1JNJA 4WW2C 4XP1L 3QI9A 2AEQL 5E6ZA 2NYYD 5FKPB 4ORGA 4UTBH 3MLPA 1JWUA 3CFKB 2DI7A 4ELKA 3W39B 1S9VA 1A6WL 5EBWA 5DRWA 1MI5B 4HBCL 4JDZA 4ODVH 4Z5RB 4P0DA 4KKAC 4Y4KC 1LO4L 3OGCA 3VFSA 1CVSC 4WV1B 5D8JL 2W9LA 1ZVSB 4KDTC 1MI5D 4JHAL 3OQ3B 3QXDA 3TT3H 1YECL 4J2XA 4NQCA 1A6VL 4ZXBB 4L4JA 2VLJE 4KV5E 3BVNB 3QJHA 3NIDF 3F62A 3NCFB 3DLQR 1NCTA 4O2FA 3AAZA 5DJZA 4QY8B 3NAAH 3NFSH 1JZ5A 5SX5K 1B0GB 4V2BA 1ZT1B 4X4ZA 3UJJL 3GJFK 3QAZC 4P5TB 2CK0H 3P0VL 3VFWB 3X14B 4TULH 1CFSB 1I9RL 2XNAB 3B2UD 1I1AA 1EEQA 2IH3B 5J11C 1T1ZB 1ZTXL 5TH2A 3CVIL 4NHCH 3WS3A 4XPTL 4KHTH 4L9DA 4P5TD 1P7QA 3N1PC 2J6EH 2I9LA 2X9XA 3G5XA 3QQ9C 2XACC 2AW2A 4P23A 4K3DH 3WSQL 2WBJB 2AAVA 3DNKA 3Q5OA 3CSYB 1FSKB 2YPLA 5C0GA 4Y2DB 1JIBA 4LRIC 4JHWL 3H0TB 3A6BL 5FGCE 3CDGB 1PKQB 2WBJD 2QHRL 5GGRB 4YHMH 3EYFA 3WL9A 5SWZB 3VXOA 1UEYA 2A74A 3GSVB 4L1DA 2X70A 4Z0BL 4GRWH 4K9EH 3HZYA 3J8F7 5I19H 4JE4B 2HFEA 4QHUA 5SWZD 3GSRB 1NMAL 3AB0C 2FX8H 4CADB 4ZQKA 1NCAL 4FOMA 2EYTB 3LH2L 4Q6IB 3FT4A 3VFOA 5EWIH 1TJIH 3Q48A 3F5WA 3G5VB 4YDVA 4DEPB 4E42B 2FR4B 5EOCJ 4DZBB 4F2MA 4K8RH 2NXZD 5DUBB 3UAJC 5J57B 4EVNB 2NX5E 2KPNA 5CP3H 2I07B 1FG2B 3O11B 1H0DA 2WP3T 5FYJH 4Y16D 5HHQB 1AIFA 4IRSC 3ME0A 4DJMA 1T1WA 1ZHLA 1U8NA 1F6FB 3AY4A 1NCCH 2IQ9H 3QQ3B 2HJKB 2BNQB 2OL3B 4Z0XA 5C2BL 2QR0A 3VXUA 1R3JB 5DI8A 4S1DD 5E8NA 4TRPL 4S1RH 2DWDB 1RZGA 3D0VA 2EKSB 3NH7L 4M7JH 1IL1B 1I1YA 1XGYH 4IDJL 4LMQI 2EH8L 4OV5A 3NCYP 1DLFH 1T7XA 3L5XL 3O9WC 2PTVA 3B5HA 2XWJB 3JTTB 5DMGC 1TCRB 5DFWH 3SE9H 5FO9B 4QHNB 1RPQA 5KVEH 2KQNA 4K3EL 5HJ3B 1AP2A 4M61B 5EC1B 3TNNA 4WHTB 2NXYC 3SGEH 3MACL 5DJDA 3BH8B 3EOAB 4L8BB 4OZHA 1U58A 1PZ5B 3O4LE 4PJAF 3M45A 3ILPB 4P4KA 1MJ8L 5EH1A 4MX7B 3TFKD 2O5ZH 3NFPA 4UINL 2ICWI 4WEMB 3X13B 4HKBB 4YIQB 4ZUVA 3GIZH 5EU6B 4OJFL 1VGEH 4XNQA 4KDVA 4GMTL 4FFZH 4U2YA 4OI9A 5ADOL 4LVEA 4LLUA 4NWTL 5EU6D 3U9PH 3QI9C 1C5CH 4U7SA 4F8QA 4JHBA 3TYGL 1QFWH 3H42L 1FN4A 2GT9A 2B1AH 3HRPA 3INUL 5HD8C 1V3LA 4PB9H 3CFBB 4WI7A 2DYPA 2XTJE 5IBUG 2RCSL 3DMMB 4X0KA 1AD9B 4GKOA 1JPST 2XWTB 2MJWA 2R1XA 4F7PA 1TTUA 5IFHL 2UYLB 3VGBA 2OMBA 1RAMA 2IALB 4QHMA 5IMMB 1UC6A 4U6XB 4EI6A 2P5WB 3NZ8A 4TTDC 3DMMD 3QNYB 4PRPB 1XR8B 2MQ0A 2AJSL 2BXZA 4P5KB 3SDXA 5DZNA 3FJTA 3PWNB 1DDHB 3TZVA 2P5WD 4V1DB 1JN6A 4N0YH 2VSCA 4O00A 5EO9B 4PRPD 2X1QA 1EK3A 4N5UA 3WIHL 5EPMA 4DK3A 1EVUA 2Y5TA 1YC8A 4GKSB 4V1DD 2XZAL 3OKLB 3Q6GL 3P4MB 4O51A 3LQAH 1FGNH 1ZV5A 3ZE0F 1I1AC 3CC5B 4M00A 5IB3A 4IMLB 3PWPE 4S1SH 4ZNEA 5CEXA 1W72H 1U8JA 1JUFB 2B0SL 3PWUB 4KI5F 3X3GH 4OTXL 3SKJL 3DUSA 3SDAB 3DO3A 4JO3L 2EYRB 4LSUH 1BBDH 4P23C 4NNYA 3VW3L 3RY5A 3CDYA 4RGNE 4LIQH 1HCFX 1OTTC 2FSEB 1QEWB 3SDAD 3FO9B 3GBNL 3HMWH 4RWYL 3MUGA 4G8GB 4OF5A 1I8IB 3L3IB 4E41B 3SDCA 5FV1L 3G6DH 4LSPH 3TBSB 1K4CB 1OF2B 3KPSA 4E0RA 1CBVL 1KGCD 1Q0XH 2X4UA 5FA3B 4J12A 4E41D 1KXTB 3MV9B 4P59H 2EDNA 4N8CL 4XT1C 2R0KH 5F1IB 3QDGE 3EYOB 3C2SA 1AO7B 1K6QL 1A21A 2X4RB 5HHOE 5EUOE 2Z93A 3S96A 5DLML 3RHWK 1EFXA 3DO7B 3GNMH 3K1DA 5IF0A 4N1CA 3MV9D 2VMFA 1ETZA 5M95B 4U1IB 1AO7D 2FWOA 4EN3B 3BHBB 3V6OE 2OQJB 4PY8J 5JXEA 2Q86A 2COQA 4ELMB 2QHLA 2MPAH 4K7PY 4ZS7H 1DBKL 2W60A 4FQLL 3TBTB 3GMPB 5IG7B 4EN3D 4PJDA 1T21A 3K74B 1I9EA 5D4QA 1RUML 3AY4C 3GK8H 2PYFA 4UUJA 4Z7QF 5GRZA 4BH7B 4RFOL 4P2OB 3WKMH 4F33A 2OX5A 1MJJB 4QF1B 4RMWA 4N9GA 3TT1H 1J18A 1HILA 3OPZH 4ONFH 4XCNA 2QTEA 1IM9A 5IHUH 4K7FA 4P2OD 5C9JA 2XRAL 5FCUL 4HPOL 1T1XA 3TN0B 2EDKA 1DSFL 1MREL 1JZ7A 5JQ6H 1JHLH 3IF1A 4RX4D 2ZJSL 1WBXA 2EE6A 4PPTA 3HI6L 2AJZA 3KWWB 4GS7B 2YK1L 5D6CB 1EZVY 1WZMA 3MRKA 3SGDH 5T1DH 3QFJA 5JMOC 4TSCL 3TN0D 4IOSD 4C4KT 4AIZA 4LLWB 4YNYA 4GMSL 5ABDE 4P4KC 2GQHA 5ENWA 2IPTH 1TDQA 2EICA 1JPSL 5HHPB 1MCPH 3WBDA 5I76B 3VFTA 4KK5C 1D5ZB 4I0PA 2B4CL 3T77A 4I9WD 3HB3C 3G5YB 1CFQB 3ZT7A 5D2LA 1HN1A 1E4XI 3CLEL 3OKMA 2AJYL 2WIIB 5CGYC 1BOYA 3DOSA 3MLVH 3QNXB 2QSCL 4QRUB 4NC1C 1LO2L 5B8CA 3D48R 3RUGA 2NZ9D 4KROC 1MRDH 2XFXA 4I3SL 2A6KA 1UJ3B 4Q9BA 5DMIH 4NM4L 3VXNB 4LKXA 5BMFL 4MNQE 4GAGH 1EHLH 4Y5VB 5C07A 1WVZA 2P8MA 2R9HC 1Z9SA 5DJ6B 2R29H 2Z8RA 4NO0A 1EO7A 5IQ9B 3PDDA 3ULUE 1Z0NA 2CLZA 1AGEB 3PDOA 1KLGA 4X7DC 3MRCA 1SY6L 2UVFA 4PJXF 3UJTH 1G1YA 4K7PH 4M1CD 1S7UA 3HFML 4HC1A 1CS6A 3TZVC 2X1WL 2IG2H 3RZCA 2XG5A 4OGYH 1B0RA 4M5ZH 4Z7WB 3E2HB 4RRPG 3TV3L 5CWSA 5CBAA 2A9MH 3O2DL 2C1OA 3IFLL 5I1GL 2AEWA 1OHQA 3CPLB 5DZOA 4PRNB 4ISVA 3WNNA 1T0MA 3QULA 4UT6L 3P9MA 3NA9H 4S0TD 3V6BR 3P9WB 3ZL4H 5F3BB 3MTRA 5KSBE 1CL7I 2V5SA 1XH3A 2Q87A 4D0CA 4DKFH 3N1FC 4YC2B 1BQHG 5B3JE 1BJ1H 1AGDA 4LLAA 1NGWB 4JFEB 4X6CB 5IVXE 3RFZC 4NRXA 2BVYA 3IRZA 4P3DB 5CAYB 5IGXL 1KTLB 1ZAGA 3ECBA 1UADC 2DTML 1HYSC 4WVRA 4JFED 3CUPA 4JY4B 1MFBH 4Q0XL 3SDCC 1CI5A 1WWCA 1VEPA 43C9A 3W9EB 1G6RA 3MRBB 4X6EB 2HA1A 3FOLA 1RZKH 4ZDHA 2CXKA 3FOMB 3O6ML 1I75A 3OB8A 1NCWL 3VXME 1WAAF 1ZHKB 3GJFA 4XX1G 3F7PC 3D25A 2R69H 3QNZA 5ITFA 1NC4B 4YR6B 2VXVL 4QRSA 5D5ME 3GSQB 3MBXL 4DKDC 1T0NA 2IGFL 4Y4HA 3UXFA 1A3QA 4LVNC 1YN6B 2DQDH 3ZO0A 3LQZB 5F44A 2DOCA 5FYKU 1NC4D 3ARGA 2J2ZA 2Z4QB 5JXEC 2OJEA 1KCUL 4PY7B 4FZEL 2R1WA 1M7DA 5HHNB 1B4RA 3JWDH 4MJIB 3Q1SL 4GRWF 4LDOB 1A2YB 5BO1L 1B2WL 3VFNA 3FO0H 4OZFG 5GGSB 5EU5B 1D9KB 2PXYD 1N3NB 1QR4A 3S37H 3RVWD 4HT1H 3QG6A 4HXAL 1X7QB 1KEML 3BT2H 2HVKA 5D7JA 1XFPA 2PUQT 1HDMB 1D9KD 3RPIB 4K23H 4L3CA 2H9GA 3RU8L 2CMRL 5E2WH 4Z78B 4C54A 1PEZA 3JVGA 3PWLB 2PW2B 1FFPA 3O6FB 4MLIA 1JPTL 1Q9OB 2ZNXA 3HZMB 4HDIA 1KXQE 1TZGL 2W65A 4NQDA 1V7MH 3EOTH 3T0WA 3QHZL 5T1LB 1AFVH 2WW8A 4L4TE 3O6FD 1MF2L 3QDAA 4G3YL 4X9IA 1QA9B 5CLWA 2B5IC 3HNVH 4MQSB 3QIUA 3PG2A 1LK3L 5CEYA 4PJEF 4U1NA 2O5YL 5H2BA 4G43B 3H7LA 4I0PC 1F00I 4J6RL 2OCFD 4GRMA 3MV7A 3VFVA 2GCYB 3HI1B 2V17H 1NL0L 1F4XH 3QCUL 1JF6A 4OD2B 5EC2A 1PAMA 3V5HA 5E6IA 4GUPA 4AL8H 2IPUK 4UTAL 5B8CC 1HHIA 1D5XA 4UNVA 5HGAB 3NFNA 3U46A 3VMNA 1KJ3L 2RGSA 3U0WH 3NMEA 4DVBA 5EBMA 5E9DB 1IQDA 2A9NL 2BSTA 4MMXC 1G9MC 2ICWJ 1A7PH 2QADC 3M1BA 3LEVL 4KKAD 4Y4KD 1RJLB 3QQ4A 2FATL 3TPKA 1JCKA 2OR8A 4M4PA 4HF5H 5JNYA 5E9DD 3L9RA 4X7SL 2BCKA 4DUVA 1EUUA 4NKQB 3STLA 1IT9H 5A3ID 4UU9A 1BLNB 4UB0L 3RZCC 2AK4E 2XXCB 3WS6A 2FO4B 4NPYA 4ERSL 3QAZB 1Q9LB 1G7MB 5C3LD 5C0DB 2F8VA 3DVIA 3K2UH 4F7TA 1FO0H 1R5IB 3KDMB 5EU7E 2UWEB 1A1MA 3O4OB 5CJOH 1PVHA 3EYSL 1INEH 1HOCB 5TF1H 1YZZA 3MJ7B 3S4SG 3D5OF 5FOBB 4TVPL 4F7CB 1VB9A 3U82B 3NN8B 4E5XA 3QEQA 1JRHL 4HUKB 1LEGA 1OM3L 3IDIA 3NIDE 4NQXB 5IMLB 4N8VB 1NMBH 4KC3B 5LJYH 1WC7B 4OCYL 5IMKB 1N64H 2YMXH 3DX9A 2C3HA 4MDIA 4X6DA 2HT2D 5IWLA 1NEUA 4OIIL 1LEKB 1I1FA 4CU6A 2F8OA 4S0SD 3AB0B 3QPQD 4YO0A 5LKNA 2XZZA 4HZLA 4UTBL 4JPIA 3B83A 1FGVH 3LDBC 4JFDB 3WUZA 1H8SA 3MMEB 1X5FA 4K55A 4RCAA 5GGTA 4AH2A 1RK1B 1F6AB 5JLZA 1OAKH 3QUKA 4JZJB 5ERWB 5L9DL 2ADIA 1XF3A 4LQFH 1MJ7H 3TH2T 4JFDD 1LDSA 4HFWA 4NO2A 3U0TB 2YN3A 5DJCB 1UXSA 4Y4HC 3GMOB 3LZFH 4MJ4A 5D1QB 4XVJH 4P46A 3ARGC 1UCTA 3TT3L 3UBXA 4IRSB 4P2RB 1EAPB 4OI8A 5IV2A 5JO5A 1PYWA 3DV6A 1FL6B 4CU8A 1X5YA 4HS6B 2R2EA 2QSQA 3QWQB 3F7RA 5D1QD 2HWZH 4NUGL 4KHXH 3NFSL 4ONHA 4IRSD 4P2RD 2EDTA 1T1YA 2OP4H 1ED3A 1U6AH 3R0NA 3RGVA 1MCOH 4JZOB 2X9WA 5K9OA 3PWVB 4XNMB 3RI5K 4ZFFB 5F7LB 4C56E 3LSOB 4OF7A 5IQ7H 1OOAA 1NBZA 3V4VL 5D7JC 3EYVB 1BZ9B 3VFUA 4KHTL 5MENE 1HHGB 1T66D 3JVGC 2R0WH 3BGMA 1Z6JT 4K3DL 4OLYH 4U1KA 2NXYB 3OKKA 4BELD 1VADB 1Q9KB 5BJTB 3P11L 2A6DA 4WEBH 1FV1A 1S8DB 4QXUH 1G9NC 1VSCA 4Q2ZA 4Y5XA 2NXYD 4PS4H 3DVNA 1ZT4B 1VENA 1TMCB 2XA8H 1Y6NR 3WO4C 4QRTB 3ZYIA 2HTKD 5FGSA 3MROB 5DD0H 5C09B 4K9EL 5TQ0H 4RFEB 3QIUC 2DBLH 1K85A 4H1LA 2R2BA 3HC4H 5MP6L 2CUMA 1LK2A 4D9QD 3VFRA 3DETD 4NBXB 2FX8L 3MCKB 1FYHB 2NY4C 5EA0H 5KS9F 5C09D 5EWIL 4O5LH 5HYEA 1TJIL 1QQDB 2K7QA 1FNSL 5JMRA 1FFNA 5E6IC 5DO2C 2H32A 4K8RL 2WSKA 3ALXA 5KOMC 1KLFA 4MB3A 4R4NC 2FYYA 4ELKB 5AUMA 4RMUA 3GM8A 5EBWB 3D3VE 3HAEH 2VERN 4YBQD 4JDZB 5DJ8B 1CQKA 4PJAE 5DHVH 4LLQB 1PG7H 5HD8D 1GZPA 5FYJL 4HKXA 2BSSA 3RL1A 2VDKH 5CBEB 4JY5H 2FRGP 1NCCL 2IQ9L 1OLLA 1HXMB 1J7VR 4Z7VF 2PN5A 2FZ3A 3IETA 4YZFE 5DD3H 5A16B 1F4YH 3QJHB 3FQXA 4S1RL 5A2LH 4ZS6D 1EFQA 1U41A 1ZSDA 2BNRE 4BZ2H 3AAZB 1VHPA 2JLLA 4M6MH 4M7JL 4NQCD 3WS6C 1XGYL 4HK0A 3HMXA 2AI0L 4P2CG 1DLFL 4MXVF 4TVPD 4NKDA 4J23A 1KCSL 1EA9C 1GPOH 5KVEL 3O3AA 4UILH 3RTQA 1I7RA 1IC4H 3G5XB 1F02I 4XNUH 3A0OA 5IMOA 1RUQL 2A6IA 2BOBA 2D7NA 4OM1H 3EFDH 1P7QD 4BH8A 5IVNA 5IBLD 5C0GB 3MYZA 2R4RL 3PQYE 3GIZL 1OD9A 1TJGL 2Y06H 5IB2A 4MB4A 3CFCH 3VD5A 1VGEL 5E94B 4KRNA 1OTTD 3FZUD 2X70B 5IWLC 5FO7B 1P69B 1CDCA 4FFZL 5DGQA 4U6TA 3BDBA 4HIJA 1FJ1B 5FK9B 1C5CL 4F8TA 1SJHB 3L1OH 4KAQH 2G2RB 3ZE0E 2VLRE 2X7LA 2B1AL 3OKEB 3FT4B 3R8QA 5I2IA 4KI5E 3RL2A 4PB9L 5AZEL 1CLYH 2XKNB 3G6AA 2CRIA 5BS0E 2IQAA 4XC1H 2OI9C 3I50H 3QXAB 5IJVA 5IROA 4W70A 3QJFB 1W0VB 1T03L 2X41A 3PP3H 1PGRB 4P46C 4Z77A 5F8RC 1CLCA 1AIFB 5K9QG 1KJVB 3B9KB 4DUXA 4TPRH 1U8NB 3ZTJG 1UZ8B 4J1UA 4HWUA 3DWTA 4N0YL 2CJUL 4Z0XB 1RURL 2QR0B 3VXUB 3B9KD 2X4PA 4DN4H 1QVOA 1BOGB 3OR7A 1MVUB 3D0VB 4U6YB 3RGVC 3VCLB 4PGJA 2JIXA 5INCB 4JDTH 4FQXA 3LQAL 1FGNL 4L8SA 3VXUD 4C58B 5J9PA 5B39G 3MUZ1 4S1SL 4KPHH 1W72L 4XCYB 3X3GL 4JFXA 4WTWA 2NLJA 4MQXC 3Q6FA 4JO4L 4LSUL 4XWGH 1BBDL 2VQUA 1YJDH 5L7XH 5CD3B 5F97E 3HZKA 1AP2B 5IM7A 3TNNB 1JYNA 5KN5A 2PO6B 3BAEH 3BW9A 1U58B 3GDBA 4PJ8A 5TQ2H 1KJMB 1EIBA 1PSKH 1DBBH 4LCWE 5FHBL 1NC2B 3HMWL 1XGRA 4Y5XC 4GSDH 3MPCA 4P4RA 2PO6D 1UVQB 4NJ9H 4WFGD 2HJFB 3TO4B 3Q5TA 2PYEB 3G6DL 4K8RD 1NC2D 5GSVB 1Q0XL 4HHAA 5GRVL 5GS3A 5MEOA 3MX0A 4XNQB 1I1RA 2WNGA 3TO4D 1ZA6B 4HCRA 4P59L 2PYED 2R0KL 4Y8DC 2HT3C 3AMLA 2Z92A 4L3AA 2VYRE 1W0YT 3QHTC 5FYJD 4KU1A 3I2CH 4U1JB 2EDWA 4FABH 3NBNA 2GJZA 1S7WA 5IFJA 4X0KB 4XC3H 2MPAL 2R1XB 5C0BE 4ZS7L 1T04A 4X4MA 2FX7H 5I1IH 2DYPD 1VFAB 1FFOA 3I85A 3MXWH 3RDTA 4EI6B 3NZ8B 3HPJA 3PABB 3BRDA 4LSVH 3QDJE 4RISH 3WKML 4U2ZA 1MEXH 3JSSA 1KPUA 4KWUA 3MYJB 5HGBB 3TP4A 3D2UB 3TT1L 4HUUA 3OPZL 5IHUL 2FEEL 4PGEA 3BO8A 2J8UF 4PGDA 4JGMA 4PJBE 2R4SH 2GITB 2Y5TB 5HI3C 4BQ6A 4G7VH 3D2UD 4WUUB 3HG1B 5JQ6L 4PJCF 4G9FE 2QQLL 5CEXB 4ZUSB 1YMMB 3RTQC 5T1DL 2NW3A 4JFFA 4WUUD 3HG1D 1HH9B 1PD6A 4JFPB 4Z7NF 1UWGH 2AQ3A 5D7SH 3MLSH 4NNYB 5BOPA 1TJHL 5E1HB 2ZUQC 3ESVF 3EFFB 5HDLA 2IPTL 4JRWA 4PJXE 5BV7L 5BQ7A 5IUSA 3RWGB 4BSVB 1N26A 2WWKO 3DRQB 4RIRA 4R8WH 4PREB 5EBGA 4XXDB 5DMKB 3WFHB 2BFVH 1JJUA 5CEZD 1AXTH 3SHSA 1ADQA 2X4UB 1HHJB 3MLVL 1JTOA 3L3JA 3D85A 3ZE2F 2C7UB 4YPGA 5D7IB 2Z93B 5E56A 4EXPX 3OJ2C 4R3SB 4X5LA 1EFXB 5DMIL 2XPGB 1TZIB 3TO2A 4OLXH 4GAGL 1EHLL 3MLTA 3BOVA 4ZO7A 2N1KA 3EGSA 5IROC 1S3KL 3V4UL 3KPQB 4WI2A 2FDBP 3W0WE 3MRDA 1EFXD 4JRXB 1DQJB 4KQ4H 1TVHB 5BRZA 4Q9CA 4WI5A 3U36A 1YYLH 4F9LA 1W0WB 1T21B 4JRXD 3CU1A 1UT9A 2N56A 2A9ML 2HH0H 1HNFA 2XICA 1NKRA 2WLZA 3D39A 1XGQA 1HILB 1WAAE 2X4QA 4FQXC 5DEGA 1IM9B 1XGUB 4L8SC 3WD5L 4H0GA 5IR1B 3FB5A 3NA9L 5C9JB 1T3FA 1KN4H 2Q76B 4O2CA 4D0BB 3MJ9A 5J13C 3BMVA 1JP5A 3T08A 5I74C 4RRPA 4JGJA 1IM9D 1WBXB 4DKFL 2AJZB 5DQJA 4HJJL 3QFJB 5GRXG 1D5MA 3KYOB 1GGIL 3PGFL 5C6WH 4PJ8C 4L3EA 1F5WA 5D1XB 3WHE1 1RI8A 3LHPH 5SWSB 3BKMH 2E9BA 3QFJD 2KZWA 1CIUA 3UTTB 5KW9H 1MFBL 5D1XD 2AV7A 3LQMA 5GZOC 1BQHA 2YA2A 5SWSD 4HIHA 4PP1C 2E7MA 1NCDH 3R0MA 4YFDB 3L7EA 1WEJH 2JCCB 3LEXA 4UIKH 2IBZY 1XF1A 3VG0H 1RZKL 5C0IB 1OTUC 1UJTA 4BUHA 1A6ZA 1GXEA 5D2LB 3V95A 3MA9H 4EDXA 4PBVC 3BPNB 3FFDA 3I02A 3OHXA 3MFFA 2ZSVA 1PW3A 2NZIA 1G9NL 1GAFH 4PJ5A 2MWCA 3RUGB 3BKJL 1UB6B 2PTTA 1N5AA 4M7ZB 4XMPH 1GGCH 1T20A 3DURB 4NCC1 2DQDL 3QSKB 2ICES 2IH1A 3U0PA 2Z8VC 5C07B 4PTUB 4XVUD 4NO0B 4AIXA 1I3RA 3O8XB 3CMGA 1MCJA 3IFNH 4Y4FB 1UH4A 3RDTC 4M9OA 2KZ1B 3MRCB 3BZ4A 5I16B 1NAMA 2OZ4A 5C07D 4ENEC 3FO0L 3OAZH 4PJEE 1FVDA 4NO0D 3L6FA 1K9TA 1S7UB 2QADD 3GZKA 2B8OT 1X5LA 5EOQL 3O8XD 1XF2A 4HT1L 3UYRH 4Y4FD 3RZCB 4M8QA 5DRXB 1B0RB 1Z2KA 5CBAB 5CWSB 1LGVA 2C1OB 3P9LA 1WWBX 5BV7B 4OI7A 2FBJL 5I1JH 4K23L 2BDNL 5D2NA 5E2WL 4WRLA 1DUZA 4WGWB 1G7IA 3RZCD 1T0MB 1RUKH 3HUJF 2P1YA 5EO0A 2D7OA 1BWWA 4R7DB 1BIIB 4WW2F 5CGTA 4HGWB 1V7ML 5IVZB 4WEUD 1A7NH 1AFVL 4WW1A 1A1OB 1GC1C 4Y1AE 5HGGS 1YC7A 1LNUA 4B50A 3QWRA 1LQSR 1P4BL 5EN2A 3HNVL 4EBQH 5I18H 1EHXA 5DQ9A 5DJXA 1JGEB 3WDIA 3CUPB 5IB4A 3LB6C 4LGSB 4NNPH 3P0GB 4MQTB 2V17L 1TIUA 43C9B 1F4XL 1UKQA 3G6JA 2AXGA 2VO5A 4GQ9L 1UM6H 3S97C 3FOLB 4OUUA 4AL8L 3MV11 5ITBL 1V05A 3CFDA 1NQBA 3T2OA 2GW5A 1IAOA 4YHZH 3GJFB 1WF5A 3BUTA 3D25B 3O41B 3QNZB 3KHQA 1JWMA 3U0WL 3O6LH 1DQDH 1EEUA 2Z9TA 1N0XH 4OD3H 4Z7UA 1A7PL 4OB5H 4OGXH 1FNAA 2R1WB 3SO3C 3I75A 2VDLH 4HF5L 4Y4HD 2HMIC 2VN7A 3ZDYF 4F9LC 2OLDA 1I3VA 3ARGD 1WBYA 1U8PA 2YKLH 4XRCA 4QNPE 4LPCA 4WHYH 4HLZH 5L2JA 2VDPL 3PP4H 1JZ8A 3QG6B 1IKNA 2E3VA 1G7PA 4LF3A 2EIEA 4MA8L 3BIAX 4YJZL 1G7JB 3K2UL 4NKMB 5D7JB 4GXUN 1FO0L 2QJDA 3VDAA 2H9GB 5CJOL 2KUTA 1YEEH 1INEL 4LIQE 5TF1L 3UTPD 1FFPB 5D7JD 4XBGA 3ES6B 4R7NA 3GMNA 4OCNC 2EIBA 5KVFL 3QWOB 4J3WA 2CSPA 5I0ZA 2CDFA 1E27B 4YHYC 1L4IA 2YZ1A 3NA4A 5E2JA 1FZKA 4JGUA 1NMBL 1Q38A 1N64L 1MHPH 2YMXL 4XH2B 1DQMH 4PLNC 2VDQL 5E4IA 3VH8A 5HYSB 1U8QA 4CJ0A 4TUOA 5H2BB 5E1AA 1EO5A 5INDB 3QRGH 4GRMB 5T3ZH 2AJUH 4U0QB 3MV7B 3VFVB 5ICYA 5HI5D 1FGVL 2FIRT 3NIFF 5TDOA 1OAKL 3V5HB 4GUPB 3L5WA 3SKOB 2H26A 3AROA 4YDJA 5F88B 3T65A 1MJ7L 3MV7D 4X8JA 1KBGH 2X9YA 4PLKD 1RHFA 3QO0B 3L3HA 1E4XH 3LZFL 4CJ1A 4TSAH 4XVJL 4RFNB 3N1MC 4AT6A 3WNKA 4OAWA 1YMHA 5L2KA 1DCLA 5F7DA 5EBMB 2BOCA 2NTFA 2BSTB 3V52H 4N9OB 5ANMB 4M62H 3M1BB 4PGCA 2WINA 4WNQA 3KGRA 2HWZL 4NFCA 1OWWA 4KHXL 1C5BL 1RZ8B 4LPWA 3L9RB 3GEWB 1S7VA 2OP4L 2IBGA 1MFDH 1NFIB 1U6AL 4PRHA 1BAFH 5JOPD 3AU1A 2W0FB 1NGXA 1NFDF 4GAFB 5IQ7L 4FQQA 3HC0A 3VGAC 4DFHA 4L4VA 3KVQA 5D2NC 4KKCD 2HG5A 5DK2A 2R0WL 4OLYL 3TBYA 4FA8A 1MWAH 3ROLB 4IIQB 1JL8A 5HVHC 5IFAH 5EU4A 4WEBL 4ZTPH 3VXQB 1VFOA 3CD4A 4QXUL 5BVJB 4NDMA 3E3QC 4PS4L 2VLMD 2D9QB 2VZSA 3GKZA 4E5XB 4Z7VE 5FUCC 2XA8L 3WKNA 1YEGH 5DD0L 3IDIB 3NTCL 1CL7H 5TQ0L 3PGCA 2DBLL 2F53E 5KAQF 1K8IA 4MDIB 1YPZB 3DX9B 5I66A 2LVEA 3S3SA 1F6LL 3CFEB 5EA0L 2A83A 4FP8H 3IAGC 1IGMH 1FNEA 4MXVE 5C8JB 1B9ZA 4U3HA 1DTUA 1I4FB 1O0VA 4JQIH 1CT8B 4JPIB 4D8PA 4MA3A 4P3CL 2FJGB 2WZPD 2CR6A 4AH2B 1JGUH 4WGVB 4Y19A 3LRHA 2ADIB 1XF3B 1QBML 2OI9B 1ZVHA 2CDGB 2IF7A 1XF4A 1PG7L 4WY7L 2P8LA 5EU3A 4NO2B 4KKNA 2MHAB 1JZ4A 3FRPA 2VDKL 2X1PA 4JY5L 4MD5A 3QZWB 3WLBB 5F96H 3ZT6A 2ZCLH 4F9PC 1FO0B 4S1QH 5DR5H 3UBXB 1KIUA 5DD3L 1PYWB 3HHRB 4GKNB 4F3FB 5C08A 5FCSH 1U92B 3KLAB 3MGAA 3UP1A 2LABA 2R56H 1UCBH 4ZFGH 1FLRH 1EBAA 4M6ML 1PJ9A 4XBEH 3RWEA 1ED3B 3O45A 3RGVB 5E2UH 1IKNC 4TUKH 5LVEA 4JPWH 1DVFB 4MJ6A 1OGAA 1ZEAL 4HEPG 1GPOL 2VLKA 2V5TA 3VFUB 4UILL 4HMDA 3RGVD 2DICA 4DN3H 3WIIH 1CE6B 1IC4L 1TNNA 3T0VA 3MOBH 2EDHA 2X89D 2F58H 1DVFD 4XNUL 2AJXL 1F11B 2HT4C 4PJGA 1W2KT 3EFDL 1AR1C 4LKCA 2AABH 1CYGA 1EV2E 1QSFA 1D5BB 2HN7A 1FV1B 3SE3A 4NT6A 3DUUB 1QBBA 1SJVA 3U7AA 4HKJB 1A1NA 2Y06L 3DVNB 4POZD 2JF1A 1IGCH 4GFTB 5D71H 1OAXH 2IC2A 3S3PA 3FN0L 2DQEH 3BXNA 5FYLE 3CMOH 4JZNA 1OCWH 4H1LB 5C0AE 3C8KA 3L1OL 4KAQL 3MCLL 1IM3A 2UUDH 2FJFA 4YXHH 4NZRH 3SN6N 4HIIB 3IDYC 4ZOBA 1DQQA 25C8L 5JTWA 3C5SB 5JW3H 3V0AC 1VFBA 2BXYA 4G6KH 5DVLA 4XC1L 3I50L 2HT3D 3BP6A 4YDKH 1PZUB 4LSRH 2DQFA 5IB5B 5AUMB 4RAUA 4LASH 4W68A 3LKRB 1AO7E 2IFGA 3VXTA 2DBJA 1GZPB 4ZO8A 4M93C 4TPRL 3RL1B 1EUTA 1IGJA 4NKOA 3BWUC 3PGDB 1DBAH 3QH3B 1JK8B 3IETB 2FZ3B 3MLWH 1VGKA 3DRTB 4OZHF 5K33A 3BP7B 2EO1A 3FQXB 5I9QB 4HUVA 1S9WA 3QCVH 4JDTL 5HDBF 2GUOA 1QLEH 1EJ6A 2R2CA 3CCHA 4KPHL 5I17A 1AXSA 4QHLA 5LXGH 3DGGA 5JHDE 1I7TA 2HP4A 4PV8B 4PJ9A 3RVUC 1J0ZA 5L7XL 1YJDL 4KJQC 3L7FB 5HI3D 1I7RB 2J8HA 2DIJA 3BAEL 3QUXA 1BFVH 3TCXA 3U83A 5TQ2L 1ZLWH 5IMOB 1JMZA 1DBBL 1PSKL 2A6IB 3B9VA 4F37K 4WFEE 1WUNT 3ARRA 4GSDL 2E6PA 4GW1B 2R2HB 5FDWA 3HE7A 4NJ9L 2WWMC 1QP1A 1S7XB 1MCWM 3HAEB 3VFPA 2DQHH 5DHVB 3P0YL 3KYNA 2AERT 4PIRF 3FQWB 3IXAB 3EW3B 3MRNA 1BFOB 1H3XA 2ED8A 2CO7B 5EORL 3I2CL 1H3VA 3SDXF 1CGVA 5I2IB 3M17A 4FABL 3RL2B 4FQIL 4NZDA 1UXWB 3G6AB 1A6UH 4YXKH 4YAQA 4Z7NE 1RFDH 1XGTA 4CU7A 4XC3L 5IJVB 1L9NA 1FZOB 3KXFB 3UTSE 4ODUB 2FX7L 5I1IL 3MXWL 4ZSOE 1ADQL 3H9YA 3KXFD 4RISL 1YDPA 3IDJB 4KKLC 1ORSB 3KYKH 1MEXL 4J1UB 4RDQF 3JXAA 1NUDA 2Q8BH 4IHOB 4XNYH 3QPXH 4NM8H 4X4YB 2R23A 3TNMA 4AEIL 4YHKH 4YHIA 2Z91A 3MLYH 3PWJA 2JIXB 3IDXH 5C0JA 4G7VL 3TWCH 3ZE2E 5LG1A 3QFDB 4L8SB 5DYOB 1G84A 1ULVA 2CRMA 3SGJA 4BFIA 4K3HA 1QRNA 4OZ4A 1WJ3A 5MI0C 4L8CA 2JIXD 5I74B 3N50A 2IJ0C 3S36X 2Q6WA 3Q6FB 4MGXA 5E99H 4OCXH 1UWGL 5D7SL 1M7XA 3FB7B 3UZEA 3HZVA 1BF2A 4JO2H 4PJFB 5KN5B 1HNGA 3BW9B 3U6RA 2PKDA 1OAYH 1RUAH 3SE3C 4Y2OA 4DK6A 1T4KA 1XGRB 4KZDH 5J56B 4R8WL 5F7EL 2HFTA 3C87A 3GRWH 4KMLB 3BH9B 4P2QB 5ECJE 5FIEA 1SJEB 5IHZA 4GAYB 2BFVL 1AXTL 4LOUC 2P47B 2P5EE 1KYOK 4UNTA 4FTVB 4P2QD 5ICXB 5GZOD 5F6IB 4X9GA 4HUMB 4PP1D 4NQEE 4PJDF 4OZIA 4FFYH 1OTUD 1ZS8B 1CFTB 1FNGA 4FTVD 1BFSA 4OLXL 4NN7C 1IGTA 5ACMA 1I3GL 1ORQB 4ONGH 1AKJA 2GJZB 1Z9MA 3OKDB 1S7WB 1DUYB 2N7AA 1ND0B 4KQ4L 5E03A 1AQKH 1IAKA 3RAJH 3F7VA 3LPWA 4I48B 43CAB 1YYLL 4M7LH 3BYTA 4I2XA 5GSRA 2R1YB 4WFHE 4WI3A 2X4SA 1S5HB 5F89A 1NLDH 3RX8A 3TIEB 1F3JB 4MNGA 1CF8H 2EXYC 1PY4A 2HH0L 3AM8A 3RDTD 5DK0A 1FYTB 1N5YH 4ENED 2WK2A 3JV6A 1U91A 4RAHA 5E7FA 4PGDB 3ZKND 1DE4B 4L5FL 1GCFA 1RK0A 1FYTD 4N0UB 3U30B 3LMJH 4PJ9C 1Z5LB 4DGYH 3TBWB 5E0QA 1JGLH 2VB5A 3EYQD 2NW3B 1UQSA 4LCCA 3SBWA 4U1LA 5T1KA 3CAFA 3RA7H 3QUXC 2PNDA 2I26N 3KAAA 3BKML 5HHMB 3GSWA 4ZPTA 7FABH 5KW9L 3HE7C 1MJUH 1JV5B 4ZFOA 4RIRB 3M07A 1NCDL 1SEQH 3BKCH 3KPNB 4QO1A 5HHMD 1WEJL 2WAHA 2EC9U 4UIKL 5HGHA 5DD1H 1AQDA 3OG6B 3GI8H 3VG0L 1JHKH 4TUJB 1H5BA 1MHHA 3MA9L 4UQ2A 2G60H 3FTGA 3SJVE 2JJSA 5CLTA 4O4YH 1B0WA 2NCMA 2W07A 5I73C 4N5ED 1R0AH 2VRAA 3HUJE 3LB6D 1FL5A 4LSSL 3QA3A 2MTPA 3PXHA 4XMPL 5MERB 1GGCL 2CKNA 2J7LA 3CLFL 1T7VA 4R96A 2KKQA 4QOKA 4JFQA 3SCMA 2BNUB 4H5SB 3EGSB 4HWBH 2NPLX 2W38A 4ZAKA 5JW4N 1DEEA 2CIKA 3MRDB 3ELAT 2EEDA 4JCLA 1HH6A 3GSXA 3H9SA 3SKMB 3DXAE 3SO3B 1B4JH 4P5MA 3SGEI 3SQOH 3P4OB 1LP9B 3DI3B 4JKWA 2M26A 4RAVA 5E9DE 1IC7L 3VRIA 5GISH 4LLVB 3BRGC 2A73A 3PL6A 4QCIB 3MO1B 1FVCB 3ARTA 1F3DH 1MHEA 4CKVX 3T3MF 1RZJH 3QDMB 3OAYK 1U95B 1QHOA 5FUZH 3V5DB 1HKLL 3MNVB 2A6JA 3SGJC 3NCEB 2Y07H 3EJZD 1ZK9A 3LKOB 3H3KA 1A7NL 1MUJB 3BZFA 1QFWI 3FQUA 3GBMH 3DYMA 3V6FB 5DQJB 1D5MB 4V2CB 1Y6KR 1ZHBA 3V79C 4DOHE 3C6LB 4L3EB 5L88H 3ZDYE 4EBQL 5JPMA 3ZE1F 4BZ1H 4PV9A 4FHBD 5FKPA 2GJJA 2MKLC 1OP5K 2IANB 4L3ED 1A64A 4NNPL 1XCTB 1OB1A 4HIHB 3W39A 3OB0K 2CO6B 3L7EB 1UM6L 1MI5A 1MIMH 4KRMB 3WFBH 2IAND 3IAQA 4H26A 4OF6A 5E2VL 1P4LA 4EDXB 3FFDB 4M6NL 1EHAA 3UZQA 3DX8B 1ZVSA 3U4EA 3ULVC 3L95A 1JFQH 4OFDA 3WO3B 4ZXBA 1ZLSH 3Q3GB 4PR5A 3BVNA 1H9VA 3O6LL 4UV4L 2P45B 1DQDL 3GSNA 4MVBD 4RMTA 4PJ5D 2E8YA 3BISA 4KUCF 4QY8A 4OB5L 3OV6A 4OGXL 1B0GA 1ZT1A 3BP5B 4HCRH 2VDLL 3HNTH 2FJHA 4RMQA 1I3RB 3VFWA 3X14A 5HYJB 2W0KA 2XNAA 2YKLL 2D4DA 4HQQH 4BK4A 1T1ZA 1FVDB 5FGBA 3AM8C 1XF2B 3PP4L 2EIZA 3OXSA 3K8KA 4M8QB 1LE5B 1MFAL 1MSPA 3OBAA 5J06A 3NIFE 2WBJA 1SM3L 2M2DA 1DN0A 3CSYA 3P9LB 1U93A 1MCWW 4Y2DA 5DJAA 1YEEL 1DUZB 3H0TA 3CDGA 3LKQB 5GGRA 4XP6H 5EO0B 4WO4B 5SWZA 2LTQC 1JI2A 4JO1H 1DBMH 5E8OB 2D7MA 3QDGA 4XMLL 4XNZB 2ICWB 5E2TH 4LCCC 3SBWC 5IHLB 3IDNB 2CPCA 4RWHA 1A3LH 1CR9H 1K2DA 2OBGA 4WO4D 4PJ7F 2ADGB 4M6AA 3EO9H 2ED9A 3ARZA 1HSAB 2EYTA 4Q6IA 1MHPL 4JFZH 4E42A 2FR4A 1MOEA 5F7UA 4EKXA 5DJXB 1NFDE 2L0DA 3QWRD 5MEQA 3QRGL 2CUHA 3U2SB 5T3ZL 4YDLC 1H5BC 1B88A 4M9PA 4EVNA 2AXGB 5C09E 1N8ZB 3E6HB 5HDQH 2JJSC 1GC1H 1H3TA 2I07A 2HKFH 2FB4H 1P1ZB 3GBLA 2VZTA 3CFDB 4LVHB 2BHZA 3WIFB 3X3FL 4TN9A 1EERB 1II4E 4HPYL 1E4XL 4NO3B 3QQ3A 2HJKA 2V7HB 1KPRA 2AJVH 2BNQA 1X4ZA 2OL3A 4QT5B 4QHKJ 3SCMC 3THMH 1R3JA 4EUPH 3ULUH 2DWDA 3SE4A 3V52L 4EOWH 4Z7UB 4ZAKC 4M62L 1G0XA 2V2WB 2FO1A 1IL1A 2YWZA 4H88H 4ZUUA 2VZOA 3PV6B 3VG9C 4LBEB 4MAUL 5I1AB 1FAIH 3LD8B 2XWJA 1BAFL 5CFHA 3JTTA 3T8XB 5J12B 1EGJH 5CJ8A 4XRCB 2BERA 3PL6C 4O02H 4M61A 4NQCE 5E95B 1P7HL 3O2WH 4WHTA 3BWAB 2SEBB 3BH8A 3ZDXF 3EOAA 2VITB 1PZ5A 5E8EA 3BPCA 2F8XC 2BMKB 3ILPA 2FGZA 3EO0B 3V5KA 5AD0B 4X6DF 4Q6YA 1MWAL 5FM8A 1CDHA 3X13A 4Z95L 3SQBA 4HKBA 2GSGB 1EVTC 5IFAL 3MRGA 2B39A 4IS6B 4ZTPL 4B41A 3MGTB 5GRJL 2NYYC 2ENSA 2V7NB 3N1QC 5FUOH 4NFBA 1CL7L 1AR1D 2EKJA 2EYSA 1WITA 4UZGA 2YPLE 1FIGH 1E6JH 1JPFB 2AKRB 4R6UA 3BPOC 3CFBA 4FP8L 1IGML 3VH8B 4WTZG 1U8QB 2Y36H 2ITCA 3TVMB 3TESA 5ISZA 1XIWA 4JQIL 2XWTA 3N9GH 5HTSA 4K7PX 2UYLA 5D7LA 3OTTA 1JGUL 5DD5H 2IALA 5IMMA 4U6XA 3J7HA 1U8LA 1N7MH 4PRPA 4ZXBC 2A2QT 1R6VA 2GK2A 3KPMA 3L3HB 1DDHA 1H3UA 4V1DA 5IBTH 5F96L 2ZCLL 4S1QL 3B2UC 5C0CB 3MOQA 3RY4A 4ETQA 8CGTA 5F7DB 5CZXD 2BOCB 1GIGH 5BVPL 3D9AH 4PTTB 5KSBA 1YEIL 3MLXH 4P49A 4RNRA 5DURD 5A2KH 3EJYC 4GKSA 3SO5A 3P4MA 3G5ZB 2R56L 4ZFGL 5C0CD 1SYSA 5L2KD 2JJVA 4IMLA 4L1HA 1QLRB 4XBEL 1X4YA 3RKPA 1EZVX 1T2JA 5IVXA 1JUFA 1S7VB 1KACB 5FGBC 4CNIB 1TTGA 1FG9C 1WTLA 1YQ2A 4NSKB 5E2UL 3RZWA 1YY9D 1NGXB 4TUKL 2EYRA 4JPWL 4FQQB 2WBJC 4O2EA 1FE8L 2HTLC 3VXUE 1FSKC 1QBAA 4HWEH 2RR3A 4IOFC 4Y2DC 4DN3L 1CFNA 3WIIL 2VISB 3ZKXC 3FO9A 5DK2B 4YX2L 3TBYB 4G8GA 1I8IA 3L3IA 4E41A 3D6GA 5L8LB 2OR9H 2AABL 1GJIA 2C4FT 3TBSA 1ERNA 3RVUD 1K4CA 2V2TB 1OF2A 2HYMA 4FMFA 4KJQD 3VWJB 5T3ZD 1B90A 5FYKE 5FA3A 4CVWA 3MV9A 1IGCL 5D71L 6CGTA 5TPWH 4Q6IC 5EFIB 1IQWH 2E5EA 4OZHE 5KVDH 3EYOA 4OZFH 2DQEL 4JKPH 3VXRA 3VWJD 3CMOL 1P9MA 1OCWL 1BD2A 3I84A 5HDBE 3ZHKA 4YXHL 4C83B 1WCBB 4NZRL 2VDRH 1FNEB 2EIDA 2ZP0T 4XPGL 3BHBA 1AGFB 2FIKA 4ELMA 5ICZB 5JW3L 4FQCH 2X1OA 1EHNA 2QQKH 3AFLA 4G6KL 4MA3B 4M8VA 1MFCH 4KXZI 4YDKL 3TBTA 1ZHNB 5CJBA 4LSRL 4NBYB 4Y19B 4S1DC 5I8EA 3S37X 5IG7A 1QACA 4G42B 1JWSB 4NC1E 5DRZA 4BH7A 1XF4B 3DTXA 4GG8B 3WXWH 4P2OA 1LWRA 2P8LB 4JHZA 5DUMH 1KB9J 2XN9A 1CGWA 1MJJA 2BVUA 4Y19D 4QF1A 3S35X 1BBJB 1KT2A 4OZGB 1CDBA 2DB8A 4MD5B 3SE4C 2JTDA 1KENH 2X44D 5KSVB 1P2CB 2APXA 5HY9B 1RVFH 1MWAB 4ZO9A 4FQ2H 3MLWL 1ZVYA 3FMGL 3OKYA