3SKNA

Crystal structure of the rl42 tcr unliganded
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
KEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVRAGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords RL42 T cell receptor, alpha chain
total genus 31
structure length 197
sequence length 197
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA02
4XP6H 1QFOA 7FABL 4YDIL 1EHAA 3VG0L 4OF7A 3RVXD 5F1IB 2GJZA 3HAEA 4M62L 1P84J 4K8RD 3RVWD 5FB8B 3VRIB 4C56D 4OF5A 4P9HH 4QXUL 3ZYZA 4E42A 4LRNH 5DMGC 5C7XH 4OLXL 3QPXL 4I2XA 2J1KA 4XWOC 1RIVH 4KV5F 4UTAL 4GW1B 1I3RA 5IHZB 4RZCA 2VWEE 1HXYB 2ORBH 3MRBB 4GG6B 2X41A 5I8EB 4UINH 5C09A 5JDSB 5FUZH 4PRHD 1J88A 2VXSL 1JWSB 3M45A 4J6RL 2HH0L 5FK9B 3I6LE 3FTGB 5JIPA 2ID5A 3MCKB 2XWTB 1U8LB 3WD5L 1A4JB 4JPKL 4X6FB 3AM8A 3MV9A 4ZAKC 3SDAD 3V6ZA 5CEYA 3SE8L 4WFGD 4UNUA 5M94B 4ZXBC 4Y7MA 3VG9C 3ULVH 1WAAF 2EE2A 4HLJA 1I8IB 3G5XA 3FZUD 4U2ZA 3TA3D 5D71H 3N1FC 1CTNA 4M43L 5F72S 1JPSH 5HY9B 5BVPL 3KPSB 4I48B 1G84A 3BEVA 5TH2B 5SWSB 5D7JB 2NCMA 3TWCH 4U7MA 2OM5A 4P2CG 2J6EA 1YZZA 1DL7L 5C3TA 1LE9A 1OTUD 1KN4H 3HN3A 4APQB 4RQQB 2BNRB 2YWYA 5DO2C 4X6CE 3MTRA 5JIIA 1CG9A 1UG9A 1AGDA 1IE5A 1BPVA 3KPSA 1ZHNB 1X5IA 2BSSA 2AABL 3FFDB 4NC0B 3BGFC 4YPGA 4X4MA 5I19L 2IG2L 1FPTH 3TIDB 4LVHB 3FO1A 5JOEA 1I8LC 2XV6B 2Z0BA 4UBDD 5DUBB 3MXWH 4TSBL 1KG0B 3OKLA 1SYVA 3A67L 4OI7A 4X7EC 3N1PC 5GZOD 4EXKA 3H3BC 1G6RA 3MNZB 1YY8A 5D7JC 5I1EL 4NRYB 1A6UL 5MI0B 3MV7D 4XWGL 4FFWC 1IM3B 3W5MA 1FGVH 2WANA 4ODHH 4XNZB 2X10A 2XICA 2I07A 4RAVA 2PO6D 5I8EA 3BQUA 2ZJSH 4M1DL 5K93A 4OGYL 1I4FB 4NZRH 4D0CB 4J8RB 1A9BB 4Z7VA 1IT9H 2EXWC 1DANT 4MD5A 4S2SB 5ICXB 4F7TB 4HJGB 4ZMAT 3BIBX 4OF6A 3QCVL 3HNTH 4M4PA 5FB8A 3LEXB 5FDYA 5IB4A 1ZLVK 1OAUL 1EAPB 3KYAA 1G7HA 2WP3O 2YEZB 1DQJB 1RVFH 2EDJA 3O3DA 5T1LA 4Y2DC 1ZGLB 2NY6D 3Q6GL 4HK0B 3TFKD 4XXCC 5E94A 5JIKA 1JWMB 1GGBL 2AK1L 4MDIA 1HH6A 4EUPA 5K9OB 2VSDA 4RMQA 1D6VH 1KB5B 4PJEA 4J7RA 2CDFB 5HI3D 5IMKA 1I1AA 3FT3B 5IHBA 1FNEB 1EH9A 3EAKA 1JE6A 1OW0A 3OGCB 4Y4FA 5F8QC 2OSLA 4ODHL 3MLYL 1RIUL 3PG2A 3OF6D 3UPRB 3VXSD 1TTFA 3QISA 5K59F 2H26B 2VZTA 5E8DH 4K7PL 3OR7A 4J1UB 4XBPA 5FA4A 4BH8B 5FYLD 4U3CA 3QCUH 3U6RB 5CP3H 3UZQA 4GRWH 4NT6B 1RJLB 4JFDE 2X1PA 4L4VE 3BSZL 3VGAC 4RFOH 4CW1A 3HPJA 1JNHA 2R0KH 2ZCHH 3BWUC 4OZIB 1D3CA 3L5HA 2JELL 2VXVL 3MLVL 3QDGE 3TVMD 1F6FB 1VHPA 4R97C 1CYGA 3OTTA 4JCLA 3UPCA 1NMAL 4AIZB 1VGEH 2Q8BL 2FEDC 5I18L 4R6UA 3QEHA 1IM9D 3D69B 1IAKA 4ODXB 3NZ8A 1JF1B 5EO0A 4N1CA 4K2UL 4U6VH 4PLJC 1RZKC 2IALB 4MB4A 3HFML 1I1YB 2GY5A 4PTTA 4UI2A 1JPTH 2NY1C 4EDWL 3DSFH 5ACZA 2F58L 3IF1A 3KJ4B 5GISL 5IM7B 3BDYL 4LCIL 3GSNH 2Y4SA 3WFEH 5L88L 5A2JH 3WBDA 4HG4J 4Y4KB 4OLUL 4G6ML 1FC2D 4KHXL 3CFJA 4KDVA 3VA2C 3G5ZB 2RGSA 2JJTA 2WQ8A 2CDEB 2HN7A 3PJSB 2X4PA 2DM3A 2HLAA 4Q0XL 3NCEB 5DUMH 4PJ5E 2XPGB 5JNYB 5DD3L 4UMGA 1NGXA 3D2UA 2OZ4L 3DVNB 2DMCA 4JKPL 2GUOB 3GO1L 4MQ7A 4O2EB 5IJVB 1KFAL 5I17B 3D85B 3PP3H 1PKOA 4Y2OA 4AQOA 4GRLD 4HJ0C 4G9FB 5GZOC 3ZL4H 4UINL 3T65A 5D1XA 4V1DD 4FFVC 4X8XA 1ED3A 1DBKL 3LMJH 5JMOC 2ORBL 1B9ZA 1IGMH 2FEEL 4OGAD 4HF5L 2NTSP 3PWVB 1NCCH 2JE8A 3H3PL 5HGAA 1R5IA 1XF4B 2OXGA 3A6BL 3BXNB 1EX0A 1C12A 3TA3A 1CFBA 2FBOJ 4DKDC 5JO5A 4KTDL 5IMLA 4FXKA 5ELIA 4B5EA 4JFPB 2HP4A 2H9GB 3KG5A 1MWAH 4CJ0A 3SDAB 5IWLC 5BZDA 2ADFH 2ESVB 3ARRA 5KN5A 5BRZD 3ROOA 1WAAE 1OQXA 3RPIA 3OSKA 1S7UA 3HI5L 4FHBD 3WUZA 5TF0A 1CVSC 3GIZH 3L3JB 2HRLA 4XWOD 4XC1H 1A3LL 1MIML 3K8LA 2FSEB 1G9NL 2BXYA 4KI1A 2OL3H 4OZFA 3ULUE 2YPVH 2X44D 1ND0B 1RQ5A 4JO4L 4X8JA 5DQDH 1E4JA 3GBML 1JUFA 5B38A 2WIIA 3MLUH 4KDTA 2R0WH 1RZKH 2D03L 4K23H 2VDRH 4NQED 5DFWH 4Z0BL 5I8OH 4RMTA 2QADD 4QEGA 5F3BA 1JZ3A 1KIQA 2DI7A 3SKOA 5EOQH 1TTUA 1QOKA 2X4QA 1IAIL 5J57B 3PIQA 3QFJE 2UYLA 1CXEA 4GG8A 4K55A 3DX9A 4FQCH 1MLCB 4GXVL 5D1QD 4PJHA 3GSWA 3CZFB 1OARL 3CFBB 4U1NB 4LBEA 4ENEC 4OM1H 5C0NC 4X6DF 1B3JA 1JPTL 4EDWH 3ETBF 4W68A 2HT3D 1LE5B 4X6DA 3OJVC 1UADC 4HS6B 3IDGB 3O6FB 4LEXH 4P5TD 1DDHB 3OAYK 3UZEA 4UT6H 1NMCB 4BSWB 5BXFA 1I9IL 2BRRH 4R4NC 1J1PL 4L8DA 4ERSH 4KQ3L 4APQD 4PRIB 4L29B 1U8MB 5D2LA 2BSTA 3B9VA 3U4AA 2YPKA 1QG3A 3WIIL 2P44B 4HK3J 3S97C 3AS3A 2FBJH 4NQXA 2VZOA 1OAQL 5I15L 4F2MA 4NYLA 4H8WL 1Q9LA 4XPHL 4Y4HB 4P59L 3BZDA 1M71A 5E8DL 4QHNA 3K74B 4XAWL 3VI4F 1K3IA 1KEMH 3J8F7 2FL5A 4Y4KC 1S5IL 5GGTH 4B7IA 5HHME 4KRNA 1D9KD 3C60B 2FX7H 3MUY1 2IH3B 4AL8L 3WJLC 1A22B 1IILE 1T04B 2VIRA 4FABL 1M7DA 1CFVH 2G9HB 4YEFA 3OKNB 4G6AC 2KL6A 1FZJA 2A6DA 3FN0L 3RY6C 1FORL 2R2EB 5FUCE 1YA5A 4I18C 4MA8L 1F5WA 4NCDA 1HINH 4GO6B 2GK2A 3EOTH 3VFPA 2B5IC 5J7CC 1TQCB 1SEQL 1Q1JH 1PZUB 2W60B 4LPTA 3EYQC 4X6CA 1UKQA 4RIRA 1FQ9C 2J8HA 5EBLB 3SDXB 1XR8B 3NZHH 1D9KB 1G7MB 4Z77B 3LY6A 5EO1A 1OB1B 1JZ7A 3QUYA 1BOYA 3BP5B 4PTUB 3C5SB 4HCRA 3G6JA 1ZHBA 4ODSH 5AG9A 3KPQB 4G8EA 1BVLB 1CD1A 3WKML 3MRPA 1UC6A 2QBWA 1MY7A 1CU4H 2GSGB 5ICZB 1J12A 2PYEB 3HZVA 4MXQD 1P4IL 3L1OL 1FN4B 4ZUSA 3K7UA 4NN6B 4E9LA 1BBJA 1AE6L 4OGXL 4WJ5B 2W65B 2WZPD 1VDGA 4FP8H 5CMAB 5FUOH 5C71A 2GT9A 2AJZA 4ZSOE 4E41D 5KSBF 3GSQB 4UU9B 3V8CA 2DOCA 2FECI 3OJ2C 4XNUH 4KXZI 4L9LC 5B3NA 5TF1L 3SOBH 3P4NB 1WZMA 4QRPB 4TUKH 3BESR 5HGHA 4ZNEE 3JWOC 1ZLUH 1EEYA 3MC0A 2R0ZH 1FSKC 1H3PL 2BY2A 1XF3A 5D1QB 2V7HA 1AXIB 1EPFA 5IEKB 1MCWW 3QDMD 5KS9F 1WIUA 4NKMB 3WSQH 4KRPB 1GOGA 5HHPB 1FO0A 1G7LA 1UCBL 5EU3A 2PO6A 4HIJA 1JFQH 3UJIH 1S3KH 1QRNA 1JFQL 4GKZA 3UTQB 1MCBA 3QIUB 1FIEA 1T21B 1KJVB 3GHEL 3MUGB 4Q74A 3GMQA 4NBZB 4G7YH 1HZHH 2GI7A 3VCLA 2FJGB 1RK1B 5GGUA 3QDGA 2OXHA 4P2QD 3LAFA 2B8OT 4XP4L 5IESH 1A3RL 3FCTA 4P46C 1UWXH 4W81A 1FO0H 2W0PA 1NBZA 1NLBH 3WFBL 4K7PX 4JQXC 3IRZA 1MCSA 1Z0NA 4Q9QL 1J05B 1RY7B 4UQ2A 3RTQD 3L6FA 3NOIA 4HH9A 2NXYB 1G9ML 2V2XA 3QEQB 2X6MA 2LVEA 1MAJA 4CN4A 4F37F 3CUPB 1WTLA 1PJ9A 5JUEL 4YBLB 3CXDL 4PJFB 2BNQE 2XG4A 4OBSA 2FR4B 5I1CH 2UWEB 4FFZH 4QHMB 1UZ6E 4XMPL 2WK2A 5C0FA 1HSBB 1R5VB 5HXMA 5T5NG 3TH3T 2ADJA 1YEIH 3RNQB 1HXMB 1QLFA 5JORA 1QSFE 1JZ6A 1TCRA 2EO1A 1BQUA 1E6OL 4ALAH 3RU8H 4PJCB 1D5MA 1ZT4A 3MNVA 1SJEA 2GJ6A 1EO8L 1QVOA 1AQDB 4Y4KD 1SM3H 4M1CC 4UT9H 4UZGA 4HC1L 5HBBA 2GITB 3AFLA 4LSPL 2MQ0A 4MCZB 5DK0A 4L8BB 3IFNL 4LVNC 4OLZL 1UXSA 4ZYKA 5IQ9A 1FH5H 1U3HB 1YNTA 2EYRB 2EICA 5BW7C 5ISZA 4OGAC 5T3ZD 1BZ9A 4PJ9D 4BA8A 4MAUL 4HHAB 5ITBL 1MCOH 1CFNA 4LSQL 4P23D 1D5IH 4X6DE 4JHAL 3EOTL 5BS0E 4NM4L 1T6VN 1EVTC 4ORGA 4JRYD 3L5WA 2NXYD 3QRGH 4WIQA 5JUEH 1EXUA 5I73C 4MXVF 1CFQA 4KU1A 3ZKXC 3LQZA 4YR6B 4F57L 1VFMA 4KJQC 1AO7D 1WBXA 2X42A 4F7PB 3WL9A 1D5MB 3TYGH 3EYOA 4GOSA 1QFWH 3ULUH 3BWAB 4G6KH 3U36A 2G2RB 1FP5A 1MF2L 5I6XB 2CR3A 4XAWH 3VXTA 4M9PA 4RBPK 1G9EA 2EIZA 4MCYB 1CFSA 2P5WD 2YOCA 4XTRD 5TQ0L 43C9A 1CFSB 3QHZH 2FX9H 4NSKB 1GOFA 1U8NA 5GGTA 1XGQB 3CUPA 3QNZB 4UQ3B 2Z92B 1FL5B 3UCRA 4HH9B 3BWAA 3DETD 4U1HA 1UYWH 2VLJA 2GK0B 2X4OA 3UP1A 5GSVB 4L8SC 3FQNA 2DLHA 5HYFA 4L8CB 3QWQB 3Q5OA 5CJ5A 5C0GA 1AHWC 1ZTXH 3GHBH 3RKPA 4GLRH 4U1LB 3KXFB 1UQSB 1CQKA 3I9GH 1A9EA 4ZXBA 3KYOB 1HYRC 2JLLA 1TXKA 1JNNL 1ACYH 2QLVB 1PLGH 3SKUD 1NCWH 4LIQL 1V5JA 1GOHA 4JJ5A 2DQHL 5B38G 2HLFD 3MACH 3MBEA 3V95A 5E2WL 3MLWH 3MGAA 1YNTB 4BUHA 5AUMB 4LSDA 1CICB 1ZVSB 2NYYC 3RPKA 4PGDB 4DKAA 3VE0A 1QA9B 5CD5D 2BNUA 2HWZL 1ZT4B 1MNUL 4KZDH 1KB9J 3T4AA 2RQ8A 4Y1AE 1JF6A 1DVFB 2F19H 1EBAA 5CEZD 1OT2A 5GS2H 2NXZD 3GNML 2LAAA 1JTOA 2CO7B 2PR4L 5E6IA 5HI5C 1GRWA 5HDLA 1BOGB 3WKNA 3ZSTA 1L0XA 5CLTA 5FOBB 4PJCE 4X7TA 3CDCA 1ZVYA 2KZ1B 4YHZL 4HUXA 4S1RH 4PRBB 3NN8B 4QRQA 2I25N 3C8KB 2XN9B 3BT2H 1NBZB 4P4KB 4AEIH 4IMKC 1NLDH 5HHQB 3FQRA 1A1MA 3L3IA 1E28B 1P4IH 2GKIA 1ZHBB 3RVUC 1NFIA 3WYRA 3GMQB 1YYLL 4Z77A 2VXQL 3OMZA 2BSED 2BVOA 3HE7D 3L3GA 4PJ9B 3SDXA 5EBLA 5F7UA 2IQAA 3QHFL 2W60A 3ARED 4Y5XB 3HE6D 2DQFB 4R0LA 1S7SA 4HIEB 5F9OH 3X3FH 1BJ1J 1U3HC 3Q6FB 1EEYB 3FZUC 3QUXC 1QBMH 2KH2B 2FD6H 1VADB 5I16B 1R3KB 1DBKH 3MBED 3QDMB 4TOYH 1L4IA 1AJ7H 1QFWI 4I3RL 4ZPTB 5K9KA 1LDPH 3NH7H 1NANH 4UU9A 4FOMA 4KAQH 1IZKA 1G1CA 3LS5H 5CJQL 2FEEI 4TULH 2GT9B 1A3QA 4N0YH 4XRCA 4ZUTA 4ZFFA 4NRXA 1LEGB 4QRPD 3NGBC 1WEJL 5D5MA 2FX7L 3ZE0F 4NO5B 4GJTB 3VGGA 3DO7A 5FKPA 2DQTH 2K3TA 4WCYH 4HWZB 3JV4B 5F7EL 2BVPA 5D2LB 3BD5A 5B4MC 1J5OL 3LB6C 5E8PB 5D6DC 1C08B 5IG7A 32C2A 2D31A 4DFIA 4NUJA 4NJAL 3OKOB 4I3SL 2PF6A 3AROA 3KPMB 4GRLA 3VFMB 3B9KA 4MJIE 3QO1A 4YX2H 1NGWA 3T0AA 5F9OL 3O6FA 2P45B 4M48L 4P4KD 1RJZA 2V17L 5EU6A 2QQKL 4TTGA 1W0YT 5DFVD 5F96H 3ALPA 1KTDA 3CVHA 3LKRA 4K3JL 4P23B 5IGXH 1CDGA 3TVMA 1OQOA 5F7MC 1X5XA 1YJDL 2ZKHH 5KG9B 4M7KH 4LEXL 2ICWB 5CZXC 5DC4B 4DCQB 1MLCA 2NY0D 4ZS6D 5IQ7L 1U8IB 3NCFB 1JGLH 4UBDC 1VEPA 4GAYA 1YMMD 1FLRH 5J4MA 4NM8L 3MNWB 4JN1L 1J8KA 1ZA3B 3CC5A 5IFJA 4IRSA 4JFDB 2HKFH 4L4VB 5IB5B 1S7VB 5LAXB 1JV5B 2FL5B 3VFNA 3VFNB 2XTJD 4LLDA 4P5KA 3PHQA 5FCSH 5L2KA 3OQ3B 4M8QA 4MXWH 3HG1A 5F7HA 5LAXA 4KK8D 1ZOXA 2ITDB 3W9EB 4DOHE 5I71B 3SKJL 1TJHH 5T5FL 5E99L 4FRWA 2GAZA 1A6VH 1SEBB 5KVDH 1B6DA 3DMMA 4RGOL 1IGYA 1NGQH 1RIUH 1J9CT 3IDNB 2DBLH 4Z8FH 1PY4A 1JGVH 2BMKB 4WUKL 4WWKA 3AS0A 1MCKA 3ZYJA 1WZ1L 1I1AD 3HB3C 2E27H 2BNRE 1VFBA 4KROD 1RJZB 5EU6B 1A4KA 4H1LA 5ANMA 4L3CA 2C1OB 4P2QE 1P53A 1J11A 2KUTA 3LKSB 1A4KB 5D1XD 1ZHKB 4XPAH 5GS2D 1PLGL 3VFMA 1CK0L 2K7PA 3ULSA 3VXSB 3UTTE 35C8H 2NR6D 3GFUA 4CNIB 2AJVL 5FYKL 3EFFB 4NQCA 4IBLT 2BMKA 4KI5E 1OLZA 4X5WA 1T0NA 5E99H 2X4QB 4I8DA 1QR4A 3O9WA 3VFGL 3T0DA 4G9FE 1F4HA 1DQMH 1AO7E 5D1XB 5GQBA 4XRCB 2A9NL 3MLRH 3A6BH 1FYTA 3ARDC 3PHQB 5LKNA 2P8LB 2H32A 4BH7A 5JW3L 1VESA 3I3EA 1JV5A 1E4XH 3OR6A 1DTUA 2CXGA 4IRSB 4JFDA 4L4VA 5EULV 3D2UB 1NL0L 3PGFH 5FYJH 2D0GA 4FTVD 4YDVA 1TQBB 5DGRA 2X5PA 2KQMA 3FQUA 3ZKND 1BIIB 4JFZH 4K2UH 3RBSA 5DEZA 1U8IA 3I50H 2J2ZA 2P7TB 3RWFA 4BSVA 2ARWA 3PJSA 5KSAB 1Y0LB 5A2FA 1O7VA 2AAVA 3ECBB 2OZ4H 4G43A 4PG9A 1KJ2L 4X4ME 4KK5C 4OBRA 1IKNC 3MROA 4RX4A 4PRHA 4EZMA 1EFXD 4J3VA 4HEME 4UTBL 4BQCA 4K8RL 1XGTB 3DV6A 5EB9A 4JFHD 4M6ML 1DSFL 4PTTB 2AERT 5AZEL 4NJAH 4JZJC 1YPZA 2ZSVB 3ZTJH 1S78D 3DUUB 5C0JA 2DQHH 3T0EA 1DZBA 3QEHB 3NACL 5IBTL 3SKNB 2VLKA 3EHBC 2A38A 2A6KB 4HC1H 3JV4A 2K9UA 3I84A 2NY5H 3LRGA 4HWBA 2X89D 4KUCF 3SDYL 3N50A 5I9QC 4BQ6A 5IB3A 5I9QB 4OZIA 1OCWH 2J6EH 4M7ZC 3VFVA 1F11A 2R2HA 4PJGA 3HPJB 1LO2L 3VXRE 4CW1B 2AEPH 2NY6B 4ZUTB 3F7VA 4ZFFB 3QG6A 5K59E 3OPZH 3EDKA 4NNPL 4CVZB 1MCEA 5DJDA 3QI9D 2H3NB 1XH3B 3MGTA 4JFOB 5DSCB 2FJHB 3T4AB 2JELH 3GBNH 3MLVH 3D25A 3QAZC 1T22B 2HMID 2FD6L 1ZT7B 4NOFA 1I9EA 4B41A 5TFSL 5ACMA 1XR9A 1ADQL 2C9AA 1CICA 3SE4A 4U3XA 1E0OB 4ELKB 4JY4B 1CLZL 3OGCA 2FNBA 3EDJA 1U3HD 4PJAB 5GRXG 1ZLWK 1I1AB 3FT3A 4JKMA 3MUJA 2OMBA 3W0WB 5GRJH 5EZJA 1U8OA 1RUAH 5HGBB 1H8OA 3RI5K 2NY3B 4RX4D 4KQ4H 1L9NA 2BXZA 4TNWF 4DZBB 3MJ7A 5C2BH 4AEIL 1XEDA 4RMRA 2XY1A 1DQLL 3O3DB 5HHOE 5J06A 4MX7A 4LHUB 5LQBL 3BKCH 4HKZB 1I1CA 5GRYA 2V5MA 2UWEE 4MVBD 3D1MC 3BVNA 1WT5C 3D3VB 1UCBH 3KLAB 1EAPA 5FYKD 3LKQB 4P4KA 4XHJC 4KVNH 3IB4A 3LEXA 1CFTB 2VMFA 3DX8B 3QULA 1W0VB 4K07A 4I77L 4UQ3A 4PJ8D 3U0PA 2VXUL 1MFDH 4JHWH 1MVFA 3BUYB 5JXED 4O51B 5CKAA 1W72L 4FG6C 4LRIA 5DHVB 2PYED 4QYOB 1X5FA 3L7FA 3FONB 1DBBH 4KWUA 5TE7L 3U6RA 3DV4B 3MNZA 2VDLH 2ILLA 1BFVL 5E2WH 3ALWA 3O11B 4HZLA 5JXAL 3IU4H 4FQIH 5HHMD 2VLRD 5EOCJ 5DMIH 2JCCF 4EVNA 4OZHF 3P9LB 1FNLA 2EIDA 3MACL 2X05A 3DURB 3MODH 1ZGLM 2FECL 5F1NB 1MCJA 1EEZB 3QJFA 1EUTA 4MDIB 5E1HB 1YEEH 1CF8H 4R0LC 1VSCA 4XCCL 3MBEC 1K8DA 5DHXB 3CU1A 3K80A 3CXHK 4U1GC 2QQNH 5DUPH 2R29H 4LPYA 1U3HA 5EUKA 5EC1B 5SX5H 1PBYA 3DSNA 5AYQA 4XNYH 1NMCC 2VDOH 5DQ9A 4LSSL 4GAFB 4F9LA 3WNKA 3MNVB 4BZ1H 5GS1A 1WSST 2CUIA 3BEWB 4I48A 4WO4C 3IKKA 1EK3A 4Y16C 4NSKA 3O2WH 15C8H 5CJXC 2Z35B 5EH1A 4R97B 1JGDB 2P5WE 4MYWB 3OJDB 2WBJB 2Q76A 3KYNA 4G6KL 3SE3C 4N8VB 1A8JH 5DTFA 3DI3B 2XTJE 4P23C 4PRAB 4DGYL 4F7CA 4U0RC 3L5IA 1F4WH 1K4DA 4EQ3A 4MAUH 5ITBH 5LGJB 5GRVK 3H8NA 3RDTD 2XIDA 4QNPF 2D4FA 2FB4H 1UKTA 5C2UB 5ID0B 3MRRA 2XXCB 1JNLH 4YHLH 4JHAH 4G7VL 2JTDA 3S37L 4JVUA 1K3ZA 4ODVL 1GYAA 3FFDA 1KJVA 1CGXA 2DYPD 4UDTB 3MXVH 5GS0H 3HKFA 3TCXA 4YHIB 4OAWA 3HZYA 4J3SA 4MAYC 2FATH 1HDMA 5ISZB 5JDJA 1CG9B 3RVVC 4LCWB 3WKMH 4JM2F 1CGUA 3GMPA 3E1F1 1ZS8A 4WTZG 1HILA 3MRNB 3N0PB 2Q86B 1YNLH 5EU6D 3B2VH 2QADB 1U42A 3CVHL 1EFXB 4IJ3C 4IOSD 3HUJE 2R4SL 4ODVH 5JLZB 1NC4A 2ZOLA 4Q7DA 1SJEB 1OP3H 1G0DA 2XFXB 5BVJA 1EHLL 2VXTL 2VSCA 1NUGA 5T3XD 2EH7H 5C0EA 1IAIH 3FQWA 4MDJB 1F4WL 5F9AC 3RVWC 1UEYA 2AJZB 1TQCC 3UTSA 4IIQC 2ZP0T 1VKXA 1I8IA 3CU7A 3G5XB 4AZ8A 1HSBA 4KDWA 4Y1AA 4ODWB 1FO0L 3QQ4B 3OBAA 4EOWH 5CEYB 5K9JL 3DXAB 4LFHD 5DEGA 2Y36H 1HKLL 4JO4H 3DYOA 1R3HA 3CDYA 5LCVL 4EXPX 1F4XL 3SKMA 3O2WL 1QFWM 4G8FB 2IWGA 3FQTA 2X40A 3FCTB 1ZHLB 1IAII 2EDLA 4RBPH 3UJJL 3ARGD 3MBXH 1P5VA 3C5SA 4PTUA 4OTXL 5C0CE 5IHZA 1ADQA 4RFEB 4X80H 1BQHA 5C07A 3RHWK 3M17A 3JWDC 2AJYL 2C3GA 3BRGC 3OXSA 5EU3B 5CJOH 1LO5B 5FIEA 4XPFL 2CGRH 2BHUA 2K7QA 4L4TB 2ZNXA 4EI6B 2GJZB 4ERSL 2CIKB 4NKDA 4N8PA 4ZNCD 3ARYA 3MRCB 3NABL 1JZ8A 4V1DB 5DJAB 1Z9OA 1QD0A 1YNKL 5JQHC 1JPST 4R8WL 5E1AA 3TNMA 3QJHB 2D0HA 1VGKA 4OJFH 5KVMC 2DQDH 1GC1L 5J8OA 2C7UA 1JHTB 4UAOB 1JF5A 3SJVD 2E7LC 3REWB 1W8OA 4M7ZB 4PJGE 4XC3H 4ODUA 4QF1B 4Y16B 2VL5B 1T7VA 1QYGH 3I6KA 3S36H 4YXLL 1FYTD 1QHOA 1KGCD 1PDKA 3RA7H 5MENB 4U33A 4OD2A 3NFSL 3AAZA 5DT1L 5IHLB 2R0WL 1PKQE 4WENB 3MV7B 1RU9L 4KUCD 1E27B 2EH8L 4RGOH 4BSWA 4YDLC 4JGMA 4G8EB 4M61B 1S5HB 4FFWD 3W9DA 4QO1A 3FHAA 4OIIL 5GGVH 1WC7A 3PL6B 4EI5C 1HINL 4RGND 4WI7A 4X4XB 3CFIC 4GMTL 2CLVB 1EAJA 4F3FA 5FO8B 3O2VH 3ES6B 5FHAL 3FQXA 5TGBA 3DYMA 4XNXH 1XZ0A 4Y8AA 3BDYH 5DK3A 4I0PA 3TN0B 3QCTH 4HH8A 1ZT1B 5HVGB 4LPXA 3U9UB 4DOHB 4RFEA 3FT4A 4O2FB 2A77L 3S96B 4XMKH 1P4BL 1Y18A 1CFVL 1HIML 4NQDB 3ARDA 4PUBH 4QXTA 4U1MA 5IEHA 4NQEA 1Q38A 4W70A 1LP9A 4GRMA 3A0OA 3QPQD 2JCCE 3LH2L 4GW5A 1TZGH 1N0LA 3B9EA 4P59H 5EUOE 4TRPL 4PB0L 1TJGL 1ZLUK 5IJKC 4Z7QE 3WE6B 3O8XC 2B1HL 2C3WA 5GS0D 5CGTA 5DMKA 3WIIH 1GH7A 3O41A 3PP4H 5E2VH 2PYEE 1N26A 4JRXE 1HSAB 4C4KT 1XGYL 2OJEB 5TDPB 1YQVH 4OLVH 2YD9A 4K7PH 2J6EL 1A7QL 1PG7X 3FQWB 4MDJA 1RAMA 4XP5H 1B90A 3PWJB 1GGIH 2WBWB 3EZ8A 1S7UB 2WWMC 3MLYH 3K0WA 3MMEB 1W0WB 1H0DB 2MQ3A 5GJSH 4U6YA 3C60D 1BWMA 1CLOH 4DKEH 1MFBL 4OCXH 1YMME 5F9WB 5T1MA 1VACB 4JFQB 1ZK9A 3DRQA 1X4YA 3GSRB 3HMXH 4X6DB 5ECJE 1U8JA 5E8NA 4I3GA 1FCGA 3ULUF 4LSUL 4PRNA 2N7BA 5IT2H 3HZYB 5MEOA 2GIYA 1F6AA 4FQPA 1R3JA 3GSWB 4YFDB 3FFCA 1NEZA 5DEFA 4GXUN 3B9KC 3DO3A 3V5DB 4I0PD 5I8OL 1IL1A 1Q94A 2BVQA 1AFVH 2ATKB 1LILA 1IT9L 2J4WL 2AJUL 5LBSL 1MRDH 3D85A 3PWJA 2JKXA 4H0HB 4AEHL 1BX2A 2NY6C 3X13B 1MHCB 1CL7I 4BM7A 3N9GH 4KKAC 3DHJA 1FZKA 3CCHA 4TUOA 2XRAL 2FSEA 3B2UC 4LPCA 2Q6WB 4AMKL 2FWOA 1A6TA 1ZANH 1I8LA 4E41E 3IDXL 3QUXD 5DQJB 4YBHA 3WXWL 4CN1A 5EZLA 3WHE1 4TSBH 3RL1A 1O7SA 5ITFB 3VRLE 1KCRH 2WUCH 4OM0H 5EORL 4NQEB 1DP0A 4LOUC 1OAXH 5IM7A 5LGKA 4BSJA 1I85A 1KPRA 4ZAKA 5TPWH 1KNOB 3HMXA 3TZVB 4E0RB 1NCCL 1R3LB 1E4XI 1KPVB 3U9UA 4JFPA 2OQJB 3BZ4B 3LQAC 1U36A 5IMLB 3EYFA 3EUUA 4JREB 3L3OA 4HWBH 3D69A 4OCSL 1C12B 1XZ0B 1T2JA 1PD6A 5IF0A 4JREC 3P30L 5HGAB 4JY6A 4LAQL 2CRIA 1EDQA 4U1IB 3REVB 1FLTX 4X4XA 4PJDE 5BV7B 4M6AA 3ARFC 4XVSH 3RJDA 1JGVL 1NCDL 4JPIB 2AI0L 3EDFA 1ED3B 3O3BA 3KNBA 2HKHL 4L5FH 3FRUB 1M1SA 1A7PH 5EZOH 1JYWA 4NHUB 2VAAB 1S9YB 3QUZD 4J1UA 4BELD 3O6FD 1K6QH 3MRLB 5SWZE 1VEOA 4PV9B 5KAQF 3EJZD 2DLEA 2VN7A 1XIWB 3B5TA 1CLYL 4KI5C 4BZ2L 3E3QE 4ZS7L 3WD5H 4XVTL 4OZFG 3QIWD 5EU4B 4XNQB 5F9DC 2ZJSL 1HI6B 2WM0A 2D2OA 2VDNL 4M6OL 2A0LD 5KS9B 4NM8H 4P5MA 3M8OH 2PW1A 1Q9OB 1F4YL 4PLJD 2H41A 5TQ0H 2XA8L 5DHYB 5IFAL 5E94B 5T1LB 1X5HA 2QSCL 4LVNB 1H3WM 2EDKA 4XCYA 5L6YL 4RISH 5JW4R 5EU6E 3WIFA 5K9QI 2XA3A 5CBEB 3ARUA 4N8CL 1GPOL 1TZIB 1JTTA 4ZUUA 3LD8B 2BFVH 4M48H 5GS1C 3FAWA 3T08A 1WCBB 1X44A 4F58H 2Z31D 4ZD3L 4B50A 1AY1H 1IAOA 4NO0B 5DJXB 4RFNB 1VGEL 3TV3H 2R2BA 5BO1L 2J5LC 4MD5B 3E3QC 4S2SA 1NCTA 4ORZC 4I5BB 5DD6B 4EN3C 3MLZH 3U7YH 4ENED 1XF5A 2Z8WC 1CI5A 1AGCB 4JQIH 4ELKA 1Q9KA 4XP9L 4WHYG 5I66B 3QDJD 3BQUB 5F3HA 3BW9A 2B0SH 4BFEA 1GIGH 2GSIA 2LABA 5C09D 5B3JF 3PWLA 1FH5L 4MJ6B 1NJ9A 5F88A 1HWGB 4XXCA 4BH8A 2AS5M 2H3NA 1JJUA 3Q3GB 2NX5E 4L1DA 2D7NA 1KELH 4LMQI 4PRPE 3RP1A 4WHTB 2OMNA 3GJFA 1DUYB 4Z7OE 3UPRA 1I9JH 3X3GL 4MLIA 3QQ4A 3Q6GH 1IM9B 5FKAB 2W9DL 3LN5B 4X7SH 1ZEAH 2VB5A 1XIWD 3KGRA 5TDOB 5C9JB 3EYSH 1ZHNA 4YHML 1EO5A 5T3ZL 4I1NB 4AJ0A 3X3FL 2XFXA 1RVFL 4K94L 4FQQA 1F3JB 3TJHC 1NC4B 2ZOLB 3G04B 3W39B 4NQEE 2E6JA 3E6FB 4OQTH 3CNKA 4HUUB 1MRCL 3D39E 4BZYA 1NFDE 3EOAA 3GMPB 3VFRA 3X14A 4LSUH 5D1ZD 4TSAL 1L6ZA 2GW5A 4HQQL 4HJJH 3CLEH 5HYJE 4ZO9A 1RIVL 4YHIA 3CFDB 4FTVA 1Y0LA 4OLXH 4U6HB 4D8PB 3U82B 3OAUH 1RFDL 2ZCKL 1YEGL 4D9LH 4U1SA 5I1EH 4OCXL 2MNUA 1FCCA 4D0CA 3WLWC 1G7IA 2PXYA 1J0HA 4YGVB 4ZFGL 2E7BA 2NLJB 3SQBA 3BUTA 4HUMB 2QSVA 3RGHA 2YUZA 1QKZL 4OZFH 2P8LA 3PL6D 1T20A 1H3PH 5DTFB 1HHHA 3VXME 3VU2A 2AXGA 2Z8RA 3I6GB 2KDGA 3IS0X 2XZAH 3QXWA 1VPOH 4XBGB 3T2QA 1BD2B 5C09B 1J10A 1KENL 1IC5L 3GUTB 3HE6A 5FA3A 5MP6H 3SPVB 1T0NB 4RZCB 3ARBD 1YMMB 4TVPD 1SMAA 3EO1A 4Y5XC 4MQXD 3P40A 4G8IB 4WI6A 3EBAA 3LKOB 4OSUL 5IVZA 3HRPA 5FUCC 1FNGB 3B3IB 1BFTA 1KTKE 3G5VA 1AGDB 1T7ZA 3V6FB 3TWCL 3WNMA 1E6JL 1D6EA 3NPSB 3QWRD 4JFXB 1HQ4A 2IPTL 3BKJL 5KSBE 4TN9A 5ANMB 3EZJB 4GRWF 4K7FB 3GBLA 3STLA 3ULVL 5HD8D 1GVIA 1BD2E 3BJLA 2FYYB 3OX8B 5D71L 1FJ1B 2ZUQB 5CIPH 3V0WH 5F1NA 1ZA6A 3C09B 5IB2B 3EOBB 4XBEH 4RMWA 2W0FB 5TE4L 3BRDA 3AB0B 1OP3K 3DMMB 3OJMB 1RU9H 1RIHH 3QUKB 1LK2B 4RA3A 2FX9L 3EO9H 4JPKH 1NKOA 1XT5A 3K2UL 2C4XA 4R96A 5E24E 3P73B 3GJEA 2XWTA 4GMSH 4XCNA 2IEPA 2VXSH 3S36L 2YD2A 5EO9A 1KCVL 4NO3B 4DW2L 2NX5B 1K5NB 5EWIH 3MFFB 1CDBA 3F58L 1QFWL 3DUHA 3GSUB 4QYOA 2NY1B 1ZA3A 3TYGL 2H8PA 2Z31C 3T2PA 3QDJB 4Y5VB 5C0CD 2GQHA 1YEHL 4Y5YC 4WI3A 3BKYH 4I4WA 3MV9D 4WY7H 4HS3A 4KRPD 2E9BA 4H8WH 4N9GB 1EEUA 4LLMB 3CFEB 5C0AB 5DGQA 3OKKA 5BS0D 4KKCC 3T3PE 4YC2C 4HGKC 5C0BE 5JHLL 1J86A 4CGTA 5CSBA 3SEPA 5HDBE 4N1EA 1PKQB 2AVGA 4Q6IA 4YHOH 4ZFOA 3V4UH 5IVXB 5JW4N 3KPRA 3IDMA 5F97E 3ARFB 4AMKH 5BV7C 4I13B 5CCKH 1UWEH 1IZJA 5C1MB 3DMMD 4PLOB 5D5MF 1MCIA 4DZBA 2D31B 2DJSA 2P5WB 5I30L 1FBIH 5MEQA 4OCWL 2P8PA 1CGSH 2W9LA 4HXAH 2BVPB 2B2XL 4CN6A 1GCFA 3RWCB 1UA6H 2UVFA 2HFGH 5D2NA 4Q9RL 2J4WH 3QUYC 2DLFL 2QV2A 5CIPB 2VKWA 2OTUB 1JWUB 1PG7H 5EBGA 5LGHH 4ONFH 3U2SA 3CX5K 4KJQD 1DVFD 3GJFH 1HNFA 5DJDB 5DA0B 1KYOK 3QUZB 4ZTPH 2AJ3A 3P0VH 1I85C 4K7PY 1NBQA 3KJ6L 4GW4A 3KYKH 3LSOA 12E8H 1BJ1H 3TT1H 5IB3B 3SDAC 3UTZB 7CGTA 4XP1L 2RHEA 1MQKH 4OF8A 1S9WA 3LKPA 3SKNA 4EIZC 5MEQB 4Z5RA 2V2TA 4HKBB 5C0RL 1MJJB 3QWOA 3V0VA 2A0LC 5C0JB 1FAIL 1B0GA 1OT1A 4OIBA 2F54D 3PDOA 3HUJA 4X6EA 4WI4A 1HHIB 1X5YA 2NYYD 3EO0B 4K3EL 4FQ2H 1NFIB 1I7TA 3CMOL 3GIZL 3EJZC 2D4DA 5FF6A 2EDHA 2I27N 3X11B 1JMZA 1NBVH 3BHBA 3MROB 3S5LG 5D7SL 1QSFA 1T1WB 3O4LD 4LLVA 3IVKB 4G43B 1A0QL 3DBXB 4HMEA 2PO6C 3IJHB 4PG2A 4LPWA 2FB4L 1EZVX 1RZ7L 2IADB 3FOMB 2F5AL 3LD8C 4YWGL 3ET9F 5I74C 5IKCB 3MRMB 2NZ9D 4MB5A 2V9RA 1FE8H 1MJUL 3QFJD 1K5NA 3QUZA 4AG4L 3NIFF 4WFED 1DVFA 1KULA 4HC1A 4W6XB 4HUVA 1QP1A 4EEEA 2YXMA 5J1AB 3RKDD 3PWNB 2E7LA 4O02L 3C5ZB 5H35A 5AUMA 3C2AH 3NCYS 2O5ZH 5JXEC 1Q72H 3UAJD 4FQXB 3JXAA 4NQCB 4ONGL 4IIQB 1FFNB 5BV7H 1IGIL 5HYIA 1P7QD 1T1YB 2DLTA 5MHSE 1F90L 5ALBH 3D18B 3QNYA 5GGQL 1T0MB 3W2DH 5I8CB 1EGJL 4XMLH 4JRYE 4DTGL 1YECL 1A9EB 1U2HA 4ZXBB 4LARH 4LIQE 3HAEH 1H5BC 1B4JH 3EYUL 1N8ZB 1D6EB 1N5YH 3O81A 2XWJB 3CFEA 2JF1A 3GM0A 1ES0B 3OKMB 3R0MA 3B3IA 2GK0A 2X4OB 2W59A 3E8UL 5IBUG 1INDH 1FL5A 4LHUD 4GKNB 4X4YA 2H2SC 5DJCB 4YEEA 2Z9TA 5BS0B 5LXGH 3SE9L 3IDNA 3WO4C 1AP2B 4UIMA 2ZCLH 4YHKH 4ZUVB 4LGSB 2AXHA 4OCWH 3UTPD 5DJ6A 4DQOL 2EYTA 2ITDA 2AEQH 2AXGB 1A1OA 1LHZA 4TVPH 3K1KC 4P5KB 3U4EB 3RDTC 4Y2DB 4F7PA 2I60L 4R96B 3TBTA 2NY5C 2F15A 2NLJA 4QRRB 1O5DT 3O8XA 3TNNA 1EXUB 2EEBA 2AJYH 4MNQD 1WZKA 3T1FB 3VMNA 2HJKA 3V7MA 2NY4C 3VFTA 2DWDB 3UEZA 3LDBB 5DI8B 4X99B 5TJWK 2XYCA 3CVIL 4CKVX 4KVNL 4P0DA 5DJZB 3TVMC 4D8PA 4LSTH 2E3VA 5JZ7C 5KSBB 1IQWH 3C9NB 3SCMC 2FO1A 2ITCA 5SX5K 1ORQB 2PW2A 4YQXH 1YEHH 2BNRD 3KYMB 1L7IH 3OB0H 2Z4QB 1RUKL 1X6LA 3VH8G 3X14B 4CU8A 1UXSB 4ZYKB 1QZ1A 2R1XB 1JTPA 2B1AH 4RGNB 4LGRB 5DD5L 4J3WA 3RIFK 3RWHA 3ARGC 1JYXA 43CAB 1XGPA 1KCVH 3B9KB 3K1DA 1U95B 2QKIA 3T3MF 3GSXB 5FM5O 4IOIA 4HUWA 4DKFH 4JPWL 4N0UA 4TTDC 5IG7B 1V3LA 4QOKD 1LO4H 1CTOA 1F42A 2DL2A 4HWZA 4UDUB 5DURB 3IGAA 4XVJH 4NO5A 4QHMA 3TGXA 3GUTA 5J1TC 1ZWIB 4PJFA 5IMOB 1WWBX 4NRXB 1I9JL 2J5LB 3X3GH 1AR1C 4A6YB 1CZ8L 1E4WH 2PYFA 1UH4A 4G8GD 3RWDB 3L6FB 2QSQA 3L3KA 4O9HL 1VFAA 4WI9A 1ZEAL 5AD0B 4NPYA 2AK4D 4H1LH 1DEDA 2QHRL 1RHFA 1WAAA 4YGVA 4DAGH 3AXLB 4X4ZA 1I9RH 1BLNA 4CU7A 1KELL 1P5UA 2NY2B 1NC2A 2YA0A 4PRPB 4LLWA 2FX8L 4JN2A 3QIWA 3QIUA 2IC2A 3V52L 4Y5XA 3MLZL 1DQQA 4Z9KB 4HKJA 3DPBA 4KTYA 4R3SA 4JQIL 4HCRH 3W5NA 2D9CA 4P5TA 1XF3B 1HHJA 2QADC 3RGVB 4N90E 5CGYD 4RGMB 2CKBB 3TP4A 1A1MB 4XCYB 1J8HB 4OI9A 4C58B 3SDXF 4NC1E 2R4RH 2NW3B 1CD9B 3MV8A 1QSFD 2F54B 3O4LA 4LHJB 3VXNA 3KPPB 5IR1B 1IFHH 1YN6B 2DF3A 3OB0K 5KVGL 4WJ5A 1TJIL 1R0AL 2Y23A 2ZCKH 1RZIA 1NFDB 3OAUL 5E5RB 3PQYB 5D7LD 1C16B 4HPYH 5DRNB 5T3ZE 1X6NA 4M7JL 3H42L 4JVPA 4OB5H 1K2DA 1N5AA 3BD4A 2X9YA 4GBXB 4PRID 2NW3A 5EBWB 4OLWL 1CBVH 2BNUB 2C3XA 3F65A 1BVLA 3GMRB 2H2PD 4DUWA 4MNGE 5ID1A 1ZVHA 3HPLB 2R39A 1PY9A 1BGXH 4MJ2A 2X70A 2A83A 4KJYA 1KPUA 1OB1A 4RAHA 3TO2A 3CK0L 5ESQB 3T4YB 1ETZB 2Y7QA 4N90D 2CRZA 3PHSA 4JY6B 1KIPA 4R3SB 1OSZA 4RIRB 2ITCB 3E6HA 2YMXL 3T1WA 5ISZD 2DQEH 5J89A 4WW2C 1FL6B 5HPMB 4ZUUB 2EC9U 1NC2B 5KANG 1QSVA 2QQLH 1M7DB 6FABH 2DM2A 2OK0L 1BEYH 4PRHE 4PFEA 1FAKT 4U1GB 5ITFA 3JTTB 4P2YA 5ERWA 3UTTB 3WV0A 5EZLB 3ZE0E 1INQA 1A1OB 3LEYL 1MWAA 5IOPB 1AIFA 1GZPA 4NYLB 3OB8A 4XNQA 3IFPB 5FCUH 3K8KA 3TPKA 1KB5L 4NCC1 1P6AB 2WUCL 2P24A 5FGSA 1OHQA 2L4OA 4NWUL 4X0KA 3ZE2F 1A6AB 1MHCA 4DGIH 3MRLA 1DQDH 3BKCL 1RPQA 2DWEA 4LCUB 4N0UB 4NQTA 1ES0A 4JO3L 5DF0A 5DHVH 3DVGB 4PJXA 3WNLA 1U95A 1WBXB 3DGCR 3P11L 1AH1A 3FRUA 2XWJA 2LVCA 43CAA 3VRLF 2VLRE 1UM4H 5E95B 4MNHA 3H7BA 4M7KL 2O5YH 4OIAA 5MEND 3C6LC 5C0AD 1MCPH 3REVA 5FYLH 4NFBA 2B7DT 1FV1B 3ILPB 4FXLA 1HH9A 4JG1L 5KTEH 3D18A 1ORQA 2QQKH 1QRND 1ADQH 2CK2A 3M1BB 4WO4A 3C9NA 5BOPA 3P4MA 2CR6A 5E8OA 3PNWA 5DYOA 2I60H 1IQDB 2DQIL 4KI5D 1CL7H 3HNTL 1CLYH 4BZ2H 3PIQB 3HMXL 3TZVA 2E9WA 3T1FA 2AEQL 4IJ3B 4ZAKB 3O8XB 3TNNB 1KXQE 3QUZC 3RL2A 3CSYB 4PB9H 1WIOA 4WU7B 1C8PA 1W0WA 1EFQA 4OFDA 2VLRB 4JGUA 3ZE2E 4KDTC 3Q48A 1R24A 4OQTA 2MTPA 2I9LB 5ETUA 2JJSA 4C56A 4PG2C 2D7TL 1SHMA 4ZUVA 1R5VA 1PG7W 4WTWA 3VXUE 4UT7H 4JHBA 4ZOEA 4G9DA 1I7RA 4L3EA 5E8EA 3F7YB 5ICYA 4TUOB 1FZKB 3CCHB 1Z9MA 3IU3B 4X9GA 3SBWA 4X6CF 2B1HH 1PVHA 1UACL 4KROC 4X7DC 3OG4B 2LE9A 1TZGL 4O00A 4QKXB 5E5MA 3QNXA 2IPKB 4EI5B 1P7HL 1MI5E 4AEFA 3X12A 2CK0H 1AY1L 2ZWLT 3JWNC 4RAUB 4D9QD 2ESVA 4DVRH 1Y18B 1KSRA 2QL1A 3C5JA 4QRSB 2EEAA 1AQKH 4JRXA 2HVKB 3CLFH 3MRJB 1INEH 4MZ2A 1M05B 1FFNA 4NKMA 1XF4A 5E8NB 4KVCL 5CZVH 3RUGF 2OTWA 1F2XK 2A77H 5FGBC 1A7OH 3B4NA 1FFOA 4WRLA 5EU7E 4OZIF 2YPLD 2QEJA 4LARL 1OL0A 4QRPA 4I9WD 1X9QA 4M7LL 1KCLA 1N0XL 3HCVA 4POUB 4O58H 2Y07L 5ALBL 3TZVD 3HI1B 3MA9H 4O2EA 3U2SB 2HFEA 5T1KA 4MJID 5C0IA 4PJHF 1XCQA 3ZTJG 1BQSA 4XVJL 3WFHA 4Y19E 5D7SH 1QBLH 4RA0C 1A7PL 5DMKB 3KDMB 1SY6H 4G6JH 1W8NA 2RFXA 4DN4H 2F53A 3CMOH 3MR9B 4EN3D 2GSGA 5IT2L 4YGAB 2CMRL 3UTOA 3G5ZA 4DWHA 4EUPG 4GW5B 2J8UF 2P5WA 2AK4E 1LNUA 1LGVA 4HKXA 3TNMB 3MCLH 1P4LA 3DROB 1WUNT 1LQSR 3ARDB 4QXTB 4RWYH 2XZCL 5DJAA 4QXUH 4DUVA 3SQOL 2CRMA 3QXDA 4MA3B 3T0EE 3ZHDA 4K8RC 3VWJC 2H1PL 1IMHC 4PY7B 4NBXB 5ANME 3FT4B 4HT1L 4L4TA 5EO0B 1QRKA 4TQEL 1YNKH 3TN0A 1RURH 2YHGA 3TA3C 3SO5A 4OLYH 3CSPA 3G6AA 4Z6AT 4HG4K 5IIEA 5DRZA 4F3FB 5I1AB 2Y6SC 4X80L 4YFLF 4JM2C 3DIFB 3FMGH 3BIKA 4S1DD 4XPFH 4PYHA 5CJOL 1T04A 3MFFA 1V7NL 2ARJQ 3UJJH 1DQTA 1RJLA 5J6GA 1HYSD 2VL4A 1MIEH 5D1ZC 4MHHI 3T0EC 1UB6B 2YPLB 4Y4HA 1Q9LB 2OCFD 5CILL 1RUPH 2Y36L 3KS0H 1FZMB 1P7QB 5GGVY 3ZDYE 5F96L 5D2NB 3R0NA 1F4XH 3RWCA 2CD0A 5GZND 5IMKB 3WEXB 5IB2A 1ZA6B 3FMGL 2FO4B 1FJ1A 3Q5YA 1FHGA 2CKNA 2ZNWA 4ZOCA 1A14L 4X5XA 5FHAH 4PGCB 2I24N 3D39A 4XZUB 4D9RE 4HEPG 4TPRL 5FOJA 5HYJB 5IVXA 4O4YL 5D2LF 4CJ1A 2DLFH 2H2PC 4RDQF 4JR9H 1G7HB 3LHPH 4YNYB 1OP5K 5IVXE 2DQTL 4WCYL 4OF0A 1EJOL 4HUNB 3UX9B 3QIWC 5BV7L 1U6AL 1BMGA 1JNJA 5EUOB 1MFBH 4XI5D 3JWDL 3RY4A 1BHGA 4CVUA 4OZ4A 4WDIB 4UT9L 2X4TA 3QIUD 4I3RH 4S0TD 5DRWA 1G0YR 1QNZH 4NFCA 3TN0D 3BPNC 4YHLL 4XBGA 2IANB 1K4DB 5EC2A 3QO0B 3MOBL 5E9DB 2VC2L 5HTSA 5MHSD 1OY3B 5TE4H 4I0CC 1PX3A 4GBXC 1F3RB 5KSUB 3VXOB 1EMTH 5KBNC 1NGYA 1MPAL 3KYNB 5DEGB 1Z5LB 5C6TH 3OJDA 2PCPB 1F97A 4XCFL 3U7WH 5IP4A 2LQRA 5DFVC 2BSRA 4IRZH 4XPGH 4U1SB 2C3VA 4PRDA 3VGDA 2BSSB 3G9AB 25C8H 5I6XC 5JIHA 3SE3A 4NFDA 4JQVC 2HFFA 4LKXA 3ROOB 1RSFA 3GB7B 2EDYA 4MSWA 3B43A 3LRSA 2BX5A 4HUUA 3ZTNL 1C5CH 1AKJA 2ED9A 5DD1L 4PJAF 3U1SH 3V4VL 4NCC2 1GHFH 5GJTL 2H6PA 5H37G 3V5KA 5I76A 2I9TB 4ELMB 1U8PA 5DS8B 3UJTL 1WWCA 1M6OA 3MLXL 5D8JL 4HFWB 2EH8H 1FRGL 4M3JA 1A2YA 4YHNB 4PYGA 3TCLB 1TNMA 1TLKA 5TF1H 4CBPA 1HN1A 2HWZH 4ZTPL 4YDKH 2I5YL 3WHE0 1WQVT 1YC8A 3I6GA 4J4PD 2E5EA 4HZLB 5F70A 1E6JH 1OGAB 5EIVA 5F7LB 4MQ7B 5A3ID 1JWSA 5CSZA 1JPGB 4JO2L 2DD8H 3AREC 1YNLL 5CJ8A 2ICEA 1IC4L 1GGTA 4UUJB 3FB8A 1ACYL 3HE7C 1HXYA 2E7MA 2Z35A 1U3JA 3TBSB 4GW1A 4TTDD 1D5ZB 3JTSB 1UJ3A 1X3DA 2JB6B 4FXGA 2VQUA 4OT1H 5CCKL 5EFIB 1P2CA 4CVXA 4LU5L 2YD6A 4P48A 4Y4KA 1I3GH 1UGNA 1WCBA 2NY1D 3ZMRA 3S37H 3PL6C 3ZLQC 3SDDD 2WWMD 3WHXA 2DL9A 4HMDA 3BVNB 3P0YH 4JG1H 4KY1H 3ZTNH 2IF7A 5HYQA 4J23A 3PQYE 1NFDF 1OAZH 4HGWB 1F3JA 5J9PB 1TMCB 5KVEH 3S35X 1KCSH 3IFLH 2PW1B 5H2BB 3DX7A 4HS8H 4N0CD 4JCMA 1NAML 3H6JA 3VXUD 4PJAA 1RMFH 4XI5C 5FKAA 3RJQB 2PKDA 5GSRB 4JY4A 5JPNA 2D7PA 3V5HB 2Q87A 1RJYB 1DUYA 1RV6X 5IV2A 1B0RB 3NA4A 3AUVA 1OAZL 3ZDXF 5C8JA 2VAAA 4FFYL 4LSQH 4HXBH 3IJSB 4Y89A 4KMQA 2VC2H 4N9OB 1EHLH 5DLMH 3ULUC 3FO0H 2JJSC 1BZ7B 1KCUL 2V9QA 1OPGH 2FJFB 3DUSB 1JGEB 2IH1B 3GSNA 4HX1A 4XHJD 1JHLL 1TVHA 2H45A 5FM4A 3DX6B 3NCCB 3TT3L 5I1HL 2YK1L 4MMZC 1N6QH 3ARSA 1KLGA 4F8QA 5EN2B 4EUPB 5K9OA 4N0UE 2X1OA 2V7NA 1J0JA 1W0VA 2QQQA 3IDYB 1ZE3C 3MV7E 1IAOB 1JWMA 5DK2A 5FM5M 2HFTA 1C1EH 3E0GA 4LLQA 5F6IC 4PJBF 4NWTH 4HBQA 5EDXA 5EBMB 2XA8H 1TQBC 1F4YH 1JBJA 4HMCA 5GS0L 4RGMC 1I3VA 3DV6B 4HKZA 1U8HA 1EVUA 3AY4C 3VD4A 4M6MH 4JM2B 2YD8A 4GSDH 3K8MA 4NO2B 1T03H 5IB4B 4NC2B 4FFZL 4JFFE 4XB7A 5AAWA 1P2CB 4OSUH 5DK2B 4MXQC 5LWYH 2H2SD 2OR8A 3HLAB 2JB6A 1Q9OA 4MB3A 4F7TA 4WUUE 5HGBA 5DR5L 1KLGB 2P7TA 4JG0H 3RWFB 2BVUA 4DGYH 2O61B 1ZV5A 1IC7H 1A5FL 1WWWX 1FRGH 2ICEB 1XIWA 1DN0B 1X7QB 2VLKD 4HDIA 3LPWA 4KK5D 5DJYA 4PV9A 4RISL 3IXTA 2QSCH 4JFZL 3QEQD 4MJ5B 1XH3A 3MGTB 4HPOL 3U4BL 2XZQH 3VW3L 5L2KD 4ZO7A 1KG0A 3OKLB 2ZPKH 1U41A 4WGVB 4DK3A 3TCLA 2R1WA 3C2SA 4MS8D 4GRWB 4IOFC 4D0BB 4WGWB 3U79A 5GS0C 4M00A 3HC3H 5C08E 3QG7H 4HFWA 4WWID 3MOAH 3DX7B 4CNIA 1F6AB 4HJJL 5DS8A 1WBZB 3INUL 4K3HA 1QRNE 2Y5TA 3FB7B 1KXVC 4TSAH 4PRNB 2H6PB 2QQNL 5DUPL 4OM0L 5EORH 2C1PB 4NHCH 2AQ2A 3QXAA 1ZHKA 4OGZA 3DRQB 1BREA 5E4IA 4E0RA 4D9RD 4L5FL 3V0AC 3ARGB 2JCCA 3MCG1 3T8XA 3SGKC 3ZT6A 1FVDB 5FUOL 1U91B 3O0RH 3IKCB 1J8HE 1HEZB 1CK0H 2FLBT 2O5XH 1NSNL 3EJYD 2AJSH 3NPZB 4FXGB 2AEPL 2YS4A 4PJHE 5DQJA 5JXAH 1CU4L 5C0ND 1ROWA 4PJFE 4O9HH 5F6HI 4Z8FL 3IDIA 3VH8A 2J3SA 4Z7WE 5F7KC 1NQBA 2CLZB 3W9EA 3BISA 2E9IA 5KSUA 5B39G 2DQGL 1BAFL 1KLUA 1T1ZB 2EDBA 1NAMB 3FTGA 4R90L 4X5LA 3NCBB 2P8MA 4LCCA 1DBJH 1IEHA 2XOTA 1CR9H 1S7VA 1JI2A 1HWHB 1TJHL 2HT2D 2KKQA 1QHPA 5T1LD 1Q1JL 1S9VA 4JZJA 4YHNA 4JN1H 4PY8J 3ROLA 1PZ5B 4O2FA 4UV4H 3MRDB 1TETH 1GGUA 3TV3L 4O2CB 2DKMA 1KJ2H 3NFPB 5AEAA 3U0TA 5E7BA 5IROC 4LCIH 3CDGB 2JJWA 1UEMA 5I2IA 3CVHB 1KTDB 3LKRB 3ARFD 2NMSA 3S37X 1IGCL 4L8SA 4QHUA 3HFMH 2AJUH 5EZIL 1S7RB 1GGIL 4YNYA 4YJZL 1KEML 5EZIH 4Y4FC 4IMKA 5FYJL 1H5BB 2IBGA 2ZOKA 3TBYA 1T80A 1F8TH 2GJ6D 2V9TA 5E2TH 3U30C 3CAFA 5ALCH 3QO1B 1OAYH 4JJHA 4LKXB 3EFDL 5IW3A 1E27A 3FN9A 2X09A 3OXRB 4UV4L 4YBQC 3VXMD 5B22A 1MFCH 4FQJL 4JM4L 5J13C 4PJ7B 4WWKB 1FFPA 5L7XL 2OJEA 4WO4D 4GXUM 3NA9H 5AWNL 4ZPVB 2ADGA 3DXAD 1AI1L 3DJ9A 2BRRL 2A73A 3QDJE 3QUXA 4WU5B 4ZFZA 2R69H 3UTSE 4F7MB 1P84K 1OF2B 3MREB 4MWFA 3HS0A 3OAZH 4PBVC 1J5OH 2GJJA 2NY5L 2BJMH 4OD1L 5F1KC 1C5BL 4JEGB 1NFKA 4H25B 2DAVA 3B6SB 3ELAT 3OZ9L 4NQDA 3VFUB 3WDJA 5KANI 2C4FU 5L9DL 4LLYA 4NGHL 5CAYB 4EI6A 4RNRB 2DQFA 3O0RL 4FQJH 2XQBH 1NUFA 3IYLW 3W2DL 5L8JB 2W07A 3DETC 4R4BA 3KPNB 1YPZE 3NAAL 3QXUA 1KEGH 2R8SH 5SWQB 5FYLL 1J87A 2EECA 2BY0A 3VFUA 4U7KA 4WEBL 5HHMB 4ZOBA 2YUXA 5FXCH 1G9NH 3BPLC 4XMKL 1N2RA 5JR1H 3PHOB 4PGCA 3MUHL 4IMLA 1IGCH 2BERA 4MMXC 4JO3H 4Z7VE 2ZUUA 3NN8A 4N5UA 4YO0A 2AV7A 5SWZA 4Z95H 1D7FA 2DBJA 1CICC 3SE4C 1YQ2A 1T7WA 2APBA 3UZVB 1HHKA 3LDBC 5CD3A 1CXLA 4QT5B 2WBJD 4AG4H 3QUMB 3VXUB 1BZQK 2A9NH 3MLRL 1YN7B 1FZMA 1P7QA 2CIIB 3REWA 1FFPB 4Z7WF 2CQVA 4WNQB 3CFCL 5BVJB 1A5FH 5E5UB 2WLZA 1S78C 4PJDF 1AO7A 1FC1A 4JDVA 3R8QA 2ZUWA 1K8IB 3BIKB 3MRNA 2ERJB 1HILB 4MHHG 4PBWD 2R23B 5D7LB 1CIDA 4PLKD 1HNGA 1PYWB 4L8SB 4OFIA 3C08L 4QHUB 3MBEB 4G8GE 4HZAA 1BF2A 3GSVA 2Z8SA 2C3HA 4KUZH 1QLRB 4J12A 1UACH 2IFFL 2VDML 4PD4J 3OXSB 5GIRA 2IMNA 4RDQG 4AH2B 3VW3H 5I1GL 1EERB 3GRWA 1FAIH 4DEPC 4UT7L 3VWKA 3RWGB 1S9VB 4U1LA 4RMUA 4YXKL 2P49B 3SGEI 3O6LH 1NCWL 5C0GB 1H8SA 1XCTB 3QNXB 5E5MB 1JPSL 1Y6KR 3U48A 1MLBA 5IB1B 5KVDL 1OGAD 1XAUA 3P2TA 5ENWA 4WI2A 5TDNA 5T3XE 5AZ2H 3MA7B 1R3HB 5SV4A 5C6PB 4TUJA 3TBVB 3PV6A 4L4TD 2RFXB 2CLZA 2WBJA 5DLML 4Y1AB 4G9DB 4L3EB 5IFHH 3IDIB 1CL7L 1VEMA 3VH8B 5KAQG 5F7FA 4CMHC 1S9XA 1CXHA 3CSBA 4HWEL 2XWBB 3HZKA 1RULH 2GCYA 2WNGA 3MBXL 1UFUA 3UTSB 5T1KB 2VDPL 4IRJB 4LLUB 4M9OA 2AV1B 2EKSA 4WFEE 4GAGL 2MKLC 3QEQE 2G60H 4UNTA 1FNSL 3RX8A 3RVUD 2AK4B 5JLZA 3IKCA 3P4LA 1QR1B 1WBYA 4Y4HC 5F8RC 3QH3B 1QEWA 1UWEL 4ORGB 4PGBA 4PBXA 2OTWB 3T3ME 1B0WA 5EUKB 5DYOB 2BHZA 5HYSG 5E0QA 3OKEB 4HHAA 1K8DB 4LF3A 4LNRB 2B39A 2CLRA 4S1RL 3QJFB 1GSMA 4XPTH 1I1AC 2XQYG 5GRZA 1FV1A 1CCZA 5GGVL 4TSCL 4WUUA 4RAUA 2YRPA 4GSDL 1DLFH 4MCZA 3KJ4C 1UQSA 1I3GL 3MRRB 3FO2A 3CVHH 3NFNA 4OT1L 3GNMH 3B9KD 2VDKL 3RWEA 3JZ7A 2IPKA 3FQNB 3DVGA 4JDZA 3HG1E 1UZ6F 4IDJH 1EO8H 5GSVA 4PRAA 2NY7H 1QLFB 1HXMA 5IHUH 3FT2A 2UY7A 4M3KB 2ADJB 5LVEA 1IEBB 3L7FB 4QCIA 4X0KB 1G7QB 5KVEL 1WZLA 4XNMB 1MY5A 3S88H 1NCUA 2EIZB 2PXYC 4P2RB 3P0YL 1MWAB 5CZXD 3KR3L 5ADOH 4PJEE 3QULB 1YC7A 1K9TA 1CFTA 5JOFB 5GGRY 3LKQA 2CH8A 4POZC 2NNAA 3IAPA 1TDQA 4NNXB 4DJMA 5B21A 3AY4A 2FJGA 4RGNE 4RCAA 5CP7B 3SDCB 5FYKU 3HC0A 5INCA 4Z76B 2YXFA 1RMFL 3GKWH 4QWWD 3GIVA 5A16A 3JV6A 4HPYL 2K1MA 2YKLH 5ACLA 3OKEA 2EYRA 1VENA 5EZJB 1KIPB 2NX5D 4MNGA 1G6VK 1FNFA 2Y7QB 2ZSWA 3DX6A 4QXGH 4PGBB 4L8BA 4LSSH 5IWLA 3O6KH 1QEWB 1YEFL 1YEDA 1XR9B 5ID1B 2X4SA 1QR1A 1QVOB 1JGUL 3QFJA 1IC5H 5J3HD 3RI5F 1TCRB 5DSCA 3BP7A 2E9JA 2GTZB 3VFOA 1JHKH 2ICWJ 4P49A 4IRJA 3RUGE 4KJWD 3V6OE 3RNQA 3S3SA 5D6CB 3HZKB 2XWBA 1OGTA 8FABB 4PJBB 5I73B 4PJGB 5DHVA 1QKZH 2AGJH 3UBXG 4KZDL 5GZNC 5KJRH 3VFVB 4NM4H 4OD3L 4PLNC 4JG0L 1P7KA 2Z8VC 3V7AE 5DD1H 1GZPB 3NIFE 1IC4H 4LSVH 3H9HB 4TUJB 3TBVA 5ICZA 4JFFB 3GGWA 2VQ1B 5LQBH 3UTTA 3KPSE 4QRUB 1CD1B 4M02A 1HYSC 1Z9SA 5TE7H 2F9BT 5HHOD 2CKBA 3ZE1E 4PJIB 4KXZH 5C0AE 5CWSA 3RUGB 3I3DA 3O2DA 1FNSH 1V8HA 4X6BA 3HMWL 3SDDB 4XH2B 1QRNB 3GHBL 1CDJA 3MLXH 1YEIL 5EU5A 2XQBL 3B9AA 2WV3A 4K94H 4POYA 2DB8A 3AGVA 3QZWG 1BQLL 1XFPA 4R26L 1JNLL 2IBBA 4KV5E 4XPTL 4MD4A 2G9HA 5L9DH 1MI5A 4G80A 2YD7A 1G9MH 1JPGA 2IH3A 4GBXD 5AZ2L 3D25B 3EGSA 3ZKSD 1RUQL 4LCCC 1OGAA 3BZEB 4Z78B 4OD1H 3D87B 4KQ4L 5DRNA 1KXTB 2JIXA 3LV3B 4IHOA 3MZGB 25C8L 1SVZA 3QA3B 1ZWIA 4FN0A 4Q58C 3BP6B 3R06B 1CN4A 1I8KA 3U7WL 1JRHH 4Z18A 2F5AH 4GQPH 4YO0B 3I85A 2VDPH 3ARBA 2VE6B 4JDTH 1G7PA 5I75B 4TSCH 4FQHA 1DLHA 1OAQH 4IMLB 4CAGA 1GJIA 3BPOB 5HHOA 1UKSA 4D0DB 1XGUB 1REIA 3EFDH 1AKJB 3O3UN 4DK6A 4OCLC 1WIPA 1KIRA 4QOKA 1PEZA 4BQ9A 4MJIA 5JW4Q 2ZUYA 3LRSB 5ESVA 3SOBL 1WICA 5MERA 1QQDB 3S3PA 3L95B 3SY0A 1I1RA 2EYSB 3D6GA 5L6YH 2APFA 2DWDA 1MCFA 2YBRB 3EKCA 4B0MM 1ZGLP 1FZJB 2A6DB 4TNVF 4JE4B 5DJ0B 4QRRA 1Z5LA 2A2QT 4NKOA 2Q7YB 1YEKL 1PEWA 3OWEA 4NPYB 4ZS7H 3C08H 1MQ8A 1QFHA 3HAEG 1T2QH 2X9XA 4OZIE 3P0GB 4X8JB 4D3CL 3QQ3B 2BY3A 2EYTB 4A6YA 5LGHL 4UOJA 4F7MA 35C8L 3CC5B 1PGRB 1PG7L 2Y1VA 2HJLA 1AC6A 1AD9B 3HR5A 1A6PA 4JRXD 3BZFB 4PD4K 5DRWB 3IGAB 1CVRA 5BS0A 5GGQH 3CFCH 1MIMH 2Y25A 3ESVF 1RUPL 4XC1L 1G9NC 4XVSL 4L29A 1HZHL 5KG9A 4LAJH 1EA9C 5GGSB 4ONGH 4P23A 4U6XB 5CBAB 1A3LH 3VWJB 3BP4A 4HSQA 2M1KA 1H3VA 4OF3A 3KXFD 2E27L 3WJLA 4KFZC 1MRFL 3WSQL 4MA7L 5D7IB 1PAMA 3ULUD 5KZCD 4G6JL 1C5BH 3RY6A 4JRYB 5HHOB 3RY5A 1T0MA 2EDTA 1IBGL 3KPRE 2KPNA 1DLHB 4QHKI 4OLYL 4U6TA 4WEBH 4K9EC 1G7PB 3CFBA 1C08A 4U1NA 1MJUH 4NQVA 4F9PA 4IRZL 4XPGL 1KCRL 2BNQD 2W9EL 3STZB 3M07A 4LHUG 2YN5A 4LLAA 4F80A 1EHNA 2GAZB 4P2OB 3SDXE 1HHGA 4X83A 4IHOB 1MFCL 2JIXB 3LV3A 2DYPB 2J8OA 5CGYC 4JY5L 4G9FA 3GMOA 3D3VD 4HUVB 5IJVA 2XZQL 4NGHH 4GQ9L 1WZ1H 2Q7YA 4NKOB 5GHWH 3SO3B 1MI5B 2N56A 4ZO8A 2FIKB 4CVWA 5JQ6L 1P9MA 2M8XA 2MFNA 2V17H 4GRWE 5H37H 1FZOA 4ODSL 5KSAD 1S7SB 4DGVH 1YYMH 2R8SL 4FA8A 3TVMB 2OX5A 3O4LE 1EJOH 3MRQB 4XH2A 3LB6D 5AZEH 4G6MH 2OZ4A 3V4PH 1T89A 2BVYA 5FF6B 3QXDB 3F62A 2Q8AH 3ZKQD 4KK9D 5DMJB 4D9QE 3OL2A 2H9GA 3MLUL 4JQXA 4HKXB 2DQGH 2VLJE 4U6VL 5IROA 2F58H 1YJDH 2VAJA 2ZKHL 3WCYA 4JFFA 3FRPA 4OFPA 4V1DE 1Y6NR 2H32H 1TZHB 5E03A 2D7MA 3TM6A 2HFGL 1KYOJ 4XP5L 1P7KB 3ILQD 3R06A 5FOBA 3ZHLA 1AR1D 3LS4H 4AIOA 4GW4B 1FG9C 3C6SB 2BP3A 8FABA 3D0LA 1FYTE 2BVEA 4I9WE 2DJUA 1NCBH 1J0ZA 3HC4L 4WTXA 2P46B 3VGFA 1QBBA 4X9IA 3AS2A 4ZPTA 1Z2KA 3QFJB 4CL7A 5I1JL 1YY9C 3RGVC 1NUNB 4RFOL 1IGJA 4AYFA 4S0SD 2HLFC 2XPGA 4OLEA 3FB5B 4G9FD 2HLAB 2IAMB 3H9SB 3GI8H 5DVOA 5C08A 1OSPL 2O5YL 2P8PB 3FJTA 2LAGB 4MGXA 2VABB 3MRHA 4L3EE 2F74B 5CJQH 3P3YA 5I1DB 1CDCA 3S4SB 4HF5H 4ZTOH 1GGBH 2VKXA 3CLEL 3H0TB 2HT4C 3HC0B 1DQJA 4JM2A 4Z76A 3KYOA 3RUGA 5CWSB 3KPRB 3UC0L 3BYTA 3C5ZC 1MHPH 3W82A 3PUCA 4WTZA 1CDIA 1OTTC 4XNZC 5HI5D 2FRGP 2Q3AA 1FYHB 4GMTH 5HHQA 1HHIA 4EI5A 3MJ9A 5JOFA 4L8CA 1S7TB 1K4CB 5J56B 5KSVA 3VJ6A 5BW7A 5HYSB 1YEJL 2P1YA 3MJGX 4KKNA 1CR9L 2J88L 5ABDE 1A1NA 3QNZA 1MHEA 3WS3A 3JVGA 1F13A 3RAJL 3F7YA 1FIGL 4WFFD 3UROR 3GMLB 1SMOA 4RAVB 2AEWA 3QQ9C 3QZWA 4PJBA 2Q20A 5F9WC 1A6WH 2I9LA 5ETUB 1R24B 1NKRA 3FB6A 4OKDA 4XGZA 3NTCL 2X7LB 3WFEL 3P73A 1EV2E 1B0RA 1YMHA 4RGNC 2YMXH 4YHZH 5B8CB 3WIHA 3NPSC 3EJYC 3QHTC 5KJRL 3RIAK 2DM4A 2OL3A 3SCMB 1CQYA 2PR4H 3QB7C 3P4MB 2XNAB 2QTEA 4K3JH 5IGXL 3AS1A 3KLDA 3QEGL 2Q8BH 2GTWB 3MXWL 5JHDA 2EDRA 3GIVB 5TQ2H 3P9MA 2VXVH 5IQ9B 5M95B 2AJXL 1BEYL 3V4VH 1KENH 5EOTB 3FO0L 1AHWA 1VPOL 2DIAA 2F8OA 3MOAL 3QH3A 3STBA 3TO4A 3VFWA 1YEFH 3PQYD 1LE9B 4HFUL 4M7LT 3GM8A 4QXGL 1Q0YL 5F89A 4M4RA 4N9GA 4JDTL 3HG1D 2QR0A 2BZDA 4J3XA 4KC3B 4HJGA 5JORB 4U1HB 1EZVY 3OKDB 1VERA 4HS3B 3T0XA 4Z7VB 3IETB 2VO5A 3TBSA 2LU3A 3GKWL 3QDJA 1I4FA 4XNMA 5FA3B 3VWKC 3NTCH 2I26N 3GSUA 1D6VL 5DJ2B 2YR3A 1A64A 1IEBA 4QCIB 1NCAH 1U8LA 2N1KA 1N6QL 1CGWA 1G6RB 1H15B 3UBXI 4PB9L 5H8DA 3TIEB 1KCUH 3D2UD 2VXTH 1CFQB 3EDDA 3D9AH 3QDGB 2ZG1A 1RK1A 1SQ2N 5GGUB 5HHVL 2A9MH 3QPQC 1NDMA 4JPWH 3OAZK 4Q97A 5I75C 5GIRB 3P30H 5IVNA 4I0KA 4NZUH 2KBGA 4GS7C 4PV8B 5A2KH 3HAEB 1KBGL 5IEKA 3STLB 4U2YA 5F44A 5F1IA 4RQQA 1RUKH 2X70B 3QI9A 3MXVL 1CZ8H 3JV5A 3SO3C 3UO1L 1WBYB 2PTVA 3GK8L 2YK1H 5F1SA 1JHLH 5I1HH 3KPRD 2MWCA 1F00I 5EBWA 3CVIH 3D48R 5EPMB 5SWSA 1CICD 4LLUA 4G8IA 2COQA 1KJ3L 1LO4L 3K4ZA 2GCYB 2VLME 1EEQA 1HQRB 4ODTL 1IJ9A 2NW2A 3WFBH 1BBJB 5BRZE 2FR4A 4WEMB 4Y5YA 3PP3K 3QDME 3IRPX 4LCWE 3S5LB 2AV7B 5SWZB 1NGYB 3SN6N 4QGTA 4FS0A 3EYVB 5F88B 2QHLA 5ENWB 3MRPB 3VXRA 2IANA 5EC2B 4APQC 1C5CL 5DD0H 3WFCH 1WFUA 2IFGA 1BM3H 1HHJB 1RZ8B 1WCQA 3BP5A 4P4RA 2X4TB 3FOLA 3EDEA 1T4KB 5IFAH 3VXSE 4AH2A 4MNQB 3CFDA 1X5AA 4HKJB 4KZEL 4NO0A 4TUKL 5HHPA 4JPVL 3NMEA 1RURL 4YZFF 2V7HB 3KPTA 4HJ0D 2NY0B 3EOAB 4GRLC 4PRPA 3VFRB 5INDA 4EUPH 3X17A 4HLZG 3ZT7A 1BLNB 4KRLB 1AO7B 3VGAB 5GGSY 4FP8L 3B6SA 4H25A 4BFBD 4NZRL 3S36X 1YYML 2B20A 5GJTH 3TPUA 3D0VB 4YHYC 2DQUL 2DMKA 1U93B 4J6RH 5F6IB 4JO2H 3ZYOA 5FUZL 2HKHH 2BNQA 3BPCB 1M71B 3VXQA 3WEXA 5J6HB 5JPMA 3LN4B 4YPJA 3G08B 3LN5A 4OLVL 1C5DB 5AAMA 5GRUH 1HHKB 3CX5J 1BVKB 3FFCD 2BSTB 5FYJE 4MD0A 5FEBA 3QUMH 2LTQC 3MLSL 1U6AH 3NIGE 5JOPD 4IDJL 4WWKD 4NRZA 1MFDL 4OV5B 3SGDI 2AABH 1U58A 1ZKAA 3NZHL 4O58L 3GDBA 2WWKT 1MJ8L 1T89C 3WFDL 1DLFL 3VGEA 3BW9B 2DKSA 1H5BA 2ZOKB 4PY8I 3LIZH 3TBYB 1GHFL 2AQ3A 4WFHE 5CZKA 4H5SA 1LD9A 1KJ2A 4U1IA 3AU1A 1UH3A 3SE9H 1LE5A 3O3EB 5I1LB 3MLTB 1XR8A 4A2LA 2PW2B 4Z95L 5SV3A 2YA1A 2F8VA 4RMVA 3V52H 3CDGA 3IDXH 5DJZA 4MA7H 4NC1C 4O2CA 2WW8A 4YZFE 4J3UA 3ROLB 4PY7A 2UYLB 5IBLD 2C4FT 1TZIA 5GGRA 1HE7A 2D0FA 3RVVD 1EIBA 4NZJA 4LSRH 1NMBH 1KNOA 3RKDC 2HTLD 1RZFH 1N64L 5F3BB 1I7UB 5C0RH 1KEGL 4P3WA 3MYZA 3R1GL 2FBJL 5DVMA 4Y2DA 2P8MB 4LCCB 3TBWA 4P2QB 3PDGA 3B9DA 3UXFA 1CDHA 3WO3B 4WV1A 4O4YH 4P2OC 4C55A 3QP3A 4TPRH 3BQUC 3KJ6H 3ZKNC 1AC0A 1OAKL 1KOAA 2EKJA 2O5ZL 3KLSA 3RWJB 4ZPVA 2GFBB 2EDXA 4PGEB 1J7VR 1NDGB 4X4YB 2D7TH 1TPXC 5CUSH 4DVBB 1KIUA 3WXVL 1JCKA 1T6WA 3HI1A 4GKSB 4LOUD 2XI9A 1S9YA 5IESL 5HDBF 3RPIB 4QY8A 1UVQA 3NACH 5IBTH 5BXFB 2BVQB 4G6FD 4OM1L 3L3HA 4NQUA 4QRRE 1FG2B 4YFEA 3K2MC 5BZWB 1KC5H 4R8WH 1DDHA 1Q0XL 1WFOA 2X1XR 5KN5B 1I3UA 3VRJB 1FDLL 1AI1H 3KPOA 3E2HB 4GLRI 3T09A 2C1PA 3TT1L 4MS8C 4FXKB 3LEVL 5EOQL 2CDGB 4N8VG 3ARBC 2Y5TB 3GEWB 3I75B 3I75A 2ICCA 4PJ5B 5JO5B 4LBEB 3EYFB 1A0QH 1RZKL 5CINL 3Q5TA 1KPVA 1LWRA 4KQ3H 1IKNA 2R0ZL 5E2VL 1PZ5A 3IJYB 3B5GA 3KWWB 1A6ZB 4JFQA 3K81A 1XIWC 5I8KH 1G6RL 5BZWA 4PP2B 5GRVL 1KIQB 2X4RB 1KPRB 3RZWA 5E6ID 1CXKA 2XT1B 5LG1A 1VCAA 3IFOB 4PIRF 5HSFA 4Z0XA 3RL1B 3CX2A 4GKSA 5DDHA 4LVOC 4PUBL 3IDYC 4H20L 1W72A 2BCKB 1FBIL 1MIEL 1HKLH 5HHNA 5HHNB 1RZGB 4JANB 1KB5H 4FZ8L 1TVBA 2HN7B 3QCTL 3VFGH 4ODTH 3X13A 3FO9B 3LKNA 3G6DH 5IMMA 5DDHB 1EUUA 1DBAL 1J1OL 4TNWK 5CD5C 5JR1L 4Z0XB 1LP9B 2BDNL 2EE9A 3ZE1F 2AJVH 1S7QA 3RL2B 3U83A 1I75A 3L3DA 3UPAA 2WQRA 3H3KA 3RVXC 3V5DA 5A3IC 5SWSE 3AREA 2CK0L 2OL3L 3T8XB 4XMLL 5DXWA 3BDXA 2L7UA 3S96A 3IJYA 2OJZL 3SDAA 1N0XH 4RRPA 5E7FA 1ZT1A 3FFCB 4KJWC 5E8OB 3SQOH 1SEQH 2DTML 4F7EA 4WO4B 2V7NB 4FZEL 3BXNA 1UXWB 4LSRL 5IW1B 4JQVA 1S9WB 3LKPB 2V2TB 2YSSA 1HH9B 3HI5H 1OD9A 3O3EA 1H3UA 5I1LA 4NP4H 3KPOB 1NSNH 3S9DB 1OOAA 3MFGB 1MVUA 4YXHH 3V6OC 1DEEA 4KVCH 5CZVL 1KFAH 3UTZA 3H7BB 1JGEA 3DNKA 3GSNB 4CDGC 3DGGB 1LP9E 5IBLC 3S98A 1BFSA 2IGFH 5GGTL 4J3OC 5MI0C 1G9MC 2VZSA 2XTJB 5DUML 2P43B 2DQUH 5C0DB 3DECA 3JUZA 2OP4L 3OR7B 2YD1A 1AGEB 2UWEF 3LIZL 1AXTH 2XKUA 5IV2B 4HDIB 1X7QA 2DTSA 3HHRB 2XZAL 4CMMB 4Y16A 4W4NA 4PGEA 2GFBA 3FAXA 4OLUH 3O41B 4G5ZL 5EG6C 1N3NA 3BIAX 5D2NC 2PTTA 5JPMB 2X4PB 4JM4H 2LV4A 2ZUQC 3LMJL 3WE6A 4LQFH 2VLJD 3QUML 3THML 2OR9L 2WBKA 3HLAA 3TBWB 2C7UB 3SDDC 1WV7T 4L3ED 4ONHA 1VGKB 5E6YA 4KPHL 3BN3B 1Q0YH 3RTQC 4YAQB 4XCEB 1BM3L 1Q8MA 3D85D 3JV0A 1T7YA 1QTYT 1PKQA 1MCWM 3LRHA 3ARPA 1RIHL 2V5RA 1UM6H 2EDQA 2J8UB 5HPMA 1T5WA 2DQJL 5SX4H 5MP6L 4LLQB 5C08D 1U0QA 1HCVA 1EO7A 3MLTA 3M17B 4KK6C 1HOCA 3FOLB 4G3YL 1LD9B 4Y5VA 4KJYB 3TO2B 2AKRB 3GSNL 5L88H 2B4CL 4ZUWA 1BZ7A 5F7EH 1MSPA 3T2NL 4ZFGH 3FQTB 4NO3A 5CSZB 1DCLA 5DQDL 1K2DB 4XBPB 5FA4B 5L2KE 3Q1SH 5FECA 4OD2B 4XCNB 4GG6F 5DVLA 4MD0B 3LS5L 5FM8A 3MZTA 3WFCL 1YUHA 3L7EA 3QUKA 2VL5A 1FVEA 1FVCB 3HNSL 4Y4FB 5D72H 3TIDA 2ZUXA 5AG8A 5D7LE 1LMKA 5D70H 3PABB 4JLRB 1LO0H 2R0KL 2ZCHL 4Q9CA 4DGIL 1MCLA 3VXNB 2AJSL 4JKWA 5H2BA 1HH6B 4I77H 3S4SG 4PREA 4XP9H 1NC4D 4HGWA 2DI9A 5IW6A 2XTJC 2XTLA 3TZVC 5F6HJ 3VXMA 1F3DH 2X9WA 4V1DA 3RGVA 3QI9B 5C86A 2Q86A 4M5YL 4BQBA 3G9VA 4HLZH 3QIBA 4PJXF 3UC0H 4OGYH 4YIQB 4OCRH 4R2GD 4JVWA 2WINB 3UO1H 1DQQB 3PWUB 3QG7L 1GPOH 5ICXA 2F53E 5DZNA 2WBJC 1I8MA 4PRPD 4KRPC 4LSTL 4J8RA 4GT7A 3EYQD 4LLWB 3TJEL 2CUMA 4FTVE 4HAFA 3SPVA 1P1ZB 1DQDL 4LDOB 4UUJA 1ORSA 1KJMA 4DW2H 2GJ6E 5LGJA 5TFSH 4X6FA 1HHHB 3K46A 4L9LA 1G1YA 1H15A 4GMSL 3FRPG 1YY8B 2DICA 2UZYB 3BPLB 3P77B 2A9ML 5FK9A 1GAFL 3HC4H 3D9AL 3QO0A 5CKGA 3RNKB 4HIHB 1IC7L 3BN9C 1JZ5A 1X5GA 1ORSB 2NPLX 4ODWA 1G7IB 2AJXH 2JB5L 1FNHA 2W9DH 4X7SL 4RMSA 4XBEL 3DXAE 2R29L 2VTFA 4C59B 2X4NB 2Y6SD 2BFVL 3HNSH 1I3RB 5C9KA 3H42H 3F12B 2Z91A 2LU7A 4N1HB 1CD0A 5EZOL 2NZ9C 1M6OB 4HBCH 4KKLD 2E8ZA 4FTVB 5EUOA 1MUJA 4LKCB 3BE1H 1WVZA 3K3QA 3OHXB 1R3IH 3GSXA 4M1GH 5F89B 4K71C 5GS1B 4PP1C 4YIQA 4M1GL 5B39B 4KI5F 5EIQA 2Y06H 1F3DJ 1EFXA 4UB0H 4YDKL 4XAKD 4KJPC 4M43H 3O8XD 2QHRH 5EOTA 2B0SL 3VXMB 5SX4I 5EC1A 5IW6B 4LCWA 4V2CB 2HFFB 3V4PL 4QHLB 1HDMB 4HBCL 4X5XB 3SE8H 3UAJC 3UJTH 3BEVB 3RGVD 5BO1H 4WV1C 3SCMA 3F12A 4AENA 5JW5B 2C3VB 1FIGH 1AGBB 3RAJH 3I50L 2CRYA 3PWPD 4LCYA 3C2AL 5F7WC 1IM9A 4Z7VF 2X89A 2PCPA 1OD7A 1BWWA 1GAFH 3MJ8A 1YEJH 4S1DC 1TJIH 2W1NA 4DKFL 3C60C 3MCKA