3SKNA

Crystal structure of the rl42 tcr unliganded
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
KEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVRAGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords RL42 T cell receptor, alpha chain
total genus 31
structure length 197
sequence length 197
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA02
2GITB 5KVDL 1J0HA 2R4SL 1KJ2H 2JE8A 3PWLA 3CVHA 5HHOE 5E9DD 1S78D 4ODVL 4HJ0C 3NIGF 4WFHE 3RVXD 3EDFA 4QRRA 5DSCB 1CQYA 5DZOA 4GKSA 1GZQB 5EG6C 4ZUVA 3VFVB 1X5AA 4NKIL 1OAYH 2NY4C 2VXTL 2XRAL 3PL6A 1RZKH 1DUZB 1MCWM 4HUKB 4IOFC 5C7XL 5DC4B 4GRWB 1F58L 2C3VA 3MRFB 4M1DH 3VW3H 1QBLL 1VB9A 3DVNA 3VD3A 1XCQB 4Q6IA 4LVHC 4KMTL 2C4FU 3TT1H 2CLRB 1A6PA 4TTDD 5E6ZA 1Q0YH 1KTLB 5IQ7L 5SV4A 2IBZY 4TNWF 1T0PB 1JZ7A 5HHNB 3K4ZA 4GMTL 3G6JE 5MEOA 4R4ND 1MQKL 1XCTB 4RA3A 5D7IA 2B2XH 1S7RA 1W8OA 4JVWA 5B8CC 4OKVB 4L4JA 2MFNA 2QQLL 5KANG 3BPOB 3MLUH 3QPQD 3ULUF 3DX7A 5GPRA 3QIBD 3QJHA 4GRMA 2BOCA 5DJ2B 2FBJL 2IANB 1NCUA 3VFMB 3ARGB 4Q0XL 4Y16D 4OQ1A 1MCPL 4OF5A 3WJJA 1G7JA 3ZE0E 2QQKL 4FG6C 1IKNC 4DW2H 3S8WA 4PTUA 4KC3B 5IVOA 4HUMB 4PB0L 2HJLA 4EI5B 5CP3H 2VLRB 1FIGH 5MEPA 3PHQA 3MR9A 4F15B 3JV5A 4X80H 4C56A 3N1FC 3T0XA 3C09B 1DLFH 1G9MC 4Y4FB 2D3VA 3RJDA 4XPTH 2LU7A 5JW4R 3MFFB 1FNLA 3I6GA 4NM8H 4N0FA 3RY6A 2J6EH 4XB8A 3GO1H 2BVEA 5DDHB 3B5GA 1LMKA 3HNTL 4NQDA 3UEZA 3WSQL 3U7WH 4FQQA 1T7ZA 1TQCC 4HWEH 4U1JB 2EYSB 1NGYA 2YPLA 4N8VG 4NQCB 4MD0A 1N64L 1T3FB 1FRGL 3E6FB 4Y5YB 5CJXC 4YR6B 4EI5D 3T08A 1YEJL 1Q94A 5IQ9A 3UZQA 3DXAD 3U82B 1INDH 4UBDD 3RIFK 1QEWB 3LEYH 3GJEB 4UDTB 4BZ2L 3KDMA 4NO2A 4OTXH 3NVQA 3GRWA 2RJMA 5B38G 5C70A 3GSOA 1T03H 4R2GB 4GG8A 1H3VA 2AV1A 5C07B 1RU9L 4K7PH 2Q7YA 1UT9A 5H94A 4XPAL 4XXCC 2ZG3A 3AREB 2D03H 3VJ6A 5D1ZA 5EU6E 3EO9H 1S7WB 4CW1B 2NYYD 3CDCA 4MD4B 4LMQI 5HGBB 3NACH 4YXHL 5GJSH 3IDMA 4PP2B 5FKPA 3CVIL 1NL0L 1P84K 3H0TA 3K1KC 4Y4HC 4XT1C 4YC2B 1FVEB 2Z31B 4BK5A 5I1EL 2O5YH 4RAUA 3QUMH 4Q9CA 1QP1A 4X7DC 2ED8A 1RVFH 3WE6B 1F58H 3BJLA 1FLRH 1M1SA 1K2DA 5BS0D 2AK1L 2V7NA 3QDGB 2J8UB 1HHKA 2JCCA 3BPCB 3MOAH 1QLRB 3G5YB 4XC3H 1KT2A 3KPTA 5TDOB 4PBVC 4XNYH 4BQCA 5DA0B 1ZGLB 2HLAB 4NZUH 5B38A 4U6HA 5C0BA 3MRCB 1IGJA 2B2XL 4Q0XH 5D8JH 2ADFH 2UWEB 4UQ3A 1VPOL 4KPHL 5JOPD 4UIMA 2BNUA 3VXQB 3NPSC 5D1ZB 2R1XA 1B90A 1TTUA 3TFKC 1MHCA 1QHPA 5IW6A 4LSUH 3PWJB 4NJ9H 3G04B 4P9HL 3VA2C 4PG2C 2YD8A 3E2HC 3UO1H 3ZDYE 3MLSL 1KPRB 2F53B 4NJAH 1T7VA 3VRLE 5FCUH 2YPKB 2BNUB 3LN5B 3VXQA 3T4AB 1OB1B 1MUJA 3QDJE 3C9NA 3D5OF 1JTOA 3F6LA 4HFUL 4G9FB 4GO6B 5IQ9B 4DN4H 3MRCA 1XF5A 3DV4A 4OM0L 4R2GD 3OB0H 3V52L 3TIEA 5KSVA 5F7YC 2A73A 3V5KB 1P9MA 5J1TC 5CILL 2W07A 5DJ0B 1OP9A 2BY1A 1XGTA 1JGLH 2J8UA 4GKNB 1VADB 5SWZD 4D8PB 5HHQB 2BSRB 3V0WH 3SPVA 2Q6WB 3OJMB 1NCCH 1QO3B 3VA6A 1KEGH 2PF6A 1FSKB 1XIWC 4MS8D 1LEKB 1EXUA 1INEL 5D2NB 4I77L 1S8DA 5GRJL 2HVKA 4HF5H 5JDSA 1GHFH 4Y4FA 4NSKA 3RGVC 5I1CL 3TCLB 2Y25A 1YEHH 4YEEA 3M07A 4E42A 2IAMB 5FYKH 4R4BA 4Z76B 3FQWA 2GAZA 3MRRA 1GGCL 2R0KH 2CH8A 4PJ8A 2Q86B 5CD5C 2B4CH 3HAEH 5J11C 1UXSB 4FTVD 5CGYC 4KKCC 1OT1A 2FECI 1XZ0A 5KSBA 2LU4A 2OR9L 2HN7B 3R8QA 4OGXL 3MRKA 2CRIA 4YGAB 1IC5L 1T83A 4OGXH 2Y7QB 5DZNA 2QEJA 3S36L 4PJIB 3I9GL 1M7IB 3O4LD 5HYJD 3TVMB 1OARL 1T2QL 3O6ML 1H15A 3QXDB 3MZTA 1VGEL 3RA7H 3TBTA 1FO0H 3R0NA 5ACZB 5J6HB 2FO1A 5DFTA 1W0VA 3CDGA 5EDXA 4O4YL 3O6KL 3O9WB 3UYRH 5K9OB 2XY2A 1G7QB 3RUGB 1MJUL 3IAPA 3D25B 2UUDK 3WFBH 3BKJL 2OK0H 2MCPL 3VGDA 1XF4A 2JJVA 1WWBX 1NKRA 1CTOA 2GTZA 5CSZB 5FM8A 4MD4A 1TVBB 1VERA 2V2TB 2BY3A 4KK5D 4XP1H 1A9EB 4OJFL 2BJMH 1LP9E 1S9KC 2B1HH 4OZGE 4Z8FH 4DEPC 3ALWA 3LSOB 2EH7L 3BN9C 3WDIA 4NQSA 1A6VL 3L3HA 4WW1A 3ZKNC 3GHEH 5KVGL 4JLRA 1N4XL 5B8CB 4PJBB 4HJJL 2G60H 3JVGC 1D9KA 1AJ7H 2YUZA 4JVPA 3MLZH 4OGAD 3LDBB 1D5IL 2KKQA 4FXLA 1BEYL 2ILLA 1AQDB 3B9EA 3MJ7B 3T0AA 3O3DA 4Y4KB 5F8RC 3VWKC 3RL1A 5I1HH 2UZYB 1YYLL 1S7RB 3BT2L 3LY6A 5D7IB 3DURA 2MSPA 1V05A 1A3LH 1R3HA 4L1HA 5BV7H 3IU4H 3F62A 4P5KB 4PJFA 5TQ2H 4L4TD 3QNZA 2Y1VA 1QRNB 2D9QB 5BVPH 3B9KB 1AI1H 1ZHKA 2HAZA 3FO2B 3ARFD 4KTYA 1FFOB 2LVCA 3VI4E 3UTTE 4I9WD 4HF5L 1N0XH 2R2EB 1KUMA 4G6JL 5DRWB 3QUYD 5FA4B 3T1WA 4Q7DA 4WVRA 4EI5A 5HYJB 3IKKA 5CCKH 2KPNA 1JFQH 2DLEA 4OZFH 3J8F7 1NH6A 3OL2A 3IXAB 4TTDC 1KCSL 4RMRA 4WUKL 4GG6A 1G6RH 1EEZA 5CZKA 3VFUB 5KW9L 3S88L 2DM4A 3QCVL 1XGUB 5F9JB 4ZS7L 2AJVH 3KG5A 1M6OB 5JQ6H 3TNNA 3B9DA 2IPKB 1M05A 4NHCH 4AIOA 5JTWA 4X0KB 1ZK9A 1TQBB 4XBGA 3WS3A 3KPSB 4G6FB 4P2OA 1V3LA 5FDWB 5JW5A 4XBPA 4QXWA 3UCRA 1CU4H 5JPNB 1JL8A 3QCUL 3RKPA 4C56D 3TN0C 3DWTA 1RK1A 1DBAH 4K7PY 3B83A 3L6FA 1FP5A 5HVHB 1LO5B 2PYFA 1Y6KR 3BH8A 4G42A 4TVSa 4NQVB 2JIXA 4FFYH 2C3XA 4WTZG 4KVCH 3BN9D 4K94L 2I07A 3LN4A 4ERSL 1IEHA 2GJZB 3C5ZB 4ZAKD 3BDBA 1B2WH 1BQLL 2OXGA 1G0XA 3M1BA 4G8GA 4IRJA 1YEJH 2AJXL 3VI3E 5E2JA 1LNUA 5GS1B 1ZA6A 1OAXL 2X10A 3NCMA 3FO9B 3IGAA 3BO8B 3ZKQD 1FAIH 4K9EH 5ID1A 3P0GB 4PR5A 5CP3A 3UZEA 1TVHB 4YE4H 5GRUH 4PLKD 4QTHA 3TA3A 5EC2A 1JHKL 1D5BB 1IRAY 4TULH 1HEZB 3QIUB 2BC4A 4OLYL 3U30B 1BOGA 3B3IB 2A6IB 5DVLA 1P7QB 3C2AH 5I66A 1QHOA 1CICC 4NKMA 4PJ7E 1UZ6F 1YZZA 4Y89A 3CMOL 2QR0A 3IF1B 5K9JL 4KQ3L 4ONOA 3GMNB 4H1LB 3N1MC 4OSUL 1N2RB 4JKKA 1MLBA 1LDPL 4PTTA 3I6LE 4WCYL 4J8RA 1W72L 2HRLA 3C60C 1OQOA 1EA9C 4YBQC 3V4PL 2LFGA 3HE7B 3PGFH 3K2UL 2WK2A 3O9WC 2PR4L 3QUZA 4Y2DD 4F57H 2HJKB 1U3JA 1CL7I 4HK3J 4X83A 5DHYA 2DQUH 4PJGE 5DRXA 4M7ZC 4DZ8B 4XP5H 3TH3T 4MJIE 1F4HA 2VISB 1OTTD 5CKGA 5DD0L 2GCYB 1YMMD 3OKLB 2EYRB 2R4RL 4KRMB 2IQAA 2WUBH 1T6VN 4ZPVA 1QFOA 1E4KA 3DVGA 1QR1A 3V6ZA 1RIHH 1RZ8A 2L7UA 2YC1A 3MV11 4LCIL 1QNZH 2VOTA 2A2QT 4Z7WB 4ZQKB 3W39A 3S88H 3EGSA 5GGTA 1T04B 4L3EE 5DEFB 1YECL 4A6YA 2BDNH 1BX2B 4ZUWB 2W0FA 3PF2A 1FL6A 1QQDB 4QLRA 4BH7B 2DMBA 1O0VA 5F72S 2C4FT 3JWDL 1G7MA 5F93C 4U1SB 5D1QB 1I85A 5EWIH 1S7VA 1V5JA 1K85A 4PY8J 5CKAA 5E99L 3MUJA 1F8TL 4JFFB 4PGZA 5ERWA 3FCTA 4HIXL 5HYQA 3P9MA 2EE6A 5DJ8A 5L6YH 3CX5K 4ONGL 2V9TA 2NY4B 1G7IA 2E6PA 1MFEL 3K8LA 5MENB 3S9DB 2C3HA 1QKZH 3S37X 1CN4A 4NM4H 3A6BH 2IPTL 4OLXL 5GRJH 5CD3A 4APQC 3GSOB 2WINA 3GGWB 3ZHDA 2FB4L 2OM5A 1MHPL 4RSVA 4L8SC 4ZOAA 2Z8SA 3LQAL 3KDMB 4WDIA 1BBDL 4PLJD 5CSGA 3D2UB 4FABL 5HVWA 1Q0XH 1IAIL 4LFHD 1JF1B 4I0PB 2F8VA 2YXFA 2LVEA 2XWJB 4NYLB 3ME0A 4ZUUB 2X7LB 3VFOA 2NZ9D 3JV6B 3VXRE 4QEGA 2CDFB 5T3XL 1QBMH 1RHHA 3HPLA 1OWRM 1FL3A 5HHVL 5D2LB 4QNPE 1KIRA 5HBBA 2D0GA 3QIBB 4XMLH 1F97A 4M62L 2NZ9C 5F88A 4I18A 4K3GA 3RZCB 3ISWA 1DR9A 4G8IB 2V5SA 4HUXB 4PD4K 2AJUH 5CZXD 4Y4HB 4HMEA 3NGBC 3DXAE 5F3BA 1G7PB 1AXSB 3TWCL 3EDEA 3U4EA 1A7NH 3PG2A 4OUUB 3WNLA 4KHTH 5IVXB 3WL9B 1NDGA 2Z8WC 1S78C 3SCMC 4G6ML 2Y9RT 4RISH 4RMVA 4EDWH 1YNKH 3ARSA 1U3HB 2EDTA 3C6SB 4N0CD 4MNQD 5SWSB 2BOCB 3BT2H 5DJ2A 2VXUH 3VMPA 1MAMH 1VEPA 2BCKB 3HPJA 4OKVA 2EH8H 5SWZA 1TQCB 3CH1B 4H88H 5DWUL 2XFXA 4EQ3A 3D85B 3PV6B 3BDYH 3SDCC 3IDNA 5MEOB 3NCFB 1CK0H 3ARPA 4DGYL 4MXWL 4LCIH 3HZKA 2PCPA 1TXKA 2VWEE 4YIQA 3DXAB 3VXPA 3SN6N 1KEMH 1S7UA 3V5HB 4PJCE 2HVJB 1CICB 5TPWL 1E6OH 4HEME 1JRHL 1WISA 5E8OA 2DICA 2APXA 1FGVH 1I7ZA 2P7TB 1JPFA 2YA1A 2GK0A 3ZMRA 3IU3B 4QF1B 3BKJH 4B0MM 5C2BH 2Q76B 3VFGH 4QRUA 1A7BA 1L6ZA 1SY6L 1AP2A 5FHAL 1QSFD 4EVNB 2OI9C 4PJXB 3T2QA 2Q7NA 3ZE0F 1D9KC 1TVDA 2OTWB 4EDXB 4M5YH 3E1F1 4JY6B 3NMEA 3TJEL 1PG7H 5IIEA 4FXGB 2PKDA 4JAMB 4HAGA 2NY7L 4HFUH 4IMKA 3BVNA 1LEIA 4OM1H 1ZA3B 3MRQB 2DQFA 4AY0A 4R96B 4RGOH 5JHDE 5BS0A 3DX6A 5D5MF 2CIKB 3SDDD 4HH8A 4OZGF 3I75A 3RWDA 2NNAA 1HIML 5EU7C 4QTIL 3T0DA 3FFCA 1KGCE 2VDQL 1OD7A 1IBGH 3MXWL 4LKXB 5GRZA 2DQHH 1R3JA 4FXKB 1K5NA 2W0KA 3LPGA 4KI5E 4TNWK 4K3JL 1DLFL 4P46D 3C6LC 3S96A 3WIFA 4UINH 5B39A 2GY5A 4LEOB 1S9VA 3I84A 3QP3A 1HOCA 3CDYA 2J5LB 1VDGA 2DWEB 2VR4A 4LBEA 4YK4C 1K4CA 2F19L 4N5EC 3ZYOA 1Z9SA 3MODH 1AD9B 1CLZH 4FQXC 3KPQB 4JM2B 3BFOA 5E2UL 3W11D 1NC2B 1SEQH 4PJEB 3RDTC 4APQB 2PO6A 3TC9A 1ROWA 3WXVL 3FT4B 5DMIH 1RZIB 4LNVA 1DFBH 3RU8H 1RJLB 1PSKH 1M7XA 4GMTH 3STBA 4NN5C 4P23B 3BMVA 3NAAL 3BMWA 4PJDB 4MJIB 3ULSA 1ZHLB 4BH8B 4X6EB 1HXYB 2WQRA 4H0HB 3U46B 2G75B 3BPLB 4OCRH 1BWMA 3CFJA 4PYHA 3TF7C 1JF5A 3ULVH 1T03L 4N0RA 1PG7L 1J8HD 1G9ML 3X14A 3LIZL 4OAWB 3ROLA 3MTRA 1QFWM 1JZ5A 2AJVL 1HI6B 4PJIF 5I73C 3JWOH 5BO1L 5HDLA 1NAMA 3T2NH 1ZMYA 4LSTL 4UAOC 3OKMA 3RDTD 4HS3A 3MCLL 3EFDL 3QIUD 4BSWB 1I85C 4M5ZH 1NUNB 4HHAA 1B4JL 4NNPL 1LP9A 1QSVA 3BEVB 2EEDA 1ZLWH 3BZFB 4JKMA 5EO9A 4JHAH 3GSXB 2ATPA 2OYPA 3SGDH 1JRHH 2E7CA 1CFQB 3QA3B 2X4PB 3TJHD 4K3JH 3JV6A 3VFOB 1YNLH 1BFOA 2A74B 3HAEA 1FVDB 3F7QA 1A1MA 1KTDB 1GH7A 1CXFA 3DBXA 4PJ8C 5I1EH 2DJSA 1JYWA 4LCWE 3MJ9A 3U79A 2EE3A 1OSZA 4HKBB 3C87A 3QG7L 3BDYL 3KNBB 3DETD 5DJAA 2BRRH 1CFSB 4NO0D 1R5VB 2MPAH 2ID5A 5DJ6A 2IALB 4PY7A 3GK8L 3HZMA 4TUJB 4OZ4A 3O45A 4U0RB 2EO9A 4JFFA 3RWGB 2IMNA 4CMHB 1FJ1A 2FBJH 1OTUD 5CGYD 2LAGB 1NBVH 1IZKA 4E5XB 2QBWA 2EDKA 1YEEL 3CFCL 5HI4D 5FM4A 2ZOKA 4CADA 3X14B 4BH7A 4NNYA 4LGSB 2ED7A 1RZJH 4F9PA 2DKMA 4YHYC 2LE9A 3MRHB 4QOKE 2VDNL 4HZLA 1RURL 5DRZA 1KN2H 3ZKSD 4L29B 4Y5XB 3SE4C 4XVTL 1EFXB 3KLAA 4O2CA 1PLGL 2L4OA 3RRQA 1WWCA 1T80A 5EU6A 2H3NB 5GQBA 1CDJA 1A7NL 1MWAB 2J6EL 2Y6SC 3U9UB 1XF1A 2DQIL 5GRYA 3QA3A 1ACYH 1IC4H 4HWUA 1BQHG 3Q6FB 3OJ2C 3CFBB 5IV2A 3MRBA 3AUVA 3QIWB 5IFHH 1KSRA 3UAJD 2VQ1B 4IMKC 3ZHLA 4U6XA 3LQAC 5FF6A 3RIAF 3L7FA 4HH9A 4OF8A 5KAQF 4K3DH 2D0FA 4PV8B 3BP4A 2FB4H 2FD6L 1D5ZA 3MV9B 4MQXC 3QQ4A 3GSRB 1AGDA 1JVKA 1WAAE 4IJ3B 4AEIL 3SKNB 1T7YA 3TFKD 1YJDH 4CVZB 3G6DH 4HBQA 3O2DA 1F6AA 2IADB 5HI5C 4WGVB 1I8IA 5SV3A 4PJ5D 1G9NC 3ZT6A 2BVQB 4F8QA 2AK4B 3L7EA 1RZJL 2Y5EA 1HXMB 1LO0H 1Q8MA 3H9SA 4YH6A 2FLBT 4Q9QL 5FA3B 3U36B 4DVBB 3TGXA 1DUYA 1KJVB 5CEZL 3RWIB 5BVJB 1OAQL 3C5SA 3P77B 5CUSL 3WHXA 3P4OB 3G5XA 2F58L 3MBXH 4XVJH 5I1AB 4JM2C 1T2JA 1RZJC 3VXNB 3EYSH 3MA9L 3MRMB 2DM2A 2XTJE 3NFPB 4JJ5B 4JRXA 1EAPB 1ZEAH 4Q9BA 4YDIH 4KY1L 3TA3C 1KB9J 4U6YB 4YDIL 5I19L 1FAKT 1B0RB 3MGTA 2CUHA 1LP9B 2VLME 3V52H 1Z9MA 2P48B 3MPCA 4JPIA 4ZYKA 5HYSG 3X11A 3MCKA 1W0YT 1I7ZB 5HGDB 4V1DD 1ND0A 3TIDA 2XZZA 5E8OB 2IQ9H 1IC4L 4GJTB 4WFHD 3KS0J 4ZSOA 5TFSH 4KZDH 5LGJA 2NY5H 3D69A 1KN4H 2WP3T 3AAZA 3AB0B 5C0GB 1FFPA 3LKOA 2CIKA 2X1OA 3B2VL 1OLZA 5B22A 4EIZC 1BD2D 5C08E 2P8LA 4OD1H 3BIAX 4GW5B 3QCTH 2RR3A 4N9OB 5IEKA 4LQFL 5A40E 2ADFL 4CDHA 4Y1AB 4FXGA 4G7YH 4GSDL 5ECJE 4EI5C 2XTLA 2CXGA 4S2SB 1ZKAA 5EBLB 4QCIA 3RWEB 3CX5J 1DUYB 4WNQB 2DTMH 4X98A 4FQ2L 3VD5A 5I0ZA 4XHJC 1J86A 5E4IA 5DD1L 1X5YA 1MRFH 1KB5A 3MJGX 5IEKB 1L4IA 2GJ6B 1L7IH 4ZFOB 3NPSB 3P11H 1UWXK 3GO1L 5SX4H 4CAGA 1G9EA 4FMKA 1VFAA 2IFFL 5LAXB 4K8RL 4PBXA 4UILL 2N7BA 3PJSA 2P24A 3GHBH 3MMEB 1C08B 1GC1C 1KB5L 3BE1L 4Y19D 5HPMB 2VQUA 3D69B 3GBNH 1Y18B 4KFZC 1MCSA 1T1XB 5KOMC 2HFEB 3RNQB 4KJWC 5FKAB 5E8NA 4ZS6D 2V9RA 1DSFL 2XYCA 2A83B 5ILTH 1KJ3H 5GZND 2E8ZA 1Z3GL 2QHRH 3I3EA 4LCUA 5JW4N 4JFDE 4XWGL 1NCAH 1Z6JT 3NA9L 3WN5B 3TO2A 3DVFA 5F6HI 2CDEA 4ZFOA 5ICZB 1IQDB 5D7SL 5GRUL 4HIJA 4UT7H 5F7LB 1BZ7B 4XAKD 3HPLB 3MCG1 1MRDH 2JIXD 4JFOB 3L3DB 4MQSB 3MXVL 5K33A 1CXIA 5EU3B 2BNRD 4S2SA 2FX9H 4M5ZL 5DQDH 1ORQB 2AJZB 4HKXA 4EDXA 4FQ1L 3KPPB 4PJBA 2QJDA 4X7SH 5EUOB 1M71A 1TPXC 5IF0B 2DD8L 4UTAH 1HXMA 3FB8A 3MV9D 4WFED 4CN6A 4R0LA 1FFPB 4AYFA 1YEIL 3GGWA 4JZOA 4C4KO 1I9JH 1I8IB 1BM3H 1U3HD 3GMRB 1CFTB 1BM3L 3BW9B 3HFMH 1S9YA 1EX0A 3F8UB 4ZDHA 5ETUB 3SOBH 2WMPA 3SKNA 4F3FA 4XPTL 3WIHA 2AXHA 1XGPA 2X41A 2XZAL 4LLDA 4Q6IC 5F7DA 1AGCB 5I1DB 1J05A 1MREL 3FHAA 1EDQA 1S7UB 3OR7B 4J3SA 5I8EA 2W91A 3SKOA 4N8VB 5T1KD 1CLZL 3T2OA 1KIRB 4RX4D 3T8XB 4XC3L 4JRXB 2F74A 5M7QA 1VFBA 5KG9A 1BJ1H 3U9PL 5I1AA 3S34L 1MNUL 4ZG1A 4PJIA 3ARFA 5KVMC 4UOW1 1EEQA 3P0YH 1P6AB 3VRIA 1HHJA 3D2UA 4WHCA 4NO3B 3ZDYF 1BZ9B 3QYCA 1KENL 1MCRA 4XP4L 1SBSL 2HKFL 5KSAA 3GUTA 5GJSL 1A7QL 2ZOLB 1U8HB 3FQWB 2W65A 5TDPB 1Z9LA 1L0YA 4LCWD 4MAYD 1PKQE 1NDGB 2UZIL 3E0GA 3X17A 3HRZB 1A6WH 2A6JB 4NBXB 1QBBA 1D5IH 4QHUB 3RVUD 5JDSB 1MHHB 3QHTC 3O3AA 3SGDI 4NRXB 4XP6L 1U8KA 2HJKA 2NCMA 4Q6YA 4KQ4H 1G0YR 4C58B 4H26B 1C5CL 5D6DC 6CGTA 1OTSD 3OXSA 2R2CA 3QEUB 3MRNA 1FYHB 4M43H 3EJZD 2I9LB 3IKCA 5ELIA 4JQXC 1J8KA 1F2XK 1NCWL 1ZANH 5FUCC 5CEYB 1AY1H 1KJ3L 2AKRA 1PFCA 1JTTA 5K9KB 3BZDA 5E2VL 1A9BA 4U33A 1FZKB 4E41E 1F2QA 4PJDA 1FLTX 5E5MA 5CJQH 3WSQH 5HGGS 1PZUB 5SX5K 2YOCA 5KSAB 2BHYA 1AE6L 4F37F 2JLLA 1KCUH 3NIDE 2ICWJ 5K9QI 1AHWC 3QEQE 1MOEA 5TFSL 4KZDL 1HQ4A 1QTYT 1IBGL 2AJYH 4N90E 1E6OL 1F90L 4KK9C 4OZGA 3TEUA 4WDIB 3GSNL 4GRLB 3UPRB 1NCDL 1L7IL 1JWMA 5M95B 3O4LA 1WTLA 4AMKL 3V6OA 2OJZL 5E00A 3IGAB 3V6OE 4KJYB 3S37L 4ZO6A 1J1XL 1JUFA 3VGFA 3GB7B 2J3SA 4KY1H 4HWZB 1MHEA 3SGEH 2EEBA 2YMXH 4PJAE 5F97E 1HE7A 4XVJL 4OZ4B 1ZLWK 5DTFB 1ZGLA 1N3NA 4X5WA 4JO1L 4PJAA 3VGBA 4S0SD 4U1SA 1EFQA 1JK8A 5DJZB 5FV2A 3O0RH 2HFTA 4GBXC 3NH7H 3DHMA 6FABL 3CFDB 4RQQB 3C5ZD 1PQZA 2IPUG 3BUTA 5IROA 1FC2D 2BJML 3EUUA 4I77H 3HMXA 1NC2D 1ZHLA 4Z7VE 3DYPA 3QUXD 4IOSD 4WUUB 1OGAB 5D93C 1JJUA 5IF0A 3FB5B 1FL5A 1WC7B 2IQ9L 4ZPTB 2Y23A 3ELAT 1HCFX 4H8WH 3IFLL 2Z31C 4ALAH 2K9UA 2DWDB 2GJJA 2IQAB 3C5ZC 2AJUL 4M7LH 2NXYC 1BZ7A 2PYEB 1FH5L 4UTBL 2Q7YB 1FG9C 4PJ9D 4DZ8A 3WN5A 3UBXG 4QF1A 3P73B 4PJEF 3FT2A 3M1BB 4LEOA 5CZVH 5I19H 1CDYA 3QH3B 4Q9QH 4XHJD 5F8QC 1H3UA 2DLFL 4OKDA 3UPAA 2CPCA 4HBCH 5ICXB 2P43B 1DL7H 4X6DA 3G6JF 2FX8H 1UG9A 1Q9OA 4HC1L 2GQHA 3EYOB 3VFRA 4Y0GA 3EO0A 2EIBA 2IPTH 3QUMB 4N8PA 2XI9A 2Y5TB 1OP3K 2VRAA 4HX1B 4NZUL 1M05B 4PRHE 3WJLA 5CJOH 4M8QB 4YPGA 4TPRL 4FZ8L 4EJ1C 1CDIA 2FD6H 25C8H 3RBGA 3ARFC 3QI9A 4LLMA 5F89B 5HGHA 3TZVB 1EHAA 4ZFFB 4MAYB 5AD0A 2HJLB 2DM7A 4HDIB 3FO9A 2UUDH 5HVGB 3RGHA 5T3XH 4PRPA 4WV1B 3PABA 4ZFGL 2IANA 2ZUQB 2GY7B 2ORBL 4MVBD 4PJ7F 3MX0A 3PWVA 3SE8H 2UYLA 3UYOD 5FHBH 4DKAA 1ZVYA 4Z7OF 5ISZD 2GYSA 3QUML 2X2YA 4MAUL 3UO1L 1XF4B 2YRZA 3QNZB 4HUUB 4JPKH 4KJPC 3OKNB 1YEIH 2X4RA 1MFDL 1G9NH 12E8H 3KPMB 4POYA 4MNQE 3B6SB 3UYPA 2IF7A 1GZPB 1FL3B 1CT8B 1CIUA 3IAGC 5I1IL 1BFTA 3QPXH 3ZO0A 5IMMA 2EDXA 1WCBB 1EMTH 2VQTA 5KBNC 1GGIL 1UM4L 1X5LA 3NOIA 4TSCL 3G5XB 4PB9L 4NZTH 4M7KH 3ALXA 3TNNB 4DVBA 5EOTA 3GRWL 2QV2A 3ET9F 3QEHA 4WW1B 1I4FA 3BEWB 5CFHA 3IXAA 3NFSH 4LSSH 3WJLC 4WI9A 4JCLA 5JW4Q 3BZEA 1UXSA 2X89D 5E8DL 4NUGL 3SKMA 4X4XA 5C0DB 1CXLA 3MRRB 4YGVB 2YR3A 1QFHA 1DSFH 4QRRB 1RMFH 5CAYB 4XNQA 2EZ0D 3PGCA 1LO4L 3I2CH 5BZDB 1YNLL 5LWYL 2VDRL 2XA3A 2X09A 4MD5A 5K59E 2BFVL 1F90H 2HT2C 4KHXH 2J8HA 1QO3A 2X1QA 3RZWA 3V6FB 1U93B 1F6LL 1SVZA 3VWJA 4EN3B 3QXDA 4I3RL 4ZUWA 3QIBA 3QIWA 4NRYA 3FN0L 3ZHKA 4WFGE 3V5DA 5IV2B 4JFYB 3SHSA 4Z7WA 5CCKL 2BRQA 1NEUA 5KN5B 4QXUH 3H9SE 4UIKL 1MJ8H 1IQWH 1OTUC 1J0IA 5LGKA 2VH5L 4M43L 1ZVSB 4DKDC 1TPXB 5D2NC 3LN5A 5BO1H 3I85A 2XZQH 3D1MC 3OKLA 2GTWB 4LPXA 2C1OA 1CXHA 5D5MA 3LEXB 4KRPD 2GUOB 2DLFH 3Q3GA 2WLZA 5DR5L 3P4NB 4O00A 5EORL 3PL6D 4Q58C 1I7UA 4YXKH 5HHQA 4R26H 3LZFH 2VNCA 4PTTB 1NCTA 5CIPB 5F1SA 1A21A 4U1IB 4PG9A 3VDAA 5IB3B 2EDLA 4QRRD 2B5IB 1HHKB 2JCCB 3BPCA 3KXFA 1XF2A 2DL2A 4PREA 4LIQH 3PWNA 3P0VL 1A2YA 4WWID 3PWPD 4JO4H 3QULB 1OTTC 3CNKA 2P49B 3DV6B 2Y7QA 4G9FA 1CGTA 3MRIA 4LRIA 4BSVA 1TZIB 2VKXA 4QRPE 3JWOC 4MJ6B 3PQYE 3K46A 3NZHL 3UTSB 5JLZB 1D5BA 1XZ0B 3IDMB 2Y06H 4TVPD 4PJHE 2OXHA 3SE4A 3JXAA 2H8PB 3PXJA 4MLSA 2EYRA 2AV7A 4WTZA 4CGTA 3RX5A 1MJUH 4IOIB 2ATPB 1A4KA 1UQSA 5FUZL 3OGCB 5F70A 1MH5A 3KR3L 4NUGH 4P46B 1Q38A 3W82A 4XWOC 4TNVF 4UDTA 1S8DB 2NY2B 3EDKA 4HGMA 3IRZA 1LEKA 5GS2H 2R29L 5F1NB 3UJTL 3U0TA 4NZRH 3MV8B 3UTSE 3JTSB 1TZIA 3S4SG 3CSPA 4M1CD 2Q6WA 4QRPB 3CFKB 2VZTA 3QULA 1ZLSH 4FMFA 2V7NB 5EIIB 1MLBB 4AG4L 4CU8A 3SBWA 4DAGL 1IE5A 1QFWH 1XF2B 5JIPA 3GHEL 4I5BB 1ZHBB 1GGCH 5A3ID 4LVNC 1BHGA 5D7SH 1WICA 5D7KD 5FYLD 1OF2A 2Z35B 3ARYA 5JXAH 3WS3B 1NGXB 1QA9A 4X99B 1FPTL 3KPRD 3MFFA 2DIAA 5JA9A 1AR1C 1VKXB 2B4CC 4OFVA 4YC2C 5A2KH 2YPKA 1RJZA 2CLZA 4WFGD 2GCYA 3H3BC 1P4LB 3FO1A 3VXMD 4K2UL 1YEFH 4HGWA 4D9RD 4EUPG 4ODXA 4P5MB 5C0RH 3SDYH 3G5VB 4BM7A 3AGVA 5H37G 2DDQL 4P9MH 5EN2A 5BZWA 2CKBB 4JO1H 2HKHH 3GMPB 3WIFB 4UQ2B 1FN4A 4G43B 3MLRH 2C3GA 4G8GB 1FNSH 3RKDC 3RTQB 2VABA 4P5TC 2G60L 2ESVD 5I1JH 1LVEA 1VFUA 3BDXA 1TZHB 3DOSA 4L9LB 5MEND 3RL2B 4YHIB 4YZFF 4OCWH 3KPSD 4NRYB 1UWEL 2XZCL 4DCQB 1IEBA 4WW2F 5ESQA 1GHFL 3SGKC 2X4OB 5DDHA 2A6DB 5KSUB 5EU5B 5C0AE 1IM3B 2KUTA 3DUSA 4FQHA 1P7QA 3BVNB 1LEIB 4Z18A 3DARA 4JG0L 1JWSA 4LHUA 5F7EL 43C9B 2EIEA 3S5LA 5BZDA 4FQXA 1LEGA 5CHNB 1NCBH 4R3SB 1D9KB 4GAFB 3MOBL 3M8OH 3FOMA 5K9QG 2XQBL 4G80A 2F54D 3HG1B 1QLEH 1AP2B 3SE3C 4I9WE 4UT9H 3SO3C 3EW3B 4KROB 5C07A 2CD0A 3MLTB 3ZYIA 4JREC 4YHKH 4NO2B 4QGYA 1HINH 4MXQC 4NDMA 1U8PA 5EORH 3ARDD 4M8VA 1BVLA 2XOTA 2H2SC 4L4VB 5KSBF 5FA4A 4PJCB 5F6HJ 4OI8A 2R2EA 3OG4B 1BBDH 4FABH 1Q94B 4JKWA 3BH8B 3EKCA 3V79C 2X44D 1HH9B 4WFFD 1E4WH 5GJTH 3BP7B 1MFAL 5J12C 2WUBL 1GZPA 4R9HA 1W0VB 3V0AC 1WAAA 3WFCH 2A6DA 3TBTB 5IEHB 3EJJX 3VXSD 2X4TB 1SJEB 4WI3A 1P6FA 3ZKND 4UU9B 2CLRA 3AMLA 1ED3B 5FCSH 2B5IC 4I2XA 1AGBA 1A22B 4WU5B 3IETB 5IJVB 3AY4A 3RWFA 1YMMB 4LVEA 3CH8A 2AXJA 1QFPA 2PR4H 2YS4A 3LKQB 5JHLL 1I3UA 3UX9B 4JR9L 5MHSE 4CVXA 4DZBB 5D7KE 3PL6B 3UTQA 5E8EB 1JWUB 2VERN 1MCJA 3OAYH 3T0EA 4BQ8A 5FV1L 2X40A 4FQLL 4F2MA 3U4BL 1CVSC 1JGVL 3FO1B 4QRQA 2V17L 3FN3A 1IGML 5DQJA 3KVQA 3MREA 2CDGB 4K3EL 2QSVA 1O5DT 5C0IA 2CUMA 2VN7A 5AZ2H 4PV9A 4KMQA 1KCKA 4UNUA 1KELH 2FJGB 1U8QA 4M9PA 1R3HB 4X80L 4ETYA 3LEYL 2PXYA 2VJXA 3KPNB 2XWTB 4WI5A 3W0WA 5F7HA 1MFBH 5CLTA 3F65A 5IG7B 5DJ0A 3RL2A 3TVMA 3BP7A 5DRNA 3TIEB 5D8JL 1PKOA 4FTVB 4L9DA 1NC4A 2WP3O 4KVNL 1XR8A 5FYJE 5C0AD 3U48A 1V7ML 5E2WL 3EFDH 3RVVC 3QH3A 5FHAH 3B43A 4IRSA 5D6CB 3Q1SH 1WJ3A 1EHNA 3MOAL 3VGAC 2CO6B 5HI3C 3U7WL 4K7FB 1DBMH 3D9AL 4WHTB 4NKQB 4L5FH 2W59A 2IEPA 2H32A 1RVFL 1X5XA 2APFA 5EO1B 1R3LA 1N6VA 4YK4B 2FJFA 4LLQB 3SDCD 3WFZA 5KS9B 3FOMB 3SDXA 4JFEB 4RBPH 5BQ7B 2APTA 2OX5A 43C9A 1E4WL 4FQCL 4KUZH 1IGJB 5D7JC 1K8IB 3HG1D 3QISA 1CG9B 1MCWW 5EFIB 4JRYA 4Y5YC 5FGBC 4Z7QF 5D1QA 5ALCH 1I8KB 5KW9H 4CMHC 5ADOH 3QUYB 3C60A 1JHKH 5DYOB 2W60B 4L3EB 4YDVA 2JCCE 5GIRB 3ZYZA 1KCSH 1YMHA 3KHOA 5FO8B 3NA4A 3OR6B 3HS0B 4JQIL 3FTGB 4YE4L 3S3SA 5CMAA 1UXWA 4Z7UA 5DTFA 4TVPH 3FOLA 3G08A 1IC1A 3M8OL 4CDGC 4CVUA 3RTQA 4OLZH 3S3PA 4NQUA 4XCNA 2ADIA 4LSDA 4KK5C 1D5XA 5L0QC 3S3JA 3TH4T 3ARXA 5ICYB 1U95B 2P5EA 4KJWD 1F4WH 4PJGB 1L6XA 3RGVB 2YK1L 4YHOH 2H8PA 3HC4H 4MNGB 4U1KB 2XZCH 3CSYA 4MJ6A 3HR5A 4PYGA 5I1HL 1MY7A 3G6AA 5D2NE 2H1PH 4LOUD 3FT3B 4NRZA 3TZVD 4JY5L 2W0PA 3VXTA 2FEDD 5CJBA 5C08B 5B3JF 2YXMA 1T3FA 4LF3B 2O5XH 1ZHBA 4M1DL 5GGTH 3KYOA 4U1JA 4K9EC 4KXZH 3KYOB 5GGVH 4UT7L 1GRWA 4XPFL 5CIPA 1GVIA 2CR6A 5DA4A 3ILQC 4XNUL 4LP5A 4M6NH 4Y5VB 3MLUL 4N0FB 3BP5A 3IJHB 4H26A 4ZAKC 1LO0L 1SYVB 4UV4H 4U2ZA 5IMKB 2F53A 2HLFC 3QDJB 1FBIL 3KPOB 4QHNB 4GAGL 4AEHL 4R6UA 1X7QA 5E5RB 4BFEA 3WFCL 3DI3B 3PWJA 4HS8H 4HC1H 5DD3H 2GEEA 3N85H 4P59H 3LS4H 2F5AL 4GG8B 5I6XC 4UIMB 5KTEH 1D5XB 5GGQL 1X5FA 3OXRB 3W5NA 1EBAA 3GJEA 5IVXE 1QEWA 2EDNA 1FQ9C 3VXUD 4X6DF 4WWKC 2EDDA 4P5TA 4TUKL 1C5BL 2HTLC 4ELME 2AGJL 4OFDA 2AK4E 3GMMA 4MB5A 4X6CF 4LP4A 1A6UL 1UM5L 3F7VA 1OAUL 1OGTB 4ETQA 5IFHL 1W0WB 4OT1L 2WANA 5EU4A 4HJJH 4Z5RB 5GHWL 5D2LE 4XBPB 3VXOB 2C5DC 3MUZ1 4P2OB 4PV9B 2DJUA 4MD5B 4K23H 3HLAA 5I1DA 3HUJE 3CSBA 4NT6A 5CSBA 2FJFB 2W1NA 4JFDA 4LLQA 4HUWA 4IDJH 3WMSA 4ZDHB 3BGAA 2BVPA 5C0NC 4NNPH 4ODWB 3MR9B 4ODUB 1PYWA 4KH2A 3MCLH 3FZUD 4R0LC 2WNGA 2HRPL 3QI9C 4ZFFA 3JTTB 1CICD 1NGZB 3UTTB 3BP6B 2HP4A 2RFXB 3VXUE 2UVEA 4OM0H 4WENB 5AYUL 3Q0HA 2M26A 3C8HA 4Y5YA 5FGBA 3QUKB 5BXFB 4U49A 1UACH 2XN9B 4P9HC 4JKLA 2GITA 2R2BA 1AO7E 2CDEB 1EEYB 2EE2A 1S7TA 3DUHA 4HD9A 2VUYA 4P5KA 4JZJB 4M00A 1S7TB 2Y06L 3GNMH 4YWGL 2Z31D 5DUMH 2ERJC 1MCFA 4Y4KA 4N0CC 2XN9A 5IHLB 4L9LA 2XZQL 3IFOA 1HH9A 5ABDE 4PP1C 4OFYD 2YD2A 5DD6B 4HIEB 4JHWH 3LKSA 3MYJA 2EC9U 3PQYA 1NUGA 1XGQB 5D71H 2SEBA 2IMMA 4Y7MA 4LLVB 4MDIB 1A8JH 3BRFA 4N8CH 4UINL 5JR1L 1TJGH 5GGRY 2ADJB 3ULVE 1BVKA 3K8KA 1KB5B 1H5BB 1TZGH 2H1PL 3BQUA 2BNQE 3E6HB 3QZWG 5H35B 3JWOL 2A77L 2BHZA 2FRGP 2DQHL 5HDQL 4GG6E 2BNQA 5JIKA 1VKXA 2AEWA 3HLAB 1S5HB 4KHXL 3ARRA 5TE6H 2KH2B 2AJ3B 1JWSB 3NGBB 4KU1A 4IJ3C 1MREH 5JDJA 4GW5A 3SY0A 3QQ3B 1LHZA 2DM3A 3MRLA 3IVKA 3B6SA 1MJJB 3D3VD 1H9VA 1J1PH 5FFLA 1ZT4B 1X3DA 1ZWIA 4S1RL 2NY7H 4OLXH 4PIRF 3NZHH 3GSQA 5IW1B 1FYTE 5ESVA 5DFVD 2DB8A 5FYLE 1FYTA 4I18C 4UNTA 3RTQC 5IUSA 1ZAGA 3L9RA 3MRDB 2BXZA 5IVZB 5I30H 4KPHH 4N9GA 2VE6B 1J12A 4B41A 4R90H 5F3HA 1L9MA 3OXRA 3P73A 3VCLB 1NCAL 3GB7A 3NA9H 5HDOA 4QT5B 3MBEA 4PUBH 1LDPH 2KQNA 3GK8H 3NN8B 4XMPH 4G8EB 5CWSA 4OZFA 5KOVC 4XB7A 4P4KB 2RQ8A 1JNHB 1LEGB 2DLHA 4OI7A 4QHNA 1KELL 3L5XH 2BP3A 5JLZA 5ADOL 5DR5H 3GBMH 4M8QA 4YPGB 1FSKC 3QHFH 3D6GA 4OLUH 5D1QD 3IJHA 4PRAB 2EYTA 4OF6A 2COQA 1MCEA 1VSCA 4D0CA 2DI7A 1CIDA 5CP7B 2Z35A 4IIQB 2OSLA 1WT5A 1F3JA 1DBML 4NFDA 1JMZA 3QSKB 2VIRA 1MRFL 1BMGA 1LILA 5HVHC 3SDCA 4LFHG 5BJTA 3T09A 3F7RA 1RI8A 5EC1A 4YBLB 2FWOA 4J3TA 5E6ID 3CFKA 3F7YA 3MLWL 4X6CE 5F9OH 4PGJA 4G43A 3QXAB 5ITFB 5HHOD 3GMPA 4P2QB 4CJ1A 5CJXA 4Q2ZB 3RVXC 3IFPB 1IAOA 3FT2B 2ICES 2P5WE 2FSEA 1BF2A 4OLWH 4XBEH 1GYAA 1YQ2A 1KIQB 2HTKC 1OCWH 1KIUA 3ZTJH 3QNXA 4HQQH 4DQOH 1GOFA 4Y19B 4J6RL 1MHCB 1YJDC 3WNPA 1U95A 4YX2L 2YSSA 5F9DC 4JDTH 2HWZL 1L7TH 4U1MA 4EBQH 4RZCB 1D5MA 4JPVH 2NR6D 1MWAA 5CBAB 3GSUB 2YUVA 5C0BB 3QWOB 2APWA 3EJYD 1RIUL 1U58A 3D18B 4JY4B 1WFNA 3OG6B 1B6UA 1L0QA 1OGAA 5E1AA 4OLUL 2A77H 4HZLB 2XKNA 4Z9KB 1OARH 1T2QH 1QFWI 3QDGA 3O6MH 5FO9A 3KLHC 1A2YB 4HT1H 2XKUA 2VLMD 2XRAH 4PLJC 4QOKB 4OD3L 2DOCA 4L3CA 5DYOA 3JBG7 1RJYA 1UYWH 3EDDA 1JNJA 1YQVH 1B9ZA 3MRNB 1LO3H 1IJ9A 3ARBB 5IBUG 4YHPB 3O8XA 3P30L 3T0ED 4OZIA 5I8EB 3EYSL 1MCQA 2VZVA 1ZT7A 1VHPA 4ELMB 4R90L 2GJ6D 3DIFB 2VLJA 1J05B 4H20L 5DO2D 2MTPA 2CLVA 4HJGA 4UT6H 5CJOL 4M93B 4KVCL 1I1AB 5LJYH 4KV5E 5H94B 1T4KA 3TYGL 1CGUA 3GIVA 4JDZB 2K1MA 3O4LB 1QBAA 4ZTPL 4OBRA 2OLDA 1QOKA 1DVFA 4OCMC 5EUOE 2AXGA 2GTWA 5GGUB 1WVZA 4OZGB 1K8DB 3X12A 5GXBB 4OZHE 3B8SA 4RGOL 5F21B 4DOHE 4LCWB 3O2WL 4Y2OA 3E3QE 4MB3A 5IQ7H 5CZVL 5JIIA 1KTDA 1ZVSA 3LRSA 1JYXA 4WI7A 4JFPA 4G9DB 1XH3B 5SWQA 3QFDB 1WBYB 2I60L 1JBJA 3HCVB 2Z92B 2Z93B 3HTLX 4OCYL 3NZ8A 5I8KH 3DPBA 5IWLC 2YPLB 1KC5L 3LQZB 4NPYB 3MNZA 1P2CB 4QHMB 5IESL 4J3VA 1CDGA 3ARDA 1QNZL 2XQYK 1T83C 1EVUA 1S7QB 2FJHB 2DTSA 3QO1B 4WO4D 5LVEA 4PS4L 3TBVA 4JG0H 5TDNB 1NBYA 3E8UL 3R1GH 4RIRA 2RBLA 2XQBH 4FOMA 4JPWH 4F3FB 1JNNH 2ZJSL 3Q3GB 2X05A 2HMID 4JM2F 35C8L 2R23A 2VLRE 1VACA 1DQQB 1CXKA 1SYSA 2BSTB 4XP5L 4H8WL 5F9WB 4LSUL 4WV1A 1ZV5A 4WO4A 2YD6A 4X4YB 2VLKB 1DDHB 5I16A 2P8PB 3GMOA 3P4MA 1IKNA 4O4YH 2E9WA 5AD0B 2Q3AA 4N0YL 1EGJL 4P99A 5DJXA 1C7TA 1TCRA 3L3OA 2ZUTA 2FZ3A 4PRBA 4G7VL 4XVUD 3GJFA 4KK8D 3T3ME 3TP4A 3S37H 2G5BA 2AQ3A 1CF8H 5GGSA 1F3DH 1NLDL 4ZOBA 1KGCD 4PJEE 4LKCA 4LBEB 2R29H 4HT1L 1WCBA 3MLZL 2BDNL 3BRDA 1QYGH 1MVFA 3MJ8B 5HHNA 3PUCA 3EYOA 4OIAA 5DMYA 2UZIH 3BZ4A 3N85L 3OKKB 4WU7B 4C57C 5KZCD 1RIUH 4JM4H 2IPUK 3Q2CA 1JZ2A 3GBML 4AL8L 3TPKA 3OZ9H 3WUWA 4LLAA 4K2UH 2AW2A 4RGMC 3RHWK 4F7PB 2OZ4H 1D6EB 1BZQK 2AJYL 4RGNC 3GJFH 4I0PD 4HQQL 3KPRA 3BW9A 2NY6C 5JOPE 5IBTH 1B0GA 4MDJA 4HDIA 3DX6B 4KJPD 4F57L 5EBWB 1G7LA 2Q87A 1M71B 2YEZB 4D0DA 4XCFL 4U7SA 5C3TA 4NZRL 3FFDA 3MLWH 4M3KB 5F9OL 2FHFA 3GI8H 4ELKB 5HHOB 1ADQA 4H25A 4KTDL 2OR8A 4ELKA 2NW2A 1KJVA 4U1GC 2X4QA 4HPYH 2BZDA 2BVUA 4HPOL 5T3ZL 2E6QA 2R8SH 3O11A 3U0PA 5EBWA 3TPUA 2WW8A 1A7QH 1WGOA 3CMOH 4WJ5B 2H9GA 2VDKH 3HMXL 3PGDA 4NQXA 4M02A 2BHUA 4ZFZA 5DFWH 2EIZA 2NYYC 4GAYA 2NY0B 2WBWB 5JXEA 4I48B 3OF6D 1VGKA 5HY9B 4X4MA 1KB9K 4H20H 1R5WB 5DQDL 1DQDH 5BW7C 3ULVD 4U05A 3X11B 3UTPD 1IQWL 4YIQB 3IRPX 4HSQA 1HWGB 4AH2A 5J3HC 2RIKA 4KJYA 4CBPA 1ZANL 4JZNA 4QOKD 3DUUB 1VFMA 3B4NA 3PWPA 4BFIA 3SKUD 2VR5A 4XH2B 2OTUB 4M7JH 5IMOA 1GSMA 4RWHA 3O3UN 4NQEB 5DI8A 3KXFD 4JO3H 3QUXB 4LPWA 5CILH 5FYKU 2G9HB 4M93C 5C09E 3HUJF 1SBBA 1EO8L 4M48H 2ICWI 3RWJB 5C09A 5FYKD 1A3LL 2MKLC 1FVCA 2PW2B 1CE1H 3DYMA 3V7AE 4Y1AD 5HHME 4HZAA 1T89A 1AH1A 4YXLL 1I7TB 1VACB 3QWRA 1NGWB 4KTDH 4PLKC 1I1RA 4XP9L 3ZSSA 3TJHC 5E9DB 4Z95L 1OLLA 2DQTL 1I1FA 2FO4A 1IGIH 4WHDA 3J7HA 5HI5D 5FGCB 5E5UB 1ETZB 5J89A 5J57B 4IS6B 3MCKB 1A7OH 2PYED 1MCHA 2W9DL 3HI5L 5C0EA 4ORZC 1P5UA 5I6XB 1NPUA 1RZGB 3QIBC 2HH0L 4WW2A 1HCVA 2PYEA 1CE6A 2I9TB 4LRNL 3RFZC 2JELH 1MCKA 4WWKB 1DQJB 4QHLB 2G2RB 2AK1H 3KNBA 4YDJA 2W38A 4GT7A 1T21A 4PRHA 3OMZA 1FE8L 4JN1L 5BVJA 1A6ZA 5KJRH 5A16B 3TNMB 1TLKA 1Z5LA 3QWRD 4JQVC 4QXTA 5DUML 4W4OA 5F71A 1DCLA 1A7RL 3FQXA 4YWGH 1WUNT 2GSIB 2VDKL 3DROB 3DMMB 4U4BA 1WIPA 1JIBA 4KROD 1F6AB 3CMGA 3K81A 4M1GL 1RV6X 3WKMH 5IBLC 43CAB 4HPYL 3VU2A 1CL7H 5T5NG 3ARQA 2FX9L 3P9MB 5HYQB 5FOBA 2PTTA 3QEUA 4U3CA 3PQYD 2EKSA 3P4NA 3N9GH 1S7VB 1JF6A 1XGYH 5CEZH 1QRKA 1GCFA 1P5VA 2CRZA 43CAA 3P3YA 2HFFA 2J7LA 4QOKA 2PUQT 4LU5H 1WFTA 5H2BB 1I8MB 3LEXA 4D9QD 1T04A 35C8H 4BQBA 5IR1B 1PGRB 3KLSA 4NOFA 1BBJA 2IFGA 3LKNB 3OSKA 2UY7A 3CXDL 5DC9B 2E5EA 1PZ5B 3QRFM 3E8UH 1RZ8B 1HQ4B 1MWAH 2FECL 4AEIH 4JGMA 2H3NA 4KWUA 4W70A 4HBCL 4M6MH 3O2DH 3C8DA 1DQJA 4QHLA 5D9SA 3UTZB 4TNVK 5ISZA 3ARFB 3LKNA 5F9WC 3IDUA 4LGRB 4YDLB 1OAKL 3L95B 2DWEA 4MAYC 4PS4H 1UKQA 3WD5H 1RZGA 4UZGA 4KTEL 2JB5H 2NY0D 3QBTB 3B2UD 1T1YB 3RWCA 1LK3L 1KXTB 4TPRH 4DTGH 4LMQE 5JMOC 1NAMB 3MA9H 1GOGA 1IAIH 5E8NB 4GSDH 2NY5C 4M3JA 1DANU 1R3IH 2X1PA 3WS6C 1DBJL 4J8RB 1MCIA 3SDXF 1MCLA 1Y18A 2VDOL 4PY7B 2EIZB 4KDTA 5I8CB 3G6JA 2PW2A 4P4KD 5EUOF 7FABL 1IM9B 4MA1B 2FGWL 3JSSA 1AD0A 4FFWD 2H9GB 2IAMC 1B88A 3FAWA 3GMQB 4EUPB 3DBXB 3O11B 3P30H 4Y88A 1F42A 1MY5A 4R4NC 4HKXB 1UACL 3KPQA 1NAMH 3SEPA 3MLVH 1HHIA 3MROB 4MZ3A 1OL0A 3GSVB 3PDDA 1FFQA 4JEGB 4P5TD 5DD5H 1F3RB 1OPGH 2X4PA 3MLRL 2FHCA 1OW0C 1CFQA 1VFBB 2YUWA 4DKEL 3VGAB 1N5AA 3BO8A 2E9IA 4WW2B 5GS1C 3T3PE 1TDQA 1KPVA 1C8PA 3BZFA 2FCBA 1K4DB 4LDOB 5B39B 2Q76A 5T3ZE 2EH7H 3VCLA 1BQUA 2VN4A 4UI2A 1MLCB 3BOVA 4FQCH 4YFLF 1U8IB 1R5WA 4MLIA 1N59B 2ITCB 3RVWC 4KK6D 1FH5H 4LSQH 4P3CH 4HMDA 1UZ8B 5EBMB 3QRGL 5IOPB 4YX2H 4BFGA 4M7LT 3BWUC 3ZZ1A 1V3MA 3SCMD 3V5HA 3TBYB 4DQOL 2O26U 3EYQD 2AXFA 4HKJB 5E9DE 1WFUA 1ZWIB 3GMRA 4JZOB 4PRPB 5D70L 3PP4L 1AIFB 5HHMB 1AGEB 4CRPA 4L8SB 1XGYL 4HUNB 1XF3B 5JW5B 1ZSDA 1P69B 5E2WH 1QSEA 1FCGA 4G9FE 2HT4C 3NIFE 2E7LA 4X0KA 4DOHB 3I9GH 3OBAA 4OQTH 2R39A 2OTWA 5HD8D 2Y4SA 4G8FA 1H5BA 1K4CB 4NWUL 2F5BH 3OKEA 5C0CB 2ARWA 5L0QB 4HG4K 1AO7D 3BPNC 5INCA 3ZSTA 4IEFB 5EOCL 1H8NA 1IGYB 4Z78A 1UADC 1ACYL 1NEZG 2DYPD 2HA1A 1KG0A 1AXIB 1PG7X 2UV3A 4HIEA 2HVJA 5JXEC 1GPOH 1AXSA 2HFEA 4MXVF 4FG6D 5IB5B 4M48L 1ERNA 3BKMH 4Z7OE 4OIIH 5E2VH 1X5HA 3VFPB 2WIIB 4F7EA 4F9PC 2ZZUT 1RULL 4XMPL 1HKFA 4AEEA 1JNLL 3BZ4B 3LS5H 3RZCA 3PGDB 4NKOB 4LNRA 1NUFA 4X9BA 4O9HL 4DGIL 1K4DA 1KPVB 3GI9L 1NSNH 4LVOC 3MO1A 3LQZA 2ICWA 4GW4A 2IAMD 1B0WA 4ERSH 4LSVH 2E8YA 3F12A 1A14H 5LBSL 5I1GH 4WCYH 3C6LD 3WHXB 1CBVH 2DJ4A 5EU6B 1CGVA 1EJOH 4G3YH 4WEBL 1TETL 4UOW0 5IB4B 1ZSDB 1FL5B 1VA9A 5JORA 2P8LB 3DJ9A 2FH8A 4GAJL 5JQHC 3HRPA 4ODUA 1AD0B 5BV7C 2OL3A 4S10A 4MNQB 5SWSD 1NMBL 1T4KB 1G6VK 1UJ3B 1OP3H 2B39A 1I7RB 1YEDB 4ZNEE 5D7LA 4J3OC 3MACL 3TIDB 4KUCF 3CLEL 3BP4B 4IRSD 5DZLA 3MJ6A 2IH1A 5DMIL 4YHPA 4JPIB 4ZYKB 3AXLA 4PB0H 1FGNH 2FR4A 3SQBA 1A5FH 2RB8A 4WUKH 1MNUH 3UTTD 4R4FL 1IT9L 1A7OL 3L5IA 2VL5B 1FFRA 4LIQL 4MQXD 2QADC 4X7FC 5D7LD 3W39B 4NN6C 4XWGH 3FQXB 5MI0B 5D9SB 3HPJB 3QUXC 4PJIE 1CDCA 2FYYA 3UBXB 1AI1L 3SOBL 5FA3A 1XR9B 1T66C 3D85D 5T1KA 5GS0D 1XEDA 1DQDL 5SWSA 4W4OC 1JPTH 4PRHB 1X4ZA 5D1ZC 5EPMB 4RZCA 3KLAB 1YN7B 4JDVB 1Q72L 1EIBA 4PG2A 2NY6B 3HE6B 4R4BB 4Z7VF 5I8CA 4X7SL 3PHOA 2B1AH 3KYMB 4F7CB 4GXUN 2BERA 3CK0H 2O93L 3JV0A 4KKAC 4M5YL 3UJIL 2E7HA 2DQCL 5IHUH 4F58L 1N4XH 4RRPG 1U2HA 4EI6B 1NANI 2O61B 3BP5B 2X4NB 1G7MB 5A1AA 3RWGA 5FOBB 1JFQL 3SDYL 2O5ZL 1IGCL 3GI8L 2EDOA 4QRTA 1TJGL 2QTEA 5FO9B 3SDCB 3RY5A 2H45A 1JYVA 2Z4QA 3NZ8B 3VXSA 1NCBL 4PRNB 2Q8BL 4JANA 3O6FA 4DGIH 4ZO9A 2IWGA 4F80A 2ZCKH 4ZUUA 5I66B 4PRDA 5HGAA 1CS6A 2J12B 5HDBF 4AL8H 4HXBH 3C9NB 3ZL4H 2LABA 5D1XD 1NGPL 3ULUH 1A1MB 2VDQH 3RI5K 2AXGB 2EC9T 5EOCH 2AP2A 2F15A 3NIDF 1RY7B 4OZHB 4XH2A 5BV7L 3ARUA 2G2RA 3UC0H 4NQCD 4G8EA 4M03A 5ID1B 1I1YB 1LD9A 4FQLH 1OW0A 2H26A 4DGVL 4DVRL 3MBEB 3S4SA 4CNIA 1VGEH 5IHZB 3UXFA 3MQIA 3MV7E 4LAJH 3FQUB 5I73B 1PBYA 3AM8C 3DIFA 3BI9X 3CD4A 4ACPA 4OFPA 2KBGA 4U6HB 1AGCA 5KVGH 1IC5H 1R3JB 4FXKA 4P2CG 1N2RA 3HKFA 2QQLH 4JFHE 1J0KA 5ESVB 4QKXB 5IVXF 3WFDH 1I7TA 5C0RL 3IF1A 2J8OA 1RK1B 3GSNH 4FN0A 5DUPL 3SCMA 3O3EA 3DROA 3TLRA 2C9AA 2OSLB 3EO1B 4HKZA 2VB5A 1NFDA 4Y4FC 3JWDC 2EECA 3G6DL 4YHNB 5D70H 5LKNA 3KPSA 1YEHL 3WIHH 5LCVH 3OZ9L 1KCUL 3QFJB 4PP2A 1FBIH 4Y4KD 5EU3A 3OAYK 2EDBA 5EC2B 3FFDB 4LASH 4DGYH 1CR9H 1RIVH 3U7YL 1MF2L 1M7DA 1JGUH 3GSXA 1LO3L 1T20B 3QNXB 1HYSC 1LNUB 2WLYA 1A64A 1HOCB 5GS1A 2ADJA 5DD5L 1WV7T 2VXTH 5IWLA 3R4DA 3DVIA 4F7EB 3EZ8A 1SQ2N 4IRSB 5D6CA 3VFPA 4M6OL 1FZJA 2ITDB 4XVUC 3STZA 4X8JA 1CICA 4UB0L 3O2VH 5K59F 3H6JA 1L0XA 2CR3A 4ORGA 1MI5E 1NMCB 3TV3H 1Y6MR 1MI5A 4BH8A 1MJJA 1X5IA 2N4IA 5D1XC 1S5IL 3IDXH 3LOWA 2QR0B 3ESUF 3BPLC 5L2KE 4APQD 1BOYA 5GS0H 1ZVHA 2I5YH 4PJXF 4P46C 4M6AA 5L2KA 3QUZC 4D3CL 1KEGL 2APBA 3S35L 3MJ7A 1LO2L 3JWDH 4GUPA 5F9JA 5T1DL 5I1JL 3V8OA 2YA0A 4PJBE 3JVGA 5IMOB 4FS0A 3C6SA 2HT3D 3ZLQC 3D0LB 3DGGA 5GSRA 3W9DA 2NPLX 2QKIB 1IZJA 4J3WA 2UVFA 4OCYH 5I8KL 4PGCA 3GMOB 3H42H 3P4MB 4ZODA 1AC0A 4MDJB 1PW3A 1WTGT 1G7JB 4M1GH 3NCJL 3K74B 4LIQE 2DL9A 1E6JL 4MCYA 1DE4A 2VDRH 4IRJB 2ZUXA 4N9GB 3QJHB 1G7PA 2XZAH 4RMSA 2Z9TA 1UVQA 1N26A 2P1YA 5DXWA 2DQIH 1UC6A 2GTZB 4BSJA 1ACZA 3BKYL 5K93A 1KTKE 3A6BL 5HXMA 4LSPL 4G9FD 4NOBA 4YXHH 1SJEA 2X4TA 1IGTB 4QO1A 3E2HB 5EA0H 1OSPH 3L1OH 1AFVH 3MRQA 2F53D 1EJOL 2ERJB 4NGHL 1T5XA 1U42A 4KZEH 1NGQH 5IIEB 1ZGLP 1UM6L 4H25B 4KZEL 5I30L 3C08L 3LEVL 4OSUH 5IJKA 2R0LH 1I1CA 5J3HD 1IGIL 4PGBA 4MNGE 3WKML 5H35A 4JQIH 2DQCH 1T1WA 3CX2A 3RBSA 3LIZH 3PIQA 4EXKA 2XACC 1FG2A 4YXLH 4ODWA 3GIVB 4H1LH 1SM3L 5E7FA 4N1EA 1A1NB 4L4TE 3O3BA 4P2OC 4FA8A 5K9JH 4HJGB 5DJ8B 1HQRA 5J1SC 1NCDH 1Y0LA 5T33L 3ARGD 5D7JD 2R0WL 1U91A 1EXUB 2DAVA 3A67L 3BD5A 3RUGF 2VTFA 5TE6L 3IDGB 3WEXA 4P2RD 3BUYB 3QFJD 3PWLB 2V5YA 5EO0A 5C3LD 3CDGB 4XNXL 1TJIH 1IKFL 1XMWA 1IGMH 4NZJA 3D9AH 2X4OA 1V3JA 4DJMA 4QRSB 2VQ1A 1OHQA 3ARDB 5B3NA 3SBWC 3F7VB 1ZGLM 4HK3N 5D2LA 5DGQA 2DBLH 1DQTA 3L95A 4KAQH 3MRJB 5EOQL 2X9XA 5GGSB 1LO2H 2NX5E 4N8CL 1RHHB 5E1AB 3HCVA 4I2XE 1YN6B 5HYSB 2JKXA 3DV4B 5I2IB 5CBAA 3KS0H 4TTGA 5FM5O 5DO2C 3AVEA 1C12A 1CLYL 1DBKL 3RPIB 2YSSB 3O4LE 5EBGA 4I4WB 1BBJB 5EN2B 4E42B 4OCLC 3WL9A 2XTJC 1J8HA 4PBWD 1C5DA 2BVPB 4XXCA 2WM0A 3T65B 4JRYD 3ARVA 3TN0D 1LDSA 5JQ6L 3AU1B 5FHBL 4UOJA 2DD8H 3VH8B 4POZD 2ADIB 4FTVE 4KKCD 3NCYP 4HAFA 2NTFA 1RZFL 3SPVB 3WDJA 3VG0H 3CUPA 2EDYA 2DQDH 5T1LA 2X1XR 4LLYB 1JYNA 3U6RB 4MWFB 3BX7C 2AABH 5GS2D 3BGMA 3MNZB 2NY2C 4GXVL 3LRHA 3SGEI 2W0FB 5GS0C 4JFED 4KK9D 3DSNA 3ROOB 1ZT1B 5C0JA 2R1YA 4HKBA 1CD9B 1K3ZA 4OUOA 2VLRD 1XH3A 3GMMB 4D0CB 3FT3A 3GMLA 3ZYJA 3LVEA 2YC1B 3V0VB 3TNMA 1S9WA 5A16A 4V1DB 3TVMD 1QR1B 5KSBB 5MP6L 1MCCA 4N0UA 4P46A 2E3VA 4HWBA 2ZSWB 4PGDA 4DUWA 3DMMC 3C09C 4X9IA 2GK2A 1ZLUK 5GHWH 4HUVB 3TCLA 2P5WB 3KYAA 4YUEL 1UH4A 3EOBA 4D2NA 1J5OL 4WFEE 4HS3B 4K71B 3QI9D 4BK4A 3O8XB 3LPFA 3SDDC 3QXAA 4Z7UB 2ADGA 2HJFA 5E1HB 4YBHA 4RNRA 4NQCE 4PB9H 4L3CB 1U2CA 2AS5M 1ORSB 3MXVH 4KUCD 2YD7A 1JV5B 2XICA 2YRLA 4UT9L 4NGHH 2XWTA 2XKNB 1U9KA 4IRJC 4O58L 3DMMD 1SY6H 5FUCE 1NGPH 3W9EA 3GI9H 1H3XA 1YC7A 3T0VA 3RGVD 1H8SA 2MCPH 4XCYA 1IC7L 4L4VE 1PG7W 3G9VA 1E27B 3WNOA 5IB1B 3GDBA 1CQKA 1X5JA 1T5WB 3BSZH 3TA3B 1KCLA 3AREC 4MX7A 3IDYC 4L3AA 3RGVA 4H88L 3HG1E 3MGOA 2DQGL 4KROC 3LKPB 3MNWA 1KCRH 2IANE 2FEEI 1N8ZB 4XXDB 3HZYB 1I3GL 4NCC1 5TQ0H 5I1LA 2BVOB 5DWUH 1NLDH 4HIIB 1A3RL 3RWHB 2NZIA 4Z0BL 3WYRA 3ZT5A 4F9LC 3GMNA 4D3CH 3FFCE 3U7AA 2CUIA 5I71C 3HE6D 4KDTC 3LS4L 2R0KL 2K7QA 1X4XA 2P5WD 4KRPB 3H9ZA 4WEMB 5I17A 4CVWA 3R1GL 1CG9A 4W4NA 4JQXA 3V0WL 4PJHF 5GZNC 2J4WH 4OF7A 4JO4L 3O2VL 4QWWC 4RFOL 1X9QA 2BNQB 3AMKA 1M6OA 1CCZA 4C56B 1BVLB 3CPLB 4TSBH 4XC1H 3O3BB 4RAVB 4PR5B 3DYOA 2Q3ZA 1TTGA 2FL5A 1UM5H 4X5LA 4ZXBB 2I60H 4OD3H 1UKSA 5T3ZD 3UAJC 4KTEH 1VENA 4OGYL 2VLLB 1JGLL 4GRMB 1JPFB 2QSQA 5EB9A 3GKWL 1CZ8L 2EIDA 5FCUL 3L5HA 1FDLH 4MJ2A 3GSQB 1MCOH 1U8JA 4JB9H 3HB3C 2EDWA 5I17B 1TITA 1HHGA 2OTPA 5JO5A 1CT8A 2CK0L 4M7ZB 4W6WB 3RPKA 4EOWH 1QRNA 4X7TA 2P46B 3VXMA 3ABZA 2FHBA 3PNWA 3TN0B 4PJ5E 4OLZL 3A6OA 4PJDE 5FYJH 4OZIF 4R7NB 3U1SH 4GQ9H 5I1GL 1RJCA 1MRCL 2F8OA 4H0GA 3I50H 1Q9WA 5ID0A 4KAQL 1UYWL 4QRQB 1U92A 3U9PH 1XIWD 1H8OA 2RFXA 3V4UL 3TM6A 3PABB 4U31A 4NO0B 2MNUA 1EEUA 1W72H 4GXVH 5IVNA 2FL5B 1Z3GH 3MLTA 1OGAD 2HT2D 2CKBA 1QACA 4Z76A 2DQDL 2ZKHL 1Z2KA 1MPAH 3G5VA 3T0EE 4MAYA 1YY9C 4BUHA 1YECH 3X13B 5IHBA 1CD0A 2N7AA 4JPVL 2V2TA 5JA8B 3MXWH 2A9ML 3Q5YA 4NJAL 3QAZB 2A9MH 4XCYB 3ZL4L 3WHE1 5EZIH 4DN3H 5TE4H 1XCTA 5E8DH 3KJ4C 2E7MA 5KVFH 2FJHA 4RDQG 4X9HA 3QB7C 2R2BB 5IEHA 1QR4A 2VC2H 4X7TB 5IROC 5CINH 2WWMC 1W72A 5FIEA 1RU9H 2HH0H 3B9AA 1V7MH 4ETQB 1U8JB 1OGTA 5BRZB 3DTXA 5E08H 4RNRB 4JFXB 3QFDA 4BELD 4KXZI 3VXTB 2BVOA 4NRZB 4LQFH 1A14L 5LBSH 3MSPA 1O7VA 3NABL 1BF8A 5EA0L 5B8CA 3Q6GL 1BPVA 3CU1A 1B6DA 2DRUA 5C8JA 1EJ6A 1KFAL 1R3KA 4NZTL 3R06A 1SJVA 5L2JB 1JPST 1NJ9A 2H32H 5DEGB 1OSPL 3L1OL 3L3IB 4HCRA 1G7IB 5FO7B 4YQXL 3KYNA 3IDYB 4NT6B 2ZCHL 2CLVB 5ADPH 4J2XA 4UQ3B 1FNEB 4TSAH 4X99A 2UWEA 1N0LA 3VFSA 1EO8H 5ISZE 3NCCB 3IS1X 3GEWB 3ARBA 1HH6A 3K80A 1ZTXL 4Y16B 2JTDA 4PUBL 3H3KA 4L8DB 1VADA 4MJ5A 1Y6NR 1KLUB 1DQMH 1QVOB 25C8L 5IMLB 4D0BB 3EGSB 4QNPF 5IB3A 5GSVB 3LCYA 3I50L 1X5GA 3RWHA 4RGNE 4L8BB 2X4SB 2DQJH 3BESR 4K71C 4P5TB 1XF5B 5IJKC 4Z7UE 2VABB 2X9WA 1FNEA 3CVHH 3ARTA 5DVOA 1K6QH 4I8DA 5MERB 1DVFC 3MNWB 3CSYB 1MH5B 3AREA 3VJ6B 3LKPA 2VL4A 4HUVA 4U3HA 3TV3L 4Y19A 1G9MH 4MCZA 5D5MB 1U6AH 4PRPE 5D2NA 4YZFE 4K3EH 3BD4A 3ULUC 1ZE3C 2D7QA 4LEXL 5DF0A 3HE7C 5GJTL 1QA9B 3TT1L 3U4BH 2EDFA 2J2ZA 4GQPH 2W9EL 5T1MA 1A47A 5HYSA 5ALBL 4ZD3H 5B38B 2L7JA 4GRWH 1QBLH 5IG7A 1U41A 2Z4QB 3MYZA 1KIPB 2X89A 1S3KL 5K9KA 4WWKD 2GSGB 5C2UB 5IMLA 1KOAA 2D0HA 4IOFD 4U1IA 1JV5A 3HS0A 1IMHC 1BLNB 4MJ5B 4OGYH 1U8QB 1BD2A 3VWJB 3AY4C 3NCYS 5C2BL 1JI1A 3WE6A 1C16A 2OCFD 3BSZL 3VI4F 5EO0B 4M7LL 4X9FA 4XVTH 1LWRA 1CR9L 2YN3A 1OB1A 1FVEA 2Z31A 2CDGA 3AU1A 4JFEE 3VFSB 1KN2L 8FABA 5DHVA 2A6JA 5FOJA 3SJVD 4LU5L 3X3GL 4A2MA 1S7SA 3OGCA 4FQIL 4PJGA 6FABH 3QR2A 4W6YB 1U8HA 4RFNB 4A6YL 1H3PL 3PWPE 2VDOH 1C12B 2EDHA 2CKBL 5TQ2L 1JN6B 3VFMA 4KMLB 5T1KB 3VFNA 1Q9KA 1U3HC 3BQUC 3QEHB 3UDWA 4NWUH 3L9RB 3MRDA 5IVZA 5E95B 4LCYA 1R24A 1KCRL 5C6PB 3C6LB 3PWUB 3IETA 4U3XA 4Y5VC 5TDOA 1KT2B 1RQ5A 2GT9B 3DTXB 3E6FA 4YHMH 1D9KD 2VLKE 3T8XA 2W60A 4YDVB 2ARJA 1QSFE 2WSKA 3C60B 4IDJL 1RIVL 3RP1A 3BGMB 4PJ5A 2AJSH 3OAZH 2NY4D 4OV6F 3DHJA 3KJ4B 3WNNA 5BV7B 5FDWA 1DZBA 4ONHA 3T1FA 4XVSL 1FE8H 2NX5D 2R69H 3ARED 2N56A 1UGNA 1S5HA 4LCCA 1QZ1A 3L5JA 5E03A 1FZOB 4UV4L 3PE9A 1KV3A 2C3VB 3MRFA 4PLOB 5D1XA 3OB8A 1UJ3A 4ZS6C 4KKBD 4Z0XA 2JK5A 4BKLB 4KGLA 1UWEH 1EO5A 2PYEE 4WHTA 1E28A 5D5ME 4RFEA 3VRJB 5LXGH 3VD9A 4AM0A 4KRLB 1T1WB 4C56E 1RPQA 1AY1L 1W2KT 2X4UA 5DSCA 3EOYG 5IHUL 3VDBA 5EUKB 1IGCH 2R0ZH 2P8MB 3ARBD 3EYFB 1XR8B 4H5SB 5D1QC 3RVWD 5KTEL 5IMMB 3MV01 4L3ED 2ZUWA 3LB6C 4MVBC 3SDAB 1SMOA 1IM3A 2BRRL 3KPNA 1UA6H 4IBLT 1BWWA 3AS0A 4XGZB 3IDIB 4ISVB 4N1HB 4NKOA 5ESQB 3SJVE 4B53A 4DCQA 4HUUA 4OB5L 4Y16C 4NJ9L 4P9HH 1QKZL 3I6GB 1HKLL 1AR1D 1KTLA 4PJ7B 3UZVB 1DBKH 1H3WM 1NFDE 3ZE1E 3L5XL 5JXAL 3B9VA 5DQJB 3O8XC 2AEQH 3BH9A 4AIZB 3CLFL 4PRIE 4ZUSB 2YD1A 4R4FH 1CDHA 4KDWA 4PGCB 1DUZA 2V5MA 4NC1C 4TOYH 4L8CB 4S1SL 1H3GA 2QQNL 4QXGH 4X5XA 4NO0A 3TZVA 1IGFL 2YKLL 4ODXB 3MV8D 1RZFH 4K8RC 3PDGA 1ZHNA 5IFJA 2MQCA 5C6WH 4NKDB 3WKNA 3IYLW 5IJVA 4Q74A 4RAHA 1HNGA 4QTIH 3M17B 2CQVA 1XF3A 2P5ED 1IFHH 2AVGA 2GIYA 1OWWA 5IKCA 2EEAA 3AAZB 4WUUD 3OKNA 4X6DB 2D4FA 5MP6H 4S1QL 5ICXA 3TO4D 4RQQA 3D0VA 4KI5C 4Z7UF 3C8KA 4ZSOB 1IARB 4JO3L 4YEFA 4ODSL 3JTSA 1MRDL 4HIIA 1XIWA 4LCYB 3BHBA 5HGDA 1AKJD 2K3TA 3VFNB 5I1LB 3QG6B 5CZXC 4MA8H 1V7NL 5IB2A 4R7DA 4MA3B 3C60D 3ZDZF 5IHZA 3KYKL 2ZNXA 3PP3H 4F7MB 2D31A 1GZQA 3VXSE 4QYOB 1A4KB 1UQSB 3FN9A 4XNMA 1NANH 2IAMA 3HG1A 5C6TH 5D96B 3UTOA 3W9DB 4W81A 1AKJA 4RMQA 4YO0A 4O2FB 4R3SA 3HHRB 5F89A 5HGHB 5EZLB 1CVRA 4P3DB 1LP9F 1HHIB 3WHE0 1J18A 3C5SB 4S1DC 5E7BA 1NFIA 4ZPTA 3RX8A 2DBJA 3GMLB 4WUUA 3PDOA 5EZJA 2YD3A 4JRXE 3E3QC 3P11L 5CS7A 1JGVH 4KK8C 5I18H 3W9EB 3VFRB 4PREB 1CLYH 3GHBL 4I5BA 4LDLB 1UKTA 5KSAD 5JNYB 5CEYA 3DO7A 2DYPA 1P9MC 2LAAA 1WWWX 2NR6C 4LLYA 3U6RA 3CCHA 1D5ZB 5C0AA 4AJ0A 1YPZE 5BOZG 1IAKB 2IH3A 3T04D 3MV8E 3MNVB 3ECBB 4X4ME 3HZYA 2CMRH 5DJYA 3MV8A 2CMRL 5F96H 3MV7B 4YFDB 3I02A 1MHHA 1X6NA 4MNGA 1CI5A 2P5WA 4S1QH 2OS7A 2IG2H 1JWMB 4GFTB 3K4AA 1UB5B 3OHXB 1RUAL 4LSRL 3HE6A 2P5EB 3UTZA 5KSAC 2AV7B 2R9HC 2ZSWA 4ODHH 4OLVL 2PNDA 1GL4B 2DS4A 4NQDD 1N6QL 1M4KA 2BSSB 1KPUB 2NX5B 3UBXA 1YUHA 3WXVH 3S36X 4BSVB 4B50A 3MRIB 1AGFA 3H42L 5I71B 3ARGC 5IW3A 1MELA 4BYHA 5IR1A 4OT1H 1OGAE 5F7UA 1QSFA 2LQRA 3OR6A 5J56B 4Z7VB 1WZ1L 2OMBA 1YMHB 2XXCB 3MUY1 5FO8A 4FFVD 4L3EA 2ESVB 2EXYC 5GIRA 4PLNC 4XPGH 4WI8A 3AXLB 3OKOB 2Q20A 1FV1A 1F4XH 1ITBB 1V3KA 4GQ9L 1Q0XL 2Z91B 2R1WA 5DQ9B 2AJXH 3VWKB 5CGTA 2AEQL 1A0QH 1EPFA 2OJEB 4OZIE 3F7PC 5F7DB 3DX8A 3HI1B 2OQJA 1S5IH 3IDXL 3IFLH 4L4TB 3EOAB 4YHLL 5DT1L 5TH2B 4RGND 2J88L 5ETUA 1HDMA 2I5YL 4X4XB 2YZ8A 5C0DA 4OB5H 5KZCB 1WEJL 3DMMA 4XPHH 1OSZB 1BZ9A 2FGWH 3RI5F 3OKYA 1XT5A 3D3VE 2XG5A 3LV3B 3T0BA 1S9WB 3V0VA 3WJJC 5JOEA 1DLHB 1GGBL 1HSAA 9CGTA 3INUL 4X7EC 1DBJH 5AZEL 4YAQA 1IAII 1YPZF 3IJSB 2YMXL 5I75C 1A6AA 5KG9B 1URLA 3KWWB 2V9QA 2P47B 4GW4B 2HKHL 3QZWA 2F54A 3I6KB 1UCTA 4GBXA 2V2WA 4E41B 3ZDZE 4OLEA 3O2DL 2DDQH 4P9ML 4LHUD 3EZJB 2J4WL 1MFCL 3OR7A 4GOSA 4Z8FL 1J7VR 3QJFA 1HZHH 3DRQA 5JW3H 3OKMB 2D2OA 1PLGH 1QLEL 2R9HD 1S7XB 5C0IB 3VH8A 3IDGA 4G6JH 3WEXB 3OV6A 2G5RA 4RFOH 1IEAB 1INQA 1ZOXA 5IK3A 5KVDH 3ROLB 3H9HA 4XNQB 1MAKA 1OCWL 5LCVL 3WFBL 32C2B 4UUJA 4YDKH 2VLRA 5MEPB 4BZ1H 4RFNC 3PJSB 4LAQH 4YHLH 5BVPL 1I8LA 3CC5B 4TUOB 5INCB 5E2TH 4POUB 1JTPA 1Q9LB 1YEGH 3N06B 4NO3A 4MA7H 5E99H 3ARWA 1ZS8B 3VFWB 1BQSA 1U92B 3QXUA 5T1LD 2FYYB 3CZFA 2UWEE 5HHXH 2AERT 4V1DE 2DQGH 4WU5A 4ZUTB 1AGBB 1A6TB 2R0ZL 4JHZA 1IQDA 1AJ7L 1BJ1J 3EO0B 3TN0A 4U7MA 1XFPA 3B8YA 4LCUB 1MI5B 3KPMA 1R5IB 3FONB 4HXAH 3ULUL 4CMMA 1ADQH 2FX7L 1MAJA 2WUCL 5ANMB 5L8KB 1Q72H 4PJCF 4ORGB 2ZCKL 5I1CH 1JPGB 2ZCHH 3T4YB 1XCQA 1NFDF 4GLRH 1INEH 4KDVA 5DK2A 4OGZA 1WZKA 5L88H 1G7HA 1U8PB 1IGYA 4Z78B 1CFTA 2R69L 5DK0B 1RAMA 1FG2B 3LHPH 3W81A 4P0DA 1JRHI 3EYUH 3KPRE 4ZUVB 3VFVA 5CJQL 4XPFH 3FB8B 5FYJU 3Q1SL 3IXTB 1CGXA 1EAPA 5C0CE 1PD6A 4PGBB 2A1WL 1S3KH 2O5XL 3QFJE 5MI0C 3QEQA 5E08L 1QBML 3LB6D 3P4OA 3FRUB 3KLDA 3QFJA 5HJ3B 5AEAA 1NAKH 4P2RA 3ULUE 4NNXB 5EZOL 2FATH 5DUBA 1C5BH 1T0MA 5D7JA 4Q97A 4GKZB 3O2WH 3ORJA 2VC2L 2VSCA 4O2EA 3F5WB 3UJTH 2JJWA 3UC0L 5H8DA 2A6KA 3UTSD 5FM5M 2PTVA 2EZ0C 2X4RB 3HA0A 3HC4L 2RAMA 3V9FA 1SMAA 2F5AH 5F7MC 3FMGH 3V4VL 3B5HA 3GIZH 4PY8I 3BJ91 1XGRA 4AT6B 2F9BT 5HDBE 2V17H 4YLQT 3WNMA 2GKIA 4HFWA 3QUZD 2NW3A 3QDMD 1MLCA 1MJ8L 1YDPA 1SEQL 2P24B 4TVPL 2H6PB 1DEEB 1NEZB 5E00B 4D9QE 4M7JL 3QDMA 3LZFL 1BFVH 5C08D 3QI9B 4LLMB 1IT9H 1YY8A 2R56H 3QT2A 4XPBH 5A2JH 3OWEA 2BOBA 4WNQA 3V8CA 2DWDA 4D94A 5HSFA 4YPJA 2NXZC 5HGAB 4U1LA 2AK4A 1F11B 3L7EB 1QSEB 4EUPH 4WHYH 1Q9LA 3S7GA 4O2CB 2I26N 1PZ5A 1N5YL 1G0DA 1WIOA 3QQNA 2AAVA 1FZKA 3OF6A 1N5YH 3ESVF 2E6JA 1DDHA 2XWBA 3VG9B 5T3ZH 32C2A 4UUJB 4F9LA 2NQCA 4OUUA 3QEQD 15C8H 3OX8A 4CADB 1IEAA 5IK3B 1XAUA 1HHHA 4F7TA 2XTJD 3EAKA 5IOPA 4PJAB 3CIQA 2ITDA 3STZB 2E27H 4G8GD 2VLJE 1K6QL 2X9YA 3ILPB 4HUXA 5F6IB 4ZAKA 3LD8C 4NN7B 2FIKA 2V7HB 4C4KT 3EOBB 3N1PC 3O45B 1CBVL 2CJUL 5J11B 3KYMA 4F7CA 4LLUB 2QHRL 4LDEB 1FNGA 4TRPH 1AC6A 4OFKA 2NY3B 4U2YA 4OBSA 4IOIA 4JJ5A 1N0XL 3EYUL 4OZHA 4N0UB 2GI7A 3LH2L 1E4XL 2BMKB 1HYRC 3U30C 5TE4L 4XVSH 3FQNB 2YZ1A 2P44B 1MVUA 1RULH 1AHWA 3BIKA 5E6IC 3RNKA 4I0PA 1WITA 1AHWB 1WC7A 3EJZC 5DS8A 3QRGH 1KLGB 5GGUA 3LMJH 4Y4HD 3QQ9C 1QRND 5E5MB 4LARL 3GBNL 4PRNA 1UA6L 2IADA 3EO9L 1HDMB 3KXFB 2EH8L 5EO9B 3CFDA 2R8SL 1FNGB 4HXAL 2HYMA 3TH2T 2IFFH 1MAML 3QQ4B 2WAHA 3JV4A 3CUPB 1UM6H 5C86A 2XN9E 3K4DA 5IM7A 2X4NA 4ZAKB 1P1ZB 5D7LE 3TBSB 1IAIM 1YEDA 3MLVL 2VXQL 3QNYB 3OKOA 3VXUB 4HIHB 4NRXA 1VFOA 4OAWA 2XV6B 3VRLF 2ZUYA 1MCNA 4NWTH 2XWBB 5D4QA 1JGEA 2C1OB 3BKCL 1QG3A 2ZPKH 1MCBA 3IT8D 3QDHA 4HEPG 3BWAA 3BIKB 3GSUA 4M6NL 5CBEB 2CO7B 1ZLUH 5CBEA 3I6LD 5I2IA 1D5MB 1FNAA 2G9HA 2P45B 3TWCH 2DLGA 5SWZE 4GBXD 4NHCL 2FEDC 3FFCD 1X6LA 1CWVA 3F12B 3RAJH 4WEUD 3MJ9H 2EDEA 1CE6B 2I9TA 2GFBA 2ICWB 5JW3L 4YHML 2AKRB 4AENA 1KXVC 3MRHA 1OPGL 2EDJA 3QWQB 4QRTB 3NCJH 3IKCB 1ES0A 1NEZA 5FDYA