3SKNA

Crystal structure of the rl42 tcr unliganded
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
KEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVRAGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RL42 T cell receptor, alpha chain
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 197
sequence length 197
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknA02
3MRDB 3DGGA 4X4XA 5HHPA 4U1SA 3TT1L 1INQA 1CICA 5L8JB 4DQOL 3QRFM 1NCTA 5K59F 4GSDL 1OAQL 5JA9A 2VDOL 3GMLA 5CSGA 4HDIA 4L4TA 2BVTA 2VLKA 2XQBL 3TYFB 1FO0H 4WENB 2HLFC 3HAEH 4XBGB 4O2FB 3GSNH 1KSRA 4NQVB 1LEGB 4XWGH 5GGSY 5L7XL 3DUSB 3V7AE 3QO1B 4WW2F 5SWSA 1ZLSH 2NY0B 4GRWB 4L9LA 3BE1L 2LTQB 5L88H 2CO7B 4ZXBD 4I4WA 1EZVX 4WU7A 2NXZC 5B38A 4RMUA 1I7ZB 3J8F7 1UA6H 2H3NB 4IHOB 1VADB 2WINA 3BQUA 2YC1B 4PRPD 5HYSA 4H5SA 3WNPA 2VERN 2DQJL 5GS1B 1VACA 2CKBA 1MOEA 1FE8L 2QSTA 3GI8L 2RB8A 4MQTB 5GSRB 1ETZB 2QJDA 3B9KD 3SEPA 5BOZG 3LD8C 3LS5L 5GRJL 3SDDA 3CZFA 4KUCF 4Y19D 3RU8H 4P5TC 3GSQB 3ES6A 5DURB 1ZS8B 3QJFA 5D2NB 1WZLA 3IB4A 4FG6D 4XH2B 2AS5M 1NBVH 4QRRE 4QT5B 1MFCL 5DUMH 2X4TB 3O3EB 3JV6B 2LU4A 3SHSA 4MX7A 2A6IB 2EDRA 4XB7A 4DGIL 4OSUH 1RZFL 4WO4C 1INEH 4NNYA 2ITDB 1U8NB 3TT1H 2R0KH 3T3PF 43C9B 3MA9H 4N0FA 4FTVB 4GAJL 3VFNB 1F11A 4OJFH 4CDHA 3V52H 3EJZD 1FIGL 3FO9A 2B7DT 3UTSA 1M4KA 4S0SD 1I7UA 2V5MA 5IVXA 3BMWA 5KSUB 5DD0H 3T77A 2YD1A 3OB8A 5C0EB 4ZYKA 1HXMA 3GI9L 4DGYL 3QJHB 4HWBL 1DQJA 1G9ML 4D0BB 4N5EC 3P11H 4DEPB 5DRWA 2VAAA 3TNNB 4MWFB 2V2WA 5E00A 4DKDC 4X6CB 1VFAB 4Y5XC 5DFWH 4APQB 1ZT4A 5SV4A 4NQDB 3I84A 1NGQL 2EH7L 4P3DB 5F97E 3OJ2C 1KJ2L 1U3HA 2YA2A 1KC5L 4GBXD 2M8XA 3HUJE 3EUUA 3N85H 3VFWB 1LEGA 5JOFB 3DUSA 1HQRB 4FHBD 4Q9RL 4LKCB 2NY4D 2GJZB 3MXVL 2F8OA 5FB8A 1Z6JT 4W4OC 3BIBX 5TQ2H 4NNXA 1OCWH 5FOJA 2H32A 2OR7A 3G6DL 1I7ZA 2H3NA 4PGJA 4IHOA 1F4HA 1VADA 2NLJB 1PD6A 2YC1A 4MB4A 4XNXH 2VLJB 1CD8A 3QZWB 4K94C 4Y5VB 5HDLA 1HILA 1LDPL 1FFOA 1QSFE 5DI8B 2PR4L 3GM8A 5F7EL 3G5YA 3RJDA 3QH3B 1FZOB 2X4SB 5GSRA 1ETZA 4WV1B 1QQDB 1S9KC 3X3FL 3CJJA 4DGIH 2ADGA 3MACH 3SE3C 5JO5A 2OXGA 3IJYB 3TH2T 3GSQA 1X5ZA 1PGRB 1ZS8A 3RBSA 1L0QA 5I30L 1YEDA 4GAJH 4KK5D 4XH2A 5E8DL 1JNNH 2NTSP 3O6ML 4JN1L 3KDMB 4UILL 2EO1A 2R2EB 1BPVA 5EORL 4XPHL 5BV7C 4XC1H 2NPLX 1U8NA 2C4FU 5LWYH 2FLBT 2A1WL 4PG9B 1BOYA 1YY8B 43C9A 4FTVA 4JFDB 3NIGF 1PDKA 4OLWH 3CNKA 4JPWL 2GSGB 3NFPA 3ARRA 4QRRD 5DZLA 2XWJB 2OCFD 1ZT7A 2DTML 1U8OB 5C0EA 4TUJA 4MAYC 3B5GA 3FQNB 3SKUD 3EO9L 5EG6C 2BVPA 4KMQA 5ISZA 1ZLVK 4MJ5B 4PLJD 2YWYA 4KHTL 1CGXA 1KJVB 1NCNA 3QIUD 3FQWB 5L0QB 4ZSOE 5CWSA 4AEFA 4XBEH 1MFAH 3TFKD 5DJZB 3MXVH 2HLAB 4U1GC 4LNRB 5I73C 4MS8C 1UENA 3BN9C 3QWRD 5ADOL 1MCKA 1T21A 2AJXL 5KTEH 3WN5C 3P9WB 5FO8B 4XGZB 5HHOB 5JOFA 4AIOA 1VFBA 1RJYB 1HQRA 4R3SB 4ODWB 2GJZA 1KNOA 2HFTA 2FO4B 3NAAH 4GMSH 5IVXF 1GAFL 4P2OB 4FQ1L 2PR4H 8FABB 3ZKND 2BY2A 1TMCB 4AT6A 3X3FH 1RMFL 5ADPL 4L3EB 4WTZG 4W68A 1JHTB 5FF6B 5DRNB 1TVBB 2DLIA 3CZJA 1CU4H 5D6CB 2FX7L 3QZWA 4PLNC 4HJGB 1FDLL 4LCCC 4OM0H 4RNRA 1S7WB 4OFYD 1A3RL 4JN1H 1INDH 1YY9D 5EN2A 3QH3A 4Y4FC 4O9HH 1FZOA 4BA8A 2MKLC 4WV1A 4PGDB 5IBLC 1ZEAL 1IQWL 1BJ1H 1WAAA 2FD6L 4AMKL 3MXWH 3QNXB 4HS3A 5ICXB 1YEGH 1E6OH 3QUZD 3VFUA 3S3SA 2NXYC 1TTUA 4GRWF 1FFPB 1C7SA 4N1CA 1QSFD 1R5VB 2DBLL 2NY6B 3QQ3B 4ODTL 3HI5H 2AW2A 2R2EA 4HPYH 1IL1A 4J3OC 2P5WE 1ITBB 3MNZA 5JXAH 3SKJL 5GGQH 4PG9A 4I1NB 3VFOA 2B2XL 4HBCL 4KHTH 1DQQA 4K9EH 3TA3B 5F44A 1WZKA 3V6ZB 2GSGA 2UWEB 3WJJA 4JRXD 4GMTH 4JPVL 5H37G 2ZUSA 3QEQA 2V2TB 5E8EB 1K2DB 4S1QL 1HK6A 5JW3H 4MJ5A 3U9UA 3C2AL 3FQWA 1ITCA 1CN4A 2ADJB 3T65B 1DN0B 5DJZA 3MJGX 3MJ9H 4LNRA 2HLFD 3H3PL 1FGVH 5EZOL 3VXOB 4YK4C 4TVSa 2OXHA 2DLHA 5DS8B 3EZJB 4JVWA 4EBQL 1BBDL 1RVFL 3TH3T 4A6YB 3MOQA 3LEXA 4JZNB 1KELL 2CK0L 2XI9A 2NXZD 4R3SA 4CVZB 4JGUA 1OW0A 2KL6A 4CNIB 4P2OA 4PJDE 1TVHB 1T66C 3DARA 4X4YA 2C4FT 3IFNH 3MLVH 1G9NH 4OTXL 3ROLA 2FX9L 4OQTA 1NUDA 1IGYB 3FFCB 2HKFH 3FT4A 3TF7C 4HJGA 4ZPVB 3DECA 1S7WA 4G8GE 4L8BA 4KWUA 5DJ6A 4PJ8B 4IS6A 5F7YC 3X12B 3MRQA 4FS0A 4PGDA 1AH1A 3PWUA 2LU3A 3FAWA 5DDHB 5MI0C 5E4EB 3K2UH 1T4KA 3QNXA 4W6YB 1MELA 5HI4C 1NSNH 3VRJB 2FL5B 3RKDC 1H3PH 3LSOB 4O2CB 4WO4D 5ITBH 2VJXA 1XCTA 1UYWL 3TN0D 2O5YH 1TCMA 4JREB 1OTUC 1TJGL 1Q72H 4EKXA 1YMMB 1JZ6A 4H0GA 1LO0H 3VW3L 2G9HB 3K81A 4I2XE 2WLYA 4K3EL 1RD6A 3MRIB 3U83A 5MENA 3TZVC 2KZWA 2Q7YB 3ZO0A 1FGNL 2RR3A 4S1QH 3V0AC 1TVDA 3V5KA 3KYAA 1T5WB 3TA3A 5AAWA 3V6ZA 5L8LB 4N5ED 2UWEA 2G75B 1ZOXA 3BEWB 2CD0A 1OPGH 3VFRA 4E41E 2YXFA 6FABH 3AVEA 5D7IA 4LCYB 1FNGB 5E8NA 5EZOH 5A2FA 2P5WD 4IRJC 1WAAF 2V2TA 1S9XB 5E8EA 1K2DA 4JO2H 4O4YL 1BOGA 3M07A 1RVFH 5DLML 5T1MA 1T22B 3T65A 1DN0A 1P4BL 5D1ZC 2JJSA 4M7KH 5C0CD 4WUUA 1YMHB 3ILPB 2E6JA 3UPRA 1VDGA 2BDNL 3RRQA 3D0VA 4D0DA 5DJCB 3PL6A 2ED9A 2NY5L 4GG6E 4XRCA 5FHBL 4JZNA 5DHYB 1OF2B 4FZEL 4CVZA 4YZFE 1DCLA 3M8OL 1RI8A 1GGIL 3RNKA 4CNIA 4YHYC 3C5ZB 3OAZH 1WUNT 3EDKA 4QYOB 4PJIB 3GRWA 5CJOL 2E27L 3GGWB 2UUDH 4B50A 2BERA 5EWIL 1DQML 4R4BB 1IC7L 2WIIB 3LMJH 4ORGB 4NO2B 4QOKA 2FRGP 2XA8L 4LLWA 4RDQG 1MIEL 4QHNB 5A2JH 5F7DA 2ADFH 4NFCA 1UQSB 1B4JL 3GM0A 1ZWIB 5EU6B 5EB9A 3SKMB 4LEXL 2FL5A 5I1KL 2RCSL 4NUJB 3T2NL 5EULV 5CEXB 1NBYB 2VDKH 3MRPA 3ARVA 4IIQC 2VL4A 1E27A 1ZGLP 3LKSA 4JLRB 3QCUH 2IALA 4JJHA 4R8WH 5SWZA 4HWEL 5C3TA 4DN3H 5GJTL 5CBAB 4NRYA 3W9DA 1I9RL 2Q7YA 4TVPD 3WLBB 3QUYB 1J1PH 2DLFH 3HI6H 1UM6H 3DTXB 4K7PX 1CICC 2EE9A 2G75A 4KJYB 3SKOB 4GS7C 4JPKL 4PB9H 1R3JA 2Z8VC 4XCFL 4LCYA 1NC2D 1G7LA 1SMAA 5ICYB 4PV9A 3C6SA 3BJLA 4Z7VB 4MS8D 2HYMA 2E6QA 1G7PB 1PKQB 1TZGL 3LHPL 1T22A 3BN9D 3RPIA 3KGRA 5IGXL 3M8OH 1EHAA 4E41D 1NDMB 4U0RC 3F7QA 3MYJA 5EZIH 2LE9A 2HKHL 1YMHA 4L9LC 2F5AH 4Y16B 4XP4H 2RJMA 5DJCA 1MY5A 2HJFA 5K59E 3GSOB 3NH7H 3T0VA 1YQVL 2UWEF 3BQUC 5TDNB 4D0CA 5I1LB 2DQIL 2Z8SA 5C8JA 1MIEH 4V2BA 4JHZA 5D7IF 2VXUH 1IEBB 3MUGB 1JBJA 4JDVA 3U36B 3HE6B 4H8WL 2A6JA 4QF1B 3W0WE 4Z78B 5JPMB 4LCUA 4KQ3L 4Y4FD 2AJSL 4PJEE 3SDDC 5E7FA 4R4BA 2WIIA 4ORGA 3QRGL 4Z77A 4XMLH 1LK3H 4X9BA 4OCYH 5E56A 1I75A 1P7QB 1E6JL 2N7BA 1X3DA 4MNQA 1UQSA 1MAML 2C9AA 3ZKXC 1ZWIA 3N1FC 2NXYD 5DQ9A 4NJAL 3MLTB 1DEDA 3GK8H 3GBLA 5CLTA 2AKRB 1SJVA 3SKMA 1RZIB 4DTGH 3GHBH 4NUJA 1ZAGA 3HMXL 4JO1H 5CBEA 3HRZB 2OK0H 4KMTL 1MEXH 5EBMB 4JLRA 3RTQA 3QHTC 4QWWC 5IBUB 4J3WA 2F74A 5CBAA 3WDHA 3FRPA 3HI1B 4C83B 4TYUA 2HTKC 2X40A 1OD7A 2C3VB 3BESR 1HXYB 3QI9B 2D03L 3DTXA 3NCJL 2DQFA 2VXQL 3GKZA 3MBEA 4MNGB 5MEPB 4R7DA 2Q7NA 1A9BB 4KJYA 4PRHB 5KSVA 1CXFA 2EEAA 4R4FL 5HPMA 2FIKB 1HI6B 4HIEB 2ZNWA 3T3PE 3MLWH 1K5NA 1G7PA 1PKQA 4UNVA 1U3HC 4EVNB 2P4AB 1S8DB 1YQVH 3DYOA 4O58H 3U4AA 4BK5A 3N9GH 2J1KA 1NDMA 3E2HB 1NDGA 4WFFE 3QXAA 5HYQB 2LTQC 4Y16A 3PE9A 3L9RB 1FFRA 1OB1B 1RULL 4M48H 4OF6A 4ONGL 1KTLB 1W0YT 3RWDA 1ND0A 2DQHL 1HNGA 3GSOA 1T66D 4QRTB 1EX0A 1HH9B 5TDNA 3VGFA 2DLTA 5JOEA 2D9QB 2J88L 1UH4A 2AAVA 5IVNA 1IEBA 3MUGA 4N0CC 3HE6A 3P0GB 4KK8D 4YHOL 4QF1A 4EN3B 1MAMH 1AGFB 4R7NB 2BRRL 4Z78A 5JPMA 5K33A 4X4ME 4Z5RB 4UOW1 4EI6B 5JHDE 1G6RL 4I3GA 1OARL 1GGBH 4OZ4B 2CPCA 5HVFB 32C2B 4U2ZA 3PNWA 3QIBB 2Q8AL 1YNKH 5DVMA 4Z7WA 4Z95L 2BSSA 5HI4D 3MBXL 4DKFL 2DMKA 4QXGH 1UEYA 4QXTA 3LN9A 2B4CL 5F7KC 2VKWA 4HQQL 4K7FA 3MLTA 1UJ3A 4MD4B 3G6JB 4HZLB 1F45A 1OTUD 4XVSH 1U8JA 4LK4A 5E08H 1L9MA 4GH7B 5FM8A 4L4TE 3TZVD 5HPOA 2VLKE 4NOFA 5EBMA 3AM8A 5IFJB 3SPVB 1ONQB 1RZJL 1X6NA 4HUMB 4JKMA 5KS9B 1UACH 3HI1A 5CIPH 5J3HD 4NRZB 4MD5B 5LBSL 1XCQB 4JHAH 2FSEA 3K1KC 2SEBA 3LKRB 4DEPC 3QI9A 5SWSE 3S34H 3NPZB 4K8RL 4IRJD 1X5YA 2CIIB 5MEPA 3QDMA 1WT5A 4AEIL 1MJUH 1FSKB 1RPQA 1W72B 2FIKA 3PP4H 4KUCD 3DV4B 4EDXB 4TPRH 5BXFB 4NJ9H 5D1ZD 1RULH 2D7PA 2OLDA 2J4WH 3NIGE 4EVNA 7FABH 1MLBA 5ID0A 3BPCB 1S8DA 4M6NH 3NA4A 2VUYA 1GOHA 3UC0H 2ICES 3P4LA 4NZRL 4G3YH 5HYQA 1KB5A 2BNUA 5E03A 1CD0A 1EGJH 3EOYG 3AREA 2CH8A 2CDEB 1H0DA 1OB1A 1WCQA 3LKOB 1KFAL 3E6HA 3I50H 2EXWC 3MGOB 2VH5L 3AMKA 1VGEH 1FPTH 5HGHB 4G43B 5CINL 4WFFD 5E1HB 1JGVH 5C2BH 1QKZH 3I9GH 1IEAB 4L8CB 4ZNCD 2LAGB 4KH2A 4WV1C 2YOCA 4PTTB 3QNZB 3QCTL 4EI6A 4M43L 3UTSE 3MLUL 4OZ4A 4WWKA 4XNUH 3A0OA 3GIZL 3STBA 4UU9B 32C2A 5IVXE 4J12A 4BZYA 5C0GA 2FWOB 1RZJH 4UQ3B 2ZUYA 2YK1L 3C8HA 4WI3A 2DQTL 4HJ0C 5T33L 4XNYL 5CZVL 3KLAB 4MD4A 5D7KE 2HFGH 4ZD3L 4K7PY 5JHDD 3MROB 5JMRA 4HLJA 2ZWLT 2VDNH 4MJIB 4KTEL 4AEIH 4LKXA 3U82B 1ONQA 4P23A 3WJJC 4NDMB 2I5YL 3VG9B 5FHAL 1UM5H 4NRZA 3OHXA 1ZA3B 1N5AB 4ELMA 2APBA 5CEZE 3G5VB 2YPLD 2WWKT 4GRWE 4O2EB 5DR5H 3DSFH 1QFWM 2HVKB 4OT1L 4L4TD 3KYOA 4JCLA 3TGXA 2JIXB 2VLKD 2VQUA 4HUWA 5L0QC 4M6OH 1W72A 4Z7WF 4JR9L 3HKFA 1CBVH 4LEOB 3WFHB 3QDGA 4P2CG 4XNZB 5BXFA 3X13A 4G9FB 2NNAA 4MZ3A 5J1TC 2ARJB 3BDBA 1FL3A 5SWSD 3KPSB 4Q7DA 1QSVA 5HGAB 3BPCA 3M1BB 4HCRA 4NUGH 4MCYA 3MLYH 4Z7NF 4O5LL 1Y0LA 3F6IA 12E8H 5B39A 1OW0C 5CINH 4NP4H 3DUHA 1ZVSB 1ZSDB 4P2OC 4YDIL 5D96B 3FOMA 3RWHA 2CDEA 3WDIA 3BQUD 5J1AB 2ZG3A 1S9YB 3LKOA 1QRKA 4L4VB 5F7WC 1F42A 4WFGD 2XPGB 3MGOA 2AJZB 3BDXA 1RZ7L 5JQ6L 1HSAA 4FQLL 4I0KA 5I0ZA 2EH8L 5HGHA 3MNWB 4HK3N 4G43A 5IEHB 1G7HA 4I18B 1CT8B 3H42L 4IJ3B 3H9YA 4JDZA 1QRND 5T33H 2ITCB 1A4JA 4KK6D 5CZVH 1EHLH 4FTVE 1HCFX 3QNZA 5C86A 3CK0L 5MEQA 1MWAL 1NLBH 4GAGL 2Q87A 1UVQB 1LE5B 1J1XH 4X0KA 1GYAA 1A6WH 1U8KA 2QADC 4KTEH 3NIDE 3QB7C 3WXWL 1XF2A 2FJHB 5INCB 2GEEA 4UQ3A 4ZQKB 3LV3B 1E4KA 4AEHL 2NY6C 3KLAA 1T1ZA 5JLZB 4U4BA 5L2JA 3P9MB 3UTSD 1LK2B 1YQ2A 3MROA 1EAPB 2DKMA 3O9WB 1BX2B 5B8CA 4BSWB 4CVXA 1HHHB 3FO2B 2HTKD 4JFHE 3TA3C 2YKLL 3RVUD 3G9VA 1JPSH 1NMCC 3PV7A 4X7FC 3GMPB 3VXQB 3U2SB 1ZA3A 5D7KD 4X6FB 1PZ5B 3ZT6A 4B7LA 2NY2B 4O2EA 4HC1L 3RWEB 1PEZA 2A9ML 2W65B 5CD3A 1IT9H 5I0DA 4MJ4A 3NCEB 2Z92B 3WFHA 1U3HD 2JJSC 1LDSA 1W0WA 4RMVA 3V2AR 2GAZB 4N9GB 2EE3A 4WCYL 1U93A 2X89A 5D2LB 5CEZD 3KPSA 3PL6C 2DTSA 2IBZY 1GRWA 3GO1L 4MXQC 1U8IA 3CFEB 1MCDA 3JTTA 2WUBL 1JNLL 3OPZL 5HHQB 1ZVSA 2NYYC 5DD5L 1OM3H 1WAAE 3OB0K 5DQDH 1ACZA 1YC8A 2XTJD 3DMMB 3IDYB 4RMWA 1AHWB 5J1AA 2AXHA 1FCGA 1XGPB 3OGOE 4KK9D 5DHVB 4ELMF 2AQ2A 4HFWA 4L4VA 3U7YH 5KG9A 3L3KB 4DK6A 5D7JA 1JK8B 1MAKA 4GAGH 3IU3B 2VDQL 4X7TB 1QP1A 3DHMA 4JKPH 4Y88A 3N06B 4P4KA 3MNWA 3B2VL 4MA1C 1CFVH 1KPUA 1FORH 1KPVB 2O5ZH 3P73B 3WXWH 1LQSR 3T0BA 4FXLA 5I15L 5DURD 1N4XL 1U2CA 3D0LB 1ZT1A 2VR9A 4JFDE 4Q2ZA 3CFJB 4S1DC 3RPKA 2F53A 5E4EC 3HPLB 1UVQA 4DGVL 1DUYA 2IQ9L 3UTTB 4ESKA 3EYOA 4L3CA 2MNUA 2VRAA 2VYRE 1NFIA 4PV8A 3TWCH 3S88H 3QEQE 4XNQA 5INCA 4WNQB 1N7MH 3LV3A 4XMPH 1VA9A 1D3CA 4JB9H 1EEZA 1W2KT 2F19H 1I1FB 4FTVD 3HNVL 3EDJA 4GW1B 1K6QH 3P9MA 4BUHA 2GK0B 1EAPA 5FYKH 1R3HA 3QQ9C 2CXKA 3NN8A 4JO4H 4OLYH 1FV1A 1GSMA 1ES0A 1I7TB 2IADB 1VEOA 4MXVF 5GS2H 2NZIA 5ISZD 1AP2A 5IIEA 5HHOE 1F97A 3U2SA 1HH6B 1I1CA 4OCRL 4IRSB 3WHXB 4WCYH 2EE2A 4HGMA 3TYGL 2NTFB 4BK4A 1WITA 1NMBH 2X1QA 2W65A 1EVUA 4LARH 3DROB 4JFHD 2V7HB 3X11A 3UZVB 1XGQA 4L3EE 3MRNA 1KG0B 4JM4L 3SDYL 3KPLB 3LRSA 4H0HB 4G8EB 1VB9A 5D2LA 2F58L 4S1SH 3I6LE 4HIIB 4HKJA 1I9IL 4KKAC 1FNLA 5EFIB 5DJ2A 5I66B 1JFQL 5HHQA 1PYWB 3H8NA 5T3XE 2W92A 4YEEA 1ZV5A 1AHWA 4P3WA 5DHVA 2I9LB 1CFQA 4I48B 2IFFH 3O6FA 1FO0A 1E4XI 1NANH 3VD7A 4LCWB 5GZNC 4X7TA 3HAEA 3QWOA 2ERJC 1X5JA 3FN0L 5HYJA 4KVCL 1PKOA 3NZHH 5IVZB 3TIDB 1E0OB 5MENE 3OKYA 2APFA 4NCDA 5D7LA 5EO0B 4G42B 1HKLH 3WO4B 4OM1H 2XG4A 1P2CB 5ALBH 1AO7A 4HUUB 2UWEE 1IC4H 1MFBH 3GJEB 4JFEB 5M7QA 3VXNA 3S36L 3FO1A 4HJ0D 5D7IE 3S96B 4QGTA 4QY8A 4BSJA 5IMLB 1WTLA 3P77A 1TETL 3HS0B 4WNQA 4LLDB 3RTQC 5I18H 3V4PL 1FZJA 1I1FA 1D5BB 4GW1A 2GK0A 4J4PC 1N3NA 1MJ7L 4G7VH 1P84K 2AJYH 5DD6B 1U8HA 3QUYC 5HY9B 1YECL 4XVUC 5TDPB 1IGML 1EXUA 3SQBA 1WWWX 4WUUE 3QEQD 1CWVA 2X4NB 1I7TA 4M00A 5A16B 2IADA 4X5WB 5EU3B 4P59L 4Y8DC 4JM4H 1CZ8L 1OGAB 2MCPH 5HHXH 1HH6A 4YWGL 3WJLA 3DO7B 4PP2B 5I1JH 2W9EH 4Y0GA 1CL7H 3SOBL 2IAMB 3NIFF 3C9NA 1NAKL 4AQ1B 5C6TL 3JWDL 1K8DA 3S37H 1NH6A 4YQXL 2YBRB 3RY6A 4HULB 2BY0A 1MCNA 1KG0A 2ZCHL 2VC2L 1HINH 3KPLA 1SJHB 5SX4H 2ADIA 2IGFL 4G8EA 5E2UH 2PO6B 4Y16C 4KRLB 1OD9A 4HIIA 1YJDH 4P2OD 1KJ2B 4X99B 2P8MB 1GOGA 3I02A 5EFIA 1OP5K 5C0NC 3TIEA 2BVYA 2JJWA 5ID1B 1PYWA 1F4YH 1OP3H 3S35X 4N8VA 4CGTA 3HE6C 3OKNB 3LVEA 4I48A 5H94B 1J8HB 1LO3L 5J9PB 3C60A 4LCWA 2YRPA 5L2KB 1XH3B 1T03H 1BJMA 4FZ8L 2QTEA 1IFHL 1ZLWK 5SWZE 4ODUB 2GCYB 1FCCA 1JPTL 3VWKB 1MRCH 1T1YB 3D69A 3IAGC 1DLFH 4CBPA 5EO0A 5KANG 1A7OL 2QADD 3V4PH 4CVWA 1OT2A 5D2LF 1P2CA 2CLRA 4HUUA 3K7UA 1BM3L 4LSSH 5L6YL 5KSBB 2QSCL 4DN4L 1GGCH 1QNZH 4H88H 2NY6D 4Z7UB 3THML 4OB5L 2VDMH 3SE8H 2ID5A 5MEND 2BVUA 5IMLA 3HS0A 2R2CA 3AM8C 3GSUA 5GRVK 5E5RB 4M4RA 3VA2C 2W1NA 1IQDB 2FB4H 2CUIA 3TA3D 3B3IA 2BXZA 3HZVB 4QTHA 1MJJB 2WBJA 5DD6A 5A2LH 4XZUB 5SX5K 3CSGA 3QI9C 4U6HB 3GKWH 1UGNA 1FBIH 2EYSB 5DEFB 4ZTPH 5IOPB 1XF3B 2PF6A 1WT5C 2X4NA 5A16A 4X5WA 3HG1A 2ED7A 3RIFF 1OGAA 4XCYA 3DO7A 4TVPL 4PP2A 3PHSA 2BC4B 5DMKB 4HWBA 2ORBL 3B43A 4GQ9L 5I1CL 4PJIE 2ZOKB 4WUUD 3QFDB 1A3LL 3MSPA 5GHWH 2BNRB 3PL6D 3VRLF 4YXHL 4LPCA 3RNQA 5IK3B 2MCG1 4MXQD 1T0MB 3WKMH 3KPTA 3AREC 3RIFK 1X7QA 2V17H 3GSWB 4XNMB 4JRYA 1S7RB 1KJ2A 3KLHC 4G8FB 2K1MA 3TC9A 1WJ3A 5T5NF 3GIVB 3VFVB 1LO2L 2CRIA 2QHRL 5EOCL 4MNQE 5BVJB 1JPTH 3K46A 4DKEL 1BLNB 4LBEB 2O26U 3SJVB 1BREA 3N1QC 3I6GB 4LPWA 3RWFB 4UDTA 4J1UB 1WBXA 1XF4B 2J12B 4QOKD 3D1MC 5L2KA 3PDOB 3OQ3B 3WHE1 3D85B 4WWKC 1BP3B 3WUZA 1JZ2A 2W60B 3EGSB 3JWOH 3VWKA 4S1DD 3VD4A 2LQRA 3K80A 1HHKB 2ATKB 3GB7B 1J7VR 1R0AL 4OGYL 4C56B 5KSBA 4AM0A 5IB3B 3PABA 4K71B 4ZUUB 4PD4J 2UZXB 5SWZD 4Z7UA 3SGEI 4ZO7A 4QCIB 1DVFB 2R0WH 3MYZA 5TFSH 5F9OL 1I3RB 1IKFL 1IAKB 4P23C 3IDGB 1F00I 3QQ9D 1PKQE 3WD5L 1BQLL 1QR1A 1JZ5A 1A6AB 1MJJA 3VXSB 2ORBH 1IARB 1IILE 4XZUA 4K3DL 5C0BA 4XPAH 5F96H 4UINH 4H1LH 2Y1VA 3IDJB 5I1CH 3WFCH 4LVHB 4Z76A 5E6IA 5FDWB 4GKSA 1Q0XH 3VFGL 3MUJA 1I3GL 4MSWB 5IFHL 2QSVA 2BC4A 4RGOL 1F90H 1NCDH 3MV11 1RZ8B 1K8IB 1QHOA 3MRBB 3PHQB 3RFZC 1DDHB 4NHUA 1B0RB 3QFDA 5C71A 4F7EA 5DMYA 4YHKH 5I8KH 3ARGA 2AV1B 3EDEA 2VABB 3JVGA 1QSZA 4KKAD 3INUL 5I17B 3X14A 4ZDHA 1A4KA 3CC5B 3QCVL 3GSWA 4XNMA 4D9QD 4DW2L 4QHLB 5D72H 3UCRA 1AGDB 1NGZB 3VFVA 2XOTA 3IFPA 2FX8L 2GY7B 3ZKSD 2E7HA 2XRAL 2DIAA 5GZND 4BZ2H 4LBEA 4X7CC 4AJ0A 1L4IA 3HPJA 5D7SH 4J6RH 3MOBH 1WCBB 2FECI 4Z7NE 4OUUA 4K23H 3QULA 1LEIA 1MQKL 2Y5EA 1EVTC 2W60A 4MNQD 1U42A 4ZOBA 1Z5LB 1CD1B 5ALCL 1KCRL 2ICWJ 4KV5F 3HZMB 4TRPH 2X4RB 1C8PA 3GB7A 5IROA 1E4KC 4MNGE 3VJ6B 5FYJE 1KLGA 3QDME 2RGSA 4YFLI 5DRXB 4XPGH 3QUML 3RTQD 1FYTB 3GDBA 4KKLC 4HXAH 2OMNA 4QCIA 5B8CC 1M7DA 4LLYA 1S5IH 5K9OA 1I3RA 1N6QL 2HRPH 4LSUH 5IFAL 4ODHH 1IAKA 4I3SL 1TQCB 4Q74A 4XVUD 1NEZB 4QHKJ 3T0WA 1I3GH 2CGRL 2DWEB 3MBED 1A6AA 2NZ9C 3D6GA 1CGUA 3VXSA 1NJ9B 5M94B 3OJDA 2DN7A 4U1HB 2MPAH 2YD4A 1QYGL 4XAWL 5DJXA 3IDJA 3DIFA 5LAXA 1HIMH 2JCCB 5FM5O 5AWNH 5FDWA 4LNVA 1AFVL 5JW4M 5IT2H 4NC0B 4XCCH 1JP5A 1MNUL 4XNZC 1PW3A 1CFSB 2I60H 5KSBF 4WGVB 3OKLA 1K8IA 4ZAKB 1DEEB 3MRBA 2X9WA 5JW5B 3F7PC 4Z7UF 1KXQE 3A6OA 4LSRL 4PTUB 3FN9A 2AV1A 1OGTB 2VABA 1QUNA 4LIQL 5I17A 3FQRA 5D96C 5D8JL 5EOTB 5CP3H 5C0ND 2GT9B 3PIQB 5HD8C 4YAQB 5H35A 4QHLA 1KCKA 1AGDA 2QQKL 1EO5A 2I26N 4K3JH 4WDIA 3HE6D 2VXVL 4DCQB 1NGWB 5DTFB 5IBTH 1YA5A 4P4KC 1DR9A 4NWUL 3GBNL 5DVOA 5DJAA 1X5XA 4IJ3C 3RWCB 3DXAB 1JRHL 3D9AH 5E9DA 4PJ7B 1KCSH 4FQ2H 1WCBA 1ORQB 4HG4J 2IH3B 5HVHB 1RZKC 4S2SA 2YS4A 1LGVA 3VXMA 3LEVL 5T3ZL 2GSIA 3PWPD 3TV3L 2CUHA 1ADQH 1I1YB 3ARFB 3HZMA 4HKBA 4ELME 5IFAH 3FB8B 4I3SH 3QG6B 3CLEL 5I2IA 1JZ7A 3SDXB 3VJ6A 5DRXA 3GBML 4NKMB 1MCHA 2XKUA 4UTBH 1Y6KR 2AK1H 4BQBA 1QYGH 3QDGE 1JV5A 2EYTB 4RBPH 1BEYL 1KACB 1X5AA 3KVQA 5GS3A 5EZJB 2V9RA 2LAAA 2XZCH 2W0FB 2FYYB 4PIRF 3U1SH 3OJVC 1F6AA 4NM4L 3OKMB 1KIQA 5FYJD 4F58H 3QDMD 1NJ9A 4NZUH 4U1HA 4JFQB 43CAA 1UCBL 1SQ2N 4KXZI 5GRZA 4U49A 2DYPA 4LSVL 1KYOJ 2JCCA 5C9KA 1BFVL 1Q0YL 3IDUA 4YNYB 2N56A 1I8IB 5TDOA 4KJWC 3TJHC 5MEOB 2A6KA 1FG2B 5DEGA 4ZAKA 3BISA 3GMNA 1T2QH 1CK0L 5C0JB 3EZ8A 1JNHB 3FQUB 4LGSB 2Y4SA 3ARED 4G80B 4MXVE 1P9MA 2O5XH 1BBJB 4LSPH 1OGTA 5HHMB 3MNVB 3T2OA 3KLHD 5F89B 1T7VA 4ODVL 5D70L 3BKYL 1RQ5A 4OZFB 5EOTA 3IDYC 2GT9A 4O00A 1AHWC 4NC1C 2ESVA 4RGMC 4JQIH 3O6FC 4NKDB 1LWRA 2PW2B 3VGEA 2A2QT 4HMCA 1NGWA 4UT6H 4UB0L 5DTFA 5T3ZH 2OL3H 5F88A 2KBGA 1CLZL 3F7YA 4OCLC 1B90A 3S4SB 4PRIA 4WWKD 1MHCB 4Q6YA 3KPQB 3V95A 3DXAA 3IXAA 3HRPA 4PJ7A 3MV8A 4YDKL 2OM5A 5DC9B 4LASL 1EA9C 3ESVF 2GI7A 2WWKO 2HVJB 3HNTL 4F3FB 1NCWL 2EDYA 1FNFA 3TBWB 2X70A 1I1YA 4XP5L 4MXWL 2YUZA 3QG6A 3P4NB 5DGRA 3UTZB 5GGUA 3L7FB 5EIQA 1OSZB 4P23D 4OBSA 1PQZB 4ALAH 4RGNB 4RMQA 3WSQL 1XIWB 1BFVH 3DX9B 4GW4B 1LO5B 4X6EB 5EZJA 1HHGB 1D5IH 2W0FA 2FYYA 1QA9B 4M93B 2IPUK 1C16A 1MFDL 1N8ZA 3KPSE 1EO8H 3E8UH 3AS3A 4NZTH 3WJLC 1CIDA 4YXLL 3DVIA 4PJCB 4HWZA 4JFQA 4KVNL 1UXSB 3QDGD 2IH1B 4F8QA 4I3RH 1RJCA 4YNYA 1N59B 3M17A 1UADC 4L4VE 3L7EB 1I8IA 3I75B 3UJTH 4G7YH 1BQHB 1M1SA 2I9TB 4YXKL 1RUQL 3VCLB 4R0LA 3CFBA 4FABL 3ARDB 1VERA 1PX3A 1B88A 1RJLA 1I4FB 3RWJB 3ZZ1A 5E2JA 3QNYB 3WNLA 1AD0B 5TE7L 4CMHB 3BZFB 8CGTA 3MGTA 4ZUVB 4G80A 2GHWB 1BBJA 3NTCL 1P4IH 3U9PL 3D18A 2C3XA 3O8XB 4NRXB 3U46A 2F53E 3H6JA 4WI6A 3NIFE 3OAZK 4ZOCA 2C5DC 1SJXA 4GFTB 4M6ML 5I1HL 5TF1L 1MREL 2PW2A 2ENSA 3NABH 3C60C 3VD5A 1G7QB 4NO0A 2JCCF 1KENL 4JM2B 3SE4A 5DRZA 4UT9L 3VG0L 3BD5A 3P0VH 4P9HL 3SGDH 1JHLL 1MHCA 1WF5A 5CCKH 5ITFB 3QBTB 4U6VL 4IDJL 1MHEB 2HVJA 4JG0L 4KAQH 1G6RB 3DUUA 4F3FA 1ED3B 3BIKB 1NCUA 5F9WB 3IDNB 3TBWA 5MHSE 1FL6A 3STLA 1EPFA 1W8OA 1KT2A 4KKLD 3PHOA 2EZ0C 3QG7H 4R26L 4YHLH 3DX6B 4OFKA 3L7FA 1NFDA 5FGBA 2EEBA 4ONFH 1J11A 2WBJC 1PQZA 1FVDB 5IB5A 1K85A 2G5BB 1H15B 4MQXC 3HMXA 3DX9A 4GW4A 4NKIH 1LO5A 4X6EA 5IHZA 4G6KH 5E8OA 4DVRL 2AEQL 1YC7A 1QA9A 5D2LE 2A83B 3TPKA 3NCCB 4PJ7F 4OIIH 3WFEL 1RUQH 4FABH 4PJCA 3STZB 1G9MC 4Y4KA 1OAXL 1KBGL 5TE7H 4WJ5B 1RUAH 4DZ8A 4FQPA 4NC1E 5DJ8B 3CD4A 1CGYA 2AXFB 2EDBA 2QR0B 5D71H 5I1DA 1EHNA 2X89D 3I75A 3KPSD 5KVEL 3VCLA 2APVA 3I3EA 4OLXL 3GJFH 5HYJE 1TJHH 4EQ2A 3F58H 5HI3D 3RWJA 2ZSWB 1MREH 3G5XB 3QNYA 1JN6B 4ZUVA 4B0MM 3LY6A 3OX8B 4NQXA 5D7LE 1NL0H 4HIJA 4Q6IA 2VISB 5HD8D 2BXYA 4TTGA 3MR9A 4L4VD 3GHEH 2R1XA 4NRXA 5GGVL 4CJ1A 4RFEA 5EA0H 5T5FH 1CS6A 5D7JD 5DK3A 5C9JA 4Y2DA 5F7MC 2XWBB 5HGBB 5KVGL 4P4KD 4Y7MA 5J11C 3SQOL 3ZE1E 4IM8A 1RHHA 3MLSL 4XBPA 4K7PL 5FYLL 1S9VB 4ODXB 5TE4H 2Q76A 3HCVA 3VRLE 4M61A 3BD3A 2Z91B 3VWKC 4UNUA 3SDCD 2F53D 4XP9H 4ZXBB 1CTOA 3FOLB 5FYJU 4M5ZL 2QBWA 5F9JB 4R96A 2R69H 5I16A 1A8JH 3ZDZF 5DJ0B 2ZKHH 1MLCB 3GZKA 3MRCA 2JJTA 4PRPB 4CU8A 1G6RA 3BIKA 3D3VD 4N90E 1FC1A 2EDKA 1A1OB 1MHPL 1KPRA 3U6RA 1LD9A 4WTWA 2V2XA 3BP6A 3B9KB 3FAXA 1GH7A 2P48B 4HUNB 2AXGB 1JF5A 4LSQH 5JMOC 5HJ3B 4M3JA 4WI5A 1U3YA 1FVDA 2Y72A 5EO9A 1H15A 5HXMA 1T7YA 1FL5B 5MHSD 1MJ8H 1JPGB 4D9LH 3OAYH 4UI2A 1RK1A 5E6IC 4JJ5A 1GZPB 5MP6H 1TTFA 3ZLQC 1AY1L 2AEPL 3STZA 3JWNC 4HW6A 3T4AB 3RVXC 1J1OL 3BPLC 4IBLT 4KJWD 4OD2B 4XPFL 4WJ5A 3OXRB 2QQNL 1EJ6A 1URLA 2KQMA 2QR0A 3GSRB 4ZODA 1ZLUK 2J6EH 4M62L 1MCWW 2YPKA 4LCWE 4N0UA 5MERA 2VLRA 3JVGC 2F5BL 1NFDF 4YEFA 2ZSWA 1JN6A 3TH4T 1K4DB 3CMOL 3H7LA 4PRAB 4F9PA 3B9EA 2VISA 3WEXB 3O6FD 1JGDB 2WBWB 4W81A 2CLVB 3ECBB 4QXWA 4ETQB 4Z0BH 4JFEE 2R2BA 4LLVA 2B5IB 4PJCF 5HYJD 1KB9J 2VZTA 3KS0H 4J8RB 1LO4L 4GBXB 3HFMH 2BP3A 5D7LD 4NNPH 4JAMB 4ZOAA 2NY4B 2CIKB 4WW1B 2DM7A 5LXGL 3DYMA 4LPYA 4YHZL 1AO7D 5IEKB 2XQYK 4ZXBA 3L6FA 3FOLA 1RU9L 1AQKH 5DQJA 5HDQH 2P46B 5F9JA 3D48R 3T0XA 5IROC 2W59A 3UYRL 1A1MB 4UQ2A 5DJ0A 3P30L 5J13B 4LHUG 1G9NC 4YR6B 4PRPA 3BP5A 1MWAB 1EEYA 2IPKA 5F7UA 3HG1E 2G5RA 4LDLB 2GUOA 1A1OA 1OGAE 2FATL 3MRRA 1DVFC 5ERWB 5C3LD 5TQ0L 2HJLA 4GT7A 1F3JA 1IAIL 5AUMA 4ODSH 1JUFB 2R8SH 1G9EA 4Z8FH 2VITB 5ESQB 4DFIA 5FUOL 4UIMB 4RAUA 5EBWA 5F6IB 5HSFA 3NFSH 1AY1H 3PJSB 2C1OA 2ZCKL 1KJMA 1XGYL 3QUXD 3R0MA 3BKML 4EXPX 5J1SC 4XX1E 5C08B 5F7LB 1XF5A 4N90D 1KULA 4JHWL 4KV5E 3VH8B 4EIZC 1JPGA 4LVHC 5AZEL 4DK3A 3EO0A 5DWUL 3O2DH 4ORZC 1GZPA 4XCEA 2ZPKH 1GIGH 3LS4L 1JGLH 3ZSTA 3R0NA 2ATPB 4Q9QH 3T4AA 4YC2B 5FAAA 4I8DA 4S1RH 4KZDL 2FHBA 4LFHG 35C8L 4ZMAT 4L8DA 2OR9L 2BOCB 2AJVH 3QXDB 1NUGA 5L2KE 4E5XB 3T0DA 2FLRT 4U1NA 1CE6B 4GQPH 3E6FA 3GMRB 3LN4A 5CZKA 1P1ZB 5AG8A 2OTUB 3QIUB 1X9QA 1EO7A 4ZS7L 3WEXA 3ECBA 1NCAL 3C60D 4LCWD 2P45B 5KSBE 5J6GB 1JYXA 4HSQA 1YEFL 1A7RL 1J0YA 4Z7UE 1EBPA 3ARSA 1UZ8B 2X9XA 4J8RA 3UYRH 2R0ZH 3O2WH 4GAYA 5IWLC 3IJHB 4P2QA 1EH9A 2ZUXA 2EIBA 1BJ1J 4KPHL 3VWJA 2CIKA 4WW1A 4X9IA 3MMEA 4OCWL 5FK9B 3L1OH 2FJGA 4ZOEA 4XC3L 5IEKA 1MPAH 3AROA 1O7VA 2XACC 4C57C 2IF7A 5JIHA 5C0BE 3L3HB 4YBLC 3V6OC 2K9UA 1S5HA 4X7SH 4OFIA 2HWZH 5D93C 1MWAA 1N6VA 2EDFA 3RWGA 4UZGA 3BHBB 4AENA 4OCMC 2EDTA 1IBGL 4YIQA 5ERWA 4D3CH 1X44A 1NBZB 2ZCLH 1JUFA 3ZDXF 2WBJD 2FZ3B 4BUGA 3KJ6H 1TQCC 4UIMA 4MQXD 2JE8A 4OCSL 3BH8B 4GRMB 1CR9H 2XIDA 1XR8A 2BNRE 5C08A 3HG1D 4WWID 1R3IL 1OGAD 3QUZB 4LGRB 3OXSA 4LLUB 4PJ5B 4WUKH 3FFDB 4KTYA 1PEWA 4TN9A 4MA3B 5F21B 5GGSB 4KUZH 3SCMA 1E28B 2PTTB 3Q1SH 3W5NA 5DGQA 2ATPA 1E4WH 4NSKA 3N1PC 1FVCB 3QHFL 5DC4B 4ZAKC 4U1JB 2X4QB 1EBAA 3NBNA 3L3GB 2R4SL 4HC1A 3HC3L 4QHUB 4O51A 4JRXB 2EDJA 3T4YB 4PJXA 3T09A 2H26B 4E5XA 4JRYD 4G6AC 4P2RA 2C3GA 4ZUSB 4PPTA 3GSVB 1V7NL 3WS3A 1CE6A 2V5TA 3EW3B 3GMRA 5EC2A 4LQFL 2R15A 1P1ZA 3D2UA 1OP9A 4AY0A 2OTUA 1YEJL 2NY5C 4YDVB 3RUGB 3IAPA 4YPGB 1QBLL 2VL5B 4PRDA 3GNML 4NN6C 5L2KD 2AI0H 1UB6B 4MVBC 4AQOA 4Y5YB 1SVCP 2WANA 3VFMB 5FCUL 1AI1L 3VWKD 2D4FA 2Q86B 4LRIA 4QTIL 5HGDA 3TCLA 1RIUL 4EOWL 5AD0A 1PLGL 3MRMB 3DO3A 3VXSE 5C0RL 4F33A 2B1HL 1FFQA 1T1WB 3RVVC 4MD0B 4MA7L 4RA3A 3DLQR 5FUCC 3C2SA 1D6VL 3WIHL 1U8LB 1NAMH 5CJ5A 3HMWH 5JUEL 1VGKA 1V3MA 4PGEA 4MA8L 5B4MD 3QXVA 1NBZA 3LB6C 1X5IA 2VLLB 4WHTA 4DAGH 5C0BD 1C1EL 2V5RA 4PYHA 2BY1A 3UTPD 5E6ID 2E5EA 1AXSB 2RIKA 4ZFOL 1VKXB 4PJ5A 4WO4B 4KY1L 3TN0B 1TZIB 4LPTA 4MA3A 2CDFB 4NQCB 2JB5L 2PTTA 2FJFA 4AIZB 5JHLL 4FQIH 1JF1A 1AR2A 1OAUH 5BVPH 1BZ9B 1DBKH 4R0LC 2D7MA 1FVCA 4ZS6C 3DRTA 1NCCL 3ARGD 4BKLB 3BKJH 2P1YA 1I9EA 3L3GA 5F71A 4QHUA 5I19L 1QFWI 1LE9B 3BPNB 3UYPA 1CFNB 4PYGA 5TH2B 1QBLH 2G2RB 4E9LA 3MLPA 3MA7B 2H45A 3TBVB 4ZUSA 1A6ZB 2Z31A 1PSKH 2P5WB 3V4UH 3CH8A 3VXME 4QRPA 3KG5A 3EYUL 3H2WA 4P46B 3FB7A 1CGSL 5I1EL 2JELL 4YDVA 3RUGA 4YPGA 1MCOL 4HIXL 1DN2A 3V6OE 1OL0A 2CJUH 2VL5A 3SE4C 2OQJA 5C0CB 4Y5YA 3O2VH 1V3LA 1FVEB 2XYCA 4H8WC 3CVHH 2Z35B 4S10A 4IMLB 3WIHH 2Q86A 4M5YL 1RUPL 5FEBA 4PJXF 1BGXL 5GRWA 4QNPF 1CXLA 5BMFH 1ZVYA 1R3LA 5CUSL 1MCBA 3G6AB 4M1DL 2AGJH 5B3NA 2JCCE 2R39A 3EJYC 4TSBH 3H7BB 4E0RB 1RURL 4WY7H 4DVBB 4LAQL 4OZHB 4ZFGL 4JDTH 3OKOB 3VXSD 3EYSH 4F7MB 4UBDC 1G7JB 4MGXA 5TGBB 1F3DH 3PGDB 4M93C 2FGZA 2H6PA 3T8XB 5CS7A 3AS0A 5LGKA 2XFXA 3MLRH 1DANU 4LL9A 4OZGB 1AXSA 1Z3GH 4JFFA 5TPWL 3RZCD 4PRNB 1VKXA 4Y4KC 5BV7B 4HKZA 1KCVH 2VQ1A 3TN0A 3NACL 1JGUH 1T0NB 2ESVE 3HC0B 1IM3A 4NQCA 4CN6A 1DTUA 5CP7A 5FYJL 3CUPA 2X1XR 4FQXB 5KSAB 1BZ9A 3ARQA 1K3IA 1HN1A 1B4RA 3EYUH 2X9YA 2DKSA 2EE6A 1LE9A 3UBXB 4I0PA 5D9SA 5F6HJ 1ZTXH 1RV6X 1OWWA 4PRIE 1U91B 3LOWA 5TH2A 3DXAE 1YYLL 4PJ7E 4Q6IC 3TBVA 4HK0A 5AAMA 5DA0B 3L5HA 1RK0B 3QDHA 4Y2DC 1H3TA 2DBJA 2I07B 4P46A 1N0LA 2Z93A 2OP4H 4OGXL 3SN6N 4UIKL 3QHZH 2K7QA 5FUCE 1A9EB 1QO3B 4GLRI 5E9DD 5C0CA 2IWGA 3MJ8B 1BIIA 1ZGLA 4P5KB 4JKLA 5EZLB 1CDHA 4R4ND 1Z0MA 4M7JL 5CUSH 1FVEA 3HR6A 3VXMD 3Q5OA 1SJEB 2WNGA 3TT3L 3L3DB 4XI5D 3MLXL 1T1XB 4FFZL 1RURH 1GGUA 4JO3H 2JJTC 3T1WA 1FZMB 2AP2A 1QBML 4KU1A 5F9WC 3RVTC 3KR3H 5HVWA 4TSCL 2HFFA 1ACYH 1EJOH 4K94H 4YGAB 2H41A 4JG1L 4Y4FB 3RUGF 1VFUA 4DVBA 4IMKA 1DBAL 2ZUUA 4OZHA 1RIHL 4JFOB 4KQ4H 4QGYA 1OAYH 4IRZL 5C0AA 2DQEH 1F6LL 3OKOA 3PGFL 2D7QA 3ZTNL 1RUKH 1EERB 3PGDA 3DURB 3ZDZE 1RZJC 1U41A 2NXYB 2DYPD 3LEYL 1A6UH 4N0RA 4O02H 4OZGA 3V0WL 3BZEB 3AXLB 5HHME 4BJLA 3EBAA 5T1KA 2Z8RA 5J06A 4Z7OF 4MDJB 4KMLB 3V6FA 2Y06L 1T0NA 4K8RC 5BV7H 2D7TH 4ZAKD 1JWMB 3OR7A 3B6SB 2D4DA 2WUCL 1X6LA 3LPWA 3PV6A 4FQXA 3DRQB 5KSAA 4NPYA 2IPTL 1NGPH 1T7ZA 5ACLA 1BMGA 1SHMA 1YN7A 2CMRL 3MO1B 1A7PL 3CDGB 3ISWA 5IM7B 4Q97A 4KI5F 4H1LA 1D5MB 2PW1B 5DZOA 2ESVD 4OLVH 4KTDL 1T5XB 3WIIH 3PWLB 3JV5A 4F9PC 5KAQG 1JHKL 1FNSL 4HCRL 2EDNA 3HLAA 1RK0A 1DQLL 4FQJL 3NOIA 1DZBA 1BAFH 2IANA 3OKDA 1Q1JH 2APXA 4MVBD 2WQ8A 4AL8H 1U8QB 4KDTA 4YK4B 1CDGA 1MAJA 4KJQC 4PRID 2Y36L 1OY3B 1A9EA 1J5OL 1P7KA 3MV8D 1QFUL 1Q9OA 3BYYA 2YMXH 3FQTB 1DANT 5IMMB 5GRXG 5EZLA 4TSCH 4AH2B 2I24N 4ZXBC 3ARBA 3SGKA 3C8KA 3BRFA 1NKRA 3L3DA 3VXPB 1SEBA 3KYNA 1JI1A 1T1XA 1TENA 4GKZB 3VI4F 3MJ7A 3CFDB 1MHHB 3NGBB 5C7XL 3EFDL 3RVVD 2HT4C 3EJJX 2A74A 2FHFA 1PZUB 2RQ8A 1GHFL 4EUPA 2EDHA 4PJCE 3VDCA 1UKQA 4UV7H 1MVUA 1EMTL 1A14L 4QRUB 5LGHH 1MUJA 5F9DC 1O7SA 1IGCH 3B5TA 1C5CL 5E99L 3CFCL 3LB6D 4ZTOL 1I9JH 5KJRL 3QUMB 5IV2A 5E2TL 3QEUB 1JPFB 3IFLH 3P4MA 5DYOA 3S35L 4YDLB 1BD2D 1YPZB 4BH7B 2WUCH 1D9KB 2A9NL 5EUOA 4GW5B 1CDYA 1AQDA 1IGTA 1C08A 4HXBH 3S37X 1Z0NA 3WFBH 3PXJA 4ISVB 5GZOD 4WW2B 3K0WA 4MDJA 1GGYA 3WIFA 3SDAB 3TZVB 4F57L 3QISA 4ZS6D 3X3GH 4KTDH 3REWB 4OGAC 5GGTH 2R2HA 1J05B 3Q6FA 1EEUA 3TVMA 2YSSB 4FQJH 3MO1A 2Z4QB 3RIAF 1IC1A 5DMIL 3SO3B 3RAJL 2GIYA 2DQDL 2J8UA 4OZHF 5IM7A 4IRJB 1A2YB 5E2VH 5EUKB 4LLQB 3EOTH 1T5XA 2ICEB 1BZ7B 3CXHJ 1CQKA 3FL7A 2VDLL 5F9AC 3W39B 3LQAL 1Y6MR 5J4MA 3FONB 2APWA 4NO0D 1W0VB 4OZGF 3UJJH 3OJMB 2B5IC 4MJ6A 4M6AA 5EU5B 2XZAL 1I7RB 3RDTD 5LQBH 4OD1L 3CH1A 3O6KH 2DM4A 4Y4HA 3VWJC 4YGVB 1KEML 3QEGH 5IMMA 1C5BH 4P48A 4AH2A 1OAZL 3WNMA 5CP3A 3TNMB 1NEZG 4GKZA 2CQVA 1BF8A 2VMFA 4TULL 2P43B 5BRZA 5J13C 1MRDH 5KJRH 5I1GH 4WI7A 1RZKL 4I77H 3L3IB 1TCRB 2PXYA 3S97C 5INDB 2E9IA 5ESAB 1YZZA 5I75B 2UYLA 2R4RL 1F4WL 2GITB 5F6IC 3LIZH 4UBDD 3F12B 2GFBB 3BSZH 1H3VA 3QUMA 5FXCH 1NBQA 1CE1L 4N0UE 3QEUA 3U4EA 1NGYA 5HYFA 5DUPL 5ILTL 4F15B 5IW6A 2VE6A 1YPZA 4BH7A 2E9BA 1D9KA 4Y4KD 1KIPB 3WXVL 2OZ4L 1K3ZA 4UV4H 4HS8L 1Z9LA 3OKKB 1L7IL 5AYUH 4MDIB 4X6DA 5GSVB 2B1AL 1OT1A 3U7WL 4DFHA 3SDAA 4OV6F 3JZ7A 3MRFB 5DO2C 3PXHA 4WFHE 3NA9L 3ZDXE 4BFBD 2D3VA 3IF1B 3TO4A 2PNDA 4X4XB 2VDLH 4URTB 2HH0H 4U1SB 5HHPB 1J05A 3ZL4L 1INQB 1I8KB 1OTSC 5I76B 4GS7B 3BKCL 3GMLB 2YPLB 5FUZH 4X80L 1N0XH 4HDIB 4PLJC 5JW4N 4L4TB 4J23A 4LLQA 4HF5L 1R3KB 4Y2DD 5EIIB 4QRSA 3ARXA 3ZTJH 5DJYB 1IM9A 3CX5J 1K4CA 4JFYB 3W39A 1OHQA 1Q94A 4KROC 5EUOF 3I2CH 2JLLA 4PRPE 4RQQB 4TUKH 3RX8A 2XWTA 5EU5A 4U0RB 5SWSB 1I7RA 4L9LB 1VEMA 4LRIC 4I4WB 2MQ3A 2V9QA 1FO0L 3MRLB 2EXYC 2D7OA 2OSLB 3RGVA 2KDGA 1U58A 1QLEH 3GSNL 1PG7H 2WINB 4G6FB 4XWGL 4HS6A 2RHEA 5EBGA 1DUZB 4H5SB 3RVTD 1ZLSL 2J8UF 1VACB 5L88L 3L3JB 4G6JL 5E24E 2MQCA 1NUFA 5DT1H 4FNLH 4K07A 4NHCH 3MZTA 1UA6L 4OGZA 2FNBA 3AY4A 5INDA 1IVLA 3CZFB 1KJ3H 3QT2A 4N1HB 1QRNB 3ES6B 3QJFB 2GITA 1F58H 3BT2H 3K1DA 2VWEC 3F12A 2GFBA 2V7NA 4LHJB 4OKVB 4XXDB 3ZKXB 4MX7B 4GXVH 3QUZC 3D25A 3NA9H 1A7NH 3RU8L 1IGJB 3LZFH 1QSEB 5EDXA 2AQ3A 5H2BA 4N0FB 4GKNB 1F11B 3TCXA 2F8XC 1YUHB 4OZFG 3UTSB 1NBVL 5GSVA 3MGAA 5DUML 5KOMC 2Y23A 1SY6H 4YHIB 4EDWL 4HUVB 1ULVA 4LU5L 3T77B 2VLRD 4ZYKB 4OSUL 1WIOA 1DQJB 2RFXB 1INEL 1GC1H 3C6LB 5BOPA 5DRWB 2VAAB 1I8KA 2R0KL 2V2WB 5E00B 3MA9L 5I76A 3BO8A 4P2QE 3MRHA 2R29H 4OJFL 2Z31C 3V52L 1UM4H 1ZT4B 3S4SG 5JZ7C 3CFKA 2YPLA 5DD0L 1R3KA 4WFHD 5EIIA 4CMMA 5DJYA 3P11L 4JFYA 4NCC1 1QG3A 1YPZF 2P7TB 5F1SA 3MREB 1UEMA 1U3HB 3VFTB 1GPOH 4RQQA 4KJQD 4Y5YC 3QUKB 4FQHA 4X6DF 4J2XA 3PG2A 2VZVA 4N1EA 5FB8B 2VR5A 3H9ZA 4NNXB 4G6JH 3MRLA 4KJPC 4UT7H 2H32B 2OSLA 1ZLVH 3VGBA 2YN3A 4BQ6A 3N85L 2XTJB 4Y89A 2DF3A 5C08E 2HT4D 1PY4A 1DUZA 1CXEA 1OQXA 1HILB 1FJ1B 1MCPH 3L3JA 1FFOB 2YA0A 5TQ2L 1OCWL 3G5YB 2CKBH 1Z9OA 2ADGB 2CKNA 1U95A 4KI5C 5JO5B 4CAGA 4V1DA 2HG5B 4RBPK 4XNXL 4HUKB 1QRNA 2JJUA 5FYKE 1YEDB 1BQHG 3IDIA 4F37F 4OKVA 4XXDA 4PJXE 1FH5H 4TOYH 4EDWH 3N0PB 4NQTA 4HZAA 4LU5H 4N8CH 1WIPA 3MACL 4P2RE 3TN0C 2XN9B 1IGJA 3SBWA 4HH9A 1JF6A 1QSEA 2Y5TB 3MLZH 4GKNA 1YUHA 2VZUA 4PY8I 4BM7A 4XPBH 1S9WB 1J0ZA 1JNNL 3NFPB 4OGAD 3U30C 4YHIA 2DL2A 4HUVA 3IDXH 4F7TA 1ZT7B 4TUJB 4F37K 4I0PC 2RFXA 2AK4B 3BPNC 3C6LA 4XC1L 3ILQC 5JNYA 3JWDC 5LWYL 2BVPB 2BFVH 4LHUD 5ISZB 4JVPA 4WHCA 4YHNB 3TBTB 4OLWL 5CWSB 3UZQA 4P46C 1YYMH 3V9FA 4JE4B 3VMPA 4LF3B 1T21B 4U1KA 2P7TA 3MREA 2FEDD 1TIUA 3VFTA 4U6TA 2EYRA 4P2QD 5CD5C 1VFBB 3QUKA 3VWJD 4XBEL 1MFAL 1OSPH 4HHAB 2E9WA 1KNOB 3GJFA 3H9SB 3BOVA 1EIBA 3O0RH 1G1YA 2XA3A 4GRWH 4JGJA 1KLFA 5KTEL 4HV8B 4AT6B 2IFGA 2VWEE 1VPOH 5C92A 3L5XH 1J0KA 1JIBA 2VQTA 3CDFA 1T6WA 2QEJA 1U3JA 3NAAL 4PJ5E 5IB1A 4GMSL 4PRBA 4RNRB 1FJ1A 2X09A 3ZYJA 1JGEB 5EN2B 5IW1B 4IMKC 1ROWA 3CGTA 3S8WA 2VXSH 2HG5A 1M05A 3CSYA 4HS3B 5C08D 1CU4L 5D5MA 4XP6H 4OM0L 3VFUB 1KN2H 2CUMA 1BZQK 4R6UA 3U0WH 1INDL 4JRXE 4KHXH 4O9HL 5FOBB 3SCMD 3WUWG 3I3BA 1IL1B 2XZQH 1L7TH 3MNZB 5A2IH 2VSDA 3MXWL 2XN9A 3VFOB 2Y5TA 3FTGA 4PJAB 1YEGL 1E6OL 5FYKD 1DQQB 2VB5A 5DO2D 1ZHNB 1GCFA 5E95B 4HAGA 4FQXC 3RUGE 1S9WA 3I6KA 5KSAC 1N5YH 3GEWB 5ENWA 1SBBA 4ELKB 3O3DA 3P3YA 1AJ7H 3HI5L 1OTSD 3MODH 4HPYL 1DQTA 3MRKB 4P2RD 1D6EB 5GS2D 4KRPC 3ULSA 1D5ZB 2AK4A 5JXAL 2CRZA 3QEQB 4HLZH 3ZHLA 5GGQL 3EYQC 4NZDA 3U9UB 4HJJH 3D2UD 1UCTA 4YHNA 3OF6A 4K9EL 1AR1D 3TBTA 3IJSA 1SYSA 4Z7OE 3UJIH 4KROD 2W0KA 4GMTL 1SBSL 1FRGH 4KDTC 4LF3A 1UWXK 1BQUA 3CCHB 1A6TB 4HBQA 5JW3L 4F9LA 5JPNA 4LCIL 3V79C 3MTRA 3SE9H 3LEXB 3KJ4B 2Y7QB 5CJQH 4HHAA 2EXYD 5ICZA 3H9SA 3SGKC 3G9AB 3MJ9L 4KI5E 3U48A 3RKPA 1FGVL 1TZHA 4EI5B 2L4OA 5IG7A 4NN5B 5A40E 2D0HA 4HV8A 4X4YB 1A5FH 5I9QC 3ROLB 4XVTH 2R1WA 2PN5A 1T6VN 2AJUH 3FT4B 3MV7B 4CJ0A 5HHVH 5DD1H 1JGEA 1S7TA 4L8BB 5IW1A 5DJ6B 2KPNA 4NQCE 4IS6B 5IHUH 5IJVB 3MRQB 5IF0B 3IFNL 5IUSA 3MLVL 1G9NL 1N2RB 3PWUB 1SVZA 1T4KB 2P24B 1RZGA 2HKFL 3EHBC 2QADB 3VI4E 3BEVB 2N7AA 3AC0A 4PJ5D 3VXRA 5E0QA 4OI9A 1G7IA 2Z9TA 1XCTB 5FOBA 2OTPA 4YHMH 4CU7A 4MHHI 2DWDA 4YE4H 3KYKH 4RMSA 3L5WB 5MENB 2AXJA 4G8IB 3K2UL 1BVKB 5E8PA 4IOIB 5LG1A 3V5KB 1G0DA 3KLDA 1MCJA 1NSNL 3LRGA 4PJAA 5BS0A 1H3PL 1ZHNA 3BPOB 3TVMC 4BZ1H 4U2YA 5ANMB 5ITBL 1NMCB 2O5YL 1Q72L 4LVOC 4ELKA 3VFRB 1LO0L 5C0CE 4ZPTB 1E4XH 2CRYA 3U0TA 5D7IB 1SBSH 3MRKA 1D6EA 2MHAA 4ZO8A 2Z31D 5E8NB 3WFDH 4OZIB 1D5ZA 2ENYA 5JZ7D 4WTZA 1Q38A 4PJBA 4QRPD 2X4PA 1YEKH 1BOGB 5D5MF 3O2DA 4LCIH 5T1MB 4YFDB 4XTRD 4NM8H 1RUMH 3QPQC 1EZVY 1OPGL 3EOAA 4M8VA 6FABL 5HDBE 3H9HB 4XPTH 2DIJA 3TPUB 4WUUB 4FQQB 1HHJA 3UPRB 3CCHA 3D0VB 1A6TA 5DUBB 4D0DB 4Y4HC 3PL6B 4JO2L 3V7AG 2FR4A 4IDLA 4PS4L 4XRCB 4KJPD 4AEEA 2Y7QA 1T3FB 3V7MA 4OZHE 1YNTA 4X7EC 3A6CH 3RNKB 4M7KL 3PF2A 4FMFA 2OJZH 5C0AE 5CSZB 4EI5A 5AZ2H 2BY3A 3LAFA 3NMEA 1WWBX 3NGBC 4U33A 1XMWA 3NCBB 1BWMA 3VH8G 2F54A 1LP9A 3OMZA 4OZGE 2LVCA 2PXYC 4OQTH 4KK8C 1QFOA 2KQNA 2P5EA 3MV7A 4MA1B 5IR1B 5EO1A 5K9JH 2X44D 4KI5D 3BRDA 4QOKB 4LLWB 4QHMB 3VD3A 5F7DB 4OCXH 5IJVA 5IF0A 1KCUH 4G6MH 1N2RA 5DMGC 4Z18A 4GUPA 3E1F1 4TVPE 2XNAA 4TSAH 1DBMH 2P24A 5T3XH 3ULUH 3DYPA 4YDLC 3LMJL 4JFFD 3BEVA 2HFEA 4X5XA 1IAOA 1D9KC 2W9DH 3MRPB 2FBOJ 1NMAH 2ADFL 2VDRH 1E27B 3LKSB 5E2WL 4NQCD 2IALB 5SWZB 4Z0XA 4WW2C 2X10A 1OTTC 3SDAC 1QACA 4NRYB 3L5WA 3WL9B 3W9DB 2AV7A 4G8IA 4ZNEA 1QR4A 5DVLA 1BVKA 1D5XA 1R24A 4IOIA 3TO4C 2IANE 3U4BH 2HA1A 3F65A 5DFVC 4YDJA 5J3HC 2VDKL 3ELAT 4I0PD 5ANMA 2PTUA 1VFMA 1DL7H 2PKDA 3GFUA 3ILQD 3IKCA 3QCUL 1R3JB 4R8WL 4ZPTA 4OZIA 3SO3C 4DN3L 4LSTH 4RISH 1G7LB 2D0GA 1UWEH 4PV9B 3C6SB 3S9DB 2VSCA 4P46D 1J1PL 2DLFL 5HVGB 3HI6L 1UM6L 1WFTA 4PS4H 5T1DH 2OYPA 3RPIB 4LP4A 2A38A 4PB9L 5EOQH 3H9HA 5CD5D 3MYJB 3TPUA 1ZHBA 4I13B 4FQQA 5C0DB 5DUBA 2FH8A 4GO6B 4PJAF 3RGVC 1F2QA 2HJFB 2O93L 1L6XA 4KRNA 4A6YH 1T3FA 4QRQA 4D0CB 3G04B 3S6CA 4DKAA 2IEPA 5CSZA 5C8JB 2UY6A 3BI9X 5EZIL 1H3WM 4X6BA 2F5AL 4JDVB 2X5PA 2YUWA 2A6JB 4XP4L 3GRWH 5EUOE 4PJBF 4MMZC 5I71C 2XKNA 4KKCD 1ZHLA 4LCUB 4GAFB 3EDDA 3UBXI 3AY4C 3NH7L 2CR3A 5FYKU 2ERJB 4Z77B 5IR1A 1MCEA 5IB4B 2FBJH 3HTLX 5I75C 4NWTH 1JE6A 4QHMA 4M7ZC 2W07A 5C0AD 1N64H 4OFDA 2VXUL 5E2WH 2NR6C 4MNQB 5DQ9B 1QPPA 1WICA 2GTWA 4NQSB 4OLZH 1OAKH 4F15C 4XMLL 1LK3L 4Q58C 5T1KD 4OCYL 5CBEB 9CGTA 1CDJA 1A6VH 3JUZA 3O6LH 3H3BC 1MIMH 3RTQB 1FN4B 1NAMA 2F74B 4FQXD 5HBBA 3WL9A 5KSAD 4ONOA 4ZFOB 4OLUH 5IESH 3GK8L 4M02A 1LP9F 2N4IA 5CEYA 4DTGL 3GHBL 4JO1L 2DQFB 4KRPD 5GRUH 3MBEB 2OK0L 4R7DB 5KSVB 1MEXL 4MHHG 2Y07H 3EYQD 5HPMB 2R0LH 2ZSVB 2VIRA 3HR5B 1MCFA 5CMAA 5H8DA 2G60H 1P53A 3BH9A 4LMQE 1L0YA 2IAND 3MFFA 3VD9A 1K5NB 3S5LG 5BRZE 1JPST 4C58B 2Y25A 4Q0XH 4H20H 1NDGB 3QXAB 2FECL 3ARBD 5C0DA 5EU7C 1AXTH 3RWDB 3SGEH 3MLWL 1EK3A 1AD9A 2HJKB 1ND0B 1X5LA 5JR1H 2AERT 3QPXH 2QKIA 4O58L 3TEUA 3N9GL 4BFEA 3G04A 5CFHA 1KTDB 3KPPB 3BD4A 4OZIF 3FO0H 1AGEA 1YPZE 4N0YH 4M48L 1RFDH 3K4DA 1F4XH 3UPCA 2B0SH 4FP8H 3MOAH 2XKSA 5IB4A 1WEJH 2XV6B 4KK6C 4RRPG 3PNWB 4DZBB 2OTWA 1BQSA 3NCMA 4Z7WB 3WIHA 2BSSB 4U6XA 3EHBD 4JFPA 5KZCB 1J86A 5D1XA 4LDOB 3BGMA 4QXTB 4GG8B 4HPOH 3W11C 3RX7A 4NQSA 3HA0A 4K7FB 4NFDA 4ZSOA 1PG7W 3PWPB 2YWZA 1UJ3B 4YUEL 4X83A 2YA1A 4H25B 1GGBL 1U8JB 2Q8BH 5E5MA 4PFEA 2DL9A 3BVNA 1WV7T 4RAVA 1YNKL 4K3HA 3VGDA 4WRLA 1FN4A 3VE0B 3VGAB 4RMTA 3ZHDA 4QXGL 1DFBH 3F5WB 3IVKA 4LIQE 4ZFOA 3TVMD 3DV6B 4AG4H 2FSEB 3RVUC 3C6LC 2SEBB 4XVSL 5ACZA 4P2YA 5E08L 4KC3B 4P5TA 5ETUB 3FMGH 2ICWB 3A67H 3QDMB 4UOW0 3QP3A 3WNKA 1H5BB 2ZSVA 3HR5A 1UACL 4UUJB 4U1MB 4JHAL 4JFZH 1EHXA 3QPQD 4R2GD 1BVZA 3S34L 5CGTA 1MLBB 5F8QC 5ID0B 2ZZUT 1J18A 2IG2H 1MJUL 5JORB 4Y4HD 2Q3AA 3R1GH 4WEBH 3T0EB 5T3ZE 3PP4L 1KB5B 2BNUB 1AXIB 4TPRL 1MRFH 3AREB 4I5BB 4NJ9L 1XGUA 1H0DB 3Q5YA 1ODAA 2J4WL 2HJKA 3FQXB 3E6HB 4P9HC 7FABL 5BRZD 2FDBP 2DDQL 2XTJC 4M6NL 5SV3A 4KK9C 3UC0L 3WKNA 4P57B 1FAIH 3LQZA 1QTYT 1KTDA 4G3YL 2P49B 3KPPA 4C4KT 1UKTA 3FCTA 2PXYD 1EGJL 4RFOH 2XXCB 3FB5B 2AABH 2DIBA 3LH2H 2PCPA 5F70A 3I50L 1SEQH 4YUEH 1IGFL 3HC4H 4PBVC 3VMOA 2NMSA 4JEGB 4M9PA 4OF5A 4WWKB 1VGEL 1DJSA 1FPTL 4RDQF 5DMGD 4RA0C 4DZBA 1NC4B 2UV3A 1WZ1H 3IYLW 4QEGA 5C0GB 1JGVL 4JFXA 1CLCA 5C2BL 1QKZL 3I9GL 4FFYL 1D9KD 5ECJE 4GG8A 2NW2B 2ZJSH 4NKOB 3NFNA 3PWPA 5IQ7H 1JTOA 1WGOA 3UBXG 4LLMA 4POZC 5GISH 4H25A 4IOSD 4XNUL 2YPLE 4F7PA 1OTTD 3SDAD 1L6ZA 2E7MA 4JGMA 4LKXB 1AE6H 3VE0A 2NY3D 3TO4D 4P23B 3AU1B 3F5WA 5DFVD 3DV6A 2VDPL 1JRHI 3OHXB 5IQ9A 2HFGL 4ELMB 4G5ZH 2X2YA 1NLDH 5IB2A 4PJDA 3T08A 3BAEH 2VDNL 5ETUA 2ICWA 3AAZA 3KYOB 4CADB 1H5BA 4HUWB 4R90H 5EU7E 1IM9D 2FHCA 1ZHKA 5C6WH 1A7QH 5I8OH 3QDGB 4UUJA 3BN3B 1UM5L 4U1MA 4K2UH 1UB5B 5FKPA 3X13B 3IKKA 2DAVA 2NNAB 3F8UB 4WFGE 1FL3B 5DR5L 4F9LC 1CQYA 3DSFL 5I74C 1CFBA 1RAMA 2DDQH 4MCYB 4QLRA 4MB3A 5JORA 4M6OL 1Y0LB 1CBVL 5B39B 3RGVD 3T0EA 2ZUQC 1CD9B 4QXUH 4V1DE 4I5BA 3FOMB 3RWHB 4J3TA 1U0QA 1QRNE 2RBLA 5BQ7A 3FQXA 1IGFH 2EC9T 4NUGL 2YD7A 3MLYL 1HSAB 1IGIH 4MJ2A 3LQMA 4P57A 1U36A 12E8L 15C8H 1HKFA 1G7HB 4NP4L 5EBLA 5T3ZD 4X98A 2CO6B 3DI2B 3FB5A 4FFYH 1QSEE 2C26A 4JDZB 5GJSH 1NQBA 1A4JB 4KXZH 1WWAX 3WN5A 5MEQB 5ESVB 4W6WB 2DD8H 1B3JA 2K3TA 4P3CH 2NR6D 4X0KB 2FO1A 1U8KB 5GGVY 1NC4A 2BX5A 3C08H 3Q48A 1J0HA 2QQLH 1YEHH 1XF2B 4UNTA 2NW2A 2BVOA 4NKOA 1OLLA 1EHLL 1T1ZB 1OQOA 2VDPH 3REVA 5L2JB 5TE6H 1NLBL 1XFPA 4PD4K 1J1XL 5B8CB 4HFUH 1A6WL 1KXTB 5BO1H 1CDIA 5DFTA 4OFPA 3VA6A 4CVXB 3RA7H 4JPIB 1AKJA 1CLYL 4XCNA 3AU1A 4JY5H 1JYVA 1WBZB 3DX8B 3P4OA 1VFOA 3BZ4A 3GSXB 4JQXA 1IC5L 2DM3A 4RWYH 2R9HC 4CADA 1U3ZA 5CD3B 1JPSL 1W72H 2IJ0C 1W0WB 2YN5A 2XTJE 5JXEA 1UB5A 3RY5A 1CFTB 3ULVL 1U93B 3OAUH 1CF8H 5GGTA 3AS2A 4KFZC 4XVJH 4MQ7B 2DQUH 3HZYA 1U8IB 3KJ4C 1IT9L 3JTTB 1B6UA 2VZSA 4P4RB 4NKQB 4ENEC 4M3KB 4EI5C 4G6FD 4NN5C 5D5ME 1U92A 4HFWB 4PJHA 4PJDF 5KG9B 5D7JB 4P4KB 2X7LA 2WLZA 1KPUB 1OM3L 1KN4H 5DQDL 4V1DD 2XN9E 3OGCA 1JMZA 4H26A 2BVEA 5CILH 3U7YL 2J5LB 1ZT1B 4Q2ZB 3QDJA 3GMQB 4M1GL 5ESVA 4ZUTB 2F53B 3SDCB 4JKPL 1DUYB 1QEWA 2B8OT 3W11D 2BMKA 1CFVL 3EYOB 4L3CB 5FGCB 1FORL 2O5ZL 2AK4E 2NY7H 1NFIB 4PV8B 1WIUA 1CLYH 2N1KA 4XNQB 2MMXA 5ISZE 4WVRA 1QSED 3D3VB 4GRLA 1EEZB 1SM3H 1FLRH 5BCAA 3ZTJG 2DQGH 1IC5H 1MH5B 1S7XB 4XMKH 3WCYA 1R3HB 1FYHB 4JPIA 3BPOC 3R06A 1IRAY 3H3KA 3NN8B 3C6LD 3TWCL 3S88L 1FV1B 1YN6A 3UPAA 1ES0B 4BFIA 1N7ML 1WBZA 3DX8A 4XMPL 1AP2B 4JB9L 3KYMA 5IIEB 2R56L 2F19L 5CZXC 3GSXA 1K6QL 3H9SE 3ULVH 5FYKL 1J0JA 3QQNA 5GQBA 4YX2H 2CDGA 5FYLE 3T04D 3W0WA 4JO4L 4OLYL 3X11B 1XGQB 4B5EA 1ZA6A 3MRNB 1UKSA 3PQYA 3KS0J 4PJEA 5J0BA 3IDMB 3LRSB 4HX1A 3O45A 5DD3H 5C70A 1CFTA 5DSCA 2IBGA 1DSFH 1P69B 4FFWC 4W70A 4HKJB 4MQ7A 1NMBL 4R97C 4LARL 5DJ2B 1AC0A 3D5OF 5C09B 4P4RA 2KKQA 3HNSH 1HZHL 4M7LH 4LLAA 5FKAA 3KPRA 4YZFF 4RGMB 1CFQB 3O6FB 1FO0B 4S1SL 4M1GH 5KVFH 3J7HA 3HAEB 3QWOB 3QEHA 3N1GC 3WO3B 5GGRA 3GSNB 4L9DA 5HYJB 5JIIA 5EIVA 3MCLH 2BJMH 1AIFB 2COQA 1V05A 5D7LB 4JY4B 4PJAE 2IFFL 5BS0E 1VSCA 4HG4K 3GMQA 1AO7B 4ZUTA 5HTSA 3SDCA 1C12B 3P2TA 3LDBB 4GXUN 3VXNB 3VU2A 4F7CB 4NGHL 1OP5H 3FO1B 3O4OB 4PJ9A 4JVUA 4L4JA 1H8SA 3NZHL 3SY0A 4POZD 4QY8B 1N26A 3O3BB 3P77B 2XN9D 1HKLL 3D3VA 3AS1A 1U8PA 4OM1L 2R56H 1FZJB 3LKPA 4PJHF 5ALBL 3UDWA 1MH5A 1IC4L 1MFBL 3FT3B 3TJEH 1N3NB 1S7XA 1ZLWH 4LPVA 3TBYB 4CW1B 1U8HB 3VFPA 1EXUB 5FO7A 2JB6B 2OZ4A 2AK4D 3QUXB 5B21A 1NFKA 1F8TH 5EPMB 3BXNB 1UFUA 1A7BA 5I18L 2X42A 4PUBH 1G0YR 3OF6D 1CXIA 2P8PA 3C5SB 1ZVHA 4G7VL 1TDQA 2AJYL 3B9AA 4RMRA 4UDUA 4EXKA 3KPOB 3C9NB 5B38G 1S3KH 2HN7A 1KYOK 5DC0A 5L8KB 1K8DB 2H2SD 5HYSG 4X4MA 1HEZB 1HZHH 1MCRA 1U6AH 1Q9LA 3IDMA 5HHXL 2MCPL 5CGMA 1IMHC 2GY5A 4BH8B 3WMSA 2ADIB 4YBHA 1RIVL 5I1JL 2P5EE 2W9EL 1CL7L 3MV7E 2YZ1A 3H9SD 3QQ4B 2WAHA 3P0YH 1MCIA 1XR9A 3I02B 5FYLD 3S37L 1LVEA 5I8EA 4PY8J 3TIEB 1DBBH 5C09A 2JTDA 2C7UA 3K2MC 1HINL 3ARYA 4UTAH 1U2HA 5IVOA 5E2UL 4N8VB 1M7IA 2P8LB 5DHVH 2ARJQ 2MSPA 1YJDL 3C60B 3GSNA 3IS0X 4NGHH 3SGJA 1XZ0A 1F4YL 1AIFA 3D69B 4PJEF 4KZEH 2BNQD 4ZNEE 4JCMA 4JY4A 1MF2H 3VDBA 1MI5A 1QLRB 4TQEH 4LQ1A 5D1XC 3VXRD 2CLRB 1JWSA 3O41B 1C12A 3D87B 5ANME 5F7NC 1T03L 4F7CA 5BW7A 1G84A 1GL4B 4JQVA 4PB0H 4OZIE 4NIKB 1MRCL 4OIAA 3O3BA 1DLFL 3BP4A 4D8PA 1DE4B 3GSUB 25C8H 4PREB 3OG6B 5BS0D 2C1PB 5E6YA 4LSSL 3B3IB 5JDSB 4QTHB 1X4YA 3FT3A 3B9DA 1GGCL 3BDYH 1QNZL 2WBJB 4H88L 3TBYA 4CW1A 1DQDH 2JB6A 2VDML 3SE8L 5F3BA 3MBEC 3QUXA 1HYSD 3QWQB 2C3HA 3K3QA 5EPMA 3BXNA 3HG1B 3IETB 2R9HD 3ARZA 4KRMB 2FB4L 2YR3A 4XCYB 3C5SA 1CLOH 1RIVH 4NYLB 3KPOA 2R23B 2Y6SD 1CVRA 3PWVA 4HKXA 3GKWL 1FBIL 4ZTPL 3IXTB 4XHQA 4S11A 3UZEA 4DQOH 4PGCA 1HEZA 1IAII 4GSDH 1S7SB 1OAQH 2BSRB 3RNQB 3KPNB 2VDOH 1XAUA 4BH8A 1I85A 2XQBH 1X7QB 3QQ4A 1JJUA 3HB3C 4QOKE 2PTVA 3MRDA 4JRYB 1QFPA 4ENED 4EI5D 2NY1C 5GHWL 3MPCA 2BVQB 3ZYZA 5C07B 4POYA 5L7XH 1X5HA 2F54D 2MWCA 4PP1D 3WKML 4ZFZB 2P8LA 2P5ED 3BE1H 3MV7D 3BUYB 3PWNB 4UDTB 2V17L 1WBXB 3TYFA 5J11B 1JCKA 3DHJA 5HDOA 4XBGA 4O2FA 4NQVA 4LPXA 3ESUF 4JN2B 3QO1A 2DQJH 2MJWA 3BGAA 1QLRA 4OCNC 1UT9A 1FE8H 3GI8H 3O41A 1UJ3C 4HLZG 4AM0B 3PABB 3LS5H 5GRJH 2ZNXA 3JWOL 1S7VB 1DE4A 4PREA 2D31B 3SO5A 3VGAC 3R8BB 5GS1A 5K93A 1MFCH 2C1PA 5JDSA 1QR1B 4OF0A 4ACPA 2R1YB 1RZFH 1GJIA 5C0BB 2WM0A 5E1AB 5CZXD 2R0WL 1PJ9A 1QD0A 3EYVB 5D2NA 5TFSL 4Z76B 5E6IB 1H5BC 3WHE0 3IETA 4GKSB 1FIGH 4QT5A 2WWMC 2X4TA 2D7NA 3O3EA 3JV6A 4NYLA 4U31A 2A6IA 2GQHA 4D9QE 3GI9H 4DGYH 2R23A 3BPLB 4HWBH 4NT6B 1G9MH 4XPAL 5F96L 4UINL 2ITDA 4NHUB 3WFCL 3IXTA 4F7EB 5F72S 3VFNA 2NQCA 3ARGB 3QZWG 1Q0XL 4FFWD 1S7SA 2BSRA 4PG2A 3T0EC 3KPNA 1PG7X 4WFEE 5KSUA 3X14B 1F90L 1NCDL 4ZDHB 1NGQH 1A4KB 3BYTA 2X6MA 3QJHA 1VEPA 4D0BA 2EH7H 3A6BL 1KJ2H 3TNNA 4MWFA 3IFPB 4X6CA 1KC5H 1JYWA 3IS1X 4YHKL 1VFAA 2BVQA 5I8KL 1UH3A 4APQA 3ALXA 5C07A 1BFTA 4Q9RH 4NQDA 3DJ9A 1ZK9A 4ZFZA 2J8OA 3HPJB 3BUYA 3PWNA 5CGYC 1F02I 4P3DA 3G6DH 5D72L 4OUUB 1CGTA 3QULB 4ZG1A 1LEIB 4JRWA 3IT8D 3VFWA 1F3DJ 2GW5A 4LKCA 3BGFC 4BZ2L 4JN2A 5D7SL 4J6RL 1LDPH 5F7EH 3MOBL 4LVEA 1KLGB 2OMBA 4K23L 2NLJA 5C0FB 3DWTA 2W0PA 1M7DB 3ET9F 1S7VA 4LLYB 4F80A 5FECB 3CAFA 2VLJA 3CDCA 4NO5B 5I30H 5K9OB 4Y5VA 4TRPL 1MCCA 2D31A 5E8DH 5DI8A 3O6MH 3V0VB 3O3AB 3ZSSA 2X4SA 4UILH 1BJ8A 1QFWL 1QQDA 2R1YA 3OJDB 4XPGL 3MC0A 4JQXC 4XPHH 5EORH 3IJYA 4UAOC 3NCFB 5KBNC 5DJXB 5E1AA 4HXAL 3DIFB 5LAXB 2A1WH 1MFNA 1QZ1A 3EYVA 1EEQA 1M6OB 1S5IL 5CJBA 2HRPL 2GJJA 4LSUL 4ODHL 3RZCB 4JPWH 5F1KC 3KDMA 3FHQA 1NGXB 2DTMH 5JXEC 1J0IA 3OKLB 3EDFA 2MPAL 4NT6A 2YD3A 2CRMA 1OLZA 4PBXA 3A6BH 3EO9H 1HIML 3FJTA 1YY8A 2EECA 5AWNL 1JL8A 4JFDA 1YNLL 5IT2L 4U6YB 4XCCL 2LABA 3B2UC 2EDLA 4XAKE 3FQRB 2XWJA 5IMOB 2I60L 4CN4A 2E6PA 1JVKA 1U8OA 4C54A 5H35B 5ADOH 2AJXH 3FQNA 2JKXA 4Z7WE 4ZFFB 1TQBB 4WDIB 3OKEB 1KJVA 1KTRL 1H9VA 3MJ9A 3PWPE 5DJAB 2HLAA 2DMCA 4WFED 1GAFH 3RHWF 1KB9K 4FQ1H 5JIKA 5E9DB 2EKJA 2I25N 1EUUA 5FO8A 1A1NB 4S2SB 1RMFH 4XGZA 5ADPH 4K3JL 2GJ6B 2VZOA 3EFFB 5HHOA 3VXMB 5D1XD 4OIBA 5DXWA 1RJYA 1E4JA 5IBTL 4P99A 2GSIB 2FX7H 4ODWA 1FDLH 2FO4A 2H2PC 4HKBB 1PBYA 4YBLB 1A3RH 8FABA 5I2IB 3E0GA 3D9AL 1KCSL 2WZPD 3NIDF 4FQ2L 4GRLC 1QFWH 5D93B 5FIEA 2DLEA 4L3EA 3RHWK 5C0FA 1ZEAH 1IQWH 1JHTA 5FF6A 5JDJA 4X6CF 2FD6H 3AB0B 4AMKH 5DRNA 1TVBA 1JV5B 5FECA 5D6CA 4NO5A 4JKKA 1ADQL 2I27N 1F6AB 3V0VA 3O3AA 4P5TD 1KIQB 4ODTH 2DBLH 3VI3F 4UTBL 1PAMA 2AK1L 43CAB 1CTNA 3PP3H 5BZWB 3T0EE 3FRUB