3N85H

Crystallographic trimer of her2 extracellular regions in complex with tryptophan-rich antibody fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSIWWSWIHWVRQAPGKGLEWVASISPSSGWTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWWSSAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Structure of the complex between HER2 and an antibody paratope formed by side chains from tryptophan and serine.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 214
sequence length 218
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H01
2CXGA 3O3DB 3QUXC 4KK6D 4G8IA 5IFAH 4HCRL 5SWZE 5FF6B 1ZANH 5I6XC 5HDOA 5GJTH 1IZKA 1NFIA 2VDMH 2YBRB 4Q9QH 1YNTB 3HZMA 1S9XB 3HC4H 4X5LA 2ZCLL 2ADGA 1IGML 4QHKJ 3BIBX 4ZTPL 3VFMA 5A2IH 5I1IL 2X09A 3KHOA 4TSCL 2Y06L 2PYEE 1VCAA 2FJFB 5CCKH 5F7UA 3QXVA 3DVNA 4LCYB 5FXCH 1S7SA 3QEUB 2FLRT 3WLWC 3ULVH 5JW3H 4XI5C 1YQVH 5GRUL 5EU6B 2JELH 1S5IL 1G9MC 1NMAH 3H7LA 1TXKA 3IKKA 4XXDB 3KYMB 1C5DA 4K7PH 5M7QA 4U2ZA 5D7SH 4L5FL 1DVFA 4F15C 4CMHB 1QSFE 3U2SB 3T04D 5IFJB 3SY0A 1J7VR 4ZOCA 1PSKL 2RBLA 1QFUL 3EOTL 1CLCA 1T1YB 1BQSA 3RJQB 3V4PH 4X4XB 1R24B 2H6PA 3QO1A 3QDGD 1QOKA 3DGGA 2XZCH 5IMKA 4JHAH 4Z76B 3BGMB 1W72A 4HK0B 4C83A 4NC1E 4YHNB 2NXZD 5KSAC 1ACYH 3MV8E 4S11A 5IOPA 2C4XA 4NZUL 3UPAA 1U8QB 1RUMH 4ZDHB 1OY3B 3AFLA 2QSTA 1CQYA 2EEAA 1Z6JT 3UEZA 3KS0J 1HSBA 2XZZA 4IOSD 3S37X 1HCFX 2L0DA 1IC5H 4U1LA 5DC4B 1TJIL 2PN5A 3MQIA 4PGEA 1F8TL 3TNNA 3CVHL 1UG9A 2Y72A 1ADQA 4LK4A 3TYGH 4TN9A 2GIYA 2VLRE 1J0YA 3VRJA 4LFHD 1JFQL 1JPSH 3CZJA 4HJJL 3SGEI 1V3KA 4XNXL 3RHWF 2RFXB 2H8PA 2B2XH 1F4HA 2NX5B 1WZ1L 5BCAA 1VFMA 4ZXBB 1BLNA 4QRQB 1ZMYA 2B20A 2GJ6D 1DANU 2CRIA 1E4WL 2IBZY 5HHVH 4U3HA 2QSVA 3F7YB 3UTTA 4OGYH 4UB0L 2VAAB 4R7NA 4L4TB 5L0QC 3MRHB 4Z95H 1FE8L 4RGNC 4LASL 1MWAH 3VCLA 5IJVA 1I85A 1TZHA 1W8OA 3GK8H 1CFVH 3DETD 1CT8B 2BVUA 4RDQG 1P4BL 1GHFL 3U0PA 2BOCA 3MFFA 2OTUB 1H5BA 3L3DB 4Y0GA 2EC9T 1JWSA 4Y19D 1MCQA 2GJJA 4KDVA 4PGZA 4LSVL 1OCWH 4K8RD 4ZNEA 4ZUVA 4JQXC 3S35L 1BMGA 1D5MA 2XOTA 4D2NA 4UBDD 2OJZH 3VI4F 3LS4H 5E6ID 3S96A 1N5YH 3P4LA 5IG7A 4BZYA 3DLQR 3BZ4A 5EBWA 3P0GB 4NKOA 3S3PA 3CFCL 4R4ND 5KVGH 2VLKA 1ZLSH 2BNRB 4Y16C 3FO2B 4Y4KD 2BP3A 2EXYD 4MXQC 4N5UA 1FYTA 3EUUA 4PLKC 3QEGL 5ERWB 5HGAA 3WCYA 1BQLL 1PBYA 5IEHA 4HKJB 4LU5L 1U8HA 4HS8H 4GSDH 5KSBA 3DXAE 3IDYC 2X4OA 1X6LA 2CDGB 4Y1AE 3A67L 4XHQA 1YEJH 3OF6A 1T2XA 2NXYB 3IKCB 2CR3A 2V5SA 1HYSD 4KKLC 1R3HA 3VXRD 4UT7L 1E0OB 2HVKB 4X8JB 5I8EB 4HLZG 4CN6A 4NQCD 3SBWA 3SN6N 3MV9A 3KLHD 4ORZC 1KJMA 2HT3C 1V7NL 4XRCA 1M7DA 3Q5YA 5DGRA 4G9FB 5IWLA 3PGDA 5IKCA 4NC1C 4DFHA 5E70A 4HEPG 4OZFH 4M7LL 2D7TL 4ONFH 5DT1H 3QUXA 3UC0L 1FZOA 4JDVB 3RZCB 4L3CA 1YMMB 3UZQA 4YO0B 4OLUL 3TVMB 3RKDD 2NY2C 2AXFA 3DUUB 4RWYL 3U79A 4N1CA 4P9ML 3MCLH 3ARWA 5FYLD 5AG9A 5I6XB 4JZJB 1I1RA 4PRIA 4OI9A 1MQKL 5CD5C 2R23B 4XWGH 4HMEA 1IGJB 4P4RA 3BP4A 3WMSA 3OX8B 3LDBC 4YK4C 4XH2B 1U6AH 2F5BH 4WW2A 3MRIB 1MFDH 4Y5VB 1UB5B 3LQAC 3UDWC 2LU4A 3U6RB 3L7EA 3CC5B 3BQUD 4IRSC 1HOCB 3ZYIA 1KIPA 5JZ7C 1TVBA 1BVZA 2H9GB 4YIQB 4O2FB 1NJ9B 1W0YT 2IG2H 2AK4D 1KFAL 3O2WH 3MZGB 3QDJE 4KUZL 4M8VA 1J05B 5D7LE 1I7UA 1NGXA 1I9RL 3NFNB 2IPKA 1AGCA 5KG9B 1JV5B 3CMGA 3SEPA 4P46C 3QXDB 1VFBB 3KYNA 4YBHA 3N1QC 5EU7E 1UACL 2QQNH 5IGXH 5GISL 2GTZB 2PO6D 3G6JA 1D5ZA 2ZOKB 1A14H 4JJ5A 5KSAA 1S5HA 2VZSA 1KB5A 1S7TA 3K4ZA 1B90A 1Y18A 1HDMB 4LLDB 2D4DA 4NRZA 4PJ9D 1N59B 5F3HB 4WJ5B 3FL7A 2IPUG 3KYKH 4M1GH 4YJZL 5D5MB 4ZO8A 4KVCL 1TPXC 2OJEB 2VDPL 2VXTH 2DI7A 2HLAA 4JKWA 5EZLB 1KOAA 3IS0X 5E8NA 1SJXA 2BERA 3BH8A 3QHFL 3D6GA 1WLHA 1DANT 4MVBD 4RMSA 1CE6A 2C9AA 1NGYB 3D85D 4OT1H 1JGLH 1TQCC 2YPLB 3HNTL 2DF3A 5CWSA 1WVZA 2QQLH 4GBXD 4RFOL 3CH8A 1G7IA 1AGFA 4WW1A 3ARED 1UWEH 5GGTH 1X5KA 1CLZH 3EO1A 3PHQA 2GJZA 4X83A 3O8XB 4Q6YA 3IFOA 1SY6H 4V1DE 4LRNL 5DZLA 1Q9KB 4N5ED 1LGVA 2VLJA 2YUXA 1RI8A 2B0SL 1NBQA 5E2VH 1FO0A 5DK3A 2R4SL 2BVOB 3BAEL 3PP4H 5TE6L 1LHZA 3X12A 2F8VA 5L0QB 4PTTA 1N5AB 1UVQA 1UADC 2Z92A 2ZUWA 4JPIB 12E8L 1GC1C 4KTYA 4K8RL 3EDJA 1B2WL 4MHHI 1CFSB 5INCA 2QR0A 5ID0A 3HI6H 1KN2H 3VDCA 5E00A 5AZEH 5EPMB 1T1ZB 2AV7B 3EJYD 3JTSA 3A6CH 3MLPA 1N8ZB 1JGUL 1P1ZB 2APBA 4GKOA 2F5AH 4MAYB 2A2QT 2A6DB 5CILL 2IFFH 2HRPL 1KEMH 2BK8A 5EBGA 1PVHA 2AXHA 1A6AA 1H15B 1TJHH 5SWZA 2DYPA 5TF0A 5H2BA 5C0JB 2G5RA 4PJIB 3MYZA 1I1FB 5CKAA 2O26U 3D3VA 4NUGL 5HI3D 4FFZH 3TT3H 3MLRH 2FYYB 4C4KO 4H5SA 4NM4L 2CMRL 4H8WH 2A9NL 1Z9OA 3REVA 3VFGL 1T0NB 1G1CA 2VIRB 3GHBH 3ROOB 3SKUD 3TN0C 5IFHL 2FD6H 2NY0D 5BS0D 2XQYG 3DX7A 4U3CA 8CGTA 4XBPB 5C07D 4Y16B 3BIKB 5D72H 1RPQA 1PEWA 2JJVA 3IETA 3VWKB 2CIKB 4PD4K 1AR1C 1KG0B 2YD3A 1T03L 1YPZF 1ZHLB 2C3WA 1T21A 3SE4C 1OTSC 3F62A 1QSFA 1D7FA 3KGRA 3RWHB 3PXHA 3VG0H 5JOPE 5IMMB 4A6YH 2KL6A 1NCDH 1CBVH 3IDYB 4NKDA 2J8UB 4NO0B 1TZIA 1X4ZA 1R5IA 3MACL 1BFSA 2VC2L 4G8EB 2HJFB 3MGOA 3MUHL 5T1KA 5GRJH 5IP4A 5ILTL 4P4KD 3RI5F 1N4XL 1LWRA 3MV8A 1Q1JL 4Z7QF 5C70A 3GKZA 3QHTC 3KPOA 5T33H 2MKLC 1OAXL 5T1LB 1ULVA 1UM4H 2ZKHH 5KANI 5IBLC 4NQTA 2YN5A 2YUWA 3F58L 4FABH 5FO9B 3RL2A 5IESL 4JO1H 3ARPA 3UBXI 1U8KB 3X13B 4OZGF 3QIBB 4TYUA 1NBYB 1N6VA 3BPCB 1C12A 4OZIE 3IS1X 1T4KB 3C6LC 5C0CB 2ZUTA 3LKRB 4I3RH 2WWKT 4YAQB 4U0RB 3WXWH 2EYTA 5BZDB 1AGBB 1Y6KR 5ESAB 2VDOH 1NLBH 4YK4B 1IQWL 1ZAGA 5E8EA 4F7MA 4M48H 4PJBF 2I9TB 5KS9A 4OCRL 4GAGL 4IRSA 1RZJH 2DQTH 4ELKB 2EDQA 5I2IB 1F58H 1FL6B 5KOMC 3D2UB 4L4VD 2JKXA 5KTEL 1II4E 4GLRH 2F9BT 4NIKB 4P46A 4UIKL 2RJMA 2V5RA 5FOJA 1N2RA 2IJ0C 4PR5B 5F9JB 1KIRB 2M8XA 5IVXE 4HHAB 4DK3A 1QLRB 1UC6A 1ZOXA 4PJDB 1KJ3H 4BKLB 4WFED 1IGTA 3S36L 2VXSL 4PJAB 2NTFB 3W0WD 4UU9B 1E4KC 4JM2A 4KJWC 3AY4A 3FQWB 1Y6MR 4UNTA 1HCVA 1F4YH 3BUTA 2DS4A 1MF2L 4ZOEA 5C09E 3D18B 1MFAH 5DD3L 1JNHA 3NIFE 4JDTH 5EA0L 5HGBB 4J1UB 4NPYA 1LEIB 4ZYKB 3P9WB 4YX2L 5IW1A 1JHTA 2V5MA 5EO1B 3VU2A 4D9LL 2OR8A 4B5EA 3OAYK 4FQXB 4MD5A 1DDHB 1RZ7H 3QQ9C 2RCSL 2ID5A 2R8SH 3ZKXB 1JYNA 1E6JL 2YA1A 2A9MH 5DSCB 1WAAF 2WNGA 5DJXB 3UTQB 3DXAA 4JM4L 1EDQA 5GRZA 3MUZ1 3BPLC 4UZGA 1HILA 4WTZA 1S9VB 4Y1AA 5CJ5A 3F7VA 3CFJA 2R39A 4QXGL 1JWUA 2VQ1B 5CIPA 4IDJL 1DQLH 1XIWD 4KV5F 3RWEA 3BH9A 3RVWD 5T3ZL 4PJ7E 5I74B 4FG6D 1OAUL 5C0AB 2ZSVA 3NIDE 3D1MC 3RWFA 5CJBA 2VITA 1L7IL 1U8IA 1CDIA 2IAMD 3GMMA 3IXAB 1F4WL 5EO9B 1NDMA 5HY9A 3S4SA 1M05A 4MNQD 4X6FA 2Z8RA 3GNMH 5GSVA 3KR3L 4GMSL 1MOEA 4M61A 1UJ3C 3QISA 4AENB 3QUYD 1D5BB 2VKWA 4KQ4L 1YY9C 4L4JA 4WWID 1NKOA 1KNOA 3OKDA 4EJ1C 3LEVL 1UQSB 1X44A 2UY6A 3NCBB 4IRJC 4L8CA 1CS6A 3TN0A 1I4FA 3VA2C 5HTSA 1A6WH 3G04B 4LCIL 5EUKB 4AEIH 3Q48A 1CR9H 1ZTXH 1VPOH 5F1SA 5I71C 1FZJB 2CUMA 3RVXC 4WNQB 5D1QD 3BI9X 3HNSH 3IF1A 5HI4C 3CFKB 2R4RL 5E8OB 4AJ0A 4Q58C 1LE9A 3FFDB 1FV1B 4U1SB 3CMOH 15C8H 3SE4A 2CD0A 4LHUG 3QDJA 3RIFK 2AEPH 3UYRH 1HH6B 3LRGA 4CVUA 5D7LA 4JRYD 4S0SD 5DJZA 5FFLA 2NY7H 3WBDA 4JFPA 4PYHA 3CX5K 3SKNA 2ED8A 5ICYA 1TCMA 4M7JH 1LO2L 2DI8A 2LV4A 2ICCA 3RGVC 3CPLA 1G6VK 4BQBA 2W65A 5I17A 1ZKAA 4MQXD 1FNGB 4HIJB 2JJUA 4XCEA 2EZ0D 2VZUA 3B5TA 1MIMH 4KXZH 2F74B 2J8HA 4HJ0C 1CLYH 4RX4A 3WEXA 2VLMD 3KPSB 3UTSE 3BE1L 3TBWA 4LARH 2ICWA 3PWPD 2V5YA 5SWQA 3NN8B 1A4KA 2BHYA 4JLRA 1M4KA 4BH8A 4R96B 3C6LA 2EIDA 5IR1B 4LLVB 3LB6D 2Q1EA 3QWRA 3E6HA 4U1IB 3EYQD 4ZFOA 3QXTA 3PUCA 4LQFL 1HYRC 1OD7A 2Z35B 2VXUH 2P5EB 5KAQG 4GXUM 2FHCA 2XQBH 4M5ZH 3KPRB 3SGJC 2DMBA 4G9DA 2WWMC 3EGSA 4V1DA 2R0KL 4XVTH 1DTUA 2V7HB 4Z7WB 4PGBB 1JYXA 1QFPA 5IQ7H 1ZA3A 3JWOL 4EN3D 3FB7B 1X5AA 3VFRB 5C0IA 4X0KB 1QNZH 3ULUH 2YA0A 1ZXQA 2ESVB 3BYTA 1BF2A 5E99H 1KB9J 1XGTB 1MRFH 3T77B 4QNPE 2DWEA 1JPGB 2X1WL 5JIPA 5FYKL 4UI2A 1MIEL 4XVSL 3KAAA 4OB5L 3FQTB 3SKMA 5IMLB 3EYFB 4F2MA 3SDCC 3QG6B 5E1AB 3F7QA 3KPPA 5J6GB 1A64A 1DE4B 5IM7B 5L2KD 3U4EA 2OP4L 4F7PA 1NCUA 2DIJA 2EDLA 4XPFL 1PG7L 5KSBF 3A0OA 4XPGL 4N0UE 5ITFA 3W81A 3CUPB 4P2RB 2WV3A 4JG1L 5H94A 3VWJD 3C5SA 5CP3H 1T1WB 5A3IC 3K74B 4TOYL 2OMBA 3DRQA 4HIXL 3WN5A 1AXTH 2VR5A 3B43A 3V0WL 3VE0B 4TRPL 4X9IA 1FFNB 1RHHA 3DHMA 1CD8A 4L9LB 1MHEA 4F37F 1JHLH 4LIQL 3CXDH 1ZT7A 4HT1L 2DQGH 2IPTH 4FZEL 5D71L 4WO4C 2A6KA 2PCPB 4HWEL 1V3MA 4GKSB 4RRPG 5DEFA 25C8H 1UA6L 4QHKI 2EKSB 5IHZB 1YEGH 1U93B 4YPJA 1NGQH 5F6HI 4PGDA 2MNUA 2ATKA 1WWWX 4GRMB 2GTWB 2ICWJ 2AP2A 1BJ8A 3UX9B 1DQMH 3WIIL 1J1OH 4NZTL 2R29H 3ARDB 2DQUH 4ZSOB 2C5DC 2VABA 2H26B 4PRDB 1Z9LA 3RWDA 2YPKA 1F5WA 4NQXB 3SKOA 3BXNA 5BXFA 5JPMA 1UYWL 2YN3A 4F57H 5C0EB 2I5YL 4WW2F 1D3CA 1WIOA 2D03H 2HWZL 2IH3A 2JK5B 5D2LF 1A7RL 4TQEL 4YBQD 2X9XA 1JRHL 3MNZA 3HS0B 1A47A 5CUSH 1KGCE 4HIHA 3UAJD 4P9HL 5DDHB 3SE3C 1UJ3B 5FKPA 5IB2A 3DYOA 5J7CC 2OR9H 1IC4L 3UJJL 4IRJA 4OZIA 4K7PY 5D7KD 5GS3A 4HS3A 2H2SD 4PJCB 4P23D 4RA3A 4GQ9H 1BP3B 4OZHE 4PG2A 3V5KA 2Z91B 4EBQH 4YZFE 1U9KA 4YGVA 1JK8B 2AI0H 1MCBA 3MRFA 4GG8B 5DK0A 4KHXH 4J7RA 3U30C 5HPMB 1NCWH 1S9WA 2XWTB 5FCUH 3UZVB 4X98A 4NKMA 5C0BB 2Q8BL 4JGMA 5I73B 4P3WA 1AJ7H 3KXFA 2WUBH 5HGHA 4JREC 5BO1L 5J1TC 5DI8B 4P2QB 3BEWB 3CK0H 5DK2B 2BNQD 5JOFA 3QUKA 2VYRE 1DEEB 2KZ1B 4YEEA 3RGVA 3O2VH 1F4XL 1GGIH 3W9DB 4AY0A 5IVXA 3TZVC 4HMCA 2X6MA 5CKGA 2LQRA 3BMWA 4N8CH 3FQXA 4P2OA 3KPMB 3FO9B 2VXQL 1RZGB 4LLAA 1XGYH 3QUMA 4DEPB 5BQ7A 4Y88A 1Q9OA 3HMWL 3OKNB 5TQ2L 2CIIA 3QXUA 3FB6A 3VXPB 4MLSA 5C09A 5DJAB 4D0BA 1CG9A 5J1AB 2VSDA 4QHLA 3CFBB 1IQDB 5F89B 2FR4A 2E6JA 4JRXB 4N0YL 3LIZH 4OLEA 3PWVB 4MDIB 4XP1L 5HHXH 2G60L 3NMEA 1A1NB 1HHIA 1BWMA 5E0QA 4ONOA 4HUNB 2K7PA 4HH9B 4ZFZB 5HHOE 3S37L 5HSFA 1R0AH 3ROLA 5A16A 3Q6FA 1FG9C 3BKMH 3DMMC 3MRNA 2DQJL 4MX7A 3MCG1 5LCVH 3ZTNL 5ICXB 2Z8WC 5LWYH 3GB7B 1RUAL 5EULV 3P77A 3S3SA 5GGSB 3I6GA 5JXAL 1VSCA 1ZLVH 2VDML 1NH6A 1FCGA 2XG4A 4PJ7A 1ZHBA 2XPGA 2HFEB 2K3TA 3TBVB 1XH3B 5FIEA 2EDDA 4ZAKB 1S7RA 5ANMB 5CCKL 3BD3A 1T1XA 2OK0L 2GJ6E 4V2BA 3VMNA 4LFHG 4NQVA 5E8PB 3KYAA 3OAUH 3ULVL 4HWZA 5JW3L 3QFJB 3AS2A 4OFKA 5EFIA 3MNVB 2VXVH 5EOQL 1OLLA 2Y7QA 3HE6D 1NMAL 5DMKB 3HPLA 3HTLX 4JY4A 5F96H 4WU7B 2BDNL 4LNVA 5F6IC 3SDCB 1EFXA 2QHLA 4EQ2A 2ADFH 4FQJH 1MLBB 2MMXA 4YFDB 1YUHA 1MI5B 1UEYA 2YC1B 4QHNA 1NUDA 3EOBB 4JKPH 4G5ZH 1TIUA 3RWJA 1MCRA 1XF1A 3QA3A 3EDFA 1LO3L 4Y4FC 4M62L 1WJ3A 3B8SA 2XZCL 4JHAL 2HLFC 4LEOB 32C2A 4LHUB 2I24N 5DRZA 2XACC 5D6DA 1S7QB 5GIRB 4MXWH 2LAGB 4WO4A 2NR6C 2YPVH 4G80A 3O3AB 4R4FH 5DS8B 3V5HB 1T89C 3TWCH 1HHGB 5E9DA 4WI7A 1YN6B 4JFDD 4GRWB 3LSOB 1X7QB 2AQ1A 3LQMA 3I3EA 1CL7H 4M7LT 4OAWA 5E03A 3T65A 4PG9A 3AC0A 2DQHH 3BZDA 3TYGL 1E6OH 3RQ3A 3GI9H 4RWHA 4LAQL 3L5JA 5H8DA 4I3GA 1JPSL 2Q3AA 1L0QA 5CEZD 1AR2A 5B39A 2FJGB 2B2XL 1LE5A 1DP0A 4PREB 4HWUA 4A2MA 3UTSA 1R3LB 4R0LB 1LD9B 4WWKD 5SX5H 2A77H 4NUJB 3TIDB 2Q3ZA 4DQOL 1U8JA 5DTFA 2BRRH 1F3JA 4Z95L 1EUUA 4F3FB 3O3DA 4OF6A 2PKDA 1JN6B 5I8OL 1MWAL 2GT9A 4LCUB 3O6FA 5E08H 2VDLH 1CFVL 1I1YB 3MMEB 1EH9A 1I3GH 4LRIC 3VFSB 3LMJL 5I8KH 1T7YA 1I3RA 1NAMA 1IT9L 2NY5H 3MTRA 5CEYA 2KQMA 5LAXA 4EEEA 1S9YB 3R06A 4JHWH 4XB8A 5I15H 5BRZD 4XVJL 4KQ3H 1CD0A 2DJSA 4OM1L 1OCWL 3DRTA 4ESKA 5F1IA 3GSVB 3MRMB 5IHUH 4P57B 2OJZL 2BY2A 1N5YL 3K81A 3TZVA 43C9A 4LOUD 4Z18A 1MCWW 4YFLF 4TVPH 3D87B 3AGVA 5KVGL 2IGFL 1NMCB 1ZLSL 3IDXH 1ZSDB 3SDYH 2QADB 1WEJH 4N90D 4DOHE 2JIXA 3F5WB 1R24A 3B9KB 3VXQB 4EZMA 1OAKH 3MNWA 3MXWH 1ETZA 1ORSA 3WJJA 1LO5B 3GUTB 3TF7C 1LEGA 1BGXH 1IC1A 3DETC 4HK0A 1JZ8A 5ISZE 4LGSB 2CSPA 1H3UA 1WSST 2DQIH 4N0UA 5HYJB 5TH2B 3ILPB 3HRZB 1A1OB 1YEJL 5E2JA 1QACA 5F3BB 4NM8H 1G6RL 5GS0H 4RFNB 3IB4A 4QY8B 1MLCB 3AAZA 2RGSA 1ZT4A 2GI7A 2Y5TB 3DMMA 5CGMA 2H3NB 2OZ4L 1FC2D 1MHCA 3MROB 1XF3B 4MQTB 4JEGB 5FYJD 5DR5H 1VA9A 5DT1L 3EDEA 5E6IC 3KPTA 4X4YA 2DLIA 4LDLB 3LV3B 4BJLA 3PQYB 1FAIH 4DVRH 3RTQB 3RWCA 5CBEB 4EI5D 5F7YC 3L6FA 4EOWH 1ROWA 3OJMB 5FKAA 4RMVA 4KU1A 3RIAF 4XMKH 4R4NC 3IJYB 3T0XA 7CGTA 4CMMB 3GSRB 1Z3GH 4YHPB 5TGBA 2EXYC 3SPVA 1A6VL 4HS6B 4W81A 4XWGL 4WUUD 1CU4H 1PY4A 3OKKB 3UJTL 4C57C 1ZHKA 1U6AL 3OKOB 2F5BL 4M6MH 1NC4B 3C60D 4K7FB 4M6OH 1SVCP 5TPWH 1U95B 3ORJA 1AGEB 5GGRB 3FONA 4L29B 5JPNA 3MRGB 1NGPL 4LPCA 4CW1B 4NFDA 2IG2L 2N7BA 3IDNB 1KJ2A 3L3DA 3WUZA 4QO1A 1A7QL 2QKIA 1TITA 4JR9L 2DM3A 2IH1B 3OXSA 2X4QB 3KLHC 4OZ4B 2GFBB 2NW3B 5F7DA 2VUYA 4MB5A 4OZHA 1RZKC 4G8GD 4Y4FA 4GG6B 5DRWB 1CD1A 4GXVH 4WEBH 5JOEA 2QQNL 5DVOA 4ZUTA 4EDWH 1ND0B 2H2PC 5HGDB 1A14L 2PYFB 3RKDC 2FEEL 1JPTL 4FFYL 5IB3B 5GXBB 1RY7B 5D70L 3KYKL 4M1GL 3FO2A 1QKZH 3O9WA 2VR9A 2DQEL 2VXTL 4B41A 5ERWA 2CKBA 2EH8H 3HZKA 4KMTH 4S1DD 35C8L 3C5ZB 1KLUB 2Q20A 3O4LB 5HYSG 5C6TH 5MERA 5C07E 3NZHL 4TUJB 5I1CH 5CS7A 1RK1B 1D5IL 1EV2E 3BQUC 3NPZB 4FFVD 1WBYA 1IKFH 1DSFH 3C5JA 4XCCH 4UDTB 4ONHA 4FQPA 2OM5A 1GZQB 1DBKH 2XRAH 1UWEL 4LCWE 1A1MA 5DO2C 5KOVC 5ELIA 1F90H 1WT5A 1FSKC 1EXUA 2BVPA 2WIIB 1CLZL 1R3JA 1RURH 1PLGH 3Q1SL 1N7ML 1SY6L 3N9GH 3GMPA 1NBVH 4GQPH 3HMXA 5E2VL 3WS6C 2RAMA 4MNHB 1N6QH 5EOCL 2PO6C 3FO0H 3IDIB 3PP4L 1CFQB 2FSEA 1Q0YL 2ADJA 4JDVA 3PJSA 4ZO6A 3QDGB 4UNVA 4YO0A 3TVMA 4LVHB 3ECBA 1K3IA 3PNWA 4PJ9C 5HHOA 2VL5A 3HI6L 1KN2L 4NN6B 2NXZB 3LQZB 4RCAA 3A6CL 3DI2B 1FJ1B 2HKFH 1EO7A 3WSQH 3HR5A 3MLWH 4YGAB 2F5AL 4R26H 2IFFL 3HCVA 3MRIA 4QRSA 5DUML 4GMTH 3VXUB 5DQJB 2E7LC 4LPWA 5IB1B 2X05A 4GBXC 4CVXA 4HLZH 4FFZL 1RZIA 1NJ9A 1INEH 5TDOB 1QFOA 5ID1B 2F54E 1A5FH 3H3BC 4H8WL 3AREC 2EXWD 4LF3B 3L3OB 3GHBL 1MHHA 2V9RA 5JUEL 1K4DB 2MHAB 4P5TD 2VDNH 3TPKA 3BPNC 1JV5A 3UYPA 3V52H 2ZCKL 3CDGA 4WI4A 3QXDA 1VFBA 2IANB 4NZRH 5FYKU 2HYMA 3H7BB 3OJDA 4DZ8B 1DUZA 5LGJA 2AABL 3BP6B 1MCDA 2ZOKA 1QO3B 1HZHH 1QBAA 4X6EA 1EBPA 3QCUH 1UFUA 2XKSA 4WHDA 4DZBA 1RZFH 2VTFA 3VG0L 4U6VH 1XCQB 5K9OA 1NCDL 1EJ6A 1CBVL 1YMHB 4ODXA 3EJYC 4LSSH 1I9IH 4PJXB 1KPRB 4XMPH 3W0WE 1CGTA 1JYVA 1UM5L 2XN9D 4E9LA 3B3IB 1A3QA 4CU7A 2ZUSA 3QI9D 3ET9F 4Y19B 2PW1A 4NDMB 1F13A 1CN4A 1NGYA 2YUZA 1A6PA 1YJDC 2X4RB 3MRJA 1FFQA 2YPLA 5E6IA 5T33L 3I02A 5DJ6B 1HHHA 3WNMA 4HC1H 3PDOB 2P8LA 4L3EE 4KI5E 4XPTL 2YXMA 1YNKH 4WI9A 1BZ9B 3MOAH 4OQTA 1KUMA 4XP4H 4XC1H 4Y4KB 1ZGLM 4KH2A 4OZIF 3FZUD 4IMLB 2Q7YB 2BVOA 1DQQB 5LGHH 1YECH 3DX6B 1NLBL 3VH8G 2OSLB 4JPIA 5IW6A 1DBMH 1CF8L 1CGXA 4TPRH 3ARVA 1IE5A 1RZJL 2YKLH 2HP4A 2DQTL 3I84A 2ADIB 4R3SB 5EPMA 5BV7C 5IB5B 3WHE1 3MGTB 1HWGB 1N8ZA 1K6QL 5GSRA 1ITCA 4XNQB 1QA9A 4UQ3A 2A6DA 1LP9B 1HQ4A 1FG2A 5CJOH 2WANA 4TTDD 3VXRB 5L2JB 2GHWB 1GGBH 3RWGA 2XICA 4K94C 4NQCB 1KCRL 2E8YA 1KTRL 3N0PB 1LDSA 3LZFH 1OT1A 5JA8B 5JA9A 1PYWA 1CWVA 1KJ3L 2AXGB 2W59A 4Y4HC 5IVXF 1ZA6B 3EYOB 1PKQE 5HJ3A 3BN3B 1RJCA 4PS4L 4AMKL 2ERJB 3AS1A 2HJKB 3EBAA 3EFFB 3FFCE 1MFAL 3J8F7 4JDTL 1ZT1B 5DJ8A 3VXTA 4KROD 4ZS7H 3NIFF 3VWKA 4GAJH 3G08B 2DJUA 43CAA 3OXRB 2EE2A 4M7ZC 2GUOA 3GJFB 2XI9A 4PTUA 5F1NA 5C7XH 1P9MC 3RHWK 4U1JB 4MJ6B 3FRPG 4PJ8D 4A2LA 4YEFA 1WICA 4G6ML 4PP2B 4NNPH 1FPTL 4IIQC 5CJ8A 2A9ML 2AK4B 4QOKE 3ZKQD 4PGCA 5F7FA 1OM3H 2RIKA 4I0PA 5ISZA 4OFIA 3MRRB 1FSKB 2F53E 2AJZA 1A21A 3NGBB 2FEEI 4UV4H 1KLGB 2IC2A 3HUJE 2PO6A 5T1LA 4RAUB 3Q3GB 3MLTA 4U6YA 1U8OB 4AIXA 3JWDL 5DD1L 4X7SH 3PABB 4X5WA 3X13A 4PJ7F 1EAPB 1XGUB 4CVZA 5DVNA 3ALWA 3NIDF 4ALAL 4PJ9B 3BSZH 1T4KA 2VDRL 1N3NA 1F2QA 5C0CA 6CGTA 3LKRA 4CDHA 5MEOB 1Q8MA 1Q72L 4PRAA 2E7HA 5ESAA 4WRLA 4I4WA 1HEZB 4DN3H 2I9TA 2E7LA 1QLFB 1D6EB 4XX1G 1DVFD 4KI5C 1FFOA 1L9NA 4YDJB 3VFOB 5SWSE 3D85B 3MO1B 1AXIB 2DDQL 3RY6A 2WLZA 4F7EA 3VFNB 2MCPH 4GBXB 1SJHB 4AIZB 1A6WL 1JI2A 4QRUB 1Q94A 5DD5H 4AH2B 4AEIL 3AREB 5FGRA 1BOYA 1VPOL 2AJYL 1AIFB 3PDDA 1EZVY 1WZLA 3HNSL 3K8KA 1NCTA 4KK9D 1DEDA 4G7VL 1T5XB 3OR6A 2YRZA 1M71B 5GS1C 1XIWC 3TH4T 2OMNA 1BM3H 3CMOL 15C8L 4X7CC 1KTDA 4FG6C 5J12C 5FDWA 4JFOA 3N85H 1NEZG 5DHVB 5E94B 3T1FB 1KN4H 1P5UA 2IAMC 2Y36H 1BREA 1OF2A 3CZFA 4DKFH 4M7JL 1LEIA 1CIUA 4GH7B 5C08E 3D0VA 2IADB 2FX9H 3G5VA 3BKYH 3QUYC 1X5GA 2W9EH 3LKQA 4LAJH 1VESA 3LS5H 3PV6A 4UOW1 1FBIH 1MIML 5A2JH 1A2YB 2V7NB 2R56L 3UTTD 3U9PL 2V2XA 4B53A 2EH7H 5HYSB 1N64H 4LARL 4NQDE 1Z9SA 1K2DA 2NY0B 4WI2A 2ITDB 5BS0B 4NRXA 2EDEA 3W11D 3FAXA 4HKBB 5CJXC 4UUJA 1Y0LA 1WFNA 5HDLA 4NQEB 1RIUH 3GMOA 3HE7C 1HI6B 5IF0B 3EO0B 3T0ED 4CVWA 1DUYB 1JYWA 4POUB 5C0AA 4LCWA 5LJYH 3LN4A 2XQBL 4M5ZL 5MHSE 4JDZB 4ODUA 3B9EA 5CAYB 2B4CL 2CH8A 4PRNB 4XCYB 2VAJA 3QNXA 5BV7B 3JVGC 1NFKA 5IQ7L 2DIAA 5IB4A 2LVEA 1YN7B 1RJYB 3KWWB 1DCLA 2PXYC 4FP8L 2GQHA 1JMZA 4ZUWB 2XA3A 1AY1H 5IIEB 1B4JL 4Z0BL 4P4KB 1KPUB 3VGHA 1MRFL 2VLKD 4Y4HA 4HDIA 4Z77B 4QNPF 1FYTD 3DV6B 1INQB 1U8LB 4B50A 4OKVB 5CMAB 3WFEH 3C08H 3STZB 4ZFFA 5LQBH 3WUWG 3O41B 1FRGH 1VB9A 2OTPA 4PLNC 3FFDA 3OF6D 4U1SA 2Q7NA 2VUOA 1MCEA 2F54A 2V9TA 4HQQH 4WU5B 3TPUB 2YXFA 4IJ3B 1YNLL 1ZVSA 3MA9L 1P9MA 2V17L 1GIGH 3MV9D 3PWNA 4J3VA 2B1HH 5DMGD 1AXTL 2A6JA 4OD1H 1B0GB 2X4TA 4L8SB 1EA9C 2D31B 4NC2B 1ORQA 3OL2A 4JZNB 1W2KT 3HC3H 4L4VB 5EUOE 5HVWA 1FNGA 1JHLL 4OCSH 1K85A 3MBXH 1X6NA 4LCCC 3W2DH 1JPFA 2PETA 2FX7H 3G6DH 5FK9B 1ZK9A 4M7KH 1CZ8L 4PRID 2EYRA 5C6PB 3W0WA 3V5DB 1YEGL 2VZTA 2HG5B 4M3JA 5F1KC 4JFHD 1DN0B 3QRGL 4RMUA 1FORL 1U2CA 5CSBA 5DJYA 2R29L 4HKXA 7FABH 3TGXA 1M6OB 2KH2B 4NJ9H 1M7IB 2R0WH 1QRKA 3DX9B 2WINB 3DSFH 3ZSTA 3G5YA 5D8JH 3DO7A 1TTFA 4L3EA 1YY8B 4EI6A 4EUPB 3TLRA 3GIZL 2G75B 4U6XB 1JF1B 3VWJC 2AJUL 4Z6AT 1FL5B 1G84A 1RIVH 4GRWH 2OR9L 2OR7A 4FQ2H 4KHTH 5EN2B 1UH2A 1SQ2N 2LE9A 4P48A 4KTEH 3VH8B 4U1NB 1MH5B 4HCRH 4GQ9L 4QXTB 5EC1B 4EBQL 2P43B 2AI0L 5KSAD 2ESVA 4OZHF 1ADQL 4YZFF 4KHXL 4Z7UE 5T3XE 5MEPB 1NCWL 3HI1A 5FCUL 4JAMB 1IGMH 1IGFL 3VGGA 3B4NA 5I1IH 4GRLB 1GSMA 4TSCH 2Y06H 3EFDL 3K80A 4NJAL 5I1GH 5IMOB 2HN7B 2P24A 4HKZA 3WO3B 4YBLC 3CK0L 5J12B 3T0DA 1OGAB 5GRUH 5E1AA 4I2XB 4OLYH 3IGAB 3ULSA 5J6GA 3FRUB 1MHPH 3JV4A 2XV6B 4FMKA 5IM7A 3K4DA 4JB9H 3VRIA 1MPAH 1I1AC 3PWLA 1LVEA 1MCWM 5D7JD 4MNQB 4H1LA 1PKQA 3W39A 4L5FH 3CUPA 4XNYL 4P2RA 1T22B 3RVUD 1QFUH 3IU3B 1WCBB 3FFCA 3RX8A 4YQXH 1NUGA 3KPQB 2R2HB 3HZVB 1F11B 5F9AC 1JPST 1X5JA 5C3LD 4JZOA 2H2SC 4RGND 2ILLA 1I1CA 4P23C 4MWFA 3MLUH 3UJIH 3LIZL 4N9GB 4NZUH 3UTZB 4LSQL 2PCPA 3HR6A 5CJXA 3VFPB 5ADOH 5D1QB 3HE7A 3L9RB 3O2DA 1J0ZA 3I2CL 2UWEE 2ZUXA 1XF4A 1P2CA 1BVLB 1NFDE 2FO4A 4QOKA 1F8TH 1F02I 1DR9A 5SWZD 4JRYB 2N1KA 4EDXA 2DYPD 4ZSOA 2F53A 5LWYL 4I1NB 1JFQH 1KCUH 1X4XA 4OSUH 3QSKB 4ODWB 3WE6B 2CLZB 3D3VD 2PXYA 1S7XA 4PJEB 2JB6A 4MJ5B 2NY1D 5CEZE 4ETYA 4DVBB 4E42A 2ED7A 1FN4B 1HWHB 2AJSH 5LXGH 1BEYL 1AD9B 5D1ZA 4MXQD 4UB0H 4BSWB 5C9JB 4LPXA 5FDYA 4NZJA 3HZYA 2HKHH 5KW9H 1FE8H 4ZODA 3C8HA 4LASH 3OAUL 3UZEA 1JGDB 4E5XA 3V6FB 4WTWA 2UVFA 1MUJA 2BMKA 4KWUA 2Z91A 3PWPB 5F96L 1KCVL 3B2VH 1KPVB 4U6HA 1BHGA 1QSFD 5HPMA 3W9EB 5SWSA 1IAIH 4JFQB 1F45A 1G7HB 4BH7B 4YNYA 1WC7A 4EXKA 2VWEC 5AYUH 4JKPL 3QZWG 2YK1L 5DI8A 4UTBH 3BEWA 3U36B 4HAFA 5T1KD 2BNUA 4BK4A 1N26A 3S35H 4JO2H 5KSUA 3P4OB 3MV8D 2ZCHL 2A1WH 4X6CE 1NEZB 1YA5A 3KPMA 4MXWL 1AH1A 1NAKH 1UH4A 1RUKL 4I5BB 4R4FL 4LCCA 4EN3B 4PY8I 4OLXL 4NRYB 3FKUS 4FS0A 3TA3C 1G9ML 5M95B 1MJUL 5DJAA 3PXJA 1CL7L 1FNLA 1MELA 1ONQA 3QEGH 4MZ2A 4WV1C 2DQHL 1A9EA 5C08A 1BQLH 2X9YA 4LU5H 1E6OL 4N90E 3GI9L 2Y07L 5DUBA 3HE6C 3FN3A 4MDIA 3OHXB 4GKZA 4YE4H 3DV4B 4L8DB 3SDXE 1A1NA 1HQRB 5CZVH 1OD9A 2BCKB 5JXEA 4IRSD 1VKXB 5I1AB 3BGFC 3GFUA 4PRPE 2QL1A 4W68A 4P49A 2XTJE 4YC2C 1X9QA 3WNOA 1BWWA 3VXNB 2PW2A 5L2KB 4X4ZA 2BSSB 2CDFA 1Q9WB 2BSTA 2A77L 5DJDA 3VWJA 2R9HD 2LTQC 2A74B 4NQDA 5EO0A 2A6IA 1KB5L 2VRAA 3GSXA 3FJTA 1V7NH 1UKTA 4C56E 2APTA 4HUKB 1LP9F 4P46D 1ERNA 3FB5B 2VLLA 5DUPH 2D7TH 4XCNB 5C0FA 1OSZB 3UC0H 5E08L 1FH5L 2VDLL 4U0QB 2Q6WA 1T3FA 4ZNCD 4F8QA 3CH1B 4XGZA 5FYJE 4OLUH 3M17B 1IBGL 1NSNL 4RWYH 1ZGLP 3TBVA 2ITCA 4JM2D 3EO9L 4HUXB 2NLJA 4GW4B 1DQJB 2BSRB 1MQKH 3OZ9H 2R2EB 4KQ3L 5FO7B 3HHRB 5EU5A 1OB1B 2GAZB 5IHLB 2WSKA 4LMQI 3UXFA 5T1MB 3SOBH 5FECB 4H25B 2E6PA 5DLML 1B9ZA 5EIIB 1PZ5B 5EDXA 1U3HC 1PW3A 4FXGB 5DA0B 3IFLL 1MVUA 1I1AA 3MYJB 3VGBA 1L4IA 4TVPL 1KFAH 1QBBA 2YC1A 4WWKC 1I7RA 4KUZH 3AU1A 3WLBA 2P8PA 1FNSL 1WEJL 3HAEG 4Z7VB 4C55A 3DXAD 1OAKL 1C08B 5JO5A 1C16B 4BFIB 1GVIA 2FIRT 4FNLL 4QCIA 1H3XA 4IS6A 3GKWH 4HZLB 5D7IE 2DLFL 2X42A 3MUGA 4DGYH 2DQIL 4P23B 3O3AA 1C7TA 4NM8L 4KVCH 3BP5B 3D39E 3HB3C 1EO5A 4XP5L 2X7LA 4MD0B 3UYOD 3NZ8A 5BVPL 1A6UH 3QULB 4N0FB 3H9SE 3BEVB 3LRSB 3QHFH 3SCMA 4HCRA 1CFNB 5EUOA 1RQ5A 4UIMB 3WJLA 4F7CB 2DQFA 5DR5L 3L3IA 1CK0L 2LVCA 3L3GB 3C8KB 3KDMA 2ZOLA 4LVNC 2BNQB 1OPGH 3LH2L 1RJZB 2FJGA 3HNTH 4WY7H 1KXQE 4XNZB 4DVRL 2QHRL 4EOWL 2HRLA 4PREA 4M5YL 1QRNE 1JZ3A 4HGKC 3TBTA 4WFFE 3RVTD 1JZ6A 2EDNA 1A6ZB 1KJVB 3TN0D 1HXMB 1VGKB 4FTVE 3KLAA 4LRNH 1CU4L 2I9LB 2Y1VA 1DN2A 3SE8H 5TE6H 5TPWL 4U49A 2VN4A 1U8MA 2XTJC 4PJHB 2ZUQC 12E8H 3TNMB 2JF1A 4K8RH 3GSOA 1OTSD 4CRPA 2FECI 3QDJD 1ZLVK 5B3NA 1YEIH 4HH8A 5D7LD 1H3VA 3GMNB 3L3KA 1IL1B 2EE6A 1S78C 1S9YA 1Z0MA 1JGUH 3GZKA 4Y8AA 2UV3A 3FMGL 2A83A 1ZS8A 1GL4B 1K5NB 1FZMA 2QJDA 4O5LH 3MRKB 5GJSH 4YUEL 1CGWA 5BVJB 4WEBL 3H0TB 3P4NA 3I75A 3VFWB 1KELL 1NCBL 4Z7UA 3DX8B 2EIZA 4TULH 3ZYZA 4EDWL 2X1OA 1VFAB 2ENYA 4NUGH 2AQ2A 1G6RB 4ZFGL 1RK0B 3BMVA 3DTXA 4RX4D 2A9NH 2YA2A 3LQAL 4LSPL 4ZD3L 2W1NA 3TA3A 5E2WH 1C7SA 2J6EH 4KMQA 3CVHA 3L7FA 4RA0C 5IQ9B 3TP4A 5K9KB 1P7QA 3ZHLA 3ZZ1A 3C6LD 1DBAL 3QQ4A 2EH8L 3FQNB 3REWB 1YEDA 5A1AA 3C60C 1LO5A 3G6AB 2ICEB 3QWRD 1QR1B 1BQHG 1V3JA 5HHME 2BXYA 5HHPA 3HE6A 5C6TL 2G9HA 4U3XA 4U1KA 3A6OA 1FL3A 4B7IA 3SJVB 5KBNC 3BO8A 1KT2A 1IKFL 1A1OA 1DSFL 3SKJH 1AQDA 1HNFA 1XZ0B 4XCCL 1L7TH 4LSUH 4MZ3A 1DBKL 2XKNA 4QY8A 4V1DD 2GY5A 5F21B 3BGFB 3MACH 4JQVA 2VC2H 1IGIL 4UAOC 4YC2B 5FYLH 1RURL 1PLGL 3N9GL 3PWUB 5D9SB 1VEMA 1X5ZA 2H1PL 4HFUL 5ILTH 4E0RA 3FT4B 2WW8A 1Q1JH 1N6QL 1XCTB 4NCDA 3LV3A 5HBBA 4AEHL 3LKOA 3PQYA 2NY3C 2ZSWB 4PV9B 4UDUA 1G9NC 3F58H 3GJFH 3QHZL 4PBXA 3V7AE 2UWEA 1NFDA 3GSRA 1CL7I 1AXSB 3L95B 1G7LB 1NBZA 4LLQB 3ZKND 1OQXA 4RNRB 4X9GA 1P7KB 4JFDB 4R26L 5SX5K 2EDTA 4S1DC 3BWAA 3MRBB 1HHKB 1LILA 3ARGA 4PRHB 3MJ9H 4HXBL 1IQWH 1CI5A 3T4AA 4X9BA 3F12A 1U3HA 4GAGH 4QF1A 1NGZB 2BC4A 2CRZA 3C9NB 4L29A 5E5UB 1KBGH 5EU3B 3X11B 1INEL 1MAKA 4TNWF 1AGDA 1A5FL 4F33B 3MLXH 3UBXA 3QQ9D 5C0ND 4R7DA 3RAJH 3OB8A 4OZ4A 2GFBA 4HK3N 1WK0A 1ZWIB 5KTEH 1GC1L 3V52L 3VG9B 3MR9B 3G9AB 4WWKB 3H9HB 1NDGA 3MRCA 5DRWA 3FOLB 1OVZA 3FQRA 4LSRH 5HI5D 1T04A 1XF2B 3MJ8B 1HZHL 5HGDA 5JR1H 3T4YB 3U9UB 1HE7A 3QZWB 2VXSH 5T3ZE 2VQTA 4U6VL 2OI9B 3TO4C 5AAMA 4S1RL 3ESUF 1ITBB 5FGBC 2IWGA 1I9IL 4LSSL 1X5XA 1E4XH 4JG0L 3OR7A 5MEND 2O61B 1CQKA 1S7UB 1BJMA 3G5XA 5BZWA 5BRZB 1I8IB 1TVHA 2J88L 4YX2H 1NUNB 3O4LA 3SO3B 1PEZA 1QLEH 4RSVA 5DQ9B 4HAGA 4YDLC 1TZGL 2P5WB 4MGXA 3SDDC 3TCXA 5K59E 4JFEE 4OF0A 4NO5B 1A6TA 3E2HC 1RUPH 4HC1L 1EBAA 4IMKC 5FOBA 1OLZA 1UJTA 2EXWC 5CEXB 5E7FA 2FBJL 1E28B 2RCSH 4IRJD 3ZE0E 4QT5B 1ACZA 4FA8A 3OKMA 5DHVH 1OP3H 4KI5F 1E6JH 5FUZL 4WI8A 5ENWB 4NNYA 1YZZA 4JM4H 1HH9B 5C71A 2GCYB 4W4OC 3SDXA 1ES0B 1DJSA 4ETQA 1N0LA 3B9AA 4KK5D 1WBXA 2BHZA 3O6ML 4QXGH 1MRCL 3C09B 1IGYB 4RGMC 4PRPA 4X5XA 5GQBA 1DBML 1PAMA 1FNFA 3DUSB 3LPGA 2YZ1A 3AMLA 5J13C 1OAUH 3IRZA 3KXFD 3PL6C 1YEHH 3NBNA 4ZOAA 3FAWA 5I66B 4JY5H 2OL3H 4NCC1 4C56A 1RJLB 3OQ3B 1W8NA 1LMKA 2IMMA 4NKQB 4R2GB 4K55A 3UPCA 5M94B 4ZPTB 3OAZH 4QXWA 3EZ8A 4NBYB 5CJOL 3QI9C 4M93C 3RGVD 5C8JB 4P3DA 1GGBL 1EEZB 4OCMC 3DVGA 3KR3H 3BESR 4GMSH 4NWUH 3V0VB 4HIEB 5H35B 3VXUA 3LZFL 3IAQA 4P2OD 5HYQA 1ZHNB 4KQ4H 2FWOA 3BKJL 3IDJA 4YLQT 1BX2B 3QNYB 5ID1A 1F6AB 3IDUA 3LEVH 4ZFOL 1VADB 2AJXL 4IOIB 1KIQA 3FT2B 4FN0A 3NFSL 4EI5B 4KKCD 1CCZA 1NANH 3V6ZB 2IALA 3WS3B 4FQHA 5EBMB 2IANA 3IJHA 1IAOA 2W0KA 5BV7H 1FIGL 3AXLB 3GO1L 2YD2A 4DZ8A 5FA3B 1JWMB 4OV6F 4WUUB 3DARA 5MEQA 4L8BB 2ZJSH 3HAEB 3LVEA 4K94H 1QFWH 2Q76B 2D9QB 4LLMA 3QQ3A 4PJXA 4NHUA 1QHOA 2SEBB 2VE6B 1QSEE 3CU7A 1L6XA 4NNPL 5HGGS 3I6LD 4D9QE 5IVNA 3RY4A 5IHBA 3EJJX 1WFUA 2W60B 5D7IA 1WFTA 4P5MA 4GO6B 4PP1D 3IAPA 2X4RA 1HKFA 3TO2B 4QTHB 5DJ6A 3MLZL 4G8GB 2JCCE 4PJEF 3HUJF 3BFOA 1J0KA 3IDMB 1NMBH 1A4JA 3D39A 4X7SL 2ARWA 4WVRA 3EOAB 1JBJA 3H9SA 3UTTE 3BSZL 5ESVB 1I8MB 4OCNC 5K9JH 3CSGA 3BRDA 2B5IB 4KROC 3MJ7A 3V8OA 1I7TB 3MRDA 5IEKA 1SYSA 5JNYB 4FQQA 4MCYA 1EFXD 3FB8B 4AEEA 1QRNA 3MUY1 1A7PH 3P4MA 1GGCL 1EHXA 1XR8A 1IC7H 2NW2A 1K4CA 2ADIA 4PJ8C 3FTGB 4Z78B 3BIAX 3OPZH 3T0EE 4FTVA 5GGSY 2P49B 5A3ID 4LVOC 1RVFL 4XPBH 2AJVH 3GBML 5DD5L 1JF6A 5L2JA 4X7FC 3VW3L 4S1QL 1LO0L 1PG7W 4QGTA 4HX1A 4U1HA 3VXME 3ILQD 5KN5A 1S8DA 1D5XB 3ES6A 3X17A 4PPTA 4WO4D 2GW5A 1XF5A 4YFLI 3QJHB 4YHLH 5E9DD 2OTWB 1FVDB 1BM3L 1ZA6A 4D0DB 4HJGB 4EUPH 4DJMA 1DFBL 4XVSH 3TO4A 3N85L 4ODSL 4H88L 2BFVL 4XAKE 2HT4C 5FGBA 1KN4L 4NN7B 3FO1B 3PHOA 1B0RA 1P4IL 1TNMA 4IOFD 4DKFL 1CDBA 1CICA 3IYLW 4JCLA 4OUOA 3LD8B 4OD2B 1UB6B 4AL8H 3BT2L 3T1WA 2ATPB 3MV7B 2OP4H 3MODH 3OKEA 4QYOA 3BKYL 4R8WL 4XPFH 1PG7H 3QDME 3SDDA 5CD3B 5FM5M 4LBEA 4UTAH 1BECA 3UTSD 4JG1H 4I9WE 3KYOA 3DURB 4GW5B 2QTEA 5C0GB 1UENA 4TOYH 1BQHB 2EH7L 2GSGA 4HIXH 3RIAK 5J11C 1E4JA 3QFDB 1JGEB 3V0WH 3LEXA 1K8DB 3VFUB 3O6FD 2XWBB 2C3XA 1ED3B 3GMLB 4P5TB 1KIUA 4GKNA 1HHJA 4HT1H 3DROA 3WKNA 1T7XA 1RIUL 4UOJA 1A3LL 3ARBB 5TJWK 1UA6H 4F9PA 2G5BA 3PL6A 3FOMB 4F7TA 3F7RA 3QNZA 2DICA 1NLDL 4NN5B 1T0MA 5FGCB 4KJYA 2E7MA 3WHXB 4AK1A 3QUML 1BVKB 5I1EH 1FFPB 3GSWA 4NO2B 1R3KB 1IAIM 2K7QA 2MQ3A 3DBXA 1V7ML 5HHQA 3TZVD 4WHYG 2J2ZA 3TBYB 1I8KB 2I5YH 2XN9B 2J5LC 1NCAL 3OV6A 1AY1L 3QI9B 2XFXB 3BJ91 1A7RH 3ARUA 1JRHH 4ODTH 3VXOB 3CX5J 5MI0C 3T2NH 5JMRA 2IPUK 3GJEB 2EDRA 3RBSA 1IC4H 3RX7A 1Z5LB 2XZAL 4OZGB 3Q5OA 2YEZB 1XGQA 3D0LB 5JHLL 4JPWH 2JIXD 2EE9A 3KJ4C 3WFEL 1KTLA 1CDYA 3E3QE 3JTTA 2X70A 4QRUA 5DMYA 5LQBL 4JFYA 1I85C 5DJ2B 1N0XH 3P9LB 1AP2B 5DRXB 3L3HB 1LK2A 5JDSB 1FP5A 2D7PA 1AHWB 5D1XC 3IJSA 4PJBB 3G6JE 2OQJA 2X4PB 1XGPA 1RIHL 1ZEAL 2CDEB 2VDQL 4RQQA 5JW5A 4W6XB 2KPNA 3T0EC 1AD0A 1H5BC 4MA3B 2Q8BH 4ZG1A 4HQQL 1P69B 2YD8A 3CFIC 4JO3L 3STLB 4LKCB 5GS2D 2E5EA 5DC0A 1TCRB 5DHVA 1GIGL 2G2RA 1HIML 2ZZUT 4X99B 3ALXA 2FIKA 3TBSB 3DMMD 2P7TB 3M1BA 3RU8H 2AJ3B 2B1HL 3FT3A 4OD1L 4RIRB 3O11A 1NQBA 4GAYA 3TYFA 2L7UA 5GZOD 3IXTA 3ZHKA 3BJLA 3MBXL 1XFPA 2C3VA 5EUOF 1YDPA 3CX2A 4WDIB 3W2DL 3HMWH 4ZXBD 5FO8B 2FX7L 4XPHL 2DTML 5GRYA 3NPSB 4M7KL 4I48A 4QHUB 3NCEB 2CUIA 1FNEB 1P7HL 5J9PA 1BJ1J 1HINH 4U1GB 2AV1B 3P9MB 3ULVE 4Y5YB 7FABL 3QUZC 4NJ9L 1SYVB 2ITDA 1FVCA 4ODVL 2R0WL 5D2NB 4NT6B 1IZJA 4JFEA 2DM2A 1ZGLB 8FABB 4NQEA 3EDDA 4P5KB 5IF0A 2A0LD 3GSUB 1WTLA 3JUYA 3ARQA 2DWDB 3S37H 3AROA 1RIVL 4PJ8A 3L3JB 5F8QC 4FQ2L 5I1DB 4X6BA 2FB4L 4PRNA 4S2SB 1K8IB 4G43A 3VFTA 3ZTNH 3MXVH 4KTEL 1A9BB 4Y4FD 4Z0XB 1LO4L 1RUAH 4MB4A 4O51B 4EVNA 4RFEA 1H0DB 2HLFD 3VRLE 4LVOB 3GRWA 5JXAH 3RP1A 3NACH 1JTTA 1X5IA 1KCKA 4ZUSA 5GRWA 3PGFL 5CFHA 3CU1A 2UYLA 2NR6D 3NTCL 4JJHA 1NFIB 4FXKB 3BDYL 3D3VE 4Z7UF 5KSVA 5L8LB 2L4OA 1L0YA 3HZMB 3O9WD 4LPYA 5F6HJ 3WDHA 1W0WA 4HFWB 5I1GL 2OK0H 3RUGE 3ARTA 1JJUA 3VFMB 2PTUA 5GGRY 4WW2C 2UUDH 2ZG3A 3WFHA 3KPNA 3DVNB 4MJ2A 1IEAA 5EOQH 4OLYL 1S7SB 4KZDL 4G7YL 1S7VA 1MHPL 5B22A 4ELME 4MJIE 2BDNH 5IT2L 1MCJA 2A38A 3ZE2E 2QSQA 4JB9L 3INUL 1U58A 1WGOA 1MPAL 4RGOL 3ZDXE 3GSNA 4APQA 5FUOH 2XZQL 3DIFA 4Q6IB 3S5LA 1B6DA 3E3QC 1C5DB 1U8NA 1DVFB 2CO6B 3THMH 4YQXL 1IJ9A 4OKDA 4PJGE 3SY0B 5JDJA 1NAML 1LO3H 4M62H 3NCJL 3MLUL 3QAZC 3UJIL 1J5OH 1MRDL 2H6PB 2MFNA 3QO1B 3RZCD 1YMMD 4K9EC 1B3JA 3DGGB 3TVMD 4CN1A 5C0RL 5I1HH 2R1WA 5IMKB 5ADOL 4O02L 5HHOD 1W72B 1D9KA 4C83B 3QIWA 5IOPB 3DUHA 4AG4H 1QSEA 3BZEA 2CRYA 2HG5A 2UWEF 4OCLC 2VJXA 1G0YR 1NFDF 2YHGA 3KJ6L 2H32A 2C1OA 1HSBB 4YHOH 5GGQH 4G8FA 4LAQH 4U1LB 3OTTA 1M7IA 4PGEB 3TNNB 5L88L 2IF7A 1KCUL 2WINA 4R97B 4OSUL 4QRRE 4KRNA 2JCCA 4HW6A 5D7JC 4UT9H 1V05A 5KS9E 3RVUC 5BJTA 2MSPA 2H8PB 2AJSL 2DD8H 5LXGL 5EN2A 4DQOH 3GIVA 3WFZA 1BLNB 2HKHL 5KW9L 1H9VA 5I8OH 1JE6A 4JKLA 3H8NA 4R7NB 3IRPX 5EC1A 4QXTA 3QEHA 5HD8C 4NO3A 3KJ4B 1SEQL 1UZ8A 3VCLB 3B2VL 2DM4A 3SQOL 1TZHB 1ZLUH 2D7NA 4X7DC 5D1XA 1IAIL 2X4SA 3LMJH 3UTOA 4QWWD 3T0EA 1IT9H 4GRLA 4JPKL 3LKPB 2BOCB 1CFBA 5IMOA 4XVJH 5AYUL 3MFFB 1HXYA 5HDBE 5BMFH 1H5BB 4UTBL 5AZ2H 4OM1H 1JWSB 3VXMA 2R1XA 1FVEA 4JO2L 5F7EH 2CQVA 1IM3A 1FZKA 1H3TA 4OBRA 2YPLD 1J11A 2A1WL 4ZUVB 2C7UA 4M6NH 1OGTA 3PF2A 2IBBA 1D5MB 1NAKL 2FZ3A 2NY1C 4X6CF 3S96B 5IG7B 2IGFH 3BZ4B 2WP3O 4B7LA 1G9EA 3RNKB 2EDYA 3WIFA 3G5ZA 4NKOB 3AB0C 4BSJA 1SBSH 2R2HA 2VLKB 3HZVA 5TF1H 1PQZA 1XEDA 4WFHE 1KJ2L 3JSSA 3QPQD 3QBTB 1FYTB 3BPOB 3QUZA 4HIIA 2FNBA 4N9GA 5HGAB 1SEBA 4YE4L 3SO5A 3QDMA 2Y4SA 1U8HB 2XXMB 5CZVL 2XT1B 4UNUA 1IAKA 5KSBB 1E27A 2GYSA 2ARJQ 2DBLH 1LQSR 2X4OB 3QXAA 4MNGE 4WI3A 1G6RH 5TFSH 3VFVA 2Z4QA 3OKLA 2P4AB 5E8DL 5DJ0B 3MRPA 2YSSA 2X2YA 4WTZG 4O2CA 2OZ4H 4U4BA 5DJCA 1R3HB 5C1MB 3P73A 3T8XA 1WWCA 5DUPL 3MV9B 5J6HA 1KJMB 3MLSL 4XRCB 1M7DB 3WDIA 3PGDB 4L1DA 5IKCB 1J0HA 3ARFC 1UXWB 2H2PD 2EIEA 3O3UN 3OB0H 3QUXB 4TTGA 4PV8A 1FZOB 1P5VA 4L3CB 2AXFB 5FV1L 3S4SG 3OZ9L 1A6VH 2XNAB 2Z31A 1SMAA 3UJTH 4PRIB 1BBJB 2DJ4A 3V6FA 3RA7H 3VWKD 4P4RB 1WF5A 1P4LA 3BGAA 2C1PA 2M2DA 1G0XA 3SOBL 3EYUL 4GFTB 4OIAA 2CUHA 4YXHL 4O2EA 4WW2B 3H6JA 2BVQA 3ZT5A 5D2LB 4NYLB 3D25A 1NGPH 1EVTC 3ZT7A 5EBLA 3HC0A 3L7EB 1EK3A 3FQUA 1A7QH 4NO0D 2R9HC 1KIPB 4JR9H 1TVBB 2JE8A 5DO2D 3NCMA 4LNRA 4F15B 3U36A 1RAMA 4I0PD 5ISZD 1J0IA 3QEQE 2JB5H 1NGXB 4U1MA 2IPKB 1AGCB 1QTYT 5EC2A 1KCLA 5DEZA 3OGOE 2YZ8A 1EGJL 3KYNB 5T1LD 5AYQA 3GKWL 3J7HA 1JPTH 3H3PL 4DGYL 3T3PE 5B8CA 4FFYH 3QAZB 5D7IF 1D5ZB 4PJ5E 4JM2C 3BVNA 5DRNA 3AY4C 5D70H 5F88A 1DLHA 4JJ5B 5KSAB 4BFBD 1S5HB 1KB5B 1S7TB 1Y18B 4YDKL 5ACZA 1A0QH 2DQEH 4PGJA 3S8WA 1RSFA 4NRZB 1BD2B 5C0CD 4CBPA 1A6UL 1LEKB 1YC8A 4Y8DC 35C8H 4D8PA 2HLAB 4W6WB 3L5WB 3UP1A 4PJFE 4G6AC 5E8NB 1J8HE 3NZHH 5ACLA 3HNVH 1D5IH 1OPGL 4WY7L 5I1AA 4J8RA 5D7JA 3RIFF 1S7WA 2VOTA 5CWSB 4KK8D 4WTXA 4KKBD 2X4UA 2ARJA 4UT6L 1AGFB 3I50L 4WW1B 3Q1SH 1WWAX 1B6UA 1IKNC 1N7MH 1G1YA 4FQ1L 3ZT6A 3HPJB 5CSGA 3PHQB 3EO1B 1IFHH 5EOCH 3SE8L 3IFOB 3RDTA 5JORA 1Q0YH 5CZKA 2VLJB 1BBDL 4RGNB 2XYCA 1FO0B 3S3JA 1G7MB 3X12B 4PTTB 4ENEC 1YEIL 1UVQB 3I6KA 2Z92B 1BQUA 1AO7E 5FB8A 5INCB 5ID0B 2QR0B 4HWBH 4YHIA 2HMID 5E00B 1GXEA 3JTSB 2MTPA 2FL5B 4O5LL 5T1MA 5DUMH 5GJSL 1VGEH 4XZUA 4NQSA 3EYVA 4H25A 4LLWA 5LGKA 2FLBT 1A6AB 1QFWM 5SWZB 4TULL 2DYPB 1Z9MA 4MA7L 4XBEL 5H2BB 1Q9LA 3RWIA 4QRPE 3RVTC 3QJFA 1I8LC 3WUWA 4M43L 3RUGA 1TENA 5E2WL 5JUEH 2J6EL 2PYEB 5IVOA 4H5SB 4L1HA 5I75C 2ZCKH 4P2YA 3REVB 1X5FA 3MOQA 1FHGA 5FM5O 4H20L 1C16A 4ELMA 4MJIA 3QIUA 3BW9A 3AB0B 5LBSH 2AABH 3DX7B 1IAII 3IDGA 3QH3A 4OCXL 3IETB 3SKJL 1I3UA 1QFHA 4OV5A 5GGUA 5C0AD 4LCWD 1L7TL 4LSUL 5FYJH 1T21B 1IAMA 4DAGL 1QSFB 4D0CA 4PJGA 3W5NA 1MCKA 3MRLB 1DLFH 3QG7H 4MD0A 5EU7C 1UM5H 1MWAA 4NKDB 5FYLL 1GZPA 1TZIB 3GMRA 1R5IB 4F7CA 2EO9A 3P0YL 3L3GA 5MENE 3MGOB 5T1KB 3UO1H 3BX7C 3ARFA 3MV8B 4Y4HD 5DHYA 1OQOA 5F1OB 3KPOB 3HAEH 5F9WC 2DL9A 4XPTH 3X3GL 5C0DA 2NY2B 2DQCH 3RL2B 3KPLA 1XGRB 5T5NF 3JV5A 3O81A 4J3UA 3AS3A 4DWHA 2WBWB 2NZ9D 1Q0XL 1C12B 2VLRB 4QRRA 4O4YH 3MJ9L 3ZKSD 3LDBB 2CLRA 1IVLA 3X3FL 3TNMA 3MGAA 1CF8H 1P6AB 4H8WC 2F54D 1QQDA 1MREL 1KBGL 5EZJA 5EOTA 5E8EB 2V2TA 2IBZX 5I18L 4WI6A 3U46B 2O61A 4MSWA 3MLXL 3T2OA 1K6QH 4IRSB 3RAJL 3KXFE 2CJUL 2IQAA 3NCYP 4YDVA 1I9EA 2B39A 1KCRH 3HG1E 4Q0XL 4NP4L 4LSRL 1OHQA 4KY1L 4P46B 4LQ1A 4XTRD 5JR1L 5I9QC 1N2RB 2V5TA 4R4BA 3U0TA 4YHKH 1WTGT 2JJSC 4PS4H 4AMKH 4QGYA 2QQQA 2YRPA 1IGTB 2Y9RT 1CFTA 2WBJA 4X6DE 4JVPA 3ZKNC 1AKJA 2X44D 1E4XL 5F7HA 3CXHK 2YRLA 4OZFA 4PLOB 4XHJD 1TPXB 1L0XA 3EYSL 1R6VA 2EO1A 1JNHB 4XC3L 3AM8A 1QLEL 2GITA 4ACPA 5GGVH 4RMRA 3SJVA 4L3ED 2N56A 1RFDH 2A73A 5IW1B 1JHTB 4HBQA 1DBBL 4KI5D 4CGTA 4LLUA 1RUPL 5K59F 4XWOC 1EO8L 3KPRD 1TQCB 5C0NC 4G6MH 3WN5C 1G0DA 1MFEL 1FPTH 3ZE0F 4MD5B 3CFDA 1T7WA 1IKNA 2X1XR 1UT9A 3VJ6A 1TLKA 3I6LE 5HI5C 2YMXL 1GPOL 4HUVA 2ESVD 4JVWA 3DXAB 4Z7QE 4MNGA 5K33A 5I30L 4Y1AB 3JWDH 3F7VB 3CFJB 1JWUB 5DD1H 3WL9A 2VZ1A 3PIQA 5CIPB 5I19L 1YEHL 1P84K 5J89A 3RWEB 1YJDL 3BH9B 1G7LA 1W0VA 4JY5L 2OL3L 5J4MA 4QHMA 4ALAH 4MQSB 2RHEA 2VKXA 2VDRH 2ZSVB 3MREA 3TFKC 3VXSE 3RWFB 2VITB 1U8IB 1Q72H 5CSZA 1U8PB 4NWUL 4PRHA 4CUCA 1NDMB 5HY9B 3ELAT 3S4SB 1M05B 3GBLA 1A7BA 1KENH 4G3YH 1O0VA 2E9IA 4P2RD 4M61B 4LLYA 4OCWL 5F70A 3X11A 2DDQH 4PRBA 5HVHC 4E41E 3FFCD 3U48A 1I8LA 3EZJB 3V6OE 3B9DA 4Z5RA 2CK0L 3K1KC 4K3EH 1KNOB 4R6UA 3OKDB 3BZFA 4L8CB 4HGWA 4JY6A 3MR9A 1A22B 4PG2C 2AJYH 3TN0B 3B6SA 1I4FB 4JFXA 5BV7L 1UKQA 1EX0A 4KK5C 2JJWA 4G7VH 1EVUA 1T0PB 3HE7D 3IF1B 4JANA 2ZJSL 2W9LA 4PBVC 2D7MA 4K94L 3RGHA 1LE9B 1QFWL 2IQ9L 5E9DE 5FCSH 5GGTA 4UQ2A 4JFFE 1TTUA 4K2UL 4QOKD 1SY6A 3QDJB 3IVKA 4YXLH 1QSVA 2B8OT 5D7LB 2GSIA 3QEQA 4TSBH 4I0CC 2X10A 4HUWA 2F53D 5DJZB 1MSPA 1I8IA 5ESQA 4JFPB 2FJHA 1KYOJ 3V95A 5ICYB 2IEPA 3SKNB 2WP3T 2JLLA 4P2OC 3ULUE 1T6VN 2Z93A 5J06A 3SDAC 2PXYD 3CPLB 2F19H 4PJ5A 5I17B 4LDOB 3RL1A 3LPWA 5DYOB 5JHDE 2N4IA 2VERN 5CP7B 5EZIL 3LRHA 2R56H 3E1F1 2JCCF 4ODHH 4LSTH 1NMBL 1IEHA 1G7JA 1QVOA 5D1ZD 5D6CA 3U9PH 3TCLB 2FH8A 1JNLL 4KKCC 2BY3A 2I60H 5T5FH 4MCZA 2BHUA 5B39G 3WEXB 3TJEL 5K9JL 5SV4A 4PJFA 3TBWB 1J8HA 2EYSA 1IM9A 2ICWB 4P99A 1ES0A 2Q86A 1BZ7A 3LN5A 5SWQB 5CLTA 1A4KB 1FAKT 4JLRB 1JTOA 1UCTA 3C6LB 4U33A 5SWSD 4ISVA 1HK6A 3I85A 5EWIL 1A7PL 3E6HB 4ZFOB 2R69H 4FMFA 1IC7L 5DHXB 3P2TA 3STBA 2NY4C 3IAGC 4PY7A 3OPZL 5I66A 2P1YA 3GJFK 1EPFA 2IFGA 3DECA 2B4CH 3WIHH 3ZTJG 1MCFA 4XPBL 2AJVL 5HXMA 3CCHA 1S9KC 2PTVA 3KS0H 3EGSB 4V1DB 2VZ3A 3DOSA 5EU6E 4F58H 1RMFH 4HIEA 4PP1C 5IW3A 3WNLA 3MBEC 4FP8H 2VISB 5F8RC 1ZHNA 1ZA3B 4NNXA 1B4JH 4Z0BH 4A6YA 3RPIA 5C0IB 3RNQA 4YHLL 1T66D 3BUYA 4HV8A 1AO7A 4FQCH 4GW1A 1VADA 4N1EA 2JJSA 3JWNC 4RZCB 3C2SA 5I9QB 5AEAA 2DWEB 3V6ZA 4I77L 5C08D 4MA8H 1T7VA 3NFPA 4LKXA 1BIIA 4JRXD 3U7YL 4W6YB 4GUPA 4LMQE 4AL8L 3SKMB 5ICZA 4F2MB 5FM8A 3MODL 1OTUC 1A8JH 1VACB 5JXED 4J2XA 1U91A 3KPPB 4L8BA 4QRPA 2P8MA 3HAEA 5FUCE 4UTAL 3GGWA 4F7PB 1YNLH 2Q76A 5F7KC 4R9HA 3MA9H 2V17H 4NQDD 4RBPH 5ITFB 1UZ6E 2SEBA 2VE6A 5H94B 5I76B 2Q8AH 2HFTA 4H26A 1OSPL 4OD3L 3DRQB 2W60A 3ILQC 4Y5XA 5D6DC 1RHHB 4P59L 3M8OH 1H3PH 1J1XL 3V7MA 1MHEB 3O45B 4S1SH 5I16A 3BPLB 3X14A 3NH7L 1ZT7B 5MHSD 1CZ8H 1UXSA 5CGYC 2EICA 4CKVX 2GEEA 2NX5E 5I1KH 4N8VG 5CBAA 1NL0H 1E4XI 1CDHA 2KQNA 2Y23A 4LSDA 5DEFB 3JV6A 4JN1H 3QO0B 3GI8L 1I8MA 2KDGA 3QRGH 1CLOL 3QFJD 3K46A 4IOFC 1FORH 3PWJA 4L4TE 4PGDB 5I1EL 2ATKB 3T0BA 3WHE0 5MENA 3LKSA 1OP3K 3ULUC 1CXFA 5F9DC 1CDGA 1BFVL 2X1PA 2PTTA 3FB8A 5TQ0L 2VABB 1I1AD 3RWDB 1CXIA 2YPKB 4ODTL 3R1GL 3BXNB 5BXFB 3GIZH 5JPMB 2ZNXA 1W72H 3T2NL 2AJUH 3FTGA 2IH3B 4BQCA 4JN2B 2VDKH 3MNZB 1UWGH 4JPWL 4HIHB 5JQ6H 2AXJA 3O2DL 5C92A 4OTXH 4M00A 5GHWH 3O6FC 5HVHB 4IRJB 1J1PH 1QYGL 1N0XL 1OP9A 3QCVL 4OZIB 1AC0A 5F9OL 5LG1A 3IFPA 3OAZK 5EIVA 1VDGA 1A7NH 4HS3B 1ADQH 4NFBA 3TC9A 4Y89A 3V5KB 5I71B 2BVYA 1IGFH 4YGVB 3G6JF 4M8QA 3U1SL 3TIEB 3EFDH 3KHQA 4NJAH 4QTIH 1JZ7A 1S9WB 3DVIA 3K8LA 5DD6A 4NKMB 2BNRE 1L9MA 1T20A 2R1YA 3EKCA 2MQ0A 3RU8L 4G6JH 3SCMD 3HG1A 4TUOA 5ALCH 4C4KT 5JOFB 3QUKB 3U4BL 1CDCA 3WFBH 3RGVB 3SDAA 5CD3A 1BFOA 4OGZA 4CMHC 5IVXB 4X80L 1C1EH 5J57B 4XNYH 1ZVYA 3FQXB 4QRTA 1KXVC 4P2OB 4X6DA 2X40A 1MCSA 4Z8FL 2I07A 5E5MA 1NANI 2AK1H 3DURA 3QUMB 3HI5H 5BQ7B 1Q9OB 5AD0A 1MFCH 3P11L 2CIIB 1HINL 3ZO0A 3FB6B 3WJJC 4WIQA 5C09B 4D0BB 1CG9B 3BKCL 4G9FE 4QHLB 2P46B 4Y2DA 4PUBH 1YPZA 1NKRA 3NA4A 4ZO9A 5FGSA 4LSQH 4OFVA 4C58B 1HSAA 1YMME 4MMZC 1QFWI 4TNVK 3TM6A 1CTNA 1HHIB 4I18A 3I2CH 1U2HA 3R0NA 3JV0A 3MCKA 2HT2D 1FFPA 3MXVL 5A16B 1TETL 1PKOA 3Q6FB 3ROLB 4DN4H 5GZOC 5KJRL 3RFZC 5T3XD 3CDFA 2Y25A 3NACL 3MBEA 4HWNA 4OLZL 3P77B 5ADPH 4P0DA 4ZXBC 3I6GB 5IROA 3UTPE 1KC5L 5JIHA 4WFGE 4D94A 3TA3D 4ZUUA 4PJ7B 5D96C 1ZHBB 1BEYH 4OZGA 2XPGB 2YEZA 1U36A 1T83C 1P7QD 4U2YA 5EORL 1UGNA 3VXSA 4NHCH 1GJIA 4IHOA 1S7RB 3RUGF 1T1XB 3RPKA 4NQVB 4KKNA 1EHNA 3CVIL 4P3CH 4HWZB 4R90L 5FA4A 1KCVH 5EFIB 5DFVD 1IARB 5HDQH 4ELMF 2Y7QB 2A0LC 3ZE2F 3HPLB 1T5WA 4RISH 2D7OA 4JY4B 2BZDA 4E41A 5FUOL 3JXAA 2ZP0T 3BP7B 3V6OA 5TE4L 2ZG1A 3ZDXF 1EFXB 1PD6A 1T2JA 4OI8A 5D5ME 4X99A 3V4VL 2V2WA 1XR9B 2YK1H 1TQBC 4UOW0 3THML 2HVJA 1VFUA 2ORBL 1NC2A 1PDKA 4QHNB 4WHYH 2O5YH 5DEGA 4AM0A 1RZ8A 4ZS6D 3RWJB 3TJHD 5IV2A 3FCTA 1J5OL 2ZCHH 3QA3B 3HKFA 3PQYD 2NNAA 2EIBA 1TMCB 1KV3A 3RTQD 5F97E 1UH3A 5I1HL 4WDIA 1RUKH 32C2B 2YPLE 4UV7H 4OLXH 5DRZB 1C8PA 4JFFA 1G9MH 3O9WC 2R2BA 4WHTB 4WO4B 4AG4L 4G80B 3VA6A 1MJUH 4KTDL 5JLZB 2DLTA 5E9DB 4K3JL 4J6RL 2HJLA 1JTPA 3VGDA 2C3HA 4YHOL 5GGQL 4YPGA 3ARGD 2Y07H 1MFBL 4KJQC 4OAWB 3T65B 3ABZA 2K9UA 4PG9B 4DW2H 1TFHA 1U3HD 4IM8A 1ZGLA 1CDUA 2RQ8A 5JHDA 3E0GA 3T2QA 1NEUA 4TVPE 2OS7A 2YD1A 3ZKMD 4UT9L 5B39B 4ZQKA 4N9OB 1JMXA 5JIIA 5KVDH 3MRQA 5KS9F 1WT5C 1LE5B 4HUUA 2DD8L 1KB5H 2HFFA 2X4NB 4XVUC 1WAAA 3UTSB 1K8IA 1WZMA 1NGWB 5DTFB 5FF6A 1F3JB 1FH5H 3RZCC 1C5CL 4MXVE 3TVMC 2YBRA 3HLAB 1GRWA 1DL7H 2GT9B 1YNTA 1IBGH 3O6FB 1NSNH 1S9XA 4JZJC 4FXKA 4PJIE 5CGTA 3O3BB 4KKAD 3EO9H 1B4RA 5CP3A 1LNUB 2FJFA 4Z7OE 4HFWA 3U30B 1I3RB 1NAMB 4LCYA 5BMFL 3HB3D 4V2CB 3QEUA 5AZ2L 3K2MC 5CEYB 5LAXB 3VD3A 4JM2F 3R06B 4Y5VC 1SJEB 1VHPA 5HDBF 3C5ZD 2XY1A 4Z7NE 5EU6A 4JREB 3O4LD 2OLDA 5F7EL 2AGJL 5DLMH 4WGVB 4UINH 4XXDA 3DRTB 3VI3E 3KYMA 4OF8A 1JRHI 3IFLH 4KVNL 4LEXH 4M6NL 5F1IB 2DQDH 1INDH 1FO0H 4KZEH 3TZVB 3U2SA 43C9B 2FATL 2DKUA 4Q6IA 5IFJA 4JO4H 4RAVB 1EJOH 1FNSH 1T1YA 4ONGL 1SBSL 2J8UE 4X4XA 3MFGB 5D4QA 1LDPL 5TF1L 4BZ2H 4NOFA 3LEYL 4HLJA 4MQ7B 4Z76A 2HTLD 1CVRA 1WUNT 2JIXB 3BGMA 4FNLH 4XNMB 4YHNA 3MNWB 2DLFH 3BD4A 1ETZB 4HMDA 4M6AA 1ORSB 4PRPD 2EDXA 1U8QA 2XTJD 4OFPA 1LEGB 4WUKL 4ZDHA 4QWWC 2DBLL 5TFSL 4N0UB 4FFWD 5T3XL 1GOFA 1S78D 4C56D 2VH5L 4XP5H 3HRPA 3ALPA 5BVPH 2R0ZL 4G42B 3AAZB 4XAWL 4BM7A 1ZT4B 5C0CE 3DMMB 1CK0H 3VXUD 3C2AH 1MHCB 3LH2H 3V2AR 4N8VB 3E8UL 2RFXA 3L1OL 2NY5C 2QHRH 4M5YH 4PY8J 2NX5A 4X4YB 5B3JE 4ZXBA 4QRQA 1EUTA 3RWCB 5IJKC 4LPVA 3L6FB 5A43C 3PGCB 5FKAB 3F7YA 3LKNB 3O8XC 2VAAA 2HAZA 2OXGA 4L4TA 1T83A 3MRHA 3C6SB 2IAND 4KUCD 5TGBB 4ODBD 3QPQC 4TVSa 3SPVB 5D96B 3RA7L 1K3ZA 1KTKE 3B5HA 5IVZB 4ZTOL 5JW4Q 1CT8A 2CPCA 1ZHKB 1JNJA 1GGTA 4JE4B 4MD4B 1DZBA 2AQ3A 1PJ9A 2X5PA 1BAFL 4PJDE 2OTUA 1RULH 1QPPA 4PJAE 3LKPA 2BJMH 3FONB 4I3SH 5JPNB 5F6IB 4MAYC 4WI5A 3FMGH 4K7PX 3WO4C 1X3DA 3P40A 3BDXA 1KJ2B 1JNNH 3TH2T 2APVA 3I9GL 1U92B 4QXUL 2QKIB 4YUEH 3OXSB 2JB5L 5B21A 1KLFA 5F7DB 1TQBB 1KELH 2UUDK 1NCBH 4ERSL 4OZHB 5K93A 4Q7DA 4Y4FB 2NY3D 1CD1B 5GS0C 5E2UL 4ZFGH 3D39D 4ZUTB 3T3PF 3LQAH 4LSPH 2BNRA 4ZD3H 3RNKA 4PB0L 5CEZL 1A0QL 2H45A 3H9SD 4Q9RH 5FM4A 5E4IA 1IEBB 3D69B 1DBAH 1H8SA 3O9WB 1GGYA 3CFEB 4HKJA 2XIDA 4OUUB 3VWKC 4BQ9A 2FGWL 2VB5A 2CKBB 3HZKB 1QRND 3HNVL 4WCYL 2CDGA 4PJFF 4WFFD 4D9RD 4NC0B 3VGAC 5MERB 4NKIL 3BWUC 4ZPVB 3IKCA 2XY2A 1VFOA 4HG4K 1WBYB 4FTVD 5DJ0A 3C5JB 2HVKA 4X8JA 5I8EA 4OM0H 5C0AE 4ONHB 1AE6H 1OW0C 1IGIH 4G9FA 4OIBA 4I0PC 1A1MB 2H1PH 1JP5A 4HFUH 2GKIA 2BVPB 1EXUB 4OGAC 1R3JB 1IFHL 3QQNA 5BOPA 2X9WA 3ARRA 3GMPB 4AEHH 2Y6SC 2APWA 1QEWB 3RZCA 1UXWA 1YMMA 3DUUA 4RMTA 1FLRH 3QHZH 4OJFL 4H0GA 2FSEB 2ADJB 3MPCA 3PJSB 4JZJA 1P6FA 3TO4D 3K4AA 4KGJA 3ECBB 3QIBC 5F7WC 2XNAA 2R23A 3PNWB 5HHOB 3DNKA 1IGJA 2VL5B 4HWBL 3OX8A 2LFGA 1CICD 4XH2A 1BBJA 4U0RC 4Y5VA 3HR5B 4CADB 5L9DH 1VGEL 1UB5A 4HXBH 3ZYOA 1I7ZB 3HCVB 3O6KL 3U6RA 3CC5A 4QRSB 1RUQH 3QXWA 3SDDD 5D2LA 3S88L 4NYLA 1HOCA 4Z9KB 3DO3A 2H9GA 4YIQA 3RY6C 4O2FA 3O4OC 4KK8C 4KKBC 1ZLUK 4BUGA 1J05A 5CIPH 5GGVY 4CVXB 1J8KA 1RZIB 3NFNA 5KG9A 1GC1H 4LHJB 5AAWA 2GJ6B 5HHMD 1MHHB 1N6UA 1U3ZA 5ETUB 5LBSL 3CDGB 2GTZA 4DGIH 4FQLH 3OJDB 5ITBH 1DUZB 5LGJB 1HDMA 4LLDA 3BRGC 4KMLB 1N59A 5F3HA 4WJ5A 5FYJL 4X6EB 5D5MA 3PL6D 4S1RH 1I9JL 1U0QA 2OJEA 4DZBB 1WIPA 2HMIC 3V6BR 1BD2A 3KPSE 5K9OB 1DLFL 3QWQB 3QG7L 5J3HD 4ODXB 5EZLA 2R15A 4JG0H 1LEKA 4XB7A 1WISA 2J88H 1QUNA 1OAYH 2QQKL 4DUVA 3L5WA 4XP6H 5SX4H 4OBSA 1TZGH 1MCOL 1GCFA 4FQXC 2PW1B 3UO1L 1JVKA 2DKSA 1OWWA 4JKKA 3MRJB 5E6IB 2BY1A 1FC1A 2P5EE 3I02B 1HHHB 2FBJH 1KXTB 3ZKXC 5IJKA 1ZV5A 2DQCL 3KPRE 3ISWA 2P8LB 2UZYB 5FUZH 4EUPG 2MPAH 3O8XA 1Q9KA 1UEMA 3HPJA 2ZPKL 4L9DA 4Z7WE 1X4YA 1FIEA 3O6MH 1MCCA 2R2CA 4O4YL 1N5AA 4KC3B 1MRCH 1QPXA 1G7MA 2ESVE 2F8XC 5I74C 3C87A 1X5YA 3MLVL 1R5VB 1CFSA 1KYOK 5IW6B 1CGYA 1T1ZA 2AV7A 3OB0K 2WQRA 1P1ZA 1ZE3C 4MAYA 4CU6A 1G9NL 1H15A 2FL5A 5GSRB 1QA9B 4UQ3B 3WO4B 1HQ4B 5C0JA 4DCQB 1FG2B 1X5LA 5T3ZD 4PJIA 3RWGB 1I1FA 3BKJH 3K7UA 4JQXA 1JGVH 2FYYA 2ZG2A 1OARL 4YHKL 2MKWA 1PYWB 2AJXH 4P2RE 1T0NA 2VIRA 3ROOA 3NFSH 1FGNL 2P48B 2PYEA 4JVUA 5HJ3B 4DUWA 4X6DF 1UWXH 4U7KA 4XBPA 4Y16A 3BIKA 1FIGH 3GO1H 2NZ9C 4H1LG 2O5XL 4XNUL 2CIKA 4PB9H 4JFED 1KG0A 2C3GA 2EDKA 3ZSSA 5DJ8B 1ZHLA 4NQED 3VXTB 5GGVL 2AEQL 1EHLL 2QSCH 4N0CD 3RWHA 1RFDL 5IMMA 43CAB 2YWYA 1NPUA 2GUOB 1IILE 3BQUB 3B2UD 5GRXG 4K3HA 1GAFL 2J8UA 4NO0A 4PTUB 3MRLA 3VGAB 1EEYB 5F1NB 4G8EA 1OAQL 1OW0A 2HJFA 1O7VA 3QCTL 4DOHB 4OGXL 1YEFL 3EW3B 4J4PC 4ZSOE 1JZ5A 4PGCB 4XTRC 3TEUA 4I0PB 4MDJB 5ISZB 3MLZH 4PIRF 2AJZB 2CGRL 5FO9A 3IFNH 2PO6B 4HXAL 5DVMA 3MLTB 1U8KA 2E7CA 4U6YB 3ZLQC 1H3GA 3QIBA 4S10A 1NBYA 2HT4D 1XGRA 2YD4A 3BPCA 5GZNC 4X5WB 4L3AA 4XHJC 3N06B 4AQ1B 4YAQA 4CVZB 4O58H 3GM8A 1B88A 4PJCE 2VLRA 5BZDA 1AGBA 1N3NB 2W0PA 4PRAB 5ALBH 5DVLA 1GGCH 1KENL 4APQD 4G3YL 2DLHA 4I4WB 3UDWA 4ELKA 3RY5A 5DZNA 5C0BE 3U46A 4FQIL 1EAJA 3ZHDA 5I2IA 1FFOB 1FL6A 4C54A 1RVFH 1G7PB