3N85H

Crystallographic trimer of her2 extracellular regions in complex with tryptophan-rich antibody fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
214
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFSIWWSWIHWVRQAPGKGLEWVASISPSSGWTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWWSSAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Structure of the complex between HER2 and an antibody paratope formed by side chains from tryptophan and serine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 39
structure length 214
sequence length 218
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H01
2CRZA 2DLGA 4EJ1C 3STLA 4YHIA 3CAFA 2EH8H 1H8NA 3RY5A 1U8JB 3VGAB 5CLWA 1QNZL 1JPGB 4MZ3A 1BVKB 2D0HA 3GJFB 3WD5L 1YEKL 1MCKA 2WUBH 5D7SH 4FMFA 1FCCA 1T2XA 5KVMC 3MRMB 3SGKC 1XGQA 3EFDH 4NFDA 4ZQKB 1EIBA 4PJ8A 1HCVA 5DR5H 5EBWB 5BZWB 2BHUA 4HWZB 3FRUA 1YNKH 5I6XC 5T1MA 3QUMA 4EQ2A 3TA3B 5HHNA 1CLOH 1OARL 5DLMH 3GSNH 1XFPA 1EBPA 4N1HB 1E6OL 1U8QA 2Q7NA 1M4KA 4ODVL 5DUPL 5HPOA 1WBXA 5JQ6L 1DEEB 4U2ZA 4YHZH 3CD4A 3SPVB 3TN0D 2F8OA 3PQYA 4PRPE 5FHAL 1BP3B 3O6FC 2B39A 4IRJA 4NNYB 2EXYD 4OLZH 1BJ1J 1ZS8B 1DQLH 4NKDB 2GTZA 1WWBX 1FZKA 2YWYA 3KXFA 3VWKA 3LKQA 1BIIB 1SHMA 2X4RB 4HCRL 1TNNA 2AEQL 4JRXD 1R5VA 4MJ6B 4PY8I 3WLWC 5ANMB 1NC2D 5C1MB 3GHBH 1IGFL 1JNNL 1OAUL 1NSNH 5FKPA 3X3FH 5FKAB 5ICYA 3EO1B 3QHFH 5GGTH 5IMOB 4P2RB 1I7ZA 5KS9E 1YEJL 1MHEA 1OL0A 2IGFL 4NO0A 4S1QH 4KJPD 4MWFB 2CK0L 1N7ML 4PJHB 3UBXI 3A67H 2DTML 4UDTB 1W72B 2NY6B 1WC7A 2YD4A 4KAQL 1LO0H 1W2KT 3KPSA 4CVZB 1HSBA 4J1UA 4POZD 3T8XB 3WS6C 4FZ8L 4N9GA 4CUCA 1H3PL 3WN5B 2ZUXA 2ZSVA 3ARBD 1VFAA 1SYSB 2XWBB 4JPWH 4GBXC 4PLJC 3V4VH 3GIVB 4YDVA 2CIKA 3NCMA 5JNYB 2Q86A 4UMGA 2VDRL 4M1GH 1M7IA 2JIXA 4DEPC 2APFA 4PRIB 1BECA 1JK8A 1RMFH 4R96A 4Y16D 4HAFA 3FO1A 1XGYL 2NY3B 1FYHB 3QFJB 5GRZA 3V4UH 3DVGA 3VXUA 4KRPC 3LKSB 2DKMA 4UIMB 2VOTA 3CUPB 5DI8A 3GSWB 3BVNB 5BS0D 3LQAH 4I8DA 1KCLA 3V4PL 1ZVSA 2BSSB 3ULSB 2C3GA 2NNAA 1BLNB 1XZ0B 3NA9L 3DETC 4L8SB 4QTIL 4OI8A 4HF5H 3PP4H 1DVFB 1CGSL 3D2UA 3GSRA 3IDMA 4NQCE 4RMUA 3J7HA 3KHQA 2H1PL 3GKWL 1BVLB 1UKSA 4NO5A 5CZXD 5HD8D 1MCOH 1NGYA 2WBJA 3JTTB 2R1XB 2GIYA 4NQXA 4G9DA 3VA2C 4ZS6C 1RZIA 4JFEE 1A3RL 1WFTA 1WAAE 3O4OB 1TIUA 3RU8L 4PRHE 3RHWF 4MD4B 4JRYE 3EZJB 5HYSG 5E8DL 3PL6A 4OCMC 4JFDA 5JXED 4Z78B 3DMMA 4RQQA 1KB5B 3GSVB 3I6GA 4RISL 4JDZB 2EE3A 3IDNB 4U4BA 4UDUB 4NN5B 2GJJA 5F6IC 1HXMB 4L8BB 5TQ0L 5FUOL 4NKIL 4WCYL 1EVUA 2BDNL 4OKDA 3FQXB 2VSCA 3ZKMC 4G6FD 5F70A 1M05B 1HZHL 2AJ3B 2GAZA 4HCRA 3WEXA 3PWUA 4XXDB 4PR5A 2VL5B 1JE6A 5ADOH 4HV8B 4UB0L 1RUML 5EO9B 1MUJA 5MERA 3GI8L 3I3DA 5HYQB 1MI5E 5CBAA 3D1MC 2FH6A 1EX0A 1F4YH 4IHOB 4NKOB 2JK5B 4U1SB 3OAZK 3M8OL 2JTDA 4PFEA 1O0VA 1ADQH 1KT2A 4L3CB 1PDKA 4QHKJ 1JV5B 4WV1C 5DSCA 4LPYA 2X89A 4FMKA 5DUBB 1AGBA 1SMOA 1MFCL 2J7LA 3KPQA 4HKZB 3F6LA 5A2IH 3QIWC 1X6NA 3OB8A 3S8WA 3N9GH 2DMBA 1IKFH 4LGSB 5D6DC 5FYKH 1RI8A 3P9MB 5T1LA 4WI8A 4U6HB 3U82B 1UZ6F 1CGXA 3TYGH 1CE1L 3QI9C 3W9DB 1E4XH 5IVZA 2X4OA 5FUZL 2HFEA 3CC5A 4ZUUB 3NZ8B 1DBBH 4LCWD 5IW3A 3O6FD 5D6CA 5GGVH 3VG9B 2F53A 1GSMA 1KTLB 2FHFA 3TN0B 4PUBL 2DQDL 1NCBH 1XCQB 2ICWJ 3VGBA 3TVMA 1NFIA 5C92A 4OZ4A 3WLWD 2Y6SC 5DQ9B 1II4E 4JE4B 1K8IA 1ZHLB 3HAEG 3LV3A 4WUUA 1UEYA 3BUYB 4R4BA 5SWSE 1UYWH 3TESA 1EHXA 4JRXB 3T0ED 3MREA 4HGWA 4GAYA 1NC2B 3L3HB 3MRLA 2OSLB 1QTYT 3MRJA 4MNGA 2YPKB 4LSPL 5C08A 1EMTL 1YNTB 3AREC 1XH3B 4NRYA 5FO7B 3I6LE 4DGYH 4EVNA 1SYVA 4FXGA 2Y1VA 1FZMA 4R4FL 2ICWB 3G5VB 1S7VB 1RIHH 3WJJA 4I2XE 3EOYG 5K9KA 4UT6L 1JN6A 1A6ZB 3HI6L 4NZRH 4PTTA 4PLJD 3BESR 2BXZA 1BJ8A 2CMRL 2UUDK 3BOVA 1Z9MA 3CVIL 4FZEL 5ITFB 3HNVH 1NGXA 1NCDH 2IBGA 1FIGL 3ARBB 2ZPKL 3SE8L 4JPVL 2P8PA 2DD8L 1A4KA 5GRUL 4G7YH 1XGPB 4GUPB 1KLGA 4JAMA 1QSFE 4JDTL 1ZLUH 1RJCA 3HHRB 2VDNL 4KRPD 1V05A 4MXQC 3NMEA 2WLZA 5I2IA 2CXGA 3SDXE 4Y16B 3I3BA 1V7ML 1FNEB 5B38G 1HKFA 1N59B 3IXAA 2IQ9L 1WUNT 1LEKA 5T5NG 3GHEH 5L88L 4NZTH 5DGRA 5F7WC 2ATPA 4WWKA 4IRZH 2L7JA 3DETD 3G08B 2IAMC 1VGEL 3TBVB 5DRXA 1BEYL 4OLUL 1MH5A 3MFFB 2P5EA 2PYFB 3JV5A 4WUKL 5BS0B 2ZG3A 4ZFGH 1BFSA 4J6RL 1S3KL 3OAUL 1I1RA 3BD4A 3M1BB 5H8DA 1HOCA 3DBXA 3O2VL 1TZHA 3C2AH 4ZS6D 3T3MF 2DM7A 4BK5A 2HN7B 1E6JH 5DYOA 3KPMB 3BYTA 3MJ8A 1FAKT 1WFUA 4WW1B 4JKMA 3TT3L 2FIKA 5JLZB 4GW4A 1UADC 3B5HA 4C56E 4IMKC 1G9NH 5LXGL 1GH7A 5SWZB 5CEZD 1GGUA 1B6DA 3U48A 4FQJH 5AD0A 3QUYD 3E6HA 3GJEB 3E0GA 5EU5B 3ZKMD 1WBZB 3H9HB 3QEHB 4KHXL 4ODUA 5E5UB 3QNXA 4MA8L 3W11C 1IQWL 2AJVL 1BREA 3H9SE 4OM0H 3SE3A 1MAMH 2FX7H 1Q9WB 3DVFA 3QO0B 3MLRL 2X7LB 3RL1A 4LP5A 1A21A 3GJFK 3IFLH 4LQ1A 4G6FB 2VL4A 5K33A 3G6AB 2FLRT 4OF5A 5C09D 2EC8A 4X7EC 4Y5VB 1T04A 2P7TA 4PP1C 4PREA 5CZKA 3RX8A 5J9PA 1WZ1H 3F12B 1U8PA 4LDOB 3ILPA 1QO3B 4KVNH 4WHTB 4YBQC 2PYEA 4YHPA 4KK6C 5FO9A 5H2BA 3WKML 2FWOB 1ODAA 3MGOB 4N8CL 4F8QA 3QIBA 2BNQD 1CCZA 4BFIA 2P4AB 2EDHA 1XGTA 1MCIA 3BKJL 3MROB 1S7WB 2P5WE 2Z31A 3BFOA 2HJFA 4M3KB 3VFGL 3OJ2C 3QUXD 4GMSL 1JPST 4N0FA 3QIWD 4EXPX 3Q6GL 4NM4L 2J8UF 1FRGH 1DQML 5GS0C 3NCYS 1IBGL 3D48R 2MQ3A 2MCPL 1IZKA 5I6XB 2Z92A 5GZNC 4KXZI 4JB9L 5JZ7C 3U0WL 3SGDI 2FL5A 5F1OB 3C08H 3VXNA 3GO1L 2YA2A 2IALB 5BW7A 3UJIH 5T1DH 4OZFG 1KLUA 1F2QA 5ERWA 5ALCH 1NMAH 1EH9A 1QRND 3G9AB 5D2LA 5FXCH 2ESVD 5F1NB 4DK6A 1ZLSL 4X0KA 2KH2B 2CJUH 3T0WA 5HSFA 3FT4B 2R2BB 4BSWA 1I7UA 5FOJA 4LCWB 3MLXH 3O6FB 2AABH 1I1AA 3O0RL 2V5SA 5DQJA 1A1OB 1XCTB 1P5VA 1BGXH 3IAQA 3RVXD 3UCRA 4EI5D 1I1CA 5AYUH 5IKCB 1NCWH 1QPPA 1T03H 4KI1A 5FCUH 4X5WA 5IM7A 1KENH 1F5WA 3X13B 5DHYA 3NFNB 1J1XL 2IH1B 3RWIB 3GI9H 3PQYE 1HQRB 5ACZB 1LGVA 4LDLB 2C3WA 4LBEB 3MUJA 2HMID 2LU4A 4UU9B 1KJVB 3KXFE 1XAUA 5JOFA 2EDNA 5EZOL 4F58H 3UPRA 2ADGB 2YXFA 8CGTA 5GGSY 1T5WA 4YNYB 3OMZA 4AL8H 4DVBA 5C7XL 1FL6B 1GC1H 1QBAA 3QHZL 5IF0A 3QJFA 2CDFA 1RJLA 4FTVD 1T7YA 2ILLA 3LKPA 4G6KL 1TJGL 1EZVX 5HDQH 4AZ8A 5KVGH 3CDYA 3P11L 4DGIL 1UB5B 1F97A 3P0VH 4ZAKA 2WM0A 5I1GL 1VSCA 3ROLB 4G9FD 4KKAC 5IK3B 1W0VA 4MXQD 1RV6X 3LB6C 5J1AA 2VZTA 3NACL 2X05A 4OGXL 4R7NB 5GJTH 1KCKA 3KPSE 5CBEB 3BZFA 4YHML 2X4NA 3KR3L 3BGFC 3OHXA 2ID5A 3QZWG 4KRPB 3O2WH 1IFHL 2IAMD 5E4IA 5FM8A 3PV6A 4O5LH 5KANG 1MNUL 4AH2A 5KSAC 1HINL 1MREL 5IV2B 4H88H 1FC1A 2C1PA 3GBMH 1T4KA 4KDTC 3L7EA 3BIKB 1OQXA 2QQQA 3MNZB 1CFQB 2APTA 2F5AH 4ZTOH 3IS1X 5IIEA 2E7LA 5EOCL 1MCPH 3IRZA 3O3EB 3CPLA 1J11A 5LJYH 1ZGLP 5I15L 4UINL 4MSWA 4HAGA 5IEKA 1DP0A 3VXUE 2Q8AH 2X1QA 3U46B 2R2HB 2EO1A 4ZO8A 3FT2A 2CLVB 4NNXB 2R4SL 4Q2ZB 1HSAB 1WF5A 4HH9B 1CG9A 2AI0L 3QG6A 2UVEA 1XT5A 3GMOB 4EDXA 4OKVA 1KXVC 3W11D 1IC1A 4TUOB 3D5OF 3BGAA 5E6IA 5KSBF 5D7JA 1N5AA 1IRAY 3QUYB 2OXGA 1AI1L 5I1KL 1FZOB 4XB8A 3VFUB 1NGWB 3ARXA 4OSUL 1KCRL 1EK3A 1OT2A 5D5MF 5AUMB 1YEHH 4RAVB 4PP1D 3QQNA 1S7XB 1NUNB 1ZVYA 5HGDB 2YSSA 1B0RA 1OP3K 2HVKB 5GGQL 4YBQD 4JFDE 5DJYA 3U1SH 4KK6D 1NAKL 1VKXA 2W59A 3MCKA 5C09B 3LSOA 4OIIH 4NQED 4YHNB 5FHBL 3BKML 4BQ6A 3MR9A 3LIZH 3D69B 4OCWH 3X11B 5C2BL 3BKYH 3QDGA 5B39G 4ISVA 2BNQB 2VXQL 1I4FB 1CGTA 5BRZA 1S9YB 5HGAA 4GLRI 4ZXBA 4EI6A 2ARJQ 2O61A 1R3IL 1RK1B 2A83A 2HG5B 2JB6A 3B8SA 3QUXB 3Q2CA 4JFYA 3PHQB 3QIWB 1IC5L 4LVOC 4OCLC 5FF6B 4PJEA 3VMPA 1BD2A 4QRQA 3O6LL 3LOWA 4G8EA 4RMRA 1I1YB 1CDGA 4OD1H 3QRGL 3O3BA 2A6JB 3RGVC 2GITB 1JCKA 5EZLA 2LV4A 4XWOC 1QRNB 2ESVB 1JGDA 2O93L 4HX1A 2G5BA 2XA8H 3Q5OA 1IILE 4Y4HA 2EYRA 4PJGF 2HT2C 1PSKH 3KYKH 4MQTB 5SX5H 5H94A 5JHDD 1ORSA 4JGUA 1AGDA 2A1WL 4LASL 3GSQB 5MEND 4K2UH 1YPZB 2X4PB 3SDAC 4PYGA 1UWXK 3MBEA 3D9AH 4K94H 5C8JA 4IDJL 2G9HA 3DXAA 4JGMA 4PJAB 3FRPA 4J3UA 4EI5B 4KGJA 4TSBH 1OSPL 4CNIB 2FJFB 5KVDL 3TC9A 4YUEH 4OZGF 2BFVH 5JPMA 2JB5L 2F53E 1U3HD 4YDKH 1RZ8B 2GK0B 5JA9A 1PKOA 4P2OA 3O8XC 4EUPB 3FL7A 2WZPD 1A2YA 1S7RA 5SV4A 5KVEL 2DMKA 2OR9L 3E2HC 2G60L 1ORQA 4D9LH 1QLEL 4PD4J 4WUUE 4RSVA 3U4BH 2VB5A 2VAAA 3FZUD 3K80A 2VSDA 1ZEAH 1IT9L 4NOFA 4NYLA 4QCIB 4G8FA 2DJUA 5DJ2A 3SO3B 3JUYA 2D9QB 3T3PF 1T1ZB 4OM1H 4MNGE 4KKAD 2V7NA 3IKCB 1HHJA 3MA7A 1SJEB 4HFWA 5C08E 4PV9B 4FTVB 1LO4H 1IL1B 1OVZA 1CFSB 1QFWL 1QSVA 3CSBA 3KDMB 4BA8A 2BRRH 1L6XA 4GXUM 3QWRD 1UZ8A 1KGCE 2VN7A 4YXHL 3MV7A 4G9FB 3LS5L 4LCCB 3RWCA 1N3NA 1SY6H 1V3JA 5CJOH 5GGVY 3AGVA 2VXUH 1S5HA 1C5BH 1S9XA 4FP8L 1DSFH 5DD5H 4APQC 1HILB 4HS6A 4ELKA 3T1FB 2IAMB 2P24B 4Y5XB 1U8JA 2Y07L 2FYYA 2NZ9C 1OY3B 2GSIA 1JPGA 3TPUB 2A6DB 1IEAA 4P4KC 4DKFH 3LEXA 4Y4KA 2YD5A 5IHBA 2WBKA 3MRMA 3N06B 5E2JA 5I1HL 3ULUL 5IFJA 2K1MA 3QUMH 4L3EA 5BZWA 1KULA 4HWZA 5SX4H 5IESL 1R3KB 3F7YA 2ITCB 3LKNA 2APBA 3GMRA 5DVOA 4BFBD 1A6UL 1BOGB 5HJ3B 1QRKA 1Q1JL 1G7MB 2F19L 4ONFL 5I19H 2P5EE 4WGVB 2B4CL 2DQFB 3DOSA 4WTXA 1KNOB 1MELA 1KB5L 2CDGA 3O11A 1DEEA 3V79C 3SPVA 3VG0L 1P4BH 5CKAA 4JVUA 2BSTB 3TYFB 4JFPA 1F4XL 3ROOA 5E08L 4JO3H 1XR9B 1Z9LA 1D5ZB 2IAND 3L5XL 1QQDA 3ES6B 4NKDA 1F6FB 1FDLL 2NY0C 1BIIA 4MXWL 4CAGA 1BQHB 3VXSD 3IFNL 4X99A 3RZWA 1RZGA 4MJ6A 5JW3L 4FFYH 3KPPA 3HI5H 3K2UL 3KPOB 1CE6B 5JIIA 2FX8H 5KJRL 4JCLA 3HE7C 5IMOA 2XRAL 4FFZH 3DO3A 1YJDC 4HS8L 1K3IA 3WHXB 4MWFA 1VADB 4NQEB 3IRPX 4DGVL 4LPTA 7FABL 3EDJA 4PJHA 3U7YH 1OOAA 2ENYA 1OW0C 5KAQF 2PTTB 3R4DA 3CLFH 2LVCA 1U8LB 4U0QB 3QHTC 1ZTXL 4CVZA 3U83A 4XMPH 3RVWD 2ZUYA 1I85C 2JCCA 3SY0B 1FPTH 4QRSA 5FYLD 3VXRD 2EDDA 4XBEL 3VFMA 1GGIL 4FNLH 2PYEE 4JFXA 5I74B 4FXLA 3WDHA 4PGEB 2Y36L 5DF0A 1MEXL 1RJZA 4XC3H 4IJ3C 1NCAL 3O3UN 3RGVD 5FDWA 4XWOD 5EA0H 1GGYA 1EXUB 3K4ZA 2OM5A 3RWDB 3JWDL 4OJFL 2HT2D 1EZVY 4U2YA 1DLHA 1H3WM 4YXLH 2NR6C 3TWCL 1JWSB 2GFBB 3C6SA 5E94B 3SDAD 4RCAA 3EOBB 1NLBL 4U1JA 3CUPA 3NIFE 4R4NC 1QNZH 3BVNA 5JHDB 1RK0A 3PWPA 2BSSA 3ULSA 3MLZL 4M1CC 4M7LH 5J6HA 3RZCD 5MENB 3GSUA 1OP5K 5D7IA 4F37K 4JPIA 2DWEB 1JTTA 5D2LE 3DO7A 3U4EB 3WD5H 1YEKH 1URLA 5EO1B 1CICC 1UACL 4XBGB 1C16B 2YRZA 1J0YA 1CFVL 2ARWA 3WUZA 3O8XD 5LQBH 5J1SC 4MQ7B 1JNJA 1JRHI 5CSZA 4R97B 4OLWL 2R1XA 3KPRD 1U3HB 3KAAA 1MQ8A 5EC2B 3O4LA 5LVEA 3GMQB 1OARH 2C3XA 2H32B 1RUKL 1TVHB 1E6OH 5DUPH 2YOCA 3KLHC 1J8HD 3TBTB 2VDOL 5I1CL 1O7SA 4HXBL 5KG9A 3REVA 4AEIL 5KSVA 2IH3B 5JQ6H 1OGTA 4Z78A 4U7MA 3SKNA 1KB5A 4M00A 4WI3A 4D2NA 2P42B 3IDNA 5FHAH 1LK3L 4JQIL 3F7VB 4L8BA 4LSVL 5DS8B 4NZJA 4F7MB 3CGTA 1X5LA 4M1DL 4RAUB 4B7LA 1BIHA 3F5WB 3IDUA 3ARFC 3Q3GB 3NIGE 4HCRH 2AEQH 3OB0K 5DRZB 4K8RD 5GISL 5EOQL 1X5FA 3AXLA 4Y2DC 1IGFH 1JNNH 3BGFB 1OAUH 2FJHB 3HC4H 3HRZA 4XXDA 5E5MB 2AXJA 4A2LA 2X1WL 2A6IB 2P43B 1AIFB 4JY6B 4Z76A 5EO9A 1TJIH 1ZVHA 3FN0L 5EOTB 3NBNA 2BNUB 4H0GA 2A9ML 4JO1L 3VWJC 2IGFH 1HHKB 3QPXL 4P4KD 3FHAA 4RGNE 5D1XC 2RAMA 2CK0H 4IBLT 1N7MH 3M17B 2DTMH 3EFFB 1Z9OA 1J05B 4HH8A 3C09C 3EO9L 4U1SA 3THML 1WAAF 3C9NB 4JZOB 3TO4D 5IFAL 4KAQH 1VENA 4OT1L 4UNTA 5GGUB 4L3CA 4DUXA 2BP3A 1IEBB 1H3PH 1I3RA 1PFCA 4DCQA 3TBYB 3VXQB 1S7UB 4OV6F 1X5KA 1NCNA 1JNHB 4I5BB 4XCFH 2VKXA 1XF3B 3MLVL 4JHBA 3P9MA 4PLOB 5D7KD 3T4YB 4QRRA 4YDJA 2Q3ZA 3T65A 1JGLL 1SVCP 1CK0L 5F7HA 2OTPA 1FFOA 4OCNC 5I16B 1XGYH 4H1LG 4C4KT 1PEZA 1N8ZA 5A3ID 4KTDL 3SOBH 1KTLA 2ZSWB 1YC7A 4M03A 4ZNCD 2VDML 1CDJA 4QGTA 3V4PH 3BPOB 2NY4D 2AXGB 3VRJA 2IANB 3NA9H 4QTIH 5BO1L 3HE7D 3TEUA 5HHQB 3MJ9L 3LS4L 3ZDYE 3IDXL 1NC2A 4ZSOE 2H1PH 3GKWH 3FO2B 2OSLA 3C8KB 5C0IB 1X9QA 2CRMA 2YEZA 1G0YR 4YO0B 4PV8A 1XH3A 5HHVL 2W60B 1A3RH 3J8F7 4JQXA 5DA0B 2ZUSA 4A2MA 1DBAL 4UI2A 1KBGL 3CLEL 2GTWB 3MRFB 1PG7W 1S7VA 5DVNA 3FQTB 5E8DH 4JQVA 3AS0A 3FONB 4I0CC 1A1MB 4RISH 3RUGB 2FNBA 3E1F1 4Q9BA 3QUZC 3VD5A 5DVKA 5ITFA 4FQCL 4LVOB 5TQ0H 3VXRB 3CZJA 5FUOH 4NRZB 4I48A 4NKIH 3ZTJH 1IM3B 2BDNH 4C59B 1ACZA 3UMTA 3RY6A 1JZ7A 3QDGE 4OIAA 1RZJL 3ARTA 4NN6C 3H7BA 1B90A 1QSED 3WLBB 3HKFA 3RGVB 2YBRB 4U33A 2NR6D 43C9B 1YEGL 5EBMB 5BRZE 1V7NL 4OI9A 2K7PA 4Y16A 4UB0H 1RUMH 1CDHA 5EN2B 1N59A 1BHGA 1A14L 4R4ND 5EO0B 4QHMA 3GI8H 1A4JB 3F58L 4W4OC 4X4XA 3G6DL 4M1CD 2IQAA 5JO5B 1Q0YL 4GXUN 5B39B 4GT7A 2W0PA 3RI5F 3SDAB 4WU7B 1P84J 4PJEE 4RA3A 1BD2E 2MHAB 2Z93A 3UTQA 1G9EA 3M8OH 4QXGL 1Y0LB 3RZCB 4H26B 1IM9D 3M1BA 4F9PA 1BQLL 5ENWB 1DTUA 3QQ3A 3MA9L 4G8IA 2R39A 4F2MB 1MFCH 5T3ZD 3O8XB 5J6GB 3EYUL 3KLHD 1OAZL 4RWYL 2P8LB 3KPRB 3Q1SL 4JZJC 4WW1A 3OSKA 4LLWB 4BZ1L 4RX4D 1CE1H 3DXAE 3CFJB 1LNUB 5FUZH 3DYMA 3AS1A 1J8HB 4YXKL 4J3WA 4PD4K 3ULVL 3P0GB 3SDXF 5FECB 3FOLB 3GJEA 2LAAA 5JXEA 4PUBH 3QEHA 4PRBB 2DQDH 3ARFD 1EFXA 4FRWA 1M7DB 1Q9WA 3T4AB 3RWGB 3EYOB 1INEL 4Y2DD 3B5TA 2X7LA 2C1OB 2YRLA 5A16A 3IAGC 1UM4L 3VWJD 4F7CB 5D1XD 3MJ9A 1OD7A 4ZNEA 1Z5LA 3F12A 1NBVH 1B9ZA 3HNTL 3LQZB 4U1GC 5JW5B 3OR7B 1EMTH 3QA3B 4XPBL 1Q9OB 4P4KB 1DQJA 4O51B 2G75B 4AIZB 8FABB 5ID1B 4R4FH 3BGMB 5HHOA 3MROA 4HEME 3MV7E 3HG1D 4K7PL 1S5IH 4UT6H 1DE4B 3TO4B 3HI6H 3OKMB 2CMRH 4Y8DC 3CVIH 4FZEH 5L9DL 4GO6B 4G5ZL 2OS7A 1FNAA 1AGFA 1CN4A 3KJ4C 1FIGH 1VFBA 3IXTA 4JPVH 3SE8H 2E5EA 5JA8B 5DK2A 2DD8H 1FQ9C 1S8DB 2RHEA 3SDDC 2ZZUT 5GRUH 3WJLA 2VE6B 4O2FB 4OCRH 1OAQL 3QXTA 1CFTA 2BVPB 4K3HA 4NP4L 3ZHKA 5F1NA 1WCQA 2VDNH 2X1XR 4JPKL 5CEZL 3FT4A 4L5FL 2R2BA 5HHXL 1GRWA 1V7MH 1T3FA 1KN4L 4L3EE 4PJCA 4NKQB 2IQ9H 3O81A 5L88H 4M6NL 1EA9C 3G04B 5I1DB 1OAKL 3V2AR 1A1OA 3HCVB 4GG8B 1XCTA 1VGEH 1T5XB 3O6KL 5LGJA 4HQQL 1BEYH 1I9EA 4OLUH 1CI5A 1PYWB 1TTFA 2APVA 1FE8L 4WUKH 5GQBA 2XOTA 3UP1A 5IKCA 3D39A 2NY4B 4GKZA 4XNXL 4BUGA 1P2CB 1S3KH 3OAUH 4I77L 1K5NB 2XNAB 4AIXA 3HE7B 3IFOA 4PJBB 3S97C 2IH1A 3P3YA 1KF9B 2Z91B 3T0EA 4XMLL 3PHOB 4Y4FA 4DAGL 3TNNB 2IC2A 5LCVL 4LBEA 1YEIL 1KJVA 3VD4A 3L95A 2R0KL 3DWTA 3TT3H 2L4OA 3OKKB 2FATL 4ZDHA 2ADGA 4GKOA 2CKBL 5LXGH 4HK0B 5TE4L 4Z7NE 1FL6A 4DZ8B 4D8PA 1ITBB 4R7DB 1NANH 1R5IB 3ZT7A 4X6DB 2HVJB 1WZKA 4MA8H 1U6AH 4ZFZB 2AJVH 2FDBP 2GJZA 2VLME 4X4YA 4KI5F 3ROLA 4PJHE 5IJVA 2AEIT 5IK3A 2UY7A 1HDMA 3O41B 3VFVB 4N8VG 2FBJL 3MLRH 5I8CA 3OKOA 5C07D 3E8UL 1CL7I 3MLTA 5CBEA 1QSEB 2JCCE 2K3TA 3WFDL 1ETZB 4S2SB 3DHJA 3CDGA 4B5EA 4JFQA 3WKMH 2LTQC 5IHZA 4XVTL 4N8CH 2GJ6D 2BHZA 2ICCA 4OFIA 1U8MA 1TXKA 3MNZA 3BKJH 1CFQA 1XF1A 3K81A 4K9EL 4IOIB 3VFGH 3LZFL 4GMSH 1U8HA 1P7KB 3V0VB 3Q6GH 2YKLL 3HLAA 4NM4H 3ZYOA 3UJJL 1IM9B 1R3LB 3L3IB 1IBGH 1NBZB 3PIQB 2MCPH 2D03L 1NKRA 2R2HA 4JB9H 4WFED 5IB2B 3U0WH 4Z9KB 4ZPTA 3W9EB 2CLVA 3OAZH 3GO1H 3PWPE 2AK1H 4QGYA 1HSAA 3HA0A 2PW2B 5D7IE 3BN9D 4HH9A 4IDLA 3AU1A 1ZLSH 1LEIA 2D7OA 3MRGB 5KSUB 3WNPA 3S35L 3ULUE 1OT1A 3CFCL 3QUYA 5I0ZA 5TE6L 3QH3B 3O0RH 3U0PA 4XRCB 4BYHA 3BMWA 3VFUA 3O4LE 4NQVB 1NGWA 3ARFB 1OAYL 5I18H 5T3XD 4L29B 4XX1G 4G80A 5I66B 4RAVA 4G43A 2EECA 2FLBT 3QPQD 4EIZC 4NQDD 4Y2DB 3DX8B 2E7CA 1EDQA 1I1FB 2WUCL 1J1XH 4M6OL 3TIEB 4AMKL 3FHQA 1AC0A 3VWJB 5D1XB 4Q9RL 2NX5D 4ALAL 4C54A 1NC4D 3P77B 3D69A 4CU6A 3QNZA 3X11A 2ADIB 1KIRA 3C09B 3BZDA 1WZLA 2KBGA 2BNQA 5IROC 4TQEL 5EZOH 1KYOJ 1U8KB 1FG9C 3PUCA 2FEEL 3CCHA 5JHLL 3HG1B 1LDPL 5C7XH 4LPXA 2CKBA 4OZFH 5E1AA 4K3EL 3SO5A 3QHZH 1RK1A 2HG5A 3QUXA 1E4JA 3S6CA 4MNHB 4LVEA 2V2XB 4G6KH 1TJGH 4M7LT 2P47B 4DGIH 3P11H 4WI6A 2JELL 1S7TB 4ONHB 5I1GH 2HLAB 1C08B 1IAMA 1UT9A 1RZKH 1YY8A 1IGJA 3DHMA 3NACH 3CSYB 3IJSA 4OGXH 1WBYB 2H45A 2UUDH 1XF4A 3LMJL 4KKNA 4YHMH 3EO0A 1HCFX 5I17A 4I3SL 1IFHH 4PY8J 1MNUH 2OQJA 1HINH 1MREH 4LNVA 5F8QC 4YR6B 1HH6B 5HI3C 2DQGL 3GSQA 5L8KB 3T0BA 15C8L 2VLKA 4OD3L 4QRRE 1DCLA 3MRNB 1T7WA 2Y9RT 4RIRA 4EI5A 2MPAL 2FZ3B 5EOCH 3K3QA 3B9KD 1C5DA 2Q1EA 5I15H 4UINH 1K8DB 4JM2A 1FH5H 5ID0B 3VXMA 4UT9L 2GK0A 5HGBB 3L3OB 4PYHA 3WS3A 1GZQA 5FUCC 4EUPA 3QDHA 5ICXB 2R4SH 4YPJA 3NZHL 3MMEB 3C5SB 1ULVA 4H1LB 2AI0H 1I8IA 5BVJA 5JW4M 1FVDA 6CGTA 1SBSL 1G7QB 1EFQA 2A73B 3UBXB 4Q6IA 4M48H 3ZDZF 4UTBL 2ICWI 4P5KA 4EN3A 4HWBL 4FTVA 5I1KH 1IL1A 1CFSA 2HA1A 3I02A 4OSUH 1KCRH 3FFCD 1F4WL 2HT3C 4WJ5B 1NEZG 4G9FA 4LCCA 3U36B 5AAMA 5CSBA 5IMLA 5GGQH 5DD3L 5C07B 4K55A 4PTUB 3ZZ1A 3T2OA 1NAKH 5TDPB 3TBSB 2WQ8A 3X14B 3B43A 1AP2A 2AJZB 3SGEH 1GYAA 3V6OC 4OFVA 1PBYA 4YC2C 2P24A 1OSZA 3BKMH 4Y5XA 5FHBH 4KQ4L 2JJTC 3SBWA 5C2BH 3IF1A 4TRPL 4HDIA 2GJ6B 4ETQB 4Z0XB 2ZG1A 2VXQH 1P84K 3B9AA 1DBKL 4Z5RA 3MBXL 1U92A 4HGMA 1LP9A 1R3IH 2XWTB 4KROC 2PW1A 2ITCA 1IC5H 4U6XB 4MDJA 1H15B 4JZJB 1BOGA 4HJGA 4A6YB 3SDCC 4GJTB 5IGXH 2FBOJ 1E28A 4L4JA 1I7RA 5FYJL 3JBG7 4XNZC 3QRGH 2G2RB 3RKPA 1WT5A 1ZLWK 1K4CA 3TYFA 2BSTA 1YEEH 1K4DA 1MWAB 1ROWA 2YR3A 2E6QA 2A1WH 2BK8A 4LASH 3ES6A 1JPFA 2ZWLT 2FECL 2W1NA 1BQHA 4IDJH 3VE0A 4IIQC 1GOGA 1XIWA 5KVDH 5C0GB 5IWLC 1K9TA 2XWJB 4NQDB 1PZ5A 4JRWA 5C0BD 4LSQL 3CZFA 2JB5H 2O5ZL 3CIQA 2EXWC 3RDTD 1T89A 1TQBC 4PS4H 1F11A 2Q8BL 3EBAA 1VADA 3BX7C 2VMFA 2XFXA 2NX5B 3Q6FB 1HIMH 2VN4A 1NC4B 1NL0L 1BJ1H 2XQBL 5KVEH 4PJFA 4PJ7A 3PDOB 2G60H 1RZ7L 1GOFA 1AE6L 2FO4A 4LCIH 4F80A 3UTTB 1IT9H 1NUGA 5IJKC 4AK1A 4YE4L 4ZNEE 4X4MA 3KJ4B 2JF1A 3QWOA 2VDLL 3D0VB 1JWUA 1MRCL 1ZT7B 1KEML 3CVHB 1QFWH 2PNDA 2R4RL 5JDSB 4HWBA 5F21B 1MCNA 4GRMA 5HHOE 5FV2A 4MNQD 3RWDA 3LEYL 3LS5H 2V5YA 5B3NA 4XHJC 3L3DA 4OIBA 5IW6B 4FP8H 1S7SB 3CK0L 5HI3D 5HY9B 3VXPB 1Y18A 5M7QA 1JWSA 1CZ8H 1IAOB 4WVRA 5E94A 4U1NB 5L2JB 4PY7A 3DV6B 3SKJH 4Z7QE 4GRLC 4WY7L 2Y07H 4HJJL 1OHQA 1FV1B 1ZA6A 4M8QA 1AHWC 2DS4A 2QQLL 1TPXC 2GSGA 4UQ2B 2Y72A 4UT7L 4CRPA 3VH8G 3JWNC 4LPVA 4XBGA 5I1EL 2D2OA 4X8JB 5I1HH 3ULUH 2E9IA 1A64A 4PJCE 4NKMB 4X6EB 3LKRB 4MQ7A 3CXHJ 4BJLA 1WICA 3OKDB 1KPRB 4Z77B 2XTLA 2E9JA 1U3HA 4L4VD 1Q9LB 5EC2A 3HZKB 4P5MB 3GMQA 2M26A 32C2B 3BQUC 1QG3A 2H32A 3ET9F 1Q1JH 5DEZA 2F19H 4ONFH 3BMVA 1TVHA 2B4CH 4J2XA 5AZEH 3D39E 3TBTA 3KYOB 3QXWA 1KB5H 2R69L 5BXFB 3SDYL 3VI3E 3VG0H 3OKYA 4BH7B 1IGIL 1P1ZB 4E0RB 5FYLL 3AS2A 3T0EE 5E08H 1FZJA 2D0GA 1KG0A 3F7VA 3PJSB 4G6AC 4LU5L 2HT3D 3SKOB 1JHLL 3L5XH 1BBJB 3RWEA 5CMAA 4RAUA 1FDLH 1MHCA 3NIFF 4BQCA 4PG9B 5EBGA 4F7TB 4MXWH 4KV5E 1ZSDB 5DRZA 3IFNH 5FGCB 3FFCB 3QWRA 5JW3H 5D2LF 3IDYB 1I8KB 1G9MH 4MJ2A 2CR6A 3C8DA 5E4EC 1QEWB 3LRHA 5KJRH 3S88H 5C0AD 2VIRB 1N6VA 4HLJA 4JY6A 4XZUA 2XRAH 3D18A 1N2RA 4D0DB 1FP5A 5B22A 2BNUA 4HSQA 2LTQB 3TH4T 1FJ1B 2FB4L 4HS8H 3ULVE 5FFLA 1HHKA 2LE9A 3MLUL 1FNHA 2UVFA 2FHBA 4MS8C 1FCGA 5DHVB 4DGVH 3M17A 3I2CL 3EFFA 4X80L 4PG2C 4TUJB 1OP3H 4YIQB 3C9NA 4RMQA 3TLRA 2UZYB 1ITCA 1ZTXH 5GGUA 4KROD 3G9VA 1P7QA 1IAIL 1IEBA 4JVPA 2XQYK 4LLVA 3LKOB 1J18A 1GGIH 1PGRB 2J5LC 1LE5B 3SDCD 1KTKE 3TBYA 3WIFB 4OQTL 3QBTB 3UJTL 1RIVL 4N8VB 2Y36H 1GCFA 1MEXH 1JNHA 5E6YA 4KJYB 1NCAH 5C6TL 3U79A 3GSXB 3ZYIA 3JWDH 2VISA 1CQYA 1SJHB 1NGQL 4U3XA 3RVTD 4OJFH 3MGAA 1YEDA 4U05A 5E9DA 5DRWB 4WHYG 3TWCH 1VPOL 2VWEE 4KUCF 4M7JL 4XPGL 1HQ4A 2VH5L 4B41A 4H0HB 2DQTL 4NQUA 3STZB 2GUOB 3V5DA 3MLZH 3L5WA 4G42B 3ETBF 1T0MB 4LLUA 4YFEA 4Z6AT 1J9CT 3DTXA 1MJJA 3EUUA 4K8RL 1QOKA 2Q6WB 4O2EB 4CVXB 1ZOXA 5I1AB 3QDMD 1UACH 2GW5A 4U1HA 1ZANL 1WIUA 2EXWD 2CUHA 3AVEA 4N90E 3VXSA 2W65B 4LKCB 3S5LG 1CFVH 1AKJD 4OZHA 3ARYA 1HWHB 5I1LB 3C5ZA 4CMHB 5C0BB 2HRPL 3BSZL 5IB4A 4QEGA 3B9EA 1UWXH 3WUWA 1E4WL 3RDTB 2OXHA 4TTDC 2W60A 4KUZL 3ZDXE 1RUKH 5FA3B 4LRNL 5I1CH 2VDOH 4HXBH 1OM3L 4Q9CA 3FQTA 4AEIH 1TETL 4XP1L 3U2SA 1EEUA 5EIVA 1T66D 4XP6L 1KYOK 5C6PB 3LQAC 1G1CA 4Y2OA 4M5YL 1LK3H 2R2EB 1MFAL 4JQIH 2DM2A 3ARWA 3VXRA 4XPFL 5ALBL 3DUSA 4P2YA 4LSVH 4XVSL 1IM3A 3W81A 3OXSA 2GK2A 1NGPL 3P9LB 4C83A 4U1IB 4M1DH 4PRDA 2H9GB 4XHJD 2I9TB 1CGYA 5JW4N 1BWWA 4MVBC 4MD5A 3WLBA 3MV9D 43C9A 1FG2A 4MNQB 2OZ4L 1GPOL 1BZ9B 3RTQC 3ZDYF 5DJXB 3ZKQD 3LAFA 5FM5M 1OD9A 4GRLD 1NCUA 5E5RB 1MFNA 4Y1AD 3FN0H 2YZ8A 1P4LB 2A9MH 4JO1H 1YN7B 3BH9A 5JO5A 5J0BA 1ZHNA 5FK9B 1RQ5A 2VQUA 4BH8B 5LAXB 2W9EL 4WU7A 1KPUA 4TVPD 1B2WL 4Q0XL 2EDTA 3V0AC 2HKHH 3EO9H 4ODHL 3THMH 2WANA 1QZ1A 5IFAH 3FOMB 2VUOA 4HBCL 4RFOL 3RZCA 3CFDB 2BX5A 4U3HA 5T5FL 1EBAA 4F7PB 3FO9B 1GVIA 4U1LB 1MIEL 5ENWA 1MCJA 3MJ6A 3WFBH 5BOPA 4F2MA 4C57C 3BQUD 2CLRA 3WNNA 2BMKA 2X4QB 4L1DA 2OMNA 3L3KB 4OQTA 2FEDC 2P8LA 1X4XA 2VLKE 4JFFA 3MLVH 4L4VB 2AV1A 2BVOB 3JVGC 4LLWA 1JGLH 2JJVA 1TFHA 1CK0H 5BJTB 1LNUA 2B20A 4PP2A 3F7RA 3R0MA 5IEHA 1HXYB 2IPUK 3OKNB 4HIHB 4E5XB 4G6AD 3FCTB 4HHAB 5ICZB 5E6ZA 1D9KC 2ITDA 3QIUC 3VXME 1MCSA 1NDGA 4GFTB 5I1IL 3BO8B 5HDOA 2VDMH 5LG1A 4RGOL 3T4AA 1MCDA 3RWGA 3OX8B 3DUUB 3UDWC 3MLPA 4PJEF 1U91B 1R6VA 3QQ4A 5BO1H 2C1OA 2AQ1A 1MLCB 3MRKB 3MJ9H 4LNRB 3LS4H 3B2UC 3IDXH 4LMQE 4F7CA 2GY5A 3MGTB 2E6JA 3T09A 5LWYL 4MS8D 3E3QE 4CVWA 5C0AB 1J1OL 2DIJA 4LARL 3UZEA 2D7NA 4FTVE 3OR7A 3QA3A 4RZCA 3GMMB 5K9OB 1YY9C 1JHKL 1JYWA 5T1KD 2NW3B 3QNYB 5ID1A 1DBAH 3NFSL 4XXCA 5CJBA 1KBGH 3CLEH 2XG4A 4G9FE 1ZLVK 4BSJA 2R8SH 3PXJA 4U1MB 1AGCB 4P5TD 3TO4A 1DE4A 1G0XA 1BQSA 1GZPA 1UB6B 3EYQC 3DYPA 3P4OB 5DDHB 1WZMA 3OKMA 5HHMD 3QCTL 4KROB 5EPMB 1UFUA 4FQCH 1LQSR 1LEGA 1PLGL 3FB5B 2N4IA 3G5YB 3SDCB 5HBBA 4ESKA 2RFXA 1FC2D 3ARSA 1NBYA 2NYYD 4O2FA 2AGJL 1RZJH 35C8L 4WTWA 3WYRA 1HNFA 2XG5A 1YEGH 1R3JB 4WTZA 1LP9E 4Y5YB 5DEGA 1I8MB 4ORZC 4PJ5D 5IW1B 4GG6A 2OZ4A 1A14H 1QA9A 4BZ2L 5ISZD 2VLLB 2AK4D 3F58H 3KS0H 1YQ2A 1Q0YH 2NY1C 3HCVA 4GG8A 3KJ6L 1T21B 4P9HL 2AXFB 4FQQA 5T33L 2HFGL 3ZKNC 3S5LA 3TBWB 1PYWA 4QXGH 1NQBA 4IIQB 3VFSB 1P2CA 3GFUA 3G5XA 5IQ7L 5A1AA 4DWHA 4LSRL 3DRQB 1BQLH 3QDMB 2FO1A 5EU6B 4K7FB 3MXWL 3PHOA 1TCRB 1KELL 1TQBB 4TTDD 3TNNA 1AKJB 5EULV 5TDOA 1JZ2A 4I0PC 5CP7B 3EYUH 1EJOL 1D5XB 2OTWB 4U31A 3VGFA 3B2VL 2NY5L 1OAZH 4RWYH 2Y7QB 1OP5H 3UYPA 3B6SB 1NDMB 1A6TA 3BXNB 4BZ1H 3BPNC 5IMKB 5AZ2L 1OB1B 2F74B 3G5ZA 4YXKH 1M1SA 4MAYA 3UTOA 3EYFB 5FCSH 4DZ8A 5I76B 3VXTB 3ULVH 4HZLB 4XNYL 2EE6A 2J8UB 1A7QL 4MVBD 4HUXB 2XZAL 5AWNL 3E6FA 1INEH 3O41A 4PJ7E 3P4NB 2CO7B 4PJFE 1H3GA 4U7SA 3RTQD 3BPCB 3ESUF 3UXFA 3CFKB 2D9CA 2AJSH 4NZUL 2I24N 4W68A 5M95B 4JHAH 5CAYB 1K2DB 1QSEA 1UM4H 4PJXA 4X6CA 3TCLB 3FO0L 4Z7UA 3MV9B 4X4ME 1NPUA 5E8EB 5ADPL 3HNTH 4WNQB 4GRLB 3BZEA 4Y1AB 3RIAK 1MPAL 5D1ZD 3EJZC 1G9NC 4XPBH 4LSUL 1AHWB 3QEUA 5DMKB 2Q3AA 1TPXB 1FFQA 2MKLC 5JOPD 5L8JB 3LCYA 1I8LC 1YYML 1H3TA 4D3CL 2FGZA 3GSOA 4WHDA 4K7PH 3KPLA 1BBDL 4IOIA 1X6LA 1ONQB 1WK0A 3FQRB 4Z7NF 2EIEA 5L9DH 1IM9A 2BZDA 1R3LA 2P46B 1FYTA 4XC1L 2FEDD 4G5ZH 2Q20A 5E8OB 4BKLB 7CGTA 4Y19D 1MY7A 1X5YA 3BQUB 4X5XA 1F02I 4MA1B 5LGKA 1I7TA 3BDXA 3BN3B 4NP4H 1YDPB 4NNPL 4JPKH 4XBPB 3QIUD 4L5FH 4WW2A 3MRGA 5KSUA 5HHXH 2GKIA 5E2TL 5L2KA 1OPGH 3MOQA 2JCCF 1KN4H 3QEQA 4DZBB 2Q76A 4ZO9A 2AKRB 4M6NH 1A6WL 1OAKH 2Y5TA 1QBBA 4WFFD 1F2XK 4XRCA 3O6KH 5ACLA 5GGSB 3CMOH 4HQQH 5CP3A 4JZNA 3VFRA 1UJ3A 4XNXH 1YN6B 4AT6B 1XGRB 3DX8A 3IU3B 4I77H 5FYKD 5FYJE 2XPGB 3WIIL 1J5OH 3ARZA 5E4EB 3T0VA 5CFHA 2YA0A 4FG6D 3GSNB 2KQMA 1EUUA 4XMLH 4ZOBA 4DAGH 1YY9D 4JEGB 5F7DA 4NBYB 1NUDA 1CD1A 4XVJH 5LCVH 5DJDA 3WXWL 3DGGB 5D9SA 1YEIH 3V5KB 2BNRA 5CJ5A 5B8CB 3EYQD 2FATH 5EZJB 1BFTA 5D7IF 4NRXB 1A0QL 5T1KB 2CKBH 3IAPA 5IHUL 5TE4H 3RHWK 3HG1A 3EHBD 5E56A 2J5LB 2JE8A 4P5TB 4RFEA 3N1FC 1UCBL 4D0BA 1T0NA 2Z8VC 4MNHA 5HHMB 2V2XA 5I71B 3ULUF 4ODXB 1MFDL 1PG7L 3EOAA 2FBJH 2RBLA 3IDIB 3E8UH 2OX5A 3RGHA 1WBYA 4HXAL 5J89A 5AYQA 3NCJL 1MWAL 4GSDL 2NY1D 4FA8A 3SE4C 3WFDH 4W70A 1UM6L 4KMTL 4JANB 4H5SA 4P4RB 5DUML 3PXHA 2F8VA 3ZKND 5GS3A 4ELME 4PJ5B 4CADA 4PJIA 1GGBL 4CJ0A 4WGWB 1HH6A 4XVTH 5ISZB 2AK4B 5KSBB 2PXYA 5KANI 2BCKB 2YPLA 2PO6C 3G6JA 1GC1C 3MRNA 4S1DD 4K9EH 4DEPB 2FZ3A 3BEWA 1C7SA 5E9DE 2EKSA 4I0PD 4K7PX 2YKLH 3EGSB 1U93A 3UJJH 5J13C 3FQWB 1Q9KA 2D03H 4Z0BL 5DMYA 5ID0A 2P8MA 4EUPH 4QY8B 5HGBA 3L3OA 3U7WL 3A6OA 2FJGA 5DJ0B 1ACYL 3MRQA 4ZMAT 5DJ6A 5ICXA 5DFWH 1CD8A 1H9VA 2W9DL 3LN4B 1OF2A 4R6UA 4GXVH 2CSPA 2W0LA 4ZYKB 2FCBA 1H5BC 1FFPB 2W38A 4NC2B 5F9OL 3VXSE 4NPYA 3BEVA 2XXMB 2GT9B 1N6UA 1G7QA 4OZHE 3NGBC 1GXEA 2A73A 3UBXA 1AQDB 4PRPD 4DJMA 3FQNB 3CFCH 3MRDB 4CMMA 2ATKB 5TE6H 1XF2A 1AO7D 2ARJA 3HMWL 1U8NB 3L1OL 4UILL 4L1HA 1N0XH 2D4FA 4H25A 2EE9A 4WI4A 1FGNL 4WJ5A 3BP5B 5F7UA 2F58H 3RTQB 4OGYH 5C07A 5ACMA 5TDPA 4DQOL 4M6OH 3TBSA 1AC6A 4AMKH 3X14A 3T04D 3KYMA 1TVBB 3OKEB 3V6FB 2AJZA 3EJZD 4W4OA 3QXUA 4Q9RH 1CR9L 1IC7L 3QXAB 4ALAH 5BOZG 3NCEB 5FYLE 1N64L 4S0TD 3VXRE 4PJGB 1DN0B 4NGHL 4WENB 3WFHA 5MEPA 4U1KA 5D1ZB 4NFCA 1VESA 1U3JA 5K59E 2ZCHH 2DDQL 2IWGA 4UOJA 2UV3A 5JHLH 3MPCA 3RX5A 1LDPH 1DEDA 1RD6A 3PABA 1ZE3C 4K3EH 4WO4C 3TIDB 1X5GA 4WI2A 4YFDB 1FBIL 4OZGB 4KMQA 3PWLA 5EBLA 3D6GA 4R2GC 3U6RB 5IMMB 4PBVC 2JELH 1BAFH 1H15A 1RIUL 4XTRC 4KU1A 3RWFB 5IVXB 1DBJL 2YD7A 4ZFOB 3W0WD 1NFDE 2ZCKL 3IFPB 4NC1E 2AEPL 3LMJH 3T2NH 1MHPL 2XZCL 4I3SH 3QIUB 5IOPA 1BFOA 1MWAA 1X5XA 2WK2A 3RJQB 4PIRF 4GH7B 4UIKL 3PWJA 2E8ZA 4CDGC 2DQGH 1V3KA 3JWOC 15C8H 3VD9A 2H6PA 4JFFE 1KV3A 1Q94A 2AJYL 1D5MB 1NCCL 3O6ML 5DZNA 2VO5A 4HUUB 2MPAH 3MOBL 2AV7B 3MRPB 1UA6L 3V8OA 2XWJA 3SJVA 2HKFL 5DWUL 4DVRL 3ZE0E 2J1KA 4UT9H 3Q48A 1G0DA 4XGZA 4CW1A 4B53A 1A9BA 2OLDA 2NX5A 3Q6FA 5EU7E 3V5HA 1AR1C 4UV7L 1NC4A 4JFED 4P99A 2NLJB 4LFHD 4NO3B 3ALXA 3O9WD 4JKLA 1G7PB 4PRHD 4YZFE 3SKMB 4F15C 1RU9L 3VGHA 2HH0L 1SBSH 2I9LB 2QKIA 3AM8C 4U6TA 3S35X 2EYTB 4YHKH 3S4SA 4K94C 3D0VA 3VDBA 1KPVB 1ERNA 2ZKHL 1VFOA 4HWBH 3MLWH 5FYKU 3IU4L 1KTDB 3K8MA 1V3LA 3B4NA 4UUJB 5JDSA 4WWID 2BVEA 1F4WH 3AY4C 4YDLB 5MEOB 3X12A 3WNOA 1TQCB 3R8QA 1JF1B 5IBLC 1S7SA 3ZMRA 3P4MB 3FFDA 4KK9C 3P2TA 3VXPA 5IR1A 2NY1B 4ORGB 4KPHL 3DV6A 4HMCA 5IQ9A 3N85H 1BPVA 1MI5D 1F58L 4OBRA 5I8KL 4KQ4H 2CUIA 1FV1A 3N1QC 2CIIA 4W4NA 1SEBB 4FFWC 2DLFL 2YUZA 4JN1H 3QT2A 1S9WB 1DBKH 1ZT4A 3MBXH 1A7RL 4X8JA 1EO5A 3TP4A 1F3JB 3K4AA 4X6EA 4GAFB 3LKRA 3B9KA 4R3SA 4GG6E 4I0PB 1QHPA 1F6AB 5E8PA 1X5IA 2H32H 5E70A 2YD1A 4GS7C 3OAYH 4P5MA 2XN9A 4JGJA 5DEFA 32C2A 1OWWA 3BPNB 5FYJH 3MUGB 1NKOA 5LKNA 1IQDA 5BXFA 3HFML 1OGAA 2H2PC 4QYOB 2IF7A 5F7LB 4BH7A 4E0RA 3DX9B 1CGWA 3DIFA 3WIHH 3UYRL 4AENA 4KTYA 4UOW1 3MV8E 4R0LA 1WFOA 3PJSA 5INDA 2HJLB 4OUUA 1DBML 4KHTL 4H0IA 4Z7QF 2EZ0C 4PJ8C 4PRPB 2J3SA 3NABL 4LLDB 1AO7B 4F7TA 1T80A 3PGDA 3MACL 3FFCA 4WFGD 1ZGLB 5LBSH 1I8KA 3V6BR 1A6VL 1QEWA 4O2CB 3ZKSD 3NCBB 2VIRA 1G6RL 2WSKA 4LSQH 2O5ZH 4MHHG 1QFOA 4J4PD 4PJCF 1RURL 2MNUA 3VD7A 2Q8BH 1BOYA 1RUPL 4ZUSB 5BVPL 5DHVA 5DFVC 4XCYA 4LCUA 4YAQA 1NL0H 2XQBH 3I6LD 4LLMB 4TUJA 1D6VL 4YIQA 1RZ7H 3MYJB 4WO4D 4P23A 4IRJC 1TLKA 1AE6H 5FOBB 3QDAA 1D6EA 3DX6A 2X4UA 1NUFA 1B0GB 1QR4A 4Q6YA 1F00I 1QSEE 4PJXE 4X6CE 1UH3A 4R2GD 5DTFB 3VWKC 1T20A 3W39A 4Z7UE 3H3KA 3U30C 4YE4H 3VI3F 5I1JL 1CDCA 3S7GA 4OV5B 2VDLH 2HLFC 4XP9H 3D85A 4XNUL 1MRCH 1KEMH 1M71B 1PJ9A 4MDIB 4OFYD 2R4RH 3RVUC 2DJSA 2Z8SA 2GQHA 1AXSB 3EW3B 5F7NC 1DQQA 5SWQA 4V1DA 2VDQL 3LEYH 4KV5F 4MXVE 1SJHA 3W0WB 1E4KC 2BVUA 3NCYP 4I9WD 4JM4L 4PRNB 1MCEA 25C8L 4MB4A 3CK0H 2EIZA 2B5IB 4EBQL 1FYTE 3QFDB 4DUWA 1S7QA 3IVKB 3ARGA 3K0WA 3ULVF 4WY7H 4LKXA 3VFPA 1IMHC 4MCYA 2AERT 1S9KC 1WGOA 4G42A 4LVHC 4N5UA 2QQLH 1T7XA 4HWEH 2GCYB 5A43C 1OTUC 5HPMA 2Q6WA 4NJAL 1EUTA 1EERB 4O2EA 5EU3B 3RPIA 3V0WL 4C55A 1LO5B 5FGBA 2IPKB 1A9EA 5I1EH 4ZS7L 5L2KE 3MQIA 4KK5C 1ZT1B 3QEQE 4RRPA 1UM5L 1MVUB 2XKSA 1AR1D 5E2VL 5GZOD 3VCLB 1LO2L 2OJEA 3RDTA 5HYIA 2HFFB 4K7PY 1MSPA 5FA3A 1XGUB 2MWCA 2FHCA 1T1YB 4ENED 3LEVH 4YEEA 4JFEB 2HT4C 2R69H 2IADB 4LSSL 4XAWH 1NEUA 1KIPB 3O9WB 3SDYH 2OR7A 4PRHB 1IGIH 2C3VB 1AFVL 5FYLH 4UQ3B 3BHBB 4LU5H 4Z7OE 3DVNB 4IS6A 3ZE1E 2YUXA 1JPTL 4JKPL 2IG2L 3H9SD 3VRLE 4EQ3A 2BNRE 2H9GA 4PJ9A 2YPVL 1IGML 2WBJC 4LHUD 4I18B 4AEHL 5C0NC 2I9TA 5HHPA 5IBLD 3RQ3A 4N5ED 4KK9D 3T77B 4Z8FH 3HG1E 1BZ9A 2L0DA 2A38A 4I13B 3GB7A 4RNRB 4OD2A 4OFKA 2UYLB 4OBSA 3WKNA 1P4LA 1YN7A 1JFQL 3KLAB 1JYVA 3PL6C 1G6RA 2WV3A 4FFWD 4L4TA 4QHLB 1I75A 5GS1B 1R3HA 3DMMC 4QRPA 3RNKB 4LLQB 3KPNB 3I2CH 4XH2B 5DJZB 3L5IA 1MI5B 4X80H 4L8CA 2WINA 3ZDXF 5GRWA 2YMXL 1CD0A 1YMHA 3FOMA 4JO4L 4ZUTB 1FFNB 4X98B 1BZ7B 5E8NB 4HIXL 4IRSD 1JWMA 4ZPVB 4OZIB 5DJAB 1IAIH 2ADFL 4LLAA 4O4YL 2QBWA 5J13B 5HYJA 3IKKA 1OTTC 3IGAB 1HH9B 5JMRA 1JUFB 4N0UA 3B83A 3L9RA 4OQTH 4RMSA 1Z6JT 1WTGT 2X4QA 4ZTPL 1WIOA 3F8UB 4PJIE 3SQOL 3A6CL 4QRUA 3DROA 5C6TH 1G84A 5C6WH 1JPSL 2VQ1A 2YPLE 5A2KH 2H2PD 4X7DC 3G6JE 5IB3B 1NGZA 2BVOA 2ICEA 3DV4B 5F88B 2WIIB 1H5BB 1M6OA 1NGQH 5BJTA 1OTSC 3QQ9C 5HI5D 2IJ0C 3JV6A 4MLIA 1DFBL 1HXYA 1MOEA 4DTGL 4HIHA 3EAKA 3EOTL 2NMSA 3KYNA 4U49A 3LN5B 2YK1H 3NGBB 1P6FA 3TNMB 1IGYA 3FCTA 2H3NB 5FAAA 4OCSH 3S3JA 4HKXB 2EZ0D 1VPOH 1TZGL 3MZTA 1A6AB 4G6JL 5J12C 4M7JH 1NMCC 4XPGH 5C0CD 2Y06L 4LEOA 2VH5H 2DQTH 4KI5D 1ED3B 3MUHL 3DUUA 4LEXL 4GKSB 4FXKA 5IUSA 4FQXD 5E24E 4WIQA 1DR9A 1FL3B 2D3VA 3QO1B 5EORL 1ZLWH 1MLCA 1ZANH 5I30H 4H8WL 1EEZA 4XNQB 4PGDA 5IB1B 3ZTNL 1CXEA 3NOIA 1INDH 4YHOL 1KCUL 5SWSB 3PQYD 5KN5B 3ZE2E 5C0AA 2HRPH 5F3HB 3VFTB 3BSZH 5TDNB 3HTLX 3GMMA 2BOBB 4IRJD 4KUZH 4TVPL 4HKJB 1HEZB 1FNLA 3AB0C 4KK8D 4LP4A 5ESVA 2NW3A 3QNYA 5DURD 3D0LA 2H26B 3VW3L 4LRNH 3VWKD 1IGTA 1DDHB 1OM3H 1QYGH 3EZ8A 3TVMC 3HI1A 1AGCA 2MQ0A 2YC1B 5C07E 1TETH 4NDMB 4XP1H 4WO4B 5DDHA 4XP6H 3SCMA 3ZTJG 4JM2F 3RVUD 4M5YH 4I2XB 4R2GB 5DJCB 1MFAH 3HZYA 5E1HB 1ZHBA 4XPFH 5ALBH 3FB5A 4WEUD 5DZOA 3G5YA 2QR0A 1NGPH 3HE6A 3SEPA 2J12B 4WHYH 1S9VA 3CXDL 5IB5B 4JJHA 3OGCB 2OL3L 3IETB 5ESAB 5FO8B 2OZ4H 1GPOH 3KPSD 4Y5YA 5D7SL 2WUBL 4LCYB 3WL9B 5CEYB 1YECL 3RVVD 2VLLA 2X4SB 3WJJC 4HEPG 6FABH 3EFDL 2W9EH 1PZUB 1T21A 4WFEE 2AXFA 5HI4D 1B2WH 4Q0XH 2CDEB 5C0DB 4AM0A 4ODHH 2JIXD 2CKNA 1A7NL 2C7UB 1U42A 4RFOH 5T5FH 3GSNL 5SWZD 5TGBB 5TH2B 2H2SC 1MIEH 1GL4B 3C5JB 4LLYB 3NN8A 4GRWE 3HPJA 1TCRA 4G8GA 3R06A 2VC2H 4ETYA 4YHZL 5CP7A 1XR8B 4GW5B 2DQHL 3B6SA 3KNBA 2HJKA 4PB0L 5EIIB 1TNMA 2VZSA 1R24A 4F15B 4X7CC 4WWKC 5CGYC 2VNCA 4JDVB 5I76A 1LP9F 3OF6D 3SJVE 4YK4C 4C56B 2V2WA 4HZLA 1G7IA 4K3DL 2E9WA 5DC4B 2D31A 2C5DC 3X3FL 1KXQE 2FIRT 3WMSA 5GGTL 2XACC 4RGOH 1UXWB 2NX5E 1H3UA 2R0ZL 3SKUD 5D2NB 1N26A 3VMOA 3H9SB 1KUMA 3CFKA 3TO2A 1FVEA 2V7HB 5JPNA 4LHUB 3CSPA 3HNSL 4YLQT 1QR1B 1H8OA 4F8TA 2DI8A 4JFDD 5E95B 3DMMD 1LO0L 2XKNB 4WNQA 1ZLUK 1J1OH 1QBML 4LARH 4Y1AA 1AXTL 4LRIA 1CLZH 2X9WA 2VITB 5MEQB 3B9DA 1JZ6A 5DMKA 5GSVB 3DURA 1JHKH 4NT6B 3HUJA 3FQUB 2BSED 3NFSH 4XNMB 4CN6A 3SE3C 1AY1L 4M1GL 4XP4L 1CQKA 3IS0X 4WRLA 5DGQA 3PWNB 4IRSB 3QCTH 2H8PB 1CXIA 4Y8AA 3OPZL 4GW1B 1PLGH 4FFVC 1JGEA 1ZWIA 3ECBB 4GS7B 4FQ1L 4PGBB 4YFLF 3QQ9D 3TJHC 4YHIB 4MLSA 4X6FA 3ZHLA 5C70A 3RNQB 2AGJH 35C8H 3WBDA 1OWRM 3U7AA 4PJFF 4PJ7F 5CJQH 2QQKL 1YDPA 2DIBA 4XBPA 1B0WA 4HF5L 3C6LA 2OL3A 4BZ2H 2X89D 2Z31C 5DZLA 3L3GB 4HT1L 1XMWA 3KJ6H 4P9HH 3FRUB 3DX7B 4KC3B 2XN9E 5T33H 5C0CB 3CU1A 5T1MB 1F42A 4Q9QL 2QQNL 2UWEA 2APXA 5T1LD 4OF6A 1X5JA 4FQXB 5HHNB 1JZ5A 4P9ML 1ZA3A 2XPGA 5IQ7H 1OGAE 4AG4H 2QV2A 2X4TA 4QRTA 4LSRH 2J88L 5BW7C 3VFOA 3GSNA 1J86A 3MXWH 3T0DA 4GBXD 1WBXB 4IMLA 2F53D 3BWUC 1EJOH 4K23L 3IJYA 3B2VH 2NY5H 1I3GL 2EDKA 3PQYB 3WO4C 2F54A 3DGGA 3V5KA 2VYRE 5B8CA 2X10A 1YMMD 2R15A 1LK2B 3L7FA 4IRJB 1LO3L 4O58L 1I1AC 5EZJA 5AZ2H 4MMZC 3FFCE 4MX7B 1R5WB 2GTZB 5F89A 5T1KA 1FZKB 2ADJB 2C4XA 1LVEA 5DURB 1HK6A 3VWKB 3LKQB 4UBDC 5ILTL 1WWWX 4DFIA 1R5VB 5D1QA 4P5TA 5HVHC 5IFHH 4M43H 4XNYH 5D71L 5BV7L 1A7QH 4ODXA 5ICYB 3VFWA 1IGCL 5ADOL 2FR4B 2XZAH 1YNLL 3JXAA 5AWNH 4J12A 5C08D 1MHEB 5GGTA 3B3IB 4HMDA 1JRHL 2XYCA 1KGCD 3IDIA 3MV11 2ZG2A 4M9PA 4QXTB 3I6KA 5C3LD 4H20H 1FVCB 3GGWB 2VXTL 4ZOCA 2KDGA 3FO0H 4Z95L 2MFNA 1EPFA 1TTGA 4MA3B 2DYPD 4JANA 3KPSB 4P4RA 4KH2A 1HSBB 5ADPH 3GBNL 5CD3A 2VLRA 2BVTA 4N9GB 3OXRB 3EYSL 1MPAH 5ISZA 3DPBA 2ZSVB 5D7LD 4LSUH 4LVHB 1EHLL 5C86A 2BRQA 2FSEA 2ZP0T 4KJWC 4YDVB 1YYMH 5IG7A 2H2SD 4D3CH 4V1DE 4RGNC 2Q86B 4UTAL 4LVNC 4ZAKC 1CDUA 1BBDH 2JIXB 3BP7B 4TN9A 4LAJH 5MHSD 4R96B 2EEAA 4ERSL 2BY1A 4QY8A 4Y89A 3KHOA 1NMBL 1CU4L 4WWKD 1JZ4A 4U7KA 3PV7A 5CGYD 4WHCA 3NTCL 5DI8B 4NNPH 1FFPA 1ZVSB 1KB9J 2NNAB 3A6BL 5E2TH 5CHNB 2AQ3A 5JMOC 2YHGA 2G5RA 3D2UB 1UYWL 3IDMB 4U3CA 1BJMA 1AQDA 3K7UA 2E7LC 4NM8L 1A6WH 3MRDA 2WWMC 4ELMF 3P73A 2BVQB 4HIEA 1NGYB 4JY4B 4KY1L 5J7CC 4X5LA 1U8NA 3SQBA 4B0MM 3FTGB 3BP5A 3MRBA 1CTNA 4G9DB 4NWTL 3MRHA 1RZIB 3UPCA 2N1KA 2E6PA 1G7JA 3N50A 3WIIH 5JORA 3MO1B 1WEJL 1MCWM 2EDLA 2A0LC 1TVBA 3V6FA 1HYRC 2DQUH 3NA4A 4JFDB 5BMFH 3DMMB 4RQQB 1ES0B 3I6GB 4BK4A 1XF5A 3WXWH 3HNVL 3QJHB 2VR5A 5D1ZA 5E6IC 5D7JC 4POUB 3QI9D 5EUOA 1A0QH 5IHUH 4U0RC 4KKBC 1G7LA 1UZ6E 1YUHA 4FFVD 2DBLL 4YFLI 1IAKA 1UCBH 4OZHF 1J0HA 4HPOL 2GAZB 2ZOKB 3WEXB 3AROA 3PWUB 4L4TE 4PR5B 3U6RA 1J8KA 1MFDH 1PG7H 1X7QA 4QRPE 1MUJB 3CFEA 3C60A 2Y6SD 4Y19A 3GHEL 5MERB 3SGJA 4AJ0A 5DT1L 3RWFA 5IVXA 2VDPL 5CBAB 5L8LB 5CWSA 4IRZL 3IFPA 4CJ1A 1HKLL 2EIDA 4HXAH 4GRWH 4NUJA 3NCJH 1MWAH 2DKSA 2F15A 5HYJE 4GKNB 1UM6H 4MQXC 3HPLA 4KMTH 4N0UE 5DUMH 1VEOA 5DSCB 1ZMYA 3UTSA 4PB9L 5ELIA 3ARED 3FRPG 4ZXBC 3C2AL 2UZXB 3WFEL 2F9BT 5F71A 4LAQL 3RI5K 4S1SL 5ECJE 5K59F 4HS3A 5CGTA 2AV7A 3MRPA 5T1LB 4ZD3L 4Z0BH 2X4OB 1RZKC 3CC5B 1BX2A 3U7WH 5D6CB 1JIBA 4FQJL 4GBXB 4L9LA 1ACYH 2F53B 3AB0B 1NAMB 4WDIB 4Y4HC 2W9DH 2BJML 3W2DL 4UBDD 4QF1A 4NO3A 3CX5J 4X9FA 3RAJL 3BKCL 1NFIB 1R0AL 1NFDF 3DUHA 1YMMB 5F9OH 2I9LA 1K8IB 4GOSA 3UTZB 3MBEC 3LV3B 1P9MC 1DANU 4R4BB 4DKEL 2EYTA 2NTSP 4LF3B 5C0AE 3VFVA 4TTGA 1SMAA 4HGWB 1IARB 4GAYB 3MRLB 3OKLA 3HMWH 4WU5B 3EDEA 4KVNL 4JCMA 4UILH 4MNGB 5EU4B 4MGXA 3KGRA 5C08B 2A74A 4P2OC 3UO1L 4NRYB 3CH1A 4EVNB 1SYVB 4FXGB 2I5YL 1U58A 3HC3L 3FB6A 1CR9H 4KUCD 3ZE0F 1IC7H 4PTTB 1N64H 4KJWD 3FAWA 2DYPB 4NGHH 4RGND 2LQRA 4OB5L 4ZAKD 2QHRL 4YPGA 4QT5B 2YUWA 3HZVA 1SEBA 3FMGL 1CGVA 5D7LB 4K07A 3TF7C 2P8PB 5SX5K 5C71A 3ARDA 2DDQH 4QHNA 1A4KB 1F90L 2CGRL 3SN6N 5I0DA 5GGRA 1KLGB 3QXDB 4JAMB 3D25A 5DRNA 1LDSA 1FBIH 2ED9A 5C0JA 4P49A 4PJDA 2FRGP 5F6IB 1CXHA 1RIUH 2ZOLA 1LEKB 4KVCH 4XCNA 4BQ9A 1CGUA 1DBJH 4HIIB 1PG7X 2O5XL 3H2WA 2ATPB 4WWKB 2ZCKH 2NXZC 4P3CL 1QBLL 1PY9A 3VGAC 1BGXL 1PVHA 1MH5B 4QYOA 1MHPH 2WMPA 2XZCH 4YK4B 5AYUL 5E99L 2WWMD 3DX9A 4Y4KC 3WFCL 1KENL 4G8GE 2QSCL 1DUYA 4UIKH 1L9NA 3DBXB 4I0KA 1TZHB 2MCG1 2XTJE 3VRIA 3GMPA 3D3VD 2W0FB 4LLDA 1D3CA 1AO7A 2OK0L 2RR3A 1HHIB 1WCBB 1NCCH 3C8HA 3O6MH 3PWVB 4D94A 2I27N 5HYSB 4P3DB 4TSAL 1ZGLA 3RWHA 3QAZC 3MJ8B 3MOBH 4N1EA 1UA6H 3MRIB 2FIKB 5GS0D 2HKFH 5E03A 1UQSB 4DVRH 4WV1B 3JWOH 3U0TB 5GZND 3EJJX 4GG6F 5JZ7D 5DHVH 1INQB 4UAOC 5E6ID 5D7JD 5AD0B 5EC1A 1BWMA 4UV7H 4ODUB 1I8LA 2D7TH 4KKBD 5FM5O 3QNXB 2DLEA 3MYJA 4QNPE 5FOBA 4OAWB 1RU9H 3BP6A 1B0GA 3QI9B 5DTFA 3RL1B 2Y25A 4HLZH 5GJTL 4WI9A 4OV5A 4JR9L 1KJMA 2P7TB 4HZAA 4PREB 2ZKHH 4Y1AE 3BP4A 5J9PB 3O2WL 1A3QA 2OR8A 1U8PB 3ILPB 4O5LL 4CU8A 4LHQB 2ZUTA 4YHPB 5FO9B 3HUJE 5J57B 1YEFL 2X70B 3GBML 4TVPE 4V2BA 3QDGD 2JJSA 4MQXD 3W0WA 3VDAA 4Z7VB 4BFIB 4J3VA 5F1KC 4WFHE 1XGTB 3KVQA 5BRZD 4NBZB 3QEGH 5B4MC 2I07A 2HJFB 5CZVL 3IVKA 1PQZB 4TSCL 2A6KB 3N1PC 4N0FB 4KPHH 4Z18A 5MI0C 1X5AA 2VABA 1F58H 5I8KH 3OJDA 4K3GA 1F3DH 2IBBA 3AREB 1P5UA 5B21A 1W72L 1DJSA 2OCFD 1TJHH 2FL5B 3EYVA 3VXNB 1JP5A 5ERWB 2D4DA 5HVFB 4PJXF 2RIKA 4X6CF 5D2LB 1ZT1A 4Z7UF 4X0KB 4Y4HD 1CL7L 3U4AA 4BSWB 2XY1A 1I7UB 3WO4B 3I3EA 4UV4L 4F57L 4U6VL 4JY5L 5F6HI 1MJ8L 2W07A 3I9GL 3LB6D 2UWEE 4PGJA 2DLIA 3HAEB 3P30L 2C3HA 3MNWA 3PP3K 4JO2L 3HFMH 3INUL 4NWUL 3O9WA 1L7IL 1YYLL 2HWZL 5HVHB 3BZ4A 3LH2L 5BQ7A 3UYRH 4RFNC 2VJXA 4UQ3A 4X5WB 5KSAD 2AJXH 4HJ0C 5DHYB 1IKNC 5DMGC 2MTPA 1DBMH 4KHTH 3HC0A 2R56L 3DVNA 2F54E 4OIIL 3VI4F 1U2HA 3NABH 5MP6L 4I18A 3ULUC 1KN2L 4KXZH 2BY2A 3LD8C 5DD1H 3MACH 4NHCL 2A77L 3SGDH 2OI9C 3T77A 3BKYL 1BVKA 3GJFA 1A6VH 3O4OC 4WW2F 4F33B 1G6RH 3UPRB 2UYLA 3P0YL 1CFNB 1RURH 1QFWM 2B4CC 2XXCB 4ZQKA 5EBWA 5HHME 4DVBB 3HRPA 4QHLA 5GS1A 5BVPH 4D9QD 4LLQA 3KPNA 4ZUVB 2CDFB 1RJLB 3N1GC 5KW9L 2IEPA 2C26A 4RGNB 1UH2A 4NN5C 1D6VH 4LVNB 3TA3A 1FNGB 4G6MH 4ZAKB 4XAKD 3RIFK 5E8NA 3MV7D 1OAXL 4OZIA 1A22B 3CMGA 5DJAA 1W0VB 1UKTA 1CIUA 1I9JL 5B38B 5I1JH 1JUFA 4EXKA 5C0RL 4XPAH 2VLRE 2X4NB 4J8RB 4XNUH 3OHXB 2XA8L 3RL2B 5ISZE 2HTLC 4Z7OF 5K9JL 5DD0H 5GPRA 3DGCR 1G9MC 4AH2B 3VRLF 1UGNA 4NNYA 2C1PB 1ZS8A 2VDQH 1H5BA 3KLSA 3L7EB 4Y4KD 5CGMA 1YC8A 2DQEL 2X4RA 4M6AA 4YWGH 3TNMA 25C8H 5ANMA 5IIEB 4EBQH 4M61B 2WBWB 3M45A 4L3ED 1KB9K 1A6AA 1JNLL 5FKAA 4FS0A 3EO1A 3WCYA 4P2RA 4MSWB 2Z35B 5IEKB 1TENA 4GKSA 1U36A 5H37G 3FT2B 3D3VB 3GM0A 4NJAH 2C4FU 3QO1A 3CFBB 4UDTA 3V0WH 3WDIA 1W72A 1WLHA 4ZS7H 4TNVK 5IB1A 1CG9B 4UOW0 5HDBE 1MCLA 2V17H 5L0QC 3T8XA 1FO0B 3U4BL 5E2VH 5KN5A 4OKVB 1LILA 2VXSL 1L6ZA 5F3HA 3VFTA 3O3AB 1LO2H 3WN5A 3JWDC 3AAZB 4J4PA 4ZSOB 4PJIF 1H3XA 1SYSA 2XA3A 2XWBA 3UPAA 2BOBA 3VG9C 5FA4B 3GIVA 1HEZA 5E6IB 5D7JB 5I8OL 5JNYA 3G6JF 5HGGS 1EAJA 4U0RB 1DDHA 2EO9A 1ZXQA 2YC1A 4LSSH 4EIGB 4PRIA 2EXYC 3OV6A 3OJVC 1AFVH 2YSSB 3QFJA 3A0OA 5DJYB 1L9MA 1D5IH 2PCPB 3S9DB 5KS9F 1JPTH 2VLMD 4JKPH 3LSOB 3MUZ1 3LKSA 2YPVH 1IGMH 4GAJL 4UIMA 4AEHH 3GSWA 5EUOE 4XVUC 4ONOA 2HRLA 3L5JA 5JOPE 3OGCA 2UZIL 5DQDL 1BLNA 1XZ0A 3IETA 4L8SA 5ESAA 5FO8A 3QDGB 3QISA 4ISVB 4JQXC 1Y6NR 1DVFA 1RFDL 3AS3A 1QLFB 4LCYA 3WL9A 3LQMA 4QHUB 5BRZB 1JFQH 5HGAB 4JQVC 3EDKA 1BVLA 3ZE2F 2JB6B 4HMEA 1NLDL 4NUGL 4Y19E 4POZC 2Q7YB 3JTTA 4OZFB 5C0DA 5IVXE 3UYOD 1HE7A 2C7UA 2YMXH 4JO4H 4R8WL 4PJEB 4HIXH 2CUMA 4QRQB 1F8TL 3K74B 4MD4A 4ODVH 4N0CC 4G8EB 3RY6C 3K2MC 3RJDA 3VGEA 4ZTPH 3GSVA 3UTSE 1JGDB 3SQOH 1SBBA 1XR8A 1P4BL 4JDZA 2VKWA 3A6CH 3QXVA 1VACB 4Y4HB 4UDUA 2YD6A 4M62L 1HXMA 1JMXA 5I8EB 1VCAA 5H94B 4WFFE 3PWPD 5EIIA 5JIHA 3FQXA 4OGZA 3X3GL 1WQVT 1M05A 1DFBH 4DTGH 3EOTH 3MBEB 1E4XI 4HJ0D 4MZ2A 5C8JB 3CX5K 2AJ3A 4APQD 3DXAB 4OLYL 4JHWL 4LK4A 4K71C 2VL5A 4FFYL 5F7EL 4HV8A 3ULUD 3FN9A 1PAMA 4F9PC 5KSAB 2NZ9D 1YEJH 4GLRH 2ENSA 4FFZL 3T2PA 5HYQA 4LEXH 4I1NB 5D2NA 3O4LD 1T1WB 4P2OB 4IHOA 4HWNA 5CZXC 5HD8C 3UEZA 4NKOA 4LHUA 2JK5A 3U9UB 3O3DB 3R1GL 1QR1A 1S7RB 4H8WH 4MJID 3OWEA 3B8YA 3ZTNH 1DLFL 1ORQB 5F97E 1JV5A 4YHOH 4GRWF 1KCUH 4FZ8H 1TCMA 5HGHB 4NYLB 1PX4A 3F7QA 5DUBA 5JW4Q 1GIGL 3VU2A 2VITA 3ILQC 3OL2A 5IBTL 4Z7WB 4HKZA 2IMNA 4TVPH 5JTWA 5GSVA 5JXEC 1AR2A 2V7NB 2NTFB 3MA7B 4HFWB 4XNMA 3VW3H 1QUNA 2VDRH 3HMXL 4KWUA 4U6HA 3BYYA 3QZWB 3MV7B 3I84A 3W9DA 3RWCB 4IRSA 5EDXA 2HTLD 4ZUUA 2H8PA 3NZ8A 1S5HB 1S9XB 3ECBA 2ZUUA 4HK3N 1W8OA 3TN0A 4ELKB 2NY0D 4XWGL 1XCQA 3MOAL 3RNQA 3CXDH 2NXZB 5HYEA 1T2QL 2FYYB 5J8OA 5DQ9A 2GSIB 2OL3H 4M7LL 1IEAB 1ZHLA 1CGSH 3LEXB 4Y4KB 2Z0BA 3BUYA 1FLTX 4KRLB 3S36L 4JRXA 1YECH 2ZJSL 3L3HA 3L3GA 4NCC2 5IFJB 4PJDE 5LQBL 4L3EB 3BWAB 3DX7A 2YPKA 3F7YB 5CJXC 5C0CA 1LD9B 3LKNB 3GMRB 1YNTA 1A7NH 5FO7A 4QRRD 3QAZB 4FQXA 3RU8H 2ICWA 3G5VA 1JZ3A 2WP3T 3WJLC 3I50L 2R1WB 1A6ZA 2CDGB 3O11B 2EYSB 4UAOB 5ETUB 4NSKB 4FABL 1RZJC 4CN1A 1EAPB 4JFPB 2DQHH 1K6QL 3ROOB 5FV1L 3ARBA 4PB0H 4WCYH 1AO7E 4NIKB 3H3PL 4LSDA 1LK2A 3BE1L 4IEFB 2Y5EA 3BI9X 1QQDB 5IP4A 4MX7A 5KTEL 1R5WA 4M6ML 4LIQL 2ADJA 3SE9L 1XGPA 4GUPA 4D9RE 2K7QA 1HZHH 2NCMA 4E9LA 4X99B 1RZGB 1I9RL 4F9LA 4K3DH 3U9PL 3HC4L 1T0PB 3KPPB 1FNEA 1D5BB 1MCBA 2B0SL 2WP3O 2FR4A 5KOVC 1TJIL 4XVUD 3RIAF 2R0ZH 3ISWA 3T0EC 3B3IA 4Y4FC 3G08A 3FB8B 3JZ7A 3BAEL 3TBVA 1JVKA 2GI7A 4QXTA 5I73C 1CICD 3PDDA 1E4KA 1FVCA 3HNSH 3GGWA 3MFFA 2PYFA 5BS0A 1HN1A 2AEWA 3MSPA 4MA3A 5F9DC 1JGVL 3WO3B 5MI0B 2B2XL 1I9IL 3IJHB 2JCCB 3RFZC 1T6WA 4LSTL 3OXRA 1QBMH 1AXTH 4QRSB 1DN2A 3VFMB 4HUVB 1W8NA 5GRXG 2HN7A 4JFXB 4N0CD 4DOHE 3ULVC 3MRRB 3KPMA 1RJZB 1UJTA 2MOVA 1AY1H 1KACB 3E2HB 4TVSa 4XCFL 3W0WE 4XP4H 2DLTA 5KVFL 3BP7A 5FDWB 5JLZA 2FX9L 1YA5A 4N0RA 3HMXA 5SWZA 3OJMB 3GIZL 3DI3B 3OPZH 1DLHB 1NAML 4TULL 5DXWA 3SOBL 4FQ1H 5EU5A 1WBZA 3H9HA 3C6SB 2E8YA 4FQHB 1IE5A 1U41A 4LHJB 1DL7L 4U1JB 2QQKH 1RK0B 3PWPB 1L7TL 3QO0A 5J6HB 4HKBB 1CBVL 1H3VA 3GSUB 5CHNA 5D7IB 4JPIB 4RFNB 2FD6L 3G6AA 3DO7B 1QACA 1AD0B 3ALPA 4Y5VA 3OF6A 4APQB 3WNKA 4HT1H 1QO3A 4WHTA 2BVQA 1E27B 4JY4A 5CSZB 4LSPH 1CDIA 2DN7A 5CINL 1MLBB 2FWOA 2VWEC 3LD8B 5BCAA 4Q9QH 2QQNH 3MGOA 3FTGA 3V52L 1Z2KA 1AQKL 2OI9B 2YD2A 3LRSB 3O4LB 4DKDC 1QHOA 4P9MH 1T83C 3X17A 2J88H 3MO1A 1S7WA 2YZ1A 2ZUVA 3GMNB 4F3FB 3SGKA 2W9LA 3ILQD 4MJIB 5KG9B 3REVB 5KSVB 4Y0GA 3BPLC 1GJIA 1OGTB 2HYMA 1DUZB 4K23H 3SKNB 1ES0A 4FQLL 1I3GH 1EFXD 2J6EL 3QJHA 4JG1L 2ZPKH 1I3UA 1LO3H 2GHWB 3QUYC 4O58H 5ITBL 2IALA 1G6VK 3BJ91 5DMIL 4JDTH 5ILTH 1KJ3L 1FL5B 1N6QL 2ZOKA 3AXLB 4TYUA 3CJJA 4P57B 2E7BA 3HRZB 5D71H 1AJ7L 5BV7H 1IGCH 2BHYA 4Z76B 4LCWA 1YNLH 1YZZA 1WV7T 4KKCC 3O6FA 1KLFA 1SEQL 1JRHH 3GK8L 4ZODA 2NY0B 2WNGA 5HHOD 1BVZA 4OZIE 2O5YL 2VXTH 5F72S 1D7FA 2I60L 4Z95H 3TH3T 4J6RH 4GKNA 1BM3L 3X13A 3GBNH 3NFNA 3RWIA 3ELAT 3O2VH 5LGHL 1HQRA 3EYSH 5ACZA 1I3RB 1EHLH 4DCQB 4NHUB 3QUXC 1J88A 1SQ2N 4UU9A 4UTAH 4OI7A 4MJ4A 2AJUL 2DM4A 4POYA 4QRRB 3OZ9L 4YDJB 4EUPG 2ZUWA 3T65B 5L0QB 1CWVA 3QUZD 3WS6A 5ANME 5DO2C 4YNYA 4ERSH 1FFOB 3IYLW 4MB3A 1NMBH 1N8ZB 2BC4B 4P2RE 3ARUA 1CU4H 4GBXA 1W0YT 4KHXH 1NAMA 1GGCL 4WDIA 3MYZA 1IQWH 2RJMA 1UB5A 3NTCH 1U8IB 1W0WB 4IJ3B 1JF5A 1YMMA 1U2CA 2JLLA 3D39D 4S1RL 3VRJB 4QXUL 3A6BH 1MAJA 4X83A 4WFGE 3UTZA 4WI7A 3SHSA 4P48A 4R7NA 5DC0A 3RVXC 1TITA 4LF3A 5F9JB 4EI5C 4NM8H 4Y4FD 4N68A 4NC0B 4K9EC 3UTPD 2AW2A 4MQSB 4KY1H 4WU5A 1NBVL 4JM2C 5IV2A 1P4IL 5EU4A 4V2CB 2YEZB 4NWTH 4PV8B 2YRPA 3BIKA 4DN4L 1CLYL 3BRGC 4PRIE 1CICB 1WEJH 3QWQB 2HMIC 3O3EA 1S5IL 1MY5A 3QFJE 5D96C 2VZOA 3P4LA 3QCVL 1G7HB 1DQMH 3IDGB 2MSPA 2DYPA 3ULVD 3U46A 3B9VA 4QT5A 3SO3C 4Q6IC 3E3QC 4PRAB 4I48B 5D7LA 1HHHB 1P6AB 2J6EA 4NNXA 4EN3C 4Q2ZA 2EDOA 4U6YB 3WHE1 2DBLH 4OCRL 3H7BB 3QXDA 3S37L 4I9WE 3T0XA 3GMOA 4LCCC 4HPOH 4JN2B 4TUOA 1KC5L 4E42B 2Y4SA 1Z0NA 1X4YA 4QHMB 4X4XB 5DT1H 2IQAB 2VDPH 4HIIA 4KDWA 4R9HA 1FZOA 3QP3A 4Y5XC 1HKLH 5AUMA 2Z93B 3SBWC 3UTQB 3OR6B 1S7XA 4HIJB 5HGDA 2VUYA 4K71B 2HVKA 4LGRB 2LU3A 1NJ9B 4FOMA 1BQHG 4EEEA 4PB9H 5C09A 5D70L