3N85H

Crystallographic trimer of her2 extracellular regions in complex with tryptophan-rich antibody fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSIWWSWIHWVRQAPGKGLEWVASISPSSGWTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWWSSAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between HER2 and an antibody paratope formed by side chains from tryptophan and serine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
molecule keywords Receptor tyrosine-protein kinase erbB-2
total genus 39
structure length 214
sequence length 218
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n85H01
3EDEA 3T2NH 3MRLB 3QP3A 3T1FA 2IH1B 4J1UA 3PWNB 3WJJA 3DI2B 3W11C 4GLRI 4PJXA 1M7DA 1YQVL 4LL9A 1V3KA 3WHE1 1IL1A 1GGCH 1AI1H 1DFBL 3GHEH 4NRYA 4XC1L 5C0BA 2VLJA 3GBNH 2CGRL 4CNIB 1XGPA 3QCTL 5I1HL 5DT1L 2MHAA 1KT2B 4UT7L 3AROA 1NCWL 3QJFB 1CICD 1NFDE 4FQXC 4HS3B 2EZ0C 4CJ1A 1FVDA 4FA8A 1NANH 3KPPA 1B88A 2OI9C 4XHJC 5E08H 4IOFC 1U42A 4PRDB 2P45B 3OXSB 4FQCH 3RWDA 4P3CL 3S5LB 4AL8H 5KSAB 4ODXB 5I8CA 4NWUL 4F15C 4G9FE 1S5HA 1JUFB 1UXSA 3IB4A 3WEXA 3QDJB 4P5TB 1I7RA 1S7RB 1PG7X 4UT6L 4FZEH 4Y4HC 1NJ9A 2CDFA 2FD6H 1I7UA 5FHAL 1G9NL 1BX2A 2ED8A 4G8GE 2GTWA 2XZCL 3DSFL 3M1BA 5EOCH 5HDBF 1QYGH 1B2WL 1QFWH 5HGGS 2B2XL 1HCVA 5JXEA 1UYWH 3MFFA 4XCNA 5I8KL 1ZHKA 3KPQA 4M00A 3O4LB 4JM2D 4N9GB 3FB6B 3DGGB 5EZIL 2X4PB 5L8KB 2YUZA 4W70A 3RDTA 3MLTB 4GRWH 2F58L 3HG1D 5DTFA 2X4TA 4LRNH 2Y9RT 2B5IC 5MEQA 3PABA 3AS2A 1X7QB 1MHCB 1BFOB 2AERT 3V0WH 5C0DA 3RNKB 1G7QB 3NCYP 3NIFE 3WFBH 1S7VA 2VR9A 3RVXD 3WUWB 1VACB 1XF4B 3H9YA 2DQDL 3RKDC 3IDIB 4WI4A 4HIHB 5BVJB 1LEKA 4PRBA 4M93B 2R1XA 1MFBH 4HJGB 5IB1B 4W4OC 4KJPD 3WUWA 4OCNC 4E41B 2QSTA 5HYEA 1JNLH 3MO1A 3QPQD 3QXWA 5MI0C 4G8IA 3DSFH 2R2BB 3EHBC 4LPTA 4F9PC 3PP3K 4HEPG 1LE5A 4M43L 1E6JL 3RTQD 4JFPA 1U3HC 5IROC 4GKNA 2IMNA 3NCEB 1IAIH 1RIUL 4M61B 3LAFA 4NUGH 4OGYH 3KHOA 5CBEA 1AD9A 3S37H 1XGUA 2OL3L 4NHUB 3DBXB 4P5MB 1RUKL 4JRXA 35C8H 5KSUA 5IVXF 1F3DJ 5EG6C 1TVHB 4NQED 4Y16A 5E2TH 3MRGB 3RDTD 3E6FA 5LJYH 4OCRH 1LEGA 3NZ8B 3MNWB 1A7BA 3FQTA 1G1YA 3SDAC 3IDXH 4PJBE 3U0PA 4ZAKA 4DZBB 1FFPA 5IEKA 3MLPA 4KMQA 2VERN 2XG5A 4WO4B 4XMKH 3KPPB 5HYQB 5IG7B 4Y1AE 1TQCB 1CR9H 1EIBA 1MNUH 1EVUA 4X6DF 2WMPA 3IS1X 4OD2A 4I2XA 3HMXL 3FB6A 2OL3B 3QEGH 3IF1A 1ZHBA 2QQNH 3KPRD 1EUTA 3IRZA 3CSBA 4MA7L 4PGEA 1FNGB 4RDQF 4MXVF 3MLYH 3ZT5A 4D9RD 1F6LL 4H25A 4P2CG 3ARGB 3PHOA 3MV01 5CKAA 4FXKA 3PHQB 2H41A 4YHKH 4YNYA 1RUAH 4K3JL 5ADOL 5IESL 2DB8A 5FYJD 2P4AB 5K9QI 2CJUH 1MI5D 1KJ3H 2XRAL 1KCRL 5HI5D 5F7MC 5D1ZD 5J1AA 4OB5H 4J12A 5KBNC 1HHIA 4ZSOA 2XPGA 1OAQL 3PWJB 4S0TD 1MLBB 2HVKB 3C5ZD 1KIRA 4YJZL 1BM3L 2VIRA 3ECBA 1CBVH 2V5TA 4G43B 1BHGA 4KTEL 4LVOC 1D5BA 2WBJD 3BVNA 4PJBF 1ZLVK 3MLSL 5F7FA 3P4MB 1RZFL 4I5BA 2Z35A 4X6EB 2VZTA 3QZWG 4YXHL 3MRBB 3MCG1 4LLYB 1S9YB 4H25B 4ZUTA 5CINL 4CU8A 4M6OL 1DP0A 4OKVB 5C86A 5J9PA 5F7LB 3RAJL 4NKOA 2VLKA 4ORZC 5BS0D 3QEQB 3UDWA 1HIML 4FN0A 3ZKND 2A9ML 3DVNA 3PQYD 4DOHB 3MOBL 4HKXA 3S4SB 2WBWB 5ENWB 2FO1A 5B4MD 1CFNA 4NDMA 5CZVL 2J5LC 2Q7NA 4IMLB 3SN6N 2EC8A 4M6OH 4NKDA 1DBKL 1FGNL 2Q1EA 1JI2A 3QPXL 4QY8A 5B4MC 1BIIA 5IJVB 4YC2C 2DMBA 4ZYKB 5D2NE 1LO4H 3U0PB 3K74B 5IBLC 4Y8DC 4E42B 4LCYB 3MCLH 3PWUA 4FXGB 4KTEH 2P5EA 1NUDA 3FRUB 4E41D 3BGAA 4P5KA 5FXCH 4ZUWA 3JZ7A 1E4KA 2YBRB 3D39E 3MREA 3L3DA 2A6IB 4H0GA 5GRUL 3SE3A 2MKWA 5C6PB 5A1AA 5C0AA 1JGUL 2W0PA 4RQQB 4X4XA 3FO2B 4RISL 4O9HL 1OGAB 5D7KD 4NGHL 3QO0B 5E9DE 4HIIB 3GM0A 4C56D 1OCWL 2IF7A 1NH6A 3BPOC 4JHAH 1RUKH 4NUJA 2NNAB 2QLVB 4EI6B 1FNSL 3RPKA 4KI5F 4OD3H 4NZDA 4GSDH 3L3HA 4IM8A 1OT1A 3GRWL 4NO0B 4RAUB 2HVJA 1YY8B 3GIZH 3KPNA 5GGTL 4A2LA 3I75A 1OARH 5HPOA 1IAOB 4PJCE 1Q72L 3IDMB 5FUZH 3QXUA 3TBTB 5TPWH 5IB3B 2BDNL 4JR9L 1A6UH 3QI9B 1YMMA 4MD0B 2A0LD 2F5BL 3C9NB 4XP5H 3GSQA 4FQQB 4DUVA 4TUOB 4G6AC 5SV3A 1NLBL 1NBVL 4OF8A 4TOYL 1G7PA 4NSKA 3QRGH 1KIPB 1SM3L 1A7OH 3WDIA 3KPRB 4P3DB 1BAFL 1OB1A 2VR5A 4XPTL 4EVNA 1CCZA 1TJIL 2R39A 3WFCH 8FABB 1J8HE 5GS2D 2M2DA 5E99H 1ZA6A 2YZ8A 3TBVB 5JNYB 4OZGE 5L7XH 3S35X 2EICA 3JWOL 1TZHA 5A16A 1M1SA 1FCCA 3KPNB 5GGVH 1DEEA 1PW3A 2DBLH 1IAOA 3P30L 4M7ZB 1KYOJ 3O6KL 4MAYA 1YJDL 1HXMA 5IHZA 4M1GL 4HX1B 4B50A 2P5EB 1F3JB 1H3UA 2BRQA 4GG6F 1S9VA 3G9AB 1SJHB 4RAUA 4GLRH 1N2RA 2ENSA 1X7QA 1J0HA 3FAXA 4K7PY 1TNMA 1CLYH 1V7MH 4PJEE 3QUMB 4WW2C 1UH3A 1QPXA 4ZQKB 3TH2T 3D6GA 1A4JA 1JL8A 4NKDB 3P0VH 2VR4A 3DUUB 3LPWA 1E27B 1I75A 4XP9L 4D8PA 1F45A 5DF0A 2C3GA 5FGCB 4OAWB 3CC5B 3V6OE 3I84A 3W5NA 2NW2A 2X6MA 4FABL 4LPXA 3QO0A 1XGPB 1DJSA 4ZAKC 3H3PH 4HKXB 2VDKH 4KJPC 3U9PL 4FQCL 1KJVB 3QIWD 1S9KC 2DWDA 1LO2L 4IS6A 1OM3L 3ROLA 4POUB 5DJXA 5ITFB 4NM8H 1HE7A 2GTWB 5GZOC 2NR6C 4F7TB 3VFSB 3MCKB 3AREC 4LLDA 5SWZE 2CJUL 2J8OA 3OB0H 4GW1A 1LO3H 4GAYB 1QP1A 5FO8A 2FYYA 4D0BB 4XPFL 4NQEB 1AI1L 1DFBH 3D0LA 4HKBA 1FPTH 1JGVH 4MHHI 2R0KH 4JREB 3MRNA 2OQJB 3FCTB 4RBPH 2GCYA 5KS9A 5T1KD 4E0RA 1JYXA 1FVCA 1OAXL 3H7BB 3CPLB 2ZG3A 1UKSA 1CFNB 3PNWB 4NDMB 1K6QL 1DLFL 4N1HB 2L7JA 2GYSA 4J4PC 1TPXB 3GK8L 4OV6F 5GJSH 1Q9OA 5T1LA 2HJFA 3R1GH 4QHUA 1KT2A 4RGNB 4J8RA 3WE6A 4NZTH 3WFCL 1MCBA 1D5IL 4HUNB 3VXUD 3UTTB 3X3FL 2AJUL 1IAMA 3FQWB 4Z18A 2VLKD 5BS0A 1M7IB 2UWEE 5HHPB 5IB5B 2DQCH 1T2JA 1MCNA 5I18L 3UTTA 5GZOD 4ZFOA 5HGHB 4GFTB 3OJDA 5JW4M 4XPGH 3L6FB 2H2PD 1KXVC 1K2DB 4PJAF 4OD2B 2V5MA 4LRIC 4Z7QF 4PBXA 2ZPKH 3RY6A 3T0XA 4KJWC 2R23A 2R2HA 2ZUYA 2PXYA 3I50H 1CG9B 3HI1B 4I4WA 1NGPL 2WLZA 2B8OT 5D93C 4F9LC 3ZE0E 5E4EC 3VDBA 4NC1E 1A9BA 1CG9A 2F8OA 2JKXA 3ZE2F 4OGYL 3PHQA 3W11D 1C1EH 1LEGB 2EDRA 2WM0A 5DD6B 4LVNC 1NKRA 1PY4A 1JNHA 1AY1H 3DVGA 4KK5D 1OTSD 4S2SA 2ZCKL 1Z5LA 1BM3H 1VERA 2K9UA 3ROLB 2GTZA 3B9EA 5JW5A 4O02H 2VDML 3VFWB 5J13B 2ZG1A 1QKZL 3ZL4L 1T1WB 4CMMA 5EWIL 3VFUA 4GRMA 1IRAY 3Q2CA 5DA0B 1GOHA 1IC5L 3BEWA 1F3RB 3BQUC 5K9JH 4EUPA 4R97C 5DLMH 1LWRA 2OXHA 5F88A 3L95B 4V2BA 5IB4A 2LTQB 3WHE0 4DEPB 4PRIA 2GCYB 2F5AL 2D3VA 1KV3A 3ZE0F 3QDGD 1FE8H 5D2LF 3CFKB 3ZYZA 3S7GA 3CFDB 1I8LC 1MHHB 3DVFA 4CN6A 1T66D 2B7DT 4BQ8A 4Y5XC 1FNAA 4LLDB 2C7UB 3UTZA 4XPHH 5A16B 1UYWL 5I8KH 3HUJE 1IKFH 3O81A 1T0NA 3ARFC 5HJ3A 2H1PL 1JMZA 3UJJL 3BDXA 3U83A 5DRWB 3ULSA 3RVTD 1TMCB 3P11L 4KZEL 3I6GA 4F80A 3V0VB 4G5ZH 3KLHC 4NQCB 2J2ZA 5DQ9B 3SPVB 3JTTA 4RSVA 4I0CC 3MUHL 5E0QA 3SE8H 4EBQH 1A4JB 3WFBL 3D2UB 3TEUA 3I2CH 4MQXC 1BFVH 4YFLI 3H9HB 4HMDA 1FH5H 3S35H 3EFFA 1QA9A 4HHAB 5I8OL 3WIHA 1VFAB 3U9UA 4M5YL 4FQJL 2AJSL 4EBQL 1E0OB 5B8CB 4P4RB 4LHUB 1UEYA 4YHOH 5CIPB 5MI0B 5CEYA 2HFEA 2FO4B 3FHAA 2AK4B 3RGVA 5IESH 5KVGH 3ZTNL 5LCVH 2MCG1 4KV5E 1BECA 4MWFA 5KVFH 3QQ9D 2FSEA 5T33H 3UMTA 3MV8B 5C09A 4CU6A 1JV5A 1WCQA 5D71L 5SX5H 4XP4H 3CCHA 2BSRA 5DJAB 1A1OA 2BNUB 4OLVH 4JLRB 5FA3A 3OKOA 2VB5A 1WBYB 5FKPA 1SMAA 1YDPA 5HHOE 3WS3B 3L3DB 1NCDL 1FO0L 1CGTA 4XC3H 4IOSD 5HI4D 3QWRD 3V6FA 2XA8L 3OX8B 3O3AA 3JWDH 2CMRH 4EQ3A 2EE9A 3K2MC 1MJ7L 1I8IA 3QHFL 3H9ZA 1J0IA 4UB0H 1RZIA 3R8BB 5I1IL 1YN7B 1N26A 4JFFD 3MV7D 5DK2A 1INDL 1JCKA 2UVFA 2P42B 5LGHL 4N68A 4ZTPL 3SKOB 3UPRB 3MRDA 1D3CA 3KJ4C 4HDIB 3ULVC 2DM2A 1KLGB 3KYOB 4TSCL 4NZTL 5HHOA 1YC8A 1KPVA 4HWZB 5CHNB 1Q0XH 4ZFGL 4LPCA 5BO1H 2DQUH 1KEML 4IRSD 3T4YA 1CTNA 4KDTC 4Q9RL 3NA9L 1PEZA 4R3SB 1II4E 2IFFL 2WINB 4ZNEE 5MERA 3TPUB 4OLVL 3HZYA 2YWZA 1MSPA 1IBGL 4OCYH 4WHTB 5BW7A 1WWBX 2NY5H 4HLZG 5DRNA 3IAGC 5I17B 4R8WL 5ANMB 5IVXB 2EH8H 1P7KA 2DQFB 3F5WA 5BQ7A 2EYTB 2IQAB 2XY1A 3VGBA 2ZUXA 4L8SC 4OLXH 3HRZB 5CILL 3DXAB 3LEXA 3QDGB 2C3HA 3QUKA 2M8XA 3CU7A 3ORJA 3SE9L 1GZQB 5L2KE 1W0WA 3PP4H 1DE4A 1TZGH 2YC1A 3TJEH 3GSOA 4QKXB 4IOIA 5DR5H 1JBJA 2VLLA 2WBKA 4J3OC 2FYYB 1U9KA 2HKHL 4W81A 3VGAC 4H5SA 5D70H 1X5YA 2D4DA 3NFSL 3D3VE 1KG0A 3QUXD 3S98A 3MACL 3IJHA 3OF6D 5B38B 4S1QH 4P2QA 2BVQB 2E7BA 5F1NA 4R3SA 1BZ9A 3N9GH 3QCUL 1RK1A 1UJ3C 1PG7L 4KJQD 3OJ2C 2CUIA 3P0GB 3D2UD 3QHFH 25C8L 5JW3L 4M6AA 1GCFA 3OR7B 3IYLW 5JHLH 3SKMB 2Z9TA 1JPSL 5C0IA 2GAZA 3IFLH 5CGMA 3HFMH 3PL6B 1FLTX 3TH4T 2HFEB 1D5BB 3BVNB 5T3ZH 1LD9B 1OP9A 1Q9LA 3MOAL 5JPMB 4N0RA 1K3ZA 1GC1C 5E99L 5IB2B 5GGTA 3CXDL 1RUML 3GNMH 4JDVB 3QUYC 2N7AA 4HUXA 4UT9L 2NY6B 4LSVL 3P77A 4WW1A 15C8H 3Q1SL 3B3IA 2BVYA 2YWYA 3ZKXB 5DS8A 2FR4A 2H3NB 5AYUH 1OGTB 3KNBA 1N0LA 4L29A 1F42A 2NLJA 4XNUH 4JFFE 4JQXC 3MR9B 4RFOL 5DMKB 5HDQL 1XF3B 4HQQH 4CDGC 1FFRA 3EYFB 1GH7A 5I30L 2HMIC 4FQXA 4AEHL 4TVPH 4YHKL 4K71B 1H0DB 4KAQH 1Q9KB 3P9MA 3EAKA 2ZG2A 4P23B 1FH5L 3ULUD 3BW9A 4OLEA 5DGRA 5HGBB 3IDJB 1RJLB 4G9FD 1T20A 1ZSDB 3SGEI 3MGAA 1YY8A 4MWFB 4QOKD 4ERSH 4JDTH 2DRUA 3QA3B 3QO1A 4YDIL 3E6FB 5JW4N 4XTRC 3CFKA 1LD9A 2RCSL 1QRNA 2VDQH 1HI6B 4LVEA 5HI4C 3UDWC 1TTFA 3EFFB 3R0NA 1ZV5A 4L9DA 4Q7DA 1EJOH 2IAMD 3JWDC 2R9HC 5F3HA 3PXJA 3T1WA 1PEWA 5T3XL 2JLLA 4X7EC 1B0GB 1YUHB 1JVKA 3L95A 4QRPE 5HHMD 1OSPH 1B0RA 3IU3A 1FL3A 2UY7A 3RNQB 1GC1H 4V1DD 1DN0A 4JHZA 2VXQL 5FB8B 5C71A 1FQ9C 3D1MC 5JZ7C 3FONB 2FJGA 4XPBL 5ECJE 4IHOB 5BS0E 2ZUVA 2CLVB 5IT2H 3VFWA 4NHUA 2ZSVB 1DSFL 3U4EA 5JDJA 5EIIB 5F9AC 4MA8L 2NZIA 1K8IA 1ZVHA 1R3IL 2X4NB 3BPCB 3VFMA 3DYMA 1IILE 3TYGH 35C8L 2X4OB 3S36H 5ITBL 4JG0L 1WWCA 43CAB 5JA8B 4KI5E 3VH8G 3ME0A 4UMGA 3AY4C 3DHJA 2R0WL 3V5HB 3MODH 2B1HL 2FATH 4M43H 3TESA 1PYWB 1AGFB 4KKAC 4Z7VE 5CILH 1LE9A 4H26B 3B2UC 2FGWL 5IJVA 3AM8C 5FCSH 4HULB 1NL0L 4JKPH 2D9CA 4ODSL 1KB5B 4MJ5A 4Z7NE 1QRNB 1H5BA 2NX5A 2YD8A 3EJYC 2IPKB 3RY4A 1LILA 2R2EA 2MQ3A 2HT3D 1XT5A 2CIKB 1QSZA 1OAZH 3ROOA 2BCKA 4MDIA 4MZ2A 5GGQH 1U58B 2CKBA 4XZUA 5IKCB 4DN4L 4OIIH 1N3NA 5T1LD 4OIBA 3DIFB 1CD1A 1GZPA 5C0NC 1DVFA 3RZCB 3BD3A 1H0DA 4LLAA 1GXEA 4PGDA 5CIPH 3RVWD 5GGRY 1RZ7H 4Q6IC 4EKXA 1C5DB 1Y0LB 1HHGA 1YPZB 5KSVA 4K3HA 4R7DB 4TTDC 5GS1A 1UM6H 2ZKHH 3AXLA 3FQNB 8CGTA 2P7TB 1UJ3A 3ETBF 5LGJA 3PV6B 5DURD 1WITA 4RMWA 3PWJA 2X9XA 3O9WA 3ZKMD 3MRFA 3PWPD 4DGYL 4OCWL 4GJTB 4M1GH 5EBMB 4UV4H 2XA3A 4MHHG 5HDOA 5TPWL 5F1OB 5LGJB 4OD1H 3G5ZB 1QSVA 4MCYA 3V52L 4P0DA 3LN4A 2R8SL 3EW3B 2RBLA 4PJEB 1BWWA 4O4YH 3ZTJG 1OTTC 4C57C 1RZFH 1RJZB 4M8QA 4MNQD 4NO5B 5K9OA 4LLQB 1R5WB 2PO6D 5FYJH 1XIWB 2YD4A 1NCCH 2KZWA 4F8QA 3FFDB 5HYSB 3QDMD 1EAPA 1I9IL 2O5YH 4BK4A 1CD1B 1GZPB 4WO4C 4X7CC 1C16A 3WIIH 3GGWB 4QHKJ 3ULUH 1VFMA 2EKJA 3U36A 3PWVB 4R96A 1JZ7A 1SVZA 1LVEA 2BVPA 3NACL 2NTFB 3MJ7A 4P23D 4P2QB 1NBZA 3DX7A 2D0HA 5EC2B 1C8PA 5C9JA 3OAYK 5E8EB 3AVEA 5JLZA 4GS7C 3SE4C 4JAMB 3V95A 1IKNC 1UM4L 2QQQA 4PYGA 1DUYA 1I8KA 4L8DA 4NZJA 4F7CA 2FBJH 5AUMA 3ABZA 1P84K 1ZVSA 2ITDB 3VFVA 3DV4A 2HH0H 4P99A 3UCRA 3I6LE 1D6EB 1FYTD 4XCYA 3BKJL 4X80L 2NY5C 5IW6A 4G6AD 5F7DA 4LLMB 3VXTB 3IXTA 5JOPD 3BYTA 5FYJE 5CCKH 5I16B 5DMIL 5FKAA 4YIQA 4KK8D 2R4SL 2WBJB 4LGRB 1ZANH 4X6CF 3C6LB 2YUWA 1SEQL 5SWSA 3OG6B 5SWQB 4F15B 1QYGL 3BH8A 4JFHE 3GSNA 1N5AA 4GKSA 1I7ZB 3CC5A 3LD8B 2GJZA 3B4NA 3VFNA 3KLAB 3D39A 1J5OH 4HEME 4QCIB 1CFQB 2R4SH 1EEYA 5JMOC 2H3NA 3GSVA 4Q0XL 5A3IC 4XRCA 2EECA 2AJZB 2DS4A 2R1XB 5EO0A 5EN2B 4X6BA 2VKXA 4JY5H 4S10A 3CMGA 4N8CH 4LKXA 3CFDA 4L8BB 3STLB 4TRPL 1QSEB 2HH0L 5I8EB 2FX9H 3ARDB 1EO7A 4LCIL 4YE4L 4AIZB 3SY0B 2XICA 2W0LA 3SE9H 5IB2A 1NUNB 1LK3H 3NPSC 2YZ1A 3KYKH 1IGCL 1IARB 3HR6A 1A7NL 3AB0C 3F7VB 5FYLH 1MWAH 1OWRM 5FOBA 2CSPA 3HE6A 4J23A 4YWGH 2A2QT 3EYUL 3ZE1E 1BQLH 1KPUA 5H2BB 5IIEA 3L7EB 3UBXB 4PS4L 2LV4A 5C08B 1IFHH 5HHQB 4ZNEA 1HKFA 5KVEH 3HE6C 4Q97A 4QRRA 4XVJL 3R8QA 4ZXBA 4XC3L 5FECA 1P9MC 1OGTA 4QGTA 1OGAD 3U7WL 4HZLA 3BT2L 4QNPF 3KPRA 4P3DA 2EEAA 3NA4A 3TCLB 2ITCB 2PF6A 3D18A 4F2MB 3DUSA 5KTEL 1YEKH 2Y5TB 3LEVL 1NCWH 4LSUL 1CFBA 2XN9B 4L5FH 4W6WB 1J1OH 3QI9A 4MD0A 2CH8A 4KKBD 2HTKC 3VMNA 3BN9C 5DEFB 1NUFA 3WXVH 2RB8A 3ARDA 2IG2H 1VEMA 2YRLA 3DX9A 1U8NB 2B1AL 5FM8A 1HOCA 3BQUB 3MJ8B 3ARFA 2AJXL 1PG7W 3AAZB 4FFVC 4Y2DD 4Z0XB 3W81A 2QL1A 5JPMA 4YHYB 4U6XA 2A6DA 3KGRA 2ARJB 4Y4KC 2EEDA 1CYGA 1PJ9A 4LNRB 3ZZ1A 4BELD 4G42A 3EYSL 1M7DB 32C2B 2XA8H 3D39B 5C0AB 5HI5C 3GJEA 2V2TA 4YO0B 3WFZA 1M7IA 3TT3H 5TF1L 2CQVA 3MRHA 5J3HC 3C60D 1AXIB 3VWJA 4K3EL 1LMKA 3MV9A 3FQRA 1CGVA 4RGOH 5BMFL 2P5WD 1IAKA 4TSAH 5ACZB 4HUWB 2XT1B 5HHNB 3I3DA 3SOBH 4WFGD 3VRLE 4EI5A 5ESAA 4IDJH 5DHXB 4DK6A 4K3GA 4UUJB 3B9DA 4YZFE 2C4FT 3QG6B 4PRPD 4Y19E 3O2VL 2X4UB 4HFWA 1C08B 3BDBA 4GW5A 5C0EB 3BKCH 3RWFA 3GKZA 3K8LA 6FABH 2B1HH 1LNUB 2P5ED 1CFTB 4M6ML 4PJDF 5CUSH 2W60A 1CLZH 2HJKA 3AGVA 1TCRA 3RWFB 4IRJD 1A6TA 2YK1H 1KB9K 2FCBA 5JORA 1U0QA 3HE7B 4FXLA 1GSMA 1XZ0A 1FNFA 2KPNA 4QTIH 5C7XH 3R0MA 4C4KO 1ONQA 4JPWH 2V2WA 4OUUB 5HHNA 1NAKH 1CI5A 3QUXA 3QUXC 2E7MA 3GMNA 3ISWA 5I17A 3MA9L 1RIUH 4KKBC 5T1KA 2Z35B 4CUCA 3CCHB 4I3RL 4QHNA 2Q7YB 5HHOB 5I19L 5IG7A 3WSQH 4WI7A 2HVKA 2HFFA 1CLCA 2W9EL 1NFKA 1KLFA 3QFJD 1MCIA 2XQBL 2Z31A 4Q6IB 5D1XA 5EOCL 3KR3H 4NNXB 2EDTA 4Z7VB 1A6AB 5CEZD 1KPVB 1X5AA 1ADQH 2A83A 5CJ8A 3Q3GA 1A5FH 4WUUB 4NQUA 4ENED 1U8HB 4GH7B 4PJCF 4UDUA 1OD9A 5BRZE 1OWWA 3MUY1 1QRNE 1G7IB 2FB4H 4JFZL 3U79A 2AV7B 1VFBB 5LKNA 2OSLB 3DECA 2VJXA 4QTIL 3FO1A 3TN0C 3DUHA 1KUMA 1E4WH 3X13A 5CFHA 1XFPA 4YK4B 3IF1B 5EO9A 1EMTL 3VXUB 3TWCH 1XR9B 1RIVL 4O02L 3PWPA 4X8XA 2BERA 2G9HB 3GJFA 4PIRF 4XVTL 1HSAB 4JLRA 4C58B 5BJTA 1Q9WB 4UOW0 3RZCC 2PKDA 1UC6A 1ZLVH 4P2QD 3ULUL 1NLDH 1AP2B 1IM3B 1FFQA 1W0YT 4ERSL 1ES0A 4A6YB 3PDOA 2RR3A 5TQ2L 2EKSB 3QDAA 4DN3H 5IB1A 5DDHB 5FUCC 3ZT6A 1T6WA 4MJ5B 1JWMA 3NFPA 3RA7H 4Z95H 2I60H 2E7CA 4KWUA 1NFDA 5KSAD 5DFVD 4X6BB 3UROR 4OD1L 4MMZC 1TJGH 3MLXH 1UWXK 1YNLH 1EGJH 2RFXB 3J7HA 3LQMA 4XMKL 3BD4A 5DYOB 2NXYB 3S96A 4N8PA 3KXFA 5F8QC 1YYML 3ES6B 3O8XA 4YDJA 2X4OA 3UJJH 4PRAA 2VAAA 4PG2C 3RWJB 5INCB 4D94A 2DMCA 1BOGA 3BRDA 4GRWE 5DJZA 1NC4D 5IHLB 4M61A 4WFEE 5FHBH 3FB5A 3MXVH 5GS0L 5CJOH 3ULSB 2GW5A 5T1MB 5TE4H 5DJZB 2D7MA 3O4LD 4YHNA 4P2QE 4YIQB 1T1ZA 1YEKL 3WNLA 1MVUA 2VSDA 5I15H 1I7UB 3SDAD 1FL3B 5IVNA 3P4NB 1HHHA 4NQXB 1ZLWK 1ETZA 1NCDH 2F54D 4WJ5A 5T3XD 3DX8A 3S37L 5B3JE 3F6IA 1JGEB 43C9B 5GSRB 4K71C 1MCWW 1FHGA 3WN5B 2Q8AH 4CVUA 2ITDA 4LARL 5K9KB 3A6BH 4RIRB 4CDHA 2FECI 2HLFC 1DL7L 1C7SA 4FQPA 2QQKH 4I3GA 5C70A 5L2KA 5SWZA 4MQXD 1MHHA 4OJFH 4KH2A 1E6JH 2XTJC 4FZ8H 4KKCC 1T7XA 1N6UA 3B9KB 4QF1A 1U3HD 5C0DB 1D5ZA 3TIDA 2IAMA 4WFED 4BFIB 3LRSA 5E00B 2BC4B 3DOSA 3GB7A 3IRPX 5EU6A 3PGFL 2X4RB 4Q9RH 1ZHLB 1DQDH 3JWOC 3QFJE 2IFFH 3MRBA 4LHUG 3OKDB 5KW9L 1QR1A 2NY0C 2XKSA 3U36B 5JXAH 1W8OA 1KENL 4Y5YA 4OZFH 2UYLB 4MJIE 3BPOB 5CJBA 1YEIH 1JK8A 5HGDB 1P7QB 3BMWA 3TZVA 4NYLA 1CGSH 3MUZ1 1KCVL 2EYSA 3RWCB 5K9OB 4JANA 5F1IB 3TNNB 1LO0H 4KPHL 5KSBF 5E1AB 5DVNA 4D3CH 3D69B 4I0KA 5D1QC 3GSRA 3SCMD 2FX8H 1Z9LA 1JF1A 4NQEA 5I8CB 5EPMB 3P9LA 1P7HL 1EK3A 3BQUD 1CD8A 1MJ8L 2WQ8A 3VI4F 3CAFA 3R1GL 1J11A 1UT9A 5GZNC 3TBYA 5I9QB 4A6YL 1FVDB 3PL6A 4YHLL 5SX4H 3FQNA 4PB9L 2DYPA 2PNDA 2E6PA 4DUXA 1K4CB 4MQTB 4YAQB 1EGJA 3U30B 5EU7E 2FEEL 4P2OA 4HIXL 3Q48A 3HCVA 5LBSL 4JZOA 5C0BB 3WE6B 4OBSA 1HXYA 1QSFD 1WZ1L 4PREB 3O0RL 4W6XB 1EAJA 4YDVB 1KN2H 3DUUA 1S7TB 3X3GL 1RZGA 4PRHB 2B20A 3LRHA 2A74A 2DWEA 2ZSWB 5IR1B 1OTUC 4M62H 1KCUH 4MJID 3MROA 1IEAB 4NJ9L 4JVPA 5FM5M 2GI7A 3L3IB 5TQ0H 4PJGE 4J8RB 4LSUH 3VXNA 5ICXA 2ILLA 3CSYB 4PYHA 4R4FL 1UGNA 4BQ6A 2EDQA 1WT5A 4M7KH 3PGCB 5LXGL 3D0LB 2F54E 4Z9KB 5T3XE 5EBLB 2Y7QB 4S1DC 3TZVD 4EUPG 5JO5A 4UAOB 3VXNB 1GIGL 3F7YA 4BZYA 1DEEB 1HWHB 4JO2H 4LKCA 1R6VA 1BVKB 5F9DC 5BVPH 2HLAA 3L5XL 3TA3B 1F4HA 4WEMB 5D5MB 3KJ4B 3GMQB 4XXCA 5C0AE 1MLCA 1QHPA 5M95B 5GS3A 3DVNB 3FO0H 2APXA 4YAQA 4PJ9B 4S1SH 3S9DB 1E27A 1SYSA 3KDMB 2KKQA 1IGJB 4S1DD 3RI5K 25C8H 3DNKA 4FG6D 1HXYB 1UCBH 4GRWF 4ZUVB 3VD7A 1RHFA 2E9BA 4CADB 3BP5A 1EHLL 2Q3AA 1OQOA 4WTXA 3ZYIA 1JZ5A 2NCMA 5IFHL 1JNJA 1QZ1A 1FIGL 1MFEH 5KG9B 1V05A 2ICWJ 4M6NL 3I75B 1F3JA 1KGCE 3MCLL 5D2NA 4XH2A 3LEYH 4MXQD 4OTXL 5F9JA 3KJ6L 4OLYH 3QO1B 5I1JL 3ARFB 3DXAD 4JY4B 2IBBA 3SKOA 1HKLH 2R29L 4LCUB 5TE7H 4D2NA 3RX5A 1V7NH 4NO2B 4Z7UF 3AMLA 4WI8A 3PABB 4PUBH 3WJJC 4UNVA 3DYOA 5HGDA 3S3JA 1OY3B 3VWKC 4OIIL 1S7QA 3TFKD 3BN3B 2UV3A 3H3KA 3SHSA 1BJMA 2NY1C 1F4XH 1UEMA 4JANB 5F1IA 2OJEA 3WXWH 1H8OA 3IETB 4F2MA 4PJAA 4XNMA 4LFHD 1ZHKB 3QHZL 1KELL 3SBWA 1P4IL 3LS5L 2DTML 5I75B 1NCNA 1YEDA 4J3VA 3DI3B 4P2YA 5FECB 2DLEA 3DX6B 4KVNH 4EN3B 3UJTL 3ULUC 2D2OA 8FABA 4N0FA 4PFEA 5FUOL 1ZHBB 2JJWA 3VD5A 3ZHKA 4P2RD 4QXUL 2Q6WA 5IB3A 4GSDL 1BVZA 1OW0C 2YBRA 4NFCA 4C56B 1CZ8L 4Q6YA 4CVWA 4PR5A 5EU6B 4PJ7B 5H2BA 4POYA 4JZJC 2BFVL 5IIEB 1UXSB 3A6OA 2MOVA 2YUXA 4IDLA 4PJXF 3BOVA 3PWUB 4U7MA 4QF1B 3SBWC 5BO1L 5DJ2A 3RWDB 3QXAB 4N5UA 4ISVB 1ZTXL 5FV1L 5I1LB 1QBML 3E8UH 5CD3A 5KANG 5JQHC 4JN2A 4IMLA 1U8QB 2XTJE 3EDFA 5ESQB 5I6XC 3VWKA 2OJZH 3CLFH 2MHAB 1Z0NA 3QSKB 4URTB 3BRFA 4HJJH 3MLYL 4AIOA 7FABH 2P1YA 4EEEA 2GAZB 3BP6B 5F1NB 3G5YA 5IQ7L 5DFTA 4HUUB 1MCDA 3WLBB 1AD9B 2WIIB 3RVUC 2VDQL 3GRWH 3NABH 5GGVL 4X83A 3CDYA 2VXTL 2XWJB 3IFOB 4PRHD 4F37K 3P4MA 4QYOB 2BSTA 1HQRA 5FKAB 3WNOA 5GHWH 4K9EH 5I75C 1RIHL 5DFVC 4NIKB 1MREH 2VN4A 4NFBA 4NZRH 1UB6A 2FX8L 1RVFL 1QSEE 4UTAL 1KULA 5KVFL 1JGDB 4LASL 1N6QL 5J89A 3HI6H 4G6MH 3IDIA 3JTSB 4LCWD 4PJDA 3T08A 1Q94B 1SHMA 3QISA 2Y36L 1MWAL 2EDDA 3CSYA 4Y4HB 3TA3D 4JPWL 4QRTB 3IGAA 3NA9H 3DJ9A 3S3PA 4DQOL 1NMCB 2J88H 4V1DB 4PGJA 1ORQA 2JCCF 2R15A 4JFHD 4XCEA 5J57B 4LAQL 5EUKB 3IVKA 4QRRE 5L9DL 2APBA 4K3DL 5BV7H 3QIWB 1SBSH 1XGRB 1U8JB 3QPXH 1AE6L 1CE1L 2QHLA 4ZUSA 2XKNB 3T65B 2H8PA 3HZYB 3KR3L 2R0KL 5EORL 1ZK9A 3C5JA 3D48R 4UI2A 5DMYA 4JO4H 5J6GA 5DHVH 2LAAA 1P6FA 3VGGA 1MJJA 4PGCB 4JDZA 4DVBB 4NZUL 3MRRB 2PYEB 2FD6L 1SBSL 3QDJA 5GQBA 2E8ZA 1JGLL 4CKVX 4L3ED 2WAHA 2DLTA 4U1JB 5ALBH 1FZOA 1CL7H 1U8KB 5D4QA 3FB8A 4PGEB 4G9DA 1IM9A 2YRPA 4NNXA 1BD2D 1NFIB 1SM3H 2F5AH 4GW4A 4JM2F 4PD4J 4K7PH 1HHGB 1JWSA 1WBZA 3DRTB 3CH1A 1HSBB 3LIZL 3LKRA 1QR1B 2VDLH 5D1ZA 1KEGH 4K07A 4RZCB 5GRVK 3FT3B 5CBAA 1AO7D 4M4RA 3DPBA 4BFIA 1N6VA 4FHBD 1RK0B 4Z7UB 1I1YB 3PHSA 3QQNA 5C07B 5TFSL 1NEUA 5SWSE 2BSRB 1IQWH 4N1EA 5J12B 3MO1B 5D5MF 1WZ1H 1V3MA 1ONQB 1G9NH 2VQ1B 1A6WL 2BFVH 1EV2E 2EEBA 4HLZH 4FQ2L 1XGYH 3ZKQD 3ZKXC 2IALB 2YPLA 4Z77B 1MUJA 2DLFL 3T77B 2NQCA 3IT8D 5FA4B 3BAEH 3TF7C 1CS6A 4W68A 3SDDB 1I7TB 2P8MA 4JFXA 4OZFG 1MJ8H 4PLOB 2IEPA 2X4QB 5CEZH 5FIEA 3KWWB 4K2UL 1AD0A 3N1PC 4HAGA 1ZLUK 4XC1H 3V0VA 2PN5A 1OD7A 3O6LH 4ZXBC 5D7LD 3LIZH 4TULL 3QDMB 5EFIA 1U8JA 1FZMA 3GJEB 5EU7C 4QNPE 4YGAB 1GPOH 2AK1H 2AV1A 2Q76A 5F9OH 4R7NA 1C12B 3GJFK 3VWJB 1PSKL 5CWSB 1A7RH 3U7AA 3EYVB 3B5TA 3V5DA 5T5FL 4HJGA 3FTGA 3SGDH 4U1MA 5INCA 1RUMH 3GNML 1AGCB 1T80A 1ZS8A 3UZEA 2F54A 5JQ6H 3MLUH 1FFOA 3O11B 1JF6A 4HX1A 2VE6B 4ZS6C 3ARFD 1BF2A 4P4KB 4O2EA 4GMTH 5DUML 3QCVL 4BSJA 3MA7B 1HH6B 1P53A 4PRDA 2APTA 4PJGA 4RWYH 3DO7B 3DX9B 1CD0A 5F88B 3SDCC 1DBAH 4HH8A 5CEZE 5C3LD 3VD3A 2MCPH 5T3ZD 1KLUA 1T2QH 1J1XH 2P24A 3BW9B 3QDJE 1OOAA 1FSKC 2BMKB 1A21A 4YUEH 3VXQA 4CMMB 4EZMA 1VPOL 4F7MB 3AU1B 3O6FA 3DMMC 3MXWH 1BLNB 4JGUA 1WIOA 4H8WL 3KXFD 4EUPB 2VUYA 4P59H 2HFTA 4UV7L 4YDLC 4YLQT 5EB9A 4R4BB 1VEPA 3WFEL 3VI3E 4KRPC 3WUZA 4MCZA 3FO9A 2OZ4A 3KPQB 3BN9D 4LP4A 3TCXA 4DJMA 4DWHA 3D85B 3BKML 2WNGA 5I1DA 2ADJB 1Y6KR 5DMKA 2FBJL 5D7IA 1J8HD 1FN4B 5E2VH 5DWUL 4NN5C 1HINH 4HXBL 4F33B 4LBEA 3OXSA 1N8ZB 3QULA 4LHUD 2O5YL 3U2SA 5A3ID 1YC7A 4P48A 3C8KA 2FHFA 4FFYL 3WNNA 1ZOXA 1Q1JH 1UA6H 4KI5C 1H3XA 4ZTOH 4FQLL 4OUOA 2X89D 3H42H 4QCIA 4I4WB 1G6RH 2H26B 2MFNA 3TN0B 2EDWA 4UINH 1WEJL 5EZJA 3VD4A 2H45A 1PLGL 5DD5L 2AEQL 4ODHH 3LQAH 1AHWA 4FMKA 1AQKH 4R0LC 3GSWB 3KJ6H 2FIKA 1IEBB 2CDGB 4X6DB 2DTSA 5E5MA 5B38A 4ZFOL 1BF8A 1U3YA 2GQHA 3VGEA 3EOYG 2OP4H 2NY3C 5A40E 3LKPB 4X6FB 5C07D 3MGTA 2N1KA 1JRHI 2FBOJ 5IMOA 5GSVA 4Y1AA 1UM6L 2ZKHL 1XGQA 4KQ3H 5JPNA 2VOTA 4PP1C 2BY1A 1LO3L 2O93L 2VLLB 3WIFA 5JUEH 3QWOB 2EDOA 1MAKA 5L6YL 4E42A 3CFEA 1UCBL 3M8OL 4FXGA 1I7TA 4U1HA 5FGBC 4IOIB 4RFNC 4OZHB 5DD0H 1C08A 1VSCA 2IBZY 3Q1SH 5C0CE 5D7JC 4JAMA 1KIQB 2LAGB 3FFCA 3O3EA 4UZGA 2VXSH 1Z9OA 1BQSA 3MRPB 1UACH 4U1HB 4P23C 1AKJA 5F1KC 3MLZL 5IGXH 1FFNA 1OF2A 2AEQH 4GQPH 4WTZA 5ICXB 2HT4D 3CU1A 5JR1H 2DQJH 2IGFH 2V7NA 3L3JA 1A1NA 5JLZB 2NW2B 4WEBL 2DLHA 5C0AD 4Y1AB 3RL1A 1MRDL 1SY6L 1AHWB 3TIEB 3GBML 4ETYA 3BEVA 5TFSH 2BZDA 2HG5A 2XQYG 5JIHA 4TUJA 3EO1A 4UBDD 2WWMC 1MH5B 4WV1A 3EYOA 1Z2KA 1QBLL 3ARPA 3KXFE 4BSWA 2EIEA 1JPGA 3ECBB 4GMSH 3S6CA 4JG0H 3AAZA 2WUCH 3Q6FB 2A6DB 1YQVH 5CD3B 4F7PA 1S7WA 1KLGA 5D1QA 1BJ8A 3L7FB 1NGYB 2XN9E 2NYYC 1QFUL 2Y07H 5C2BL 4FP8L 1G9NC 2XWBA 1NGXB 1W72A 4LVHB 4TTDD 1NMBH 3MJ9H 2FECL 5GS1B 5F9WB 3I3BA 3ZLQC 2OMBA 5DHVA 2HLFD 1G7LB 4JDZB 5EC1A 4DVBA 2DWEB 2ZSWA 4V2CB 3UYRH 2AVGA 3ARGC 2JJVA 4P46D 2KQNA 4WTZG 1FG2A 1KN4L 3ELAT 3D85A 1KPRB 5D7JD 2IADA 1M7XA 5C0BE 2NW3A 5C1MB 2YA2A 4Z8FL 4U6VL 1I3GH 2APWA 2FSEB 5HHQA 5JW4R 1FZKA 4QXGL 4K7PX 5IBTH 1E6OH 1CDIA 1BLNA 5TE7L 4ODTL 1D5XB 5ICYA 5I1AB 2WW8A 3REVB 2J88L 2DKSA 5B8CA 3L1OH 1C5CL 3VU2A 3ZE2E 2CIKA 2IQ9L 1QQDB 5EH1A 1A3LL 4X8JA 4YHML 1F8TH 1I9JH 4XAWH 2VLRA 1NAML 4NC2B 4HF5L 2QBWA 4I48B 3QNYB 1VPOH 3B9AA 4DKAA 4NWTH 1P5VA 4HW6A 5EU4A 4FZ8L 4UTAH 1BBJA 4QLRA 1K8IB 3BPCA 5FYKH 3TJHD 1R3KB 3MBED 3X12B 2X2YA 5D5ME 5A2IH 3VCLA 5DQ9A 2HT3C 2X44D 3WO3B 1E4JA 1TFHA 4PLJD 3EYQC 3HS0B 3EJYD 3FKUS 4MA7H 1I7ZA 2ZZUT 1FYTA 2OK0L 1CK0L 3VXRD 2YN3A 5E7FA 2WLYA 1WIPA 5GHWL 3VWJD 3B2UD 2ZCLL 3UTQA 2DJUA 5IV2B 2Q20A 3P40A 3GSNB 2R1WA 1ADQL 1ND0A 4Y4FA 4DKFL 1T0MA 1ZA3B 2AJ3B 4E41A 5LAXB 4OSUL 3ZKNC 3ULVL 3IJYB 1I1AB 4Q9CA 4QTHB 1LEKB 1BQHG 3Q0HA 2ZPKL 1UH4A 4Z77A 1OAYH 2DLIA 1BJ1H 1NAMB 4U49A 1K9TA 4HH9B 4LLMA 3PGCA 4ODBD 3HAEB 1HH6A 1LO0L 7FABL 4K8RC 2VXQH 3DURB 2A6JB 5J4MA 1FLRH 5DUPL 3MRIB 4ZYKA 1BPVA 2DQCL 3U1SH 1GGYA 3LKSB 3PF2A 2YD6A 5FCUL 5JZ7D 3MACH 4JN1H 4ZO9A 2R1YB 4XBGA 3CVIL 4OZFB 2W59A 2JCCA 2BNRA 4R26H 5A43C 3B2VL 1A0QH 3S4SA 2K3TA 4LLYA 3QEQE 4U3XA 4X4YA 5C07A 2IAMC 1T1WA 1W72H 1EAPB 1E28A 5INDA 4OKVA 3FT3A 5CBAB 5E6IA 3QFJA 3MRQB 3FJTA 3N1GC 5CZVH 4M7JH 4G6ML 1Q0YL 2L0DA 3BDYH 2ICWA 1J8HB 4JKPL 4ODSH 4OGZA 5IBUB 1JNHB 5EU6E 4LFHG 3B8SA 1MFAL 2DKUA 4GBXD 1WZMA 3L5IA 5E9DD 1ZT1A 1YEEH 2BK8A 4ALAH 4F9PA 4PJEA 1AXSA 4G43A 5J11B 3DMMB 3NCYS 3QJHB 3K4ZA 3VJ6B 5GS0D 4BH8A 4H1LB 4NWTL 1EMTH 3TBWA 4JM4L 4GG6E 1ZT1B 3UYOD 2P44B 2APFA 3FMGH 3THMH 1T89A 4JDVA 4K8RH 4LARH 3QJFA 2XTJB 5KSVB 1KGCD 4L3EA 4HS3A 1UQSA 2LVEA 3TT3L 1TPXC 5ITBH 3QRFM 4QXTB 4L4VD 3B9KD 4G8GB 1UH2A 2VDKL 1KEMH 3U9PH 4KVCH 2EDXA 1WV7T 4QEGA 5EUKA 2GY7B 4JJHA 1XCQB 3MXWL 5FOJA 5CP3H 1ZEAL 1B9ZA 4G8EB 2Q86B 4ZO7A 4N0UA 4FNLH 1AGBA 1I1FB 3QR2A 1A8JH 3DARA 1KJ2L 4JPIA 4LEOA 3KS0H 2KZ1B 4PJ5B 4XPAL 1E28B 3MGOB 5DMGD 3QEUA 4PJ7F 3SGDI 3V7MA 3DETD 4OGAD 2J6EL 2CKBB 3OB0K 3MRJB 4XCEB 2DMKA 1F90H 4BFGA 5GGSY 3LEVH 2I27N 3HAEA 3O2DH 1FG9C 2V9TA 4FQIL 4XT1C 2DQIL 1XR8B 1MHEA 2R56H 3QH3B 4ODUA 4I9WD 3DETC 3BZEB 1HYSC 3FCTA 3QDHA 3EHBD 4UUJA 4QO1A 2AJ3A 2DQGH 1PYWA 4JJ5B 2JB5L 3MLRH 5DHYA 3TGXA 5IQ7H 1VB9A 4KVCL 4GW5B 5E70A 5FO8B 3SCMA 2H32B 5LCVL 4AJ0A 4V1DE 3ZDXE 3PP3H 5BQ7B 2V5RA 4M7KL 2Z91B 3RVXC 4P2RA 4DTGH 4YGVB 3G5YB 4HUVA 2CLVA 2W92A 5E8DL 1S5IH 1KJ3L 3GMNB 4J3XA 3GKWH 1T0PB 3ARBB 2VWEE 4L1HA 1DLHB 1QACA 1JZ4A 4YO0A 3QEHB 3PWPE 1ZLWH 1NPUA 5C0JA 4DAGH 3F8UB 4FFZL 1A7QL 2HJLA 3IGAB 4MJIB 4PJ8A 3RRQA 3PGDA 1AR1C 1EFXB 4MS8C 3V4VH 4B7LA 3WFDL 4OZ4A 5FYLD 1DQQA 4OIAA 2P5EE 1NCCL 5KAQG 2VDNH 4GBXC 2V5SA 2EXWD 2N56A 1D5IH 4PTTA 2OMNA 4PJBB 4HDIA 2GJ6D 4OZGF 4YHLH 1HXMB 3TFKC 1RJLA 5CJQL 3M45A 2X4UA 4JM2B 1F4XL 3WXWL 4X5WB 4YPGB 1GHFL 4HIJA 5DJ0A 4WIQA 3HPLA 3S88H 5IEHA 4HS6B 3C8HA 3D18B 3VA6A 4X9IA 3PWLA 5ISZE 5CLWA 2ADFH 3F7QA 1HH9A 4CVZA 3G5XA 3L5XH 4L4JA 4IOFD 4YHOL 1EERB 4PJEF 4QHLB 5HVFB 4HMEA 2NW3B 3F12A 4J6RH 5IFJB 1WFTA 2DQEL 4LSRL 5FK9B 4P9ML 1X6LA 3TM6A 4DAGL 5I73C 2CR6A 4B41A 4M7LL 4NQEE 1Q38A 2OX5A 3BT2H 3C9NA 1KBGL 1FDLH 3EJJX 4NN7C 4JREC 1KCLA 3EFDH 4L9LC 4PLNC 4GXUN 2DQHH 3ARSA 3CDGB 4M48L 1EHLH 4HWBH 5J1SC 2I9LA 4FMFA 3UJTH 1BD2E 3QXVA 1TZIB 3LN5B 3STZB 3BPNB 1ZE3C 1IFHL 1G6RB 4LHUA 5CZXC 1RPQA 2OYPA 4CVXA 1U2HA 2CKBL 1P5UA 1QSEA 1BEYL 4JB9L 3EYQD 4UOW1 1T21A 4ONHA 4C54A 1BQHA 1QR4A 3BX7C 3SQOH 1VCAA 5KG9A 5D6DC 2DD8L 1QUNA 4MDJB 4HS6A 1A1NB 2JE8A 2PCPA 3S5LG 1QLRB 5IGXL 1MY7A 5LXGH 4I0PC 3K2UL 3S35L 1DQJA 3IFPB 3QNZA 2HN7A 2PYFA 5KOMC 3O3UN 5FYKD 4I77H 3D9AH 3FRUA 1NKOA 5D6CB 4S1RL 3AMKA 4I0PA 3SDYH 2B1AH 4KPHH 5JA9A 3C5SA 3GBNL 3R06B 4LHQB 4ELMB 2AJXH 2XZAL 5I66A 2P48B 2R4RL 4GT7A 2VWEC 1C5BH 3LN9A 3HC4L 1MVFA 2IALA 4KXZH 4PRIB 4YHZL 4RAVA 1XF2B 2EIBA 3LS4L 3QEHA 3JV0A 4I77L 1EGJL 4GRLD 4LKXB 5D7KE 1JHKH 2V5YA 4JVUA 1AY1L 3D25B 2GHWB 1DUYB 2W9DH 4DW2L 4OD3L 3ARGD 1R3HA 5IW1B 5CJXC 1D9KB 1GVIA 3D39D 1DLFH 4P9HH 3CH1B 4FTVA 2F74A 5FYJU 4KK5C 5D8JL 5J1TC 4NQSB 1FZJB 3QFDB 4X6EA 1VA9A 3RVWC 4ACPA 1NGPH 4G6KH 3A6CH 2P5WB 1F90L 4P2OB 1J12A 4X6CE 1IGTA 1EFXD 2W65B 2QTEA 2ICCA 3SGJA 1BVKA 5DA4A 1AC0A 4KMLB 3T2OA 1K4DB 1SJVA 4S1QL 5MEPA 4NKMB 4ZPTB 4ELKB 1F00I 4HJ0D 4XCYB 4LCCA 2AV7A 1BVLA 4M8VA 3CFJA 1U36A 1FIEA 1T22B 4PJCB 1LK2B 4UBDC 4JRYB 5F44A 2XTJD 4Z78B 1BFSA 3WIFB 3C2AL 3VFOA 1Y6NR 4Q6IA 4FRWA 2XKNA 1VADA 3L3OB 5GSVB 3C5JB 3OHXA 2HT4C 1IGIL 1DVFB 3RZCA 1JNLL 4R96B 2VL5A 4XP6L 1WBYA 5INDB 1WBXA 3T09A 3V5KA 4QXTA 1VFUA 3FQXA 5DJAA 3D3VA 4EIZC 3VG0L 3LMJL 2P24B 3LQZB 3FZUD 4IIQB 5ID0B 1R3LB 3WO4B 1PDKA 2Z4QB 1WIUA 3QIBA 2JIXB 5BRZA 4N5EC 3QYCA 3AB0B 1CK0H 3IKCA 2H2PC 4MAUL 1Q9OB 1JF1B 2PYED 5TE4L 3K81A 2AK4E 2FZ3A 1NAMA 2HKHH 4PJDB 3QDGE 4DQOH 5MENA 3DO7A 3SKNB 1R3JA 4KAQL 3TNNA 4ETQB 1P1ZB 3QRGL 3MRNB 2FH8A 1DQTA 4KK6C 1AJ7L 4YQXH 3HNSL 3ET9F 2D0FA 4OM1L 3OB8A 1I4FA 4G6JH 5LAXA 4OF3A 3ALPA 2YD9A 1MIML 4O5LH 1HHHB 4NQXA 1JZ3A 1SY6H 1SYVB 1QRKA 5IVZA 5FUCE 1TQBC 5JIKA 5DQJA 3GIZL 2X4RA 3QQ4A 1DCLA 2DBLL 1T21B 1PFCA 1RUQL 3CXHK 3H8NA 2VDPL 4YR6B 1KBGH 4HXAH 5EU4B 4PJHB 5GRJL 5GRZA 5B3NA 4OAWA 3IFNH 3WDHA 3LV3B 1BBJB 3SJVE 1F4YH 3RNQA 1S78C 3OJVC 4R4FH 2BVTA 2C7UA 4WI3A 1JTPA 5IT2L 3VFVB 3C87A 4Y19A 3DWTA 4PTTB 1U8NA 3LV3A 2ATPA 2C1PB 3QIBD 5ICZA 4OCWH 2A38A 2GJ6B 1ES0B 2PTVA 4A6YA 4I18C 3RY5A 2OJZL 3QUYD 2W91A 3EZJB 2W1NA 3OPZH 4MAYB 3O4OC 2WP3O 3SKUD 4R2GC 3C6LC 1NAKL 2R0ZH 1IGFL 3MRKB 3C2SA 3F65A 3RVVD 5GJTL 3V5DB 4Q9QH 2FJHA 1FO0A 4O51B 3HR5B 3GDBA 3KPLB 3GGWA 3S34L 1AGDA 4HZLB 3GSUA 4RNRA 3TV3H 4UAOC 2DIBA 1Z5LB 4XCFH 2A0LC 4KHXL 3HLAA 4OGAC 1E4KC 3IETA 2IJ0C 1JPFB 4A6YH 4I1NB 5EIVA 1XR9A 3GI8L 5EC1B 1BX2B 4OLXL 3CIQA 4FFZH 1IQDA 1VGKA 4NNYA 2V17H 4BKLB 4K7FA 3F7RA 3HNTH 1UKTA 2FZ3B 1YMHA 4NUGL 5DJ8A 3HE6B 3JWNC 5DYOA 3B6SB 4RMVA 5F7HA 1YEHH 2CR3A 3T0AA 5C0GA 1RURL 5FA4A 2K1MA 2W9LA 4P49A 4OM1H 1A64A 5EDXA 1JPST 2ADIB 5GRUH 1CDCA 1NAMH 4HWBL 3ULUE 1B3JA 3NN8A 1T7WA 5F9JB 1AFVH 1T20B 3DLQR 4Z7VA 1HINL 1KACB 3OAYH 2FX9L 4WRLA 1BFVL 2Y1VA 1WFNA 4XMPL 1MEXH 3ARDC 5KOVC 4X98A 2A77H 2BSSA 3BJLA 3CUPA 3K1DA 3V0WL 1T04B 4OQTL 1MCQA 4EDWH 3WL9B 5FGRA 1Z9MA 4I13B 2Y4SA 1WICA 3FQWA 1J5OL 5J13C 1X6NA 4LIQH 4G7YL 1N6QH 3HUJA 4WVRA 1X44A 3C60C 5D96C 5IBLD 3P11H 3ZDXF 2LQRA 5DRZB 4DFHA 1K5NB 2V7HB 1GYAA 1AGEA 2X10A 2Z93B 2EDYA 3BKYL 4KQ4L 1XR8A 4HGMA 2Y7QA 3QDGA 3BIBX 4NBYB 4WWID 1UB6B 1BGXH 1G7IA 1EVTC 3C60A 3MFGB 2W65A 5F96H 3CFEB 4Y4KD 3ARTA 3MJ9A 4JFDA 3C2AH 3MRRA 4I0PB 4G80A 1NMBL 1EX0A 3AS0A 2HRPH 4ELMA 3RWGA 4XNXH 4KHTH 1M71A 1H3VA 3TN0D 3QG7H 5GS0H 3TJEL 4M3JA 4JPIB 1P2CA 2YPVH 2A73B 1D9KA 4HC1L 1S7TA 2N7BA 3BD5A 3X14B 4D3CL 1IC7L 3QWRA 4K23H 1RK1B 3OKNA 3FONA 3FQRB 1NLBH 2FIKB 5I74C 3ZTNH 1BQHB 1C16B 3VI4E 1L7IL 3N1FC 1NGQH 3O2VH 1KOAA 5DK0A 3QXTA 1IGCH 4P2OD 2EH8L 5FO9B 4X5XA 1TJGL 1KIQA 2GEEA 3FFCB 4JFYB 1NBYA 1G9EA 4N0YH 1TVDA 1R5WA 3ZE1F 2I07B 4MSWA 3L5HA 2DLFH 1R5IA 4RGOL 4TNWF 1G6RA 3EUUA 3EO0A 4AEIL 4O4YL 3BHBB 1GGUA 1IGML 5KVEL 5GJSL 3GJFH 1HQ4A 1PLGH 1QTYT 1U8PB 2Y72A 4N0YL 4MAYD 2ITCA 2FWOA 4R26L 1DBBL 3WHXA 3MRQA 4IRZH 3T0EB 4APQA 3GMLA 1MJUH 4AEHH 4KC3B 5DUBB 2DM3A 3Q5OA 4NYLB 1YN6B 1IC4H 2QKIB 1FBIH 4Y5VA 4OT1H 3GSWA 4IRJC 4PP2B 5A2LH 4JFQB 4LSQH 3GUTB 4ZTPH 1A1MB 1HNGA 3T0EC 1JV5B 4YBLC 2QR0B 4Y5VB 4XPAH 4F7MA 1CGXA 4M5YH 1MHPH 3U48A 4QT5B 1A6VL 1NCAH 4I2XB 1E4XH 4WFFD 4XXCC 3KHQA 2BC4A 2C4FU 3KPOA 1T4KB 4HWNA 4HMCA 3ZT7A 3ZDYE 2FB4L 3B5HA 2I9LB 2KL6A 3J8F7 3HNVH 1X5FA 3ROOB 4UINL 5KS9E 3VXSE 1FFPB 1URLA 4ODHL 3HG1B 5D7JA 3OKKB 3V6ZA 4OQTA 3ARBC 1T5XA 2ED7A 4JKWA 4JRYE 4PJIA 1JGEA 2PR4L 3U30C 3WN5A 3UTOA 2A9NL 2ZJSH 3BZ4B 4LAJH 3T0VA 3VFTA 3ARBA 2OZ4L 4O58H 1R0AH 4MZ3A 1RFDH 3ZKSD 3SPVA 1HH9B 2NYYD 3GMPA 2UWEA 2CDEB 3ARZA 3TNMA 5EOQH 3WKNA 4P46B 3UO1L 3VRLF 2MMXA 1FP5A 3MJGX 5ACLA 3KS0J 4YHNB 1MAMH 3TVMC 3KPSE 3GSXA 1OM3H 3MV9D 4LPWA 3RL2B 5JQ6L 4XBPB 4P2RB 4RFEB 1MELA 3AS3A 4P46A 4PJAB 4XNMB 4NT6A 2NX5E 4ONOA 2VLRB 1CTOA 4M5ZL 4N9OB 2R2BA 4WO4D 4UU9A 1OTSC 3ZYOA 3VFGL 4XP9H 1I8LA 4FQHA 3RGVB 1Q8MA 1BD2A 1BJ1J 1NGXA 1LHZA 1W72B 4HK3N 4XNZC 2ATPB 1U93B 2VXUL 5F7DB 2R0LL 5DUPH 2RIKA 4NJAH 3QIBB 5GIRA 3O3BB 1LP9F 2DL9A 3U7YL 3GBMH 3MROB 2FX7H 2HT2D 4HIXH 1UJTA 3DV4B 4PRNB 5FYJL 3SOBL 5HYIA 1MCLA 1LO5A 1AP2A 1RHHA 2HRPL 3K2UH 3JVGC 4HBCH 3OF6A 1A7PH 3PIQA 4DKDC 3O4LE 4WHTA 3CLEL 1KC5L 1I1YA 3P0YH 4MNQE 4NNPH 2Y5EA 3MUGB 5ISZA 4LSPL 4PJ9A 1BBDH 3NCBB 2XNAB 1A7QH 3N06B 4GKSB 1RZKL 2H32H 3V4VL 4ZFFA 3HPJB 4TYUA 4ZS7L 4OZIE 3CX5J 2QKIA 4WTWA 5D1XD 3C5ZB 5EO1A 3SJVB 4HQQL 3T77A 1INEL 3LDBB 1I1AD 4QGYA 4JR9H 3DV6A 2YUVA 4KZDH 3A67L 3MLWH 2V6HA 3FQUA 3ARRA 3FZUC 3FHQA 1HYRC 1RJCA 5DD1H 3H9SB 1G84A 4FG6C 4OZGA 3U46B 1C7TA 1QLEL 1F02I 3BP7A 2IPUK 3QEQD 4IJ3B 1WQVT 1NC2D 5E9DA 4KK8C 5GGQL 2P7TA 1IAIL 4R4ND 4DVRH 2VH5H 1JK8B 2CLRB 2BJML 2H8PB 3JV6B 3C8DA 3U6RB 4MJ4A 1JPSH 4M03A 3V5KB 4KRMB 5BXFB 3VG0H 4YXKL 2OTUB 2O26U 1A14H 4UTBL 1UWEH 2AXFA 2P43B 1WF5A 4WFHE 3D25A 4IEFB 1MIMH 4U6HB 5KJRL 4NQTA 4Z7WF 3CDCA 1UADC 4UQ2B 3V4UL 4HF5H 1KTKE 5L2JB 1VGEL 4OZHF 3GI9L 4MCYB 2CPCA 3VDAA 3U2SB 3DMMD 2X9YA 3FN3A 1CT8A 5FFLA 5D2NC 2KUTA 2UWEF 5DRXA 3V5HA 1TJIH 4Y16B 3BH9B 3H7BA 1MCSA 5DO2D 5CP7A 3VXRE 3BMVA 3OXRA 4PG9A 5CJOL 4LBEB 3QUKB 3RFZC 4KK9C 3KPSD 3VFMB 3MBEA 3EJZC 4D0BA 3U0TA 4LSQL 2AXGA 12E8H 3I9GH 2VLKE 1F11A 4LSSH 2VABA 5IVXA 1KXTB 1CWVA 4O51A 5FF6A 4DZ8A 2I26N 4M1DL 1KCKA 2ICEA 3MV9B 5DJYB 1U3ZA 1OAYL 3M17A 3MLXL 1NDGA 1JGVL 1T3FA 2MKLC 3BZ4A 4PY7B 3NCJH 3ILQD 3ZDZF 3T0DA 2OS7A 4UT9H 4JRXD 3WCYA 5D7SL 4HT1H 1N7MH 2VO5A 3WFDH 4MDIB 4KMTH 2H9GB 3ULVE 1HOCB 1XF5A 4MXWL 4PRAB 2NY4C 4NQVB 2XYCA 4XXDA 1QLEH 3HMXA 3BFOA 3BPLC 2DOCA 4YX2H 3WO4C 5B39A 2NPLX 4TVPL 1MHCA 2F53A 3RHWK 2OTPA 4YHYC 4MQ7B 1QEWB 4RMRA 2J6EA 1INDH 4MA3B 5E6ZA 3EOTH 1RUAL 3IDGB 3M17B 5ADOH 3HI5L 3BZFA 4Z5RA 3BGMA 3PDOB 4LQFL 5TDPB 3RIFF 5D93B 4HUUA 1MCPH 3QIUB 2ZCHL 1L0XA 4HC1H 5D7LB 3QWQB 4P23A 1JE6A 2QQKL 3RIAF 2RCSH 3MR9A 1U8OB 1J1PH 3K3QA 3NIDE 2BNRE 3RWHB 1S9XB 1YPZE 5D7LA 2VDOL 3ULVH 4L4TB 4K8RL 2F8XC 3VFTB 5LVEA 3S4SG 2G75A 3MRKA 3WEXB 1NEZG 1KIUA 4ZQKA 2NXZC 4NCC2 3F7VA 3KYNA 2XWBB 1REIA 1RUPL 4G3YL 4JY4A 3CSGA 4P4KD 3OKKA 1B6UA 2YEZB 4G7YH 2GFBA 3UZQA 4JZNB 4F7PB 5I71B 1TCMA 3QAZC 4X7DC 5EUOA 3L7FA 5EN2A 4JFOA 1U8HA 1JF5A 4HWEH 4K3DH 5BV7L 1EXUA 4R0LA 4Z7OF 2C3XA 1XIWC 1B4JH 4EI6A 3Q5YA 4LOUD 5BXFA 1RZ7L 5IOPB 3LDBC 3OKNB 4WFHD 4F7EA 2HG5B 1IT9L 2R29H 4HUVB 1OGAE 3OKEA 4ZOAA 4LGSB 4OUUA 4N8CL 1MCOL 5EU3A 3OR6A 2B4CL 4HD9A 3CK0H 1BZ7A 5HY9B 3TO4C 3MOAH 3JBG7 3VXUA 5E4EB 3U7WH 5T1KB 3QUZB 1NFIA 2X4QA 2CKBH 4MD4B 2AI0L 5KN5B 5IBTL 2BOCA 3V6OA 2W60B 2O61B 4WDIB 1S7XB 4LLWA 3TBTA 2QQLL 4F8TA 4NZRL 5JW3H 1VFBA 1AKJB 1S9WA 4RGND 5C0EA 3RGVD 4LKCB 1I1CA 4RGMB 4TSAL 4HGWB 3HG1E 3NPSB 4QRPA 4OLWH 1HHJB 2W0KA 4U1KB 4F7CB 2C4XA 4EUPH 1CFTA 3RZCD 3Q3GB 1G7MA 4WUUA 4XGZA 1SJEA 4MJ6A 1HEZA 4PGCA 1BIHA 4Y4FD 5H35A 5DMJB 4PUBL 1OHQA 5D70L 1T5WB 4BK5A 3MGOA 4NN5B 2VXSL 1GAFL 5FO9A 4TRPH 1IEAA 2FEDD 2XZQH 4Z7OE 1HSBA 2DQEH 4LSRH 2XACC 4NBXB 4TSBL 3S34H 3BEWB 3HAEG 4RBPK 2J8UF 5DURB 1RI8A 1ZGLA 3AS1A 4KTDH 4NKOB 5TGBA 5L6YH 2IG2L 4GRLA 1A6ZB 2AXGB 4OT1L 5EBWB 5JXED 1RVFH 1SMOA 2V2TB 4JO4L 3ALWA 1KFAH 3C8KB 5DD6A 2BNRD 4GAGH 1SJEB 4XNYL 1YN7A 1YMME 4PD4K 1HHKB 1CXIA 1L7TH 5E1AA 2C9AA 4YX2L 1YMHB 1MAML 3GSRB 2IGFL 2DBJA 3H9SD 1XGQB 1TVBB 3O3AB 1E6OL 3PDGA 5HHVH 1CL7I 5F71A 1TNNA 3E2HC 1FN4A 3VDCA 4YDLB 3O6FD 4QHMB 1J86A 1KYOK 3IFLL 4DKEL 2Q8BL 4JFDD 4DGIH 4OFVA 5K93A 1RULH 3D0VA 3CZJA 4N90E 4MDJA 3IXAA 3TO2B 1X5XA 3L3KB 3QDJD 3BXNB 4MB5A 1MRCL 2JK5A 2BP3A 2DQHL 4M48H 2JCCB 2H26A 3TN0A 4ZD3L 4Q58C 2ADGA 4JKKA 1J0ZA 1N0XL 2VDRL 4ZXBB 3VXQB 4LCIH 4YE4H 2QHRL 3C09B 5I1CH 5IOPA 1Y6MR 4QRSB 1LK3L 3AU1A 1FE8L 4G9FA 4KV5F 3S36X 2VQUA 1R3IH 1XEDA 1KIRB 3VGDA 1A4KB 4TPRH 1ORSA 2DQGL 1G9ML 4ONFL 1YECL 3E2HB 3V8CA 2DD8H 2ZUUA 3HZVA 4DW2H 1U93A 4Y16D 1RZ8B 3THML 3GK8H 5ID1A 4MNGB 4O58L 3VWKD 3ZL4H 5E8PA 5J3HD 1QBLH 3G6JA 3D2UA 5DSCB 3UTTE 4IRSC 2F8VA 1QBAA 4GW1B 4C56A 3CFCH 1RU9H 1YNLL 3H9HA 3RKPA 3V7AE 2FH6A 2AV1B 2Q76B 4MXQC 2HFGH 4PRPE 2BJMH 1ZEAH 1U3HA 2Z91A 1P6AB 3GSUB 5SWQA 5HVHC 1QPPA 3SDDC 1XGTB 4JRWA 3WHXB 1CFVL 2VDNL 4LLUB 2CRYA 2GJZB 4PB0H 2H6PA 2XFXA 4OLYL 5C7XL 2VXVH 2AGJL 2HTKD 2BVEA 3SDDA 3B9VA 1N64L 1T1XA 4DZBA 2AKRB 1CT8B 5E8PB 2WUBH 1FAIL 4I3SH 1MUJB 2GSIB 3DURA 5E6IC 5CMAA 3RTQB 4ZSOE 1RULL 4S1SL 4HG4J 4APQC 3RDTB 2JF1A 2JB5H 3MLRL 3O8XC 5T1MA 5EZOH 4ZOBA 2BSED 3MODL 1CFQA 2DI7A 3KLSA 2COQA 2Z8WC 4HKZA 5HXMA 3QIUD 4U1IA 4Y5YC 4DKFH 3KDMA 3T4AA 4GKZB 4KJWD 1PZUB 4QOKA 2I60L 4CU7A 3R4DA 3O8XB 4HUMB 4YDJB 3U4BH 5H37H 2B4CC 4TPRL 4BQBA 4YC2B 1F11B 3GEWB 5JW5B 4GAFB 5HYJD 4I2XE 1IM9B 3RQ3A 2CD0A 3QH3A 4ODUB 3FO1B 4R4NC 5FYKL 5MHSE 1ITBB 1A7OL 4WUUE 3HC4H 3HZVB 3OXRB 4BZ2H 3DTXB 2DI9A 2X5PA 2YRZA 3GBLA 4HUXB 4B53A 4OGXH 3FN0L 1CGSL 4QWWD 3K0WA 4R7DA 4QRSA 2YKLL 2D31A 3REVA 3HPJA 3UC0H 1J8HA 4ZFFB 1A9EB 3QUMH 5KANI 3EOBA 2EDKA 5ICYB 4OSUH 5D1ZB 1OPGH 2JK5B 3WFEH 4PJXB 5JOPE 1RZGB 3VXUE 1MQ8A 2VXTH 5IR1A 2Y6SD 5DGQA 5CCKL 2NTFA 3MJ7B 1RMFH 1EHXA 2O5ZL 4JRXE 4AZ8A 3H0TA 3OAUL 1JP5A 1I3GL 2WQRA 3HCVB 3GUTA 4XP4L 3OKMB 1YEEL 4ZPVA 1GRWA 4HCRA 2DDQL 4DK3A 2GIYA 4GOSA 3WLWC 1LO5B 1RHHB 2HWZH 3M1BB 4LU5L 4L4TE 4WY7L 1U8LA 3MREB 1CDUA 3NH7L 2DI8A 3QIWC 3EOTL 4LDLB 2EIZB 5EUOE 1FVCB 4ZAKD 4RFOH 5FYLE 5BZDA 4OZHA 2D31B 4MA1B 4H26A 3GHEL 5AWNL 3H9SA 3UJIH 4LVOB 3EO0B 3MV7E 1ZLSL 4NM8L 1NMCC 4BJLA 2YC1B 4JHWL 3OTTA 1LEIA 5D6CA 5HYFA 1VKXA 1QG3A 3QUML 2EYSB 3T65A 3MV8E 2OR8A 2WWKO 2X4SB 3NCCB 4IBLT 4PRHA 1BAFH 4XPTH 4Y4FB 4UQ3A 2Z92A 3BE1H 5J6HA 1HDMA 1OAUL 3OKMA 1QLRA 1S7UA 1RU9L 4HUWA 5A2JH 5CJXA 4ZD3H 1OTTD 4LQ1A 1DQML 4L4VA 1MPAH 1BZ7B 5HY9A 4R2GB 1X5JA 2ID5A 4OZIF 4WHYG 3V6OC 3CX2A 3BSZL 4WY7H 4Y4HA 3MBXL 5KS9F 3TVMD 5EPMA 3OMZA 2BHUA 1YECH 4EI5C 1PVHA 4JN2B 2CK2A 1K8DB 5DFWH 1J1PL 4Y19D 5ESQA 3NFSH 3NCMA 4GUPA 4N0CD 2Y07L 5FM5O 3TP4A 4U1KA 3BQUA 1H15A 4HUKB 1U95B 4YBHA 3PDDA 2ADIA 3QUYA 5L2KD 2OQJA 4WDIA 1UENA 5SX4I 2YEZA 4XNYH 3PL6D 1U8MB 5I66B 1MI5E 2D0GA 4NRZB 2CRZA 3VRIB 4G7VH 3G08B 5D7IB 1JYVA 4L9LA 2OTWB 2BNQB 3IJSB 2CGRH 1EDQA 2UUDH 5C09D 2X4PA 1PD6A 1ACYH 1J7VR 4DFIA 4LNVA 4UT7H 2F5BH 4KGJA 4XP5L 1UCTA 3VFPB 4CVZB 2HWZL 2IADB 2XG4A 4J4PD 5C0CD 3BP6A 4HV8B 1ULVA 4DKEH 3FO0L 5ANME 5IVXE 4EJ1C 3QG7L 1FL6B 3AUVA 3FT2B 3LCYA 1C1EL 4U6XB 2VXVL 1KPUB 4HV8A 2PW1B 1LP9E 2HTLC 3KPLA 1RIHH 1G7PB 5TF1H 1A3RH 5T1DL 1HK6A 2W07A 1MQKL 3BZFB 4Z5RB 1A5FL 3IDGA 3WKML 3WBDA 3W0WD 5DVLA 3QI9D 1MCEA 4ZOCA 1CDYA 1YMMB 2NR6D 1QOKA 3HFML 3LS4H 3O2WH 3LN5A 3MNZA 4EDXA 2BXYA 3UAJC 2G5RA 2A6JA 2Q3ZA 3JUYA 3MYJA 4PJ8D 4TUKL 3UTSD 2JJSC 5TDOA 2ORBL 1MCPL 4GQ9H 1GOFA 1S3KH 1JZ8A 1YEFH 2QQLH 2GT9A 1A4KA 3QIUC 1S9XA 2AEWA 2YOCA 1MCRA 3QHTC 1XF5B 4L4TA 1WZLA 3IDJA 2YPKA 4WI6A 5H94B 4NRYB 1QD0A 3IDXL 1ZA6B 2M1KA 3TC9A 1DVFC 4J3WA 4LPYA 3F58L 1X4ZA 1A7NH 3N0PB 4X0KA 1U8OA 3CK0L 2KQMA 2Y23A 1EHNA 4UIMA 2ZOLB 1VADB 5CBEB 3IFNL 1A1MA 4LHJB 3HR5A 3SDCD 5ALCL 5FF6B 4XBEL 1CXHA 1HNFA 1FFNB 1J05A 1MQKH 3CX5K 3KYAA 3RUGE 1B6DA 1KCSH 4AT6B 3UTZB 3OZ9L 3O6MH 1WCBA 4GMSL 2ZUQB 2IC2A 5EZLB 1V3JA 5TF0A 4RX4A 4F58L 3JV4A 5CINH 2H9GA 3LSOB 2NXZB 3DO3A 4QRPD 2ED9A 2PTTB 3GSVB 1DUZB 1F4WL 4NQDD 2WSKA 1P7KB 2DQFA 4FQ1L 5AUMB 2Z31B 4XNUL 5BZDB 1ZS8B 4F57L 1NMAH 2QSVA 1O0VA 1WLHA 5C0IB 4Z7WE 5AG9A 5L2JA 3GZKA 3H3PL 2NY4B 3L3GB 3GJFB 1U8LB 3MYZA 1SBBA 1D9KC 2L7UA 3PXHA 1AGBB 4QHNB 2DAVA 3IS0X 4LVNB 3DVIA 5C0FA 5CGYD 1A6VH 4MNQA 1JWSB 4U1GC 4Y16C 2ICWI 3W9DB 2WBJA 5SWSB 4X5LA 2EXYD 4KROB 2Z92B 2DYPB 1F4AA 3QDMA 4TOYH 2A6IA 1P2CB 3IU4L 4U7SA 3EOAB 2XWTA 4XPGL 2EDNA 1HHIB 3IAQA 1FL5A 2ESVA 3A6CL 2I9TB 1VKXB 2XIDA 1MREL 3SKNA 4EXKA 1YYMH 4KRLB 4TVPE 1G7MB 4XGZB 4NRXA 4LMQI 3UYRL 4PJCA 3MA9H 4ZSOB 3ZSSA 4PRID 1IMHC 1IQDB 3FQUB 3PUCA 1CZ8H 1CU4L 2IPTH 3C6SA 5C0BD 3LQAL 4KJQC 3V7AG 2D7TL 4LLWB 1YDPB 2JB6B 3P2TA 4HS8H 2ZOKB 2YKLH 3DRQB 3QUZA 4XP1L 1X5LA 1WTGT 1CICB 5TH2A 2P5WA 5AYQA 3K4AA 5HYJE 4U1NB 4YFLF 1UZ6F 3JV5A 1C5BL 3MRHB 5IHBA 5TDNB 3U6RA 5KSBE 3OZ9H 3EOBB 1F5WA 2AJYH 1H8NA 5FA3B 4WHDA 4U6YB 3I50L 2AJSH 2E7HA 3VG9C 1A3LH 1VFOA 3LKSA 2BDNH 3LH2L 3BO8B 1I9JL 3K1KC 4XAWL 1B0WA 3L5WB 4P5TD 3FB8B 2HJFB 1ERNA 2C1PA 1E4WL 3OJMB 5F89A 1LK2A 3C6SB 2XPGB 5JXEC 3SDAA 5C6TL 3C6LD 4KMTL 1CFVH 4D9QD 4OI8A 2DQTL 1IGMH 2VE6A 3V2AR 5GIRB 1UXWB 4ORGB 2IFGA 5EOTA 4OFYD 4ZOEA 1A6WH 3ZHDA 2QSCL 5ESAB 3E1F1 3DX8B 2DTMH 3VRJB 2BVUA 4TVSa 3UAJD 3X11B 4YNYB 2VLJE 2XWJA 3IFOA 1IKNA 1W8NA 1VFAA 1PX3A 1NC2B 1T1YB 3IDNA 5C0FB 1WC7A 1FYTB 5I1KH 2XI9A 5FGCE 3P4OA 4M1DH 5E2UH 5IQ9B 1MVUB 1FZMB 3IU4H 2ZNXA 4U0RB 5CKGA 5M94B 1XGTA 2HTLD 4IHOA 2VDLL 2AI0H 3EFDL 1I85A 5CEXA 3ARUA 3D9AL 3N50A 2ZUSA 4YDKL 5IW1A 3RWJA 5E2TL 2N4IA 2FNBA 4R0LB 4RGNC 3I6GB 3I02B 3K8KA 3HZKA 3L3GA 3HC3L 2R1YA 4XBGB 5C2BH 4NQCD 4Q9BA 4Y7MA 3JV4B 4AEEA 5KW9H 3DXAE 1UKQA 1PKQB 2VMFA 4MQ7A 5CMAB 3RTQA 4KK6D 1ZLSH 3SQOL 2Z8SA 1KCRH 3FQTB 3W2DH 4NOFA 2MQ0A 5K9JL 4HIHA 1X5IA 5BVJA 1ETZB 2Z4QA 3GM8A 5IHZB 3VFRA 2VQ1A 4FQLH 1R3LA 4PS4H 3QA3A 5F6HI 1VEOA 1FZKB 2EKSA 4N0CC 4XRCB 2BNQD 1ZA3A 1T4KA 2G5BB 5IB4B 1A14L 4UTBH 4YK4C 3TBVA 3LOWA 2GUOA 3WIIL 1F6AA 5JNYA 4JKLA 1OB1B 1OP3H 2NTSP 4QRRB 2EZ0D 3CZFB 2UZIH 5K33A 5EA0L 4XBEH 1NGWA 2E9JA 5FYKU 2DYPD 5ERWB 2X9WA 2CDEA 3MV8D 2VDOH 2GT9B 1G6VK 4RRPA 4AG4H 5C6TH 1EEZA 1JI1A 2J7LA 1LE5B 1P84J 1X3DA 1RSFA 4TSCH 3X13B 1NGZB 2EE3A 4U0RC 5JHDD 2C3WA 1J18A 3W9EB 2YSSA 1JHKL 5DQDH 5JOFA 1NCBL 5DS8B 3HA0A 4ETQA 5BZWB 5I1HH 4KTYA 2VXUH 4CW1A 4XPBH 1PX4A 3W82A 2PO6C 5B21A 4M9OA 1ORSB 3AFLA 1IM3A 5I1KL 3VXOB 4XNQB 5J6GB 2F19L 5HHME 4NUJB 4YBQC 1V5JA 4JFFB 2NY6C 2PO6A 4IRZL 2WP3T 3T8XB 2VUOA 4K9EL 4XWGL 2V2XB 5TDNA 3QPQC 5HVHB 3MLTA 4TNVK 4JHWH 4OCLC 5BMFH 3VXMA 5IWLA 5JW4Q 5E5UB 5IF0B 3CVHA 5GRWA 4M9PA 2R8SH 4PRPB 2BX5A 2V7NB 1IZKA 3FMGL 2BNQA 3SDXA 4HT1L 3ARYA 4XMLH 5CSZB 4AYFA 2UY6A 1ORQB 3RU8L 3W0WE 3NH7H 2HLAB 2ZOKA 3DRQA 3DSNA 2DF3A 3L3OA 3P77B 2Z31C 4LLQA 1TENA 1TJHH 5DJ6A 4L4TD 4X5WA 5EOCJ 2W0FA 1PZ5B 4NJAL 4UDUB 3ESUF 3GSNL 4LIQL 3RWGB 1RIVH 5MHSD 4MJ6B 4NO2A 4ZUUA 3MRMB 3O4OB 1CE6B 2GITA 5AYUL 5KVDL 1KENH 2I07A 1DANU 1KJ2B 1FL5B 1SEBB 2ESVB 1YEIL 1R5IB 3EDDA 2CXKA 5I8OH 2PTUA 3MZTA 4QRPB 3DV6B 2DQUL 4PJFF 4PGBA 1U2CA 1LO2H 2XWTB 1YNKL 3RWEB 1DQJB 2AXFB 3IKKA 1HILB 3MRJA 4YHIA 3KYMA 4HWEL 2XXMB 3KVQA 4LCWA 4UIKH 1ZLUH 4F7TA 5EOQL 3CVHB 2NY2B 3MQIA 1RURH 3BEVB 5D2LB 3ZMRA 4WUUD 1INEH 3OR6B 2YR3A 1CFSA 3CH8A 4M3KB 5KJRH 5IMMA 2ORBH 2O5XH 3OGCA 4NQDA 3MLVH 3TBYB 2EC9T 3RUGB 3GMQA 4YWGL 5A2FA 1M71B 4AM0B 2C1OB 1HDMB 1KJ2A 1SEBA 4J2XA 5HDBE 5TE6H 1EJOL 1SJHA 4W6YB 2J4WL 4G8GA 5CSGA 1LQSR 4OFKA 4PGBB 2ATKB 1FDLL 1KTLB 3QEGL 3O3BA 1IC1A 2P8LB 1OTUD 4AT6A 1JPTL 3TBWB 5EO1B 4GG6B 1DR9A 5DEFA 1QSFA 4MD5A 4GXVL 2GJJA 2EIZA 1NMAL 3PG2A 4Y4KA 1FIGH 1MFEL 2Y5TA 2F15A 2D7PA 2FDBP 4QHKI 3O41B 4XTRD 1L7IH 5B39G 4GBXA 3HN3A 2ZUQC 1ZHLA 4QRRD 3VCLB 1YEFL 2AXHA 3WXVL 2OL3A 5E1HB 4HKZB 4HIEA 3RWIA 5GZND 2DL2A 2MJWA 2O5XL 3VE0A 2DDQH 2E6JA 4UT6H 1MAJA 1X5HA 4X4YB 1G7JB 5DVKA 3LKNB 3VMOA 4G6FD 3NN8B 3ZHLA 5BOPA 1SVCP 5JHDB 1EA9C 2AABL 4KHTL 3VFRB 4WWKA 4PTUA 2HMID 3P73B 5EUOB 3LB6C 3RUGF 5CEYB 4ZMAT 4N8VG 4P4KA 3MYJB 3LQAC 1NC4B 1YQ2A 3EZ8A 4MB4A 5F7YC 5AD0A 3TBSA 3TCLA 4BKLA 1KB9J 4I18A 5ILTL 3RPIB 3RI5F 4Y89A 1KPRA 1OSPL 4GG8B 1KEGL 1WK0A 3U4AA 2VYRE 5I1GH 1D6VH 3HC0B 5I1IH 3FB5B 4X6DE 1SJXA 4PBVC 4OLUL 1N5AB 1I3RA 4QOKB 1NCTA 3NIGE 2ICEB 2E3VA 4JQIL 2JELL 3BUYA 2GKIA 1M6OB 4JFPB 1ZMYA 3SDCA 3S96B 2MSPA 4ZG1A 1UWGL 1KTDA 1JIBA 3V4UH 3VRIA 3OAZH 4DEPC 1NQBA 2X7LA 5F96L 1VGEH 1OP5H 4ZUWB 1DANT 5FUOH 2IAND 1T1XB 2PW2A 1Z9SA 4PG9B 4BZ1H 1F4WH 1ZVSB 2BY2A 4I3RH 1ZSDA 4MJ2A 3RIAK 3HKFA 4RRPG 1S7VB 5HI3C 3O11A 5F3BB 1JTOA 1OAUH 4G6JL 2Z8VC 5ADPL 1OLZA 1PAMA 3QQ4B 3LKOB 1T0MB 1Q9WA 4S1RH 5F7WC 3UTSA 4WJ5B 4PJ5A 1AXTL 3SEPA 1MY5A 1NCUA 3BUYB 1MCOH 4U05A 3CNKA 1I85C 3KYKL 1Z3GH 5IVZB 2JTDA 4U4BA 1C5CH 4N0FB 3U0TB 4HKJB 1U3HB 3NIGF 4JY6B 1JTTA 1UM4H 2YD5A 1WUNT 1YN6A 3WJLC 5C92A 4ZFGH 1IVLA 1T0NB 3GIVB 1DDHA 5C09E 4B7IA 2VIRB 1P1ZA 1RZ8A 5KSAC 1QO3B 3VXTA 3GSNH 4FFWD 4OBRA 1AO7A 2FJFA 1WWAX 4MX7B 1QBBA 1PKQE 1RFDL 4BZ1L 3QJHA 4YXKH 1CN4A 4BFBD 5IROA 2A83B 5F7UA 3LD8C 1KNOB 1T2QL 1PZ5A 4PV8A 1YNTA 2Q8AL 1MHEB 1MCJA 4BQCA 4PB9H 2ZCKH 5B3JF 4JDTL 3S5LA 1NBYB 2BVOA 3LQZA 4M4PA 3MC0A 1DBJL 5HVGB