1P7KB

Crystal structure of an anti-ssdna antigen-binding fragment (fab) bound to 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (hepes)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
217
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody light chain FAB
publication title Structure of an anti-DNA fab complexed with a non-DNA ligand provides insights into cross-reactivity and molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB02
3V5KB 3U0TA 3FQXB 3BGMB 1UJ3B 3TBSA 2Y07L 4YXLL 1TZHB 5D7JB 5IJVA 3CVHL 3LD8C 1X5GA 3HG1B 1DP0A 3OX8A 3QO1B 4MZ3A 1IGJA 2J8OA 2R29H 3RZCD 1RUML 3PJSA 1SJHA 1XMWA 2YHGA 1IEAB 5FYLD 4PY8J 4PJ9C 4J3UA 4RZCA 2JJWA 1DQLH 4ALAH 1A0QL 5GGUB 2BERA 3EYOB 4TQEH 4DVRH 4G8GB 5D5MA 3KPNA 3BPOB 3GDBA 4OUUB 1RZKC 4QRRE 3KNBB 1QRNE 3KLHC 1RZJC 3P0VL 1IL1A 3UYRL 3LQAH 4HV8A 2W9EH 4NFCA 3L7FB 3QT2A 4G80B 4HIHA 3ZKND 5JR1L 2NY3B 3SKOB 1WGOA 1F3JA 5IG7B 5IFJB 1ORSB 1YMHB 4OFVA 1QR4A 3A6OA 3JVGC 1R5IA 4M03A 2E7MA 2XZQL 4X0KA 2FEDD 4XBGA 2X89D 4HS3A 4G6JH 3TT1H 1HHHB 5IOPB 4XHJD 5T3XE 2YK1H 2MQ0A 3Q5TA 1NSNL 2B20A 5K9QI 3DPBA 3SKUD 3DGCR 4AYFA 3IXAB 2VWEE 1NDMB 4FXGB 1WBXA 2A9ML 3QEGH 3RWEB 3GK8L 2W91A 1I3VA 4ZQKA 5IVZA 3L3HB 3DRQB 2QSCH 1J9CT 3QNYA 2C7UB 2FO4B 5FK9B 1VFBB 3MBEA 3CFEB 2VRAA 2X9WA 1QLEH 1N59B 4X6EA 2CLVA 1YEDB 4JFHE 1L7IH 3THMH 2NY1D 4LCIL 3OR7A 3MRRA 4P59H 3HTLX 3ZKQD 2DJSA 4G9FE 4Z7WE 4G7YH 4J6RL 4ONOA 4Y5XA 3KLAA 5D71L 1NL0L 2HP4A 4JGUA 5GRYA 3HI5L 1JYVA 3LQZA 1U8LA 4JPWH 3QUXC 4U1JB 5K9QG 2ICWA 5HI3D 4KU1A 1Q9KA 4JB9L 5KANG 4JG1H 1MPAH 1ZA3A 2EEBA 3BKJL 3GB7A 2VL5A 3ESUF 3I6KA 3ES6A 5CKGA 4KY1H 4YUEL 2ZCHH 1X5AA 3HC3L 3KR3H 3FQRA 2IPTH 3RWFA 1OP5H 1JWSA 1L0QA 2Z93B 4P57B 2W60A 4F9PA 5E6ZA 4FQHB 5CD3A 1D9KC 2A6JB 1F6AB 3U0PA 3WFBL 1EVTC 2NY1B 4I18C 4AIXA 4Y4FC 3EYUL 3F5WB 5F96L 1MLBA 4JFZH 1UB5A 4MB4A 3HAEA 3C08L 3MLXL 1JZ2A 4OZHF 1QACA 1QP1A 5CBAA 4ZNEE 1IQDA 3ARFD 3OPZL 2EH8L 4LPYA 3LKQA 3FQUB 4QY8A 2VAAB 5TE7L 4YHYB 3S35L 4TSCH 4M9OA 5IQ7L 2J8HA 4I48A 4QRTA 4ZNCD 4WUUA 4OCNC 3MCKB 2D7QA 4MQSB 2CGRH 1P7QA 4N0YL 5DEZA 4WWKC 2B0SH 4ZTPH 4LVOC 4L5FL 1E4XI 2H2PD 2YPLA 3E6HB 3MV11 1G0DA 1B9ZA 3QHFH 4FG6C 5HGAA 4MDIB 4LCYB 1HOCB 3ZE0E 2QTEA 5I2IA 4YXHL 3G08A 3QA3A 1CGXA 4I0CC 1DBJL 1QRKA 1KCVL 2AJ3A 3P9WB 4XPTH 3QDGD 3SGJA 3Q6FB 1DBAH 1RZKH 1FNFA 3I02A 3WS6C 4F15B 5E8NB 4PB0L 1RZJH 1MCLA 4Y5VB 4WVRA 4FQQA 5GPRA 1YYLL 3MV9D 3B83A 3DO7B 4C55A 1OP5K 3F7VA 4HZLA 3EO9L 4OLZL 3ARFB 5EBMB 4PJBE 4QXUL 2FSEB 1HHJA 4K7PX 4M62H 2PCPA 4PGCA 2P8PB 3VFNA 3K74B 3WUWA 2VXVL 1F13A 5D1QD 4O2CA 2VYRE 1FJ1B 1NCCH 5CHNA 4K8RC 5IB3B 3ZO0A 3CPLB 5FHBL 1SYSB 3STLA 3QZWB 2VLKE 1XGRA 1YN6A 5I19H 3TESA 1KJMA 1Q94B 5DD6B 3SJVA 2DL2A 4PS4L 4HHAB 5FKAA 4R97B 2F8XC 3QDGB 5DI8B 3DUUA 4BKLB 5BMFH 3GSVA 1U8NA 3FO1A 1G84A 3MV9B 4H20L 4Y8DC 5F89A 1U6AL 2E8YA 3BEWA 3RY6C 4BQ9A 2YPVL 2V7HB 3FO2B 3SDCD 4ZFFA 4N0UB 2AS5M 4GQ9H 4ORGB 2AVGA 2XV6B 5IUSA 1M7IA 4YEEA 3NZ8A 1T20A 5HHOA 3IFOB 2R8SL 1HINH 4UI2A 5J6GA 5H94A 2EDTA 1T83C 5D1QB 3BN3B 4ZAKC 4XCNA 2DM3A 1A47A 5J06A 3ME0A 3T0AA 4J1UB 3F7YB 3INUL 5TJWK 4OCSH 4NNXB 1KJ2H 4LIQE 3O8XD 3V4PL 2R9HC 1QSEE 1MJ7H 1TJHH 1MFBL 4POZD 1JRHL 1JGDB 4KJWC 3EOAB 4TUOA 4BZ1L 2BXZA 3UPRA 3D48R 3O2DH 1CDHA 4MWFB 3ISWA 3KPQB 1R24B 4EEEA 1UWGH 5MP6H 1AGBB 3GGWA 3K4DA 3HAEG 4P5TB 4PJ5E 4C54A 1T5XB 1OLLA 3LV3A 3SDCB 3C8KA 4I3RL 1EZVY 1AR2A 5F1IB 3VDAA 5SWQB 4OF5A 1YYMH 3QH3B 4Y2OA 4EIZC 2RJMA 3NA9L 5DS8B 2P45B 3Q3GB 2APWA 4PJAE 2JJTA 3QULB 4OCLC 1W72L 3WXVL 3D3VD 3TFKC 1RUKL 2WWMC 2P1YA 4OM1H 4ZSOA 1G9NL 5LWYH 2DKSA 3TWCL 2Z4QB 2R0ZH 3BH9A 4PRPD 3Q6GH 1YC8A 4Y16A 4RGMB 5TF1H 3U46A 4NRZA 4I5BB 4ZS6D 4Y2DC 4JRXE 3SGDH 3D18B 1ETZB 2A74B 2X2YA 4NQSA 1MELA 1KIQB 4G8FA 1FL6B 2CJUH 1KN2H 1KTDA 4HKXB 5GZOD 2P44B 4WHYH 3C09B 4U1NA 4JDVB 3GMNB 4GH7B 4GAJL 4R2GD 4XVTL 3BOVA 1M05A 5HDBF 5ADOH 1CTNA 1N5YH 3VWKC 4QTIH 2C3VA 2K1MA 1TIUA 3KHOA 1KLFA 1E27A 3EYSH 3GJFK 3VXUE 4O4YH 4RISL 2JB5L 5IBLC 4AEHL 3WUWG 4XAWH 4OFYD 1GZQA 1JFQL 3D3VB 3O2VH 3PIQA 2EEDA 1LHZA 2VDPL 2XOTA 1ZXQA 1EV2E 4PRPB 5TF0A 1LO0H 1CFTB 5ANME 2CD0A 1YDPA 2QSVA 2D3VA 2WK2A 5IB5B 3UC0H 1RK1A 4KVNH 5BVPH 2HT2C 1NCBL 2GI7A 4K8RH 3H9SE 2LU4A 4KDVA 3L5XH 4JFYB 4RAUB 1ZVYA 5KS9F 2FZ3A 1MHPL 5F3HB 5D2NC 3UZVB 1PEZA 5F71A 4GG6F 1IGTA 2K7PA 4ZUUB 4R2GB 1UZ6F 3RVWD 1FV1B 3FHAA 1Y18B 1OQOA 1YPZB 1JGLH 3BWUC 3KJ6H 4QRRD 3SKJH 1QRND 3ZTJH 1IKNC 3PHOA 3IDGA 4XNQA 2YD2A 5FYKL 3DJ9A 2CKBH 2IANE 5FFLA 2X5PA 3QXAB 1OTTC 32C2B 2YD7A 1EEYB 3B2UC 4LHUA 4XP6H 1AIFA 1IAMA 3H42L 1NCDL 3O9WA 4V1DA 4NWUL 1A3RL 4P46A 5ETUA 3W81A 5F1NB 4KI1A 4JHAL 3CX5K 1NLDH 1W0WA 1FFPB 4X7EC 4MSWA 1A4JB 2YEZB 4UIKH 2X4NB 4QRSA 5EO1A 4J2XA 5T3XD 5F9WC 3UXFA 5KG9B 1DSFL 3NPSC 1LO2L 2ZPKL 4Q6YA 5HYFA 1RUAH 2DQFB 5D7SL 3GSNL 5C0DB 3RVTD 2MPAL 1MCKA 1MREL 2R4SL 1R5WA 3BP4B 3WDHA 3GRWH 3FB7A 3CXDH 3V6OA 4KC3B 1KT2A 5FHAL 4NPYB 4RAVB 1PYWA 4QRRB 1PY9A 4RGNC 1QRNB 3PP4L 1C08B 2XQBL 3LKRA 3MUGB 2BVOA 4JFHD 4LVEA 1R0AL 4BQ6A 3RU8L 4RDQF 1YJDL 5DO2D 3WFEH 3FRPA 2HYMA 1LEIB 2QKIB 5HI4C 2FATL 3FONB 1OWRM 4H0HB 1SBBA 4RMRA 1DEDA 3AB0B 3TIDB 3ZTNH 5CSZB 4PJHE 4K7PH 5CJOL 3CSYA 4LK4A 4HUXB 1T1XA 3HS0B 4TVPH 4JPKL 1AP2B 5CCKH 1AQDA 4M48L 4DZBB 3T8XA 4NWTH 3ULSA 2ED8A 3QO0A 2KZ1B 1TQBB 3UJJH 2VDKL 5DHVA 2H32H 1DUZB 2DDQH 5IBTL 2VDML 1FIGH 2Q8AL 3UTOA 4XPHH 3FQNB 1A2YA 5TGBA 4L4VE 1NFDA 4NKDB 4D0DB 4QEGA 3QISA 1UJ3C 4G7VL 2RFXB 5CUSL 5EUOF 3RHWK 3EOBB 1U91A 5F7YC 3G6DH 4Y4KA 2OBGA 4OCXH 2XT1B 1JNNH 2AEWA 1F4XL 4ODHH 2VE6A 4Z7WB 4G9FB 1MHCA 4YE4L 3NTCH 4KDTA 3MLWL 4FQ1H 3BHBB 3Q1SH 5DXWA 3NH7L 1LEGA 4IRJD 1C8PA 2X4OB 5ECJE 3G04B 1V5JA 4L8BA 4LP4A 1GHFL 5B39B 5DMGD 3MA9H 2BSTB 3L3DB 3BPOC 4K94L 3NACL 4LEOA 1TCRB 2FGWL 3GI8H 1I7RB 3DVGB 1GIGH 1I1AD 2FH6A 2HWZL 4NO3A 5EH1A 1Z9LA 1PZ5B 4LPUA 5C0BE 2NY3C 2ADGA 4LHUG 3M17B 4X6DA 3CCHB 3TO2B 3T2NH 4XPBL 3TBVB 3KG5A 1NC4A 1YECL 1IC1A 4R8WL 5J3HC 1GPOH 5DR5H 3IFNH 4NP4H 1BVKA 3VWJB 3QP3A 4P3CH 4D2NA 5F7DA 4KJPD 2ORBL 4HIXH 5JOPE 4U6HA 1T89C 2HJLB 1CT8A 3ZT5A 4GG8A 4WTZA 2BY0A 3VDCA 4DW2H 5C8JB 4IRJB 5ICXA 2I5YH 3CFKA 1F58H 2XA8L 4CJ0A 3S96B 2J8UF 3AREC 3V4UH 1WCBA 5CGTA 4WRLA 4CDHA 1FFNB 3EDEA 3IJYA 3G6JA 4FZEL 2A2QT 4NO5A 4EDWH 1YA5A 1NCNA 3BKYH 4LKXA 1P6FA 2P8MA 2VLKD 1WTLA 4GS7B 3VI3E 1ZT1A 2HA1A 1H0DB 1Q9OA 2GIYA 2DQTL 3V8OA 4OQTL 1ZGLP 3IVKA 3ARGA 2AK4E 2IH1B 5GRVK 1MUJB 1HH9A 5D1ZC 4LPVA 5E9DA 1AFVL 1SY6A 2MTPA 2NW2B 4TUKL 4UNVA 5BXFA 3LKPB 4PJ7A 2GSGB 2FEDC 4P2QA 3KYNA 4RRPG 1INEH 1N3NA 4P3DB 3V9FA 3E3QC 4XHJC 4CMHB 2A1WH 2ESVA 3HI1B 3OR6A 4PJBB 3SKMA 1IBGL 2DQUH 1I7TB 5I1AB 4KUCD 3U7YH 2KQMA 5GGQH 2QQKH 4Q58C 3IJSB 2LAAA 2D7TL 3U4EB 5B8CB 2O5ZL 2XKUA 4O9HH 5KW9H 1IC7L 1MF2L 2XWJB 5FYJH 2WIMA 4KMTL 4KKBC 5CJXA 4L8CB 1EAJA 4D0BA 5DT1H 1OM3L 1CL7H 4UT6L 3SKNB 2Q8BH 4CMMA 5JIKA 4BH8B 2ITDA 2VLKB 1BOGA 3CMGA 4WY7L 2ZOLA 4J3SA 4WW2F 43C9B 3W9DB 1MRFL 2NY1C 3VD9A 3H3PL 3MRMA 4D3CH 1RJLB 3VD4A 3CJJA 2BMKB 3TGXA 5EUKB 4BA8A 2YUVA 4U6XA 2N7BA 4J4PD 4X4YB 4Q6IC 4YHYC 3CFCH 3VRIA 2DTML 5I75C 4Y1AA 3AS3A 3MGAA 4RGOL 3GI9H 1IC5H 5JW5B 1KNOA 4GAGH 3PWNA 1IQWL 3ARDA 3UTTD 5F21B 3QQ3A 4OI8A 3O6FA 1FZOA 4ZFZA 3MNZA 2OYPA 1M7DB 5FYJU 1IAIH 4LSUL 4PJCA 5TE4H 4ODUB 4EDXB 1AGFB 1C7SA 2I9TA 1OW0A 3F65A 3WIFB 2WUCH 3FTGA 3O6LL 5FGBC 3K1DA 2MWCA 1N2RB 2DI8A 4JRXD 3L6FA 1RJYA 3GMPA 5SX4H 3OJDA 2XTJD 4UTBH 4XRCB 3UYPA 3PHQB 1BECA 1V8HA 2YC1A 2DLFL 5HHXH 4LPTA 1JF5A 4XXDA 4NJ9L 5GJSL 1MFDH 2XZCH 5JQHC 3TA3A 1U58B 5DZLA 3ARFC 3UTZB 1ITBB 4PJ5B 1EDQA 3HZMB 3BESR 3VXUD 2P5EE 4ZUWB 4WTZG 1LO5B 1CVRA 1V3KA 2FYYA 3MACL 1FBIL 1FVEA 4PJAB 4XCCL 5E70A 1G0YR 3JSSA 2OJZH 4HKBA 3RL1A 1S5IL 4U1MB 2Y36H 5FYLH 2IG2H 4LGSB 1CR9H 4X7TA 4K2UH 1K8DA 2MJWA 3C6SB 4LLMB 4R4BA 2X7LA 4N1HB 1GGIH 3NCEB 3NPZB 4R97C 1BEYH 3WDJA 4X7SL 4JRXB 2XA3A 1EO8L 4F7PA 5DRXB 4X6CF 5J6HB 3QDJE 1EZVX 2XPGA 5DJ0B 2PXYD 3O2WH 1CXIA 1EHAA 3M07A 4M5YL 3DBXA 4TOYH 1J86A 1YEJH 1G7LB 4D9QD 2C1PA 2HJKA 2VR9A 1N8ZA 2NR6D 2Z92B 4MD5B 4XWOC 5HDLA 1U2CA 5TFSH 5M7QA 3OF6D 2D2OA 1A9BA 2VSCA 3GIVA 3LZFL 4YH6A 5H8DA 3DV4A 4BZ2H 1G1CA 3VXUB 3W82A 4LVHB 5LJYH 2ZG2A 2HG5B 5D1QC 3LDBB 2ZCKL 1OB1B 1KXVC 2IAND 3RL2B 2AJZB 5FYKE 2G75A 1I1YB 1A64A 2FIKB 1B0RA 5C1MB 2QEJA 1FQ9C 5LGHH 5IBUB 4OLYL 4J8RB 5ANMB 4X83A 5IMMB 1M6OA 3RP1A 2BRRL 1DANU 1U3YA 2FB4H 4PJ9A 2MHAB 3AUVA 3CVHB 3GSWA 4LBEA 3EJZC 1IGFH 2AEQL 2PXYB 2VC2L 2FEEL 2CLRA 2WLYA 3VXOB 5E08L 4HCRH 3P4OA 1J1OL 3O4LA 4P5TC 4PTUA 2E9JA 4UDTB 4HJGA 1VACB 1T2JA 1VKXA 2IBZY 4WFEE 1WC7A 3SDCC 4P2RA 4AJ0A 4ZTOL 1QZ1A 2IQAA 4WU5A 3WKMH 3GKZA 2ZKHL 2VDQL 1G7JA 1U0QA 3O0RL 4MAUH 5ALBL 2X6MA 3KPSA 3NIGF 4P23B 4X4ME 3EOTH 4OD3L 2CXKA 3SO5A 2ZUTA 3O3EB 2IANB 5C9JA 5E00A 1CXEA 5D9SB 4H8WC 2F8VA 4OCWL 4S1DC 5JQ6L 1RD6A 5DRNA 4M8QB 4POZC 2EO9A 4MNQD 1R3JB 4JVWA 3ROLB 4E5XB 1NJ9B 3JWDL 4LQFL 2F19L 4S0SD 2PW1B 4MNGE 1KULA 2HT4D 3C09C 3QEHA 3IDMB 1LP9E 4AG4H 1FCGA 4L1HA 2GT9A 2X4SA 4E41E 5IGXH 5KSVA 4CRPA 5JIIA 4FQCL 4O2FA 1UM4H 3QPQC 3KS0J 3OGOE 1YEKL 1P4LB 5E94A 4DKFH 1L4IA 1CDCA 4IRSD 4NCC1 5LCVL 3QQNA 4LF3A 5HXMA 3SE8L 4JQVC 3LH2L 2B1HH 1RFDH 3RWGB 1OOAA 1U3JA 2WBJA 4YHIB 4ODBD 4O02L 3AS0A 1EIBA 2VISA 2DI7A 3V7AG 1AKJA 1U3HD 1MFAL 4X4ZA 2O93L 4HG4K 2I26N 3STZB 3L95A 3KDMA 3BKML 4WEBH 1AQKH 4XH2B 3VD3A 1KBGH 4P2OD 1MCJA 4ZS6C 1NCWH 1TTGA 3PWLB 1P84K 3GSQA 3LMJL 2R2HB 4I0PD 1MHEB 3ULUF 2JELL 1P4IH 1KJ2A 5DD3H 5GZOC 5D5ME 4PJHB 2OK0H 1ZKAA 3HZVB 4R2GC 3OB8A 3HNTH 2IMMA 4ONGH 4ELMA 3BW9A 4Q9RH 4XMKL 4NZDA 3S34L 3QUYC 1H3PL 4LLVB 2GHWB 4IRSB 1EPFA 4YNYA 3MRCB 4PRHD 5K59F 5HYIA 1U8KB 1YNLH 4HMDA 4L3CA 3VFRA 3K7UA 1KLUA 5DJDB 2HFGH 3GMOB 3RKPA 4L4VB 1KG0B 4RMSA 2ZNXA 1U3HB 3BP6B 4NQDE 4QYOA 2JIXA 1S7XA 4F2MA 1U95B 3S3PA 1CD1A 3BDYH 4NM8H 1T21B 1WAAA 3QXDA 5HDQH 3AAZA 1YEIL 5TDOB 3MFGB 4YC2B 4P2OB 1Q1JH 4HQQH 3QUZD 5JMRA 2J1KA 4OKDA 1A6UH 1GGCH 5T1KA 5KVGL 3MJ6A 4HXAH 3DXAA 4G3YL 5HYSA 3MRQA 3RVWC 1JV5B 3CVIL 2BK8A 3CH1B 3V0AC 5JIPA 2Z31D 4NIKB 1JWMB 1WTGT 4YPGB 5AD0A 1IGYB 4KK6D 2VB5A 1MI5A 4HKZB 3RIAK 4N8CH 5CZVH 3WD5H 3BXNB 3K2UL 3U0WH 1MSPA 4PRID 4WCYH 1CBVH 2L0DA 2VLLA 2HN7B 1RMFH 5I8EB 5C0BB 4F8QA 1JL8A 3OKMA 4RA0C 1CQYA 4PR5B 1P7KA 3HHRB 4ETQB 3AXLB 4OGXH 1CXKA 4NQCA 2VIRA 2ADIB 4LARH 4HUVA 1NGQH 4QNPE 2YBRB 1BGXH 2D7PA 4Y0GA 1BAFL 4H8WH 2EYRB 1FLRL 2D03H 2ADFH 3RI5F 1J7VR 3RWHA 3B5GA 1IGCL 1RVFL 2XIDA 2X70B 2IH3A 1ZGLB 3RJQB 3OAUL 3RVTC 4Z6AT 3X14B 1XGYH 2VWEC 2PYFA 4MAYB 3RBSA 4NO2B 4QHNA 4MCZA 4XP4H 3ELAT 2Z31B 5HGDB 4U49A 1LDPH 1ZHBB 2VDOL 4X5LA 1FN4A 5FO9B 1ZTXL 4MA1B 1P1ZA 3GSXA 1RIVL 5HYQA 1RHFA 5EC2A 1CK0L 4X80L 5DO2C 1ZV5A 3CAFA 1SYVB 2AXHA 3OZ9H 2C3GA 2CKBA 5DEGA 1LILA 1P2CA 4WUUE 1CIDA 5J1AB 5I1DB 2R23B 3RY5A 1NLBH 4ODTH 1U8OB 2OP4H 4OFIA 4DN4H 1IM9B 1MJJA 3CC5A 4X5XA 1T83A 3GIZL 3PNWA 3QNZA 1HSBB 5ESAB 4DKDC 5KVDH 1UACL 5E4EB 3SDXA 4H5SB 3SGDI 2FWOA 1F90H 1I3UA 3K46A 4FFWD 3RWDA 1YNKL 4JM2F 4LSTH 3GMRA 2J6EH 3TYFB 3T3MF 4OSUL 2YS4A 3DVNA 5ESVB 3V5DB 2YPKA 4TNVK 5HYEA 3MZTA 1X5YA 3FOMA 5CLWA 5KSAB 5F6IB 1WZMA 1R3KA 2P49B 35C8L 4OJFH 4O2EA 4OZIF 3U9PH 3GRWA 3QXUA 3W9EB 4TSAH 4CKVX 3LAFA 1UB6A 3OJ2C 4PLOB 2V5SA 3VWJC 5GGTH 3CMOH 5KSBA 5TH2B 4L29B 4G6KL 5J89A 2W0KA 2UWEF 3IDJA 1G6RL 2L4OA 2Y72A 4C4KT 5MEPA 3IU3A 3P4MA 1U8IB 4J3WA 1H8SA 1X4XA 3TPKA 3MRPB 3P0YH 4NUGL 2NY7L 1MCOL 1QUNA 2X1OA 2YA0A 4ZOBA 5HYSG 4FQJL 2R1YA 1WBYB 2IC2A 4KTDH 4AENA 2XRAL 3CLEL 4MX7A 3ARYA 4OGZA 3UYOD 4ZUSA 5DMGC 2WM0A 4M43L 3S88L 1HIML 3U2SB 1W72B 3SJVE 5KVEL 5F7MC 1SY6L 3T65B 2DLHA 1S7WB 2BSRB 4Y2DA 1O7VA 2HAZA 4HW6A 1D5XB 4GS7C 4NQVA 2QHRH 5E2VL 4N68A 3REWB 3LEXA 4HWEL 5DJCB 1AE6H 4JCLA 1FFRA 4MJ4A 4HFWB 2WINB 1KJVB 4WIQA 2QQNH 3VWKA 4UB0H 2V2WB 1QQDB 3MJ7B 1WCQA 3D0LB 4KJPC 4F57L 2Q6WA 1Z6JT 2R29L 1TETL 4PREB 4FRWA 3OAZH 2YRPA 4CMHC 4LDEB 4LLDA 4XWGL 1K9TA 2BX5A 4GLRH 1FZKA 2NY0D 4ALAL 1J1PL 2P5EB 3E1F1 4FXLA 4U1IB 1TPXC 2V2XB 4TQEL 1E4KC 4X8JB 1YY8B 1E4JA 1H3XA 1EMTH 1Q38A 4N5UA 2ARWA 5B8CC 2ATPB 3JUYA 3LQAL 2EIZB 3L9RA 1S3KH 1B4JH 1NGPL 1VGKB 3N1FC 1HCVA 3D69A 3O3BA 3BFOA 2W9LA 2XXCB 5I1EL 5HHNA 3TPUB 4KFZC 1KPUB 2Z8VC 1XR9B 2AXGA 2F5AL 4L3EE 2E27L 2IAMA 3MRNB 4PJDF 3EFFB 3ZTJG 1WQVT 3ARBA 3QCUH 3HCVB 3NCFB 5GGRA 3TT1L 1IARB 4ONFH 1NUDA 4QRUA 4WFED 1BBDL 4ZSOE 1UXWA 2YK1L 4JZJB 3B9KA 1AD9A 3ARSA 5DVMA 4JVUA 4BQ8A 4XVJH 4H0GA 1MNUH 4OZGF 3RPIB 2NY0B 3FRUB 4NRYB 3LS5H 2GK0B 4V2CB 1SM3H 4U3HA 1JE6A 1JPGA 2QSCL 3X3FL 4ERSH 3OAZK 4WFHE 1URLA 3BT2H 1MOEA 1T7WA 3D25B 3O41B 5DJ2A 3PE9A 5HSFA 1L7IL 3LKOA 1JHLH 1HNFA 4AMKH 3THML 5E7FA 5FECB 2KBGA 3QJFA 2XKNB 3T4AB 1CFQB 4HMEA 5GZND 3QWOA 4G7YL 1H3UA 2QR0B 5JW4M 1E4WL 2DD8H 4E41D 4G5ZH 2BC4B 2BJML 3UBXA 4LNVA 2ID5A 2PTTB 3AY4C 4JLRB 5C0FA 5DUMH 1MWAA 3B9VA 1ZT4B 3WJLA 4HWZB 3GSNB 5K93A 2FX7L 1ODAA 5KN5A 4XNXL 1MPAL 1WV7T 4N90E 3BZEA 3O3DA 2Q7YB 4Z0XA 3TT3H 1T1WB 4UILL 1Q9LA 4QXGH 4X98A 3WLBA 3KR3L 2IPTL 1XCTB 3P77B 4GW4B 3TEUA 5EBWA 1BFSA 2GTWB 4Y4HB 2YR3A 3C2AL 2B8OT 5J8OA 2VO5A 3WS3B 1BX2B 4GKNA 4E0RA 3EYFB 1IAOB 2IBZX 5B21A 5DVLA 5BRZE 1MAML 5ACZB 5DZNA 3NN8A 3AROA 4JFZL 4MNGB 3S37L 3HB3D 5I1HH 1LP9B 1ZHLA 3DVFA 2EE3A 1EA9C 3QCVL 4E41B 1DE4B 4UT9L 4WFFE 4YK4C 1HXYB 3EHBD 4GFTB 4XMLL 5CBEB 2ZUUA 4ZFOA 5L9DH 4IOIA 4YWGL 2W07A 1YC7A 3VCLA 1A6VH 4WI8A 5JO5A 2X10A 1JI1A 4LVHC 2CGRL 1UWXH 2B0SL 2ARJQ 3LDBC 3BGMA 3VFWA 1MRDH 3TBSB 1K5NB 2FL5A 3IJHA 4V1DE 2VJXA 5IJVB 4RWYH 1CDYA 1IC4L 5M95B 2Z35A 4KJQD 5AAMA 4AIZA 5E6IA 4WW1A 5JIHA 3OX8B 3RGVA 5TPWH 1IGJB 1J10A 4Z7VF 3PJSB 1SJHB 4EQ2A 1DBAL 4AEFA 2OR8A 1CLOL 3U1SH 2GJZB 1RZJL 1XAUA 4RZCB 4QO1A 2HKHL 3BIAX 3OJMB 3NGBB 1NDGA 4MMZC 5D5MB 1DLFL 3KPNB 3V95A 4KAQL 2NMSA 1BQSA 3MBED 3QJHA 3MA7A 4M62L 3P4LA 1IL1B 4HV8B 1MQKH 2DM4A 4OGYL 5IF0A 4I13B 3L7FA 3MV01 2F5BH 4HIHB 4G80A 4P23C 4HJ0D 3MYZA 1NCCL 4PJFA 3RUGF 5HHME 1V7MH 5DHYA 2ZJSL 5INCA 3LHPH 1CGUA 3NAAH 4X0KB 1MCDA 3MJGX 4XP5L 4HS3B 4M93B 3TJHC 3S35X 1HHHA 4NQDB 3ZKSD 1T89A 3UJIL 5BMFL 2D7MA 4LIQH 2LVCA 2JCCA 1AGEA 1JTTA 3RIFK 1WBXB 4FZ8H 2R2BA 1IGMH 4FXGA 3AREA 4U7SA 5DK0B 4ZQKB 5IVZB 1QG3A 4DGIH 4KVCL 1CL7I 2H26A 4GQ9L 3QNYB 4MYWB 3UBXG 5IESH 2C7UA 2FO4A 4JE4B 2EDQA 3MBEB 1NFDE 3CFEA 3BDXA 4Z7UA 3N06B 1QTYT 1N59A 4X6EB 1OTUC 4GSDL 2CLVB 1A02N 5LVEA 2Y9RT 3OR7B 1PBYA 4OCSL 5D1ZA 1J18A 4YHZL 3FQTB 4Y5XB 1MJ7L 3KLAB 4Y8AA 4LU5L 4R4FH 3D9AH 3H0TA 1YY9D 3LQZB 1U8LB 2BCKA 4IJ3B 4XZUB 1VEMA 4TTDC 4OIBA 1OF2A 4WUUD 1BZ9A 2ICWB 4XXCC 4XC1H 3AGVA 2XWTA 1Q9KB 1P7QD 3HNSH 1UCTA 1IAII 1ZA3B 3ARTA 3GB7B 1KSRA 2VL5B 5SWSA 3S6CA 2YPLD 3I6KB 2Y5TA 3ES6B 4A2MA 4FMKA 3AM8C 2R56L 1S9XA 3FQRB 3FN0H 3RWFB 1S9WB 2J4WL 5SX4I 1JWSB 4NJAH 3L3GA 4IRSC 2BFVH 2W60B 4X6DE 5IB2B 5CD3B 3NFNA 5DJ6A 2A6JA 1F6AA 2J3SA 4OM1L 4HCRA 3U0PB 1AR1D 3EFDH 3WL9A 2MKWA 3I3DA 4KRPD 3EYQC 5I1LA 5EOCH 1OCWL 1MLBB 1UB5B 1PGRB 3HAEB 5TF1L 1U3HC 4L4TD 4BFGA 3IXTA 1F97A 5CBAB 1IQDB 2YWZA 4M3KB 3LKQB 1UM5L 4EUPA 4PTTA 4QY8B 4KK5D 3MLUL 4Q6IA 4YC2C 4P2OC 2WQRA 4XTRC 2BNRA 2VR5A 5CINL 2CJUL 4I48B 1NBYA 9CGTA 4QRTB 4TRPH 4WUUB 4AY0A 1P7QB 1FPTH 1BBJA 3G6JE 4JDZA 4YXLH 3GBML 3CFIC 4PY7A 3U30B 3LB6D 5HGAB 4Q0XH 1HOCA 3G08B 3QA3B 5JZ7D 2P47B 4S1RH 5ITBH 4XAWL 2AJ3B 3SJVD 2CUMA 1RUMH 4I3GA 3I02B 4XNMA 1MEXL 5E8NA 5E9DE 3U9UA 2CLZA 5DJXA 3C87A 4FQQB 5GSVA 3S36L 1IT9L 4BJLA 5F9JB 5FAAA 5FGSA 5CJ5A 5HVHB 1LO0L 1A0QH 4PJ7E 3F7VB 4P2QE 4HZLB 3QQ4A 5HHOD 4K8RL 5EBMA 4NO0D 5BOPA 1HHJB 4PGCB 3L5XL 2PCPB 2WNGA 3P0VH 3UYRH 3VFNB 3WUWB 3QUKB 5KJRL 4O2CB 2DMKA 4MCYA 2Q20A 4RAHA 4IRZL 2ZWLT 3ZYZA 2AQ2A 5CHNB 1TMCB 5I66A 3TO4D 1LWRA 4S1QH 3STLB 1D6VL 4MAYC 4JFDE 1XGRB 2Z31C 2MMXA 3KJ6L 3SKJL 1YN6B 3TVMA 3U82B 1SHMA 5GS0L 1KJMB 3V0VA 3SJVB 2CKBL 5FKAB 4HHAA 1S9KC 3DUUB 5FCUL 3GSVB 4MA1C 1U8NB 3FO1B 1L9NA 4C58B 2V9TA 2OCFD 1QLFB 5F89B 2OSLA 3BEWB 3A6CL 3GK8H 1QO3A 2DMBA 1IAKA 2V7HA 3FO2A 5DD5H 4ZFFB 5GJTL 2GJJA 2YXFA 1M7IB 3NZ8B 1T20B 5HHOB 5SWZE 2MQCA 3B5HA 5J6GB 5H94B 2VL4A 3KLSA 4XCNB 5E4EC 4LCIH 4EOWL 2FD6L 4JZNA 4PJCE 3F7YA 1YMMA 4Y16D 4X4XA 4LVNC 5FOBA 4J6RH 5DC4B 3CXDL 5CJ8A 1NL0H 1XGTA 3HI5H 4TUOB 5KSAC 2EIEA 4JB9H 2DLGA 2BY2A 2DRUA 3BKJH 4HKJA 4P5TA 1Y6KR 1PVHA 3LV3B 5SV3A 2N56A 1S7SA 4L3EB 4YUEH 3C8KB 1G7HA 2MSPA 3HC3H 4EUPG 3QH3A 3ZTNL 5DS8A 1X5KA 1DN0A 3V7AE 3SDYL 5D1XC 4ZSOB 4NN7B 2DL9A 4ODWA 4MXQD 1CGVA 1IFHL 3BH9B 4N90D 5JORA 2DBLL 2X1XR 3GJEA 4Y16B 5F96H 3UJJL 1JZ7A 1HH6B 4XT1C 1GJIA 2V17H 4LAQL 3C08H 3MLXH 3MREA 3U46B 1FDLH 4NRZB 5EZIL 4K07A 4UDUA 2PYEA 5CP7A 3TBYA 1MRCH 1EUUA 1G9NC 4XPHL 5F7EL 1CLZH 5TE7H 3UROR 1JMZA 4NQSB 3S35H 4OGAC 4G8FB 4PGDA 4JANB 3MXVL 1KTDB 4HT1L 3MRFA 4MXVE 5BOZG 3HNVH 4U1NB 3SN6N 1PX4A 4N0YH 4R7DA 3T0WA 1QFOA 3G6DL 1M05B 4L5FH 5FDYA 3AMKA 2AQ1A 4OCXL 2C3VB 4XBPA 3C5SA 3QG7H 1E27B 3UDWC 4HZAA 4YXHH 4LSRL 4OBRA 4WFFD 4F58L 4FQ1L 1F4YL 4JQVA 3ALXA 1U9KA 1GZQB 5DTFA 4JO4L 3V6FA 1WSST 4LHUD 5KVFL 3PIQB 4PB0H 1F3DJ 1JJUA 2NTSP 4OF7A 3M1BA 3C6LA 1CFTA 1YDPB 3O9WD 4V1DD 4YFDB 1S7TB 5IB5A 3J8F7 2NNAA 1RK1B 2X4UA 1Y0LA 4P46D 3EO9H 1A6PA 4OLZH 4QXUH 5FUOH 2V5TA 4JFYA 4CU8A 2NYYC 4RAUA 4Z7OF 2FZ3B 4JPIA 3TZVD 2VXVH 3O4LE 2XI9A 2NZIA 1IGTB 4MA7L 1F2QA 2J6EA 4P2RE 1ORQA 3VFGL 3TN0C 5DR5L 2A73A 3BKCH 4NP4L 2CRZA 5T5NF 4ZMAT 3QUYA 3KPSE 5FHBH 1YPZA 4WJ5A 4HIXL 4QXTB 2W9DH 5MERB 4U1KB 4JZJC 2NPLX 1I1FA 4LGPB 4XPAH 5ERWA 4LFHG 1MFCL 3IDGB 3PHOB 4XNQB 1DR9A 4DW2L 4HGMA 4LHUB 5GGTA 5FKPA 4C56A 1AIFB 1NGWA 1Z2KA 2QHLA 5HTSA 5CAYB 1U6AH 3O9WB 2YPVH 4V1DB 4HS6A 5EIIA 4ORZC 2JKXA 1XFPA 4P46B 5DC0A 5ETUB 3BMWA 4MQXD 1KACB 2R8SH 2QQLL 1W0WB 4CL7A 4MSWB 4I4WA 1IGIH 2WV3A 1A4JA 4QRSB 1OAQL 2IPUG 4PJXA 3T3ME 4GXVL 3VXSA 3ZLQC 1MWAL 1TENA 4W4OC 3CDFA 3VMPA 1FG9C 3P9LA 1JK8B 1R5WB 2Q86A 4OZIE 1RJCA 4HLZH 3WIHA 5E2JA 3FB7B 1MFBH 2FCBA 1INEL 1KT2B 3DIFB 2A1WL 2ENSA 2GJ6A 1PYWB 3WNNA 1S7RA 4BZ1H 3SDDA 3QI9A 5EU6A 2DQUL 3LKRB 4YHNA 2BVOB 3U7YL 3ARZA 1QHPA 4Y4KD 2V2TB 4ZYKB 2F74A 3A6BL 1NANH 4NSKA 1H5BA 1T0MA 1UVQA 5FYJL 4I3RH 1CN4A 4UV7H 5HHMB 4Y4HC 2HLAA 3BN9C 3TIDA 3IRZA 1CE6A 3CSYB 5C7XH 4HUXA 2YZ8A 1T1XB 1W72H 3QB7C 4ZFOL 1YJDC 2C4FT 1RUKH 1FNHA 1BIIA 1G9NH 3FO0L 4ELME 1AQDB 3TWCH 4D3CL 4WENB 4WU7A 3T8XB 2EE6A 1OGTB 5CJQH 5DHVB 3ET9F 3DX7A 2WMPA 4MQ7A 3DSNA 4OM0H 3GI9L 1A2YB 1IC5L 1J8KA 2EECA 1V3MA 5TGBB 1NFDB 4NKDA 1VGEL 5GRUL 4D0DA 4P5MA 3BPNB 2RFXA 4LKCB 1NC4D 3UPCA 4GAJH 2D0HA 3FKUS 4XVTH 1CDJA 3JXAA 4Y5YA 1WAAE 4Y4KB 4CVZA 1IAIL 5TE4L 1OT2A 1TTUA 2P8LA 5E2TH 2VE6B 1MHCB 4XGZB 4RISH 2JB5H 4AEHH 4CW1B 2CKNA 2YN5A 3DXAE 1WEJL 5C2UB 1LEGB 1CU4H 3FQWA 4JJHA 4OCMC 2NXYD 4L8BB 5HHXL 5I1IL 2L7JA 3IFPA 1T66D 3JV6A 4UBDD 1I8LA 2AJSL 3HB3C 3ZSSA 3IAQA 1MI5E 4LEOB 2DF3A 5D7IA 4P4KA 3EHBC 1NCBH 1FHGA 3CU7A 2YMXL 1J0KA 1CIUA 2VUYA 3NCBB 3CSGA 3ARGD 1B90A 1S7UA 1MHPH 1LO4H 1TVHA 2ADGB 3VGFA 3RY4A 2VSDA 4X6DB 2OJZL 5HGBA 4J7RA 5EN2A 4PJIA 4K94C 4NQCE 1NC4B 5E9DD 2DJ4A 4HK3J 4Z9KB 3ZE1F 1X6NA 1CR9L 4GRWF 4KJQC 1BVKB 3BIBX 4K2UL 3VWJA 5F7DB 4LGRB 4OZGE 4P2QD 1LGVA 4M93C 1GGIL 4GLRI 4U6HB 2ESVD 1A6ZB 1CT8B 1I85C 4GG8B 1BEYL 3RKDD 1ZEAH 3JWOH 3HE7A 3U4AA 3CD4A 5FYKH 3QDAA 3H7BA 2FHBA 5ICXB 3O2WL 3CFKB 2HVJB 3A67H 1BP3B 4RMVA 4TOYL 4GBXB 1WCBB 1G6RB 3IJYB 1FFNA 3G6JB 4OFKA 1L9MA 4NO5B 3MBEC 1A3RH 3GKWH 2QL1A 3ARRA 4LKXB 4JO2H 4JHAH 2P8MB 1Q9OB 5C71A 3N0PB 3IVKB 3ARGB 3ZYOA 3P11L 1DSFH 4HH9A 2EYSA 1DTUA 1MUJA 1HH9B 1OTSC 2YKLH 1I8KA 5F88A 3RWCA 4EVNA 1ZVSA 5E9DB 3GSNH 4LSVH 2JK5A 3C8DA 5I8CA 2MPAH 1MREH 2R4SH 5BXFB 2FDBP 4PJ7B 4P2QB 3KYNB 5KTEL 4IJ3C 1N3NB 4Y1AD 2RCSL 5FHAH 3S8WA 3OR6B 1T2QL 2FB4L 3SKMB 1RZ7L 1V05A 5E4IA 3PP4H 3ARDD 1RUPL 5EDXA 2VLRD 5K9JL 3O6FD 4L1DA 3OG4B 4HCRL 1E4KA 1RI8A 3RU8H 1YJDH 4FNLL 4YBQD 5B38A 4ODSH 1HXMA 3WKML 1FLTX 4PY8I 1J12A 4L8CA 4D0BB 3EO1B 4F9PC 3SKNA 5E8PB 4CMMB 2ITDB 3T4YA 3MRBA 4JFDB 1BOGB 5IW6A 2APFA 2ZOLB 1JTPA 1KIPA 4JFFA 3CXHK 3TH4T 3MRMB 3TA3D 1U8JB 3MUHL 4H25A 4U6XB 2VQUA 2VDKH 4PG9A 3VMOA 5IBTH 1BPVA 2Q8AH 3BD4A 3VRIB 3VJ6A 3EZ8A 3BISA 1CDIA 1KNOB 4OFPA 3HRPA 5IGXL 3ARDB 5L0QB 4RMQA 3GHBL 1GOFA 4G7VH 4PJEF 5CUSH 3QQ3B 3RTQA 3O6FB 1FZOB 5IVXF 4ZFZB 3MNZB 3WHE0 5F6HJ 4IEFB 3PL6B 4OLXH 4PJCB 3H8NA 3NZHL 4DKFL 2I9TB 1T2XA 4YHOL 3T0BA 3FTGB 1QSEA 2B1HL 4OB5L 1RFDL 3SGJC 3MLWH 3EIFA 1MAJA 5E7BA 3GMPB 3OJDB 3NH7H 3SBWA 1UZ8A 4Z78A 3ARPA 5HVHC 4XXDB 3I75A 5KBNC 4U4BA 1ZLVH 4K94H 4BFBD 2FGWH 1QPXA 4I2XE 1CFBA 4M1GL 5IB4A 1E6JH 2OL3A 2FYYB 1OD7A 4EI5B 1FVEB 4PJAA 4GKZA 3STBA 2A6KA 4Y19A 3HNTL 4HKBB 3RL1B 2Z0BA 4XPBH 4UIMB 5B3JF 3U48A 1UQSA 1YECH 4R8WH 2JTDA 1T22A 4X7TB 5HVGB 1LE9A 4PP1C 1K8DB 1A1MA 4ELKA 4Z7NE 2X7LB 5JZ7C 4N9OB 1IZJA 1JTOA 2YXMA 2AJXL 3PQYA 3BAEL 1F6FB 3MLZL 5D6DC 5J12C 1YNLL 4PJ9D 4W81A 4FQLL 3X12A 4F7PB 1E6OL 5DRXA 4N1CA 5JMOC 2XPGB 1MCWM 3P2TA 3RVUD 2XA8H 5JNYA 3O4LD 4ZO6A 1U93A 2C1PB 4P2RD 3VFOA 3ZYJA 2HJKB 1N8ZB 5DMIH 4NM8L 5TDPA 4FZEH 4HH8A 2JJSC 3KS0H 4P9HH 1Q1JL 1A9BB 3KPSD 3DV4B 3VXTA 5ID1A 1JCKA 2Z8SA 1A6UL 3FFCE 1QBAA 3FL7A 4OT1H 4NGHH 4HXAL 1KGCD 2DQTH 1ZLVK 1YZZA 1UWEL 4OQTH 3TP4A 3SQOH 1OB1A 2CDEA 4MJ2A 1WIUA 4M00A 2AJZA 2G75B 1B0RB 3T3PE 4TUKH 1MCIA 5B38G 1ZANH 4XHQA 3R8BB 4CBPA 3WD5L 1M6OB 1EO7A 5CZVL 3BSZL 5IMMA 3ZHKA 3O45A 2XTLA 4H1LG 3LRHA 1JZ3A 4PJ9B 3H9SA 5DDHA 2MHAA 3MZGB 1IBGH 4LBEB 2CLRB 3G9AB 5IVNA 3P4OB 3O4LB 5LXGL 4PTUB 4HJGB 4BFIA 2VZSA 1WC7B 4P2RB 1S78C 1SVCP 1NGQL 2D7TH 4WU5B 1XT5A 5IT2L 5I8KL 1ES0A 1MF2H 1J87A 5EA0H 1KEGH 1G7JB 3UCRA 3KPRA 4KMTH 2JJTC 3KPSB 3VXMA 1OM3H 2ADFL 2OR7A 4UT6H 1VEOA 2BSSB 2WBJD 4JY4A 4P23A 4DOHE 1JPTL 3QRGL 4NN7C 4OI7A 1RIHH 1CFSA 4WY7H 2IALA 1G9ML 1YN7A 4HAGA 2FX9H 3HRZB 1AKJD 4IMKC 3LRSA 5AZ2L 1LD9B 3VRLF 5C9JB 5E00B 3H3PH 1XGYL 4Y16C 3BZDA 4X9FA 3KYAA 2H3NA 5DRNB 1LEKA 4XP4L 1NAMA 3ECBA 5K33A 1R3JA 2DTMH 2LV4A 5FYJE 4JFOA 3OXRA 5ADPL 4OV5A 3QEHB 5D93C 3IDMA 1DN2A 2GT9B 2X4SB 3B6SA 4OF0A 1RULL 2CRYA 4XP9L 5KSVB 3W2DH 5F72S 4O2FB 1UCBL 2GCYA 4GMSL 2XN9A 1MCFA 4GRMA 3JWDC 4LSUH 5E94B 5ID0A 4LF3B 4AZ8A 4B41A 4OZIB 1KCUL 4JRWA 3IGAA 2WBJB 1KPVA 3GSOA 1XF3A 2VISB 4GO6B 1KXQE 4MXQC 1F90L 1AKJB 4ESKA 3ZDYF 2DLFH 4LSTL 4XAKE 2JIXD 3VD7A 3OJVC 5GJSH 2J6EL 3L95B 3KDMB 3RGHA 1ZA6A 3RVVC 3I84A 1PDKA 5IIEA 2IJ0C 4UZGA 3GSQB 4EI6A 4PJ8C 5ISZA 5T1KD 4OJFL 4QLRA 1G7PA 1KJ2B 3DXAD 4PJHA 3MACH 1FBIH 3DX9A 3A0OA 1KYOJ 5DRZB 4K55A 3B9AA 5F7WC 1DVFC 2IQ9L 1S5IH 2DKMA 2O5YL 4ELMB 3BW9B 5GGTL 3AM8A 4FG6D 1MLCA 2R1WA 4WTWA 4K9EL 5IHBA 4POYA 4NZUH 3MMEA 1MI5D 3T0VA 2W92A 5T1LA 4YNYB 5TQ0H 1RUQL 4PJFE 2EYTA 5EO0A 4L3CB 3VFRB 1NMAL 5FA3B 4X7SH 1SJEB 1QYGL 1KLUB 3QWRA 2UY7A 1BFTA 4KTDL 4L4VA 3VI4E 3MRDA 4DUXA 3E6FA 4QYOB 2JIXB 1S7XB 2M2DA 4NQCD 4F2MB 3AU1B 3DUSA 1CD1B 2YWYA 1MCWW 1R3HA 4OIIH 2JCCE 1FNGA 3R1GH 4UOW0 3LZFH 2FX8L 2WSKA 3WIHL 5T1KB 1VFAA 2LTQB 4P2CG 4P99A 4AEIL 3DXAB 3LQMA 4LVOB 2ZCKH 2J12B 4K8RD 3D85A 5HYSB 3MRQB 3D0VB 2COQA 1QBLH 4DKAA 4QGTA 4Z7UE 3QDHA 3MV8A 2W0FA 1W8OA 1SQ2N 5AD0B 5DFWH 4OD2A 1MI5B 4L9LB 2BRRH 3BXNA 5ABDE 5HY9A 5FA4B 4PJGA 3OMZA 2VLLB 5KOVC 2I25N 2J88L 2R69L 3MFFA 4C4KO 1INDL 2BNUA 2AEQH 3OKMB 2VC2H 3U4BH 4GRLA 5E08H 1P7KB 1N4XL 5GS0D 4HMCA 3EJYC 2VH5L 3PHSA 1HHKA 1MJUH 3E3QE 3QHZH 4NQCB 4ZTOH 4HUVB 2GEEA 5T5FL 1S3KL 1U8HB 1B4JL 5T3ZL 2QLVB 1HYSD 2KKQA 2EYRA 2UYLA 2VDQH 3O0RH 4OF6A 5SWSE 1EHNA 4M4RA 5HGGS 3RWHB 3RHWF 1UJTA 4OD3H 4OCRH 1I9RH 2OI9B 3O3AA 2IH3B 1GAFH 4LRIC 2KL6A 3BRGC 3QCUL 2PYFB 4MB3A 2SEBA 1NKRA 5EFIA 3QDMA 4OCWH 4YZFE 5DMYA 2DIBA 5JQ6H 2E7LA 4ONFL 1H3VA 4MAYA 4KJWD 3EDDA 4MCZB 4NQTA 2EKJA 1TLKA 3JWDH 1FN4B 2F19H 1T7YA 3P30H 1E28A 3GSXB 1SM3L 3BZ4B 5C3LD 5EC2B 1A7QH 4ERSL 5GRJH 2AK4A 1WFOA 1BF8A 5F9AC 2BNRE 2CKBB 5DEGB 1P2CB 2KZWA 1I9IL 3HFML 3BJLA 4WI7A 2D4DA 1REIA 1U36A 3C60C 3LH2H 3TFKD 3ZDXF 1MJJB 1H8NA 3CC5B 4X5XB 2WWMD 3TBTA 1HDMA 3HA0A 3V2AR 3QNZB 1R3IL 5DK2B 2ARJA 3SDXB 3CZJA 1Z9MA 2DD8L 2FWOB 4PRDA 4Z7OE 3RWDB 4MJ5A 3T2PA 3CIQA 1MFAH 1C1EH 3OSKA 1T5WA 4JHZA 2HKFL 4TVPD 3GMRB 4Q9CA 3X11A 1TXKA 3RBGA 3BH8A 4Y2DD 3DVNB 3TNNA 3VGEA 2YPKB 4RFOL 5D8JH 3MJ8A 3O4OB 3FOMB 2UUDH 3LMJH 1R3KB 1VFMA 2FHFA 4O2EB 4QTHB 4U6VH 5DSCA 3OKDA 2V7NA 4FA8A 5EG6C 5DMKA 3VWKD 1UB6B 2NX5A 5D2LF 1ACZA 4RWHA 5KSBB 5IBLD 3IDJB 3PGCA 3EW3B 3IU3B 3P4MB 25C8L 3DECA 2L7UA 5D1XA 1G1YA 2XQYG 3QIUA 5I1HL 2R1YB 4GBXC 2JE8A 4MX7B 2F58H 3KYOA 4ZUSB 3GBNL 2ENYA 4C83A 1LQSR 1J0JA 5L9DL 4Y2DB 3WFCL 4WI3A 4JVPA 1A6VL 4GKSA 4NQVB 5EZOL 3LEXB 1CD9B 5C86A 3ARGC 5DJCA 1BQLL 1HEZA 3VFVA 4HFWA 3EJJX 4GUPA 4G3YH 5GRWA 2IAMD 3FFDA 3LN5A 3VWKB 1NMBH 3ARBD 5A2IH 2GKIA 4Q97A 2UUDK 1TJGL 5TPWL 1NQBA 1WWBX 2NY6C 2XZZA 3B9KD 3RQ3A 4OV6F 4LLDB 1TZIA 1OTTD 3HUJF 1YMME 4RMWA 2IGFL 3PDOB 2P5EA 1H3TA 4U1IA 3C2SA 3H3KA 3MGOA 4KGLA 1EFXB 1B0WA 2GTZA 2VXTL 5ICZA 5EB9A 5K9KA 5K9OA 3L9RB 2HFTA 2VITA 5AG8A 3NFSL 5DHVH 3D69B 1BAFH 3O3BB 2WP3T 3JV4A 1FLRH 5DVNA 2I07A 1XH3A 5EOQL 1KPUA 1RVFH 1IGCH 2AXGB 5DWUL 2VR4A 3S37X 3TN0A 1JRHI 5FXCH 1MIML 2IAMB 4A6YL 3QDJA 3LHPL 3OAUH 5MHSE 3ARBB 5C0AA 2W65B 5GGRB 3LN4A 3PP3H 4IDLA 5DFVC 4QRUB 4BM7A 1UXWB 2C4XA 1N5AA 3B9KB 5C0GA 1AD9B 5CD5C 3HMWL 3RVXC 1D7FA 1MCQA 5L0QC 1NANI 1IGML 1DQML 3FFCB 3WEXA 4NM4H 3G6AA 4J3TA 4U33A 1JPGB 1RIVH 3L1OL 5HI4D 4CDGC 5IESL 1NGYA 2DJUA 2VLME 4X80H 1KCRH 3PL6C 4QCIA 4XX1E 1RZ8A 1OW0C 4JQXA 5DJ2B 1K4DA 1OQXA 5ALCH 4TYUA 3LKOB 2MCG1 3WHE1 1X5LA 3UTQA 3QJFB 3GIZH 5FYJD 1MQ8A 2UVEA 2OL3L 3QWOB 4L4JA 1OAUL 1X5IA 5AZEL 2E6QA 2F8OA 4R4FL 3WO4B 3UBXB 1JBJA 2VN4A 1OGAA 3ZE1E 5L6YH 4OSUH 5C0FB 2Y7QA 1MWAB 4XC1L 1A6WH 1RZGA 5KN5B 3VXQA 4EI5C 4OKVA 4F8TA 35C8H 2G5BA 3O3DB 2Q7YA 4JFXA 4Z0XB 1NCUA 4OZHA 3PP3K 4DOHB 4X98B 1PLGH 5E6ID 5C70A 3PDGA 5I6XB 2WWKT 3VFSA 3FN0L 3P73B 3MJ9H 2NCMA 4KKAC 1CD8A 1SBSL 3RGVD 1V7NL 4XAKD 5EBWB 4G6KH 4NJAL 4F3FA 4Y4HA 1G6RH 1WIOA 1A8JH 4KH2A 4M6ML 4E0RB 1P6AB 3C8HA 3HZKA 4NUGH 2NY7H 4F7TA 4MA3A 4PLKC 5JPNA 3EGSA 4XCYB 3EYVA 4FQJH 1ZHLB 3UAJD 1LP9A 2EE2A 3M45A 3I6GA 2XRAH 3CLEH 3OKLA 1DBBL 4M43H 3S88H 1YQVH 1QKZH 3IDIA 4H88H 3I50L 4ZFOB 4IOIB 2V9RA 2Y23A 3VCLB 3MBXH 5JO5B 4C56E 4NHCL 5E2VH 1FPTL 3VFWB 4HWEH 2MQ3A 5DD0H 1K5NA 3TJEL 1SVZA 2FL5B 3IJHB 3MODL 3ZDZE 4UT7H 5J3HD 1XF5A 2Z35B 1IM3A 2AV7A 4JO3L 5GGVY 4AIZB 5E6IB 4Q0XL 2VZ1A 4WW1B 1A1NA 4S1RL 3RGVB 5ITBL 4S2SA 3LPFA 2ZG3A 4PJXE 3ZZ1A 4F57H 2A38A 1TETH 2EXYD 3VXSE 5I1KH 2DQEL 3OWEA 5IHLB 2GJZA 5GRXG 5F93C 4XWGH 1GL4B 3ESVF 2DN7A 1J1PH 3ARED 1NDGB 3LPWA 3RVUC 1YEHL 4UTAL 4XMPL 1IILE 2GJ6E 3QJHB 3MA7B 5EU6E 4CADA 3DUHA 1W0YT 5IF0B 4YDIL 1NGPH 5E8OA 1NAML 4X9BA 2AV1A 3Q0HA 4X7DC 5I1EH 5D1ZD 4PJFB 1TZGH 2F5AH 2E27H 5DHYB 5INCB 4S1QL 3U6RA 3WFDL 4OLEA 1NCTA 4NQDA 4RMTA 1BBDH 2NZ9C 3F12A 1I85A 4HUUA 2BDNH 3ULUH 4AL8H 5KANI 4ZS7H 2DS4A 1Y6MR 4JM2C 2JCCB 1AGEB 5SWSD 5T3ZE 1U8MA 3JTSA 3E8UH 2R2BB 2O61A 5A1AA 3AREB 5DK0A 5DD5L 2H26B 1I7UA 1ROWA 3X3FH 5TE6L 2WQ8A 5AWNL 2X40A 5IR1B 4KKBD 1G7MA 1QSZA 1RSFA 4Z7UB 5JUEH 4XPFL 3AMLA 4R26L 1ZOXA 2WBJC 4YAQA 3S36X 1TCMA 1AO7E 5D1ZB 4ZUTA 1E4WH 3FQTA 4HAFA 4PLNC 1BD2A 1TQCB 3X13A 2BJMH 3V6ZA 3H0TB 1T0PB 4HWBH 1YQ2A 2BCKB 4YHKL 1DQJA 1Q9WA 3DV6A 4OQTA 1QFUL 4XZUA 2BNRD 1UENA 5MENA 1OF2B 1BZ9B 4FQXA 5I1GL 2DLIA 4FQIL 5LGJA 2XWTB 3LIZH 1FG2A 2FX7H 4ZOEA 4XNXH 5E8EB 4W4NA 5SWSB 1JWUA 3GHEH 3CFBA 2Y5TB 4KDWA 5D7IE 4UILH 3Q5OA 3G5YA 3FN9A 4LP5A 1JF6A 1S9XB 4Z7QF 4EIGB 4HJJL 4YO0A 1S9WA 5A2LH 4OFYA 2EIDA 3L3GB 3ABZA 2VMFA 4R3SA 5IB2A 3C2AH 3NFNB 5DJ6B 3UPAA 4PJIE 3WV0A 3WL9B 4KI5E 3O11A 1FGVL 4QHLA 1MAMH 2DB8A 5I1LB 3GFUA 1T1YA 3S37H 2V17L 3IXTB 1JHKL 3RWIA 1FDLL 3QCVH 3CDGB 5F3BA 4UT9H 1MRCL 4EUPB 4PTTB 3MUJA 1CLZL 4Q6IB 4XMLH 3Q5YA 4JGJA 2BNRB 5I75B 1U2HA 3RIAF 2KQNA 4YWGH 1NBYB 5IW3A 1WZ1H 5AYUH 4PRNA 3HNVL 3FCTA 2LTQC 1XF2A 4HDIB 1BBJB 4JDZB 3BEVA 4FXKA 4QKXB 1ND0A 4PY7B 1IC4H 3QG7L 4UOW1 1WITA 1JHTA 5FM8A 4MD4A 4Q74A 5KS9A 1FO0A 4BQBA 3OTTA 1CGSH 4L9LC 3TLRA 1CLOH 1RJZA 3NIFE 4XNMB 4X7FC 4WHTA 1QFPA 3U9UB 2QBWA 4JM4L 2CLZB 2IBGA 5DJXB 5GSVB 5F9JA 3VFMB 2HKHH 2BNQA 3KJ4B 3QWQB 1NGZA 5DYOB 1KF9B 4XWOD 1DLFH 2HRPL 4KAQH 3QQ4B 2IFGA 2IBBA 2NXZC 5FUOL 1WFNA 1A21A 4YDJA 4OI9A 4MVBD 4OGYH 2ICWI 3QUKA 3AVEA 1W0VA 4MCYB 5J7CC 1YMMD 3BKCL 2OI9C 1NEUA 1MY7A 5I66B 2ZJSH 2HT3C 4NFBA 3T0DA 1XGUA 4M4PA 2W9DL 3NBNA 4XP5H 1CZ8H 3TVMB 3RI5K 3HMXL 4XPAL 3V0VB 1NBZA 1JN6A 5IW1A 4JFFE 5D6DA 3ZT6A 4M7JH 5F7FA 3UJIH 3EJZD 5TQ2L 1X5ZA 5DGQA 3FT2A 1QLFA 4RCAA 3ULVL 2OSLB 4P5TD 4S0TD 1QO3B 1VENA 1IAKB 1EJOL 5GS0C 5CGMA 3BUYA 4KVCH 4WHCA 1HSAA 2JJSA 1I7ZA 3NCYS 4NC0B 1KELH 5MHSD 2BHZA 3ZDYE 2APVA 4TNVF 1IGIL 4J3OC 1HYSC 2D0GA 5JXAL 4GSDH 2R4RL 4YHPA 2CIIA 3QIWB 4EJ1C 1DJSA 4JZNB 3V4VL 1F3DH 1YMMB 2QV2A 3LS4H 4X4XB 3NVQA 2KDGA 2VAJA 4S1DD 2AGJL 5FOBB 4YHZH 4LLUA 3KPLA 4LU5H 2PYED 4Z18A 1XGTB 4JY6B 5MI0B 3MSPA 1OAYH 3O4OC 2IF7A 3WO3B 2HFFA 1EHXA 2OJEA 4JKKA 5L2KE 1FYTA 1F45A 3VE0A 1KB5H 4HKJB 1FIEA 5LQBL 3QBTB 3K3QA 5E03A 5AYQA 1QA9A 3QPQD 3W5MA 6CGTA 1S7SB 4L3EA 1G7HB 2R56H 3OKEA 4N8VA 4UV7L 1ZLUH 4UMGA 2J4WH 5C7XL 1MIEH 1DN0B 4M6NH 4NNPL 3QEUA 4LSSH 4UOJA 5C07A 3SGKA 5EUOA 4Y19E 1IKFL 3QXVA 5GS1C 4ODWB 2OS7A 5CMAA 4IMKA 1P9MC 5JOEA 1Q0XL 3C6LD 3GJEB 5JORB 1OCWH 2P48B 5CJQL 1HH6A 5H37G 1NMCB 3PQYE 4LOUD 3MREB 3DNKA 5IEKB 4UDUB 3ARUA 1UM5H 2PYEB 5CP7B 3TBYB 4ZOCA 4OM0L 3BUTA 3MLUH 4U0QB 3V0WL 5I1CL 4PGDB 5CINH 4JANA 5KAQF 1BF2A 3MRFB 5DJAA 2YD5A 2F53A 4MZ2A 5LG1A 3WFHB 4R7DB 5MEQA 1QFWM 5ENWA 5I18H 3FMGL 3GBMH 4APQA 4MB5A 4AIOA 1EEQA 1CLYL 4XBPB 3C5SB 3QUYD 4BQCA 5E2TL 3TV3L 1XF1A 1XR8B 5HVFB 1A9EA 2MOVA 5DTFB 3WSQH 3V6FB 3CX2A 3K81A 3PABA 4FS0A 1CU4L 4RQQA 1MEXH 4JG0L 4KKNA 5CIPB 4C56D 2HTLC 4PB9L 4PGBA 3S36H 1IT9H 3PDDA 1ZLUK 3T0EE 3M1BB 3C6LB 1S7TA 2NNAB 3P9MA 2X4UB 1Y0LB 1UGNA 4ZXBC 3VA6A 1CE1H 4FABH 4PJ8A 3S5LA 4JPIB 1LO4L 1NEZA 2J8UA 2B4CL 3VXSD 5KJRH 3IKKA 2P5WA 4LMQE 1U92A 1ORQB 4IRZH 2ZUSA 2A73B 1DVFA 2IAMC 2BVUA 5BRZA 4AM0A 5DHXB 3KPRE 3ARBC 3QUYB 4NUJA 1EEUA 4U7KA 3VXME 4WJ5B 4QXTA 2G2RA 1D6VH 5MERA 3CH8A 4U1KA 2GJ6D 1I1FB 2CDGA 1ZEAL 3JWOL 3B9KC 5GS0H 5ERWB 3SDDD 5EU6D 2FEEI 3NIDE 1L7TL 4RDQG 4OZ4A 4W6WB 5FCUH 3I9GH 3A67L 5FKPB 4C56B 1NGWB 4Z5RB 3G5VA 5IMKA 1MVUB 1AGDA 3A6CH 1WWWX 4M7ZC 4PRAA 3UO1L 3NFPA 3V5HB 5JHLL 4HS6B 2AXFA 5EIIB 5GJTH 2AJYH 5GRZA 3GKWL 2ZUVA 4JO2L 2KUTA 3WJJA 4NZRH 1T0NA 3QHTC 4I4WB 1FL5A 4WI2A 4PIRF 3W0WE 4PJXB 4KZDH 3VXSB 4IM8A 2YKLL 2DM2A 2XN9E 1JVKA 2R2CA 5L7XH 4EOWH 4LSVL 2FD6H 3UTSA 3LSOA 3P9LB 4J4PA 3T77A 1JK8A 3WO4C 4PPTA 2GSIA 5CSGA 5DEFA 4N8VG 2Q86B 5DJZA 1J0ZA 4KZEH 4Z7WF 1KLGA 3RZWA 2XXMB 4OLVL 3VW3L 3DIFA 4K23L 4WW2A 1HWHB 2GJ6B 3WJLC 3L7EB 1S7RB 3SDDB 3QI9B 5EU6B 2OLDA 2Y06L 3U36A 3CFDA 5CKAA 5HBBA 4YHNB 2PO6A 4L8DA 3NCMA 4J3VA 3CDCA 2V2TA 5I6XC 1KB9J 2F74B 5A16B 3U83A 4ZYKA 4ODSL 4NSKB 1H5BB 1T0MB 1UVQB 4G9FD 5ISZE 2HLAB 3F8UB 4RRPA 1CE6B 2Q76A 2X41A 1UH4A 1ZHKB 2CH8A 3LKSA 4M3JA 4LCCA 3R8QA 1KFAL 3MNVA 3SDYH 1BIIB 1B88A 2EKSA 4YHLH 4W70A 4WU7B 1IFHH 2A9NL 3VXRA 4NT6A 4LRIA 2DBLH 1KTLA 3OXSA 1I1CA 2NY4D 1OGTA 2HH0L 4P4KD 1T7VA 4LAQH 4G43A 1AD0B 4RX4A 5EZIH 3DX7B 4OLWH 4MQ7B 2BVTA 3PWPE 3R06A 3DO3A 5F7EH 4MDJB 5E1AA 4NRXA 3MXVH 5IKCA 1OAXL 2EDWA 4HT1H 4P5MB 1TTFA 3X17A 1I8MA 4LKCA 4KI5D 4Y5YB 3HUJE 3VWJD 1JF1A 2VOTA 4CVZB 2ERJB 5E6IC 4OLXL 1AO7B 2P8LB 3QPXL 3RGVC 3AS2A 4XGZA 4JZOA 3BPLB 4LHQB 4CW1A 4LSRH 4F58H 3HE7D 5EOTA 1F4YH 3C60A 3S5LG 3ZE0F 1NEZG 3QCTH 1Q72H 2H41A 4JO4H 2YD1A 2LU3A 3FQWB 5DA4A 2G5RA 5KVFH 4X6FB 3MV8E 2Q7NA 1S5HA 3JV6B 3IFPB 3KPPA 2BHYA 4NQUA 3RX5A 3UAJC 5C6TH 4LCWE 4R90L 4DCQB 3SHSA 2NY4B 5D7IB 4P4KB 1RK0A 3FB8A 1FL3B 2A0LC 4PJGE 1EFQA 4X6CA 2AKRB 3FT4A 4U3XA 1E6JL 4IIQC 1P69B 2A6IB 5I71B 4PJBF 3OKOA 1S7UB 4HEME 3PWUB 1TVHB 1KN4L 2DQDL 4RBPH 5HGBB 5EN2B 4PJIB 2WBKA 3RIFF 2X1QA 4MA7H 1S8DA 4HF5L 3QFJE 4TNWF 3VFGH 4P9ML 1EEZA 1JZ8A 2VKWA 1MCRA 5D70H 4HBCH 1VADA 1V3LA 1MVFA 1CG9B 1WF5A 1LVEA 3EUUA 1OSPH 2H6PA 4BUGA 1N6QL 3TBWA 3R4DA 3FT3A 1A6ZA 2EXYC 4OD1H 1VA9A 4YDKL 5JW3L 3HE7B 4HUNB 1OAKL 1MFCH 5HD8C 3H7BB 3QNXA 2FJFB 4M7LT 3MJ9A 1K3ZA 2HVJA 3SE3A 3QDME 1XIWC 2J5LB 1DBML 4GBXA 5H35A 1G6RA 3K80A 5DMIL 1Z0MA 2P4AB 3VFPA 1OPGH 4P9HL 3ZE2E 3SY0B 4HXBL 3U7WL 1C5BH 3N9GL 3UTPE 1JUFB 4PP2A 4OT1L 2QQLH 3PG2A 4NGHL 5JHDE 1OAQH 3SQOL 4JFFD 4GXVH 5IJKA 2GAZA 2EEAA 2ZUXA 2XY1A 1LE5A 4HH9B 2EYSB 1MWAH 3RWCB 1BJ1H 5F88B 1I8KB 5CZXD 4EVNB 1ZVSB 4KUCF 4KTYA 2JK5B 5I8CB 2Q3ZA 2JLLA 3IYLW 1ZANL 1TQCC 3BP7B 1MJ8H 3ULVE 2R1XA 1FAIH 4RBPK 4G8GE 4K3JL 4QF1A 3RTQD 3S3JA 1TPXB 3JBG7 4HG4J 5AUMA 4XVSL 5B38B 1D5ZB 3A6BH 5I30H 1Z3GL 1HXMB 4K3GA 5GQBA 3RAJL 2MFNA 5EA0L 1KEGL 1QSED 4BELD 1P84J 3EO1A 5E8PA 3T4YB 3MRBB 5DUPH 2YUXA 2DLTA 4JFDA 3RNKA 4H1LB 1RIHL 5IW6B 1VHPA 3T1FA 2FX9L 3DWTA 2NX5E 1HKLL 1KIPB 2G9HA 4JFFB 3FO0H 2FJHA 1FNSL 3BGAA 3IAPA 4YBLB 1U8JA 1ED3A 1UKTA 4Z76A 4H25B 1WICA 3EOYG 1X4YA 2VXUL 4PG9B 4M1DH 4PJ5D 2GY7B 3ZKXC 2QADC 3VJ6B 3HR5A 5CLTA 1FO0L 3FJTA 1J05A 5SWZA 2VDRL 4A6YB 1VGEH 5GRUH 3KVQA 4Y19D 4NZJA 2PR4L 3W2DL 2OXHA 4AQ1B 3RTQB 1AXTL 4GXUM 2Y1VA 4QHUB 3WCYA 4EQ3A 1CDGA 4X9HA 3LRGA 5I1JH 4RIRA 3BE1H 3PL6A 2EDEA 4KPHL 1OP9A 4QWWC 4U1LA 3PQYD 1J88A 1CFNA 1QSEB 3SE4A 1WEJH 4YFLI 4DK6A 1UZ8B 4JFQA 5HI5C 5J57B 5LGKA 2AJVH 1WJ3A 3KJ4C 4Z78B 5I1IH 5L2KB 3I75B 1EJ6A 5I76A 5DURD 2FECL 2AJSH 5EPMA 3JTTA 5DF0A 1RIUH 1T80A 5IB4B 2YMXH 2OL3B 1F00I 3OKNA 1OY3B 2YSSA 3WLWC 4TULL 4EI5A 3ZKMC 5DQ9B 1FNLA 4GKZB 3HPJA 2A6KB 4Y19B 4HWBA 5DLMH 4UIMA 1UQSB 1LE9B 1XGPA 1T22B 1JNHA 3F6IA 1QVOA 3WNKA 1G6VK 1JGEA 4NZUL 2C9AA 1A1MB 1CGTA 1PFCA 3CUPA 4K3HA 4BSJA 4ELKB 3TVMC 1WZLA 3MO1A 1V3JA 3PQYB 2MKLC 5TQ0L 2BOBA 2FJGA 1QPPA 3H9SD 4KXZH 3X12B 5BVJA 3MLSL 1NGXA 3HE6B 5C0AE 1KTRL 5DD1H 5JNYB 1II4E 4NN5C 1U93B 2VABA 3GSRA 3VFOB 1WBZB 5DURB 4YK4B 5TDPB 3DX8A 2Z91B 3VFTB 1KC5H 1VB9A 4OIIL 3R1GL 4Y89A 3VXMD 3CK0H 3VXTB 5ID1B 2NY2D 4K7PY 1CYGA 4MVBC 4D0CB 4P23D 1X5FA 2EDRA 1ZE3C 4YR6A 3QIWC 3P11H 1A7OL 4TUJA 2CDEB 4OLUL 4LLWB 2PF6A 1QBLL 5FGRA 2FLRT 5I74C 2DYPB 3WKNA 3DSFH 3T0EB 3EO0A 4U05A 3OKYA 3TJHD 4BSWA 3W39A 5MI0C 5KTEH 4AH2A 4UNTA 2BHUA 2RCSH 3O45B 3H9SB 1FSKB 1T2QH 5DDHB 1RZ7H 5M94B 2EXWC 5GGSY 3DHMA 1RUPH 5K9JH 3QYCA 3U4BL 1RHHA 1OGAE 1T4KA 4BFIB 2XN9D 1MJUL 1SMAA 2PUQT 3QHZL 3UX9B 4BK4A 2LVEA 1CVSC 4FNLH 5CWSA 3HR6A 1ES0B 2DM7A 1EX0A 5ACMA 1YEEL 3KPRB 2BY3A 4Q2ZA 1N0XL 3VXMB 1OTUD 4HC1L 4MGXA 4OZHE 2NY2B 2BSSA 4JY4B 2W0PA 4ONHA 4EUPH 2AI0H 1CFSB 2IALB 1YN7B 4OCRL 4PJHF 1I9RL 3HRZA 1F4HA 3LRSB 1LD9A 4DTGL 1GAFL 5BS0A 1HHGA 3UEZA 4CVUA 1NMCC 2H3NB 3DYPA 1LEKB 2CIKA 4U1SA 1GC1L 1NAMB 3ECBB 5DVOA 4TTDD 3LY6A 1G9MC 5ISZD 3MRLA 4HULB 3BJ91 4J23A 4JFOB 5T1MB 3OXRB 3P30L 5LKNA 4OV5B 2ZSWA 3BQUB 4KV5F 4JM2A 3B6SB 3GHBH 5DJYA 3W0WB 1A7QL 1NC2A 5GRJL 2DIJA 2IEPA 2GCYB 2XN9B 1BMGA 4GRMB 3NZHH 5ID0B 5C3TA 5T1LD 3IU4L 4DGVH 1FFOA 4YHOH 1PQZB 4U0RB 2YRLA 4OZIA 2D9QB 4OB5H 1KYOK 3IGAB 3OHXA 1KPVB 1R6VA 4M61A 3GSOB 1K4CA 4JO1H 1XF3B 3EYQD 3QWRD 3H9HB 4L4VD 3ILQD 4M5ZH 1C1EL 2UWEA 3C6LC 5B3NA 4LCUA 4EBQL 5CILL 4LOUC 1FGNH 1ZA6B 5E1HB 4F33A 5IIEB 4XTRD 5D8JL 4EI6B 4NKOA 5ISZB 1OWWA 1BQUA 4M1GH 1G7PB 4U6VL 1XEDA 3DX9B 3D85D 4PYGA 1P53A 5DRZA 4NC1E 1X5HA 3MV8D 1MLCB 1PX3A 2R1WB 1FZMA 1ZS8B 3REVA 3MMEB 1AXIB 4HD9A 4JEGB 4NKQB 1KB5A 2YD9A 5T1LB 2HVKA 4GW5A 2AJXH 3BAEH 3MLZH 1QBMH 3P0GB 2VZVA 2EYTB 5EO0B 3F7PC 5GISL 3L5JA 4FQLH 5FA3A 1E6OH 3LOWA 1SJEA 1VPOL 5C0BD 1XZ0B 4K9EC 3QIBB 4ZDHB 2F58L 3MRDB 3E6FB 3DUSB 1J1XL 3AU1A 1T03H 2A77L 2ZSVB 3HN3A 3HUJB 3MLYL 4PD4J 2APTA 1R3HB 5I15L 1FNGB 1EGJA 4B7LA 4ACPA 5JOPD 2NQCA 1VFAB 3QQ9C 2DIAA 1UWEH 3D85B 3VI3F 2RQ8A 1VDGA 3KYKL 1NMBL 3D0VA 4LSPL 5IROA 3QDMD 5BQ7A 1OL0A 3MV8B 4M1CD 2ED9A 3BWAA 2W0FB 4MAYD 3MRIA 5JXEC 3IDUA 4PV8A 4OD2B 3L3KA 4L9LA 3BSZH 1A6TA 3QR2A 5KSUB 2OMBA 4IBLT 2P46B 3SDDC 3QI9C 5HY9B 2HFEA 4PJGB 5FA4A 3NCCB 1A1OA 3UTPD 4PJDA 3MFFB 3VH8A 2R2EA 2DQJL 1BD2E 4S1SL 2BNUB 2AK4D 4GRLB 3DI3B 5LXGH 1HHKB 1PKQA 5MENE 4AT6A 5T1DL 3S7GA 1RU9L 1H5BC 2N1KA 5C0JA 2EH7L 1J8HA 1U8HA 5IT2H 1G7QA 5I8KH 1IM9D 2UYLB 1UA6H 4EXPX 3BVNA 4OZGA 1AGCA 3VGAB 1JPTH 3QRGH 1X9QA 3DMMC 1G9MH 2QSTA 3O3AB 2GITA 3VXPB 5AZ2H 5SV4A 4WV1A 4OZFH 2KPNA 1MCEA 5E99L 2SEBB 3UJTH 5EFIB 3QDMB 2C3WA 4WHDA 5HDBE 3H2WA 3OAYH 5KSAD 3D2UA 1KCKA 2IPUK 4M7KH 5ADPH 1E28B 4NM4L 3S97C 2FBJH 1RULH 4XP9H 3OKKA 3BZ4A 4Y5YC 5JHDB 2K3TA 2NX5D 1DQDL 3KHQA 1QNZL 2AK4B 1KCRL 2ERJC 4GRWH 2CRIA 5CIPH 1UCBH 5IV2A 3GM8A 3I2CL 4GMSH 2GYSA 4DK3A 4KGJA 3BPLC 2WBWB 2YUZA 5ALCL 3WDIA 2YZ1A 4S11A 3TBTB 5D1XD 1HDMB 1KCUH 3QIUD 2HMIC 5BW7C 4WI6A 1EERB 5I8OL 5DK2A 2ARJB 4Z8FL 5KS9E 4PRDB 4WGWB 3MRKA 1I8LC 4MJ5B 1SJXA 2WP3O 1T5WB 4LVNB 3X11B 4GG6E 5KOMC 2AJUL 2NY4C 4K3EH 3BH8B 2WLZA 4P4KC 5L6YL 1UZ6E 5LAXB 1M1SA 3TNNB 2LFGA 4OGAD 3MJ8B 1A6WL 1O0VA 2BNQE 5I71C 4PLJD 4QTHA 4UQ2A 3MROA 5DSCB 2AABL 3OKDB 2V7NB 3CLFH 4KI5C 4GW1A 1PLGL 5DMKB 7CGTA 2IQ9H 2NX5B 1FH5L 1N64H 3MJ9L 2CMRL 2O5YH 3OAYK 4LLQA 5IP4A 3RZCB 4G8EA 4K9EH 1A7NL 3OG6B 3PGCB 2WUBL 5FUZL 3HE7C 1RUQH 1YEFH 1OHQA 5D1XB 1JYXA 3OGCA 3QIUB 2P5ED 3TIEA 1NMAH 5GS1A 1BLNA 1P9MA 2C3XA 1QYGH 2J5LC 1H15A 3TNMB 4H26A 4LSDA 3W5NA 3KYOB 4Z7VA 4C83B 1YQVL 1QKZL 4H88L 4KQ4L 4MJ6A 5SX5H 2NYYD 3MBXL 2DBJA 4GKSB 3ZL4L 1QR1A 5F7HA 2FX8H 5ESQA 5JA9A 3TCLA 3WIHH 5GS2H 5DD0L 1HEZB 3VFVB 3VH8G 4AEIH 1MH5A 1A7BA 3WFZA 4UT7L 3TN0D 4GUPB 4F7CA 2LU7A 5DMJB 3FFDB 3QDJD 3LN5B 4I3SL 4F37F 2YD6A 1S7QA 2P42B 4M7LL 2DAVA 2CO6B 5C0AD 2AK1H 4HPYL 5I1KL 5DRWA 4U1GB 4JRYA 3MLRL 5C0CA 2WWKO 3D39A 1TZIB 4PUBL 4JFPA 3RUGA 4I2XA 4TTGA 3PDOA 4ZO7A 1QSVA 5BV7L 2J88H 2R69H 1U42A 1INDH 5A3ID 4ZFGH 1K6QH 3MGOB 5CGYD 1N4XH 5FYKD 5CEYA 5ELIA 4ZXBA 2VH5H 1EFXA 4P0DA 4R0LA 2GTZB 2PTUA 5ICZB 1RURH 5K9KB 5K9OB 5T5FH 1FYTE 1UEYA 2VITB 5T3ZH 1JYWA 3RDTC 3CSBA 2ZOKA 3JV4B 3ALPA 4YDVA 2I07B 5C0ND 1XH3B 4NKMB 3IF1A 1TZGL 2HLFD 3TN0B 4BSVA 5CZXC 1DLHA 1CDUA 5SX5K 4YBLC 3QDJB 5C07E 5C0AB 1OGAD 5EUOE 3H9YA 2W65A 3LN4B 5F8RC 1GRWA 1N5AB 2BDNL 1X7QA 4DQOL 1TNNA 5C0GB 3ULUL 4FFVD 4AL8L 4ZS7L 1JI2A 1LK2A 3E8UL 1T04B 3WEXB 3FFCA 3RTQC 3G6AB 2JF1A 2VZOA 1NGYB 1LP9F 1KXTB 2Z8RA 2ZP0T 4HGKC 4CNIA 2H2SD 5HVWA 4LDLB 4QCIB 3B2VH 1RZ8B 4Y4HD 3ROOA 1ZHNA 3BN9D 5JUEL 2F53E 4LEXL 1I9IH 3HFMH 3MRGA 1K4DB 3PF2A 5FM4A 4WI9A 4E9LA 2VDNL 4KHXL 1KCSL 3AFLA 5C09A 2R0KL 3UTQB 3SBWC 5L8LB 4WO4A 1R3IH 4L4TA 4IMLA 4OTXH 3LEVL 3KYMA 1I9JH 4KROD 1DUYA 5A2FA 4HWBL 1L6ZA 2HKFH 1WT5C 3MCG1 4CJ1A 1OGAB 2VXQL 4PBWD 1EHLL 1AC6A 1DEEA 2Y7QB 4JKWA 3GNML 3GO1L 1FAKT 4RFOH 3LIZL 1RZGB 2ZG1A 2FBOJ 4HUWA 3VXQB 4OKVB 2G5BB 1INQA 2ED7A 3GMQA 4JFXB 3PV6A 3GHEL 4OZHB 2C4FU 5IEHA 1F02I 2AAVA 3RX7A 1Z0NA 2X44D 3WE6B 4KKCC 5D5MF 3O81A 4TSBL 5DJ8A 3VFSB 3P73A 5HHVL 1UKQA 2J8UE 4F3FB 1GXEA 1CICA 1C5DA 1BJMA 2P5WE 3CDYA 4WWID 2FRGP 4YDLC 4XNZC 4YIQA 5EOCJ 1UYWL 25C8H 1AHWA 3JV5A 4XI5D 1BVZA 3HZKB 4F7TB 2YUWA 2GK2A 4MA3B 2OQJA 3HE6C 2NW3A 1OARL 5J11C 5JPNB 3EGSB 4GT7A 3EYVB 2DKUA 4XCYA 4JJ5A 3I6GB 1S7VB 3OKLB 4NO0A 4KROB 2YD4A 3GBNH 3IDIB 2VKXA 1SEBA 1WZ1L 5AYUL 3WFCH 1DL7L 3N85L 1JPST 1GYAA 5EZOH 4G8IA 1I8IA 4IOFD 1TFHA 4JY5L 2N4IA 4PRBA 1BQLH 1FYHB 1M7XA 4R7NB 5JDJA 4GMTL 1XF5B 3TO4A 4Q9QL 1IM3B 2AV7B 2P24A 1A7PL 2AERT 3UZQA 4LNRA 4HGWA 3T0EC 4JN2A 1A1NB 1MHHA 3VGBA 1TJGH 4S2SB 4NQDD 3GJFH 2H9GA 1CGSL 4B50A 1OSZA 1FFQA 4X5WA 1FSKC 3G5XA 3UTSE 5IK3A 3MX0A 2IGFH 5F6HI 2CK0H 1ZT7A 5L2JA 4Z0BL 5ILTL 5I73C 2OX5A 4H1LH 4RFNB 3UBXI 3Q2CA 3EBAA 4CADB 1W2KT 1JZ4A 1C7TA 2VXTH 3GMMA 3UTTE 2F15A 4IIQA 4KK9D 2NY2C 3NFSH 5E8OB 5CEXA 2XWBB 3LCYA 4QNPF 3WNPA 4U1HA 2AV1B 5IQ9B 5E5UB 1OTSD 4UINL 3V7MA 1I3RA 2FH8A 3O8XB 5EOQH 5DWUH 3BX7C 4G6FD 3U6RB 1BD2D 1MIMH 3HLAB 4A6YH 3MUZ1 2XTJE 1CZ8L 1UWXK 2VLJA 1FRGL 5MEND 4OCYL 2CO7B 4FQXD 3B5TA 3F12B 4HUUB 4M7JL 1FC1A 3BIKA 4MXWL 5C0IB 4DN3L 4DKEH 4NBXB 1I9EA 3VXRE 3BQUC 3HMWH 1U8MB 3JTSB 2O61B 1XIWA 1DQMH 3DHJA 1I7UB 1TVBA 1LK3L 3L1OH 4LLYA 4JDTL 4Y7MA 1KELL 5IR1A 1G7MB 2Y25A 4DGYL 4UNUA 3E0GA 3IKCA 4MA8L 4U0RC 6FABL 4YAQB 2P7TA 4XVUC 5EORL 3LS4L 1OD9A 4ZUTB 4UUJA 2OL3H 1HK6A 1OAUH 2FIRT 5AZEH 2D9CA 4G6FB 5HHPA 1BD2B 3X13B 3V6ZB 2XZAL 1DQJB 1Q9WB 1FNEA 2E8ZA 3DV6B 1B2WL 1OAYL 5JW4N 4XBEL 5MENB 4NBYB 1EAPA 4FQXB 5LGJB 4D9QE 3B3IA 1FG2B 5IMOA 1A5FH 1KB5L 5E8EA 5KZCD 1JWUB 1JNLL 4U6TA 3CFBB 3QFDA 1H9VA 3E2HB 1O5DT 2B1AL 3G5YB 2XNAA 4X6CE 2VXSH 4RNRA 4YO0B 5EU3A 4HK0A 1SBSH 5EBGA 1V7NH 4NNYA 3MNWA 1MIEL 4M6NL 4R3SB 4LSSL 1WFTA 1LMKA 3PUCA 5JDSA 2I9LA 4N0CC 4IOSD 3RX8A 4M6MH 1BFVL 3O11B 4FQ2L 1GVIA 4QHLB 1EGJL 2BNQD 1A4KA 3G5ZA 1TJIL 2DICA 3QIBC 1T1YB 1K8IA 4ISVA 3ILQC 1S9VA 4HUMB 3RWIB 1ACYH 4DWHA 2DQHH 5F3BB 3CDGA 5EBLA 4IS6B 1DBBH 5J9PB 4N1EA 3TZVA 3I50H 5EZLA 3O6KL 2K9UA 4CN1A 3WNLA 4PRNB 3FCTB 1FC2D 4NQEA 3K4ZA 1XF2B 4NHCH 4PYHA 4HDIA 2X1WL 3BEVB 4KMQA 4FXKB 3TJEH 3MODH 2EDBA 5I18L 5KZCB 1ONQA 3IETA 3NCYP 5LBSL 1ND0B 1B4RA 4JO3H 4PP1D 1QFWH 3UZEA 1JHTB 4MD4B 5KS9B 4KXZI 4