1P7KB

Crystal structure of an anti-ssdna antigen-binding fragment (fab) bound to 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (hepes)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
217
Chain Sequence
b'QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain FAB
publication title Structure of an anti-DNA fab complexed with a non-DNA ligand provides insights into cross-reactivity and molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB02
4NQSA 2GY7B 1FG2A 5IB1B 5BRZA 3F6IA 4HUWB 5LXGH 2KQMA 3QO0A 4S1RH 5DK2B 1RJYA 3BQUA 4R97B 4U6HA 3T0AA 2L7UA 2YN3A 1T66C 5C9JA 3RDTA 4M00A 5FK9A 1ZGLA 2GJZB 3EO0B 3B9EA 2Y72A 1YMME 4R7NB 2IBZX 1KB5B 1QEWA 5CJBA 4P9MH 2XV6B 3CXHK 3QUYC 4PJXB 3T0EE 1ZHKB 4HCRA 2NNAA 5F7HA 4I0PA 3RWIA 2UUDH 1YDPA 2W60A 3ZKNC 1U92A 4ODWA 4MJ6B 4XNXH 3W39B 1SEBA 1ES0B 1OPGL 4IMLB 5E94A 4W4OC 5TFSH 1DBMH 3TT1L 1U8MB 3JXAA 5E9DB 2P5WA 2XZCL 5E7FA 5TDNB 3FT4A 4IRSD 4XCEA 4TQEH 1FIGH 5CSZA 3QH3B 4H25B 3RA7H 1BECA 2LFGA 3REWB 4OZ4A 4QHKJ 1Y18A 2V9QA 1F3JA 4LLQA 2M26A 5F1SA 1T1ZA 1OLLA 4JRYB 2NY3B 4OI8A 1EA9C 1A02N 2LAGB 3GUTB 1G6VK 4R7DB 1WIPA 3QIBB 1KB9J 3TVMA 3WHXB 3KYKH 3JVGC 5E6YA 3CK0L 5EUKB 1TCRA 3M07A 4ODVL 4YHNA 3BZEB 3OKNA 3S34L 5SWSE 1DVFB 4XBEH 3K2UH 5KS9F 5DURD 2FDBP 1LDSA 3S35H 1AHWB 3ARWA 1XCQA 1RHFA 3U7WH 1QBMH 3MRLB 3HRPA 4NOBA 1FNFA 4O4YL 1E28A 4QTIH 5AZ2L 4U1JA 5JORB 2EDOA 2GITA 2J2ZA 3GMOA 5LAXA 4HPOH 5JLZA 3BD5A 4K3JL 4NCDA 2PYEA 1R3KA 2PCPA 1E4WL 5DMJB 4K9EH 3QP3A 4KFZC 5FO9B 3NFPA 3BDYH 3L5IA 5KSUB 1XZ0A 4AIOA 3LQAH 4JRXE 3WFCL 2D31A 2X5PA 5F9AC 1HIML 4CMHB 4KUZH 2WIIB 4Z9KB 3WKNA 1UWGH 3JZ7A 1OSZB 5KVEL 3BVNA 3T0EC 4JFZL 2EDQA 2Z8WC 4G9FE 2A83B 2EZ0C 2G2RA 2F9BT 3AVEA 3A67L 3W0WB 1AGCB 2P49B 4PRHE 4NC2B 5EOTB 3QSKB 3D3VB 2G5RA 4LSQH 1OSPL 4ZS7H 3MLTA 4TUKL 4YXKH 1AC6A 5K93A 2VSDA 4JFPA 4APQB 2N1KA 4Z6AT 4PJCB 4U1LB 2J6EA 4AL8L 2ENYA 4HUMB 3KR3L 1YEFH 2FWOB 1HKLL 2VOTA 4Y1AB 3HZVA 2YKLL 3CFCL 4AEHL 4OV6F 1IM9A 4MNQE 3P4MA 2HFFA 1KPRA 2JJTA 4BZ2H 1BFSA 3NABH 1IGFL 4RMTA 1Q8MA 4JDVB 4OSUH 1G0YR 4U3XA 1CE1L 5AWNL 1J1PH 2GUOB 2IQAA 1GAFL 3GNML 2CUIA 4TVPL 5BJTA 4I2XE 1A6ZA 4N5UA 4NO3A 4NZJA 3TNMA 1J8HE 5CMAB 1X5AA 3UTPD 3BXNB 1UXWA 1JGDB 2XKUA 2SEBB 5HHNA 1GGBL 1FHGA 4JFDB 4F7EA 2OP4L 1DANU 2PYFB 5D8JL 3DIFA 5FYLD 1BIHA 1CVRA 4MQ7B 1UEYA 1C12B 5J9PB 3W11C 1FVEA 4KKAD 4NQDE 4YHOL 3RVWC 3I6LD 4PGDA 1A7NL 4LNRA 1JP5A 3QA3A 1LP9A 1DLFL 3UYPA 3GMLB 4DGYL 1G7JB 2O5YH 3MODH 2BNQD 2DWEA 1IRAY 3KWWA 4R4FL 2G9HA 1KULA 4YDKL 4PRAA 4HK3J 1U8QB 1XFPA 3KLDA 3SDAB 3TT1H 4BFIA 3B2VL 2EDLA 2NLJB 3HE7C 3DX9B 4D94A 4JQIL 5DS8A 3C2SA 1MREH 4U6XA 5INDA 1QVOA 5FF6A 1Z6JT 2BZDA 3V0WL 4DKAA 4QF1A 2XXCB 1NC2B 1S78D 5EBWA 5FYJU 1U58B 2H9GA 4FQHA 1MCKA 3CSGA 3UC0L 3PGCB 3CK0H 1VEPA 1QR4A 2JCCE 2YMXL 4ODVH 4Q2ZA 2LAAA 4HT1L 4FFZL 1OQXA 1BVKB 1HHHA 1UZ6F 2VZTA 3S34H 1T21A 4L4JA 3IDYB 3MNVB 4IRJC 4H88L 3SDXA 5ID1B 3D9AL 4NUJA 1JI1A 3TZVB 3ARGC 5T3XL 1I3GH 2HRPL 2BOCA 3D39E 5ADOL 4O4YH 5JW4N 3LKSB 1M71A 1FIEA 4LHUB 3X17A 4QNPE 3O4LA 4M1CC 4X6EA 1BD2E 3VD7A 4K3JH 1HHGB 4LBEB 4ZTOL 1E4WH 5IHUL 5I73C 2NY2D 3OJVC 3F12B 1VESA 3QRGL 4HUNB 1YQVL 3ARRA 1KJ3H 1C08A 3LRHA 4KTYA 1J18A 4OZFG 4QOKD 3RL2A 1ZOXA 5IWLC 1CFTB 1XR9A 5C2BL 1CF8H 3OV6A 1HIMH 3T3MF 5MEND 5JQHC 4N1EA 1K3IA 3PABA 2OCFD 4JFZH 1HXMB 4J3OC 4WI7A 1AFVL 3LDBB 4N68A 1CDHA 1A5FL 3A67H 3D18A 4HFUH 3SDYL 3ZE2E 4R0LB 4Z7OE 2IFFL 3MUGA 4S11A 2I25N 4U1IA 4PLKC 1XF2B 2IANB 5IJVA 5SX5H 5L7XL 3SEPA 5MEPB 1E6OL 1LO5B 2BOBB 3I85A 4J3XA 1EK3A 5F72S 5DJYA 4AL8H 2CMRL 3HI5H 3EO1A 3SKJL 4MHHG 2FNBA 3DGGA 3EYFB 1FL3B 3R06A 3KR3H 3RWJB 2FO1A 4MQSB 5AD0A 4N8VA 4LKXA 2Y6SC 2YKLH 4AEHH 3F7QA 4KY1H 3SPVA 5GS0H 3PL6A 1ZHNB 4GG8A 1TJGH 5E8DL 3VD4A 1OVZA 3S37H 2NY6B 5AWNH 2VLKA 1RV6X 4XXDA 1UJTA 4KK6D 4OLXH 3MLWH 1EEQA 4UQ2B 3O6FC 1F6FB 3INUH 3HUJE 4K7FA 3LVEA 1PQZB 4NKDA 3V95A 4OZIB 4TVPH 1DBBL 4D0BB 3SKNB 4JY4A 5MHSD 2Y9RT 1CGXA 2VQTA 5D1ZB 3VFTB 1GGBH 3ARZA 4WO4A 4ZFZB 3RAJL 1MQKL 4PJBA 1NKRA 5D8JH 3MXVL 3IU3A 2VQ1A 1RJLB 3JWDL 5DUPL 4OLYL 4MCZB 5I2IA 1FZMB 2X4PB 2M2DA 3ARPA 1A7NH 3MNZA 2G75A 3IDNA 2I27N 4KPHL 1TZHA 2OSLA 2X05A 2YD7A 4NKOB 3SKOA 4JANA 4WWID 1DLFH 5T5NG 2Z31D 4DGYH 5CIPB 4G43B 1XCTA 2JKXA 3O2DH 5CEYB 2BVQA 4R4FH 3SE4A 3MZGB 1I1AC 4KDWA 4KKCC 3X13B 4Y19D 5HGHA 5FM5M 4ZNEA 5E8OB 1H8OA 3B2VH 3K7UA 5JDSB 4NPYA 5DT1L 4EVNB 4JQIH 1HILB 3KDMA 1ULVA 4HS6B 2C3XA 5CD3A 5BVJA 4LLDB 1HQ4B 4DZ8B 1QBBA 2APVA 2C1OA 5FUOL 4WUUB 3KXFA 3UC0H 5ECJE 3FO2B 1G7IB 2YMXH 4NQXB 2C3WA 1AI1L 4LSUL 3D0LB 1VERA 5D96C 3KLHC 1KCRH 1EAPB 4FQ2L 4H88H 2AK4A 4ZYKA 1C7TA 3EO9L 4AIZA 4AT6B 4GRLC 1JGUL 3BH9A 5C09A 2RBLA 4U6VH 5T3XH 3LOWA 2HRPH 3UJIL 1EZVX 1ODAA 3H8NA 4FTVD 4YUEH 4U0RB 4LCWD 4OAWB 5BRZE 4LLYA 4GMSH 1A7QL 3RTQA 1B6UA 3S36X 5CBEA 2BC4A 3OHXA 5GJTL 3D2UD 3B9AA 4WUKL 5A3IC 1MNUL 3NTCL 2GT9B 3MRFA 5I1JL 2AQ1A 1OB1A 5GS2H 3IETA 1G1YA 1BX2B 3GIVB 1CIDA 3QRGH 4PRPA 2RAMA 3N85L 4WI8A 3RX7A 3S88L 3UO1L 5IB1A 1ZVYA 5C2BH 1A6WL 1PZ5B 3LPFA 4HUWA 5DZOA 5DZLA 4F7MB 4YBQC 5DK2A 3R0NA 2ZOKA 3FOLB 2RCSL 1WLHA 3DSFL 2ARJB 2GJZA 5JPMB 4A6YL 3EO0A 3S96B 1QSVA 5JR1L 5JW4Q 2P5WE 4R7NA 5IROC 1KB5A 1NFDF 5D2NE 3NACL 4P2OD 2OZ4A 4PJXA 1K8IB 2IFFH 1ZHKA 2I24N 1UJ3C 3ET9F 1KELL 1MFEL 1IL1B 2DBLL 2JIXB 5KSBF 1E6OH 4WU5B 3DV6B 3LN4A 2B4CL 3RBSA 1SBSL 2MFNA 1I8LA 2OR9L 2YPLD 4MJ6A 3W39A 1ES0A 4IMLA 3MBED 5KSAC 2CMRH 3SKJH 4KAQL 5DWUL 1U8MA 2R0KL 2BHZA 1AO7E 5E9DA 1OY3B 3BSZL 4RGNE 5TDNA 3N1PC 1CGSL 1VB9A 1O7VA 3BPOB 4GKSB 4CKVX 5HHQB 1CFSA 4W6WB 2NY0B 3QH3A 4H25A 2W91A 3REWA 3U4BL 3FT2B 3LD8B 3V4UL 1TJIL 1IT9H 1Z0MA 1MAMH 2W59A 4JRYA 5EZOH 2H2SD 3UTZB 3GUTA 4R7DA 3QIBA 3P11L 2XTJD 3WHXA 3G6JF 5EUKA 5L6YL 4PRIB 1T83C 3QHZL 3BZEA 2CD0A 3GKWH 3PGFL 3OWEA 1DVFA 3CMOL 3RAJH 1MQKH 4NC0B 1AHWA 2P8PB 1H3WM 3JWDH 5TDPB 4XP1H 5DUPH 2OQJB 3H9YA 4OLYH 3MRLA 4ODXB 12E8H 4OT1L 1T20B 4KPHH 1KBGL 5JORA 5J6HB 3IAPA 1IQDB 5DEFB 1QG3A 3U36B 1G9ML 1NC4D 1HI6B 4N0YH 2P5EB 1G1CA 5FO9A 5J13C 5KSUA 4Q74A 3DBXB 4TVPD 5K9JH 1A1OB 4OQTL 4LDEB 5HDOA 4BSWB 4G6FB 1RZFL 1BLNB 5IB2B 4Y0GA 4WEBH 2IG2L 3N50A 3OAZK 3C5ZC 2WIIA 3U7YL 1EAJA 3EYSL 2VXVL 5D2NC 5C0BD 3NCJL 1OSZA 1YY8B 3BN3B 4JVUA 3MLYL 3NIFE 2D0FA 3AC0A 3VI3F 2FZ3B 5FUOH 2BY2A 4Z95L 2A83A 1T7YA 3W0WA 1AGCA 4D9LH 3WNPA 4CDGC 5EOTA 5FYKE 3D3VA 1AI1H 5IEKB 4TSAH 4RGNC 3OG6B 3ZE1E 5DUML 5ISZB 5I75B 3P9LB 1QLEL 1K4CB 1NCNA 4YC2C 4APQA 4PJCA 1K6QL 1JGUH 1Y0LB 4U1LA 5HHVH 4KJPD 3CAFA 4WI5A 4ZQKB 5E8EB 1WIOA 3UJIH 1EFQA 2FWOA 3B5GA 2BY0A 4Y1AA 1YN6B 3RZCC 1JK8B 3FAXA 4LCUB 3DUHA 1CGYA 5GJTH 1G6RL 3MREB 4WUKH 1G9NC 3FO1B 1KF9B 4JDVA 2DQEL 5I1JH 2GUOA 2I26N 4NN6C 2CRYA 3BZFB 1WBYB 3VD5A 3V5DB 5DJCB 1OP9A 1LP9E 5CMAA 4XVSL 3W2DL 1A6PA 4U3CA 3BXNA 1JGDA 3CD4A 2SEBA 1N0LA 4JFDA 4P5TC 2PYFA 3NMEA 3KAAA 2RCSH 3MRBB 4MJIE 3QUKB 2VXTH 3ARTA 3L5XL 3WDIA 1GC1H 3DSFH 4GLRH 4MQ7A 4A6YH 4HWBL 1C12A 2R0LL 2VIRB 3SGDH 5J9PA 3EDEA 3C8KB 3F62A 3NCYP 3HG1E 1OGAB 1QUNA 3MUHL 3SBWC 2WBJC 3RNKB 5DUBB 3QJHA 4OBSA 2P47B 1RUAL 3HCVB 2DBLH 3GMLA 3UAJD 4F7PB 1G7JA 1CXKA 5DTFB 2B4CH 3LEXB 4Y2DB 1SBSH 2IC2A 1SYVB 2AJ3B 3FN0L 2APTA 3ZO0A 2VQUA 5EZIL 1U8QA 3IB4A 5D9SB 2CKBB 3SDAA 2R0KH 2J3SA 3BSZH 2AXFB 4JKPL 2NLJA 5TPWL 2NQCA 3DX9A 5KS9B 4L3ED 4XNMB 4PP1C 2MCG1 4M7LL 4AEIH 5KAQG 1S7VB 1NC2A 3U4BH 2IF7A 3V4UH 3QUZC 2Q87A 2BVUA 3BO8B 1U58A 3GKZA 2DKUA 2NY4B 3P11H 1FQ9C 1WTGT 3LHPL 3PGCA 5L6YH 3O4LE 3F65A 4XCCH 2UVEA 3TBTB 1BVKA 4N90D 1EHXA 3MNVA 4F9PC 2NXZD 5ID1A 1T3FB 4MA7H 1FE8L 2W0KA 1AQDB 5EIIA 4DK6A 3TZVA 4YXHH 3NPZB 4AK1A 5TF1L 3LKSA 2XQYK 4LHUA 2FECL 1K8DB 1CXEA 2EXYC 1KBGH 3U0TB 4HGWB 3FFCB 1G9MH 1HHGA 4LBEA 4QT5B 3VXSD 3M45A 1JNLH 3F12A 4GKZB 5B39G 4M48L 2DD8L 3IYLW 1CFTA 4XXCA 3SY0B 2IG2H 4P4KB 3ISWA 3EYSH 2ZSWB 1KC5L 1OT2A 2APFA 3NCJH 5IOPB 1XEDA 4O00A 1KG0B 5E03A 4NRXB 4K23L 1HXMA 5ANME 4S0TD 5L9DL 4NN7C 4X6FB 2JK5B 4JN2B 2OL3B 3Q1SH 5ACZB 4R0LA 4AEFA 3NN8B 1KCVL 1CCZA 1HHIB 2DN7A 1XF2A 3D5OF 2IANA 4OLZL 2W9EL 1PYWB 5MEPA 2HT3C 1LO5A 1QSFD 2BOBA 1EHLH 3ALWA 1K6QH 1ERNA 2EE2A 1CU4H 3ZKMC 3G6AB 1B0GB 3EYFA 1GH7A 1FL3A 3RWJA 5HHOD 2ZUXA 1T5XB 4M6OL 4FZEH 4XBPB 1G6RH 4K3DL 3STLB 3I2CL 1ZHNA 3NPSC 2L7JA 1OTTD 3V52L 4WY7H 2VB5A 5GGSY 2UUDK 2XKSA 3U0PB 3OAYK 4CADB 2VZUA 3QQ9D 4UQ2A 2VDOL 2X7LB 1NUNB 3PP4L 4Z7NF 4OZIA 1PQZA 5DURB 4D0BA 3Q5TA 3F58L 3SKNA 3W2DH 5KTEL 5A2KH 3MV8D 5D1ZA 3VFTA 2OXGA 4PUBL 1F45A 4ZFZA 5D5MF 1FNHA 1UCTA 1YNTB 1XF4B 5ILTL 3B43A 2BVPB 1RJLA 2R0LH 4MCZA 1FZMA 4KUCF 1QR1B 3D25B 3DYPA 1RZKL 3E0GA 5C07E 2CUMA 1JHKL 5DHXB 2HTLC 4P2RD 1IMHC 2ICES 5CIPA 4G43A 2RR3A 5CEYA 3EBAA 2BCKB 5IBLC 3FN0H 4UAOB 2JF1A 2IAMD 5EZIH 4KJWC 5E8OA 1KUMA 1NMCC 2H1PL 2C3HA 1J12A 5JDSA 4JKPH 1WISA 4Y5VB 4EVNA 2AK1L 1RY7B 1HILA 3OL2A 3UROR 2CDEB 4EQ3A 4HS6A 4M7LH 4HJJL 5KVDH 4LLDA 2AK4E 3KPMB 3S36L 4PYHA 1HQ4A 4DZ8A 3MJ8B 4OCYH 2WV3A 4WUUA 3EHBD 4OF6A 2AI0L 2VUYA 3FO2A 1G7IA 1GZQB 1RIHH 2ZUUA 1OLZA 2DQGL 3CFDB 4L8CB 4NQXA 5IHLB 3FT3B 3D0LA 1EAPA 4PJDE 1FE8H 2MKWA 4AT6A 3PE9A 4U31A 5ESAB 3OPZL 2X40A 3VDCA 2EDYA 2F5BH 5TF1H 1URLA 4OAWA 2D0GA 4HIEB 4BQBA 3C8DA 1J86A 5BV7B 4K8RC 4MZ2A 4CGTA 2GT9A 4HKZB 3B3IB 4OFYA 4BSJA 2I60H 1BX2A 3GIVA 4BZ1L 2E7BA 3MX0A 5F88B 4RMUA 5E5MB 1OAQL 3LB6C 1M1SA 1UWXH 1N3NB 5DQJB 2QADC 3T2QA 2DD8H 4PJXE 4NBZB 5I16B 4MVBC 4HK3N 4XI5C 1KIPB 1PZ5A 4LSTH 4PB0L 4F7MA 1RUQL 8CGTA 1KC5H 4PJIF 3QFDB 3FOLA 2WBKA 4FHBD 4BQ8A 3ARFC 4G6JL 4K23H 2DLHA 4X6DF 2WANA 4JN1L 2ARJA 1N5AB 3S96A 3QULB 3JTSB 1UG9A 3WYRA 1A3LL 1KCVH 1K8IA 3PWNB 2BNQB 2FEDD 4DEPB 1C5CH 3H9HA 3V5KB 2DIAA 3C8HA 1J88A 2AJXL 2W9EH 4OLZH 1IL1A 1BVZA 2JIXA 4WJ5B 1OD7A 2VDML 1FZJB 3DV6A 4WU5A 3VGDA 4J12A 3ARYA 3MRKB 1JIBA 4WU7B 4X4ME 1QZ1A 4OZHE 2GCYB 5DMGD 3WJJC 3FZUD 4WHDA 4GKSA 4XTRC 5HHQA 4OIIL 4O2CB 4ZFGL 5DO2D 4V2BA 5DR5L 2AEIT 3FT2A 1CQYA 4RBPK 3M8OH 5GGQH 3GSQB 3TNNB 3UTZA 4E41D 4KQ4L 1BM3H 5C92A 4U1MB 5CSBA 3UYOD 3PP4H 4OI9A 1KJ2B 1VSCA 4PRIA 1SY6H 1U8HB 4R6UA 3PWPD 3F58H 2YZ1A 2GYSA 3B8SA 3C2AL 4L5FH 1EO8L 4RRPG 5ILTH 4RFNC 2P8PA 5TDPA 3OJMB 2OQJA 2V7NB 4ODUB 1ZHLB 2JJSC 3OR6B 4ODXA 3SO5A 5DD0L 2V5YA 3O9WC 4M7ZB 1T20A 2NY2B 5E5RB 3VWJB 5J6HA 1IQDA 5F9WB 5DEFA 3FAWA 3U36A 4F7CB 3UZEA 4I3SL 3DO7B 1HI6A 4XVTH 2E7CA 2P5EA 5I1CL 3QUXD 4FQPA 2E8YA 4WWKC 3DBXA 4LU5L 1A1OA 4BSWA 1NSNL 1BLNA 2NX5B 5IJKA 5IB2A 5T1KD 2AK1H 1GCFA 4ZO9A 5BZDB 2V9TA 4I3RH 2FR4B 3C6LD 2EO1A 2NXYD 2FZ3A 3RJQB 4A2LA 4LRIA 3ULUE 5BW7C 1UB5B 5L8JB 4XGZB 1YEJH 3UJJH 2AI0H 2EDFA 4Y1AE 2DQGH 5H8DA 4GKNB 1IE5A 4UUJB 2NR6C 5IEKA 5ISZA 4OGXH 1OWWA 5SX4I 2W0PA 5ACLA 1X5IA 4AQ1B 3P9LA 1K4CA 3P30L 3BGMB 2D03H 1Y0LA 3GMRA 3OPZH 3PWLB 4ZQKA 3SCMD 4O2EB 5E8EA 1KN2L 4OFDA 1ED3B 4KK8D 3C08L 3RKDC 1QBAA 1DCLA 5I74C 1LILA 3MC0A 1YN6A 3ARBC 1JK8A 4R4ND 4LCUA 3MREA 3FO1A 1C7SA 4JFDE 1NDMB 3V6BR 5DD1L 4N9GB 5C2UB 1H3PH 4WW1B 2DM7A 5SX5K 5IBTL 1NFDB 4G8IB 1AD0B 3BZFA 1WBYA 4BQ6A 3V5DA 5DJCA 1UKQA 1S7RB 2HKFL 3S3PA 2FHFA 1MAKA 5KSBB 3BAEH 4PB0H 1AD9B 1RUQH 1D9KD 5C0AB 5HJ3B 2H41A 4G6JH 3MRBA 3QUKA 4XAWH 4JN1H 3CX5J 2GJ6A 2WIMA 3U30C 2VIRA 5JIIA 3C8KA 5D1XD 1OGAA 2Z31B 4J2XA 3T1FB 4P3CL 4PGEB 4XC3L 3RNKA 3QDJE 5DUBA 2AERT 1HH9B 2YUVA 4MAUH 3HCVA 4F7PA 5T3ZE 5DTFA 3LEXA 3QQ3B 4Y2DA 5I19H 1SYVA 2AJ3A 4Y5YB 3OF6D 3MQIA 4Y4HB 1GOGA 4X7SL 3GM0A 5D9SA 2CKBA 3G6JB 4BFBD 1H3UA 1HXYB 3WIHH 1ZT7B 3U9UB 2AXFA 2HFGL 3ULUC 1IGIH 3C5JB 2DI9A 3GBLA 4ZFGH 1YUHA 1RZJL 5KS9A 4XNMA 4YE4L 3LKQB 5F97E 5DR5H 3ZKXB 4YFDB 1S7VA 3LKRB 2FHBA 3TO4D 3BO8A 4KQ4H 1EH9A 1J05B 4NNYB 4ZFFB 2ERJC 3TBTA 1JHTB 3WD5L 1T3FA 2MTPA 2OMNA 4FTVB 1EO8H 1AQDA 1YEIH 3LIZL 2V17H 3MV11 4G6KH 5HGGS 1PX3A 2BNUB 5DD0H 1K8DA 3NFNB 3U0TA 4HGWA 7FABL 1LO4L 2H3NB 4DFIA 3FFCA 1PKOA 4I3SH 4QT5A 5KJRH 4F15C 5GS0C 4XPGL 5I1CH 5J56B 5DZNA 1T03H 2F53D 3V4PH 2Q8AH 6FABH 3KPRB 3SKUD 4LU5H 4GW5B 4P23D 4GKZA 1U3YA 1I9EA 2C5DC 4NP4L 3SY0A 5MERB 3QEUB 4NQUA 4P4KA 2IANE 1MIEL 2XY2A 1JTPA 4PJ5E 5IOPA 2XIDA 1KG0A 4RISL 4NRXA 3OR7B 4FQXB 4TN9A 3T0VA 4X6FA 2JK5A 5DC9B 4JN2A 5C0EB 2OL3A 5ACZA 4GO6B 1ZKAA 2C4XA 4KQ3H 1IC5L 4DKDC 1TETL 1HHIA 3KJ4B 1D5BB 3OGOE 5DDHB 3X3GL 1PYWA 2ATPB 4OKDA 32C2B 3HE6C 3THML 3IJYB 1T2QL 4X4YB 3G6AA 3QISA 3DMMC 1B0GA 1P4LB 4JFHD 1KN2H 3WS3B 3QUMH 1N4XL 1JYWA 1T5XA 2H26B 4HIXH 5CFHA 1EXUB 3TEUA 3C60C 4XBPA 3N1FC 3SGKA 3STLA 4NNXB 1N64H 1BJ8A 1NJ9B 4H0HB 4F2MB 4I9WD 1TFHA 1YPZE 4OFPA 2YD1A 4X83A 4UI2A 2VMFA 5SV3A 3MRRB 3U0PA 4XMLL 4CADA 2X7LA 2KPNA 3FHAA 3V9FA 3VA2C 1CS6A 3WFDL 1AGDB 1ZLSL 4BQCA 1W8NA 4L1DA 2ZCLL 2MWCA 1YNTA 4WW2F 4WDIB 1XF4A 4U1GB 1XH3B 2BVPA 1QR1A 4YEEA 3RY5A 5FFLA 3D25A 4MA1B 3HHRB 4XC3H 1QLRB 3TBVB 3RU8L 1M7DB 1B0WA 3OB0H 4PJ7A 1LEIB 2VLJE 3CGTA 4E0RB 3B5TA 2CXKA 4RCAA 5CWSB 4JEGB 4JO3H 2BCKA 3CLEL 5CEZL 4WUUE 3MLRL 4IOFD 4NRYB 1Y6MR 1Z0NA 2HFGH 5C0BB 2ILLA 5A2FA 1UC6A 3AUVA 3S4SG 4Y5VA 1WWAX 1EEZB 1RZJH 3QT2A 1P7HL 1U3HB 2XZAL 3ARDC 2CDEA 5I17B 2MKLC 5EDXA 2VERN 3KPMA 1V5JA 1TITA 3MJ8A 4V1DE 1ZMYA 1JMXA 5C0JB 4H1LH 4ORGB 1GZQA 1TQCC 4L8CA 3CFDA 1J11A 4I5BB 3MV7E 3FT3A 2P7TB 1JGEB 4OLWL 3B4NA 5DXWA 3GFUA 4ZTPL 5ESAA 1Q94B 5BOPA 4HKJB 5C0IB 1JCKA 3WN5B 4OFVA 4AM0B 4YHZL 5GRUL 4XAKD 4HIEA 4P9HC 4RWYL 2ZG3A 7FABH 1LO4H 1NL0L 1KB9K 3I50L 5E00B 4QRRE 4HKZA 3B3IA 4OF3A 1PG7W 2YEZB 3PQYE 4RIRB 3V7AE 5F88A 2G60L 5IK3B 2VC2H 5E5MA 1N3NA 5DQJA 4B41A 5I16A 4JAMA 1WF5A 4OM1H 1KIPA 3LPWA 4QRQB 3VXRD 5FAAA 2R4RL 1F11B 3QFDA 1X4ZA 3K4DA 4OF0A 3DVFA 2FIKB 5F7UA 1N5AA 3GSNH 3LN5B 4LIQL 3ZDYE 4JQXC 3QULA 1I85A 1FFPB 3F8UB 3JTSA 4U33A 4N8VG 1IC5H 1TETH 3PWNA 2BNQA 2PW2B 4NUGL 4WTXA 4JHWL 3V5KA 1GGIL 5L2KB 3STZB 5ERWB 1IKFL 4WJ5A 2ZUTA 5E4EB 1QFUL 1FZJA 1T0PB 5BQ7B 3THMH 4JR9H 3UTSD 5B3JE 4QCIB 3MRKA 4L3EB 4TULH 3ILQD 4WU7A 1N4XH 2GCYA 1P2CB 3AY4C 3U0WL 1CICB 3VMOA 4O2CA 3PG2A 2QQKL 5IW3A 1EBAA 4AH2B 4CRPA 4K2UL 3H3KA 5D5MB 2FD6L 1FDLL 4YZFE 5IGXL 1W0VB 3GSQA 3TNNA 3K8MA 4U1MA 1BEYL 1KJ2A 1KLGB 2NXZB 3NGBC 2K7PA 1QRNE 1U8HA 1A6AB 3ULVD 3BE1H 5AG9A 3IKKA 3WFDH 3VFGH 1ZLSH 2HJKB 3ZYOA 4JFYB 2XPGB 5HVGB 4X5WB 5GGRB 2IPKB 4DN3L 2V7NA 4ODUA 1ZHLA 2ZNWA 3OR6A 4OGAD 1JYVA 4N0RA 4RSVA 3WEXB 2B5IC 3SGJA 3CXHJ 2R0ZL 3RU8H 3VWJA 4F7CA 2RGSA 3CSBA 3D0VB 4PGJA 3DO7A 2FEEI 4G6AD 3B9VA 3CLEH 4GFTB 3PWJB 4ORZC 2C4FU 4G7YH 3BZ4B 5J57B 2C9AA 3QXDB 4LSPL 2NX5A 3CH1B 4LVHB 1JZ2A 1RFDL 2P24B 1OF2B 5BZDA 3QQ4B 5ISZE 3PF2A 3KS0J 2FR4A 3BX7C 3AFLA 1JUFB 3QEHB 1UB5A 4XGZA 1RZ7H 3NCEB 4HG4K 1CQKA 3MRHB 4Z7UB 4GKNA 3V7MA 4UUJA 1WAAF 4Y4FD 2HH0H 3QDAA 2UV3A 1T1WB 5CD5C 3RFZC 4EDWL 3BGMA 1S9XB 3ZDXE 3QEQD 3UEZA 2J8UF 3AREB 3PWLA 4O2EA 5DMKB 4ENEC 1ED3A 4FQJH 5D7LD 2OBGA 3ZTJG 5EG6C 1PLGH 1FFRA 5GRUH 2YK1H 5FYJL 4PJIB 1U8IB 4Y4KC 3L6FB 3FQWB 4X6DB 4UT9L 1NDMA 3DXAE 5EOQH 4N9GA 3MRQB 4UNUA 4MA8H 3I6KB 3RPKA 4LKCB 4XC1L 5E7BA 5K9QG 1NFDA 4G8IA 1AD0A 2XG4A 2HLFD 3RPIB 1KXTB 2XZZA 1RUMH 4UNVA 3PJSB 1PEWA 1S7RA 5C86A 3GSWB 5KSBA 4RA0C 2HKHL 4NQEE 1EJOL 3UYRL 2F5AL 1AD9A 1GPOL 5C0AA 2R4RH 4I77L 3BQUD 5HJ3A 5E2VL 5D93C 2DQUL 1C5BL 3RDTD 2E27L 4U0QB 1MCQA 4QRTB 4Y88A 4P3WA 1FC1A 2Z31A 4PJ8B 1JPFB 3T1FA 4PGEA 2IQ9L 1HH9A 4LL9A 1Z5LB 4FQCH 1BJ1H 2IAMB 1IKFH 2NY5L 5J6GB 3DETD 3D85B 4XP9L 4CU8A 3KPSE 1JNNL 3K1KC 4Y5YA 4YK4B 4Y4HA 1NDGB 3G6JA 1HXYA 4IEFB 5KVGL 1ZT7A 3WE6B 2CKNA 3U9UA 1BFOB 2FLBT 4JM2B 3C5JA 4QWWD 5DVKA 4A6YB 3LKQA 2V2XB 3QDMD 4K2UH 5I1DB 4CAGA 2FD6H 3LKRA 2KZWA 2EH8L 2CIKB 4NM8H 5I71B 5BS0E 4LVOB 5J3HD 4K3GA 1I3VA 5C9KA 3TVMD 1LHZA 4HEME 1UXSB 1OAUH 1J05A 4KKNA 5K59E 4NNYA 3L5WB 2H6PB 1JHTA 5A40E 4N0CC 4U7MA 3LV3B 1PKQB 5DVLA 4FTVA 4ZUUB 5JOPD 2OI9C 1PG7X 3BN9D 3OAUH 1R5VB 4DN3H 4OZFH 3LQMA 4AENB 3UCRA 4XWGH 2BNUA 3MSPA 4PBXA 3NFNA 2R0ZH 3BPLB 2LVCA 4JREB 3GDBA 2H3NA 4N8CL 1FFQA 2FLRT 2PYED 5GZOD 1MFDL 4R4BA 2XZQL 4BJLA 3W5NA 4X5LA 2CO7B 1F2XK 3KPRA 3BGAA 4GW5A 3OJDB 4ALAH 3DVGB 2ZPKH 1L9NA 2YA2A 1AR1D 2GSIB 3MRDB 5MERA 3QEUA 4XB8A 3M1BB 1RFDH 4TRPL 1WJ3A 4L4VB 1YEEH 4KROD 1PBYA 1GGCH 3QCTH 3OR7A 2C26A 4FQXA 1R3IL 5E6ID 5C0EA 5I1EL 3QNZB 1HNGA 3FO0L 2MQCA 4MAYD 3HZYB 4UT6H 1KGCD 1D5BA 5DDHA 2LTQB 4IS6B 5CEZD 32C2A 4EDWH 3IJYA 1UH2A 4X4YA 4MJ2A 2DM4A 1P4LA 5D70L 2F54B 3WS3A 1CFQB 1PSKL 2H26A 4L3AA 1EXUA 4QY8B 1XT5A 2V6HA 3T8XB 4TNWF 4YR6B 4IBLT 1T7ZA 2CRIA 3RVXC 4NNXA 4UT9H 4Y8DC 1NJ9A 1RK1B 3QFJD 4F2MA 5EOCJ 3DECA 4QKXB 4ZUSB 5C0FB 1SVCP 1MQ8A 3MRRA 1VEOA 1NAKL 3PHSA 4R90H 4ZUTB 4XP6L 4ZPVB 3WMSA 2HN7B 3MJGX 2HKHH 1EJOH 1ND0B 4HMEA 3SE3C 4WVRA 4KZDH 1TZGL 3H3BC 5C3TA 1AGDA 1GPOH 5GGTL 4I77H 4DUWA 5E2VH 3GI9H 2DQUH 3H3PL 3QZWB 1W0WB 4LP4A 5D7JD 4WDIA 3ROLB 1C5BH 1G6RB 1XH3A 1IFHL 1TPXC 3S5LG 4JGMA 1YEGL 5IEHB 1UZ6E 4XNYH 3RGVB 1H5BB 1QLRA 4OIBA 3TBVA 2IQ9H 1M7DA 4OM0L 1LEIA 2A2QT 2ZUQC 2NY5H 3HZKB 4LDOB 1IAMA 4E0RA 1NCCH 4GW1B 1QRKA 1HDMB 4M5ZL 3SE9L 3BRGC 2PUQT 5T1KB 2IEPA 2VR4A 1TNNA 2R1YB 4NRYA 1OP3K 1IBGL 1T89C 5C0BA 4IRSC 5F1KC 5B8CC 3C6LB 1XAUA 1EEZA 5HGAA 3G5VB 1DEEB 1U3HA 3CX2A 3T08A 2FGZA 43CAB 5I17A 1MRFH 4P49A 4N5EC 2EICA 3U9PL 43C9B 2IH1B 5CKAA 5KVMC 4TVSa 4ORGA 4L8DB 5KSVB 4NQCE 5EWIL 4JKLA 5F9JB 3WFBL 4I5BA 4I0CC 3OBAA 5D7IE 2E9BA 2BX5A 3GK8H 2P7TA 4YFLI 1JGEA 3TJHD 5CZKA 1AXSB 1ZTXL 4X4ZA 2VH5H 3BUYB 4M1DL 1D5MB 3K0WA 1Q94A 4HKJA 4QHKI 5C0IA 3UTPE 2BVYA 1S7UB 3WN5A 4AM0A 3B2UD 1U9KA 2CR6A 1OAZL 1TDQA 2F58H 5FIEA 2AQ2A 3JV6B 4EUPB 4MHHI 5DRWB 5FYLE 5LG1A 4N8CH 5E00A 1L7TL 1G7LB 4F37F 4LAQH 2VZVA 3UTTB 4HF5H 4OD2B 4OCRH 1N59B 4L9LC 2YEZA 3SQOH 1H3XA 4RIRA 4PJGF 5IK3A 5SWZB 1FVDB 4LSDA 4P2QD 1D9KB 4HV8B 4WTWA 4UILL 5HYJB 1J0YA 3L5HA 4QRQA 4TRPH 3MLVL 1INEL 3L3GB 1A14L 4PGCB 3E8UL 1F11A 1RAMA 1LE9B 2BP3A 4DGIL 1REIA 1RUPH 2FIKA 5HYEA 2BSED 5DI8B 3LN5A 1MRDH 2VZ3A 3BPNB 2W9LA 2X4RB 1FFPA 3UBXB 4U7SA 1BQHG 3FO0H 2PW2A 5EU6B 4XNZB 4BM7A 5L2KA 3STZA 4QXUL 5ERWA 1BJMA 2L0DA 3JWNC 1IM3B 4X8XA 5BQ7A 5ICZB 1ZXQA 4QCIA 2ESVE 4N1HB 2NY1C 1NMBL 4HPYL 4U1NB 4L3EA 1P2CA 1PSKH 4K94C 1CFBA 1CICA 4QHLB 3GRWH 4AH2A 2LU7A 2XA8L 5BCAA 5D5MA 1WITA 4FQIL 3PL6D 4WW2B 1UENA 2E6PA 4KVCL 1W0VA 2FB4H 3OQ3B 3IAQA 5C0RL 2Y06H 4BUGA 4OZGF 2R2EB 1KNOB 3MRNB 1G0DA 1NAKH 4MX7B 5JUEH 4XP6H 2R2BB 1KLGA 4XPTL 1NBVL 1A6AA 2YRZA 2N4IA 1TZGH 1HOCB 5GGTH 4WO4D 2HVKB 1G7PB 2HJKA 3CXDH 5GJSL 4QOKE 1CTNA 1KLFA 1UM4L 1JV5B 2XPGA 3BKCH 3I9GL 4MS8D 5GGRA 1O5DT 2IPKA 2ICEB 1IFHH 4WCYH 4KKAC 5MENE 3HA0A 1YEGH 4IIQC 5C8JB 5FYJD 4Z7VE 3WEXA 1FCGA 5CJ8A 4J4PD 3EOBB 2IPTL 2F53B 4OM0H 3IJSB 3EKCA 3D0VA 4ZO6A 3S7GA 1OD9A 4QTHB 3PWJA 4M5ZH 3SE9H 3LN9A 3CFBB 1NUGA 2NTFB 4BELD 5JXEA 3BZ4A 3QXDA 1I1CA 3BEWB 1IBGH 3CH1A 1I9IL 3VMPA 2P24A 3QQ4A 3FOMB 4FFWC 3RWFB 4J3SA 1F02I 4HD9A 1JUFA 3QEHA 4LQFL 4HIHB 3U9PH 3KXFD 3PWUB 4XMPH 3KPNB 4OB5H 5FKAB 3SDDB 3MRHA 4Z7UA 1XGYL 3WFBH 2MCPH 1X4XA 4RA3A 1KJMB 1T1WA 1NMAL 1ZTXH 1EO5A 1A64A 4M1DH 1S9XA 1X5HA 5ALBL 3AREA 3KJ6L 4JDZB 5MHSE 4AEEA 5DMKA 1TQBC 4FQ1L 4ZXBC 1ZEAL 1RQ5A 5H35B 1MRCL 4KRPD 3VA6A 4PJIA 1FAIH 1UA6L 1U8IA 4U7KA 3L6FA 3FQWA 2PO6C 4I0KA 3P0YL 4X6DA 3GHBH 2O61B 2ZKHL 3MRQA 4LVNC 3OKKB 3I6KA 3O6LH 4LKCA 4Q0XL 4PRPD 4WENB 3V7AG 2E7LA 3RPIA 3KPPB 3PJSA 5AZEL 5EC2B 5DD3L 4O5LH 4UILH 3GSWA 4Y19E 4PTTB 3E8UH 4LPWA 2HT2D 1HSAB 4DGIH 3TBWA 1R3JB 3QIWC 1DL7L 2KKQA 4JO1H 5E08H 4QRTA 4RFOL 4YDIL 3GZKA 2IPUG 4PJ8A 1JPFA 3QPXH 5EBMB 1Z9LA 1GOHA 2A9ML 3W9EB 1L9MA 1Z5LA 4QXUH 5J11C 5J6GA 4RZCB 3D85A 3EFDL 3PV7A 2YUXA 3MV01 3E6FB 1NDGA 4KV5E 4L9DA 3WE6A 1PG7L 1VENA 5E9DD 1BFOA 3MXWH 4JM2A 2Q3AA 3BIAX 1F3DJ 4KXZH 2LE9A 4M93B 4KDTA 4A6YA 2V2XA 2Q6WB 2XA8H 4WI4A 2EE6A 5I1DA 4Q97A 4FTVE 1FNGB 4KVCH 2MNUA 4LDLB 4LCWE 2EO9A 3GBNL 1JTOA 4JRYD 4PJHF 4KK6C 2NY3D 3OB0K 2CIKA 5C0RH 1R5WB 1FNEB 3BGFC 1PJ9A 1DUZB 1UXSA 3H42L 5IT2L 1S7SB 3HC4L 1CE6B 4PLJC 3L5WA 4D3CL 2H6PA 3RVUD 2YXMA 1CXLA 3VI3E 1DVFD 3LV3A 2IBGA 1EGJH 1PKQA 1J10A 4ZUUA 1YEKH 3MA9H 1UM4H 1R5VA 4JHAH 1KV3A 5GS1C 4AENA 5ADPL 3K2MC 4Q9QL 1UWEL 2YD9A 3UZVB 2PETA 1EV2E 3QJFB 1QSED 2IPTH 1CDYA 5F3BB 1CGUA 4DVRL 3R0MA 5FGRA 1GHFL 3HMWL 3HRZB 2FJFB 1UCBL 3OJDA 4UIKL 4URTB 3DVGA 1RIUL 4KK9C 2GSIA 3EYUH 3MRDA 4PV8B 2BNRD 5JW5B 2YPLE 3M1BA 1MPAL 2B8OT 1IC4L 4L4VA 5FM4A 2AGJL 3AU1B 3UDWC 1G7HB 4LQFH 5C0DB 3W0WD 1ZVSB 3IS0X 4TNWK 3TCLB 3HZYA 4X9HA 3UTSB 1H3VA 4MMZC 1UQSB 2YZ8A 2P48B 1NMAH 2XTJE 1CXIA 4IS6A 5F93C 1S5IL 3SE8H 2JELL 3B8YA 1BBDL 3KJ6H 1MJ8H 2F54A 1CFQA 1HHKB 4HXBL 2AEQL 4GH7B 1CZ8L 4QY8A 1MRCH 1LE5B 4NBXB 1NH6A 3T8XA 3QIUC 4YR6A 1UA6H 2GQHA 2UVFA 3X3FL 2KZ1B 3P0YH 1KEGL 2COQA 1RK1A 5KZCD 5T5FL 1P9MC 5HI4D 1PVHA 4H26B 4ZUSA 5C0FA 4WFHD 4Q0XH 3JUZA 5L0QB 4ZUTA 4ZPVA 2HN7A 4R96B 5AZEH 3IRPX 1NUDA 5EIVA 4I48B 3QUMB 1ND0A 2D7TL 2QV2A 3O8XB 1AP2A 3RY6A 3QZWA 4HIJB 1W0WA 4LNVA 3ROLA 1I9RL 4YPGB 1G6RA 1DL7H 4X9GA 5DLML 5JMOC 4KXZI 1W8OA 2R39A 5C0BE 4P2OC 3EDJA 4LEXH 3QDGB 4YDIH 5IEHA 5E95B 3HNVL 3ARXA 3RGVA 1H5BA 2A9MH 3FB5B 1X3DA 4OGYL 3VG9C 3P4OB 3T1WA 3HZKA 2AV1B 4FQLL 4HKXB 1EPFA 5M94B 3EFDH 3KJ4C 5C08D 3I3BA 4GW1A 3MBEC 3MRJB 1HEZB 1HDMA 3FQNB 3IXTB 4PIRF 2AXGB 4N0UE 5T1KA 3SDAD 5I1KL 3WBDA 2R1YA 4Z5RB 3S35X 2EZ0D 3K8KA 4OLUL 3C6LA 5FHAH 1DBKL 3G5VA 1DEEA 4HWBA 1UM5L 43CAA 2UWEE 4WHCA 4Y5XB 4RAUB 3CH8A 3IDGB 3GBNH 4P5MB 3MUY1 3VI4F 43C9A 2XTJC 4Y4FB 1NAML 2OYPA 2IH1A 5C1MB 5IQ7H 3LMJH 2OTPA 3QQNA 3MV9B 3HC4H 4L8DA 5KSVA 5F9JA 4OF7A 3VXMB 4D3CH 4LPXA 5CLWA 1F4XH 4M3JA 4F37K 1N5YH 3EJJX 4LLVB 1AXSA 3HAEH 1KXVC 3VFMB 3BUYA 4WHYG 5DSCB 1D5MA 2MPAL 3B9KB 1EIBA 3O3DB 3TZVD 1HH6B 3LZFL 2V9RA 1FLRH 1L4IA 5ADPH 5I6XB 1S7UA 2XT1B 5ESQB 1Y6NR 1FO0H 1ZV5A 2VDLL 4LHUD 3IAGC 1BZ7B 4NCC1 3ZL4L 4NZRL 3JV6A 4EUPA 5FGBA 3VGEA 3VU2A 4H1LB 1OTUC 1G7LA 3HI6L 4PJCF 3UTTA 2KL6A 1GHFH 3C09B 4OD2A 3HMWH 2J88H 1N59A 2YS4A 2KH2B 1YC7A 1W72L 1GGTA 5GPRA 5SWZA 1UCBH 2DIBA 2EDNA 4UIKH 5EUOE 1A4KB 1FVDA 1Q1JL 3CNKA 1CLOL 1RIUH 1D9KA 4OD1H 3W11D 4HV8A 1JWUB 1RULH 5HYJA 1A8JH 3RVWD 1MPAH 3TN0C 4YPJA 1P1ZB 1IC4H 3L3GA 2AGJH 4PGCA 3SN6N 5F7DB 1LE9A 5DI8A 3MLUH 4OCLC 4Z7NE 4L3EE 4F57H 1GJIA 5JO5B 4H5SB 2X4RA 2R56L 2NNAB 3UBXA 4HIIB 3S3SA 5EU6A 1U8PB 1DQMH 2Q76B 1OAKL 1WZ1L 3V4VL 2WUBL 5GRZA 4UOJA 4XZUB 1N6QL 4XP5L 4PRHD 1IM3A 3U2SB 3TC9A 5DD6A 3QXAB 2CXGA 4KJPC 5ICZA 1SQ2N 1BBDH 5GRJL 3E2HB 4U1NA 5I1GL 4WEMB 1FFNB 4N90E 3QDMB 4HXBH 4IRZL 4KHXH 2AEQH 4QHLA 3MRPB 1CZ8H 1MFBH 2Q20A 3TJEH 2GEEA 2E9IA 3O0RH 3X3FH 4WW2A 3BYTA 5F6IB 1KEGH 2YRPA 1MVUB 2YC1B 4HAGA 5DFVD 1K9TA 3GB7B 2NY6D 3UPAA 2R2EA 1KNOA 5F1NB 2OJZL 3MRNA 3KHQA 4MNQD 4MX7A 4LPYA 2R2BA 4CMMB 3VXSE 4YHKL 4NT6B 4MD0B 4O02H 2APBA 2YR3A 5D1ZD 1HOCA 3TA3C 2HVKA 1NCWL 1G7PA 2OK0L 1JV5A 1I9RH 1OTSD 1Q38A 4P46B 2ICEA 1CD1B 3J8F7 5C8JA 2ADIB 4YHYB 4JQVA 3EOBA 3MGOB 4OGYH 1CL7L 2I07B 2F53A 1NCAL 5HHMD 4ERSL 4ONGL 5I1HL 4CUCA 1MCHA 1Z9SA 3GJFH 2EC9T 3QEGL 4QTHA 2AJSL 1C1EL 4JB9H 4EOWL 3PP3K 4DUVA 3CFBA 2Y1VA 2NTFA 2ZCKL 5FYKL 2DQFB 5I1KH 2H2PD 3BEWA 3G08B 1QSFE 2AQ3A 2EE3A 3CU7A 4HWNA 5LGHL 3MLSL 1DBKH 3VXUB 3CX5K 2DBJA 4HDIB 2BJMH 3FOMA 5F7KC 5E6IB 5KVFL 4PLKD 4R9HA 3RWFA 2PN5A 5HHOE 3KLSA 5AYUL 3H9ZA 4MAYB 4ZAKB 3N0PB 5TE4L 4DAGL 4Q9RH 4MSWB 3GSXB 1NAMH 3PWUA 3TWCH 3DX6B 2R9HD 3KPNA 1QHOA 5FKAA 4Q6IC 4XNQB 3SDDA 3T77B 2Z8RA 1L6ZA 2I5YL 1KJMA 2ZSVB 3K46A 4XVUC 2F8VA 5J12B 4DFHA 3G6DH 4PJGB 2MPAH 5D1QC 5CP3H 2ED8A 3VCLB 3MA7B 3LZFH 4EN3B 2QHRL 4JDZA 3UXFA 3MV8E 2NZ9C 2VDLH 5I9QB 5H35A 5AG8A 3QFJB 4I18C 3ZL4H 4KHTL 2Y25A 3A6CL 5MI0B 5JW4R 4OQ1A 2VLMD 4KRLB 1EMTL 1E6JL 3IDUA 3O2VL 5CJXC 3FQXB 2O61A 1VFUA 3OKKA 4OFYD 5SWQB 4P2RE 1Q1JH 3KPPA 3VFSB 5FECB 5CJQL 1VA9A 5EC2A 5DK3A 4NKMB 4QEGA 1M4KA 2W07A 5D7JB 3Q2CA 4PTTA 4HS8L 3TGXA 1XGTA 2G5BB 3IFLH 3SDCC 5C0NC 2KBGA 3FONB 4YDLC 4XHJC 4PY7B 1HSAA 1JZ4A 2HMID 4LPVA 1R3JA 4C57C 1IJ9A 3R8BB 3S37X 1JGVL 2R56H 3WDHA 3H0TB 4JZJC 3NH7L 1AKJB 2Z91B 5J8OA 5EBMA 3W9EA 1OAKH 1TNMA 1WZ1H 3RNQB 4DKFH 3DI2B 5GXBB 3MMEB 4MQTB 2JIXD 1N6QH 4XP5H 4UV7L 4OZGB 4RZCA 3DNKA 1GIGL 5JA9A 3E6FA 5GRJH 1G9NH 1VFMA 2V5MA 1E0OB 3PDOB 4OJFL 1N2RB 3V5HB 4IRZH 1EX0A 4JM4H 1H15B 1MWAL 3E6HB 5MEOB 5IM7B 2Q6WA 1ACZA 4G3YL 1OTTC 1FNGA 1O0VA 4K7PH 1A7BA 1J8KA 2OJZH 1R5WA 3FO9B 3QQ9C 4GS7C 2EDTA 4JPWL 1FNEA 1DUZA 3O45B 5GSRB 1S7SA 1CE6A 5GSVB 2VDQH 4HJGB 4PRID 4YHKH 3AB0C 3I3DA 4RAVB 5I66B 1OOAA 4NJAH 3WIHA 1XF3B 4QXGL 4EI5C 2XN9B 1NCWH 1E4KC 5DQ9B 2CJUL 1FL5B 1V7ML 4DGVL 5A3ID 3BEVB 5DD5H 2X1PA 1XGPB 4OIAA 4IOIB 3GMQB 1A0QL 5D7SL 1QLFB 2DQIL 3QJFA 1CL7H 5CGYD 4GXVL 5F3BA 1NCAH 4ONGH 4XCNB 3VFOB 4FABH 5I1HH 4HX1B 2JCCF 2CDFB 5IESH 4QHUB 3H7LA 2VSCA 4P2QB 4HUVB 1JGLL 4RGMB 2AJSH 3HRZA 2IAMC 5E99H 4EOWH 4PY8J 2A73B 1FORL 1T04B 2FJFA 5FYKH 4MLIA 1KJVB 2APXA 4JJHA 1FYTB 4YK4C 3WLWD 1WAAA 2O26U 4G6FD 4NN5B 4PV8A 5C6TH 5EULV 5JW5A 4OZFB 3WJLC 3MLSH 5DEGB 1MCDA 5F6HJ 5EU3B 3ZHDA 5HBBA 5J0BA 3MJ6A 5KVFH 3AU1A 1G7HA 3CU1A 3EHBC 5CJOL 3OKEB 3OXSB 5TE4H 4DAGH 3V6OA 1T80A 4M9OA 3WL9B 1MCOL 5C0DA 4FMKA 1ZVSA 4JPVL 4QLRA 3UTSA 1IKNC 3Q48A 5JNYB 4E41E 1UQSA 1DBML 2OS7A 1U36A 4K71B 3MZTA 4B53A 1MCWM 1X7QB 4LKXB 4K8RL 3PWPE 4FG6C 3JV4B 4NNPH 1FIGL 1MF2L 4RGOL 1L0XA 3ZMRA 4R2GB 1HHKA 2WZPD 3OG4B 1KPVB 5EPMB 2N7AA 1LE5A 1A1NB 4PBWD 3HI1B 3MRIB 4KHTH 4D2NA 2CRMA 3VFUB 4Z7OF 1EZVY 5FA4B 2EEBA 4G7VL 4FOMA 3KYKL 3U4EB 4W6YB 1CG9B 4H26A 1MVFA 2P8LB 2A6DB 3WDJA 3QWQB 5HYSB 4R96A 4XBEL 3K2UL 5CJQH 1KIQB 4I48A 3S35L 1MFCL 3QUMA 1L6XA 5EU7C 2CK0L 3O8XA 5I15L 5B3NA 3IS1X 1O7SA 1EUUA 2LU4A 4HIJA 4QTIL 1BFVH 3ARQA 4YPGA 1FL6B 1XGUB 2GJ6D 2FL5B 3NFSL 1AQKH 4HPOL 1UKSA 3VGGA 3QDGA 3FHQA 1RZGB 1OGAD 3NH7H 4L1HA 3MOAH 2AJZB 3FB5A 2BSRB 4K9EL 2FHCA 2ARJQ 2PXYB 3JBG7 1U95B 3HUJF 3BKMH 3P4OA 4LSSL 2AV1A 4PJHB 4LGRB 4HKXA 5CBAB 1QBLH 1JNJA 3H6JA 1IEAB 3SJVE 4XX1E 4Y2DD 3MRJA 1HEZA 3LQAL 2LTQC 3FQNA 3IXTA 5F9DC 2AXGA 4GW4B 4Y16B 3FZUC 4KUZL 4BFEA 4Z5RA 3PWVB 3K8LA 1MWAH 1FGNL 2EXWC 4S10A 4BH7B 1QOKA 3I3EA 5HDBE 4Y5XA 4RAUA 2X1QA 4RGND 3IDGA 5GGUB 2Y07H 1KXQE 4P5MA 3CDGB 2YPKB 1HCFX 4Y4FA 2DAVA 3WS6A 4PG2C 2NY4D 5JQ6L 3MV9A 4B5EA 1Q0XL 3VXMA 2LU3A 2NW2B 3VXTB 3QG7L 4HEPG 4QXGH 3STBA 3VWKB 4LLVA 4B7LA 1YEFL 2R15A 4GAGL 3VFMA 5DSCA 1OAXL 1V7MH 3B9KA 3O3DA 1HH6A 3WO3B 3SO3C 1MLCB 1JRHI 5EORH 5ESQA 3NABL 1BZ7A 5D7SH 2DQIH 4IJ3B 2HT4D 1FNLA 4GXVH 5J1AB 2J5LB 4H1LA 4GBXB 3FFCD 3QUXC 4F80A 1JGLH 4P5TD 1A2YB 1FORH 5EH1A 3S98A 4EDXB 1A4KA 1P4IH 1JWUA 2ZOKB 3QAZB 3SHSA 2DIJA 2VXSH 2XFXB 1P1ZA 4P4KD 5I1LB 2WBJD 2R69H 1MIML 2ZUVA 2NXYC 5F7DA 5B4MC 5HI5D 5CJOH 5FEBA 2Q8BH 4DTGL 4HUUB 5JO5A 1MCOH 2WW8A 2XQBH 4H5SA 2V5RA 1VPOH 4HIIA 3KPLB 1IEBB 3I75B 4JPVH 2O5YL 1U8PA 3MODL 3LN4B 3TM6A 2Q76A 1B4JH 4C4KO 4L4TB 1WZMA 3P77B 1V8HA 5GRXG 4XZUA 3NA9H 4FQQB 5C0CE 4PP1D 5H2BB 3U2SA 3QXAA 4O51B 1YYLH 2DMKA 5EFIB 2CK2A 4K8RH 1CFSB 5EO1B 3SCMC 3U83A 4KK8C 3JSSA 1MF2H 4RGOH 1FFNA 4M43L 1MREL 3QDMA 4GRWE 1ZA6B 4BSVB 3MRPA 3FKUS 2A0LD 4R4NC 4JFFD 1ZT4B 2AEWA 1WV7T 1F6AB 4LAJH 1HQRB 4TUOB 2Y7QB 1MVUA 2YC1A 4G7VH 3G5XB 5DQDH 1JZ8A 3GB7A 4P5KB 1ZA3B 5F1NA 5HDQL 5IW1B 4PLOB 3MBXH 4CMMA 1UFUA 2D7MA 2WWKO 4NT6A 4MD0A 3GHEH 1V7NL 2F53E 4WV1C 1MFCH 3VGAC 2E3VA 2EXYD 2LABA 4DCQB 2A74B 2CK0H 3UMTA 5I15H 1I3GL 3T4YB 2VL4A 1DBJL 4P46A 3LQZB 5DGRA 3C5SB 3PDGA 1QSEB 3NFSH 5D1XC 1CD1A 3A0OA 35C8L 3GSVB 2ADIA 3BDBA 3BPNC 4MJID 3MGOA 4EQ2A 2I07A 1ONQB 3FB6B 4LSSH 3ULUL 4F9LC 1KJ3L 3HG1D 1RHHB 2BNRB 3KYOB 2AKRB 1CLYH 1CF8L 5F70A 2MOVA 2DQFA 5E8PA 3QUYB 1YNLH 3G08A 5K9OB 3NZHH 5BMFL 1FGNH 1KIRB 5FUZH 4POYA 3TH2T 2QTEA 4R3SB 3VXUA 3WNOA 1D5XB 1KYOJ 4HDIA 4JFHE 5E6IA 2VDKL 4HFUL 3TO4C 5A2IH 4PRBB 1I9JL 2VN7A 2WP3O 4MAYA 4ZAKA 1LEKB 5TGBB 3ZTJH 4MSWA 3GSXA 1NGYA 3DX6A 3ZKMD 5JQ6H 4XNQA 3T77A 1Q0XH 1PFCA 2GY5A 2RB8A 2ZSVA 3QG7H 3HI5L 1NFIB 2BY1A 2K3TA 4GAGH 2DL2A 1OAXH 4PJGA 1I1FB 1KB5H 3L3DB 3TF7C 4KTEL 3VCLA 2QQQA 3MA7A 4EN3A 4KY1L 5GS0L 3BRDA 2GSGB 5HYQB 1UACL 1TJGL 3QFJA 3A6OA 4P2CG 3S37L 5KZCB 2VZ1A 1ACYH 1X9QA 4UU9B 4OLXL 3MLWL 2E6JA 3O6KH 2EC8A 3FQXA 3INUL 3AMKA 4NOFA 3AM8C 5IVZB 3ZE1F 4P23C 5SWQA 2B7DT 2EIDA 1Z2KA 2D4FA 4KVNL 4GMTH 3VFSA 5FECA 4NKMA 1S7WB 3HC0B 5D7JA 1A7PL 1INQB 2K9UA 1BF2A 1MIMH 5A43C 2G5BA 4NGHH 4ZMAT 1JF1B 2HTLD 3FONA 4PY7A 4P4RB 4RAHA 5GRWA 4DTGH 4EKXA 3QJHB 2VDPL 1UGNA 3H0TA 5D2LE 1AKJA 2NTSP 2Z91A 4KJWD 4HG4J 3O2DL 3WFEH 4MB4A 5C08B 4LMQI 4GQ9H 3RNQA 3T0EB 4X0KB 3MMEA 1WT5A 4OZGA 3TH3T 5I8OL 1LQSR 3LS4H 2AVGA 4NIKB 4M7KL 1KCUL 3PDOA 2WWKT 4M43H 1N2RA 3V5HA 3HPJB 1H15A 1L7IH 3E6HA 4ACPA 3ZYZA 4PJ7F 2QR0B 5MEOA 5F96H 1MCPL 5IM7A 2MQ3A 1YNKL 5T1DL 3HMXL 3QCUH 4HLZG 4U2YA 3TLRA 1HCVA 3T0BA 4YX2H 3FCTB 4W68A 4XAKE 4BA8A 5HDQH 3FO9A 3WNMA 1KCRL 3O45A 5GSRA 5GSVA 1ZLUH 3KG5A 5IHZB 4HJGA 4P3DB 4RAVA 4U1SB 2B1HH 5EIIB 5I66A 1V7NH 4NZTL 4LSVL 1XF3A 2HG5B 5HYIA 4U6VL 2XN9A 1DBJH 1RK0B 5DQ9A 1FL5A 4YUEL 1AC0A 2VXUH 3BEVA 4GMSL 4QGYA 2DI7A 5IP4A 1XGPA 2XRAL 4W6XB 4WI6A 3VXRE 4IOIA 2X9YA 35C8H 1WAAE 3VFRB 4AQOA 2LQRA 3GMQA 3QXTA 3EAKA 1QLFA 3VWJD 4V2CB 4Q9BA 4XCNA 3VFOA 1JN6B 2WP3T 4HX1A 2CDFA 3ULUH 4QHUA 2J8UE 2Z92B 4HUVA 4P2QA 4FN0A 4M03A 1RPQA 1H0DB 5C07D 1X6NA 2Z8SA 4LARH 2A73A 8FABA 1T04A 3MACL 1CK0L 1UB6B 1KJVA 1FYTA 4LCCA 5BMFH 1IAKB 3N06B 1IVLA 4BUHA 3NIGF 2NX5D 4OZFA 4JRXB 5DEGA 1NFKA 5K9QI 4HBCH 2AABL 3QI9A 5EU3A 4K7PY 3T04D 3VGFA 2VDKH 2WUCL 5TE6L 5GGVH 1X5XA 3T0WA 3UJTL 1I9JH 5FUCE 4XCYB 5C71A 2E9WA 4RNRB 3OKEA 3OXSA 4OLVL 1MJUL 2NZIA 4PGBB 4W70A 4G9FB 3WL9A 1V3MA 3HE7B 5F7EH 4PJAE 4PRHB 2AP2A 3BDXA 5JNYA 5EZLB 3S9DB 1JZ3A 4P9HL 3AAZB 1KN4L 5DRXB 1QFWI 1X7QA 3ULVE 4KTEH 4GG6E 5EB9A 3JV4A 4RDQF 3VXNB 1EEYB 1H8SA 5D6DC 1UACH 1KPVA 5EPMA 1A1NA 2P43B 1IT9L 3EOYG 3HI1A 3MRIA 1MAML 4YHMH 4IRJB 5EZOL 1CDCA 4O58H 3VFUA 1S9KC 1OW0A 4GXUN 5FA4A 4MNQB 3FN3A 3QG6B 3U4EA 3ARGB 1CG9A 3TYFB 2P8LA 1M05B 3GKWL 2A6DA 5IMKB 4KVNH 5HYSA 4WI9A 1F4HA 4OF8A 1KIQA 3MPCA 4PJ9A 1A7PH 5CILL 1K85A 5T3ZH 4EZMA 5I73B 3VXPB 3R4DA 1J8HB 1I1YB 5AYQA 1J0ZA 4XP1L 2ZJSL 5C0AD 2DQCH 1YQ2A 12E8L 2YOCA 4YBLC 1Q0YL 1FL6A 1XGUA 4J4PA 4UBDD 2FL5A 2JJUA 2VDPH 1BWMA 5HHMB 3BJ91 1OL0A 4WWKD 1RZGA 4PJEF 1EERB 3E1F1 2J8HA 3RIFF 2AJZA 2W92A 4N0YL 1NANH 2BSRA 2EDXA 4L8SC 2PXYA 1U95A 3T0XA 4NWUL 5CBAA 4PJHA 2QLVB 5K9JL 1IEAA 5I8OH 1BFTA 5F9OL 1QNZL 4Y4HD 1T7WA 4GW4A 1DR9A 2C3VB 4M7KH 4WEBL 4Y16A 1KCUH 5CHNB 5FUCC 3PWVA 2OMBA 1RZ8B 3LEYL 1X5GA 1WEJH 4LF3B 3QEQE 1MCPH 4BH7A 1YNKH 1V3JA 5T1DH 3HMXH 3UTQB 1JPST 5D7LE 4D9LL 5GGUA 3CDGA 3P2TA 2YPKA 1A9BB 3DTXB 3DX7B 1IAII 5HGDB 4TSAL 5JIHA 4TSBL 3TYGL 5DVMA 3ULVC 5FO8B 2VZOA 2EH7L 2NW2A 2JCCB 1ZT1B 4NZTH 4YGAB 1EDQA 3UPRB 4LSVH 3VXTA 5HHVL 2ICWB 3VWKA 5DEZA 5MEQB 4KMLB 1J87A 1X4YA 3O6FB 4OGAC 5JHLL 2Q86B 1TIUA 4Q7DA 2XRAH 2O93L 1MLCA 3L3OB 4Z18A 3D39B 5BO1L 4DWHA 2Z93B 2AW2A 3RWHB 4Y8AA 5EO0B 5J1AA 4GBXA 3GO1H 4G6AC 2NY7L 1BD2B 5IIEB 4LPCA 4BK5A 2YD6A 2EDEA 3KNBB 3K1DA 4J7RA 3VFVB 2PTVA 1A2YA 4EDXA 3KPRD 3MACH 1CK0H 2V2WB 3HAEB 4HAFA 4X80H 4Y7MA 4XCFL 1S5HB 4C56D 2WWMD 2XFXA 2V5TA 2VXTL 4IMKC 3S8WA 3VFNB 2AABH 5I1LA 1GC1L 1FO0B 1I1AB 2WUCH 5TE6H 3SKMB 4FP8L 4HWZB 2JJWA 3UJTH 1B3JA 1XIWC 4FQXD 1MJUH 4OLVH 4HUUA 3H9HB 4X7CC 3QDME 4HMDA 3KPLA 1IEBA 3I75A 3MCG1 3TBSB 3RVVD 3VGBA 3SQBA 1VADB 4L4TA 4NFCA 3GGWB 2RIKA 3P77A 4PBVC 4FQQA 4P57B 2WK2A 1SEQH 4XPAL 5H2BA 4P9HH 4O51A 4JLRB 1KN4H 5EFIA 3RZWA 2YWYA 5EO1A 2FX8L 2EDJA 2DKSA 1ZA6A 4YQXL 3S97C 4BSVA 2XOTA 3EJYD 4AEIL 1Q72L 3VGHA 5JOPE 5D96B 1ZT4A 4MB3A 4M4RA 1F6AA 1HQRA 3FMGL 4TUOA 4GRLB 2RJMA 3BI9X 4IOSD 2Y7QA 3BWAB 1CWVA 3G5XA 3JV5A 3QZWG 4P5KA 1ZA3A 4XCCL 2HLFC 5IBUG 5IW1A 3L3IB 3QHFH 1NANI 3NOIA 2PYEE 3BH8B 2VL5B 3N1QC 2JE8A 5SV4A 4MA7L 25C8L 4AY0A 3HUJB 1LVEA 1U93B 4OZHF 5CILH 2VO5A 3Q6GH 4YXHL 3DRTB 2XWJB 3BQUC 4DCQA 2OTUB 2A74A 1LDPH 2J4WH 2ZJSH 3T4YA 2RFXB 4UV4L 3RDTC 1B9ZA 5GS0D 3LQZA 1Q0YH 2B2XH 3C5SA 1J5OH 1QSEA 4X6CF 1U6AL 3GSVA 1YC8A 1ONQA 3FB6A 1JNLL 4I0PC 5I18H 5DHYB 4NWUH 3DETC 4OKVB 3QXWA 4XX1G 1RHHA 1WICA 5F9OH 4Z8FH 1QNZH 2BNRA 3KYOA 2AKRA 3QDJD 2R2HB 5GGTA 3QUYA 2AJYH 5K9OA 5CEZE 2KUTA 4QWWC 5DHVB 4HWUA 1B2WH 3LEYH 1KIRA 1UJ3B 4R3SA 1DP0A 1U3HD 2R0WL 5CINH 5T1LB 1D5XA 5TQ0H 3GJEB 4W4OA 5KSAB 3Q1SL 4PRBA 2W65B 1MI5D 5TGBA 1LEKA 5J3HC 4JKMA 3HE6D 1UH4A 3TVMC 4L29B 5LJYH 3GJFB 4TSBH 5F1IA 3TYGH 3QFJE 5F8RC 5FM8A 1EHLL 2EH7H 4EUPG 3GMRB 1CU4L 3WV0A 3DYOA 3WKMH 3ZT7A 1R24B 1NFIA 5FO7B 1I1FA 3L3DA 4X7EC 4FZEL 3JVGA 4YNYB 5JHLH 2VJXA 1LK2B 4HSQA 3U79A 2GSGA 5HYQA 3ULUF 1EO7A 1DQTA 2DICA 5BO1H 4XRCB 1NAMB 4WY7L 5E2UL 2ADFH 2X2YA 3EOAB 4UU9A 2WQRA 1C16B 2NY7H 2VISB 4TTDC 1XF1A 2XNAB 5IVZA 2PTUA 2R4SH 3O41B 4JFED 4KMTH 4Y89A 3TT3L 3UBXG 4XCFH 5IVXF 1A47A 2BVOB 4ESKA 1MEXH 1S7WA 3HC0A 5T3XD 1INQA 4KROC 3OTTA 2GJ6B 2VAAB 5J13B 1VACB 3FQUB 1JF1A 2EEAA 1G7MB 4FP8H 2OJEB 4P4RA 4IDLA 5LBSH 4JY6B 3HNSH 1IGJB 5GS2D 3C5ZB 2QSCL 1W72B 1SBBA 1T22B 4LIQE 1SM3H 5D2NB 5C08A 3D1MC 1MAJA 4RQQB 2I9LB 5L2KD 3T0EA 2D3VA 4X0KA 3WHE0 2YSSB 3LSOB 4XPAH 3ARDD 5IMLB 2DKMA 5BZWB 3FRPA 1NCDH 1MCLA 2FX8H 1CFVH 3JUYA 1YUHB 4UTAL 3HPJA 4YQXH 1AIFB 3SDXE 5KVDL 1CICD 1AO7B 1Q72H 2K7QA 2IGFL 2QR0A 4RGNB 4D9QD 1HWHB 3CFIC 2JJTC 4OCYL 3O3AB 1ZAGA 4YC2B 3FMGH 1KCLA 3BKJH 3FCTA 1RIHL 4KUCD 4MZ3A 4KI1A 2EC9U 4JKKA 3RZCB 1S9WB 1H3GA 2VKXA 5IHZA 4P3DA 25C8H 4Z7WF 4U1SA 2F74B 1FCCA 2FBOJ 2GHWB 3AS0A 4F8TA 2HG5A 1CDJA 3OKDB 4LVEA 5SWSA 5IHBA 2F5BL 4HKBB 4S2SA 1RK0A 4UV4H 4LGPB 4NN6B 5IG7B 3D69B 1CDIA 4PGZA 3VXQB 1U6AH 4PYGA 3VFRA 4MCYB 1DUYB 3EDDA 1IGCL 4P5TB 2I60L 3MRMB 3KYMB 1JN6A 3WFHB 1ZS8B 2Z92A 1H0DA 4Q6YA 2VLLB 4RMVA 3ABZA 4O2FB 2WLZA 5JXED 1UB6A 4XBGB 4LSTL 2WBJB 1HE7A 4NWTL 1IAKA 1G0XA 2VAJA 4AIXA 4UDUB 4JRXA 3T0DA 3EOTH 3ZTNL 3MOBH 2R0WH 3EDFA 3LS5H 4NKIL 5LWYL 5I30L 3J7HA 4NM4H 5EIQA 3U4AA 1F58L 4XCYA 4RNRA 3HB3C 4PGBA 4G9FA 1C5CL 5DJZB 2PKDA 4XPBL 1LNUB 3HE7A 1U3ZA 2UZYB 4PRHA 5GRYA 4E9LA 4NKQB 5FCUL 2VLKE 1J1OH 3BKYH 3TJHC 1E27B 5EZLA 3WO4C 4ZPTB 3P3YA 3QUZB 2B0SH 3DHJA 3AAZA 1YJDC 5DRXA 3ARED 3HTLX 4JFFB 3VXNA 4IM8A 1VEMA 1EEYA 1KIUA 3EJZD 4AMKH 2DQTL 1QACA 5ICXB 1U42A 4ELMF 3MOQA 1PGRB 3M8OL 4PJBE 2DDQH 5GGQL 4IRJA 4MGXA 4J3UA 1HSBB 5E2UH 2M1KA 4S1SL 3ULSB 4MNQA 1BM3L 6CGTA 2CKBH 5FYJE 3QG6A 3ARGA 4CDHA 1CTOA 5ELIA 1SY6L 2WNGA 3TYFA 1M05A 5IMKA 3TT3H 3RIFK 1CFNB 2DLIA 1DQJB 3FB8B 4L5FL 1F3RB 3IDXL 4LMQE 5GGVY 3VXPA 5HXMA 1J8HA 1I1YA 4ZNEE 3ESUF 5B38B 3SGEI 2CH8A 1IZJA 4JVPA 2Y36H 4EXKA 4MJIB 5D71H 4K3EL 5IWLA 1D6VL 4PJ7B 1P69B 1HINH 4X98B 4UZGA 4PJ8D 1FSKC 3WLBB 2QSCH 3HG1B 4XVTL 1A3RL 2RQ8A 3GMMB 4XVJL 4M62H 4K94L 3KXFE 2HWZH 1NEZG 4I1NB 3PGDB 1OQOA 2OXHA 1FAKT 1I75A 1WUNT 2DLFL 3D85D 3QRFM 4NN7B 1F13A 4NFBA 1LK3L 2C3VA 3BP5B 1U91A 5CHNA 4UTAH 1FBIL 4I3RL 4JM2D 1RZ8A 5D7KD 2IGFH 2Q7YB 4LF3A 1UVQB 5C09E 3S4SB 2GI7A 3PL6C 1CLZH 4JZOB 2KDGA 3UTQA 1YEJL 3UJJL 1S9YB 1A9BA 2EKJA 3DTXA 3DX7A 5HGDA 2FCBA 2UZIL 3OAZH 4JG1L 4KI5D 4OGXL 4U49A 5FO8A 2D03L 1ZT1A 2JCCA 3NPSB 3UPRA 3TIEB 2ICWA 4KGJA 4WO4C 4PRPE 5H37H 1MWAB 1P84J 5E2TL 5E4IA 2CLVB 2FJHB 4Y4KD 2I9TB 2B1AL 1DFBL 4MS8C 4AG4L 5CEXB 5GZND 5MEQA 2OL3H 1NGPL 3O6FA 2Q86A 5JZ7C 1FN4B 2IADB 4G8EB 1YN7B 4MDIB 3L3OA 4Z7UF 4OI7A 1BZ9B 2BSTB 3EYQD 3D39A 2EEDA 1ZHBB 3QWOB 4F33B 1H3PL 2Z93A 1JNHB 5SX4H 1IGCH 3RWHA 1E4JA 5EO0A 3BP4B 2DS4A 1WFUA 1BD2A 5IIEA 3SE4C 3P73B 3KNBA 4H8WC 4WTZA 3VFVA 4JAMB 3D87B 3RIAF 3ZT6A 2V2WA 2UZXB 2P1YA 3BAEL 3HAEA 4G6MH 4NWTH 1S5HA 1CDGA 4FFVD 3BW9B 3ZTNH 3VFNA 5LWYH 4NKIH 1E4XI 4L4VD 4XAWL 3RL1B 5I30H 5JDJA 1LO0L 1FO0A 1I1AA 5E9DE 3SKMA 2BERA 4GAJH 4XNUH 4HWZA 1F58H 1D5IL 3NIDE 1NMCB 5I1AB 5ANMB 2YD8A 4I4WB 4XPBH 4JPKH 4MAUL 3X11B 3TBSA 4YWGH 4JRYE 4JZNB 5FCUH 5E1AB 5I19L 1VADA 2FYYA 3GGWA 4KRNA 4P57A 3WIHL 3ILPB 1H9VA 4JLRA 1IGIL 4CVXB 1FG9C 3CJJA 2F54D 3O4OC 5B21A 2DQTH 3Q0HA 5HVHC 4KRPC 2NW3B 2B20A 3RTQC 3TV3H 4JO4L 3ZDYF 3ME0A 4RX4D 4WIQA 5J7CC 1EFXB 4GRLA 4S1SH 3BWAA 4H20L 5JXAH 1A7OH 3WXWH 4N0CD 2QKIB 2X4OB 1QSEE 3O3EB 3L3IA 4JM2F 3ZDZE 4PJEB 2WAHA 2ZNXA 3BH8A 2VL5A 3DXAD 5B3JF 5HI3D 2FO4B 3HUJA 1U93A 1YEIL 4NHCH 3BD3A 3IDXH 2V17L 1HZHH 3DRTA 2XWJA 4R97C 2HT2C 2OTUA 4F3FB 3ZKQD 3VI4E 1WSST 2BDNL 4G6KL 2RFXA 5IR1B 2BNRE 4KI5F 2QADB 4K3EH 1D6VH 3IGAA 5KJRL 1HHJB 1LO3H 3RGVD 1A3RH 1T03L 1F5WA 5C07B 4XVJH 3AS2A 3V4PL 2Q8AL 1DBAH 3PNWB 4K94H 5DHYA 1JFQH 3ARFB 3RGHA 3W0WE 6FABL 5JOEA 1ZLUK 5DRNB 2DLFH 1I8LC 4OKVA 1LK3H 5IROA 3D3VE 3OKLB 2R2HA 4YHLL 3P40A 4WHTB 1CIUA 1JYNA 4Z0XB 3N1MC 4DOHB 1CD8A 1FBIH 1FH5H 3GM8A 1BQLL 5DHVA 1UJ3A 3OZ9H 4PJCE 1OM3L 5T1LA 2Y5TB 3PUCA 3MNWB 3GJEA 1BMGA 4JFOB 5KSAA 2NY3C 2W65A 3QXVA 1F8TL 4HC1H 4KQ3L 5J1TC 4OUUB 2NPLX 3T2PA 3QIBC 4AJ0A 4L29A 1BJ1J 5IB4B 3GJFA 2UZIH 4JG1H 1DQDH 5FYLH 3RVUC 1UM6L 1FVCB 1CVSC 2O5ZH 1DVFC 4C83B 1IGML 1KTKE 5E2TH 3L5JA 1R24A 3QUML 2B1AH 1DFBH 4AG4H 5FO7A 3IU4L 3MJ9L 1NGPH 4HIXL 1AHWC 1Z9OA 1QTYT 4YNYA 1MCJA 1LK2A 1T83A 3L1OH 2N7BA 4YDVB 3A6BH 1N64L 5HSFA 1FFOB 2R8SH 4ZO8A 4JCMA 4NO2B 4XRCA 1NAMA 5HGBB 2QL1A 4NC1E 3EOAA 3VJ6B 2VTFA 3OKMB 1C16A 2VISA 3UTTD 4RFNB 1I7ZB 2XNAA 2X44D 1ZE3C 3O41A 5SWZD 3NZ8B 3O9WB 4X99B 2X1WL 4AYFA 3ZDXF 5FYKU 2BVOA 2WSKA 1WQVT 2CGRL 5CP3A 4X7FC 5C08E 4CMHC 5HYJD 3B6SB 3GIZL 2VAAA 1LO0H 1QP1A 1VACA 1DQLL 3FQUA 3OAYH 1G7MA 3MFGB 4WWKB 2OJEA 1D5IH 1IILE 3P4LA 4MJ5B 1KJ2H 4JY6A 3RRQA 3KYAA 1IGJA 3C5ZA 1U8KB 1W72A 2ITDB 1T22A 4JO3L 1RI8A 5D2NA 5EU6D 2D9CA 4ZFOL 4RQQA 2I9LA 3N9GH 2EYRB 4J3TA 2YSSA 3LSOA 4APQC 1N7MH 1KTDB 3K81A 5IMLA 5BZWA 3UP1A 2VKWA 4N5ED 4UIMB 3TO2B 5MP6L 2Z4QB 5DFWH 3KPTA 4YAQB 1AIFA 4OZHB 1NCBH 1AO7A 1AY1L 4JO4H 2AJUL 5BVPL 1OP5H 3O3AA 2FEEL 4LRNL 2X4NB 4H20H 5HI4C 3BD4A 2X89A 4WGWB 3P4NB 2XACC 4X6CB 5FGCB 5GS3A 1WK0A 4DVBB 5I74B 2YXFA 3RZCA 1S9WA 1QO3B 3ARBB 4KJQC 2F74A 3Q5OA 4PS4L 3ZE0E 3QNYB 3RWEB 3OKDA 5KN5B 1Q9OB 1DLHB 2BDNH 4HKBA 1RD6A 4NC1C 5IG7A 3D69A 1XGRA 4RFEB 3VXQA 4Z7QE 4LFHD 1IC1A 1NUFA 4MCYA 1DUYA 1PW3A 1I3UA 1YEHL 4R4BB 4P5TA 3MRMA 3KYMA 3WFHA 2IALB 5K59F 1ZS8A 2VC2L 3U30B 2VLLA 3SDAC 4O2FA 5F8QC 4C56B 2Q1EA 3DWTA 2AEPL 4OM1L 4YHLH 3SBWA 4XBGA 3VH8B 2WBJA 4YO0B 4KRMB 1BQLH 2FRGP 1CLCA 4UDUA 5DRZB 1OM3H 4BZYA 3GSNL 2MJWA 1F8TH 4P59H 1MCCA 15C8L 1EHNA 5DJZA 1A6UL 1LNUA 2NY1D 5GGSB 4X6BB 2VE6B 3SDDD 1UM6H 2DF3A 1NGQH 4OGZA 2W1NA 1J0KA 4JR9L 2X42A 2DQJL 1E27A 3IDYC 1IGMH 2VITB 4ZPTA 4TULL 3QUZA 4OZIE 3TZVC 3IU4H 2QQNL 3MJ9H 4NQCD 3EGSB 4JFFA 5IVXB 2DQDH 2A9NL 2ERJB 5ICXA 4Z77B 4J3WA 4F9PA 5HY9B 4P48A 1HSBA 4QRPD 5FV2A 5EU5B 4XPFL 3ULSA 3W82A 5B22A 3BE1L 5HHME 4JJ5A 1CFNA 4OD3L 1DQJA 3FB8A 3VFGL 4XXCC 2CGRH 2BRQA 1X5ZA 3BIBX 5IFHL 4Z78B 3G9VA 4RBPH 2UYLB 4F15B 5HTSA 3GIZH 4GOSA 2EIZB 3GSRB 2H45A 1A3QA 1DQLH 4J23A 5B38A 3LDBC 2DJUA 4MJIA 2XA3A 1OPGH 5L2JB 5FM5O 1F4YL 4LOUC 1HYSD 5DC4B 4R0LC 3S5LB 4PRNB 4X98A 4YHPA 2XZCH 3WLBA 3HG1A 2VRAA 3GMMA 3QDJB 4G7YL 3PGDA 1F4AA 1I8KB 4FFWD 1WVZA 3Q3GB 1IZKA 3VMNA 5HGAB 4KU1A 5MP6H 1IARB 1MCEA 3BP5A 4Z7WB 1S8DB 3MGTB 3TPUB 1AY1H 3P9WB 2Q7YA 1MI5B 2AJUH 5BVPH 1UVQA 2ESVD 2PW1B 3S4SA 4JFQB 3HE6B 1JE6A 4LRNH 4JZOA 3IF1B 1KEML 2FATL 3ORJA 5DFVC 5M7QA 2NY6C 1RZ7L 4OTXL 3DMMB 4A2MA 1PAMA 1S9YA 1CBVL 3C60B 2HH0L 2VLME 1OARL 3OJ2C 3WUWB 2Y5EA 4ZXBD 5AZ2H 4PS4H 3TIEA 5D1ZC 1ADQL 1MWAA 3NCFB 1AGBB 2CLVA 2FJHA 4FQJL 2I9TA 1OTSC 3RIAK 5CEXA 2PO6D 3D48R 3VRLE 1PLGL 5DJ8B 1MSPA 1FN4A 2YK1L 4QO1A 1M7XA 2IADA 1YN7A 4G8EA 4MDIA 1NGWB 5LKNA 3KVQA 1BZ9A 2BSTA 3HN3A 3NA4A 5E56A 5EBGA 1ZHBA 5EOQL 3QWOA 3WFCH 1JTTA 3G5YB 4F33A 1JNHA 1MCIA 1YEHH 4MA8L 1YY9D 3BP4A 3L9RB 3H9SD 4JFEB 3P73A 5KVEH 1OHQA 4WFGD 2ID5A 1RUML 4HMCA 5D7IF 3IXAA 3IFOB 4N1CA 5CSGA 1UT9A 2H2PC 2AEPH 4CVWA 1FC2D 1SYSB 3QIWD 5I0DA 4HGMA 3LKPB 2YA1A 3FQRB 3L3KB 3BW9A 2JTDA 3NVQA 3TBYB 1OSPH 2A6KB 3RL1A 4TUKH 4CVZB 1QD0A 2DB8A 4WFEE 4PJ5B 2NYYD 1NBYB 1ZANL 15C8H 5I1AA 1J0IA 3IDIB 1PY9A 5ANMA 1T4KB 1A6UH 2R9HC 4I4WA 5JW4M 4ELMB 4FQCL 1GVIA 3X11A 1BQHB 2IPUK 3ARDB 1HKLH 4JZNA 5E1AA 3V0AC 1JJUA 2DQJH 3ESVF 3CFCH 5ICYB 5EBLB 5A2LH 3LCYA 3ILPA 1UYWL 5KW9L 1IGFH 3MRCB 2QQNH 2ED7A 4PRIE 4CVXA 5JOFB 3BP7B 1CE1H 1TQCB 1KYOK 2A9NH 1GAFH 4U0RC 3VD9A 5HYSG 3PDDA 3OSKA 1KFAL 2NW3A 3GNMH 2DJSA 3CDFA 2BRRL 4LQ1A 3MJ7B 3TPKA 4UT7L 4PLJD 3QPQD 3W5MA 3AS1A 4NM8L 1EFXA 4XPFH 3C6SB 1CT8B 4JGJA 2QHLA 2QKIA 1OAUL 2OP4H 2X4OA 1YPZB 3O3EA 2ED9A 4PJEA 3L3JB 4OD3H 4YHOH 3P0VL 4TOYL 3EW3B 2P5EE 2FO4A 5IFHH 3OAUL 4F3FA 3O8XD 4EBQL 3KHOA 2HMIC 5L88L 4XWGL 5IR1A 3MGAA 4AZ8A 5GRVL 4YDKH 3CFKB 4MQXD 1KENL 2EDDA 1F4YH 3O3BB 1MJ7L 3QDGD 2VWEE 1HHJA 4NDMB 4KK9D 1HYRC 5C07A 3PNWA 3ARFA 1F90L 5DRNA 3V0WH 2VLJB 4ALAL 2VLRD 2ZPKL 1WC7B 1F97A 3OKLA 4GXUM 2ZWLT 2X70B 4WHTA 2R23B 4Z0XA 3BPOC 1U8LB 1YEEL 5GQBA 1GYAA 1GGCL 2NY0C 3QCTL 3HR5B 4HT1H 4NRZB 4FFZH 1I7UB 2Y5TA 4Z7VF 1KEMH 2FATH 3LD8C 4K07A 3RKPA 3MNWA 4B0MM 2C4FT 2XY1A 4JFOA 4OTXH 1ROWA 3D9AH 5E2WL 5C6WH 4OUUA 5CZXD 4HJ0C 3WJJA 4UT6L 4V1DB 1MCWW 1CBVH 4OCXL 5IB4A 1MELA 5TDOB 1OARH 5ADOH 3CSYB 3MV9D 3AXLB 1FVCA 3VXMD 5E6ZA 4C83A 1RJZB 1MHHB 5IVOA 1VFBB 3MV7B 1ADQH 4DN4L 3QIUD 5HD8D 4U1K