1P7KB

Crystal structure of an anti-ssdna antigen-binding fragment (fab) bound to 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (hepes)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
217
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain FAB
publication title Structure of an anti-DNA fab complexed with a non-DNA ligand provides insights into cross-reactivity and molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kB02
1J7VR 4JDTH 5IHBA 3VXMD 2UZYB 5ACLA 2N7BA 5C0JB 5JUEH 3F8UB 3UJJL 3VXMB 4H0GA 2B1AH 3G9AB 1T0MA 2HJLA 5FM4A 1R5VB 3U4BL 1WT5C 5I73C 4CDHA 4IRSC 4MNQB 2VB5A 4Y19D 4Z7UA 1U8HA 3WS3A 1I1CA 4MVBD 5I19L 1IL1B 3HCVA 4Y19B 1KF9B 4RDQG 4XHJD 4R7NA 2V7NB 3MRLB 5F7EH 3HI5L 1CXHA 3BQUA 4EI5A 5IQ7L 1OAQL 1CU4H 3W2DH 5BOZG 4LNRA 3QXVA 3MRJA 3ES6A 4Z5RA 3OGCB 5IW3A 5FYJH 4F9LA 4DGIH 1RZKL 5DJDA 1DBML 1FAKT 4YHPA 2A6IB 2PKDA 4X80H 3PWUB 2XV6B 4PJHA 2BC4A 1KYOK 3FRPG 1YY8A 5I75C 1A1NB 2EICA 1II4E 2X1OA 1U3JA 4G8IA 1RK0B 3MGTB 4NSKB 3VH8B 3G6JA 3ARWA 1WICA 4RNRB 3UJJH 3S34L 3AY4C 4NYLB 4LCWB 4I5BB 4J8RB 4ETQB 5D9SB 3WNKA 1CFTA 1I8IB 2GJ6E 3ROLB 5J11B 1INEL 4PJFB 5I19H 4DWHA 4PGDA 5C3TA 4E0RB 3HI5H 4LQ1A 3MJ7A 5CHNA 5IQ7H 5T1LA 4OFDA 3U7WL 3IETA 4N5UA 1U6AL 1R3JA 4L29A 1BQHG 1RZKH 1DBMH 3X3FL 1WITA 1Q72L 1M7DA 3TJEL 3FT3A 4RMQA 1OQXA 5KSUB 3NCBB 1D6EB 2Z91A 4WFFD 2J5LC 5C07A 2A2QT 3IJHA 5GSRA 3FFCD 2E8ZA 1X6NA 4JJHA 1JYNA 3FFCB 2C3VA 3S34H 4LP4A 1ZEAL 3C2AL 4MD5B 4P3CL 3VW3H 2P45B 4CU6A 3VJ6B 3DMMD 4RMWA 2HTKD 3IRZA 3FCTA 5HHME 3DMMB 2EDRA 3GM8A 3RVXC 3K3QA 3T65A 3DXAD 4DKFL 1F97A 5F7WC 5FCSH 4AG4L 4ZDHA 1ZLSL 1X6LA 1Q72H 2WWMC 4LGPB 4QTHB 4X6DB 5D8JL 5HDBE 3TJEH 1CI5A 1CT8B 1CGWA 2V17H 3V5DB 3KPRD 3OJVC 4OFVA 3PWJA 4EXKA 3KPRB 4U1LA 2OZ4H 2CLRA 1NDGA 3EW3B 4G6AC 3AMLA 4L4VA 5KSAC 4KK9C 3SDAD 1OF2B 3SDAB 5A3ID 3O4LE 1RUMH 1ZEAH 2QHRL 5A2FA 3SE4C 4AM0B 2MTPA 3C2AH 4APQA 4P3CH 2R1WA 3RWHB 1NFKA 3T08A 1YMHB 3T0EA 3MUGB 1GCFA 1S7SB 3D3VD 3TCLB 4CUCA 4J3OC 4AG4H 4PJEF 1ZLSH 15C8H 3D3VB 4OZ4B 3SPVA 1E6JL 2Z35B 5D8JH 3TT3L 4MJ5B 1JPFB 3ZHDA 4YGVA 3UDWC 1P9MC 4AEIL 3T0XA 1AD9B 1BQLL 3QH3B 1ND0A 3JTTA 1GZPA 3NOIA 1JP5A 2OTUA 3IJSA 2VZVA 3E8UL 5C70A 1A7OL 3BIAX 3I02B 1JHLL 5I1CH 4AENB 5H35B 1I4FA 1Z5LA 3MJ6A 4HZAA 1NCNA 3FQRB 3KXFA 3NCEB 4LQFH 3TIDB 1KGCE 3D39A 3TGXA 3ZYOA 1QVOB 3QZWB 5E8OB 5EZOL 1Q9LB 2GHWB 3EDJA 3QIUD 1E6JH 3EDKA 4XWOC 2FX8H 2Y6SC 3QEQA 2FSEB 3BH9B 3QIUB 4WI6A 4OLVH 3TT3H 5IB3A 3CDGA 5SWSB 4OLZL 5KBNC 2HLAA 5C0EB 5E8EA 2P43B 4P2YA 4AEIH 2NY6C 4WTZG 4IOIB 4X5WB 4RFNC 2YA0A 1J12A 2DTML 3BUTA 3E8UH 1FFNB 4YFLI 4YGAB 3WIFA 3WUWA 3TF7C 1JHLH 5ADPL 1FNSL 2YRPA 1M1SA 1JHTA 2EDNA 4F7EB 1FRGL 2YHGA 4HKXB 2YXFA 5HVFB 1UZ6E 1FZKA 1LEKA 3O41A 5A2LH 1JWSA 1F6LL 1IGCL 2XYCA 4OFYD 1AO7E 2AERT 4L3EA 5EZOH 3P11L 1K5NA 5KW9L 4Y5VC 4UINL 4OI8A 2QEJA 4JRYD 4CVUA 1U95B 4NC2B 5BQ7B 5D7JC 5CP3A 1V8HA 5DTFB 1U8IA 3DTXA 2PYEA 5I1DB 5DVMA 1KBGL 1XGQB 2DTMH 3K8LA 1KIQA 3L3IB 2LQRA 1JZ5A 4N0UB 3ROOB 2LU3A 5ADPH 4H26A 1FNSH 1AR1C 3BP4B 4LVOB 1FGVL 2APVA 4CL7A 2FO4B 5DQJA 2Z4QB 3IFOA 1PKOA 3FO9A 3QUMB 2QJDA 4G9FA 4I4WB 3V79C 3HNTL 3GSQA 1FCCA 3UZQA 4YHIA 2JLLA 3P11H 4Q2ZA 4U0RB 3CFDA 3L5JA 4DFIA 3V7AG 1TNNA 1ZAGA 3K1KC 4ZFZB 3UZVB 4UINH 1GC1H 5JQ6L 1BD2A 3GGWA 2NXYD 1SEBA 3R0NA 4PJDA 2HTLD 4ONGL 3OKOA 4ZXBA 1MWAL 2X4OB 4OCSL 3WUZA 1B0RA 2J6EH 1CN4A 3DV6B 5DURD 4NQCD 2R23B 1KBGH 5DURB 3CNKA 3GSXB 4PJGB 4NQCB 4JHWL 4JM2A 3VA6A 1B90A 2GEEA 1NC2A 3UXFA 4N5ED 4BJLA 1X4YA 5IKCB 4FN0A 1I1AA 5CGMA 1N0XH 1MVUA 4KMTL 3MACL 2ZUVA 3OR6A 1AD0B 1DSFL 3IKCB 1CS6A 1F6FB 3FQWB 1A4KA 1IAII 5GJTL 2Q7NA 3HNTH 1BZ9B 3GRWA 2RCSL 5FB8A 3OKDB 1FG9C 2ITDA 5DQ9B 2WQ8A 2VDKL 4ELMB 4PD4J 2VDLL 5DR5L 5JQ6H 4HMEA 4R4ND 2FRGP 1MWAH 4OCSH 5D5MF 3DX7A 4ZO9A 2VQ1A 5TQ2H 5F89B 1PZ5A 3UBXA 2EXWC 4JFFA 4JHWH 1MCOL 5D7KD 1G9MC 1YNTA 1IEAA 5C0AE 1GJIA 3NCYP 3O9WA 2HG5B 4NGHL 4G80A 4QT5A 1MI5D 4KMTH 1KTDA 4HJ0D 2XN9D 1MI5B 3MACH 1DSFH 5E99H 5FO7B 5GJTH 2VRAA 2C1PB 3Q48A 1T89A 4KQ4L 4DN3H 2GFBA 1QYGL 5ESQA 4YK4B 3ARGC 2VDKH 2OS7A 1XGUA 4MQXD 4LGSB 5DR5H 3DNKA 3CD4A 4MJ4A 4WWKC 1QFWI 1ZGLP 1T7YA 3HR6A 4QRQB 3F58L 5EZIL 4O51A 2QSVA 2FHBA 3CVHL 4NRXB 1EBPA 4L8SA 1BJ8A 3WDIA 4S0TD 1NKOA 1MCOH 4UT9L 1KLGB 1AQDB 1CDHA 4WUUE 1A9EA 1DUZA 4E41D 3RP1A 5IF0A 3SGEH 5IG7A 1QSED 4NGHH 1S78D 4E41B 1G7MB 4LF3A 1XF5B 3G5YB 4YAQB 1GGIH 1CVRA 1S9WB 1T1YA 5LGJA 1IEBB 2AP2A 1U8MA 1YYLL 3QFJD 4Y7MA 3WSQL 4KQ4H 3HC3L 3QFJB 3DLQR 1GVIA 5EOCL 1QYGH 3L3JB 4YDIL 4ONHA 3ZTJH 4WY7L 4EQ3A 5F93C 3C5SA 4O2EA 4EZMA 2KDGA 3F58H 4OF8A 3Q1SL 1IBGL 4HH8A 1Y0LA 3LQAC 3CVHH 3L3OA 3P9WB 3EDFA 3RWIB 1HIML 2CRZA 1OB1A 4PRNB 1PG7X 3C5JA 2AK4A 4YWGL 1KTLB 4XBGB 3CXHJ 2IBGA 1HNGA 3OKEB 4MNGE 2B0SL 4UQ2A 5KS9A 2ESVD 2CDFA 4QRRE 3FFDB 3W11D 3WSQH 4PBXA 1URLA 2ESVB 1BVKB 3HC3H 3IAGC 5EOCH 4IHOA 4HWUA 5BS0A 3NIFF 4YDIH 2XQBL 2YA2A 4WY7H 3EAKA 1RUAL 4OAWB 4X6BB 2DYPD 2EECA 4HGMA 2YD2A 4HJJL 3Q1SH 2DYPB 1EFQA 3KPNB 4OGXH 4NWUL 4CN6A 5BV7C 3V7AE 2JJUA 1TMCB 1V3LA 3T0BA 1XGPA 4LLVA 3KJ4C 4W6WB 3FT4B 1MJ7H 5TJWK 4LAJH 3W9EB 5GIRB 5DK0A 4H5SB 3TN0A 3QP3A 4YWGH 1OTUC 2CRYA 2F53A 3TESA 5CWSA 5IMKB 2DQGH 3OB8A 1L0XA 2X1WL 5GGQH 4Z7VE 3I84A 1NPUA 2B0SH 1EIBA 4Z7UF 5GRJL 3VGAC 3C6LD 5KSVB 1B4RA 2Y07H 2NZ9D 4BZ2L 1UA6L 5I1AB 2E7BA 4HIHB 1BFOB 2AK1H 1YEDB 4FFZL 2OM5A 4L3CB 4ZO8A 3O8XB 1G6RA 2H1PH 2Z92A 3PWPB 1RUAH 5ILTL 3U1SL 3GRWL 3QUXD 5EBLA 4JE4B 1UVQA 2A74B 4MA1C 4HUXB 5HHVL 1U91B 1Z0NA 3CX2A 4AYFA 5DS8A 5HPOA 4NWUH 3RWEA 4OQ1A 1KJVB 3RL1B 2JKXA 4UQ3B 5FM8A 4GUPB 5H37G 2DKSA 3ULVE 4UI2A 4YPGA 5E8NB 1ORSA 4J23A 1NAML 3BD3A 3GIVB 4Z7WA 4L4TA 5GGRB 5GRJH 2X4NA 4OBSA 3P9LB 3BPLB 5F1OB 3ZKQD 1BP3B 2ATPB 1UA6H 4WFHE 3RWFA 4BZ2H 4DZBB 3LY6A 2NY5C 3T77B 3ABZA 4FFZH 5HGBA 1FNAA 5DJ2A 3N1QC 3CFEB 3GBLA 2WNGA 4ZPTB 1MCRA 3U1SH 2CKBL 5D93C 3PWVA 3KPOA 5HHVH 4NQUA 2KH2B 1NFIB 1BBJB 2SEBB 1DLFL 2DICA 5EC2A 4Q9RL 3EYQD 4XTRD 4PJBE 5CEZE 4XXDB 5JORB 1X44A 4MQTB 3SGKA 4D9RD 4UT6L 2FX7L 2PW2A 3KYNB 1NAMH 3AAZA 4H1LG 1W72B 3OKLA 4EUPA 1H15B 3WJJA 4OV6F 3CPLB 3R8QA 4H25B 5EZLB 4KK6C 3RVWD 2CLVB 3KPSD 4OUOA 4OD2A 4B7IA 4L8BA 3T1FA 5C0BA 3FO1B 3KPSB 2P5EE 3ZDXF 2VN7A 3O3DA 4PJCA 1JGLL 1VDGA 2EKSB 2CKBH 1SJHA 2O5YH 3OX8B 1BGXL 1E4KA 1FVCB 5F7DB 1KT2A 1B6DA 4GRWB 5HVGB 3RU8L 5IESH 2P8MB 5CEYB 1MY7A 2R8SL 3RX8A 1FL6A 1DLFH 2FJFA 2IAND 2CXGA 2ED9A 5D1XD 3TH4T 3EKCA 4N68A 4WFGD 1ZHNA 5D1XB 3V5KB 2W65B 5TH2A 3LMJL 4UT6H 4CADA 3NCMA 2FX7H 4IBLT 3HUJF 1G1YA 1VCAA 5GGSB 1GRWA 3I6GB 5ICXB 2NPLX 5E94B 1EEYB 3MO1A 4CAGA 4MD4B 3P4MA 2BVQA 3QJFB 4KXZI 4N0FB 3TVMD 1RZIB 3MFFB 3TVMB 5J13C 2FEEL 4TTGA 5IJVB 3W5MA 1BGXH 2DTSA 5IWLC 4ISVA 2JIXA 3CZFB 3ZKMD 3RU8H 2AQ2A 1T66C 3BVNB 3VXUA 3TFKD 2R8SH 4P3WA 3GSNB 1TITA 5E0QA 5I30L 1M71A 3WNPA 1GGBL 4XNYL 4Y5XB 4Y4KD 2EIBA 3I3BA 5JPNB 1T3FA 3SCMC 1WEJL 4OCXL 1ZLWH 1RZ7L 1RZKC 1ZLUK 5CD3B 2A6JA 2FH6A 4ZUSA 5IMOB 1BWMA 1YA5A 4OV5B 3QCVH 4BSWB 4F80A 2J2ZA 1IC7L 2ZUSA 4IMLA 1HSAA 4M1CD 1UM5L 5K33A 4HDIB 2IH3A 5J3HD 3TP4A 3F62A 2VR5A 3MGAA 1GPOL 3G5ZB 2X1XR 1NCUA 1W0WB 4DCQA 2VE6A 4PRHD 4HS8L 4XPBL 3S97C 4UV4L 4F58L 2HLFD 1JI2A 1J88A 4PRHB 2YR3A 2J88L 3O2WL 1CLCA 3DROA 2J8HA 2YPLA 3O0RL 4OZFG 1SMOA 4F7PA 1G7PA 1AIFB 3D85A 1DBAL 2I9TB 5I30H 5JXEC 1GGBH 4MCZA 4XNYH 4JR9L 5C0CA 2HRLA 2Z8WC 3AXLA 4KJQC 1WEJH 3ARDD 4OCXH 2H9GB 2YD8A 4U1HB 4XVUD 3MV9E 1RJZA 3ARDB 5M7QA 1QACA 1RZ7H 1KV3A 2X4TA 5C6TL 2VDRL 3VXPA 5HYQA 4YXLL 1IC7H 2VSDA 5T3ZE 1ED3A 5D4QA 3FQXA 2D0HA 1T83C 4R4BB 3QIBD 4Z7OF 1TPXC 4J3TA 3QIBB 4XPFL 1KG0B 1JZ6A 4K8RL 4R2GC 2QKIB 4ZFOB 3BXNA 3DX6A 4HGWB 1Q1JL 1EJ6A 1HZHL 4HS8H 4XPBH 3S35L 4UV4H 4DGYL 4F58H 1TNMA 4NOFA 2V5YA 3QUZC 4C56D 1OTSD 5T5NG 1CGVA 4KI5F 1DBAH 4ESKA 3PWLB 5EU6A 5F9DC 4JR9H 1XCTB 2F54E 2C4FU 5I16A 3JV4A 4HMCA 4QRPA 2A73B 2NTFA 2GK0B 1KYOJ 3DX9B 4HPOL 5C6TH 2VDRH 4QHUB 5HHOB 3MNVA 3W0WA 4YNYB 1MCHA 5C8JA 4F37K 4YXLH 4K94H 4U1MA 5GGTA 2C3HA 3O8XC 5AYQA 1LO0L 4JM4L 1JMXA 4UOJA 5DFWH 4J1UA 2H3NB 3LV3B 1I7UB 3NFPA 4CN1A 4XPFH 2JJVA 3ZZ1A 5H94A 4QXTA 2UY7A 3VWJC 1Q1JH 3S35H 1HZHH 3TV3H 4DGYH 4QRTA 5JLZB 3QUKA 2GJJA 2OBGA 2XKNA 1QRNE 3C6SB 3QWRA 3WL9A 3K1DA 3QDGE 4LLMA 1PEWA 4PJDF 4FFVD 1VFBA 4HBCL 4LKCA 1L9MA 5C09D 3BP6A 5C09B 3LKRA 4I1NB 4GW1B 2YK1L 4YHKL 1ZVSA 2ZUTA 1XF2A 2DWDA 1FNEA 4NWTL 1AGBB 4U7SA 4BK4A 5EC1A 1BAFL 1LO0H 2BSTA 4JM4H 4OF3A 3BEVA 3V0WL 1ACZA 3O6ML 4LIQE 3IDYB 2EYRB 4KHTL 3JWNC 1C5BL 5DHYA 1ZA3B 2HFFB 1A6UL 4HWZA 1N5AA 2AABL 1RQ5A 4OM1H 1FHGA 3RVVD 4AEEA 4MD0B 4NDMA 4U6YA 4GG8A 5EU7E 2AXGB 2QHLA 3FRPA 4P2QE 5C9JA 1BOGA 2P5WD 3GNMH 3ULUF 4HBCH 4I18C 5IBUB 1YPZA 2GT9A 3CFKB 3GJFH 1KN4L 3DIFB 4MAYA 4FZEL 4MJID 3QSKB 1VENA 1IJ9A 4MSWB 3O3BB 3AVEA 1HCFX 4MJIB 1T20A 4YHKH 4Q7DA 3DJ9A 5DRWB 4OD1H 4P5KA 5BZWA 3O11B 4WJ5A 4RMVA 5JDSA 3LRSA 4OSUL 5CIPH 1BAFH 3V0WH 3ULSB 2FX9H 2D7NA 4KHTH 4Z9KB 5D7SL 1C5BH 4M6AA 2J8OA 4AT6A 3SKMB 4DN4L 5F1NB 2XWTB 4NQDA 3QB7C 3UAJC 2AABH 4UIMB 1BQHA 5IW1A 3HE7D 3H42H 2EEDA 5FA3B 4J4PD 1L0YA 3HE7B 2XT1B 4I9WD 3ALXA 4PJ8D 5TE6H 2VZ3A 5GGRY 4LBEA 4PJ8B 1RUKL 2DN7A 1LP9E 3ALPA 1KN4H 4F15B 5J7CC 1BPVA 1KLUB 4OTXL 3EOAA 1KTRL 4Y1AE 2NY2D 1GC1C 2NY2B 3U2SB 3LSOB 1X5YA 5IV2A 1PZUB 1MCWM 2A38A 4ZSOE 4P3DA 3MRNB 3IGAB 4OSUH 1EHLL 4Z0XB 3C60C 3S88L 1WAAF 2EIEA 4JVPA 4I77L 4YBQC 1SYVB 3BYTA 3RUGB 4DN4H 1J8HA 4LRNL 5F1IB 4F8QA 2YKLL 3IFPA 1CICA 5F1SA 2FB4L 1K8IB 3RTQC 5DZOA 5IQ9B 1U8OB 3VI4E 2OX5A 5J6HB 1RUKH 5ESAA 1Z0MA 1D5ZB 1OGTA 1OGAE 4KK5C 5HHNA 4KJWD 3CH1B 2AJ3B 1KCVL 3ARFA 2OYPA 3V4UL 5ISZD 1T5XA 1U8PB 5E1HB 5CBEB 5AUMA 4GO6B 1D5XB 1R6VA 5ISZB 2Y36L 5EU5B 1R5IB 4OCLC 1EFXB 2Q8AL 5IJKA 4FS0A 3S88H 2BOBB 3NZ8A 4I77H 4NQEE 5MEPB 1BQSA 2ID5A 1OTTD 2CLZA 3FB7B 1BZ7B 25C8H 2B2XL 1MFNA 3FT2B 4CJ0A 1DDHA 5GGTL 3OXSA 4PGCB 3DHJA 4DZ8A 1ZWIA 3UPRA 1WC7A 4G9DA 2YKLH 5KJRH 4WI9A 2VDML 2FB4H 1FYTD 1RZ8A 1UWXK 4UNTA 5ID1B 1FYTB 2D0FA 4P5TD 3LKQA 4XPHL 4JVUA 1KPVB 1RULL 3PGCA 2H32H 1OT1A 4YR6A 1LP9F 5DZNA 4WI7A 3MRRB 4LDEB 1I9JL 1XR8A 3AM8A 2DB8A 1U8NB 3PWNA 4JFPB 5FDWB 1F90L 3BMWA 5JA8B 5MENE 3L6FA 2Y36H 4BK5A 2NCMA 2Q8AH 4HIJB 4G7VL 5CZXD 1LGVA 1IM3A 1CIUA 3QPQC 1PX4A 2B2XH 3ARXA 1JUFB 1NFDE 2H6PB 1C5DB 1FDLL 1HHKA 3FAXA 5CSZA 2VDMH 4K7FB 4XZUA 3SE3C 3GJEA 5JXAL 4GMSH 4U1NB 4XPHH 5F7UA 1MH5A 4HIIB 1OLZA 4XXCA 3VRJB 4WTZA 3MR9A 1RULH 2VLKA 1GOHA 1WBXB 4MCYA 3VI4F 1RJCA 5E5MA 2B20A 4R0LA 3KLHC 1I9JH 4FXKB 3OTTA 5FECA 1HSBB 5GISH 1T0PB 2PTTB 5IEHB 4G7VH 1X7QA 3RY6C 5DRXA 4OKDA 2DBLL 4ZQKB 4P9HL 3QIWA 1A1MA 1YEFH 4TYUA 4Y16C 4F7CB 2BVOA 4OF6A 1XF4A 1R5WA 2IC2A 3IFLL 3SDDB 3UX9B 4LCUB 4QF1B 1NJ9A 4MJ6A 5HYIA 4ZUWB 3UTTD 2RAMA 3D48R 4LSQL 4MYWB 5D1ZA 3BJLA 3LPFA 5FO8A 1NMBL 3UTTB 4WHCA 5BRZE 3CCHA 1KIRA 3RNKB 1EO8L 3B9VA 3BZ4B 1T04A 2DIAA 3QAZB 2VR4A 5F9JB 4A6YH 4MAUL 4WW2A 3ZHLA 1W0VB 1JGUL 4POUB 1BJ1H 4P5MA 1JV5A 4PJ5E 4QOKE 5SWQA 3KYOB 4X9GA 3WKML 2EE9A 3L3DB 4YHLH 2R69L 1T4KA 4RMRA 1B4JL 5MEOB 1J1PL 3B9KD 1C16A 5D2LA 4RGMC 1I1RA 3B9KB 2DBLH 4P9HH 3PNWA 2ERJB 3EOBA 2ADIB 4PR5B 1FZJB 1P4BL 3SJVD 3IFLH 3UJTL 3STZA 3ECBB 5H8DA 3DXAA 3HI6H 3MRIB 3SJVB 1UACL 2RR3A 4PJCF 4KAQL 1U8QA 2PNDA 5D72L 1U42A 3GK8L 2W60A 3WN5C 1A9BB 4LSQH 1MREL 4MA8L 2HFEB 3ZMRA 1NMBH 2NR6C 3RPKA 4PJIF 1CD0A 3HZKB 1EO8H 1NBZA 3H3PL 1UQSA 4CVXB 4M00A 3VXNA 4MDIB 1TJHL 4JFOB 4WWID 2CO6B 3CU7A 3S37L 3WEXB 1JGUH 5B39B 3RVUD 3S8WA 3WKMH 4GG6E 2R69H 4P2RE 1QHPA 1J1PH 1EGJA 1BVZA 1XIWD 4OQTA 4S1QL 3EYOB 3AS3A 1XIWB 4C54A 2O5ZL 2ICEB 3IXAB 1RUQL 3DURB 1WVZA 2YD7A 2OLDA 5LGKA 1R3KB 1IFHL 3BP7B 4HT1L 2O93L 1UACH 4F15C 4KAQH 5D72H 3TBWA 1FQ9C 1MREH 4MA8H 4UIKL 4HH9A 1Q94A 1JNNL 3AU1B 3T3PE 3EIFA 1KJMB 3H3PH 5FKPA 2WM0A 4UBDD 1PKQA 4K3JH 3TZVB 2DLHA 4X9HA 3DO7A 1TJHH 5T1KD 4NNPL 4PRAA 3WFCL 5SX5H 3E3QE 3S37H 2NYYC 5T1KB 4D9QE 1KXQE 1MLCB 4J2XA 2AJSL 2GW5A 1X4XA 5HGDA 3F7VA 3TYFA 4ZUTA 3I2CL 1QSFE 4QXGL 4UILL 1UKTA 5EOCJ 4E9LA 1I7RA 3BD4A 3ILPB 5GGUB 4GH7B 4I13B 5DJZA 5DFVD 5GS0D 4GBXD 1RUQH 4BQ8A 1T03L 5FGSA 2JJTC 3SGEI 3MRFA 4GBXB 1F58L 1P53A 2A9ML 4X6FB 5FA4B 3BESR 3EGSA 4JDZB 1MHPL 5J06A 3LKOB 5J12B 5INDA 3OR7A 4UIKH 4U05A 1JNNH 1B88A 3RRQA 2JK5A 4PP2B 4NQSA 4A2LA 2KL6A 3GMMB 4RX4A 4X4XB 1R24B 5T1MA 3LB6C 3U0TB 1OAUL 1O0VA 1CFNA 4NNPH 3WFCH 3BZFB 2VAAA 2R0LL 2W0FB 2AJSH 2JB6B 5E4EB 1HKLL 3I2CH 2I26N 4QXGH 4GG6F 4UILH 4JHAL 4LHUB 1EV2E 4NN5C 3ZKXB 2E6QA 1CD1A 1NBYA 1W0YT 4Z78A 4NBYB 2DQIL 2K1MA 1T03H 2OL3B 4Z76A 5KN5B 1F58H 1YNLL 4K71B 4PRIE 1TTUA 2NW2B 1MHPH 1A8JH 1TZHB 1KCRL 3QPXL 1C1EL 3R8BB 3MUJA 2X70B 3OG4B 1UB6B 3LDBC 3M1BA 3F7PC 4JRYA 1JZ8A 2ZSWB 5E95B 1YECL 4RCAA 1TCRA 5J1TC 2D4FA 2QBWA 2BNQD 4X7DC 2FJGA 1DANU 1OAUH 2BNQB 3B9AA 4X6EB 2CIKA 2R0LH 5TE7L 4XNQA 5L8LB 4FQPA 3SDCC 1HKLH 3RWJB 3N1MC 4PJEB 4JHAH 1H0DB 1DVFB 4JFZL 2MQ0A 3IS1X 2E7HA 2W9DL 3EOTL 5ITFA 5IHZA 1A6TA 1R3LB 4PY7A 4P2OA 4MWFB 5C0ND 4XCEA 3RGHA 4XNZB 3A6BL 4ONOA 2VLRE 3U7AA 2E5EA 4PB9L 3RDTC 2DOCA 1D5MA 1T2QL 2C1OA 2WP3O 4RWYL 5FHBL 3BH8A 4O5LH 5KG9B 1KCRH 3QPXH 1C1EH 2X9XA 35C8L 5F9OL 1LK3L 2NY3D 4IOFD 1Q0YL 4KDWA 1QRKA 1BVLB 1YECH 2J1KA 2VDOL 4DEPB 3HPLB 3W82A 3KPMA 4NUJB 3FONA 2V5TA 3WDJA 4C4KO 4ERSL 5FGBA 2IPUG 4NKDB 5F6IB 2G5RA 3MCKA 5DDHA 2CDGA 3IDMA 2IQ9L 5E9DD 4JFZH 4P2CG 2A77L 2NNAA 3SDDC 5F71A 4JZOA 2W9DH 3EOTH 1S7RB 3DHMA 4S1RL 5DMIL 4HUKB 5F7LB 1Y6NR 3VDBA 2G9HB 2VDQL 1T2QH 2V7HA 4HK0A 1X5FA 3VFSB 3L5WA 5DJAA 35C8H 2RFXB 4GKSB 5F9OH 1UYWH 4OIAA 2WINB 2YD5A 4U1SB 5CUSL 1Q0YH 4JLRA 3UPCA 2VDOH 3LH2L 5K93A 2BVTA 4TVPH 5I8OL 3LQMA 3ULVL 2HT4D 3FRUA 1BX2A 2CUIA 1YPZF 4ERSH 5J9PB 2ERJC 2FGZA 4I8DA 4KMLB 4XCFH 3VWKC 3GHEL 3LPWA 1Q9KB 2IQ9H 3OAUH 2YD4A 4OF7A 1A1OA 1U9KA 3MUZ1 2A77H 2X89D 3V6FA 5CBAB 3ZYIA 2KZ1B 2XN9A 4S1RH 5DMIH 3MLTB 1HH9B 3L1OL 4OIBA 3BRDA 2FLRT 1I9IL 1L9NA 2FJHB 2F54A 4NZRH 3RZWA 5DVNA 2W9EL 2VXQL 5FYKD 3EJYD 3RHWK 2OSLA 4YHYC 1LE9A 3HRZA 3VCLA 5CUSH 4K94C 4PJXE 5SWZE 1S7QB 5EO0B 2EIZB 5CEZL 3LH2H 2DM7A 3D87B 4XVTL 4DGVL 3D0VA 3MUY1 4KUZL 1KB5H 4FQQA 5FYJD 4Z0BL 1UB5A 3WO4B 3M17B 1KTKE 2XQYG 1T7ZA 3VXME 3MRHB 5JOFB 2VDNL 4X8XA 3GMQA 1QSEA 4H1LA 2YSSA 3MOBL 2X9WA 4MNQE 4R3SA 2VLJD 1QRNA 4UU9B 3MBEC 3SY0B 3T2PA 4P46D 1JNJA 4D0BA 2VLJB 2L0DA 3VMPA 1I9IH 3P73B 4PRPE 2W9EH 2VXQH 3JVGA 4ZAKC 3GMLB 5D96B 1RZJH 2EYSB 1H3VA 1HI6B 4FMKA 3D1MC 1OM3L 5FF6B 5CEZH 3ARSA 1BREA 5T1DL 3PHQA 3P9MB 4XVTH 4MS8C 4DGVH 3BD5A 4KUZH 4NNXA 4ORZC 4YDLB 2IMNA 1G0YR 3J8F7 3WLWC 4Z0BH 2EDBA 4PYHA 4U7MA 3TIEA 4FQLL 4HWEH 2VDNH 4LCWE 3MOBH 4JRWA 1I85C 2FEDC 1IAMA 5J12C 1ORQB 4G8EA 4LARL 4NO3B 1QEWA 3RBGA 2WBJD 4GAYA 4P2QA 1PG7W 5D5MB 5L2KA 2WBJB 1CD9B 2DWEB 1CE6B 3C87A 2AV1B 4LHJB 2VLMD 1MHCB 4LSTL 2ZOKB 4AQOA 3OF6A 4TUJA 1OM3H 1Q38A 5EBWA 1PGRB 5JXED 5IGXL 3FQNA 4OI9A 5T1DH 3UTSD 4G43B 4N1EA 4NC0B 3ARPA 1KJ2H 1LEGB 2FEEI 3UTSB 3VXRB 1ETZB 2JJSA 2R29L 1Q9WB 3TBVB 2QQNL 2ORBL 3BMVA 2GSGB 4FQLH 3QDAA 1S8DA 2FR4A 3B6SB 3BIKA 3VFVB 4QY8B 4XAWL 4MXVE 1XGTA 1FCGA 2YD3A 4LARH 5ACMA 2CIIA 5DEFB 1A6PA 1X9QA 2C7UB 1XT5A 4HV8A 3C6LA 4HIEB 4YO0A 2DI8A 4EDXA 5L0QB 3IJYA 2NY7H 1PDKA 4U6XA 1Y18B 4PTTA 4LSTH 3QCUL 5GGVY 3GUTA 3RKDC 1MFAL 1V05A 4JANA 4LSSH 4OZFA 3T2NH 3QUXA 4X6DE 5JOPE 5IGXH 2Y06L 5C6PB 3S7GA 1G7IB 1PY4A 4Y5YA 1JNHB 1DVFC 3KPRE 3S35X 3TC9A 3PL6D 2EDQA 2R29H 5L2JB 1NANI 3KS0J 2QQNH 3PL6B 2ORBH 3QDHA 2N7AA 1MIML 4PG2C 1MFEL 5T3ZL 5FYLD 1QR1B 4Z77A 4YUEL 4K9EL 3T4AA 5DJYA 2BCKB 4XAWH 1PYWA 1GHFL 1AHWB 4P59H 3QXUA 4PJFF 4U1IA 1AI1L 1YEGL 2WQRA 4LDLB 4S11A 2XTJD 2ADFL 4QXUH 4DEPC 4HKBA 2XTJB 5JIKA 1KXTB 3D3VE 1DUYB 2XKSA 1HXYB 2WZPD 4QYOB 2VISB 3U6RA 2Y06H 4DW2L 3HC0A 4Y4HC 4PY8J 4FQHA 4YDKL 5D71H 2XWBB 3B2VL 5TDOB 4NBZB 3TBTB 3DVGB 1U3HA 5IMMA 3TJHC 2VMFA 4RFEB 3VFNB 1IM9D 4OF0A 1MIMH 1IM9B 1MFEH 2V5MA 5T3ZH 5TGBA 3WIHL 5DWUH 4YUEH 4WW2F 4K9EH 5IT2H 1YDPA 1TIUA 1QQDA 4HGKC 4CDGC 1WZMA 1GHFH 3HAEB 4MXVF 5CCKL 3GIZH 2BMKB 5HYJD 4FTVD 3MRPA 3MLVL 1AI1H 1P7KB 1YEGH 3L9RA 2PXYB 3NAAL 4FTVB 3TNMB 2AKRA 3PHSA 5D2LF 2BNUA 1HQRB 4HQQL 1IKFL 3ZSSA 1QBMH 2DL2A 3U0PA 4DUWA 1UWEH 3T4YA 3V6OC 3IAQA 2FZ3A 2OMNA 5L7XL 1X4ZA 2LU4A 1NH6A 5CKGA 4DW2H 5SWSE 4QHMA 4HUVA 1T0MB 2HJLB 3B2VH 2JJWA 1N59A 2IANA 4Z7UB 1JWUA 1U8HB 3WS3B 3V5KA 2X4UA 4C57C 4HG4J 3HCVB 1JPGA 4R7NB 5DD1L 1LO3L 4Y4FA 1DQJA 4HIXL 3BQUB 4PRDA 5F7MC 3WIHH 3GFUA 2W0LA 4EI5B 1NFDA 5GZND 3CX5K 4LNRB 3O4OB 4LIQL 2DBJA 3MRJB 4OCRL 4UNUA 5CCKH 3ES6B 4G6ML 4MA7L 4Z5RB 5DJDB 3CFBA 3MLVH 3NAAH 4YHPB 4PY8I 4PJ9A 4RGOL 2AVGA 4HWBA 1IKFH 4PJHB 2BC4B 5ADOL 1YY8B 5C1MB 5ICYA 2HJKA 1A6VL 4N90D 4G8IB 4M7ZC 5JZ7C 5L7XH 1WFUA 3BE1L 3G6JB 2EDTA 3NA9L 3BT2L 5E8PA 5DHVH 4MNHA 2CR6A 43C9A 5IR1A 5KVFH 1CFTB 3C5ZC 4Y4KA 2ICES 3WE6A 4PLJC 3DV4A 5DD1H 5LVEA 4F2MA 4PGDB 1FSKB 5T1LD 1D9KA 4N0UE 3VXSE 4HIXH 3MJ7B 5CHNB 3RWDA 5T1LB 4LIQH 4OCRH 2B1HH 3IETB 4C55A 4G6MH 4MA7H 4FQXD 1R3JB 4L29B 4UT7L 4FQXB 1M7DB 3QR2A 1WFOA 5IVOA 4LCCC 3FT3B 4HFUH 2AV7A 4RGOH 1J0ZA 4MQ7A 2BSRA 4IIQC 2Z91B 4YBHA 4K2UL 5C07D 5ADOH 4XPTL 1JPTL 5C07B 1A22B 1A6VH 3EUUA 3IJHB 3MQIA 1G0XA 1HHIA 5GSRB 4WI2A 2C3VB 2ZG3A 1N8ZA 1CK0L 2CJUH 3BE1H 3T0AA 4OLWL 3IU4L 4HF5L 4PJ5A 3VFRA 1F3JA 4P9HC 2VZ1A 1S7WA 1X5JA 3EDEA 4PJGE 4ODBD 1B3JA 2XZCL 4X6CE 2YMXL 3FCTB 4LU5L 4Y2DA 3Q5TA 1UH3A 4N0YL 3T65B 5DMGD 1DL7L 1ZMYA 2A0LC 4JQXC 3CLEL 5D2NA 1JJUA 4ZDHB 5EORL 3OJDA 2HVJA 1WGOA 3LKSA 4TN9A 3DYOA 3FZUD 1J1XH 2VUOA 3F7YB 5IMLA 3PWJB 4XPTH 1JPTH 4U1LB 3QUYC 4L4VD 4WV1A 1DCLA 2CLRB 1NDGB 4LVNB 3C8KA 3CMGA 4L4VB 1CL7L 2HMID 5GRZA 1CK0H 3SQOL 4XMPL 4C56A 4IS6A 3IU4H 4LPVA 4HF5H 4JY5H 2HT3C 2NY1D 3VXTA 4APQD 3I6LD 4JGMA 2NY1B 2DI9A 5C0GA 5DYOA 4UB0L 3PP4L 4APQB 2R1WB 1LHZA 2ZG1A 1EDQA 4CNIA 2XZCH 1EUTA 2YMXH 3T0ED 4LU5H 3MNWA 5A40E 2ITCA 3T0EB 4KKLD 5D7KE 1WT5A 5AEAA 4N0YH 3BN9C 1DL7H 4IRSA 3SKNA 5C9KA 3CLEH 5HVHB 4Z8FL 3SPVB 4F57L 1VPOL 4YGVB 4POYA 1BECA 2E9JA 1I3GH 1ND0B 4XP9L 3JTTB 1CL7H 4AIXA 1GZPB 5K9KA 3VRIA 3SQOH 2OTUB 4XMPH 3IJSB 5TFSL 4O2CA 1QSFA 3C8DA 2EYTA 3BPNB 1I4FB 1WTLA 3KXFD 2M2DA 3PP4H 1Z5LB 4PLKC 3KXFB 5CJOL 5HDOA 3LIZL 4PJGF 5J1SC 2MSPA 3D39B 3AY4A 4XVSH 2ZUQB 3X14A 4H0IA 4XBPA 2DLIA 4YHZL 1YEEL 4E41E 3DI2B 4RMSA 4Z8FH 1JE6A 1H9VA 1AQKL 3QEQB 4U33A 4D0CA 5IB3B 2BXZA 3CDGB 5IBLD 3MNZA 1OT2A 5IBTL 4D8PA 3ARBC 4F57H 1VPOH 3QYCA 2HLAB 3OKYA 4M7LT 5E8EB 5ALCL 4UZGA 4TUKL 1Y6MR 4XP9H 1TVBA 4ELMF 1INQA 2VXUL 5I6XB 5TFSH 4KV5E 3WIFB 3WUWB 2YUXA 1AXSA 5BZDA 3BO8A 4Q97A 1JHTB 1ZK9A 2P5WA 4HBQA 4JHBA 1YEHL 3DX8A 1EVTC 1RZGA 1FZKB 2R9HD 1LEKB 3O41B 3LIZH 3HC4L 1JWSB 2PXYC 1WISA 4JEGB 2WP3T 4L3ED 3E6FA 1R0AH 4PRIA 4YHZH 4L3EB 1YEEH 4UTAL 3IS0X 3WFEL 4H8WC 1K5NB 5CGTA 2AEWA 5F21B 3HZMA 4PGZA 4PJAA 1AQKH 4R97B 2DM3A 4KVNL 1CF8L 4L1DA 2ESVE 5DO2D 2PYED 1H3TA 1IT9L 1U8IB 3DTXB 2PYEB 1TQCC 3A67L 4TUKH 1IZJA 5DK3A 2VOTA 2VXUH 4FG6C 1KIQB 4OZIA 2CXKA 5C0DA 4YDVA 1JRHL 1PW3A 4H26B 2VH5H 1TJGL 1YEHH 2D7TL 5LJYH 1L7TH 3UPAA 5LBSL 4JB9L 4BKLB 5DQJB 3I75A 3HZYA 3HC4H 3IFOB 1PAMA 3FO9B 4G9FD 4OUUA 3UJIL 4G9FB 2VLRA 2X1PA 2FGWL 4ODWA 4B50A 3GSQB 4UTAH 3SE4A 5F3HA 1N64L 4YHIB 4Q2ZB 3WFEH 3CFDB 4ODUA 4TNVK 3LS5L 1BD2B 5C0IA 3GGWB 1SEBB 4PJDB 1BJMA 1ROWA 4KVNH 1CF8H 3G9VA 5LQBL 3OKOB 5HGGS 3S37X 4ZXBB 3N85L 4I3RL 1QKZL 1B0RB 1IT9H 1FJ1A 3LKNA 4XGZA 3A67H 4U1GC 4JM2D 2LV4A 3PWPE 5FV2A 4JM2B 3X13A 4ZPVA 1JRHH 1FPTL 1NC2B 3QWOA 1I1AD 3UDWA 3MJGX 1TJGH 5I8KL 1P9MA 2D7TH 1I1AB 4QHLA 3MLYL 2ZNWA 3R4DA 1MVUB 4JB9H 1YYML 3I9GL 4Q9QL 3OR6B 1GH7A 1JGDA 5DHXB 3ILQD 4WTXA 1A4KB 3UJIH 1NGZA 2FGWH 2BY0A 5FB8B 2ITDB 4ONFL 3QNZA 3RVTD 1G7LA 3WKNA 2EXYC 4LKXA 3LS5H 1CXKA 5JW5A 5IEKA 3ULUD 2JELL 3MMEA 4TNWK 3SGJA 3VGHA 5DJCA 1WK0A 2P7TA 2LU7A 1CWVA 3N85H 4I3RH 1QKZH 4XNXL 1EJOL 3DX7B 1HHHA 2D9QB 4LSRH 2VQ1B 3MRGA 1PZ5B 4U2ZA 4JFFD 3UBXB 3V9FA 4JFFB 2OP4L 3F6IA 3CGTA 1YNTB 1FPTH 1IEAB 4P5TA 3O9WB 5I8KH 4R90L 4G80B 4QT5B 3MLYH 1TENA 4OD3L 4OLXL 1YYMH 1AGEA 1KTDB 2C3XA 3I9GH 4Q9QH 5SV3A 3MCLH 3VD7A 2MHAA 2MWCA 2V9RA 3ZTJG 3B2UD 3Q6FA 2GFBB 4BQ9A 5DA0B 4GRLC 5ESQB 4ONFH 1XGUB 2M26A 4B5EA 1LK2A 4G8GE 1I8KA 2JELH 4F9PC 2Q3ZA 5SWZA 1UADC 2EDYA 4KKCC 4Q0XH 3ORJA 4XNXH 1EJOH 5GXBB 4QKXB 3KPSE 1BFVL 3HMWH 2VL5A 3LPGA 1RK1A 4O51B 4WW1A 4Y5VA 4L8SB 4I0PD 4I3GA 4LLWA 1TTGA 3VXQA 4PJ7A 4GRWE 1A9EB 1DUZB 3DI3B 1K9TA 1XEDA 5IF0B 1KFAL 4ZG1A 5D7JA 1NDMA 5IG7B 1ZS8A 3O6LL 3BDBA 1MFCH 3NIGF 4OD3H 4LF3B 4JREB 4OLXH 3KYMA 1CDGA 5C6WH 4L4JA 5LGJB 1T1YB 5CJBA 3LVEA 4X4ZA 1U8MB 2APTA 5J1AA 1MCQA 1ZHKA 1FFOA 1RZJC 3M07A 3MPCA 4PRPA 5FOBA 3PDOA 5EUOE 4OZHA 2AEPL 4ONHB 2Q20A 2EDLA 4HWNA 3GHBH 3DOSA 3C5SB 4O2EB 1FO0L 4TUOA 5D7IA 1EH9A 1BFVH 1NAKL 1MHHA 4ETYA 1Y0LB 2XG5A 3L3OB 1HHGA 2VNCA 1UXWA 1OB1B 3HA0A 3C5JB 1K2DA 2AK4B 4QHNA 1KFAH 1K3IA 4NM8L 1FLTX 2H2SC 3O6LH 5B4MD 4NBXB 4UQ2B 5I18L 5KS9B 2CDFB 2EE2A 4UNVA 4X4ME 5IK3A 5JOEA 3DETD 2FYYA 5HI4C 4IHOB 4M8QA 2AEPH 3LS4L 5E2WL 5BS0B 2BRRL 2N4IA 4OT1L 1CG9A 5HGAA 3BGAA 1NGXA 2FECL 4UTBL 3VRLF 1FO0H 4HUWA 1T1XA 1NAKH 4Z95L 1JPST 2ZKHL 4PLNC 1WUNT 3SO3C 1XGPB 4LLVB 2HFEA 4PRHE 3AB0B 2EKJA 2F53D 5DK0B 3QCTL 3TN0B 4E5XA 2R0ZH 4TULL 2F53B 1Z2KA 1IVLA 4KHXL 5CWSB 2VIRA 3HE6C 3LHPL 1OP3K 4JAMA 2X10A 4JFHD 5I18H 3LRGA 3IVKA 1TZIA 3GSRA 5HDQL 4NM4L 3O6FC 5T3XH 3DVNA 4XAKD 3LS4H 5E2WH 4ZMAT 3SE8L 3ZDYE 2BRRH 1MVFA 1G6RB 2Z92B 1K4CA 3H2WA 4TVSa 5F9AC 2Z31C 4UTBH 5EBLB 2I07A 1UVQB 3WMSA 4XX1E 3ARGA 2MOVA 3HG1A 4Z95H 5DS8B 2OMBA 2ZKHH 3RWEB 1X5XA 3IU3A 3BWAA 4WWKA 5E5UB 5FKAA 2ARJQ 3QCTH 4XP4H 4NO2A 3CUPA 4TULH 1LNUA 1CGTA 4KHXH 4YPGB 1OAYH 3OKKA 1LO4L 4K8RD 1ORSB 5EOQL 3QJHA 3O45A 4CU8A 1RURL 3LHPH 4QGYA 5JHDE 4NJ9L 5DC4B 4Z7WB 4L4TB 1DQML 4UAOB 2X4NB 2MNUA 5HDQH 1R3IH 4NM4H 3RWFB 4M9PA 3VFUA 3QEGL 3S4SG 5HHOE 2PO6C 4Z7NF 4FNLH 5HGBB 4IDLA 5DJ2B 4HAFA 2QL1A 1Z9MA 2DQUL 1H8NA 1VFAA 3PWVB 3KPOB 4JO3L 4N9GA 4LCIL 4FABL 4OZGA 3GI9L 5BW7C 5EC2B 5HI5D 2OJEA 2ZUWA 4WO4C 4K9EC 4ZNEA 1FGNL 1MSPA 4JDVA 4P9MH 4EEEA 1N5YL 3IFNL 4KQ3L 4FXGA 4TTDC 3RZCC 5E2VL 1UZ8A 4JFYA 4GRMA 2PW2B 1KJ3L 4NKMA 2Y4SA 1LO4H 1ZANL 5EOQH 3AAZB 4MS8D 3HS0A 1RURH 2UUDK 4NJ9H 4PD4K 3O3EA 3OKLB 1DQMH 4EUPB 1CDJA 1EO5A 1N2RA 1LO5A 3OAZK 5C0BD 4OD2B 4L8BB 3T1FB 3QEGH 5C0BB 5JW4Q 3CXDL 1CQYA 3O3DB 4PJCB 4HZLA 1FVEA 2XRAH 3ZKNC 1QPPA 4WGVB 2DJSA 3ZDYF 3D9AL 1INDL 3V5HA 1SJHB 2VJXA 1SMAA 1KT2B 1FORL 4XWGL 1KUMA 4LCIH 4FABH 3O9WC 3GI9H 1FL6B 2FJFB 2HFGL 4ZS7L 3UC0L 1FNGA 1FFPA 1FGNH 4ORGA 1N5YH 4O02L 3IFNH 1ZHNB 4I2XA 3IDGA 4KQ3H 4ZOAA 5TH2B 5E2VH 4CADB 4M62L 4TNWF 4V1DA 1KJ3H 4XMLH 1ZANH 4DVRL 4M4RA 3U46A 1E4XH 5IB1A 3D25A 3MO1B 4QEGA 3TNNA 3P4MB 2BVQB 5M94B 4MJIE 1I1YA 3IYLW 3VMNA 1RY7B 2BDNL 1REIA 5EULV 1HEZA 3CXDH 1F42A 5AD0A 1A2YA 2I24N 1INDH 2BY2A 2JIXD 4L8SC 5EFIA 3RGVC 4ISVB 5ERWA 2JIXB 3VXUD 4XWGH 3DBXA 5CD5C 3VXUB 4ZUVA 5HJ3A 3RIFK 1M71B 2HFGH 5DSCA 3UC0H 1BMGA 2H8PA 1MAKA 1T3FB 3GBMH 4O02H 3VXSA 4B41A 2AXFA 1RD6A 3GKZA 3C9NA 2A6JB 4ZUSB 5CZVL 4DVRH 2Q7YA 5IB5A 3QI9C 1IC1A 1HSAB 3DGCR 4IMLB 1KENL 3PQYE 1DQQA 4CGTA 4GJTB 2I25N 2IH3B 2R2HA 4X98A 3KYKL 2JCCA 4X7CC 1A0QL 5IFAH 2NZIA 4NUGL 4X9BA 4YFLF 2VE6B 4DCQB 5E9DA 1QA9A 3RQ3A 3GI8L 4WNQA 4U3CA 2YPLD 2F8XC 3DROB 2YPLB 4RAUA 3D85D 4F7PB 1G7PB 3D85B 2ZCLH 5E70A 4MCZB 5C0CB 2P8PA 2ICWJ 3NCYS 2VZOA 1M6OA 3AXLB 5HHMD 4X6CA 5D1QC 5HHMB 1E28A 2IPUK 1RJZB 1HYSD 2X4TB 3IF1A 5D6DC 3ZE1F 1J0HA 1KB9J 3VXPB 5HYQB 2DQFA 4RSVA 4QWWD 1ZHBA 3TJHD 4XMKL 2CKNA 2GK2A 4UV7L 3H7LA 1ED3B 1KENH 3FQXB 2EDDA 3JXAA 3PF2A 1ZV5A 3VE0A 2WMPA 3U9PL 1JNLH 3KYKH 2WSKA 3BPCA 3FB8A 4MXQD 4PBVC 1A0QH 3JV5A 3BXNB 3DX6B 4NUGH 4XB8A 2NY4B 3KPTA 3TO4C 4NKQB 4G3YL 5ISZE 4JG0L 3FJTA 3F12A 3RKPA 4HEME 1DN0A 1XZ0A 3A6OA 1AXTL 1MCSA 4LP5A 3RIAK 4PJAF 3CX5J 3TA3C 4LOUD 3EHBC 3ZLQC 5EU6B 1XF1A 4J3UA 2APXA 2OI9C 4N8CL 5I16B 3JV4B 4K3EL 2P47B 3N50A 2XFXA 1LVEA 1BIHA 4NJAL 4QRPB 2NTFB 4DTGL 4LSPL 3W0WD 3MRCA 4OZIF 3MNVB 2PYFA 5A16A 3W0WB 5C8JB 4U1MB 4UV7H 1MRDL 4KKAC 4J1UB 3TT1L 3HLAA 3U9PH 2ZPKL 3NFPB 2R56L 3EO9L 3LQAL 5AG8A 3QO0A 5H94B 5L6YL 1CLZH 2ICWI 4QXTB 2YEZA 4G3YH 4JG0H 4QRTB 4BFIA 1HQ4A 2IAMC 1AXTH 3QUKB 2XKNB 3LD8C 4P46A 2PW1A 3WL9B 4KROD 1UM6L 2EZ0D 4LLMB 3RUGF 3C2SA 4KROB 1VFBB 4GS7B 4LKCB 3OV6A 5CSGA 2AJXL 1KGCD 1HH6A 1XGYL 4N8CH 1WIPA 3BP6B 1S9XA 3BFOA 5IWLA 4UAOC 3LKRB 3MXWH 3SN6N 4NJAH 3NACL 3V2AR 4DTGH 5F1KC 2YRLA 1QLEL 2XQYK 4LSPH 5EZJA 3ZSTA 1ZVSB 1XF2B 2DWDB 1FNEB 3MBXL 5EC1B 1MRDH 5DJXB 3SCMA 2BSTB 5F7KC 3TT1H 1OPGL 3BEVB 4NNYA 2ATKA 2F74A 2ZPKH 3EO9H 3LQAH 2R56H 2ZUYA 1OHQA 4JY6A 3JWDL 3NGBB 3QEHA 5DHYB 2R0KL 5L6YH 1YMMA 5CKAA 5I2IA 5M95B 1CGYA 1N5AB 4Q6IC 4AMKL 1NLDL 4RWHA 4NDMB 4U6YB 4GG8B 4ZTPL 3T3ME 1UM6H 4EN3C 5C9JB 4YFEA 3WFDH 1BOGB 1KCUL 3MLRL 3K2UL 3Q5OA 4JFXA 3RPIA 1IAKA 2AJXH 1ULVA 1XGYH 1YPZB 2GT9B 1CFSA 2G75A 4MAYB 1TQBB 1TVDA 2X4PA 1T20B 5GS3A 5JXEA 3KJ6H 3NH7L 1X5IA 3MBXH 4P5KB 1Z9OA 5BZWB 3REVA 3N0PB 4WJ5B 5IVZA 5JDSB 1P6FA 3LRSB 2XA3A 3JSSA 3QRGH 1OPGH 4KK8D 5BJTA 2A83A 3OAYK 1F4HA 1KN2L 3F5WA 3JWDH 1S7VA 4AT6B 4NQDD 1UGNA 4FQIL 3ZDZF 4NQDB 3QUML 2V2TA 1BQHB 3KPLA 5IW1B 3FQUA 1E0OB 1AJ7L 2OZ4A 5E6IC 4AMKH 1NLDH 4IJ3C 3UTOA 4ZTPH 4IRJC 1KCUH 3MLRH 4XPGL 5CILL 5FUCE 5JDJA 4KJPD 1FC1A 3HFML 5GS1C 4LBEB 4G6FD 1UWGL 1TETL 3U9UA 1YQ2A 2H2PD 4H0HB 1NGYA 4XC3L 3EOAB 3QUZA 1JWMA 1FNFA 1UENA 4JZJC 2HT3D 1M7XA 1J8KA 2XY1A 5FK9A 4CBPA 5IV2B 4M7KL 3PXJA 1QFHA 5FEBA 1GGUA 3UYOD 1J8HB 4FQIH 1RZFH 3G5VA 3QUMH 2E7LC 4OZHF 1AJ7H 3IFPB 1CICB 1VESA 2A6KA 3T3MF 3H3BC 2KKQA 4XPGH 5CILH 4G6JH 2VQTA 3VWJA 1UWGH 1JK8A 1KPRA 5D7IF 5ESAB 1IGJA 1OGTB 4YX2L 2HKHL 4XC3H 2R15A 5D7LA 5HHNB 1VEMA 5JUEL 4U6HA 3MZGB 4NFDA 4YXKL 3ARFB 1T5XB 2CR3A 5AUMB 4M7KH 3RIFF 4RFEA 4GAJL 3NZ8B 3WYRA 3H0TA 1CL7I 3K4DA 5B8CC 2CLZB 3OKNA 1OOAA 4HUMB 1DDHB 3OXSB 3LN5A 4QNPF 1CU4L 5F96L 1CR9L 4DZ8B 3K4ZA 1ZWIB 3UPRB 1WC7B 4G9DB 4JFDA 2EC9U 5C0AD 5HYJA 2XXCB 3KNBA 1RZ8B 4GXUM 2D2OA 3LKQB 3BI9X 5BOPA 3PABA 3THML 5GS2H 5FDYA 3PGCB 5KOMC 1Z9SA 4YX2H 4YR6B 3IDIA 1S7UA 2HKHH 1I75A 4YXHL 3LN9A 2UYLA 3VGFA 3MRKA 1XR8B 2QSTA 3L3KA 1SBSL 4YXKH 3PWNB 5E2UL 4JGUA 2IBZY 4BFGA 1JGEA 3L6FB 3WJLC 4I18A 2NY4C 3SDXA 4G8GA 4GAJH 1IM3B 1NMCC 4LFHG 1CFVH 2IBBA 4X7EC 5JO5A 5F96H 1CR9H 1F6AA 2VABA 3JV6A 1HHKB 3TM6A 5CSZB 3E3QC 5BVJA 1AY1L 4XZUB 3GJEB 2VLKD 1MH5B 4RGND 3THMH 5ID0A 3MR9B 2VLKB 4MCYB 2K9UA 4YBLB 4RGNB 4PP1C 1DJSA 1YUHA 3LEXA 5E5MB 4R0LB 3L7EA 4YXHH 3MOAL 4OCYL 2YD9A 1SBSH 4L9LC 5EUOA 4NCC2 5E2UH 5FECB 2APWA 3VD9A 5DJ0A 3LN4A 2IBZX 3VW3L 4XI5D 1X7QB 5IFJA 3U4EA 2BNQE 4FMFA 3QIWD 5DRXB 3DRTA 1VERA 3QIWB 1A1MB 1BQUA 5EN2A 2BXYA 3RAJL 4KRPC 4NN7C 5J89A 2BVOB 4HULB 1XF4B 1R5WB 1F4YL 1S5IL 4PJEE 3U83A 2J6EA 3C60A 4MA3A 4FQXA 5D1ZD 1NJ9B 4MJ6B 1MCIA 1AY1H 5D1ZB 3AREC 2V17L 3HNVH 5FO8B 3SE9L 2VO5A 2BVUA 3CCHB 1KIRB 1QD0A 4NT6A 2OZ4L 3HMXL 1F2QA 4U6TA 1T04B 2K3TA 3O2VL 1FL3A 4OZGF 1F5WA 3MOAH 1OP5H 4OCYH 5DD6A 5J4MA 3RTQA 1IC5H 3VI3F 1SJEA 4NZDA 4WW2B 1RUML 2HRPL 3GSUA 4JRXA 4P5MB 1JV5B 5SWQB 2ARJA 1T4KB 2HT2C 1N26A 5C7XL 5BXFA 1C16B 2FWOA 5IB4A 5FYKU 5D2LB 3PNWB 4AH2A 3GO1L 4FQ1L 3G5XA 1JRHI 2LAAA 3EOBB 5HI3C 2VXVL 3RAJH 4KVCL 5ICZA 1J11A 1F4YH 1S5IH 1MWAA 3STZB 1AGFA 3DXAB 15C8L 1U8QB 5I74C 2W60B 2X09A 3WLBA 2WLYA 3F7YA 3SE9H 4FRWA 5E1AA 3P40A 1G9NC 3HMXH 1A3LL 1BF2A 1NBZB 1UQSB 5IROC 4NHCL 3O2VH 1IQDA 3VXNB 5MHSE 1HILA 1DP0A 5IM7A 1ZTXH 2HRPH 5I1CL 2FIKA 1Q0XL 5KVEL 2D7MA 4DQOL 3HZVA 2BZDA 5KSBA 5C7XH 5E24E 3V6OE 4CKVX 4LQFL 4RIRA 1FP5A 3GO1H 4FQ1H 2VXVH 4DKEL 3EBAA 3QQ9C 4KVCH 5JW4N 3PIQA 2DMBA 5MI0C 3ULVD 1X5KA 3TBWB 2FX8L 4OLVL 4HH9B 5E4IA 1Q94B 3GMPA 1FFQA 1A3LH 4CVZA 5FKPB 1MRFL 4HS3A 1PKQB 4NHCH 5JHDA 5GZOC 3FB6A 4H20L 5DFTA 3AS0A 5HY9A 3DO7B 4WFHD 2E27L 4PRAB 5FYKE 1VACA 3SE3A 5CS7A 5HGDB 1Q0XH 5KVEH 3F7VB 3TYFB 4ZUTB 4DQOH 4JFEA 5HYEA 1UEYA 5CP7A 1I7RB 1CICC 2KUTA 3EYFA 2A6DA 5DJZB 3QXDA 1T21A 3EJZD 4DKEH 1W72L 3UTZA 3MRFB 2JCCF 5EIIA 2Z0BA 3Q3GA 1UH4A 3EGSB 3NCJL 3RY6A 3V52H 1RVFL 4OF5A 3OGOE 5INDB 1OWRM 3CVHA 3OR7B 3R1GH 5E7BA 4P4RA 5I9QC 2VLJE 1U0QA 4P4KC 4WRLA 2B4CC 3L5IA 4XCYA 4Y16A 4RX4D 1MRFH 1MAJA 2JK5B 4NQSB 3QQ3A 4KTEH 4H20H 4M7LL 1IGFL 3PGFL 5T1MB 1M7IA 2E27H 1WV7T 1CFNB 5AWNL 2VAAB 1MJJA 2P5ED 2BSSA 4KKBC 3MV7E 5E6YA 4WU7A 1YY9D 3K81A 2YD6A 5EO1A 4QRUA 1BOYA 4DFHA 4W4NA 1EUUA 5HYSG 1CD1B 1NBYB 4Z78B 4OLYL 2PCPA 4WDIA 1W72H 3CDYA 1RSFA 4Z76B 4WFEE 3ZYJA 3NCJH 1RVFH 1GC1L 2ZSVA 3M1BB 4JRYB 1P1ZA 5D5ME 2ZOLA 4PG9A 2J6EL 1TCRB 3SHSA 4POZD 4M03A 2Z8SA 1VEOA 3MREA 4R7DA 4GRWH 4M7LH 1IGFH 2FJGB 3PGFH 3JTSA 3W81A 3WN5A 3GSNL 5AWNH 2VLME 4NIKB 1HINL 2YBRA 2CIKB 2PF6A 3BEWA 1AXIB 4XNQB 4LSDA 2LTQB 1N0XL 4BKLA 3UTPD 2ADJA 3E0GA 1C5CH 4LSUL 4EOWL 5IVNA 1A6ZA 1DFBL 3MODL 4P2OD 3VXRE 3ZKSD 5ITFB 4OLYH 3WFHA 5FO9A 5IHZB 1A6TB 2DLEA 4PY7B 1NUFA 1UCTA 3O6FD 4P2OB 2O5XL 3KLDA 3X11A 2AW2A 4XCEB 3B4NA 1NL0L 1MCJA 4XXCC 5IVXA 4KUCD 5DRNA 3RJDA 3UROR 1D5MB 1N3NA 2C1OB 3BH8B 1CYGA 4R0LC 2FD6L 2NXYB 3UZEA 5TQ2L 5CLTA 3MJ9L 5AG9A 1ZGLM 3KPMB 3WS6A 4M93B 5J11C 3PQYA 3IXTA 3FONB 3GSNH 1RI8A 1EPFA 1HINH 2FECI 3RX5A 4KDTC 1CFBA 3GB7A 2NX5A 5C92A 3GMNA 4CU7A 4KH2A 4IEFB 3MCKB 5DDHB 1QZ1A 2CDGB 2NMSA 3QDJA 1BM3L 3IDMB 5HHQA 1KIPA 1QSVA 2NNAB 4LSUH 4EOWH 4JZOB 1DFBH 3MODH 3MV8A 3T2OA 5E99L 2O5XH 2OQJA 4OLEA 4ENEC 1NL0H 4DN3L 4YHNA 3K0WA 3DPBA 1ZSDA 4TSAL 4GQPH 5EDXA 4GQ9L 5FYLE 3X12A 2V7HB 5DF0A 3FN9A 4HK0B 3MV9D 3KVQA 3L5WB 5DJAB 3VFPA 4NZTL 2FD6H 4ZFOL 1PQZA 5SV4A 2EDOA 4M9OA 4GW5A 3BW9A 4JLRB 3DUUA 4GKZA 4NFCA 3CMOL 5ITBL 4IMKC 4HC1L 4TOYL 3MJ9H 1A64A 2XTJE 4ODTL 4HHAA 4W6XB 2D9CA 3FRUB 5IW6A 1NAMA 1BX2B 2FBJL 4ZD3L 3H9SE 3DMMC 2HTKC 1FIEA 2AJUL 1BM3H 3HNSL 3MA7A 1A1OB 4CMHB 1GGIL 2J8UA 3JWOL 3OG6B 4Y8AA 3V6FB 2XN9B 1HDMA 1C08A 3QBTB 2CKBA 2F54D 3S4SA 1PEZA 4TSAH 2F54B 3NIFE 4GQ9H 3TWCL 4FFWD 1ACYH 4U6VH 4HLZH 3E2HB 2OSLB 4NZTH 2PR4L 1LE9B 3HRZB 3VCLB 3SDAC 1FV1A 1G84A 4FTVE 3CMOH 4XRCB 5ITBH 4HC1H 4OCWL 4TOYH 2Y7QA 2Z93A 4GKNA 4ODTH 4LLQA 3D0VB 5GQBA 4FQQB 2FBJH 4ZD3H 4I0PA 3K7UA 3AGVA 1RJYA 1UB5B 2E9WA 2AJUH 6CGTA 2D31A 4MHHG 3GMQB 3HNSH 1QSEB 1V7ML 1HWHB 4H1LB 2YSSB 5IUSA 3JWOH 1QRND 1S9VA 4Z7UE 4R3SB 2F9BT 1QRNB 1L7IH 5ELIA 4X5XA 4D0BB 2V5RA 3SDCA 1VEPA 2NY0D 1F11A 3TWCH 1I9EA 5DGRA 4CRPA 4ODXA 2NY0B 2GUOA 1MY5A 2PR4H 2DL9A 3CU1A 4R9HA 5DRZA 2E9IA 2Q86A 2GCYA 2OTWA 3NABH 5KVDH 2BX5A 4OCWH 3RDTA 4OGXL 3PHQB 4FQ2L 1QFPA 1X5AA 4NNXB 1MJ7L 1OL0A 4N90E 3KWWA 3G6JE 4NC1C 3WXWL 3TIEB 1ODAA 1U41A 5JMRA 2DQGL 4R8WH 3WIIL 3KPPA 1V7MH 5GGQL 1O7VA 5CGYD 1QO3A 4G8EB 3CIQA 4P2QD 1QEWB 4GFTB 3QIUC 5L2KD 4GAYB 1CQKA 4P2QB 2Y07L 4O9HL 2VXSL 3HB3D 5L2KB 1KSRA 2AK1L 3QO1A 5DD5L 4PS4L 1P4LA 2H1PL 3OF6D 5GRVL 5J8OA 1I8LC 4TUJB 5EBWB 3FQNB 1WZLA 4FQ2H 1MFDL 2E9BA 3SDYL 1DLHA 3JWDC 1BLNA 5C07E 4YHOL 1JPSL 4EI6A 3EYVA 5KTEL 4TVPE 4YC2B 1OAKH 2EE6A 3WXWH 2ARWA 2WW8A 5GHWL 1AH1A 5GRVK 3SKOA 5HHPA 3WIIH 1S8DB 2FR4B 3BIKB 3X17A 1GL4B 1XGTB 1J10A 1KEMH 2W9LA 2CIIB 2L4OA 3GSVA 4RQQA 3MFGB 4O9HH 4B53A 2VXSH 4HV8B 2W38A 3C6LB 4EDXB 4YO0B 3VWKA 1CLYL 3ZDXE 3S5LG 3ISWA 3IJYB 1F02I 5DD5H 4MMZC 4U6XB 2DM4A 5HYFA 4PS4H 4PTTB 5ACZA 4Y1AD 3GUTB 4JANB 3QT2A 5KAQG 2MJWA 2GSIA 3TO2A 1YC7A 4OZFB 1MLBA 3QUXB 1TVHA 4LVOC 3SGDH 4PJHF 4Y5YB 1MFDH 3SDYH 2GIYA 2R1YA 4YHOH 1MCPL 1JPSH 4NZUH 5KTEH 4ZS6D 1C12A 3MCG1 1M05A 4AZ8A 3VGBA 5F72S 3HUJE 4R4FL 3G6JF 5DEGA 5GHWH 3CDFA 2OR7A 4Z77B 3T4AB 5DJYB 2WWKT 4U0RC 4BH8A 5AYUL 1PYWB 4Z7QE 4S1DD 4NO0D 2MMXA 1QTYT 1PSKH 3BKCL 3I6LE 3S3JA 1U58A 4YJZL 3IDNA 4U1IB 2NXYC 1FZOA 3MRQA 2HTLC 1CLYH 4HLJA 1AR2A 1EHXA 1OGAD 3CDCA 3QNYA 3T0EE 3V8CA 4AEHL 2UWEA 4HKBB 4D94A 2QQLL 4M93C 1CBVL 2O5YL 2APFA 3ARYA 3MBEA 3VFOA 4U3HA 1S5HA 1IAIH 1QR4A 1SVZA 5IESL 4P23D 3K8MA 5AAWA 1WLHA 3U6RB 1DTUA 3HC0B 3W39A 3VD4A 4R6UA 7FABL 1P5VA 4FQHB 4N5EC 2Q6WA 1U3HD 5A1AA 4NQED 4ZAKA 1KCKA 3EZJB 1MCPH 1TCMA 5E8DH 1JMZA 1U3HB 1NC4A 5IMMB 2G2RA 3BUYA 1EA9C 4NRZB 1RJLA 4R4FH 4Q9BA 1T2XA 2O61A 5TGBB 1WBZA 2WIMA 1YDPB 1QQDB 3K2MC 5AYUH 3MOQA 1KNOA 3K8KA 3BKCH 3MA9L 3BPOB 3EJJX 3MRPB 3L9RB 1T22A 4R4NC 2AKRB 3D39E 2BNUB 3E6HA 1A7QL 3BGFB 4AEHH 1W2KT 3CZJA 2YZ1A 1I85A 3RL2A 3U0PB 2QQLH 5DD0H 2QADD 3T4YB 1CBVH 4TSCL 2H41A 3EYUH 2FZ3B 4F7MA 1K6QL 2HN7A 3PV7A 3VGEA 3GJFA 3QULA 3QEQE 3K4AA 4QHMB 4HUVB 7FABH 1AP2A 3D18A 1N59B 1IGTA 2IANB 1JWUB 5JR1L 3MTRA 3QDME 2UZIH 1QFWH 4PIRF 5DXWA 2X4UB 4HJ0C 1VHPA 4Y4FD 1JPGB 3B5HA 2V5SA 4GMTH 5CIPA 1WSST 4JPIA 4Y4FB 1DQJB 1V7NL 2CMRL 4PRDB 4YK4C 1RIHL 3QCVL 1NFDB 5DUMH 3DUHA 3CSPA 4Z7QF 4MQXC 3MA9H 4Z7OE 3NBNA 1PY9A 5KSBF 2C4FT 3CFBB 4PJ9D 4XH2A 2EC8A 4FQCL 4MX7A 4PJ9B 1A7QH 3IB4A 3L3HA 1T7WA 1ZLWK 5ICYB 4L3EE 3BRGC 2HJKB 4J3SA 5F8QC 3QXWA 4TSCH 3TPUA 3BWUC 1K6QH 3UTQA 3P77A 4KI5E 1NCTA 2I5YL 3B83A 5DUBA 4NO5A 4MDJA 5E8PB 2GJ6A 2XY2A 4MNHB 1S78C 4ZYKA 3ZT5A 1RIVL 43C9B 5IR1B 5JR1H 2J12B 1VFOA 4Y4KB 3WE6B 5F8RC 1D9KD 3DV4B 2LABA 4F2MB 3OZ9H 3MC0A 1D9KB 2HJFA 1V7NH 4XCCL 5F88A 2CMRH 2IPKA 3RWDB 1RIHH 4DJMA 2UVFA 4UDUA 2LAGB 4JO4L 2DS4A 2MKWA 3EFDH 3N1PC 3UEZA 4FQCH 4PG2A 2HKFL 3U30B 2AV7B 2NXZD 2VZUA 4MQ7B 2BSRB 4G9FE 4DK6A 2NXZB 2Q76A 2G60L 1HHIB 4ZUUA 1ZLVH 5AZEL 1BD2E 4XCNA 4PJ5D 1N8ZB 5INCA 2GAZA 4PJDE 1ZT1A 2BJML 2I5YH 4PJ5B 4B7LA 4FXLA 3VFRB 1F3JB 1QP1A 4CMMA 3OPZL 3KDMA 1G6VK 9CGTA 2IMMA 1S7WB 1RIVH 2VITA 1J0JA 1OLLA 1U8KA 4Y2DD 1OCWL 4XCCH 4YDJA 1QPXA 1EMTL 4Y2DB 3W11C 4Y4HA 4XP6L 1B9ZA 4O00A 2Z8VC 3QISA 5GSVA 4K94L 1O5DT 3MROA 4JO4H 5E00A 5D2NB 3OJDB 2HVJB 3P4OA 3G04A 8FABA 3LKSB 2HKFH 3O2DL 5IMLB 3TV3L 2V9QA 2G60H 1NCBL 5J57B 4WV1B 5AZEH 1U3ZA 1U93A 4NZJA 3C8KB 4ACPA 2JJSC 2H32A 3O4LA 2W59A 4YC2C 4C56B 2BJMH 4IS6B 4P2RD 3ULUE 2NLJA 5EU3A 4K3GA 1P84K 2XPGA 3OPZH 3VXTB 2XZQL 1QBLL 5C0GB 5DYOB 1Z9LA 4CNIB 1SJVA 3VFWA 1OCWH 3NMEA 3P4NA 1EMTH 3BAEL 3C6LC 3MNWB 3RA7H 4M4PA 4XP6H 1EEZA 2ITCB 2NZ9C 4IRSD 5ETUA 1CFQA 1IAOA 1ADQL 4IRSB 3SKNB 5L8JB 5GGVL 2RJMA 3OMZA 3QUXC 3P30L 3O2DH 5JW4R 1MIEL 2YC1A 4HCRL 2QV2A 2BVPA 1NCBH 5IVXF 3PDGA 3MX0A 4OM1L 1PBYA 2XXMB 1K8DA 5GS0L 5K9KB 5GJSL 3VRIB 3AFLA 1QSFD 4O2CB 4PV9A 3GNML 1QSFB 5I75B 2XZQH 2EYTB 1QBLH 3L95A 3V95A 1KIUA 3FOLA 3BPLC 5FUOH 4JM2F 4WEUD 3BAEH 3X14B 4HK3N 1J05A 4XBPB 4OD1L 1ADQH 1OW0C 3MYJA 3SOBL 5I0DA 5DJXA 1WAAE 3C5ZA 5GGVH 2XNAA 3H7BA 2EDJA 2FX9L 5CEXA 43CAA 3VD3A 1NKRA 3GJFK 3P30H 4D0CB 5GRUL 3MNZB 1T80A 4D8PB 1MIEH 2F58L 1IQWH 4HCRH 1YN7A 3FN0L 3H42L 4XTRC 1TVBB 2OL3L 4CVWA 3ARED 1INQB 1UKQA 5GS0H 5GJSH 1QNZL 4LCCA 5F44A 2FDBP 3MV7A 4JKMA 4IIQA 5TE6L 2J5LB 1AXSB 5BZDB 4G7YL 4A6YA 3BO8B 2P5WB 2H26A 4UUJA 3DX8B 1QBBA 4GAGH 1RZGB 5I8EA 1F4XL 2IH1A 3FKUS 1AO7A 3CSYA 1H3UA 4PRID 2LFGA 3RVWC 2AK4E 3E6FB 5CMAA 1MELA 1UT9A 3G08A 4PRIB 2GYSA 1KPUA 3SOBH 5TDNA 5CLWA 5EH1A 4URTB 2J8UF 3HZMB 4HUUA 4PJAB 3MLSL 3RVXD 5GRUH 1JBJA 1D5IL 2F58H 4J3XA 3FN0H 4JQXA 4U4BA 3KHQA 1CZ8H 2WWMD 5BS0E 4N8VG 2OL3H 5D1XC 4K7PL 4HG4K 1QNZH 4OZIB 4J6RH 3FO2A 4KXZH 3OHXA 5C0DB 4YDVB 5LKNA 4G7YH 4G6AD 1JZ7A 3QUYA 1G7JA 4P57A 1TJIL 4KK9D 5KSAD 1SYSA 2GTWA 2EH8L 1F4XH 4O58H 3I75B 3HZYB 2V9TA 5DT1H 2VLRD 1V3JA 1MCKA 4OUUB 2X05A 2VLRB 4ODWB 4L8CA 3TVMC 5BVPL 5FGCE 5F3HB 5ESVA 1BEYH 4ODUB 1X5LA 5JMOC 4RMTA 2IFFH 5C0IB 3LZFL 3MLSH 3PP3H 1T0NA 2CDEA 4GXUN 25C8L 5MERA 3ZKMC 3QQ9D 1D5IH 1U92A 1I8MA 2VUYA 3TFKC 1FJ1B 3LKNB 4XGZB 4Y5XC 4EVNA 5KJRL 5JPMA 3WV0A 4Y4KC 1P7QA 4I3SH 4K7PH 1P2CA 5DD3L 1G1CA 3X13B 4ZPVB 3QWOB 5I8CA 4J3WA 5EO9A 2Y5TA 1TJIH 4QHLB 2EH8H 2PTUA 4M1CC 3EDDA 5FCUH 3ET9F 1CGSH 1VA9A 1JGDB 3FB5A 3KAAA 3L7FA 3NTCL 2X4SA 1NGZB 2V2XA 1UJ3A 2VDPH 5BVPH 4I48A 3QNZB 1G7LB 3INUL 4LKXB 5JW5B 3LZFH 3TBSA 5IEKB 4L4TE 3MMEB 4JQVC 5KS9F 5DJCB 2P7TB 1DBKH 2VN4A 5DLML 1G7HA 1HHHB 3MRGB 2Y6SD 4XWOD 5EBMA 3H9SA 5GGSY 5C0AA 4RZCA 3ARDC 5DD3H 4GMSL 1HOCA 4XVUC 3ARBA 2NY6D 1C7SA 4P5TB 5FYKL 3B8SA 4FZ8H 1IGYA 1GGYA 2NY6B 3HR5A 4RFNB 1AGEB 4PTUA 5B21A 3QIBC 2MHAB 3BRFA 3NTCH 2WV3A 5GISL 3STLA 3Q6FB 2Q1EA 4LDOB 4WV1C 3INUH 3GZKA 4MZ3A 5SWZD 1QOKA 2X2YA 3KGRA 1LK2B 5A2IH 1I8KB 3NZHL 1KULA 5SWZB 1HHJA 4RBPK 1YEFL 1OTSC 1HK6A 5DLMH 3DRQA 5C0BE 3OBAA 2VL5B 2N56A 1RK1B 3AS2A 4PJCE 4WW1B 4Y5VB 3BYYA 4QXWA 4WUUA 4LLWB 3JBG7 3JWOC 4M7JL 4PJIE 2R1XA 5D7JD 2YUVA 1NEZG 4PJ7B 3VXQB 4CJ1A 1CIDA 5ALBL 5D7JB 4MNQD 5FYKH 1NDMB 1ZS8B 3DUSA 4KWUA 4RBPH 3KYMB 4LRIC 3VXOA 3P0GB 4A6YL 4N0RA 1AR1D 4PRPD 5J1AB 1ZHKB 1FFOB 4PRPB 5FOBB 3PDOB 3T8XA 2BFVL 4YHLL 1XR9A 4OZHB 1IILE 2GITA 3B9EA 2F5BH 2VZTA 5HYSA 3FTGA 3NZHH 4Z7WF 4ZNCD 1KEGL 1YQVL 4D0DA 1BHGA 4TUOB 2ZG2A 4OCMC 3BZEA 2DIJA 5D7IB 1Z6JT 4FFVC 1MHHB 3HI6L 4F37F 1EXUA 2UWEF 2O26U 1H3PL 1HHGB 2BNRE 4M7JH 1WWBX 1UXWB 4LCWD 1UG9A 4LMQI 1K2DB 4QHNB 5ALBH 5C08E 3VXUE 3U4BH 1WBYA 1FN4A 4MNGA 5DJ6A 4OGAC 1BIIA 1H3WM 4M1GL 1QLRA 1XAUA 4QRRA 3IDYC 1NUGA 5IK3B 1OAQH 1XH3A 4E42A 2BFVH 3KLAA 2FYYB 2YUWA 1SY6L 2OTPA 4M8QB 4GSDL 1B0WA 3DSFL 5K9OA 1A14L 3MRDA 4EXPX 4HFWA 2WBKA 3GEWB 4QO1A 4YPJA 3O6KL 5HGAB 1CG9B 1KEGH 1NGXB 3RVVC 1WZKA 1YQVH 4ENED 3PHOA 4HUWB 3NFNA 4X7TA 3IKKA 1T1XB 3BKYL 1XCQA 1H3PH 2A9NL 1E4JA 5C0FA 1Q9OA 5DMJB 1NGWA 1MUJA 1ERNA 2YPLE 3WCYA 4E5XB 2GJZA 4Z7VA 5I76A 1WF5A 2VIRB 4K3JL 4JN2A 2EXWD 5C0CE 4M1GH 1INEH 4JAMB 1OSPL 2KBGA 3IVKB 1TZIB 3GSRB 2X41A 3U7WH 1JZ2A 5EG6C 3VFMA 3DVNB 4F3FA 1SY6H 2M8XA 1ONQA 4GSDH 3DSFH 1A14H 1U6AH 2VXTL 2KQNA 5JOPD 1K4CB 3O6KH 1GGCL 3X3FH 5FAAA 3HE7C 1DANT 4NPYA 5FYLL 4J4PC 2I07B 2MCG1 3ARGD 3HG1D 4J12A 2G5BA 4GRLA 5SX5K 3ARGB 4PJ8C 4K3DL 3HG1B 3BKYH 4DKDC 4WWKD 4WU5A 1RUPL 1IKNA 2A9NH 5HGHA 4F9PA 3IU3B 3BWAB 4WWKB 3HUJA 1JGVL 4RAVA 5FKAB 2NY2C 1KB5A 4NO2B 5I17A 3CUPB 4GW4A 3FMGL 1LNUB 3TBYA 1VADA 4PBWD 3OKKB 5EU6E 3QJHB 3O45B 3NFSL 1OSPH 4YIQA 2ZZUT 4QRPE 2AS5M 4Q58C 4KPHL 4HXAL 2APBA 3K74B 3VFUB 4ELKA 1T2JA 3W0WE 1EZVY 4DKFH 2VXTH 4K3HA 1AKJA 1GGCH 4UOW0 1EERB 5FYLH 1VFAB 3UCRA 1U36A 2VYRE 4OKVA 3ZO0A 4LLUA 4N9GB 3N9GL 3UYRL 4PJBA 4OZGB 1IGIL 3EO0A 4K3DH 2D0GA 2OJEB 1B2WL 3O3AA 2YUZA 1RUPH 4JDVB 5CJ5A 1JGVH 4FXGB 4KJWC 5EUKA 4H8WL 1UZ8B 3FMGH 4GRMB 4JFYB 4XT1C 4NKMB 4RISL 2I9LA 2QHRH 3WFZA 5HDLA 2J7LA 3HS0B 3NFSH 4HKJA 3HHRB 2DQJL 3O3EB 1N2RB 1LO5B 3SGJC 2VQUA 4MB4A 1OTTC 2P5EA 5A2KH 1OD7A 4KPHH 4HXAH 1FG2A 1MCWW 2C3GA 3H9HA 4X4YA 3NPSB 5D6CA 4HZLB 1FVEB 2XWJA 2XKUA 1MRCL 4U49A 3SO5A 3V5HB 5DMYA 1EZVX 3RWGA 5SWSD 5MEQA 1N7ML 4Y0GA 5HDBF 4PPTA 4LVEA 4KMQA 3HAEH 5CSBA 3UYRH 3N9GH 1CCZA 1SVCP 4P5TC 4DOHB 4XNUL 3DECA 1IGIH 1DR9A 1BQLH 4JY4A 2QLVB 4O5LL 1WWAX 1B2WH 1FNGB 3QDMA 1FFPB 1FNLA 2IWGA 2RQ8A 3NA4A 4ORGB 1F3DH 1ZGLA 3VH8G 1FL5A 1HKFA 1S7TA 3MYZA 1LE5A 4I2XB 3IDGB 1KJ2A 4XNMA 4V1DD 1A7OH 4H8WH 4V1DB 4RISH 5JNYA 1KOAA 3U46B 5BV7B 1DEDA 1GOFA 4L8DA 4BSVA 3QQ4A 1YPZE 2DQJH 5K9QI 1HWGB 3KJ4B 5CZXC 3WNMA 5IB1B 3D25B 1OTUD 3TNNB 5ENWA 1I1YB 5DC0A 4PRBA 3V7MA 2K7QA 2DF3A 1HEZB 3HE6A 5AD0B 1A2YB 2FL5A 1MRCH 4JO2L 2HP4A 5T3XE 1MHEA 5EFIB 1N7MH 3VGAB 5ERWB 5BO1L 4OLZH 3DBXB 3O6FA 4XNUH 4ZUVB 1CDCA 5HJ3B 3QEUA 3VDCA 4BH7A 3ZL4L 5DSCB 1CTOA 1WFNA 4NQDE 4K07A 4LEOA 2H8PB 3VG0L 3VXSD 2Z31A 1J0KA 1LWRA 1UYWL 4WVRA 3VXSB 1UCBL 4MA1B 2AXFB 3HPJA 5F7NC 2NY3B 2DDQL 2X4QA 3C9NB 4TVPL 1I3VA 1FRGH 1ZT7A 3ME0A 5IB5B 2Q7YB 5EBGA 5E56A 5F6HJ 3DVFA 1DQQB 3ESUF 2R2HB 2XG4A 1IGCH 4X98B 3D69A 1DE4A 2VERN 1SQ2N 4XCFL 2JCCB 3OAUL 3SGDI 3W9DA 5E9DB 3KPQA 1QA9B 4JO2H 5KANG 3D6GA 4WNQB 5KW9H 3EOYG 1I1FA 1MNUL 4R96A 4RDQF 5BO1H 4RAUB 3S5LA 2XI9A 4NZRL 2RB8A 2PO6A 2X6MA 1SBBA 5ANME 1J8HE 5DJ8A 3QAZC 3ZL4H 2P8PB 4PGEA 3PE9A 3VG0H 1M6OB 2KQMA 3MV9A 1T5WA 5D93B 2JTDA 4X6CB 3OJMB 3VFGL 1UCBH 1JYVA 1E28B 5JTWA 1T6VN 2DDQH 3IF1B 4M61A 1FGVH 5BW7A 1JHKL 5I66A 2DQFB 4WO4A 1ZHBB 5F3BA 1UZ6F 1KB5L 3B9KC 3FOMA 3VE0B 3RZCA 3F65A 3WHE0 5FUCC 5HD8C 3BPCB 3FB8B 4NKOA 5GS2D 3F12B 4KK6D 1DN0B 1MNUH 1XZ0B 1ZT4A 2Y25A 1I7TA 4ONGH 3VGDA 4LLDA 4LLAA 2ICCA 5CINL 1UJTA 3CFJA 5F6HI 1J18A 3ARTA 2ICWA 1RZJL 2VTFA 2XFXB 3VFGH 2X42A 4XRCA 2QQQA 4DKAA 4F7TA 3MRCB 2CPCA 4NP4L 1JHKH 2PYFB 5A16B 3RVUC 1GZQA 3WIHA 1K3ZA 4ZO6A 4QLRA 1XIWC 5HVWA 4PV8A 3HLAB 5TDPA 4W4OC 2C4XA 3QZWG 4QCIA 4HWEL 4JPVL 2RCSH 4X8JA 3QO0B 2UY6A 3S36L 2YEZB 1YN6A 2VDLH 4BFIB 4HKZA 1FC2D 4Y19E 1HQ4B 3QDGA 4P46B 4ZOEA 4HD9A 3I6KA 2PW1B 5J6GA 5CINH 1NQBA 3TZVC 3FQTA 3S96A 5DMKA 4UBDC 5J13B 4LCYA 1YZZA 1HH6B 1BZQK 5DHVA 2R2CA 1JZ4A 1S9XB 4KU1A 3RGVA 2DQDL 3RWCA 1T66D 1KXVC 3BHBA 2EO1A 5EZJB 2K7PA 4NP4H 2RBLA 1E27A 1WAAA 2VLKE 3SCMD 1KJ2L 4RGNE 4KC3B 4ZTOL 3SCMB 1OP9A 2MFNA 4NNYB 2ATKB 2F74B 1N6UA 4AK1A 4JPVH 4JY6B 5DFVC 2P24A 3QEHB 1YMMD 4GBXC 5GS0C 1B0GA 2ADGA 3S36H 2H45A 1YMMB 1LO2L 5I2IB 3Q5YA 4JCMA 1H5BA 3QI9A 4NKIL 3WNOA 3IDJA 4PJFE 4NFBA 1AFVL 1FYHB 4WEBL 2DAVA 2WAHA 5EZIH 4WHTA 2NY7L 1VFMA 4JFXB 3RPIB 1AE6L 1IAKB 1S9YA 4ZOCA 2BRQA 1TDQA 1CFSB 2G75B 1LEIA 4UT9H 2DQDH 3MGOA 4LSSL 3T2NL 1NMAL 2DQEL 3FHAA 4KKNA 3UYPA 2X4PB 1I7ZA 5E4EC 3NPSC 1J0YA 4WFFE 3REVB 1OWWA 4KJQD 4ALAL 5IVZB 4P48A 1FZMA 4ZTOH 3ZKXC