3L1FA

Bovine alphaa crystallin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
97
Chain Sequence
SEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVERAIPVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of truncated alphaA and alphaB crystallins reveal structural mechanisms of polydispersity important for eye lens function.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
molecule keywords Alpha-crystallin A chain
total genus 16
structure length 97
sequence length 102
ec nomenclature
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l1fA01
2CR0A 4YL9A 1EJFA 3AABA 3IGFA 4MJHA 4ZJ9A 2N0KA 4JUTA 1WFIA 4FEIA 2Y1ZA 1SHSA 2O30A 3GT6A 3N3EA 4M5TA 2K8QA 4PCKA 2BOLA 4YLBA 3QORA 1GMEA 3L1EA 1WH0A 4JUSA 3Q9PA 3AACA 4YDZA 1RL1A 5LUMA 2XCMC 2KLRA 2JKIS 4YLCA 3J07A 2WJ5A 3GUFA 4RZKA 4M5SA 2N3JA 2Y22A 3VQMA 1X5MA 3Q9QA 4YE0A 3L1GA 5DS2A 2MNWA 2KMWA 3QORD 4PBDA 3W1ZA 4ELDA 3GLAA 3QORB 4I88A 2RH0A 1WGVA 3VQLA 3QORC 5DS1A 2Y1YA 2CG9X 3L1FA 2WJ7A 3EUDA
chains in the Genus database with same CATH superfamily
5J6SA 3PWJA 4KFMA 3EGDA 1AXTL 3PGFL 3IBEA 5AL8A 1ZHLB 2ZOOA 5CJBA 5KSBF 4LLDA 3NTCL 3QIUB 5FLUA 1U3HD 2QSCH 1AHWC 3EYVB 2MHAB 2W92A 4FFWC 1CDGA 1MFEH 2CUHA 1T20A 1ET7A 1A8JH 1BMZA 1NAMA 2Y1AA 1IM9A 1AP2B 4OF5A 3WXWH 2VNCA 2WIMA 4L4VB 2W0FB 4BEIA 3H0TB 3AB0C 3TCLA 3CDZB 1OAUL 4PR5B 2NY2C 2YA2A 3FQWB 1CL7I 5FW8A 5GRUL 3U7YH 4APXB 1MHEA 3EO9H 1BLIA 4XAKD 5DK0B 3GGWA 4Q7DA 2DI9A 1TO5A 1T1XB 3S8FB 5FCUH 3VD7A 3SGDH 1IGTA 1UM6L 5KBLA 1YJDC 3L3IA 2NY3C 4PWFA 1EFXD 1RUAH 5JO5A 1FFNB 3RBSA 2ZZUT 4E9RA 4WKZB 1I1YA 5FV1L 3C2AH 4HQQL 3O4OB 5IB2A 4DGIL 4RFNB 1FYTA 3ARUA 4FQ1H 3A4AA 2X4PB 4J4PC 1U95B 5ABDE 2XRAL 1FDLH 1UKQA 2EDRA 2R27A 3NEOA 4B5EA 2WGNB 2EDDA 5ISZA 1I8IA 2EEAA 1P84K 1SMOA 3K0YA 4Z7IA 2MNUA 3WN5A 5K9QI 3U7YL 2LLLA 4KK9D 4LSVH 3JVGA 1ZWIB 1TVBA 1EEZA 3AREC 3WNNA 4MNQE 5EO1A 4QRRA 3LZQA 4UT6A 4V2CB 4N8CH 3MCLH 1P1VA 1NWPA 4YXHL 3S6CA 2BVUA 4LVHC 1AMXA 1TYRA 4KWUA 1J5OH 3IJYA 4XPAH 3HVDA 4HCRA 3VMOA 5E9DE 2CDGA 3DMMD 3MRGA 3VVVA 1MCHA 3RDTA 4TULL 3WUWG 3VMPA 2YAOA 2DH3A 4JFPA 5L88H 4X0NA 2L3BA 1NGPL 2QHLA 3RVVC 3KPPB 2FX7L 4WTZG 3QEQD 2P7TB 4WY7L 1UD4A 2PXYC 3VH8G 5IOKA 4X6FA 2V5SA 4K07A 3WJLC 1EEYA 1WFOA 3MRQB 2V7HA 4JFFA 1AZUA 1A9BB 4HIPA 2WY3B 1WZAA 2CO6A 2VRAA 3FCBA 2HPTA 3T0WA 1QEWB 4KKAC 4ZFFA 3MLSL 4N8VB 2F19H 1KCUL 2E47A 4OV6F 3CSYB 2J4WH 4LDEB 4DJMA 4MXWH 5BRPA 3DDGA 1E4XI 2R0LH 1Q0YH 1OAZH 1FN4B 3TURA 4JDTL 5EZIL 3VCLA 3E8UL 4IEFB 4YDIL 4HKZA 5F3HB 3TONA 3INUL 1UC6A 5KVGE 5KAQF 1SF5A 2AXHA 3I75B 1H3TA 5KYYB 2AGJL 4HXBH 1YMHB 3PDOA 4AWJC 3IMUA 5L4FA 1SXSA 3NSYA 2XETA 5AL0A 1PZUB 3N42B 4PRPB 4P2CG 2KBGA 5IP4A 1ZVHA 3KHOA 4DVBB 3CCHB 2ADGA 3OKYA 4NI6A 1W9XA 4FNSA 1QFWH 1MCSA 4G8EA 5IT2H 3BWUC 4DZBA 3GMNB 1KV7A 4MAZA 4XHJD 4U1MA 1BIIB 3MRJB 3IMVA 1J8HD 2WLMA 1JHKH 3MJ9H 4AW7A 2VQ1A 4W6XB 2GT9A 4LRNL 1YEJH 1RJZA 3OLIA 3K74B 4LDOB 5CLXA 3STBA 5TDPA 4ZS6C 1U8QA 4U3SB 4ZUWA 1PZ5B 4GQ9H 1KGIA 2AKRB 5C6TL 3V7AG 1B4RA 2HTKD 2YXMA 4O9HH 3O6KH 3DJRA 3K6OA 4JO8A 4OM0H 4U1NA 2E56A 4F15C 4FXGA 3MRHB 5HHQA 1JK9A 2NLJB 4HUMB 4TUUA 4ZMTA 3ZT6A 3CPLB 4X7EC 3T3ME 1OSPL 1QWHA 4X98B 1EJOH 1LP9F 2H26B 2BO0A 2YFNA 3ABKB 4QGTA 2R69H 3QJZA 1FVEB 5D6CA 2LAAA 1FVCB 3BKYH 4F8TA 4UZGA 1XF2B 4X9GA 1AC0A 4QRUB 3SN6N 1E9OB 3GHEH 3EHBD 2P48B 5GGSY 1DANT 1FZJB 2J4WL 1JXKA 2FQDA 1B3IA 4JRYB 5DEGA 5F6IC 4PY8I 4AQ1A 2BMKB 3C08L 2CHDA 2ZPKH 4PJEA 4KX8A 1Y1UA 4HPOH 5F7DB 3DTUB 5GGTH 3REWA 3S35L 1DUZA 4YHOL 2ZKWA 2JI1A 3D3VA 1CJYA 4B3VA 2VDOH 3CIAA 5FA4B 1A9EA 1C5CH 5I1DB 4OLWL 5D72H 2N56A 4R4ND 4QOKB 1OIOA 1KGUA 1R3HB 3DUHA 5B7EA 1XR8B 3CQPA 4TRPL 2VXUL 3HLAB 5LWYH 3HE6C 5DVKA 1UZ8B 1ZEAL 2FATL 3VFPB 2C9PA 1CICA 2DS4A 1Z3RA 3HS9A 4NWTH 3OMZA 3BIKB 4OGXH 3BP5B 2AI0H 3T0EB 2QT6A 2ROXA 4BBWA 2UZIL 3IKCA 4LXFA 3EUDA 1MJJB 3FC8A 5E5UB 3F7QA 4WK4B 4DPAX 3P9MA 1BXAA 3INOA 3KPMA 3B2UC 4A6YL 3KLKA 3IRPX 1F4WH 3CD4A 1KSRA 2GEEA 3RPKA 1WWBX 2EIBA 2YQ3A 3OLDA 5EB9A 1TENA 1UENA 4X9BA 3MR9B 1MCWM 4M48L 1KYDA 1T7XA 2IOOA 1XAUA 5K9KA 3N85L 4OJYA 1XZ0A 1ZT7A 3IXTB 3DOHA 5LNEA 4ESKA 1UJ3C 4G1EB 3FSZA 1RU9H 1XD1A 3HNTL 1CK0H 4PHXA 3V0WL 4OCRL 2F68X 3LDBC 3PABB 3DDFA 4PJDB 2DMHA 3S3BB 5FM4A 1MJ8H 1Z3GH 4PGEB 3RHWF 4I9WD 3EO9L 5CJ8A 5CJQH 4DTGL 4ABUA 4PIRF 3PWPB 3ESMA 1I85A 3BSZA 2B5IB 1S7QB 1NGWA 4DP0X 2VWEE 2B16A 2DBJA 3T0AA 4YH6A 3C2SA 1CR9H 5D4JA 4RWYH 2AZAA 1OCCB 2WANA 4PTTB 3ZE0B 5AKTA 3QIUA 1U8MA 5FO9B 5FYLE 1H8SA 3RI5F 2QVMA 5AVZB 2QSCL 2MHAA 2OCFD 3NSCA 2YSSA 4HIHB 5HYSA 4LU5L 5L8JB 3Q1SL 2JTYA 4RLDA 4GEIA 4YXLL 3O11A 3BDYL 2IGFH 4JMNA 3HI6H 4D94A 2VDMB 2YRLA 4MJIB 4OF3A 4O4YL 3PQYE 2HMIC 3BIBX 3FQWA 1SJEB 4L4JA 2AJYL 1GAFH 4K3JL 5LDSA 3HG3A 4U7MA 5BZDB 3OHXA 2O6PA 2K4WA 1N8ZB 4Y16C 4UT9A 1T7WA 4CNIB 1A6WH 2G3NA 3MKGA 4DGIH 4CMMB 3D0VA 5DR5H 3L17A 4FNPA 5F1IA 2C4FT 1U2YA 5G5DB 1FPTH 5F0LB 2DL9A 1IEHA 1ND0A 4B50A 1RY7B 3QQDA 3A67H 2CHZA 4H8WH 2UXFA 5ISZB 2HT4C 1E5YA 5SWZD 5HDBB 4KPHH 4ELDA 1X5IA 4K94L 4PB9L 3A21A 1KIUB 4H40A 2OLDA 5JTWA 4E9VA 3T65A 2DI7A 1EEZB 4HMDA 3BIAX 4HU2A 3CX5J 4LAQH 4OF6A 4UT7H 4H8QA 1KBVA 2OMXA 1L9SA 3WG7B 3SPHA 3ARBC 3G5WA 4FHKA 3OX8A 1WFTA 5MERA 1N0XL 5F70A 1YJDL 1K8IB 3D3VD 3K2UH 5C2BH 4AEHH 1OPGH 1JRHI 2BHZA 4NZUH 1ACXA 1UYWL 4XO5A 4B41A 2YD0A 3Q1SH 1IGYA 3ECQA 3NCEB 3ZDZF 2NY1C 1HHKA 4LVEA 1J8SA 1RK7A 2AQTA 1AXIB 4GRWB 5EUKA 3Q6GH 4YSEA 4DUWA 3JWOL 2J5LC 2FT7A 1JGUL 4MD5A 3TN0B 3DX9B 1NSNH 4I5BA 4TF4A 4V1DA 2ZP9A 4KZDH 5SWZE 1QR1B 4OFKA 4JFFB 3ZSTA 2GJ6B 1OP5H 1F3JA 2VL5A 2XZCL 5C0JB 3BMVA 4XNZC 1RZJC 1EGJL 2W1NA 3QWRA 4A2FA 3DV6A 3BUYA 2ENJA 3H7BA 4IYKA 3N9GL 3CH8A 5D71H 2J6EH 3VFTA 2J5LB 3H2QA 5C09B 1X4XA 3KJ4B 4C83B 4YXKH 5HPMB 2IH8A 3HC0B 4IEFA 2C9RA 2JWYA 3FKUS 4I4WB 3GM8A 4O51B 3B5TA 3TEUA 4MAYD 4KVCH 2N0KA 4QXWA 3BJLA 2XN2A 5HTSA 4GYBA 2DTML 4KZCA 4XC1H 4P3DA 5JDSB 2IPUG 3LQAH 3RB7A 1HCZA 3H4HA 1ACYH 5EBWA 3UIYA 4PRPA 4CC0A 4QTIH 3Q2WA 4N2KA 2EZ0C 3VXRB 4HUXA 4G8EB 4DUVA 4JRXE 2WB7A 5HY9B 4NGHH 2TAAA 3W2DL 1YNKL 5I23A 2K4AA 2GTWB 4M56A 2VQUA 1R24B 3IU4L 4P5MB 2CIIB 4NFCA 4U1MB 4GKNB 4EI6B 2A4ZA 1YYLH 3TEYA 2GYSA 5EORL 3BHBB 3UL4A 2O30A 3DOIA 3EF7A 1KEGH 5D1XD 4KRPB 1FYTD 3FNKA 2DEYX 4WHYG 5FYKL 4HJUA 3NZ8A 4NQDA 4LEXH 4DIXA 3T04D 1H8OA 3NP4A 3KXFD 1J05B 4FXGB 2UY6B 4K5LA 4N25A 5L4MA 4NC1E 3OZ9H 2MNWA 4NJAH 4NQSA 2H26A 5IGXH 4PJ9C 4AGNA 3GZOA 1WISA 3L4VA 4N6QA 5CMAB 1FVCA 1QAWA 2WVUA 4ELMB 4KJWC 1HAUA 3VXMB 3VWJA 4HPOL 1FV1B 1PY0A 2GITA 1XGUB 3AXHA 1KELL 1DE4B 1RKRA 3OLGA 2BMKA 3HG2A 3NPSB 4IOIB 4PJEB 5FFGA 3W9DA 3P77B 1M6UA 5F7DA 1CFMA 1T0PB 3TBCA 1ES0A 4HWBL 1I1FB 3MJWA 1E0OB 3EH5B 4GAJL 3CFBB 1JXFA 2YZ8A 4XVUD 3B3BA 3MFFB 3RG1C 1TETL 1JPTL 1LLAA 2AQNA 2AXGA 1R3JB 4GW4A 3CVBA 3ISRA 1G7LB 4UV4L 5C0ND 4AYGA 1T03H 4MHHI 4NN5B 3UPRA 3PDGA 4YPGB 3APDA 5GGUB 3ARWA 2ZCKH 4DUXA 2WM0A 2ZD0A 1VIWA 3V4UL 2CKBL 4Y1AB 5DVNA 4H0HB 5F0PB 1UFUA 2EDFA 2IFFL 5INDB 3RU8H 1MLCB 4AG4L 4MB5A 1CL7H 2CIKA 4DN3H 3G6DH 1MCOL 4UM9A 2B1HL 4XP9L 2HG5A 1TQTA 4P99A 5IY5B 3DX2A 4X7CC 3ASOB 3KGSA 3MN8A 4D3CH 3P9MB 3K71B 4EXPX 2QFPA 4WKXA 1UJ3A 5A6MA 5JA9A 1G9EA 3QI9B 2QEJA 4BHUA 2HJFA 2UWEE 3F7KA 1D9KA 4UQ3A 4YSPA 2P49B 2VDLH 2A77H 3L16A 4QF1A 4W4OA 4ENZA 5DLML 1JYXA 4KZEL 3CQFA 1QFWL 1T7ZA 4ONGL 4NAQA 5HHOA 4GBXD 1KC5H 4HC1H 1DBAL 1YC7A 2CKBH 3HB3D 3KJ6L 2MKWA 1F11B 4ZW3A 2IDQA 1XMEB 5ANHA 2VKXA 4E9QA 2UYLA 5JOFB 1HIMH 3EYQC 1I85C 5DRXA 5A3IC 1I8KA 4R8WL 5IEKA 1XDTT 2I07B 1KB5H 3WUWA 2E0PA 2J71A 3A47A 1LP9E 2F54B 1ZLVH 4H1LG 5MP6H 2CNZA 3QYNA 3V0VB 2IGTA 1PG7H 4K8RL 5I74C 3R8QA 3FULA 5DQJB 1J9TA 2LGNA 1T5XA 3FQUA 2Y23A 4W9GC 3RNQB 1ZJAA 5GGVY 4QHNB 4U1IA 2W80C 2W91A 1QSFE 4LL9A 1DBAH 1CYGA 5FV2A 1OGAE 4HF5H 3GBLA 2XHNA 3SCMA 5FO9A 1DQLL 1GAFL 4K3JH 3HFML 2HCZX 4WY7H 4JFWA 3T6XA 1S8DA 2CNYA 5T3ZE 4MXQC 3RWEB 5I76A 2NY5C 2BIOA 4XP4H 4JDZA 4ZX5A 4YXLH 3SB3A 1L4IA 3RVXC 3HR5B 3HE7C 2DIBA 1AFVL 2ZJSH 5E4EC 2YRBA 2I9LB 5HD8C 1SJEA 1U8PB 4MRCA 2NT0A 4ZFZB 5J0BA 4S1RH 2F7PA 2KLRA 4TNWF 1IC5H 1NUFA 2BC4A 1UCTA 5IEHA 4GSDL 2EDJA 2X6UA 2OXGA 2JKRM 4L1HA 4XXCC 3HFMH 4KVPA 2JK5B 2WXJA 4JW3A 5JPNA 4ZJ9A 4N0UB 2OMWA 3ETBJ 3JV5A 2VLRA 1NCBH 3GLEA 4FNLL 4HXAH 3QQDB 3MLUH 5DZVA 5GGTL 1G9MH 2K78A 4MMYA 4AX3A 2JKJA 4N9OB 5AOZA 2UY7A 2CLRB 4WV1B 1V3LA 5DUPL 4DT2A 1LEIB 3WKPA 4A63A 1NTDA 4YSDA 1ETZB 1K9TA 1YHPA 4CADB 2DF3A 3T65B 4W6YB 1PS3A 4XWGH 3V5DA 4M48H 3UIZA 3BPOC 1HFUA 4DP9X 4XPTL 1TTRA 2QLVB 5LGHL 3OX8B 5MERB 4A7GA 3K7UA 1HYSC 4XCNA 3B5HA 3ZT7A 1B6DA 4CU7A 1XGYL 2HVBA 2WZAA 2E7HA 4JHVA 4FQ2L 1IGYB 1OB1B 2NYZA 3GTTA 2CCWA 1HHKB 1JV2A 4KZEH 2IFGA 1IL1B 1K4CB 5D5MF 5CILL 5JOEA 3ULVF 3FUMA 3LSOB 4L37A 1UXWB 4YUEL 4F8OA 4RDQF 2Z31B 3IU4H 4Y16A 5CEZH 4NQEA 2VH5L 4X4KA 1E28A 2D73A 2E7MA 3OC5A 4MKTA 1GTFA 1ZHKB 1W16A 3DV6B 5IT2L 3CZLA 4X6BA 4JRXD 2DEXX 1LDSA 1FBIL 5HHOE 5BQ7A 3OGCB 5EUOA 1O9VA 4ZS6D 3O2WL 4PJAE 4X4XA 3TT1L 3HC0A 4PBVC 4V1DE 1OHQA 2QADD 3CXFA 2ARJB 4DOHE 1G1CA 4LCWB 4PJFB 3PF2A 3KH3A 1JDDA 4LCYA 4ODTL 3OAWA 2WUCL 2ZOLA 3MGOB 3OKLA 4I1PA 5EZIH 3QUMH 3SY0A 4U1LB 4FMVA 3V7MA 2EE0A 1P4LB 3PAVA 4ANXA 2P5ED 2SEBA 3ZU8A 4K3HA 1FCGA 3UZEC 2BDNL 1T6BX 4NC2B 1U8LB 1I53A 3JT0A 1PNDA 4AJWA 1OSPH 2GTWA 3GRWH 3TIEA 2XZZA 3EH3B 1RCYA 5LUMA 1OCZB 4PRHA 3KPRA 5TDOB 5ALBH 1UTDA 2FT8A 4ONFL 4K15A 1DN0B 4FEMA 1IRAY 1Q9OB 4XBGA 2ZF9A 4YZWA 4XOAA 2XWTA 3BHBA 1I1AB 1MDAA 3QH3A 3ZQ9A 5E2VL 3ARED 1QSEE 1S3KH 2FJHB 2P5EB 3NZ8B 4MCZB 3ME0B 4KXBA 1S7RA 3Q1EA 3V6ZB 1IC4L 1H3UA 4LEXL 3ZKQD 3STLA 2R4SL 4FQXD 5E2WL 1OP3K 4ABQA 3IDJA 3CAFA 2R8SL 5CWSA 5E5RB 4NQSB 3L5WB 1G6RA 5CUSL 4JN2B 4JZNA 4NOFA 5AW7B 1A1OB 1ZKAA 5DD3L 1FNSH 3IGUA 4XH2B 4NKDB 1I1CA 1ZE3H 1DVXA 4KK5D 1CI3M 4OLZH 4YHLH 5IK3A 3HPLB 3ZKMC 2UUDH 1FV1A 3VX0A 4R90H 4NB7A 3IS0X 3F01A 4HJ0D 4OFIA 3W9DB 2GBAA 2P8LA 2E74C 3ILPA 3FB8A 1P5VB 1TETH 2D2CC 3QUKA 1XF3A 5EC2B 5D2NA 3DO7A 3GS0A 5LGYA 2GABA 4APQA 3C2AL 4HQQH 1R3JA 3Q6FA 1T2QH 2FX8L 3O2VL 4YPGA 1Q9WA 2ZIDA 4OZHE 4LMQI 5GGUA 5A2FA 5A2CA 2KERA 2IDSA 3TJEH 4IMKC 4OZIB 2ZYRA 3VH8B 3T2PA 4X80H 2ZF8A 3B83A 1V7ML 1MHHA 1ZCRA 5E6IB 4NI3A 3W0WA 1MLCA 5I1KH 2D3JA 4DNLA 5GZND 4V2BA 4AGPA 1A14H 3BVUA 1Z7JA 4GI9A 4CVZA 1AIFA 2GK2A 2YMXL 3BD4A 4Z78B 1KBKA 3IAPA 1H3PH 3MRNA 2VZOA 4ZPVA 3CZGA 3UG3A 4ORGB 2G2NA 4UQ3B 3MNZA 2GJ6D 5DHMC 5FO2A 1DQQA 1JZ5A 1PY9A 3VXOB 2XZAH 3N41F 3L5JA 4J3VA 3WFEH 1CIUA 3BP6B 1D7BA 3VDBA 4W9FC 1BJ1H 3VWJC 5DZOA 2EIDA 4D2NA 3CHPA 5IEKB 1UZGA 2K6WA 4PP1D 3P40A 4JY5L 4AYMC 1W8OA 3H9HB 3L48A 1JZ3A 3TYFA 1I8UA 3WDHA 3ZIYA 3X13B 4HDIA 5FM8A 4F91B 3QDHA 5JHMA 2HRGA 5CZVL 1T5XB 3RNQA 3ARZA 1S3RA 1CT8B 3Q2NA 3U4KA 2DWYA 1YEGH 2JLPA 3WFBL 3ZYOA 1A64A 1R5VA 3L1FA 3FT4A 1KCSH 3MJ9A 3UG4A 5IUSA 1LO2L 5F1OB 2NY0C 8CGTA 1HOCA 3PYCA 5BV7B 1QPKA 2VLJD 1NMCC 1UWGH 4AL8C 3H1ZA 3EYUL 4MNGB 2O26U 2YMTA 3FZUD 5GZNA 3BSZL 1FRGL 3US0A 2IQ9L 4GINA 5C07E 5FO8B 1WCBB 2DWDB 4A7GF 3QEGL 3CVHH 1NA8A 4FFZH 4HCIA 2Y7MA 4KRPD 1WAPA 5C0AE 4BK4A 1OAYL 2HLFC 2VXQH 1L6PA 4JM2D 4WCYH 5IB1A 4I3SL 1K85A 2X4RA 3EJCA 4RGNC 1AQMA 2WYTA 5C0GB 3BDYH 1YPZA 2WWMD 5ID0B 3W37A 1SQMA 1JHKL 1CLYH 3MJ9L 5IHZB 2BJML 2GJPA 2Z6FA 3TGXA 2AEOA 4EIUA 4MJ5A 1UD8A 4K7PY 3PHAA 3QWOA 4N0YL 5FFLA 2D7TL 4G3YL 3KMDA 2QLYA 2YBRB 1ASOA 5EWIL 2YFOA 1AXTH 5DVOA 1S9KC 2OXGB 1T6WA 4JVPA 3HC4L 1KN4H 1BW8A 2R29A 4DN4L 5DJAA 1I75A 2Q86A 4FA8A 4ISVA 1NCJA 5JPNB 2DH2A 3PUUA 4XP5H 3UTTE 1CR9L 1RZPA 4EI5B 2X44D 4MDIA 1TUPA 2DWXA 4N20A 1AI1H 1NAML 1OT1A 2P5PA 5I6OA 5AOMA 2J43A 3MBXH 2DWEB 1CI5A 4KTDH 2NSXA 1MCNA 4Z95H 4KV5F 1PCXA 1M7IB 4JCLA 4FA6A 1CD0A 2CR3A 2E3VA 4HP5A 5HP5A 1CF8H 1TJGL 5TPWL 4HHAA 2VDPH 1L3WA 4CL7A 4W9LC 1FHNA 1JUFA 2UV3A 1KTBA 1N59A 2BXZA 3FRPG 4FXLA 4N9GA 3SCMC 2WCSA 1NMBH 4LLAA 1RVFL 2XU9A 2AV1B 1R17A 2XN0A 4N87A 4S2SA 4XPBH 3UOAB 4GG6A 2BSTB 3W5MA 3B5GA 1BBJA 1NLDH 2BSDA 3TBVB 3LRLA 4BXSV 1JMZA 1Y07A 3QUYB 5DJ6B 3UAEA 5KYWA 3T5WA 3WE6A 2BSCA 3C5SA 3VXRD 3VXSA 1Q4NX 3ARDB 3RTQA 4W9ZA 1KV3A 4ZW6A 3GXDA 4YFLF 3FRPA 2Y7NA 4EN2A 3LSOA 4IBTA 1IIIA 3CFKB 4LMQE 2W88A 5EU3B 3TT3H 3BEWB 2WO2B 4Y16B 2R56H 2YIHA 4OLYH 2FWOB 3W9EA 4AKQA 1PD6A 3EO0B 2FSDA 4J6RL 5I15H 3K6SA 3RY6A 5IQOA 5I1GH 2Z35B 3RGVB 4XI5D 3G6AB 3JVGC 5BQ7B 4HA1A 2ESVA 1PKQE 4JN1H 4WFHD 4ZMXA 2W0LA 3PHSA 1UWEL 4PB0L 4RBPH 4L29A 1UWGL 1KCRL 5T1MB 2VAAB 1TU2A 5ESQA 5IVXA 1SOSA 3GYRA 2NX5B 4OUOA 3WL9B 4G6AC 2FHBA 5LCVA 2YPVH 2ALAA 2Q76B 1XGZA 3S8GB 1MVYA 3ERXA 5JOPE 2JJTC 4AYID 4CKVX 4Y16D 1WFMA 2XIIA 1CB4A 3BN9C 3TIDB 2AJZA 1KN2L 4PRBB 4X99B 2IQAA 3F58L 1QUNB 5D4IA 3WLWD 2PO6B 1DQJB 2AQ2A 2P24A 4S0HA 1NEZG 3LNEA 5E99L 1QBML 1Z5LA 2V2XA 3TVMA 4JFYA 5EA0L 2R23B 5DJ8A 2W94A 3QEQE 3VD3A 3TIEB 4X5XA 5J8OA 3A23A 4LE8A 2DRUA 4UDUB 3QDGE 1DN0A 3RAJL 3VB9A 4HIXH 4QHUB 5KEZA 1X5YA 1LE9A 3FTGB 5H35A 4PJGF 2QKIB 1DSYA 3FUJA 4YSTA 3QAZC 4QHLA 1LJMA 4J7RA 3ZE1F 3D52A 4BE5A 4PV9A 2BNRA 2VXSH 2X87A 3QDGA 1NGPH 3H4FA 4KQ4L 3WHXB 1S7RB 5B4MC 4A6YH 3GXFA 3QUXC 2AQ1A 2GTZB 3LZOA 4TULH 4CKQA 1B9ZA 4EN3B 1S9VA 3PWNB 1L9NA 2PR4L 2E9GA 2UUDK 3EDKA 3MRRA 4ZFOB 2V7NA 1DTUA 2JVUA 4UNTA 3O3EA 4OLYL 1NCWH 4JN2A 2HUEA 3L7FB 1A1OA 2AAAA 4XNYH 3UBXA 4NO5A 4JUTA 4M3JA 1F3DJ 2H47C 2Q7AA 4YHML 5HBBA 5D5ME 3ULVE 1EO8H 5E1GA 3VGDA 3ESUF 3QG6B 3HPLA 3JWDH 2IG2L 3T3PF 2UWEB 5KSAA 3IMWA 3AGVA 1MNUL 1RPKA 4B3EA 4LKCA 3S3SA 3MKKA 1TQVA 4ZDHB 3W5NA 3TJEL 1XAKA 3ZKXB 5CF3A 2P8LB 3FB8B 3SKNA 4N2EA 4NQDD 3DVNB 5EBLB 5C0DB 5G4NA 3FCUB 3QUKB 1F1DA 4UINL 1YEDB 5DJDA 3TZVD 5AVYB 3DK0A 4I0PD 4Z3HA 1N5YL 4Z0XB 5INCA 4UNVA 5A1AA 5CBEA 3Q6FB 5IFJB 3UZEA 3MXVL 3O9WD 3FOLB 1MCIA 4FQPA 1GC1H 3GLDA 2CQVA 5DHVB 1K5WA 3VW3L 1Q1JL 4WWNA 3WGUB 4OZIA 3VH8A 4CVXB 3KLHD 3IVKA 5BS0A 1QRKA 3UPCA 3BOVA 4NHUA 4AQAB 2OJEA 4DZ8A 3SDDD 1S7UB 2A6KB 5KSVB 1EERB 2YAPA 4XB8A 2IH3B 4JN1L 3FFDB 1TVDA 4UTBA 1TKWA 5EZOL 3FPXA 2D3NA 1TCMA 4I2XE 4JFSA 5E5MB 4Z7OE 3FW6A 1FORL 3WS6A 1B6UA 3U30C 2Y36H 4A2DA 3BCFA 5C6TH 2MQCA 1TQSA 5GIRA 4BUQA 2IAAC 1DJYA 2R0ZH 4NZUL 4KK8C 5D4HA 3N04A 3ARQA 3VFWA 2A9NH 3MHZA 2DMGA 2YPLD 2NY7H 2ZP0T 1LP9A 4AIZB 2F7QA 3ELQA 5I6LA 1C08B 2GCYA 3GSOB 3HC3H 2A9CA 1U8HA 2CO4A 3L9BA 5DWUH 3ECBA 2JKXA 2R1XA 3RWDA 2MWCA 3TN0D 3TYFB 4YIQB 1OM3H 2YJLA 3R06B 1NEPA 3PXJA 1SYSA 1AY1L 1FRGH 2I5YL 4PP2A 5DEZA 2IOIA 3EJTA 5IBTH 3MLRL 3FU6A 1LO2H 4K0OA 3T0EE 1GA2A 5HYFA 1NCDL 2WUCH 3DTXB 2BOCA 3PPSA 4M7LT 1M7UA 1PDKB 2XRAH 3FT4B 4NKQB 4TTDD 3KWTA 1DFXA 1JZ7A 4I89A 3R1GH 3B6SA 4G9FE 5ITBH 4IGBA 4FQHA 5FHBH 1P2CA 1NM9A 2VDNH 3RZCD 1SHWA 2G5BB 2KPNA 2ZSVB 4NP4H 4A2EA 5E0FA 3FONA 3FT2B 1NBYA 1OAQL 1J48A 3O6MH 4OJFH 5A7BA 2ZE0A 3HC4H 4EIZC 4FL4C 5AYUH 3Q01A 1OAUH 3QEHA 3RWHA 5HYEA 5I30H 4ZFOL 4KKQA 4CSTA 1VZIA 1KFAL 5ID0A 5IHZA 5F0MB 5E08L 3FFCD 4JRLA 3OG6B 4U1HA 3FUKA 1I7ZA 3ARBA 4MJ5B 3LV3A 4G9FB 1GGBL 3QK0A 1LO3H 4LPXA 2AK4A 1LE5A 5MHSE 1PLGL 2YPLA 2VR7A 4XRCB 1C8QA 2V37A 3P30H 4WLCA 3UADA 3NDYE 1VHPA 4R0LB 1INEH 2K8QA 3D39E 1KG0A 3LH2L 1CVRA 3QIBC 4PJ7B 2V2TA 4YAQB 5I9QB 3GZKA 4Z7UF 5HVGB 1E8WA 2ZG3A 4JHUA 3UX9B 3PDDA 4Q52A 3QWRD 4QWWD 3BUIA 3SKMB 2N01B 1EHNA 1WJ3A 2MJWA 4DW2H 5J6GB 1HN1A 3CXHJ 3DYPA 4PTUA 4PLOB 3P4OB 5DJXA 5ENWA 4IBUA 4UMSA 5DUPH 5IB5B 1S7XB 4HK0B 1IZKA 1VEMA 3GUTB 4NNPH 1UT9A 5LXGH 1L7TH 2XN9D 2E6PA 4ALAL 3D39B 4Q4EA 2X1XR 4KXCA 1DYZA 5C9KA 2HKFH 2WBJC 2PETA 1HXMB 1ZRUA 4QXTB 1TQBB 1KMGA 5GS2D 1H5BB 2YD6A 2HFEB 4JR9L 4XMLL 3QUYA 1ZTXL 5IHBA 2XUWA 4E42B 1LK3L 4LLWA 4YNYA 1RULL 3RTQB 1JK8A 4S1RL 3VQ2C 3QORC 4OZHA 3WKNA 1BVOA 1KJ2L 2R2CA 5HHPB 1K4DA 5LKNA 1WTLA 2ZX6A 3VD5A 5C08B 5I8OH 1H5BC 2V8LA 3MXWH 5HDBE 3FT1A 1EMTL 1QSVA 3TV8A 5CU9A 5B4MD 4NM4L 1NDGB 4XBEL 5F3BA 1KNOB 3HUJF 1D7DA 4C4KO 4QHMB 4E0RB 1KGJA 4RRPG 5E1AB 4L29B 2XWJB 1C7SA 2FLMA 5AOKA 3CC5A 1JBJA 4TL5A 3I50L 5C2BL 2PPAA 2PNDA 4L8DA 4PJIB 3CC1A 2ARJQ 1RLBA 2ZOTA 4G43A 1YYCA 1ROWA 2XXMB 2IPKA 4O02L 4PRHD 4Q6KA 1AR1C 2OL3H 1A4JB 2AXFA 5ECJE 1E4XH 2D8KA 2IAMD 2Z0BA 3K5SA 2AS5M 3LAFA 35C8H 4KO5A 5AVWB 1FG2B 4RZCA 4NXSA 4BELD 2BFVL 4FQIH 4MWFA 2HT4D 4U6VL 1YMMA 1BFOA 2L7UA 2K7PA 3EBAA 4KV5E 1E9PA 3H2WA 4LESA 4ZOEA 3ULSB 3HG0A 3NA4A 1SBSH 2ED6A 4X7SH 5KVFH 4YSAA 2IANB 2O5XL 2MCMA 1RZ7H 4KMTL 5I73B 1TYJA 2BNRB 3SJVB 1L0PA 3TFKD 3DBSA 2E86A 5TQ0L 5JUEH 2IH1B 4ZAKA 2NUTA 3SPJA 3FJTA 5CBAA 4YSRA 1JPFA 2PUQT 2J1WA 4F7CA 4OI8A 2PYEA 3MBWB 1A4CA 4I3RH 5BOJA 2H6PA 1S9VB 1QSFB 1W72L 2VH5H 3TBBA 1TEYA 1RUPH 5DS8B 3SDDC 3IB4A 3HKFA 4OT1H 5CCKH 4DERA 1HESA 2PWGA 4LHUD 2NR6C 4HGWA 1WIUA 2APBA 5JQIB 3IF1B 4IHBA 1GPOL 4E9XA 3MLWL 3BT2L 4R4BB 4ZFGL 3MVSA 3KG5A 2AABH 4XMKL 5AFAA 1HSAA 4YE4L 4HJGB 1OSZB 3X14B 4XMPH 4EIBA 4XX5A 3EG9A 4GKOA 4AV5A 1DQTA 3IN0A 4GIPD 5HHXL 1DL7H 4HS3B 5IQ9B 1BXVA 3GMMA 5DJYA 4IKNA 3BUTA 2BVPA 5EBLA 1QYGL 3RWIB 5B21A 4N85A 5ICYA 5IFAL 4PS4H 2N7BA 1A6ZB 4HSCX 3ROOB 3ULVC 4J3XA 4WSKA 3CN0A 1P84J 3BKJH 5INCB 1FZMA 1SBBA 5D5MA 1S7SA 4YK4C 3MV9B 4KKLC 4BKTC 3FOLA 3N06B 1LM8V 1ZJBA 3B34A 1WBZA 3MUGB 2PTTA 1HKLH 4FULA 5DC0A 4X6CA 5I8EA 2DQIL 3HUJB 2OSLB 3O6FD 4NO0B 4TNWK 5TDNB 3BPLB 3WEAA 4CVXA 2O4EA 3MLSH 2DMCA 3C5ZA 4IJ3C 2XNAB 4G9FD 5F7EH 1SM3H 4DZ8B 4QAMB 5D7JC 3TT1H 4G6JH 4GUPA 5F9OH 4ZO8A 4PJBB 1AGFB 4FNLH 2V5RA 2WWOA 2ZG1A 4L5FE 4Y4KB 5T1KD 4Q97A 2E76C 3NJLA 4PY8J 1QNZH 4KQ0A 5GHWL 3ZE0F 3TF7C 1EZSA 1XF5A 2L7QA 1ZIAA 2BERA 5F6IB 4Q6IA 3HN5A 3ZQXA 5FB8B 1F18A 4NKMA 2HVKA 1XGRB 3SIKA 2J8OA 5GSVB 1IC5L 4FFWD 2HKAA 3VFWB 1FP5A 1NMCB 5FYKH 1AS7A 3AWGA 3U79A 1T80A 4P9HC 3APCA 3BGFB 3ZE1E 4AYDC 1NFIB 1IFHH 3EOTH 3TBWA 3GB7B 4LSQH 2IXQB 1I9RH 1C08A 2GCYB 1N10A 3GSOA 2DJ4A 4WK2B 5EZJB 4F92B 5T3ZH 3P4MA 2X4SA 4YPJA 3R06A 2F8VA 2PCPA 2WSDA 1SYSB 3DX0A 3WNKA 4Z7UA 3APFA 4HWUA 5T33L 5JQHC 4UOZA 5EU6D 5IB3B 3GSVA 5JA8B 1VFAB 5EA0H 2BOLA 1D9KC 4KNSA 3N41B 3FFCA 1Q8MA 5KYUA 4IOSD 2V33A 3N43B 1D7CA 4AIEA 4NNYB 3ARPA 4LB8A 4D0BA 2DQIH 3NIFB 3GHEL 5MENB 1F2QA 1CLVA 1UURA 4R96A 3ZL4L 2FBJH 4MLIA 3C8KB 3CG8A 3DXAD 4F7MB 5DYOB 5L2KA 4C47A 25C8L 3V0GA 3WTUA 2J1XA 1UWXH 4G8FA 5IBLC 4OAWB 3QPXH 4EBQL 3ABGA 3CFNA 4HOZA 3ABLB 1GZPB 1YY8A 4FG0A 1X9RA 1IGML 1WFJA 2PW2A 5GGRB 4OF7A 5CINH 2VDLL 5DEJA 4MZIA 2IDTA 3RGHA 4IKIA 5ADPL 4Y4FD 1U30A 4MS8C 1OY3B 4NZTL 1I82A 2DDQL 5IV2B 1E9QA 2C3HA 4AQEA 1F0LA 3RUGB 1WUNT 4X6CE 3LZFL 1KG0B 5DURB 5C0FB 4P46C 5A2AA 4I3SH 4ES8A 5E8OA 5FUCC 5IMMA 1CDJA 4MVBD 4P9ML 3GIVA 1XBDA 3KPSD 3QXDA 1GZQA 3RPIA 5FKPA 5AB9A 1CL7L 3SKMA 3KLQA 4GJTB 4L8SB 4H2AA 1KB9J 3W56A 4Z1PA 4XB7A 2XVGA 2WTRA 1FL5A 4KPHL 3HB3C 4MBRA 2ZCLH 4KJYA 2EC9T 1P4IL 2NY0B 3BUPA 2C9UA 2CSPA 3CFIC 1EHXA 3UBXG 2RTTA 1CS6A 3LB6C 3QR0A 4PG9A 1OCOB 4NRXB 3VO0A 4PJGA 4AZ8B 1ONQB 1F6LL 3GSNB 4HWZB 4JKLA 4WEMB 5FWQA 4UT9L 2P5WA 1W0YT 1H5BA 2XKNA 3MAWA 4G8GE 2HFEA 2XTJC 2BP0B 3L2LA 3OKNA 5GGTA 3SQBA 3KR3H 2BP8B 5ALCH 3SQOH 3RIAK 4TUJB 1A7OH 3NACH 1JL8A 3ARVA 5GGQL 2YUWA 2X53A 5HHPA 4LSTL 3P4NB 4M4PA 1N5AB 2PCXA 1U6AH 2ZT9C 4OZIE 5ANME 5C08A 2YAFA 2VDPB 3FS9A 3TTSA 4UQIM 5FUZH 1KTDB 3TFKC 5KVDL 2OJZH 1IO4C 3PXHA 3OB8A 2K9UA 3KS0J 2DQTL 1E50A 4QI3A 5J1SC 3QFJA 4E0RA 1T66D 1WCQA 3CZFA 1SLVA 5IVZA 3V0FA 1T1WB 4LL4A 4OJCA 3TV3L 4BSWB 3G9VA 2C7UA 4UQEA 3D2UD 1ZGLA 4AVHA 1L6ZA 4YGVA 1GL4B 3ATEA 4LCVA 2N4IA 2V17H 4U7KA 4WZ9A 1IE5A 1ZTXE 5AZEH 4KVNH 1JRHH 4XVJL 2JCCB 2YK1H 5JNYB 1MFAL 5C2UB 1RERA 4WFED 3NAAL 4Z7UE 1M1XA 4LLVB 3K1DA 5L0QB 3R19A 1X44A 5C3LD 4ZX4A 3SGEH 1E2VA 2JI3A 2VUYA 3AUVA 4NJ9L 4L0ZA 1DZ0A 2LQRA 1IBHA 3HFFA 1VESA 5DZNA 3A4EA 3EDEA 3SDAD 1EHLL 3M07A 2AJVH 4H1LB 5C92A 1FCCA 3N85H 1B2WH 2ZNWA 3FF7A 3ILQC 2IANA 5IVNA 3G6JE 4OI7A 1GYVA 4QRRD 4W81A 2GC4C 1CLZH 2HWZH 3MRCB 2H7WA 3GI9L 4H8VA 3B2DC 1JFQL 2ADIA 4H13C 4X9IA 1EO7A 1G9NH 1E6JL 2BS9A 6FABH 5DS8A 5C07D 4MJHA 1JNLH 3GHPA 2EYRB 3AS3A 2MCAA 2ORBH 3ZVVA 1HDMB 3MNDA 2WIIB 4PS4L 2YQ2A 5KZCB 3ESNA 1E27B 2ZX9A 2WNXA 4ZNEE 1C5DA 2TSAA 3GMQA 5C3TA 3P30L 2DLTA 4CN4A 1HSAB 1PLGH 3QR2A 4O2CB 4D9QE 1S78D 2QQNH 2O6FA 1QA9B 2A6JA 4IRSD 2Z31D 4MX7A 4XGZB 5CSZA 2WLIA 5KBKA 5D7IA 5ABZA 1I3GL 2X89D 4KI5C 5E94A 3IETA 4AH2B 3T3MB 1ZS8A 3CFMA 2X9XA 1W72H 2Y69B 2W81C 1OF2B 4P2RB 4PG2C 4DEPB 1CXLA 5D7SH 3FQ2A 5C0IA 3AACA 5GGQH 1ET5A 3CLEL 2OQJA 3GSNH 2QADB 3D9AL 5DD6B 4PYGA 3PGDB 4U33A 3GSUA 1E6OH 3HUJA 3FOMB 4DO4A 3VQ1C 4OZGA 4ZMPA 1KB5B 3AITA 1CXKA 1JGLH 5IJKA 1RIUL 2R1YA 3I6KB 5F44A 1CFVH 4F2EA 2D9QB 3WIFA 3NIGB 2WAQA 4PJBA 4UQBA 1MAKA 3QUXB 3T6QC 1D2PA 3HG1A 2NXZC 4X0KA 5EOCH 3PGCA 4LASL 4NKMB 1MY5A 5EIQA 3GQFA 3BE1H 5HHMB 1DBJH 2IEPA 3PU7A 1WE5A 2Q2EB 1ZHNA 1M05A 4YDKH 2Y22A 3CZSA 4MMXB 4PJ8A 3MLVH 4CJ0A 5JW5B 5T1JA 3R7RA 2QHRL 1QTSA 3E8VA 5I6XC 2KLSA 4LCCB 5EZJA 5IWLA 3FFCE 5C97A 1MZYA 1JTPA 4QRPA 4RFEA 3O2DL 1RZIA 1HJCA 2OSYA 2VABB 4NZTH 2X6CA 4HIIB 1RFDL 4J39A 4MS8D 3CDCA 4ZUUB 1CG9B 1DFBH 2L0DA 4FQ2H 2CBOA 4JFXA 4JLRA 4ZMAT 3U9WA 4JDVA 3QSKB 5E51A 5AVVB 4BDVB 3MCKB 5C1MB 5KYXB 1OE2A 3GIZH 3HAEG 4QYAA 5AB0A 1FNEA 1BZ8A 2IALB 1KPRB 4KRNA 1X5HA 4NQCB 5KYUB 3HS0B 1ZLUK 1X3DA 3NCJH 4WI4A 3MV8B 4ABWA 4MD4A 5D7JA 3Q3GB 5DUBA 4DTGH 2K0RA 1ZGLM 1GYUA 5EBGA 3LKPA 3D85A 4WW1A 1UQSA 1MFNA 3ZMRA 5MENA 3GSQA 3DX6A 3QEUA 3RP1A 3RNKA 3SDXE 4DCQB 3RVUD 1EFXB 2WVVA 2MQGA 4G6KL 4J3OH 4JZJC 4NUGH 1M6OA 4Q58C 3SGJA 4J23A 4NM8H 3DSNB 1MQKH 3GM0A 3RE0A 4G8FB 1NOAA 3GHBL 2R2BA 2BY1A 3DGDA 3JTBA 4LSPH 4UNUA 3PWUA 5T33H 4XN2A 2CHXA 2J8UB 2F58H 4MGXA 5CIPB 3GMPB 3V0EA 3DHPA 2WQWA 3DHMA 1BA9A 4HEPA 1IMHC 2F54D 4I48A 4P9MH 1BOYA 1MWAL 1QFUL 4TQIA 3BQUD 1FJ1A 4ZD3H 1JMXA 3KPNB 3LKOB 1EXGA 3IAGC 4YO0A 1LYQA 4MA8H 1T1ZB 2WINA 4KTEL 3CDGA 4LLUB 1EXUB 1I9JL 2MPAL 2WOYA 1ZSDB 2Y9RT 4N90D 3U9PL 3DSFH 3UYRL 3KWUA 3RVWD 3K0WA 5DDHB 1ZLSL 1DJXA 4B97A 2ICWA 4JZOA 4BKLA 5CP7B 1D2OA 1GZHC 5HI4D 5L4IA 4IRSA 4M8RA 4XNDA 5C0RL 3QNYA 2ZKMX 3RPIB 3SYCA 4ZFOA 2AK1L 2AC0A 2WKOF 2DLHA 5BRZD 1U93B 1FGNL 4BFNA 3ULUD 1MRDH 1WTGT 1A6TA 1UM5L 1RV6X 3SYQA 4JFTA 2GVYA 4F2MA 4R7XA 4XO9A 3A6CL 2XJKA 2H2SC 4ZAKD 4XX1G 2FECL 2WKLA 4XXWC 4Y5VB 4NZDA 1CGWA 1HINL 2EADA 4OQ1A 1V3JA 4NRXA 4AZ8A 1CURA 3GSNA 4HWZA 1KPVA 3I9GH 3WEMA 4U6XB 4MFHA 2XFXB 5GISH 2JIXB 3QFJE 2ZX8A 4C55A 1CBVH 2Z7WA 2B2XL 1OM9A 1Y18A 1Z0NA 3BDXA 3LQZA 4M6ML 2YPLE 2F5BH 2BP8A 3C6SA 3IDYB 4MA3A 4TTDC 3PY9A 4TUJA 1CZ8L 1XF4B 2VT0A 4KZ0A 3HJEA 2YK1L 1LXMA 3TO2A 4QJ3B 4R3SB 3L9EA 5F88B 1T4KB 3WAKA 3DIFB 1JPST 3S35X 4IBQA 4GB9A 4HIJA 5AYTA 4CA4A 2Y0SA 3IGAA 4FTVB 3UTTD 5I82A 3MRDB 2YPKA 1XH3B 2J88H 3QO1A 4L9LC 3ARRA 1TTBA 1D3CA 3QISA 3ILQD 3F7PC 4NOBA 1YUHB 3KEDA 4GQZA 3H3KA 4KRPC 1ZXKA 4PRID 1KTDA 4IMLB 5EF1A 4MNQB 1P9MA 2DJUA 2NY6B 3JZ7A 4GRLC 1JGUH 1RFDH 5DEFB 5C9JB 1KCVH 3QFJB 3BWSA 2BVYA 5IR1B 1OWWA 1I3UA 3BZ4A 4FNTA 3V6OE 1IGIH 1IBFA 4F3FA 1SMDA 2VDOB 3NABL 2NNXA 4KBPA 3L6FB 1TFHA 2E4TA 2PPFA 4NUJB 3SD2A 1JGIA 2H8PA 2NR6D 3KAAA 5FYKD 5FS5A 2Y3AA 4DN3L 3U9UA 3ZHKA 1D5MB 4X6CF 3H55A 2BCKA 1ILUA 4BH7A 3WE1A 1PZAA 2JI2A 1EZUA 2X38A 3FN0H 3IDUA 5T5FH 1GGCH 2OX5B 1JXDA 1DZBA 4Z7QF 3BSZH 3QXUA 3S5LG 2X4NA 1KCBA 2LAGB 1YDPA 4TXVB 5F7FA 4F7EB 3EW3B 3U7AA 1G7IA 3C9NA 3C60A 4A38A 1RJYA 4JJHA 1AGCB 4OIBA 3RY6C 2AANA 4KUZL 1JNHA 3AQDA 4HFUL 4JO4L 3H9SE 2EIJB 3TZVA 4Q2ZA 1JGLL 4FABH 1WVZA 3BFQG 3PAYA 1R3LA 4WI5A 1E5AA 4WI0B 2ATPB 1EEQA 4K5MA 2OMVA 5DO2C 3O6FC 1NAMH 4NO2A 1BVKB 3HW7A 3VJ6B 2WQUA 4Y5YA 4JL1A 3ABZA 5GGRY 3W1ZA 2C3GA 4PGCA 1OARH 4DGUA 3T0EC 1MF2H 2HFFA 4WTXA 4HHGA 5F7HA 2VE6A 4O5LH 4K8RC 4IIQC 4O2CA 1U8NA 3P73B 4LCWE 4Q8BA 5IG7B 3VI4E 2IMNA 3AY4A 2BZ7A 4YEFA 1BG1A 1F6FB 5IZ7A 5JHBA 1NANI 3SGEI 3CU7A 5IMLB 3CU1A 4PGZA 3KPSB 1ITBB 3OBAA 4AXWA 3FO1B 4MJ6B 1TEGA 5AAMC 4DK3A 2CA4A 4YXHH 3VXPB 5EUOF 3CDFA 1F56A 3BGFC 2FO1A 4EBQH 2B3IA 4DK5A 3TO4B 2D9CA 3V6BR 1WWCA 3BCDA 3S5LA 4BFEA 3AMKA 1QLRB 2PW1B 3LN9A 1CMOA 1SHXA 2EXYC 3PLYA 4GY4A 3PQYB 4ZTOL 5HI3C 2QGEA 4TTGA 1V7MH 2YS4A 3PFUA 1AC6A 5T8IA 5ISZD 2EXTA 3H8NA 5K33A 4Q9RL 2Y2YA 1HWHB 2AK4E 4PJ8C 1KJVB 2RFXA 4HH8A 1BQHG 5BRZA 4HWBH 4RIRB 3DRQA 4OBRA 5GGSA 4Q89A 3VB8A 3LEXA 5TE6L 1DN2A 3HG1B 1LEKB 2H3NB 4X0KB 2DZEA 1BM3H 4HLZG 1TZGH 1KXVC 3MV7E 3BISA 1R5WB 3V0AC 3U0TB 5IOPA 1AZBA 3FYEB 3THML 3KPQA 1ETA1 1JNNH 4PJ8B 3G6JF 4UMGA 3MA9L 1YN6B 1G7PB 3RVUC 4L5FL 4O4YH 4KK6D 4YBHA 5JW5A 3UCRA 4WJG3 4OCMC 3RL1A 1AHMA 1MCCA 3O4OC 4MA1C 1JG9A 4LCCA 1BBDL 4OZGF 5T1LB 1IM9D 1GSKA 5FK9A 2VGLM 5FDWB 2QL1A 4ANWA 1RZIB 4L2LA 3CSGA 4KJQC 3GK8H 3MLXH 5I8KH 3BQVA 5I1EL 2OK0H 4J8RA 3MCLL 3NJJA 4ZUUA 3SDXA 4PJDF 4MHHG 3DMMB 2I32A 2YMXH 2XOTA 1COBA 2XWBB 5BRZE 3QRGH 4G72B 3LNDA 4YDVB 2CLZA 1BG9A 3ZKMD 1QI3A 3KE0A 3S4SB 5TGBA 1K3IA 5D7KE 3VXQB 3HI5L 2IALA 1XGTA 4J3BA 2BSSA 2GJJA 5SWZB 1PZ2A 4H8PA 2VC2L 1OK8A 3NMEA 3QXVA 4MD4B 5I1JH 4J5VA 1HC1A 3G5VB 3ULUC 3V5HB 3D85B 2IH9A 4WW1B 1FFPB 3BKMH 5HYQB 1J8HE 4J1UB 2NW3A 4XPGH 3GSQB 3QEUB 3U36B 2OMTB 3QUZA 1J18A 1M6OB 1Z9SB 3DGCR 1K8DB 4LEBA 3QJHA 3VA2C 2FIKA 2EYTA 3WLBA 4HPYH 2H0FA 4JFDB 5C8JB 2C8NA 1D6EB 2WOBA 2MH4A 3L3OB 3LNIA 1SMAA 5HVFB 3MLRH 4OBSA 5MEQB 3KPRE 1QZNA 2EABA 3M88A 1XHHA 5MEOA 2A4EA 3MRBA 1IV8A 2WBJA 3MBXL 3QCUL 5F96H 1GYCA 3NJGA 3GXPA 5EEWA 2AAVA 3Q8BA 2N59A 3FBQA 2MOQA 4HZLA 1TYEB 5LG1A 4WU5B 2NZIA 1CYXA 5EBMB 3EGSB 2XV6B 3GJEB 1VADB 3B9EA 4PS3A 3STZB 2XWDA 2R69A 4UYQA 4IRSB 3GT6A 3AU1A 3Q06A 2ILLA 4M93B 1PL3A 4JFDE 1P69B 2BZCA 4NN6C 5BXFB 4S10A 1QEXA 1UH2A 1E7UA 2PCFB 3MJ6A 4XAWH 2XKSA 4LU5H 1NPJA 4WK0B 5E6UB 5F72S 4F2FA 3FCTA 2MOGA 2OK0L 2M2DA 5LG6A 4BFRA 1EHAA 3MOBH 4EDWH 2PR4H 1HI6A 2HFTA 2YEZA 1ZAGA 3DUUB 2AEPL 4GLRH 1FORH 1T21B 1J0IA 2JELL 5HHOD 1AGBA 2VLJA 3KPOA 5JYLA 4D0CB 1UOKA 3UTSB 1A6VH 3I6LD 3K80A 3IFNL 4HLJA 1W0WB 5KVEE 3H85A 4GXVH 4MYPA 3RB5A 4BQ8A 2XG5B 4B9YA 1RL1A 3THMH 5KUKA 3ZTNL 3V6OA 4HMCA 4K7FA 2WXLA 3SZKC 3TO2B 4EI0A 2NXYC 4QRSA 5E9AA 2AQRA 4QCIB 1MCBA 5D8JH 3DIFA 2X7LA 1UUNA 1EUUA 2D4FA 1FO0A 2H32B 4AQOA 4TVPH 1E3XA 5KS9A 3WIAA 2EDKA 2C3VB 3ZKNC 1V10A 3DO3A 5T1DH 2WSPA 1SJMA 2D7MA 1FFRA 1JD9A 1EXHA 1EDYA 3L3JB 3V4VA 1FE8L 1LMIA 1FZOB 3IRCA 3CUPA 4HSQA 1BXUA 4A2MA 5TFSH 3BZ4B 2XN1A 3SE4C 4GS7B 4PIBA 4F8PA 5AW3B 1MW0A 3I3EA 2HT2D 3CXDH 4J8QA 5D2LA 1KLUB 4UUJA 3T0ED 5B38G 4P23D 3L7EB 1FIGL 2XV2A 1AD9B 2IJ0C 3CPUA 3SE9H 3VGAB 3HR6A 1HXYA 2W8CA 3NQKA 2ISDA 1FH5H 3U9UB 3L4WA 4OGXL 3GBNL 2F53A 5DRZB 5IHUH 2XQYA 5AZUA 4FN0A 2DQHH 4PRNB 4PJEF 4F8LA 4M6OL 2OX5A 4PCKA 4RWYL 3QORA 3QVAA 2VXSL 4KQ4H 5LBSH 1A7RL 4J28A 2N7AA 1BX2B 2WC7A 4OFPA 5CZXC 5SWSE 5AW5B 3RX7A 5I71C 1JD7A 3VA6A 3BO8A 5SV3A 1D5ZA 1QX1A 2VDOL 1UVQB 4G6JL 4KI5D 4NUPA 3UTQA 4WJ5B 4FZEL 4EUPH 2EICA 1R33A 3DIDA 4P2RD 5EEXA 4NUGL 4J12A 5A2KH 1WSST 2VLKE 1NAKH 1TJMA 2EXYD 4M1GL 1U91B 2P8PA 3LZNA 1RU9L 3H42L 3MTRA 3LIUA 4JFZL 2X3CA 5DVPA 3OPZH 1I3RB 1MJUH 1QLFB 4L9DA 3NZSA 1RZGB 1U8CB 2IMMA 3C5ZC 5IESH 2PYEE 5JPMB 5AWNH 3O3DB 1KXTA 3DXAE 2HFFB 1F5WA 2FJGA 4PY7A 3U2SB 1YCSA 1ZPUA 1BVLA 2CJTA 2DYRB 3QORD 5K5YA 3LDBB 5IG7A 3FSAA 1WGVA 4NWUH 4XTRD 2HTLD 3IM1A 3LIZA 1SN5A 2IWFA 4FI8A 1HWGB 3NJIA 2JKSA 4JO3H 5J13C 3LRGA 3NEXA 1KF9B 3LXBA 2F7OA 3S2CA 4R7NB 5H2BB 1ZXQA 3RA7H 3QUHA 2ZSWB 2I27N 4UT6H 5DD5L 1L9QA 5DD0H 3QEQB 1KLGB 4YSQA 1J5CA 4O2FB 3D33A 4M4RB 1YEFL 5FA3A 1UD3A 4A68A 4OB5L 4Z18A 1TLMA 4QLWA 3UTTA 5I1AA 1MWAH 1G7MB 2FEDD 3L81A 4N28A 1MFVA 5CZKA 3S3DB 2FAUA 4HF5L 3J8F7 1T1XA 4JJ5A 3EFFA 3BZFB 5IMOB 1JWUB 4MQXC 1TNNA 4JO2H 3BDBA 5HSFA 5IW6A 1O6SB 1TZ8A 2RFXB 4JB9H 4N22A 4Z7QE 1WEJL 5HHVH 5FGSA 2P1YA 2IAMC 4NFDA 1WIOA 3EOBB 5FYLD 2VW4A 5DRNA 1NLBL 1R5WA 4P57B 3JUZA 4L0YA 2GFBB 3QUML 3SDAC 3BKJL 3VG0L 4Z95L 3WI9A 3WN5B 5E6ZA 4YL4A 4XP5L 2LU5A 1KPUA 1WZ1L 2WQSA 2XG4A 4IIQA 4LNRA 1BVZA 2O61B 3JQOB 3O8XA 2ICEB 5IQMA 5SX4I 3HE7B 3V10A 5F8QC 1AQDB 1YLBB 4P9HL 1CWVA 4J3OF 4XMPL 4NJAL 1HH9B 4JPKH 4NT6B 4LP4A 3WJMA 5GSRB 5JHLA 1OP9A 3T6WA 1AG0A 1NM4A 3K72A 4YSUA 5CEZL 1IKFL 4EOWH 2P5WE 1K2DA 2RIKA 2HRPH 2NNAB 1YUKB 3KPPA 4PJ5D 3VI4F 3ZTJH 1OXYA 1ID2A 1OAYH 2VXQL 4PJCF 1AQHA 1ZA3A 2B4CL 2PP9A 3IJEB 4GIOA 4MDJA 4YL9A 2DICA 3E3QE 3OAUH 1BZEA 4JRYE 4R9HA 1MAML 1HS6A 2X4QB 4PCTA 4AY0A 5I1HL 5EUOE 3G5VA 3U4BH 4TSBH 3B9AA 1B0IA 1XGYH 1QBLH 3L5XH 2EUWA 4LP8A 4AOFA 4KKLD 3SOTA 3CSYA 3U36A 5JIIA 3EXLA 3MREB 5F7BA 3CHSA 3LQAC 2VDRL 2YARA 3FTUA 3QJHB 2LOEA 2EYTB 3WLBB 4ALAH 3HPJA 3HZMA 4K9EL 2Z4TA 5F9WC 1ZLWH 1AGEA 3C6LC 5CZVH 2RBLA 2XC8A 5F3HA 1NCUA 3WFBH 4LSRL 5AZ2H 3SSGA 1M53A 3DWTA 1YMHA 3PDOB 1NBVL 3SDCC 5A16A 5MEOB 2AEQH 3D9AH 5C0CE 1ZK9A 2E9WA 3T6VA 2EKJA 1E8XA 5KN5A 2HLAA 2W0PA 4L3ED 3QRBA 5D93B 1JGDA 2M26A 3FDWA 4Q14A 5CEXB 2FWLB 4L4VD 1NCCH 2R2HA 2UX6A 5GS1B 1EFQA 3BLKA 4BA8A 2BVEA 3QE5A 1O0VA 2YLKA 1PF3A 3SE3C 3CHOA 3A5VA 3F7VA 2VSDA 3GZQA 1MPAH 2X1OA 3DETC 3DOSB 4N1HB 5T3XH 5BXFA 4PJBF 4WI9A 3RGVC 4XNQA 3RZCB 4YR6B 1T5KA 2Q87A 3AM8C 1NUGA 1Z6JT 2ZXBA 4N2IA 3FXIC 1IC1A 5B22A 4P2QB 1A22B 3U46A 3R0MA 4Y4KD 2WMPB 4ZUWB 5C0CB 1WFNA 2AKRA 5E2WH 4FLSA 1W0VA 1AFVH 1SZNA 4ZQKB 3QYMA 4U1NB 3IJSB 4PRDA 3B9DA 4X8JA 4D0CA 4J3UA 4PJDE 2EYSA 2BPBA 1C16B 4PD4K 5DA0B 3TCTA 5LGJA 2X0UA 5I1CH 2YZ1A 1CFNA 1HE8A 1QO3A 4QTHB 4CUCA 5ERWA 1FVEA 1A7PH 4WHTA 5D6CB 1E4JA 2XG5A 1ORQB 3VMNA 3BRDA 1OCWH 3RKPA 3GMOB 1B2WL 1FZJA 4JRYA 3FB7B 1MOEA 1XGQA 2XWCA 5FM5O 3N1GC 5DYFA 2JE8A 3CWGA 3OM3B 4HS6B 1BOGB 2BS8A 3REWB 1FZKB 1BYNA 1DUZB 1F4YH 4IU2A 1HILB 3KYOB 1KLFB 4U1GC 4Y7OC 3KS0H 1JGEA 2OCJA 2GKIA 3KBHE 1R3HA 1WLHA 1XB6A 1XR8A 3LX9A 4YJZL 3OWEA 2F8IA 4HC1A 1MI5B 2XXGA 4JO5A 4O58H 4Z76B 4OLZL 3C5JB 3L4XA 2CO1A 1JYVA 5EU6E 3EGXA 4NKOA 1MFEL 4H26A 4CBPA 4R7DB 5BCAA 1ASPA 2LU4A 2F53B 3NA9H 5JW4R 1S9WA 1S3KL 2P42B 4G7YL 3SPVB 4H7VA 3JYBA 5TQ2L 3KYMA 5EF2A 3MROA 2H1PL 2Q8AH 1NCGA 3VTTA 3VWKC 1O7DE 4AMKL 3MLTA 2DYPB 4X80L 4Y9CA 3W0WD 1MREH 5CGMA 1UVQA 4GBXB 1BZ7B 1O7DC 3GXUB 3LMJH 4I18A 4WJ5A 3UEZA 4TQ8A 3B2VL 2IAND 3DVFA 4G1MA 2VQ4A 3OSKA 3DVGA 3V4PA 3EJYD 2F08A 5BV7L 5LGHH 2DIJA 3PHQB 3SBRA 4KXDA 4UT9H 5KYNA 2HKHH 1XCQB 4FFZA 3B7YA 4KUZH 1NC4B 3A67L 4N86A 2C9XA 4GMTL 1INQB 4GRMA 1IKNC 2HRLA 5E6IC 4BWTA 1DBKH 3LKSB 5CHNB 3SE6A 2EVJA 3HZYA 1KJMA 3GI8H 3FT0A 2FVNA 4GO8A 3FU7A 4JO2L 1HQ4A 4B9KC 2WVTA 3U30B 3U7WH 4F37F 3EYOA 1EAPB 2OMUA 4B60A 4GAAA 1J5DA 2NY5H 1IIKA 4M1DL 4PTTA 2F5AL 3KXFA 4TSAH 5DU7A 4ICXA 1ZHLA 4EO5A 3Q8CA 2BHFA 3V6FB 3GSWA 1MVUB 4R7NA 4MNGE 5CGBA 4HISA 5L7XL 1IVTA 4K71B 1JZIA 4L3EA 2Y24A 1UA6L 2OTUB 4KQ3H 5DC2A 4V33A 5IF0A 3MV9D 4MJ4A 4O2EA 3PV7A 3WFDH 3KWWA 3O11B 3RWJB 2I85A 2YAHA 1NAMB 1IM9B 1DLFL 4L05A 2Y36L 3I9AA 3QDMA 1XB3A 2YN5A 4XP1H 4G7VL 2W0FA 1OD7A 4IRJA 2D7NA 3CHQA 4F2ME 3OL2A 2I60L 2NTFA 4CSZA 3EYUH 4XWOD 4G7RB 1O6SA 2CUAA 4JCMA 3GS7A 1NJ9B 5I6PA 1B0GA 1NGZB 4ZUVB 3K2IA 3IDMB 3O4LE 3SKOA 2OR9L 1OD9A 1F3DH 4IKKA 4ADIA 3OJDA 4NNXA 4Y2OA 2BHYA 5G5DA 1N68A 2H1XA 3WNMA 1N18A 1CLZL 1I1YB 1DSFL 1SHSA 3QS2A 3LNGA 1NKGA 3NCYS 1XH2A 2X4PA 4P57A 1U95A 5E8PB 5ICXB 1SXNA 4HBQA 2FGWL 5F7KC 5MEPA 4BFGA 2GSGA 3L4UA 5IB4A 3CXHK 4WFGD 3T08A 2HFGH 4PJHF 4XBMA 2YUXA 3GLZA 3QJFA 3KBPA 5C0CD 5BNXD 3VFRB 3O8XB 1DJGA 3QZLA 1CDBA 4C57C 1IGFL 3CQQA 3FO0H 1LO4H 2VQTA 3BH8B 4OGYH 3N9GH 5EO1B 1FNGA 5BVJB 1SLWA 1HIML 1NZRA 2Z92A 1N26A 4PD4J 2V17L 4ZSOB 5IJVA 1IAII 3D7PA 3L3OC 1FLTX 5IW1A 2FO4B 5CEZE 4PLKD 5LNGA 4J6RH 4ONOA 5H8DA 4E41B 5I15L 2E9IA 5JXAH 3II2A 1G9NC 3RDTB 3SE9L 3U2JA 4K8RD 4R5XA 2C9QA 4JPQA 4B96A 1P1ZB 2B4CH 3DX9A 1UA6H 4KQ3L 2WLLB 5SX5H 3EOAB 3ALPA 2EC8A 1U3HC 2GJ6A 1XGPB 2AF2A 3IFLL 5KVDH 3D39D 3P2TA 1NC2D 4IRSC 5G2NA 2QHRH 5JHDA 4Z23A 2BSBA 3QZNA 4DAGH 1DR9A 1SJXA 2R0KL 3D4CA 2XY1A 3T9WA 2ED9A 4YOKA 4UOQA 5TTRA 4PSRA 2NY1B 4MB1A 4D0DA 2B1OA 2O5XH 4B0MB 4EVNB 1HZHL 3QDME 1DJHA 3NGBB 1AGEB 2ZUWA 1A2YB 5I66B 1FL6A 4HZAA 25C8H 4X7FC 4KROC 1AZNA 1EH9A 4AUJA 2Z7UA 2B77A 3FBKA 3MUJA 4S1QL 3UMTA 2OV0A 4XN9A 5FGBA 3VNZA 1P6AB 1IKOP 3K81A 4OLXL 4KJWD 5D7JD 1NCTA 5I6MA 5CJOH 1CTNA 3AM8A 3COOA 2EE3A 2ZWLT 4TSCH 4A66A 5C0AA 2HJLB 4FQCL 4FQQB 1VZGA 4YLQT 3ARDC 4WVRA 2OI9B 4W9EC 5DK2A 5CEXA 3JWOC 2NXYD 2ZCLL 3F6IA 2CIIA 1MREL 2XSKA 4UOW0 4HVBA 2J44A 2C1PB 4UIMB 4LO9A 4CC1A 4M29A 3UTZB 1BSIA 3UYPB 2NNCA 3CFCL 4L9LA 5IHHA 3EHBB 4EUPB 3EJZD 1RJZB 2VXVH 1BCIA 3D18B 4JFEA 4PI2A 3VFGH 5H4ZA 1SVZA 3K3QA 2UY6A 4YSSA 4MAUL 4TUKL 4UZUA 4U3XA 4PJIE 2X05A 3MRHA 3NIDF 5HGGS 1I1AC 3NDZE 4KDTC 4RRPM 1YQ2A 2JXMB 1ORQA 2GHWB 3F8UB 2PO6C 6CGTA 1CE6B 3WLWC 3BE1L 2L04A 4C56D 1PG7W 2CKBA 2CUIA 1GZHA 3B2UD 5D7IF 2BX5A 3D25B 2UVFA 1ORSB 2ALWA 2CRZA 3ZL1A 2DV6A 2C4XA 1XMWA 1EWHA 2I26N 2Y5QA 2VLME 3L3HA 4IU2B 4OLXH 4M7ZB 3LKQB 1I7TB 4PJ5A 2ZUXA 4GKLA 2DQGL 4MAYA 1U9KA 3ALXA 2QPDB 4EIGB 5LHDA 3HB3B 4JHZA 4RAHA 2VCOA 1A9EB 3QZOA 4TMPA 1LO5B 2VC2H 4J3SA 3B2VH 5CJXC 4K23L 2XDHA 4QOKA 5FC9A 3UROR 3VGBA 2H6UA 3QS3A 1MI5A 3NAAH 1OP3H 3C5JA 1O6VA 3QPQC 3BQUB 5CD3B 4RMBA 4S1DC 2CG9X 4IHOA 2W9DH 5FHAH 3F6JA 3S3JA 4XB3A 2X70B 2J2ZB 4C56E 2GC7C 5AW1B 1WBYB 2QQNL 4JUSA 1T3FB 2DM4A 4K5NA 3ENEA 3VGFA 2CH8A 2PABA 1MJJA 3IXAB 3UAAA 3IPFA 3OKEA 2DLIA 4XP6L 1SXBA 2OTWB 5E6RB 4EZMA 4WCYL 1FC1A 3GBNH 3TVMD 1JHTA 4RGOH 4N26A 2VITB 1X7QA 3S5YA 3CBKB 6FABL 3ULVD 1TZIB 3CXDL 4P2YA 2NYYC 1ZEAH 4G1MB 3OKKA 3VM5A 4LSVL 4Y9GA 3HG5A 2DL2A 3FB5B 1JPEA 1T22A 4L8BA 4OGYL 1XT5A 5EZLB 5LWYL 1H0DB 1WO2A 1ZLEA 4UANA 4XMVA 1XCQA 4NQDE 3ZT5A 4HIQA 2X5PA 2YXVA 1X5XA 1YMMD 1JNJA 2DTMH 4XC1L 1XXDC 2ESVE 1ACYL 3V0VA 3CFJA 3LKSA 5CHNA 4PREB 1YEEH 3LH8A 2E6JA 2CBTA 4I1RA 4OVUA 3NSJA 4QY8B 3VD1A 2XTJD 1SDDB 4QRFA 4IK7A 4U1IB 2EH8H 5D71L 3SOBH 1NGWB 2D7OA 5FYKU 2MKLC 4A55A 5ITFA 5LVEA 2HN7B 1S6NA 1WZLA 3KXFB 3FU3A 3MUHL 4R90L 1N2RA 1WC7B 1D5BA 4M61A 3V6FA 1V27A 2OA9A 1U8KA 3ES6B 4A2LA 5TF0A 3MO1B 4MD0B 4X7TA 2DMKA 1X9LA 5I76B 1Z9MA 1MWAB 1N70A 2OTUA 4FF9A 1AKJA 4WUUA 3IGKA 3ZDXE 1QRND 2G30A 3KWWB 2VISA 3RWJA 3RWCA 3KYKH 2XTLA 3Q7JA 2CBPA 1R3IH 3QDMB 2PWHA 1KZQA 3NSFA 5J11B 4ZFGH 1S7WA 3LZLA 5CP3A 4MJIA 5I71B 4UDTB 2BC4B 3ARXA 4LPCA 4CILA 2J6WA 1TR7A 2NTFB 4PJ5E 4I18C 5LAXA 5ADPH 5IHWA 1GYWA 3QUZD 2APTA 1NJ9A 1CLOH 1NGYA 1B0GB 1TEFA 1NGZA 3FU9A 1G4MA 3ILEA 3EYSL 2ARWA 1E5ZA 1RJLB 1URZA 3B1TA 1SXZA 2H9GA 5ABAA 3LKNA 3HE6A 1HQRA 5BJTB 2WAHA 4WU7B 2VLRB 2XN9B 2GJZB 3QULB 4JO1L 5IMKA 1J1PH 3WSQH 4CDHA 5CZXD 4FKKA 1D6VL 4GRWF 4MSWB 2NY4C 2GEQA 3AUWB 4NENA 4WI2A 2CLRA 2WTOA 4K94H 1Q94B 4R2GC 2WW8A 1MSPA 5HI5D 1NIAA 1TTFA 2Q3AA 3RX8A 3S88L 4BUGA 1NLBH 5FGRA 1T7VA 1X5KA 1TZAA 5I0WA 1REIA 3OLEA 3B2PA 1QSEB 5DO2D 5I16A 4JFFD 4ENED 3BH8A 5HXMA 3ZRCC 3S37H 1JE6A 1Z9NA 3FO9A 3KDMA 5BVJA 4HEME 3BKML 3QGVA 3WMPA 1AXSA 1XVSA 1UB6B 3FYIB 4OF8A 5HJ3B 1M2OA 5DHXB 3U2SA 4E41A 3BLPX 3GRWA 4WWOA 4GW1B 4OB5H 3AG4B 1VA9A 3RFZB 5LCVH 3BAEL 1OGPA 2PLTA 2VLLA 2X1PA 3IFLH 4X5LA 4WTQA 4DPBX 2OL3A 2QJDA 2YGPA 5EO9B 3CZEA 1WD9A 4N0CC 4G7YH 3HMXA 1XGPA 3E7JA 4MVBC 4KJPD 5GS1C 5I0YA 4HAGA 2ENYA 2VLKA 2B1AH 2B14A 4V1DB 1R3IL 1ZVYA 1VGKA 4NQEB 1V55B 4DOHB 3SYOA 4PJAA 4QWWC 4IBLT 2LW3A 4PBDA 4X6BB 5GZOC 1QASA 5C0BE 3VG9C 1XR9A 4WAFA 2J21A 2JKLA 5ALBL 1IAKB 5DZ9A 3NRFA 4EVNA 2HZHA 3GRWL 3H9ZA 4X4XB 1ZT4B 5DJ0A 1PLAA 3LB6D 2F1BA 5E03A 2W9DL 5FHAL 5IKCB 4CW1B 1SXAA 2EVHA 4L18A 1G9NL 2G4EA 4OLWH 3T77A 5CSGA 1Y6MR 3HOGA 4OCLC 3SY0B 2VLKD 1NBVH 3PP3K 1DVFD 2NDGA 4YHZL 2IBZX 4FQQA 2X40A 2Y3NA 4KOBA 5GJSH 5CAYB 1Q90A 1BZOA 4FOMA 3TU6A 1RUAL 4PRIA 2VDKL 2WZ6A 3P9LB 5D9SA 5DHYB 5DZAA 3PWLB 1N9PA 2C1PA 4UIMA 3S9DB 4PJHE 4KC3B 3EIFA 4B9ZA 2NY3B 1EVTC 2V2WB 1I1AA 2ERJB 1NWOA 2B59A 1C5BL 5AVTB 1UD2A 3ME0A 4AIXA 2ZX5A 3D18A 3NCCB 4PJHA 1U3HA 4TQEH 9PCYA 2B15A 5G4MA 3N1QC 1XIWB 4KKBC 1NMAL 1OAJA 2DQEL 2IBBA 3L5WA 4FADA 1LO3L 1AOHA 4KTEH 2JB6A 2QPEB 4APQD 4KKRA 3Q44A 3PWPD 2OJZL 3F5WB 5F93C 4OV5B 3UC0H 1NCHA 1FC2D 4HKXB 4XMZA 3ZE2E 3SZ6A 2HB0A 4JHAL 4FZ8L 4NZJA 3KLAA 1W72A 1ORSA 1DBBH 2GITB 4YVNA 5GS2H 2Y6SC 3VFSA 2X2JA 2AMGA 2XA3A 1ILSA 5A43C 3H42H 4OCSH 5HDRA 4G2AA 5EC2A 3IJ8A 3V8OA 5C0EA 1SF3A 1QVOB 3WEOA 3OG4B 4APQB 4JKKA 1G9ML 1QRNB 3CN1A 1H6FA 5E4OA 3NFSH 1OSEA 3QI9D 1UZ6E 1UOWA 1AQKH 4FMFA 3UPRB 4W9DC 1HNGA 2ICWI 1EK3A 4EAEA 3BQUA 4Y1AA 3TPUA 3X12B 5JQ6H 1UT2A 2UZPA 4DQAA 4L2YA 4LAJH 1KCRH 4M8VA 2Z7ZA 2BRRH 5CS7A 2X70A 2J2ZA 2ITEA 4YFDB 4BQCA 2Q7YB 3OR6B 3QQ9C 4GQ9L 3I02B 4RSYA 3O2DA 4PWJA 4BQ6A 3VD2A 4OJAA 4EDWL 4Z78A 2EH7L 5FGCE 4Z3EA 2PMZA 3V0JA 1QRNE 2LTQC 3I2CH 2OTWA 5AKVA 1T1YB 3CVHA 5EIIG 3MNZB 3RIFF 3LCYA 5TQ2H 2CGYA 3SBQA 1NDMB 2BOBB 3VXOA 1IGJA 3S36H 2VITA 4YHMH 4RBPK 1CE1H 2GBVA 3A0OA 3BYYA 1TZIA 4W4NA 2NY6C 2ITCA 2XPGB 3T0XA 4MBOA 3UMNA 5CZRA 4GUOA 4G5ZL 5BMFL 4FQJL 4I7ZC 4TSAL 2WWMC 4X8CA 5D72L 2W60A 4PJIF 4LSSH 3FO2A 12E8H 2W65A 1J12A 1JZJA 3M7OA 1SJHA 1R9FA 4DGVH 1AQ8A 3ZKSD 3KGTA 4G6FD 1MCWW 3EKCA 3L9RA 4I85A 3BWAB 1QQDA 2FQFA 1DBKL 4IBSA 4BUHA 4LRIA 1X4YA 4TSCL 4W68A 1IX2A 2UZYA 5D7IE 4AYFA 4XC3H 4F9LA 4DKTA 3BXNB 4D8PB 1X9UA 2EIEA 1RZ8A 5DHDA 1E6OL 4LPVA 2OMYA 2IAMA 1DEEA 5EDSA 3G08A 1N2RB 5CN1A 2Q0ZX 3UJTH 1IGCH 2WLKA 1U8KB 2WJ7A 3ES6A 1GYAA 1NGXB 3E6FB 1WCBA 2DWDA 3BUDA 3W81A 1HHIA 4JHWL 5F9JB 1FSKB 5FYJH 1MLBA 2VDML 2DLEA 5FOBA 4M3HA 1GS7A 5DMJB 4QOKD 5IB1B 1BPVA 1L5GA 4CVUA 2QR0B 2IDUA 2WZ5A 5DRWA 3VXRE 3O8XC 1BAWA 3NVQA 1QLEL 1B90A 4NXKA 1MRDL 4NQCD 2I9LA 1VDGA 4G7VH 2FSEA 4E9YA 3DKHA 3LPOA 1BEXA 4X4ME 3HBGA 1W8EA 1QHOA 1RH8A 4P23C 4OU3A 3BAIA 1GVIA 3DPBA 2NT1A 5KSAC 1KCWA 5DJAB 4JM2B 4Z9KB 2DMBA 4YHNA 1HZKA 1IT9H 2E5EA 5ESAB 4GOSA 3HS0C 3NZHH 2JK5A 1EUTA 4WU7A 1E6JH 1MH5A 2UWEF 1D5IL 4TKWA 3IDXL 4OF0A 4MQSB 1YAIA 4N0UA 2PN5A 3VFOB 3GSXA 3UEQA 4E2OA 3INUH 3E2HB 7FABL 1Q94A 5GGVH 2NDFA 3MJ8A 2CO2A 4NP4L 1NICA 2YJQA 3V9EA 5LXGL 2BS71 3WBDA 3MNVA 5HJGA 3CVIH 3WIHH 5EOTB 2L4OA 4MMZA 4N9GB 5A2BA 2F7RA 3BPNB 2WZPD 2VDPL 5KUMA 3TNNA 4YXKL 4EI5C 3V5DB 3C6LA 2VMJA 1DVUA 2WQ8A 1AXSB 2FX9L 4ZPTA 4K71C 5HHME 2EO1A 4KY2A 4DKEL 2BSTA 4M6NH 2JKIS 4CU6A 5IGXL 1AY1H 3BX7C 1XF1A 2W0KA 2F8OA 4PVNA 3WS6C 1J88A 2Z93A 2VLLB 5LBSL 3NJHA 1OB1A 3MRKA 5DURD 3P4LA 2FR4A 2A74B 1T0NA 4XMUA 5GRVL 5DI8B 4Z3IA 4BWUA 5K9OA 1MRCL 3SDAA 4HEMA 2JMRA 2AK4D 3BEWA 1VGKB 2ZYIA 2DI8A 1UXWA 4A6YA 1A4KA 1UB5A 3ZDXF 3LRMA 4PUBH 4PJAB 2Z35A 3JTTA 3RGVA 1LILA 1YEHH 2YA1A 1IAKA 2EC9U 3QUXD 2YGOA 1ZHKA 1T83C 5T1MA 4EQ2A 5L7XH 5LAPA 2CGRH 3M8OH 3WY1A 4ZW5A 2LABA 1RUPL 2F2HA 1A7OL 4LAQL 4CW1A 1F6AA 1WBXA 4LOEA 4NRYA 3VI3F 4B9JA 3NOIA 5CFAA 4YDKL 4P59H 3QCUH 3LQAL 4AEIL 4M5YH 1AGDA 1QUNA 5F7WC 2W07A 1CGXA 3IDYC 5KBMA 1XCTA 3D0LA 4KVCL 2VZ1A 5DFAA 5FO7B 3M6DA 3QFJD 5D8JL 1ZIBA 1HNYA 1Z5LB 4GRWE 2ZG2A 3HRPA 4XO3A 4ZOCA 4JQVC 1V3MA 5E2TH 4F5CE 1J0JA 1U8LA 3ARTA 2IBGA 1PX8A 4ODSH 5DR5L 4FQIL 4MA7H 3NJNA 4ANUA 4XPGL 4URKA 3G9AB 1WV7T 4PWKA 1S7VA 3JUYA 4Z7NF 1IE4A 3LOWA 5TH2B 4XXCA 1KT2B 4F8NA 4P5KB 2QKIA 4ZI8A 4CJ1A 2X1QA 1X9QA 2Q3ZA 1ETJA 2AZUA 2R9HC 1IQDB 2XWTB 2XBTA 43CAB 2JTDA 1HT6A 3V52L 3QH3B 1MCEA 5I24A 2FD6H 1N6UA 5C07A 1YEJL 2G3XA 5JIKA 1L9RA 1WAAA 2W59A 2ZXWB 3TEXA 4NBYB 2V3FA 2NNRA 4GMSL 2B3RA 5L2KE 1M7DA 2H1PH 2HT3D 2WXNA 3L7FA 1P5UA 3PWJB 5CN2A 3T1WA 4PJFE 3KDPB 2V9QA 3QO0A 5ECGA 4FRWA 1CLYL 4OV5A 4NQTA 2BSRB 3NJFA 4PUBL 5PAZA 2Q1EA 1EJFA 4UB0L 5J6HA 3EYVA 1MCJA 4OGQC 4XN8A 1YECL 4W9KC 1T20B 1WH0A 1K6QH 5F1NB 4N2AA 5EU7E 1B4TA 3NRPA 1O5PA 2AJXH 1QVOA 3UGUA 1BQ5A 1XEUA 3G5YB 4HAKA 3ZUNC 2ZAHA 1LEGB 1W6LA 5J56B 3TN0C 5D2NB 3DO7B 2A9ML 4PJAF 4H8HA 3GLAA 4PM1A 4KMQA 5DK0A 3E6HB 4G59C 1QBMH 1GOHA 4JPVL 4AL8L 5J3HC 4WFGE 1VRSA 1HINH 1I9EA 3CZUB 1MHHB 4QRRE 4WKZA 5E6IA 1A4AA 4GI8A 1AKJD 4WUUD 1FYTB 2WUBL 3TTYA 1RUQH 1YQVH 4IIZA 1UFGA 3T8XA 4K94C 4XNXH 1FL3B 3MCG1 1IAIH 1QW8A 4FXKB 1LO0H 2OTPA 4YDMA 1AIFB 1I8IB 2J1ZA 4QOKE 3UTOA 2MQ0A 4A67A 4QRTB 4WWKB 5FECB 1AANA 4ZPVB 4F9PC 1IJNA 1QI5A 1KY6A 2L7JA 3IFPA 3WEXB 15C8H 4PJXF 4DPRA 2ITCB 2XPGA 1P4BH 3SPIA 4JO3L 1SDYA 3W3BA 2HLFD 1U8HB 2UXGA 1PVHA 5ICZB 3IJYB 5HYSG 1HOEA 3GF8A 3MODL 2KPWA 3J07A 4EOWL 4JFHE 3CSTA 3CFQA 4PVMA 1SJHB 4XVSH 3A6BH 3LNHA 3L9RB 4JEGB 2XY2A 4UAHA 4FCHA 3X13A 4DKFL 1M71A 2R2EB 3IDIB 5LNDA 1XTMA 5I26A 1NCOA 3ZE2F 3NACL 1PDKA 5D6DC 2ZXCA 3CZNA 5C0BA 1A9BA 1MY7A 4N2LA 4EKXA 4OGAC 3V9FA 4G11A 1CTMA 2YXFA 3VFVA 4L8CA 2FX8H 2OMYB 1DEEB 4KUCD 1QFWM 3WJJC 4IGBB 3QNXA 1I8LC 5B8CB 4XVUC 2X2YA 1HOCB 1PIFA 2FE0A 4Y2DD 2ITDA 3ARFC 2YD4A 3V4PL 1VERA 3X3GH 3QJQB 5C0NC 4MNGA 5DJ2A 2J20A 3FH8A 3FT2A 3WEBA 5EH1A 3LRHA 5KSBB 3S3CB 2JKWA 5FX3A 4S1QH 1YA5A 1UZ6F 43C9B 1QYGH 4OZHF 1ID5I 4QAWA 1L5GB 4Z7AA 2XVKA 2C9VA 2XQ0A 3WXWL 3QEHB 3I75A 1LMKA 1U41A 2EO9A 3FTYA 4JGJA 1GCFA 1OOWA 2EEFA 4ONGH 2WGXA 5BS0E 3C87A 3LV3B 4G9FA 2FSEB 2CA3A 4Z7WF 5HGDA 5KVGH 5JPMC 4NSKB 3X11A 4XRCA 2WNKA 2XVBA 3GMNA 3IWUA 3O9WB 4R0LA 1IBDA 5ESAA 3RTQD 1LD9A 2F15A 4P4KA 5DT1H 1JPGB 2Z65C 5G55A 3LS4L 1F2XK 4EI5A 2VDMH 5D7KD 1OANA 4A04A 4BZ1H 2B9BA 4KKAD 3VWKD 2EH7H 3BGMB 3SO5A 5TDPB 3NH7H 1AH1A 1U8QB 2CXGA 2OMNA 4U3SA 4LSPL 4FQLL 5ENWB 2NCEA 1IAOB 1JN6B 3MQIA 1UXLA 3KWXA 4GT7A 1WZ1H 1EQWA 4XPBL 3VXUA 1KGCE 4NS0A 3UZQA 1SVBA 3MNVB 1YEIH 3U6RA 3NFNA 4N2CA 4HUUA 1OVZA 1AQKL 3CPLA 4PJ6A 4HHAB 3QW9A 4BIKA 4GKSB 4LVNC 5E6ID 1U33A 4K3DL 4MNHA 4Q9BA 1JUFB 1MKFA 2J55A 3IDNB 1AMYA 3VM7A 5CLYA 4HG4K 3WNPA 1GC1L 4QXTA 1KB5L 1YNTA 4UM8A 1UXSA 4S2SB 3O3UN 4HFWB 1OP4A 1KIRA 1U8JA