3L1FA

Bovine alphaa crystallin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
97
Chain Sequence
SEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVERAIPVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin A chain
publication title Crystal structures of truncated alphaA and alphaB crystallins reveal structural mechanisms of polydispersity important for eye lens function.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 16
structure length 97
sequence length 102
ec nomenclature
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l1fA01
3AABA 1X5MA 4JUSA 2WJ7A 4YE0A 2Y1YA 3QORD 3W1ZA 4YLCA 2JKIS 1SHSA 3L1EA 3L1FA 4MJHA 1RL1A 1WH0A 3GLAA 4ELDA 4RZKA 2BOLA 2CG9X 3Q9QA 3VQMA 3GUFA 2KLRA 2N0KA 2MNWA 4ZJ9A 4YDZA 2KMWA 4M5SA 3AACA 5DS1A 3QORC 4PCKA 3GT6A 2RH0A 3Q9PA 2N3JA 5DS2A 2WJ5A 4PBDA 2XCMC 2Y1ZA 3QORB 1EJFA 3J07A 2Y22A 3L1GA 4I88A 1WFIA 3N3EA 3QORA 4M5TA 5LUMA 3IGFA 4FEIA 1GMEA 4YLBA 1WGVA 2CR0A 4YL9A 2O30A 3VQLA 2K8QA 4JUTA 3EUDA
chains in the Genus database with same CATH superfamily
3GHEL 5CHNB 2QJDA 1MW3A 1S7QA 1QYGH 3DK0A 5CN2A 3IFOB 4JRYA 1I1YB 3WV0A 5CD3A 1WUNT 3T4YB 2ZXEB 5JNYA 1A47A 3F5WA 4JFED 5M7QA 4YBHA 3G5YB 5DJCB 1NTDA 4CVUA 1W0VA 2J88H 1CICD 1FAKT 4X6DF 5L0QC 4W6XB 4LF3A 3F62A 1HL9A 3HS0B 1FFQA 4XGZB 2AQRA 3FO0H 4IU2B 3SE4C 4P2QE 5C0BD 4NZRL 2LLNA 2BVOB 2ICWJ 1UH3A 1NCGA 4N24A 3ETBF 3KPQA 1U8HB 4MD5A 5FK9A 5KUKA 1IM9B 1E27A 1SEQH 3CBJB 4K3HA 4W9LC 3ZYZA 4GS7B 4F7PA 3MUZ1 3EGXB 4H1LG 5K59F 4KGLA 3GMMB 1E7UA 1MCSA 4BSVA 1E4KA 2ITDB 4OW6A 4U6XB 4WW2F 4YFEA 1CGWA 2YN3A 3LZNA 4J8QA 4AEIL 4OLZH 4NLHA 3VXQB 2VAAB 1NUFA 3FBQA 4HGMA 2N1KA 4XHQA 2FUTA 5KW9L 4NUGL 4UB0L 3NYKA 4BBWA 1NCOA 4FOMA 4LCYB 2ZX7A 3EZJB 4LSPL 3C5ZC 1IFHH 4FJ6A 4ZZKA 4UV4H 2VKXA 3NACL 1IAKB 2K7QA 1TITA 2A6IB 4J28A 3WL9A 4PJ7F 4OCLC 3LNIA 4N0CC 3VRLE 2IH9A 3GD1C 2V5TA 1G7IA 4I85A 4ZXBB 4BSWB 3AZUA 1DVUA 4HFUL 3FFCA 4LRIA 5DHVA 1BJMA 2OTWB 3B3IB 4UV7L 2VMFA 4HG4J 5FHBL 1PW3A 1B0RB 3WFEL 2VGLM 4XNDA 4LDOB 1B88A 2VLJE 4U7SA 1XGRB 3CDGB 1DSFH 4P5TB 1Q72H 4K7FA 4LOUC 5I73C 4Y4HD 4P2RE 3TYFA 3B2MA 4TNFA 3UJJH 2HKHL 2JVUA 2WM0A 4QRSA 5J6GB 3ZUNC 5IFAL 2VLRA 2XTJC 3O41A 3OPZL 3NZ8A 4I4WA 4FLOA 1MFAL 4LNRA 2H47C 2L8AA 5H35B 4JDEA 3O3AB 2ESVA 2XWTA 4XPHL 4YGVB 4YFDB 2D7TL 3MRDA 1K6QH 2R0LL 2ARWA 3D2UA 4OM0L 3T65B 3KM2A 4WNQA 2BS9A 2H41A 1IGCH 4JPKL 2PR4L 1OSPH 1QTYT 1UUSA 1A3LL 3I6GB 4OZ4B 3GSUB 2ZWLT 3NOIA 4GT0A 3DO4A 4GKNA 2PCPB 4ZX5A 3U0TA 3VFSA 1D5IH 5EUOE 2IJ0C 3GF8A 3QJVB 3HPJA 3PE9A 3IPBA 2VISB 4LIQE 4NO0B 3T6XA 5IGXH 3VXPA 3JV5A 4JQIH 5FO8A 4MA3B 3BPCA 3UTQA 5D1XC 4L9DA 4QY8B 4KV5E 4ODXB 4JZJA 2CHZA 2KI6A 2BS71 3AM8A 4O2CB 3WEXB 4G7RB 4U3SB 5FYLE 2NRDA 3CC5A 3H9SB 3RTQA 3SE3C 1UZ6E 3ULUL 1UXSA 9CGTA 5BQDA 5BRZD 1K3ZA 1PX4A 3L2LA 2EP6A 4B6ZA 1U6AH 2YRBA 1HINL 5CILH 1H19A 4POYA 3MFFB 2AMGA 3T9WA 5EEYA 1XAUA 1XMWA 1GAFL 2MCAA 1T89A 2O6EA 2EO1A 1N6VA 4WWID 3U46A 4O4YH 5LGJA 2GJRA 3SKNA 2EYSA 1FNEA 2DMBA 4UWQB 4PYHA 5TQ2L 3GZOA 1UGKA 3RI5F 5TK4A 1J8SA 2W07B 3GBMH 4PWJA 2EH8L 3P69A 3ECWA 1CBJA 4TNVK 1PNCA 1AGCA 2EEBA 2FR4A 1CLVA 2YN5A 5DZVA 4F20A 1HAWA 4ALAH 1ETZB 3QUKA 5J9PB 5AKVA 5DK3A 1CUOA 4XPGH 3TX4A 8PAZA 3K8LA 4MVBC 4LSUH 2ROXA 1M9WA 3RGHA 3PUCA 3DWTA 4CC4C 1CGSL 3W39A 1QI3A 4U6HB 1NPNA 5EIIB 3VSQA 2WV3A 1F8TL 3JVGA 1HZHL 3PL6A 2KH2B 1NAKH 2A3TA 4Y5VC 1CFTB 3DYPA 1AD0A 4J2QA 2CHXA 2GK0A 5G4OA 4J6RH 3D25A 5HGAB 1ZE3H 1R0AL 2J21A 1A6WH 4TQIA 3U30B 1T1XB 5KSBB 4JFYA 4B7IA 1CE6A 1YEIL 3IKKA 4RMUA 1MUJB 2QQNH 4O2EB 5C0DA 3IGKA 1EA9C 3KE0A 4HHAA 4KRLB 1JD7A 2OMTA 5EBLB 4AGQA 1B0WA 5HBBA 3LH8A 4KTEL 4NZFA 3QB7C 1A8JH 3KGTA 1X4XA 4ANWA 3C8HA 3WFCL 2VRKA 4MDJA 2Y36L 3F05A 5D72L 1WZMA 1XCWA 1ASPA 3DBXB 3OKKA 1YUHB 3ZKMC 1TOXA 1CYWA 3HCVA 1IAII 3D0VB 2A9CA 5D2NE 4FNUA 1S7QB 4KQ4L 4YDKH 1XGUA 2Z34A 1N8OE 4HIPA 1A1OA 3WIHL 1SDDB 3AU0A 5JNYB 2CO7A 4X6EA 4ORZC 5EWIH 2X2JA 3HNSH 3F5WB 4F1ZA 4FFYH 4HS6A 3FFDA 3Q43A 1UH2A 1VFBA 5DJ2B 3BE1L 4HMDA 4LF3B 1A7PL 5JHDB 3B37A 4Z95L 3BRDA 1AKPA 5GSRB 3GJFH 2DH3A 3MOAH 3LKOA 4FTDA 3ULAB 5DWPA 4M03A 3LS4L 1BZ8A 2YRZA 1RZ7H 1NWOA 3HI5H 5FUCE 3R8BB 4QLRA 1F6FB 4WFEE 1AXSA 4ZTPH 4YMPA 1BEYL 3FW6A 4HH9A 3FTVA 4GXVH 2EQDA 2JNZA 5DMIH 2WJ7A 5HGHA 1J12A 5C86A 3AXHA 4B9FA 2Z0UA 1VZIA 4JFQB 1CGYA 2DD8H 4YFLI 4DCQB 1XD0A 5SWZE 4WEMB 3BQUD 3NQKA 4QT5A 5CZKA 5I1JL 3CTTA 2MFNA 4NKDA 3QPXH 3WO3B 3EYQC 4X4YA 1FA4A 4CN1A 5DHXB 2XQBH 1PZCA 2RGSA 2XVKA 4JY4B 1FN4A 1IVTA 1T66D 1KYOK 3BN9D 4A6YL 1AI1L 2X05A 2KS0A 3QUYB 4Q6IA 4GMSH 1VPOL 2P8LA 4PJ8C 4PRBA 2Z7ZA 1UM6L 1CR9H 1YYCA 4UNIA 4K7PY 4Z7IA 3C75A 4WUUD 3SQRA 3MREA 4H0LC 4Z7WE 3I75B 4P4RB 5C7XH 4PJDA 1V55B 5HJ3A 2BHUA 3FFCB 1ZAGA 1UCTA 5TE6H 4MD0A 3GXPA 2A74A 5T1MB 4F8LA 4ZO6A 1A9VA 3C08H 1ZXQA 1BJ1H 2RD0A 4Y4HA 1ZANH 5EUKA 3GI8L 1OD9A 1C5BL 4I18B 1WCBA 4DFHA 4K2UL 2PPFA 2BSTA 1TEYA 2W81C 3TYFB 3V4VL 1T4WA 4GG6A 1NOFA 4NQUA 4IMKA 2WZ0A 2G5UA 2TSAA 3FB5A 1WISA 2A77L 2ORBL 3O41B 1BLNB 3BVNB 3UERA 4HOXA 2FSEB 5B38A 3WUZA 1FL3A 4JL2A 1FAIL 3GGWB 4I4WB 5K33A 4JFFE 1Z5LB 4LNRB 4CJ1A 1DZ0A 2XWTB 1NCWH 2OTPA 3G3LA 5J7CC 4MQ7B 2MOGA 3HG3A 3LNGA 5DYFA 3Q1SH 3LKQB 1M53A 3A23A 4L8DB 4NQEE 4IDLA 2J44A 2BNRE 5A2JH 1IEAA 3CZUB 4NSKA 2AZAA 4M6OL 4JJ5A 4PS4H 5K93A 3VM7A 1MJ7H 2I24N 4PJFA 4MFHA 1J8HB 4AUJA 2DEXX 4MAUH 1YNLL 4LVHC 2M83A 2P5WE 4NM4H 3EW3B 4XP5L 4UQ3A 4LSTH 1W0WA 4IJ3B 1S7VB 4H20H 1T7XA 3AWFA 3B6SA 4QKTA 5BRZA 4ZUVA 4OUUB 4QYAA 3LZFH 4BXSV 4MYWB 3B9KB 3CC5B 1UXSB 2C4FT 3FQ4A 2R27A 5T3XD 4LASL 1Z5YD 1L0QA 4KX7A 5GRXG 2JI2A 4HJ0C 3TEXA 1S5IH 4OR1A 5JZ7C 1E5ZA 3GKZA 3IFLH 3U46B 3NP3A 3A0OA 3OKOA 1JZ5A 4A2GA 1RUAH 1W15A 3UZEC 2V7HA 1BZ7A 1JIBA 4UQ9A 1EH9A 1ZV9A 3BESR 2E4FA 3KPMB 2H3NA 4M8RA 3Q8AA 1OAQH 4MJ5A 4DO4A 1P7HL 4K7PX 5EDSA 3GBNH 5IBTH 3HG5A 3GSXA 4N2DA 3UIYA 4AUUA 3N44F 4QEGA 3W37A 1U3HC 2CLZB 3MLWH 3EUDA 1I8LC 5CN1A 1QX1A 3O6FB 2ZOUA 4KK8C 1NGPL 1F3JA 2NNCA 4JR9L 1KXVC 5HDWA 1WJ3A 1EVUA 5TPWL 2YAMA 4QRPD 3GUFA 3QR2A 1WAAE 4K0OA 1CGVA 3ZE2E 3QRGH 4CDGC 1TSRA 1NPUA 4NKMA 3QZOA 4Z7OE 2ZWNA 1M6UA 4Q9RH 1AD0B 4EF3A 2E7BA 3HAEB 2X70B 5FGCB 1CD9B 2GK0B 2ZOKB 3QI9C 3D25B 4OSUH 3KPSD 2YQGA 2PWEA 3NP4A 4LHUG 4NNPH 3ILQD 1QSFD 2H6PA 1WLHA 4OLVL 2EO9A 5HDQH 3EGSB 4Y89A 3ROLA 5AKRA 1CLYL 1ICTA 2DI8A 4OBRA 1X9QA 4BDVB 2A1WL 4J3SA 1ZVSA 5E5LA 5I5MA 3LN4A 3EF4A 3D09A 3OAYH 1PVHA 4FFZA 2P24B 4TLKA 2BFVL 2ZKMX 3IDJB 5L88L 2DQGL 1ITCA 1NPJA 1ZD6A 3P11H 4XOBA 2JCCA 2Y07L 4JVWA 1OANA 1NBVH 3K71B 3HCVB 2FB4H 5C0GA 3VWJC 2CRIA 4JFEB 3L9RB 4KVNL 1I7UA 3WFHA 2WWMD 3FT4A 3P0VL 4HZAA 1CICB 3DA0A 1XCXA 4FF9A 3WNLA 4A38A 3BKMH 3AAZB 4ZMTA 1TU2B 4X6EB 3W0WE 2FBJL 4PRPE 5D1ZA 1BVZA 3FHAA 5C0BB 2Y24A 4HS6B 4MNGE 4KKQA 3U6RA 2F8IA 3UDWC 2A4ZA 3F65A 4NPKA 3L7FA 5T5NG 4AGOA 5C0JA 4QHKJ 3K4ZA 2LLLA 5G4MA 3HI1B 4E9XA 3FAWA 3NCXA 4L8SB 2OYMA 1I9EA 2FQDA 5GRVL 3C6LD 4GQZA 1Y0LA 5J13C 2F5BL 5HHXL 5HGHB 3NJJA 4PJBF 4KITB 2DWEA 3ALXA 2UY7A 4KK5D 3SCMA 1H6TA 4V1DD 4K9JA 1A66A 3OMNB 2R9HC 4XXCA 2X6CA 5J12B 4KHXH 3HUJF 1QP1A 3QUHA 3P0GB 3MRFB 4NBZB 3N1GC 1OHZA 4MJIE 4U0RB 3ZE0F 1P4IH 1NIEA 1ORSA 1U8MA 3TM6A 1BHGA 3EJSA 4H25A 1AZBA 2WLYA 4X4YB 2BCKA 2WLLA 1JPSH 3AU1B 4HUWA 1FN4B 4WUUA 4XOAA 1O6VA 3DRTB 4YHZH 3CC1A 3ARQA 1SPDA 1T04B 5LXGL 4J8RA 2VN4A 4MB3A 4IIQA 3W1ZA 2MJWA 3ZSSA 3UEQA 1NFDE 1UZGA 4XMLH 5IW6B 4HFWB 3LX9A 1RUPH 1RZIA 2OI9B 3NA9L 1FVEA 1DTUA 3QQ9C 2MCPH 2BNQE 4ICWA 1P4BL 2FATH 3SZ6A 2B8OT 1OCWH 3L5JA 4KK6C 4LHJB 2R69A 4XT1C 1OL0A 4HUKB 4RQQA 4Y4HB 3H42L 3QG6B 2BSRA 1UT1A 3DMMA 4O51B 2Y1VA 3E6FB 3G6DL 3EF7A 3ARZA 4QOKA 2NQDA 3ARED 1WCBB 2XIIA 2VXQL 3BIAX 3CIAA 4M4PA 4RLDA 5FX3A 4LHQB 4XVTH 2FT8A 3IDUA 3MPCA 3CQFA 2X4SB 3FB5B 4FI6A 4Y5YC 4FQXD 5B38B 2EC9T 4M61A 1FL3B 2XQYK 5GS0H 1VFAA 2FX7L 5TDPA 1OSYA 4B7LA 2BIIA 1EEZB 1LDPH 3RX7A 7TAAA 5F0PB 3AXLA 1FRGL 1PMYA 1F00I 1BX2A 3DUUA 5DUJA 2ARJA 4ZD3L 4KKAD 3HKFA 5DRZB 4I8DA 5BW7A 1IEAB 4R5XA 4RIRB 1AR1D 1Q9WA 2DL2A 3DIFB 4JJ5B 3QDJD 5IW1A 2ZUXA 4PJFB 5CLYA 5ACZA 5GISH 3DSFH 1IKFL 2EADA 5ANMA 2CGRL 2XTSA 4XX1E 3VGBA 3NSDA 2JFCA 5I1GH 2FCBA 2VH5L 3BPOC 2DWDA 3UJTH 4MQXD 4UQ3B 1B0GA 1W0WB 1KFAH 4IBZA 1FL5B 5MEPB 1QEWB 5BRZB 1GSMA 2WBWB 1O9VA 3BP5A 3C6EA 4KX8A 4LSRL 5CLZA 4ZUVB 1DO6A 5FYKD 6PCYA 2WC7A 5DJYA 3STLA 4FQIL 2APSA 3WN6A 1N59B 3KD4A 4HLZG 1CQKA 4TUOA 2X6VA 4K9EH 1JGUL 4YPGB 5DR5H 3ARDD 4ES9A 4X2UA 5H4YA 5FCUH 4LQ1A 4OJFH 4HU8A 4RISH 1ZTXE 2A9ML 4JUTA 1BZEA 3STBA 1SLVA 3RFRA 2XY2A 1TKWB 1EZUA 1SBSL 2FUQA 2RB8A 5ICXA 1K8DB 4GG8A 5IFJB 4JFUA 2W1NA 2YD5A 3OKOB 1M2VA 4WY7L 3SO3B 4FZEH 3UO8B 4JO2H 3UZVA 2FBRA 2OYKA 2P8MA 3T0AA 2ICWI 2ZKHH 3WE6B 1JZDC 2H3NB 1KGXA 2OXHA 4ORGA 4MJ5B 4AYGA 4MYPA 2PP8A 5IQMA 1BQLH 1DCEA 4DK5A 4NQXA 1LJMA 3GSXB 4ANVA 2V3EA 4GRWB 5F9OH 4BELD 4L8BA 1AIFB 1GGUA 5CZXD 1RZKL 3BP6B 4MA7H 1CD8A 1F3JB 2ADFH 4D94A 3LXUX 3VXSD 3N85L 1OB0A 5IM7B 2YGVA 4PGCA 1R4XA 4BRJA 4ODVH 4W81A 1G7QB 5SWQB 1NL0L 3EFFA 4B3VA 5IBUG 5F7YC 5LNEA 2IALA 4Y4KA 2CRZA 3FU6A 2CK0L 1DL7L 2DQCL 4NKMB 4YK4B 4JM0A 4UT7H 2HFGH 1QSFA 4BUQA 3TT1L 4HJGB 4S1DC 2DYSB 2EUWA 1N0XH 2H45A 5TE7H 1EGJL 2IADB 2W65A 3ROLB 1AYOA 1IL1B 5BRPA 4M02A 1J87A 4I9WE 4Z8FL 3OLGA 1MCOH 3CN4A 3BPNB 1PZ2A 3REWA 1DQKA 5I9QB 2EINB 5J1TC 4QRUA 1PKQB 1EEYB 2AEQL 4ODSH 4OFVA 4B9PA 5C0GB 1QFWM 2EZ0D 4CC0A 2R8SL 3IFNH 3JTTB 1ZOXA 1I7UB 4PJ9A 1YYLH 3WFHB 2AJYH 3HC4L 2YD6A 1SXBA 3VFNB 4PHXA 3U0PA 5ABZA 2CKNA 5BQ7A 1QPPA 3ILDA 1YN7A 4URTB 3U6RB 4H44C 1G9HA 1OOAA 2IWEA 4AKPA 1WV7T 1B6DA 3C6LA 5HDRA 3EH1A 3F7RA 3NSYA 4AE0A 3B7SA 3ULVH 4KKCD 4RDQF 4FQ1H 1TZGH 4RWYH 2JE8A 4Y8DC 4KVCH 4HBCH 3EDJA 1Q0XL 1ADQL 2DLEA 1Y0LB 4HOMA 5FGBA 4X6DA 1QI4A 4GP4B 5LNDA 2YA1A 3BQUB 1D2PA 5HJBA 4FKHA 2DWXA 2YXFA 4AH2A 4E9SA 4Z1PA 2UY7B 2BP8B 3M7OA 3UCQA 2FZ3B 4PMFA 4FABL 1UJ3B 4JBSA 1UD4A 4LP5A 1YCSA 5H94A 2CSPA 4Y16C 5FECA 4UOQA 5D70L 3FUFA 1OF0A 3FU3A 1U8MB 1CK0L 1LO3L 2VL4A 4H25B 1JD9A 3Q2VA 4GI6A 2BCKB 1W72H 2AJUH 3VGFA 4HUWB 1R47A 3DUSB 2H32A 2I60L 4WUUB 2OW6A 2D03H 4OI9A 4HS8L 4QI3A 4WW2A 3UTZA 5SV3A 1H5BA 4ONFL 4J8RB 1F3DH 1CDYA 1XIWB 3MRGB 4FNLL 3TEYA 2ODHA 3BC9A 1JS4A 4AUYA 3HMXH 2XZAH 2EE9A 2X28A 5I8KL 4P4KD 4HWBH 2OK0L 4N2FA 1G84A 1I8AA 3MC0A 5DLML 3X17A 2DBLH 3UTPD 1I8MB 5LVEA 2F5AL 4XR8C 3M1BA 1KEGH 3WJJA 3WEBA 1IJNA 4NUQA 4KROC 1TMCB 4FQXA 4JDTH 1HDMA 3MRIA 1BG1A 4MHHI 4F57L 3KNBA 3CFUA 4UTAH 2GJ6A 3LZLA 1RIVL 4MCYB 2C9AA 1PG7L 2E6PA 2LU5A 1RUQH 1VFAB 4QPEA 1KCRL 5T3ZD 3RDJA 5K69A 5C0CA 3R1GL 1IGIL 4OCNC 3GSNH 2HRGA 3P2DA 2R15A 1YEGH 3VFPA 1XCTA 3AXLB 4XPAL 1N7ML 3DUUB 2ARJB 5CJOH 1FZOA 2W91A 4F2ME 2O5YH 2H26B 3L4XA 4W4OC 3QAQA 2E76C 5C6TH 3E8VA 1Q9WB 2BSSA 4AV4A 4E0RA 3BZEB 4P23D 1MFEL 2WXPA 2P52A 1BD2D 2QFPA 3OX8A 4XP4L 4YHIB 3HE6C 2UY6B 4MMYA 3LQZA 3APFA 4HV8B 5FLVA 3PV6A 4Z3JA 2C9UA 1ZS2A 2DQDH 4K5NA 5E08L 2DWDB 4U7MA 3HW7A 2YGOA 1DBBL 5HTSA 4J3OC 5HI5D 3GLEA 4PR5A 1CGUA 3BP5B 4NNXA 1CG9A 1WBXA 4JB9L 4RMWA 5DJYB 3AG4B 1KBGH 4HALA 4CNIA 4POZC 4IKIA 5KVEH 4TUOB 2MOQA 3RNQA 2Y22A 4IRSC 4TVPE 2NYYC 3HR6A 2CLRA 2VXSL 3NFNA 4NWUH 1JV5B 3WU1A 3EJCA 3DGDA 2GEEA 3MLZH 1CXIA 4G6KL 3LD8B 5ICXB 2AK1H 5D8JL 4GG8B 4JHBA 2PTUA 4FN0A 4WO4D 2HTKD 5DJ6A 1M2VB 5IROD 4K4KA 5KEZA 3CFCL 1NGYA 1WC7A 3UZVB 3DX7A 3CWGA 1YG9A 2P8MB 1NBYB 3VFRB 5JPMC 2FE0A 1DN0A 4ORGB 2YPVL 3HZYA 2IH3A 5F1KC 2JXMA 1ZS8B 2OP4H 3O2VH 4XCNA 3BAEL 5JR1L 3VXSA 1IB5A 1Z6JT 2Y2YA 3HHSA 4FYTA 2DQTH 3DIDA 2GFBA 4QRPB 1S9WA 2HWZH 4EI0A 3INOA 1O9WA 3T4AC 4GB9A 5ENWA 4LE8A 3C5JA 3EYFB 1BG9A 2NZ1A 4PGCB 4X7CC 1INQA 5AEAA 1CXEA 3WJLC 2GJPA 4XB7A 5B1KA 4ZFZA 4KDTC 5C2UB 2J12B 2A9BA 3EFFB 1BJ8A 1MWAH 3EO9H 1ZGLM 5E8DL 3AC0A 5J8OA 2ITCB 2CBPA 3CFQA 2IALB 2ZXBA 3KPSB 1JNHB 4WWNA 1XSKA 1CL7H 3QWRD 4DZBA 1ZXKA 5A43C 3LQAH 1ZTMA 4PRHA 1CTNA 2PWDA 1WFTA 1QSFB 4I48A 3V0VA 4J3VA 4XVSH 1F6LL 3EYUL 2HX9A 3M7FB 4F8TA 2K4AA 3OR7A 5ALCL 2NUPB 5E6UB 1FHNA 4MMXA 3M07A 3LB6C 5E9AA 3WJMB 4EUPA 4HJJH 4RZCB 2R1WA 4HDIB 4Z23A 2W65B 1GGCH 2YUZA 4M6AA 1P4UA 3JTBA 2IFFH 4RGMB 1M7DA 3REVB 3PP3K 3F58L 4JM4L 4ACTA 4WWKD 3AS2A 5JHLH 3HAEH 2BFGA 1N4XL 1N6UA 2FNBA 4B5ZA 4R7XA 4P59L 2R2EB 2VR6A 4GY4A 1N3NA 4QRUB 5E1AB 2N7AA 1LMKA 5DT1L 1ETJA 4EIBA 4Y7OC 3VG9C 5I1KH 1QBML 1LK3L 4LO9A 1O9ZA 4Y9GA 1T6WA 3VQLA 4M8QA 4GLRH 2H2SC 3NN8A 3WDHA 1T83C 3MNMA 3U0PB 4UT6L 1WFJA 1E9QB 5BPPA 5AVYB 4PW3A 1AQDB 3MROB 4WWOA 4E42B 2WAHA 2VZSA 1CCZA 2ZCZA 3DHJA 2ZWKA 3C6LB 3V0IA 5I6XC 3BD3A 4P2YA 5EF2A 1H3UA 1SDYA 3FYEB 1YPZF 2ZX6A 3TTYA 4D0DA 4GFXA 4V1DB 4MB1A 3UFIA 5KJRL 1G7JA 5AAWA 2JCWA 3VFUA 1SJEB 5EU6D 3NEOA 3O6LL 5H94B 5FECB 1KTCA 1DQMH 3LHPH 1OGAE 1MLBA 2EIEA 5FM5M 4JGJA 3DUHA 4K3EH 4I1PA 4UTBH 4CVXA 5IHLB 2R29L 4Y2DD 4TRPH 1TCMA 3T2LA 2C9PA 1U8IB 2WKOA 5BJTA 1WBZA 2J8UB 2EO7A 3UTZB 1H5BB 1ZLSH 4D2NA 3L5WB 4N0UB 3IS1X 1MEXH 2HT3D 3FC8A 3BW9A 3JWDC 5HJGA 3VXOB 3WLWC 1URZA 3UTSE 3K8KA 3FRPG 4GKSA 1OP5K 2EDTA 2XVLA 2F53A 2NY1D 3D9AL 5KSBE 3AREB 2XTLA 5E2WL 4LLYB 4XNMA 2LFGA 4XNUL 5AVTB 3SE8H 1DBJL 1HQ4B 3DX2A 3D52A 4WNJA 1U3YA 2D7OA 5JOPD 4CMHC 3F85A 4FQXB 1JERA 1WT5A 4M7KL 4UILL 1HDMB 1U8KB 2QEJA 3GSOB 4NRYA 1R34A 1JHLL 3G7TA 1H15B 2E8ZA 4D7PA 4MBRA 1J48A 1MSPA 2LU4A 3VXRD 4YX2H 3LXAA 5H4ZA 2CJ3A 4MJ4A 4QXVA 2Y69B 2IGLA 1TJGL 3CXFA 4CKVX 4P3CL 1J1PL 4ODUA 4JRYE 4A66A 4FQCL 1AR1B 3WYRA 4P23A 1XCTB 3HHRB 2B59A 3QDJB 2E4TA 3VFMA 1FZOB 1KJ2B 2G3NA 3RFZB 1EJ6A 4XMPL 3T3MB 3VVVA 1EQWA 1DQLH 2XKSA 3NRFA 3F6LA 4JFHE 4TSBH 4XBMA 4XXWC 4E9WA 4E0RB 3RVXC 3ORJA 3Q8BA 4MMYB 3LQZB 1RK7A 5B4MC 3PV6B 5JMRA 5KBKA 5CCKL 3FONA 5J5EA 2F1BA 2XT1B 4C56D 1MHPL 5I1LB 1OK0A 4QYOA 4GYBA 3EXLA 4RVBA 4LVNC 4PR5B 5FYLH 3ARDB 4NNXB 3WNIA 1QA9A 1WBXB 3PREA 4B9YA 1KYOJ 4X4KA 2ZCLH 3O6KL 1X6NA 4OJDH 4YE4H 2EIBA 3RNQB 1N6QH 3J07A 4NC0B 4H0HB 1IQWH 3NFNB 3NSJA 2IPTL 3C5ZD 5C8JA 3U36A 1AIZA 3E2HB 4N0CD 2X6MA 3BZFA 3MV8D 4ZFOB 3GNML 3ZDWA 2H0JA 3JXAA 2YR3A 4GW4A 4NKIL 5LO7A 1T4KB 3ELQA 4YXLL 4QHKI 2BVEA 3DX7B 4F7CB 3N1MC 1E4WL 4NBYB 3H9YA 3LPOA 3ZQWA 2JXMB 4LOUD 4NNYB 1WICA 1PKOA 1X4YA 3FN0H 4XCNB 3V0DA 2L0DA 3ZXAC 3VXSB 2ZNWA 3HHSB 1ANUA 3A4FA 3FFCE 2JKNA 1P6WA 1QLEB 4KMLB 4MTMA 3I9IA 2XTJD 1HNYA 2W60A 1RPUA 4PQXA 1GR7A 4FI7A 4HD5A 3TZVC 3QWRA 1INQB 1X5HA 2UZIH 2J8HA 3MRKA 3HRZC 3UEZA 1XXDC 2IQ9L 4HUXB 1H3PH 2V9QA 5EORL 3RHWF 2UWEF 3CVIH 4GRWH 4DZBB 1T1ZA 2W9DH 2VLRE 3B9EA 2VO5A 1KBBA 2F7OA 1ZHLB 3QXVA 3FZUC 5JXAH 4I48B 1EK3A 4LARL 4E9LA 2FLBT 4V11A 3L1OL 5IK3B 3I50L 1KOAA 3N91A 3NEEA 4EUPB 3QQXA 3CMOH 3C8KB 1YUKB 4WWKA 4G7YH 3PWPD 3SIKA 2VM9A 3SJVD 3CFKA 1ORQB 3V10A 4HUVA 5HYIA 1P53A 4ODTH 4XP9L 4TQEL 5BUGA 4PJEB 1PZUB 4ENZA 4M48H 2DQHL 4ENEC 4HOZA 3BWAA 3TURA 3RIAK 3QULA 2ITFA 4Q0XH 1JCKA 3EDKA 2PYEA 3D87B 3MNWA 3GKWH 4JEGB 3D4ZA 4UDUA 4B95C 1P7QD 2QKSA 1YYMH 3V79C 4M8QB 5ICZA 2ZUVA 2GUOA 3NN8B 4UT9L 1VRSA 1ZPUA 3QBTB 4HH8A 4XRCA 3TPUB 5GJTL 4PHZA 2O5ZL 2V0AA 3OKDB 3QSKB 3MUUA 5CSZA 1OE3A 5DGQA 3FF7A 5DEFA 4MSWB 4PY8I 5JQ6L 4NS0A 5EIVA 3IMTA 4XAWL 4K73A 5C2BH 1KT2A 4D0DB 4JPWL 5FA3A 4BWWA 3S5LA 5EU6A 1G7JB 3QWOA 2R83A 3VFUB 1ZT1B 1OCOB 2YAQA 1F13A 2C9SA 1XH0A 1QBBA 2WZ5A 4GKZA 2ENQA 1YEJH 1PYWB 3MGTA 3PPEA 2EVHA 1MLBB 3QZWA 1GZHC 1FNHA 4PJBA 2ATKB 1NFKA 1BFVL 2YA0A 3MLRL 4PEEA 4CVXB 3RWJB 4ZMXA 4AVJA 1I3VA 5KS9F 2MKWA 4PRIB 2ZUWA 3RWCB 5D7IB 3GRWH 3UAEA 3HUJA 3FB6A 3U0WH 5ISZA 4P4KB 4MX7A 4AQ8C 3ZGIA 4HEPG 3FNKA 3QQ4A 5FGCE 5IW3A 4F91B 2DIBA 5L2KD 3BEWB 3HS9A 3PIQA 2NSMA 1PY0A 2G3ZA 3PJSA 1X5ZA 3CK0L 4N2LA 1J1XL 5HSFA 5L9DH 3EDFA 4J3UA 3TEUA 5ADPH 2JJWA 1Q9OA 1BYPA 4K3JH 2X87A 5CJXC 3IDXH 4XNMB 2G0KA 2X4RA 3ESVF 3A22A 1P1VA 3L54A 1R5WB 2X44D 4KHTH 1JYXA 4GUOA 3ZKMD 1LM8V 2J6EL 3QORC 2QVMA 1TQBC 2G5BA 2LW3A 5TGBB 1PFOA 5TFSL 1M7UA 4R90H 2DS4A 4MNQD 1II4E 3VXMD 3ZSTA 4Z7QF 3W9EA 3BKYL 2PPCA 5IB3A 2XXMB 2FJHA 4ADGA 3TO2B 2NY2C 4TL4A 3LZPA 3SD2A 4X5QA 5JIMA 3NTCH 1U8QA 2UX7A 5ERWA 3RY4A 3AADB 1JGIA 4K3DH 3HVNA 4TUKH 4UQIM 1L9QA 2ZIDA 1NEZG 2Z4QB 1GTFA 4P23B 4ZTOH 3L3IA 1BD2B 5D55A 1DJWA 4NQVA 3VFMB 1BMZA 1M56B 5IF0A 5F8QC 1ZJBA 1KWGA 4ZQKB 4JN2A 2N4IA 3RP1A 1JDDA 4C56A 2DPKA 1MZYA 3RAJH 2BZCA 4PWFA 2Z3FA 1J9RA 1QBLL 1JV2A 3PDOA 4XWGH 3L8QA 3A6BH 1BW8A 2BWQA 1DDTA 3FUIA 1CZ8L 1D6EB 4W9HC 3UBHA 5J6HA 2XOTA 4ZTEA 4R7NA 4DEPB 1TNNA 1KCLA 2WN2A 3AB0C 3DJTA 1IGML 4DHLA 3C5ZA 1QOKA 1CDIA 4WU5B 2EH7H 4FG2A 1H9DA 5CUSL 4LNVA 1PQZA 3TYGH 4PJ8D 4WO4B 1TZ8A 5C8JB 3U36B 2VNCA 1VIWA 2Y23A 2CKBA 4G6JL 4M29A 5FKPA 4YL9A 4FQ2H 3BZFB 5GGQL 5B8CC 4YXHL 5LWYH 5IJKC 4JFWA 4G71B 4GW4B 1RPQA 3QUMA 1I1AC 1EDYA 1FBIL 2UXFA 4L3EB 3JBG7 3PWUA 3OJ2C 1BOGA 3W9DA 5KANI 3IN0A 2YUVA 3EGDA 4PJ6A 4J3TA 3BRGC 4ADIA 1TJHL 3CHRA 3HPLA 2OMYB 2CJSA 2L7UA 2P3YA 3N1PC 2F61A 4PJDE 3UH8A 4WEUD 1NCBH 4YSTA 1UFUA 5DC0A 2R4SL 4XXDA 4LSVL 4OZIB 3A24A 3CAFA 4MA1C 4NOBA 3WS6A 1WIPA 3ZR5A 1YEWA 1FL6B 4J4PA 4PD4K 2D4DA 1L0XA 3U4KA 1AQKH 4HF5H 4DK6A 4ALAC 2QHRH 5JIPA 1C5DA 3VXTB 5B3JE 4J3BA 4Z78A 5B1AB 1MHHB 2XV3A 4J3OF 1T7WA 5GJSH 4NHUB 4KXAA 1CLCA 4FXKA 1JGDA 3OXRB 2EICA 1FE8L 3G6JF 4L23A 4W4NA 5HGBB 3RYMA 3BUIA 4KI5E 5IY5B 3LIZL 3PWPA 4M6MH 3SJVA 1TYJA 2J43A 2YAHA 4HCRA 1VADA 2P48B 3VVWA 2CO4A 3WS3A 2B2XH 4OTXL 4DAGL 3IE9A 3PY9A 4WWKB 5IB1A 3V9CA 4AYDC 4POUB 4WI6A 4HUVB 1M6OB 1XL6A 5I5JA 2AEPH 3DO7A 1Q9LB 3A6CH 2NZ9D 1FIGL 1WEJH 4KQ3L 1A6PA 4PJFE 1I1FA 4F5CA 4PRAB 3EUUA 4YXKL 4HIXH 1VESA 1AZRA 2YD2A 3V7AG 4MB4A 4N8UA 5IVNA 3BWUF 3ZN6A 4HJ0D 2F7QA 5E1IA 1I7TA 1XZ0A 2F7RA 3O9WB 4QHNB 2D9CA 5BRZE 4UDUB 5TQ0H 4YHKH 2WLIA 2AV7A 5D71H 5ICZB 1RULL 4NQTA 4IGBC 1IUZA 1PD6A 4JUSA 2NMSA 3IJHB 3V4PA 4Q52A 1J88A 4OF5A 5KVDH 4V33A 1E2VA 2Q76A 2QVKA 4PTTA 5CSZB 4OD1L 3KPOB 2FLRT 5DEFB 2I5YH 4RAHA 1LO2H 5A2LH 2CJUH 2VC2L 3FMGH 1NGXA 3BRFA 4R4BB 1U3HD 3V0EA 3RKDC 1KT2B 2CBTA 2COVD 4JM2F 4WTZG 2MNJB 4KK8D 5FA3B 3PUUA 1MXGA 4MMZC 2C34A 3MBXL 3S5LB 5EU6B 1E5BA 4UM9B 4M7ZB 1WA0X 2X2UA 5MEQA 1EAPB 1A4CA 3S2CA 4Y5VA 3IETA 4PB9L 3A67L 4X9HA 4GSQA 4GLRI 2VDOH 1IFHL 2NDFA 4NP4H 4Y2DB 4LAJH 5CEYA 5JUEH 3QZWB 3ZQ9A 4CBZA 2OYPA 1SOKA 4LDEB 5FHAH 3SPJA 1PLGH 2A6DB 4ICXA 1JZ3A 2EDFA 3QI9D 1AZCA 2Y7LA 2YKLH 3MCLH 4MWFB 1F45A 1JF6A 3AACA 1KULA 3KDMA 4OB5H 4GFTB 3VE0B 4BQBA 1N26A 1SJHB 2WVSA 5L2KA 3U82B 5DSCB 3SDYL 4MX7B 4WI3A 3VRLF 1OLLA 2NY1B 2IIJA 2EIZA 3CNKA 3B2XA 1LMIA 2XYCA 3QC6X 3IM1A 1MCLA 4FG4A 3BD5A 4FS0A 3PIQB 1JK9A 4PGBA 3W11C 3PJSB 3WIIH 3GHBL 4U1GC 3MYJB 5E2VH 3GXMA 1U4FA 3I6KA 5DJXA 1FYTD 3R0MA 4N2GA 2X4RB 4BK5A 2AGJL 3V8CA 3MJ8B 1JGVH 3PAYA 3U9PH 3VWJD 4Z0XA 1OAKH 2E8YA 3P4NB 4L18A 2E59A 3WMSA 1MJJA 4FP8L 3CDFA 2G5BB 3VXRB 5F7EL 2OV0A 1CLOL 4BFBD 2XWBB 3RNKA 5L0QB 1IGCL 1N67A 1A6AB 3MRCA 5IHZA 1MI5D 2JCCE 1SN0A 2V5MA 4HPYL 4Q74A 1P7KB 4C4BA 5IB3B 4LRNL 1OGTB 3VB8A 1U8QB 5ERWB 3FTWA 1IC5L 5ETUB 1EMTH 3VDBA 5FUOL 3LH2L 2Y7QB 1WHPA 3L3IB 4FLQA 1VGEH 3C6SA 2XG5B 3GEWB 4OM1L 1L7TH 2R2HA 3IU4L 4GI8A 1GCYA 1EO8L 3MOQA 4PWIA 4TLUA 3PS6A 1CB4A 4JPVL 4TNVF 3P77A 4QRAA 5DQ9B 5EU4A 1YO4A 1GXEA 2IDCA 1CXFA 4F7MB 4C56B 3MJ9H 2NW3A 1CXHA 2QQLH 3SBRA 1AGEA 3PDOB 1JV2B 3K74B 3FKUS 1VFOA 4OJCA 4LL9A 4L5FL 1R3KB 2IAMC 2WXGA 2YPLD 5B39A 3A5VA 1K5WA 2EXTA 2R59A 1F1DA 4ZMYA 1JZ6A 1P9MC 2B1AL 1PD0A 2WKLA 5I17B 1NCDL 3CV5A 1KJ2H 3P9WB 4PJ8A 1YJDH 4DSYA 2VDMH 3C5ZB 1CI3M 2XFXB 4P48A 4FADA 3CLFL 3BGFC 3VD4A 1OAYH 5IMKA 3H3BC 3MV7A 4N2OA 1PQZB 3MV8B 3Q5TA 4GEIA 5EZOL 1GGYA 3VA6A 1ZPLA 2XRAH 1YDPA 5FKPB 2CKBB 2OQJB 3LVTA 4CGTA 3JV6A 3IGFA 3OPUA 3SPCA 2XDHA 3WXVL 5GGVH 3VWKA 2L4OA 5DYOA 3KLDA 1UD2A 4WUUE 4M1DH 5CGTA 1T0PB 1GHFL 2HSIA 1E4JA 2NY5L 3QQ9D 3QUMB 4LHUB 3OKLA 1Z9NA 1QO3B 4KK6D 5I73B 3D3VD 3F7KA 1U2YA 2VR9A 3KPRD 1BOGB 1Z7JA 1SLUA 5SV4A 1OP4A 4UOW1 3ME0A 2XTJB 2CO1A 1RZJL 4LDCA 1ETA1 4R96A 3BFWA 4WTXA 3MJWA 2KUTA 4N8CL 4DN4L 3FT3A 1N68A 1KDIA 3L17A 1BAWA 2EDYA 1AKJD 3EOBA 1TJIH 2W0LA 2P46B 4HIHA 4QOKE 3ECQA 4Q9QH 1MG3C 4PJIF 3S36L 3JYBA 5BO1H 5JO5B 2VITA 4WV1C 1JTTA 3HC0A 4OFQA 1XF2A 4RX4D 2CBQA 2NNAB 4PGZA 1JGDB 1ID5I 3HG1D 2DBJA 5AYUL 3V4VB 3BH4A 1PY4A 3PWPB 2APXA 3BZ4A 3FCGA 3SJVB 1PX3A 5DFTA 4FQHB 1WZLA 3OQRA 4BZ1H 1SJXA 4HETA 2BWIA 3VTMA 5L7XL 4O58H 1AXTH 2ICEC 1C8PA 5IB1B 3K3QA 4LT7A 3NJKA 4RAUA 1TQUA 1X9UA 5KG9A 4B53A 1W0YT 1CBVL 1JYNA 3DO7B 3L3KB 4EZLA 3UBXI 2R4RH 1RMFH 2OMUB 3MLSL 5EWIL 3J7HA 2VDKH 2DMKA 5AD0B 1UYWH 1V10A 4XNQB 5ANME 3PHOA 1P7QB 2PPEA 4B0MB 2Z8RA 5D93C 5F7LB 4W6YB 4M5YH 5E99H 4ZMVA 1I7TB 3FXIC 3UZEA 3U79A 5T3XE 4R97C 3ZTNH 5JYLA 2DRUA 2AV7B 5C70A 1QRND 2ENJA 4ZTPL 2D2OA 2ZUUA 4DGVL 5KVGH 5SWSB 4W70A 2C3XA 5DMIL 3S5YA 1B4JL 4S0HA 2EDMA 5CKGA 3ESPA 4H1LH 43CAA 4D3CL 3QFDA 2CZNA 2Q76B 2DD8L 4PTTB 2F08A 2XA3A 3IPFA 1I8LA 4WFGD 5L8KB 1D7FA 1A4JB 1J1OH 4A04A 5EZIH 3M1CA 2BOCA 4KBPA 3VX1A 1HFUA 1XR9B 4ELKB 4OZFG 3RUGF 3Q6GH 1GZQA 4HZ1A 1GW6A 4M56A 4PJAB 4MDIA 1SMAA 3S8WA 2AJZB 3IVKB 3EBHA 4FTVA 5MEQB 3ROOA 1QR1A 5FO7A 3D08A 1BDYA 4GMSL 4Y5VB 4DZ8B 5BZDA 1DQJA 4DNLA 5I8CA 1N5YL 1YPZA 1IT9H 1JNNH 4JVPA 3HZVA 2M26A 3NABH 2WB7A 1ZIBA 3ZDYB 4IK7A 1K85A 1ODAA 2A73A 1A6VL 3ZDXB 2DM4A 4NZTH 5TE6L 5TF0A 4XVOA 3QEGL 4BFOA 4S1DD 4YQXH 3KDMB 5DJ0A 3OKMA 5L2KB 4W9DC 3WLBB 3SDCC 4NFDA 2D3VA 3A3YB 1WTLA 3DTDA 4EDWL 4QMEA 2X3BA 3ESUF 2J71A 1QSFE 2EIZB 1FYTA 4JFZH 6PAZA 1C5CL 1JK9B 3DVGA 1RVFL 1UA7A 3TBSA 3P0YL 2EVFA 1E8YA 2BP5M 2ZP8A 3I6KB 1KIQA 3H55A 1B4RA 5C92A 4WK4B 1UTDA 2X4QA 4MNQB 1MI5A 3MCYA 4LPWA 3VXMB 2A6KA 5LCVA 2O5NA 4JFOA 4KPHH 1D9KA 1KB3A 4RGOH 4LGSB 1MFDH 3RNKB 5KBDA 2L7EA 4JGNA 3HG2A 5IHZB 1K4CB 4KK9C 4OF8A 5KVFE 1PL3A 1SF5A 5C6WH 1G9NH 5DVOA 4PGJA 4P06A 3ZTDC 5DVMA 1L9RA 2DLFH 4X50A 2K3TA 4XMTA 2XWEA 2AV1B 3LJ3A 4XWOC 4NZ8A 3BSZA 5KYWA 2NLJA 2X4TB 2B4CL 3H4HA 4NM4L 1UT9A 1W80A 2HVBA 3LY6A 3UBFA 1S7SB 1AP2A 5GS0C 5LQBL 4KXCA 3R06A 1E9OA 1BXAA 1HXMB 4NRZB 1CD0A 5B21A 1KPRA 3X3FH 3T0EA 4QGYA 4K94H 3GSRA 2VQ4A 1LNUB 4YLQT 3VSVA 1Q1PA 1S9VA 4W9FC 1UA6H 4V1DE 4Y16D 1JZ7A 2Q2EB 3IFLL 1DE4A 1V8HA 4L29A 1QG3A 3GHEH 4X6DE 5ALBH 5B39B 1WS8A 4DTGH 1NAMA 2DJ4A 3HLAA 1RUAL 3OAUL 3MFGB 1UH4A 4U3CA 5HHQB 4PJ8B 1CU4H 2WYIA 5IBUB 3GBNL 4A2EA 2NT0A 2LR4A 3JV6B 1ZLWH 4DP9X 1X9LA 4DT2A 1QLFA 3D3VA 4YVNA 1DJGA 1HEJC 4NZRH 4FNPA 5JW3L 2VDPB 1BXUA 2YEZA 2ZTBA 2AXGB 2I25N 3S37L 1CYXA 2BVYA 3FS9A 4F8QA 2C3GA 3F7PC 3KLAB 4I9XA 4KROD 1QWHA 4LL4A 4MS6A 1OF2A 3P3RA 4HJSA 3F7VA 4CRPA 4WI2A 5FOBA 4O5LH 3FQTA 2X6BA 1K2DB 4YNYB 2UVFA 2FEJA 5JW4R 3EO1A 4YDJA 3P30L 4BQ8A 1WAAF 3AY2A 4BFIA 3CFIC 4HIHB 4RX4A 3AXIA 1NGQL 4NUGH 4GOSA 4NN6C 4UB0H 4JG5A 3TWYA 4BZYA 4MHHG 1VZHA 3LSOA 1UKQA 5MI0C 2GJ6E 4LSPH 4KJPC 4XZ4A 3NACH 1IBZA 5LN8A 4N2IA 5JIKA 5D7JC 1KCKA 2V3DA 4HJUA 3TVMC 4QRTA 4LVHB 5C0CE 2QHLA 4HS3B 1LEGA 3TJEL 3HE6D 2R0WL 2K78A 4HFUH 5IVXB 2CHNA 1NZRA 2FB4L 2UWEA 4UV7H 3POCA 4G8GD 3EYOB 5FHBH 2FQGA 2QV2A 3WFEH 4AE1A 5KG9B 3T3ME 4BINA 4J3OD 1A6UL 5L6YH 3BKML 1AS8A 2YXMA 1A7OL 4U2YA 4X9FA 4AKQA 4POZD 3K1DA 3PHOB 4ELDA 4TN9A 3L3DB 4IRSD 5IFAH 1H6FA 2NYYD 1QRNA 2XZZA 4MS8C 2O1AA 3EJRA 3OPZH 2IGFL 3DX4A 5GRWA 5ICYA 1MFAH 5L8LB 5C08D 4NO3B 3JWNE 4XPHH 2D7TH 1TPXC 5BXFA 1KN2L 2R0LH 2PTTA 1PG7X 3IJSB 1JF1A 3QJZA 4K3GA 3B56A 4JPKH 3SDAA 5KYUB 2XWJA 5LLIC 3QFDB 1KXTA 1HHKA 2GB2A 3QNZB 1U3HB 2OL3A 1B3JA 3IMSA 4ZOBA 3VM5A 5ELIA 1JE6A 3ZTJG 3W2DL 5JA9A 4TSAH 1WITA 2D7QA 3V6OA 2WB1A 4TNEA 1T0NA 3FSVA 5D6CA 2VMCA 4UYQA 4FZ8L 4N0YH 5EH1A 4EE2A 2HVJA 4EOWL 1BZ9A 3MTXA 5AVSB 4W93A 3SGJA 3V0HA 1TTFA 5K5YA 1C1EL 1AHKA 1N2RB 2V37A 3BVWA 1DQJB 4QXUL 5AW6B 3VXSE 4JHWL 2GITA 5I8CB 5C0AD 3ULUH 4DVRL 1MLCA 1YPZB 2AEOA 3QI9B 4NQDD 1FLRL 1HINH 4AGLA 5K9JH 3HZVB 3TEZA 3EFOA 4K5OA 4XMLL 4GJTB 1GAFH 4CSZA 2W95A 4XCCL 1KPVA 2FH6A 4NBXB 2MCPL 4JM2D 2FATL 2WXRA 4IYKA 3SDDA 5LDUA 2WBJD 4N2AA 1YVLA 4WK2B 5DJ0B 1O7SA 3LB6D 2AEIT 3KPLB 4N28A 3MLUL 2EH8H 1SXCA 1G6VK 2Y1ZA 3M6DA 1D5XA 4PRHE 4YHNB 5GSVA 1FYTB 4YWGL 5KS9A 5HHPA 4WHTA 2Z91A 3DVGB 5E7BA 3DVNB 1SVBA 3SQOH 3VWJB 3CXHK 1NC4B 5EDXA 2GSMB 1KIQB 5I8OH 4ZFQA 4WJG3 1JWMB 1KYFA 4DGIH 2CG9X 2X4QB 4HJ1A 1MI5B 3VXNA 2A6KB 5MEPA 2YQ2A 2YBRA 1CGSH 2X6AA 2XLLA 2HFFA 3DGCR 5DEGA 5AZ2L 5HDBF 5FB8B 3CZKA 2H2SD 1JZFA 1ZWIB 1UD8A 1CIUA 4BE6A 1NAML 5LJYH 2EDJA 3MLTA 4WI0B 3GINA 4JFTA 1CIDA 4LLWA 3DYOA 1R0AH 2G3MA 1BM7A 5I1GL 2AJVL 2IDQA 3FHQA 1GTNA 1ZLVK 1JWSA 4J1UA 3TH3T 3BISA 3T8VA 5ACLA 1YEIH 5BMFL 5M94B 5E00A 2LHAA 1E9OB 1TVHA 5JMOC 1KPRB 3HEIB 4AQ1C 2YWYA 4HSCX 4KTEH 2YPLB 1IO4C 4H8PA 1VAHA 4P57A 1S9VB 4RISL 2XKUA 2NYZA 2Y36H 3QHZL 2YPKB 4IRJC 5D72H 4NOFA 3U7YL 5LB1A 4BA8A 4H8QA 1JJUA 4LPYA 3KYNA 4I3GA 3O4LA 4LEOA 3OB0H 4L4VB 2ZG3A 5AOIA 3L6FB 1AR2A 1OCZB 2DLHA 1EEQA 4MCZA 4QKXB 4OD2B 3QZLA 1OTTC 3Q13A 3EJPA 1GC1L 3D33A 2HPTA 3HOGA 4IOSD 5DRNA 2DIJA 3B7UX 4E5XG 3FO2A 3BE1H 3TCLA 5C0EA 4Z95H 3R4DA 1QLFB 3D3VB 5I2IA 3DTXA 1XB6A 5DVNA 3KPRB 3LS4H 3X1BA 2Q7YA 1ZSHA 4ZOEA 4AW4A 4MQTB 4HZLA 1BEYH 2YQBA 1I1RA 1RUKL 2LU7A 2MPAH 5INDA 1F4WL 4I0PD 3DV6A 4R0LA 1OB1A 1ACYL 5IB5B 4O02L 3UTPE 3UROR 3T8XA 3BHBA 3V2AR 4Y5YB 3WD5L 1AKJB 3KWXA 2F53E 3MJ6A 1IE5A 1Y6MR 5DFVC 1LEIB 3FQTB 5I1JH 3D69B 3TJHC 4LPCA 3UYPB 3UTOA 2GBTA 1MG2C 3ES6A 3RPBA 1A22B 1ZV5A 2VUYA 3DIVA 1FZMB 3HG1B 3WI9A 4A6YH 1NUDA 3MRLA 4EIUA 4EIZC 5T3ZE 1HHGB 1VPOH 4NRXA 4BKLA 4KVPA 1MCOL 1QFPA 5IR1A 3A4EA 5GGUA 2HFTA 4TTGA 1IEBA 2JB5L 4G8GA 4P99A 3TA3D 3RL1A 3BPOB 3RVXD 5DUBA 3T0BA 3APCA 2J7LA 1QNIA 5CZVH 5EULV 2VRAA 1THCA 3H3PL 4JFDD 1TTCA 3LQAC 4PJ5A 1L9PA 5JHAA 1ZV2A 2X0UA 5B4MD 3SKUD 5DD3L 4OFKA 1FV1A 4RGNC 3QIBC 5H2BA 1C5BH 1PF3A 3G6JA 5DTFB 5EOCJ 2CIKA 3LIUA 5EO0A 2OR7A 1AG6A 1N5AB 2APVA 2DB8A 5C1MB 3P40A 3OLEA 3RY6C 3LRMA 5BVJB 1NBCA 4RFEB 2C3VA 2F7PA 4WO0A 3DX9B 4OGXL 3VTTA 1AO7A 1QRNB 2A77H 2ORBH 2E9IA 4PJCA 2Y7MA 5I0VA 1FAIH 5ICYB 2VDNL 1XH3B 3UP1A 4GT7A 5MHSD 5SX5K 1AOHA 5BXFB 3QRBA 1UATA 5CSGA 2Y25A 1JF1B 2BSED 1M7XA 2XWJB 1DQDL 1HHIA 4YBQC 3O2DL 4XN1A 1PDKB 1KXTB 1HHKB 2GSIA 1JZGA 4LSQL 4M6OH 4GW1A 4ZS6C 4DKDC 3HIZA 1A3QA 1ZCRA 1X5IA 1KC5L 1NCHA 3KCPB 3WFBL 4PLKC 4Y8AA 4FXTA 4K5LA 5DK0A 2AERT 2RACA 4HWUA 1YNLH 4XP5H 5FYJH 4OGAD 4PD4J 5DZAA 1H0DA 1U93A 2TAAA 3U4BH 1BZ9B 7FABH 1W72L 5ESQB 1UWYA 2AJUL 5EU5B 1T7ZA 4NQDA 3S88L 4OUOA 3TZVD 3CFBA 1ZVNA 3IN2A 1HT6A 3GIZL 1ZJAA 2Y6SC 1S3RA 3BH9A 3TFKC 3H1ZA 2GT9B 1MLCB 3DURA 4JM2A 3LXCA 4LASH 5DGRA 1U33A 2AQTA 3GTTA 1G6RL 2WBJA 3EFOB 4GSDL 3NJNA 3FZUD 1XWVA 3VACA 3D8MA 2C8NA 2EDNA 1T0MA 3OZKA 5HHVH 3WHXB 2XBZA 4KAQH 5AZEH 1S7WA 3VA2C 3CG8A 2Q10A 4OI7A 3RKPA 3TBTB 1QNZL 2D0HA 2GPZA 1F0LA 1ZLUK 4CMMB 3QJHA 3TV8A 2DQFA 2FO8A 2JELL 2VZVA 5CKAA 3SBPA 1QQDA 2Z91B 5KN5A 4GQPH 5DZ9A 3JSSA 4JO3H 4JDZA 5KBMA 3QXDB 2HJKA 1G7MA 2BERA 5C07D 4ENED 1G1KA 2VLME 4G8EA 1NGPH 4UM8A 5DEJA 2K70A 2WIIA 5KZCD 5CIPA 4MB5A 3F2LA 5FYKU 5TPWH 3UC0H 2TRHA 3WTYA 2G75A 1MIML 1MCPL 3VXNB 4WRLA 3GSNL 4ZS7L 2QVFB 4UQCA 1QR4A 4F80A 2HFFB 4F9PC 2YWZA 2B5IC 5CJOL 4CAGA 4EIGB 3Q1EA 4LGPB 2O5YL 2ZNXA 3D30A 1DBAL 1FVDA 1FJ1B 3QCTL 4TVSa 3RL2A 1Q9KB 2PYEE 3MLTB 4KZEL 3T0VA 5FDWA 5L4MA 4AW7A 2DQIH 1IBGL 4P2RA 5DMJB 4LLWB 4NLAA 5DJAB 4KO7A 5AAMC 1THAA 1TQWA 2F15A 3CSBA 1IEHA 2CDEA 1ACCA 4J1UB 5JIDA 1XR8A 2K6ZA 4OLVH 2V7NA 1OIOA 2MTAA 2EXSA 4OQTA 3EH5B 3WFZA 2E6QA 2A1WH 2XPGB 3KGUA 4HLZH 3HBPA 1TVHB 2F2HA 3BWZA 4Y16B 3WNOA 4HCGA 4HLJA 1OQXA 5L88H 2BFVH 2X5PA 3GI9L 3QPKA 2Q3XA 2DQGH 4UNTA 1KLFB 4P57B 1HILB 2A4CA 3JUYA 4LEXL 2Y07H 1CTOA 1XB8A 2JKXA 3RPIA 3DPBB 4FNSA 5HGGS 1U8LA 2QV4A 5EU6E 4R5TA 3IXTA 5DRXA 4HYTB 3PWNA 4KVNH 2VWEE 3GQFA 2XYBA 3P0VH 3GSWA 4MCZB 2CDGB 3MLVL 4TTDC 3QFJA 1YMMD 5DZPA 4DH2A 2J1KA 4BGLA 5I1EL 2FBJH 2NY6C 4AQAA 1E9PA 1WPCA 3FO2B 4PJBE 1AGFA 5C0EB 2V8LA 4OF7A 2R0KL 2WSPA 3G04A 2NNFA 2C9XA 3QNYA 3IWVA 4W6WB 4GRLC 4I0PA 2Q7YB 4TUJA 1HH6B 2VW6A 3HUJE 1IQDA 3G9AB 5FO2A 4UIMA 2OJ1A 4HZLB 4KROB 4W9IC 3DK2A 5E5MA 2F5BH 2HT4C 5HHXH 2AI0L 4PJXA 2WIMA 2CCWA 5DD0H 4U6TA 3O11A 1RCYA 1O7DE 1S78C 3BHBB 2AS5M 3S34L 4RH4A 3CIQA 3LEXB 3LKNA 1JTPA 2YC1A 5JOPE 4XVSL 5J0BA 3ETTA 5DO2C 2IEPA 4Z3HA 2NY2D 2GAZA 1C9SA 1UM4L 4HJJL 1EJ8A 1I31A 5JHMA 1IC1A 3OTTA 1QSVA 3MRLB 1LO5B 2F58L 4Z77B 3TA3A 4BUGA 4X7FC 4XP6L 3DX8A 1H8OA 4NRXB 5LXGH 3QS3A 3HE6B 3NK3A 3HKZA 2OR9L 3KL3A 3QXTA 4HGKC 1IEBB 1RIHL 5DQDL 3LRLA 4G8GB 2VIRB 2K0RA 4G43A 5HD8C 5HYQA 1KGYE 3E8UL 3N06B 5C0RL 4PJIA 2H3KA 2YZ1A 3NA9H 4GQRA 3TH2T 1FYHB 1IC4L 1MAML 3O8XA 1BVKA 1P4BH 2WGNB 5T1LD 3HZMA 4OZHF 3K6NA 4JKLA 3GDCA 2BSCA 2WWNA 4BFKA 3H42H 1IGJA 4RRPM 1OK8A 1Q0EA 1Q94A 3G6DH 3H6AA 1SJVA 2QGCA 2CIKB 3L3JB 4IRSB 3FCUB 4X8JA 3THML 2KC0A 1VGKA 5K39A 4C56E 1ZMYA 3MNZB 1E4XL 1E8ZA 2R23B 4ZW5A 2C3VB 5FO9A 3TESA 2Y5TB 4EI5C 3TLRA 3SY6A 2Z1KA 4PJCB 3FQ1A 1UD5A 2BSEA 2FX7H 1L7IL 2XWCA 2LOEA 4DP2X 5D2NC 3RDTC 3MRBA 5KOVC 1FNAA 4X6BA 4PY7A 5JPMB 1NBZA 4Y2OB 4GAYA 1FRGH 3MJ7A 4ZD3H 3CFJA 1I1AD 2Y2TA 1IBDA 2GTWA 1HHIB 3ZZSA 2GSIB 3H2WA 3TBVA 2DM7A 3CSYA 2EXWD 1GS6X 3VYPA 4D9RD 1GOHA 3WEOA 1OWWA 4G1EB 3ZR6A 4GIAA 1IKFH 3JYCA 2X1PA 1CN4A 2CGRH 1I8IB 2FWUA 4KRMB 1DVFC 4B27A 2H9GA 4FMFA 2VH5H 4N20A 4OKDA 2N0KA 2V6HA 4RWHA 5FUCC 5KANG 4AX3A 3RLSA 5C0AB 4OQ1A 1BCIA 4HPHA 2IF7A 4LSRH 3LNHA 4G8FB 2VM4A 4FQIH 2BIPA 3V7MA 1MY7A 1ZLSL 3UAJD 1JGUH 1EHKB 4JM2B 2NT1A 3RUGA 1MEXL 3MACL 1OAXL 2A9MH 2NXYD 2C26A 2BY0A 2O26U 2WBJB 3IDYC 3LAFA 4NCDA 1OP3K 4A39A 1P6AB 4FQQB 4UZSA 5DD6A 5A16A 4MXQC 1OTSC 3HS8A 4P46D 1SBSH 1T0MB 3PXHA 2XZCL 4RBPH 4WY7H 3SKMA 3BGMA 3SE8L 1NEZB 4KMTL 4LVOC 4AQOA 1PAZA 3QZPA 1FFTB 3LKSB 3PGFL 1QVOA 4PB0H 2DQFB 1K4DB 5FWRA 2WXMA 3PWPE 2X41A 3SJVE 4JDZB 3ILPA 5E0QA 1X5AA 5E94B 2J5LC 3VG9B 4DIXA 4JG0L 5A3IC 3BO8B 1RZKH 1YAZA 4FFZH 1KGUA 3BUDA 3OLDA 4EKXA 5KYXA 2BMKA 1IIKA 3N85H 2CK2A 2G75B 5F7MC 3QEHA 1MKFA 1PZ3A 2FYYA 1OT2A 3ZYIA 2FJUB 1XDTT 3WTSA 3MGOB 3CVCA 4QO1A 3FBKA 5FOJA 4FKKA 3NFPB 4IGBD 1S8DA 1FVDB 1CFBA 2CK0H 3ULVF 1DL7H 2WSKA 2DQCH 4LIQL 2PO6A 3L1GA 2PWFA 5FAAA 4AEHL 4DKAA 4ETQA 1Z0NA 4EN3D 1VZGA 4RFNC 3AROA 3TT1H 3D4GA 2DMHA 3OB8A 1W8EA 5JW4Q 4DUWA 4HJIA 2CDEB 3NCYP 1XR8B 5EN2B 3L81A 1EGJH 3RKDD 2NCMA 1JPST 5FYLL 1QW9A 4HWEL 4Z8FH 2ZAHA 4Y9FA 4YC2C 2H8PA 3FT1A 1EERB 3NIFB 3N55A 4D8OA 4ZMZA 2VLKD 2WYZA 3RPIB 2AEQH 1BF5A 2RIKA 2DMGA 1FO0A 3B9VA 2R8SH 3L48A 2MSPA 3IXTB 3NH7L 4PW9A 5DRXB 3PWNB 3TT3L 5F1OB 4AQ8A 4ZMNA 3GSWB 1AGBB 4TF4A 3FT9A 3JV4A 5TDNB 4FJYA 5LAPA 4HGWA 3FCSA 1QABA 4AQAB 2Q3AA 2NSQA 3AG3B 2YOCA 2LT9A 4YHML 4GUQA 2O61B 2VDRL 3NEXA 3FN0L 2V9TA 5E2TH 2APBA 1MHEA 3G04B 3ZDXE 4LCCA 3H54A 1R19A 3W11D 4Z7NB 2P8PA 4I0PB 4F3FA 4TUJB 1Y18A 4JO1L 5L2KE 1MRCH 1XGYL 3VAEA 4JAMB 4UIMB 5AW4B 5AKTA 3H2PA 4IS6A 4TSCL 1KN4H 1Q0XH 5DD5L 2QADC 5ILTL 3BH8B 4CMHB 4EVNA 2FJGB 4PJXB 1ADWA 4ACPA 1LP9F 2ZX8A 5FGRA 1H3PL 3HN8A 2E47A 4E41A 5CM1A 4FABH 2R69H 2XETA 2W9DL 3N2JA 1EZVX 3ECBA 3O45B 3FN3A 3VFOA 4C54A 4ZNCD 1SHXA 1O6TA 3D18A 5D70H 4XCFL 2JIXB 4ATWA 4LPUA 2ATPB 1LO3H 4U1HA 2EE0A 1GJIA 2GAZB 5C09A 5DQJB 3RWFB 1KLUA 1DJYA 3ZRSA 1BXVA 2GQHA 4HS8H 3TA3B 4OVUA 2EUXA 1RJYA 4AZ8A 4ONFH 4GRMA 4ODTL 1T5XA 1L6XA 2Y5EA 4FNLH 1JL8A 3M8OL 2E7LC 4JFDB 1JXGA 1WAAA 3E7JA 4NQCD 4TV3A 3D5OF 3G5VA 3IFPB 3PQYA 2OK0H 3V4UL 3F6IA 4P0DA 1B2WL 5H37G 1ULVA 2JJSC 1BVKB 5DLMH 5AG8A 3MN8A 4LVNB 4ECNA 3HZMB 1RU9L 3L9EA 3S2AA 1UFGA 2W0FB 2IAMD 5FFGA 1YYML 2AXFA 1SYSB 2V5YA 1SM3L 2ZP0T 3J8F7 4JQIA 5AOZA 4GPVA 5C3TA 4QHPA 2E0PA 5K39B 3GTNA 4GO6B 4K5MA 1PX8A 2G60L 3ARFC 3QA3B 4F57H 2ADJA 4AQEB 2R1YA 2N01B 4HXAL 4MJ6A 1SY6A 3WKQA 1RIVH 5B8CA 3V95A 3CQPA 3UG4A 2EECA 1FF5A 2BOLA 1KCRH 3H3KA 1I1AA 3MDJA 2JK5B 3R1GH 1IGIH 2KDGA 3MRBB 4PY7B 2FJFB 3KPPB 1NBZB 4ZW8A 5IMMB 3M17A 4XPAH 1GCFA 3CFJB 5E8NA 1WZ1L 3FB8A 2HH0H 1MZZA 1BQHA 5DMKA 1BBDH 5GRYA 3ARBC 3TBVB 1MFEH 3M1OA 3CSYB 4XP4H 1JZ8A 4PGEA 1ACXA 4YSUA 1YEJL 1N0LA 4G7VL 1AH1A 4N22A 1KPUA 3TZVB 3P2TA 5E08H 2KL6A 2Y7SA 3SDXA 4N2CA 1EHLL 3HRZB 1FFOA 4I0CC 5EZJB 3UAJA 1U2CA 3ETBJ 4CA4A 4JPQA 5DLLA 2E9BA 4JB9H 3U0WL 1E7VA 2CUMA 1P6FA 4L1LA 4P46A 1ROCA 3K2KA 1HZKA 3I02A 4BGDA 2XFGB 1GY1A 1A2YA 4QJ4B 4XP1L 3V6BR 5DD6B 1VFMA 1SN2A 4LL1A 5A16B 4G6KH 4FLHA 3ZMEA 1DSYA 5IBLC 5D8JH 3HMWH 3SQBB 3L1FA 5FCSH 4TKWA 2BJML 2VJXA 3TIDB 1ECZA 1JUFA 3H6JA 1FFPA 1JI1A 3BGMB 3SKMB 5A6LA 1J0KA 2BH0A 1R33A 3CGTA 3CFCH 4QTHB 2C9QA 5EU3B 5I16B 2VDLH 1ZT4B 2OZ4L 5IMLA 2QKIA 5C07B 1H6UA 1X9RA 3DROA 4FL4C 4BUHA 3NZSA 2YPVH 3G5ZA 2XQYA 4XCEA 5KZCB 4OIAA 3WY3A 5JR1H 3ILPB 3HZKA 5CWSA 1EUTA 3OAZK 3L3OA 3BYTA 4UQEA 3NTCL 2BMKB 3UBXG 2NTFB 1V7MH 4KJYA 4H8VA 2FYYB 4ZTOL 3EG9A 3CVHL 4EN3A 5E8DH 1TVBB 3AY4C 4KTGA 4F8PA 1FO0L 4X5XB 1PZDA 3VRIA 3R0NA 3VG0L 1HNGA 3ABGA 2V9RA 1AANA 3KWVA 3QQDB 4ETQB 4JPIA 4CSPA 5J56B 3EYUH 3F7LA 4FFYA 5D2LA 1KB5L 4UAOC 3B7RL 4G80B 5ALCH 3A6BL 3GJFA 1IGTA 3US0A 4PV8A 3TIEB 2Z93B 9PCYA 5D1QD 4HX1A 35C8L 1OKEA 1S7XA 3M46A 3US9A 1J11A 1TEFA 1AY1L 2HJFA 2MH4A 2NY7L 4YO0A 5T1KA 4JM4H 2EH7L 3F58H 4JQVC 3CZFA 3VCLB 4H5SA 1N64H 4HUNB 4PJGB 2MQCA 4HKZA 1BQUA 4P59H 3U9UA 2F8VA 3WKPA 2A9DA 5B1JC 3W5MA 1YMMB 5DT1H 4YIQB 2OMWB 1I7RA 2JKTM 2VCOA 5A2KH 1QBMH 5AOKA 1LK3H 4B9CA 2AJ3B 3CZGA 5EB9A 4G3YL 4Y1AD 1NDMA 3QUXC 4LLAA 1JHTB 1NCIA 2HMIC 3ISYA 5EC1A 4AM0B 5GZOC 4OLEA 5E5UB 2ZF9A 4LLVB 1F18A 1HYSC 1YPZE 4HGWB 3FCSB 5GPRA 2ZUTA 3SDCD 4QJ5B 1ZEAL 4M4RB 1CD1A 2H2PC 3P73B 1I85C 3GMRB 5BV7H 4NN5C 4QHLB 2H32H 1NCBL 1IM9D 1MHEB 3L5XL 2B08A 4UAHA 5I24A 1IM3D 2ENYA 3BX7C 4LSSH 1UB6B 5E1QA 1CLZL 5E4AA 1W8OA 3MTRA 1TQBB 1TQCB 3DXAD 4CU8A 3SY0A 3OHMB 4Q56A 3KBEA 3GMLA 2R7EA 4EVNB 5EEWA 4LPTA 5KJRH 5F0JB 1TCRA 4GMTL 1FYTE 2FO4B 2C1PB 4XVJL 4AYSA 3W38A 2YD4A 5EG6C 3HNVL 1W6LA 4RSYA 5DS8B 4UUJA 4TNWK 4YHLL 3ECBB 4TS6A 3RJOA 3O6LH 3VFOB 3VFVB 2NY2B 4WUKL 1JF5A 1T6BX 4KK9D 3EO0A 2VQTA 1YSOA 2AFNA 2NW2B 1EFXD 3WELA 2WBKA 1L5GA 2OTUA 5EZLA 1FH5H 1JMXA 1MI5E 4JRXA 3WN5C 1KIRA 5FFLA 2CWRA 4N2EA 3OF6A 3LKPA 2B2XL 1UT2A 1MPAH 1KGCD 5FWQA 2IBZX 2LABA 1C16B 5CN3A 1BWWA 1ONQA 4L4TD 1T5XB 3MBWA 3A6CL 5GS0D 2WQSA 3H0TA 2OX5A 5T1LB 2N1TE 3ZO0A 1SNRA 1KSRA 3AUVA 4K8RH 3MI6A 3IJYA 2IAMA 1T3FA 4M62L 2Y72A 2E56A 2ZWYA 2MNWA 4IW4C 5I19L 5E2WH 1KLGA 2DKMA 3AB0B 3TO4C 4X9IA 1AC6A 2YHGA 4XNUH 3S96A 1D5MB 1DBJH 1ZIAA 4HISA 1WO2A 4OZFB 5D71L 2ICWB 3JT0A 3T0EE 2ZSVA 3UXFA 4M7KH 4UILH 4MAYA 1PJ9A 1XGTB 3VGDA 2G5RA 1QTSA 1ZVYA 2R1YB 4MJ6B 1JHLH 2W88A 1QKZL 2NY0C 4HKJA 5IG7B 5B8CB 3KXFA 4N8VG 1H3XA 1BPLB 1LO2L 3K1KC 2CM6A 1RXLA 1TJGH 1WBYB 1JG9A 1I1AB 2W59A 3NIDB 4OCWH 4P3CH 3QO0B 1J1PH 1URIA 3CH8A 2Q2LA 1D5RA 4FQCH 2H3XC 2HFEB 3MA7B 1RKRA 3M17B 5E8NB 4DP4X 3Q44A 4XMPH 4MGXA 4P9ML 3GXTA 1BQHB 5CEXA 5DMKB 3BEVA 5F7DB 5JPNC 2CDFA 3U6XA 3D3VE 4MA1B 1A4BA 4PGEB 4CL7A 3FTSA 1N0LB 3Q5YA 1SBBA 5JUEL 4BH7A 3GJEA 2EVGA 5D6DC 5DJDB 1KPUB 4U1SA 3UABA 5CCKH 2RA1A 4DJMA 2YXVA 1X44A 1GPOL 1MHPH 4GIOA 3SDXB 3C2AH 4XO4A 1FFOB 3MCLL 4S2SA 2ZPKL 2AQ1A 2N7BA 2ZUQC 3CFDB 4GRWF 4WV1A 4TOYL 2NXYB 3NCEB 2P49B 3QXAB 2YZ8A 1KNOB 4WZ9A 2Y06L 3O6KH 4PJHF 4XPBL 1DZBA 3FUDA 5B1BB 1ZK5A 4HK3J 3C9NB 3K6IA 2IPTH 3IJ8A 1S7RB 3MUGA 3N0PB 4OV6F 5K9OB 3RWIA 4G7SB 1AXIB 2Q86A 3EDDA 5D7JD 3CQQA 3GNMH 3L7EA 3VI4A 2WYHA 4NKIH 3PF2A 4PWKA 3T6WA 4YXLH 4AC4A 3KL5A 1OAKL 2QPEB 3ZYOA 1E4WH 1TEGA 1H3WM 3BZ5A 3DJZA 4U3HA 4EEEA 1RHFA 1UZ8B 2WOBA 3L4UA 4DKEL 3G5ZB 3APDA 5F7WC 5LBSL 3GXDA 4XCEB 3VJ6B 1OARL 1TG8A 2F8OA 4M1CC 4XBPA 3VQ1C 4TQHA 1HXYA 2OMVA 2YOAA 4DWHA 1HKLL 2XN9A 3LS5L 2UWEE 2I7OA 3L3OB 2AEWA 2DKUA 4IIZA 4JE0A 4EDXA 3I9AA 3CN1A 4MS8D 4U1LA 3VFGL 1XCQA 4IGBB 1TFHA 5GGSB 1LILA 4P9HC 1OAZL 5A2BA 3EG9B 1BBJB 3FQRB 4EN3B 2IQ9H 5EORH 2X6UA 1T21A 3W5NA 3S6CA 1PEZA 3MRHB 5DI8A 1HHJA 1GGBL 1QRNE 2ZZUT 4PBWD 4S0TD 1JK8A 1F4XL 4JPIB 5C0IA 4LARH 5KSVA 1ZHBB 2IPUK 5D1QA 5D2LB 3BIBX 4P5RA 3L1OH 1GIGL 1KB9K 4X5RA 2EIKB 5TF1L 3I50H 2ZQKA 4MMZB 2AVGA 3GJFB 3P9LB 1IGTB 3P2BA 4PV8B 2DH2A 2UUDK 4WFGE 5CHNA 3N0AA 3RZCC 5TJWK 4J12A 1I8KA 1S3KL 3QR0A 1TZIB 2HJFB 2VDML 5B22A 2VLKB 1L9NA 1JP5A 4U0QB 2PF6A 1NWPA 3T4YA 4XP9H 2HLEB 2EDHA 1ZTXL 3CZFB 5PAZA 4YJZL 4TQEH 5DJCA 3NA4A 2DQHH 2V2XB 3X14B 4ZW6A 2EE3A 3U9UB 5LGHL 4Y1AA 3T0XA 5ESAB 3NCWA 1P4LA 2J1XA 5D7LD 4AC2A 4CN6A 1A1MA 4IU2A 1I7RB 5HVFB 2EKSB 3MRMA 4RMSA 2BVOA 2ENPA 4YLBA 2G30A 1NDMB 2WQXA 2YUWA 3BVXA 2XJLA 4TNGA 2IBGA 3LPFA 4KU1A 1OW0C 4UT9H 5D1ZI 1IM9A 1NQBA 2WTRB 3KBPA 1P5UC 2V3FA 3JWOL 3OAWA 3ZBMA 1CD1B 3VD1A 3EGXA 2CR3A 2O5ZH 4U1GB 5EHFA 3GMMA 3QDMD 3UAFA 1KCUL 1XF4A 4N9OB 5FXCH 4CSTA 5GZNC 1UM5L 3LPPA 4JQXC 4YSRA 4AT6B 4U6XA 1E30A 5JQ6H 5G4NA 4W9KC 1JZEA 3UG5A 1MY5A 4XAWH 3B2UC 1A64A 5KSAC 3VU2A 4JPWH 3VXQA 1F41A 2VAAA 3GMLB 5IWLC 2NOYA 2Z9TA 4ZAKC 2EEAA 2AAAA 1ZVHA 5KS9E 5BO1L 4LLUB 4JCWA 1EFXA 1NIBA 4LCYA 1IE4A 1REIA 3EYSL 4F9LC 1IAKA 1YAIA 2A6IA 5JORB 3HHMA 3Q8EA 1R3IH 3EYVB 4P5MA 1L5GB 2KMWA 4BSWA 5IUSA 1BFVH 3MLRH 2WAQA 2XQYG 4BZ1L 5I1IL 3B3IA 2OTWA 4Y1SA 4QRFA 1AXTL 4W9JC 2R39A 5JQIB 1QACA 3KGSA 4XTRC 5I6MA 4NQCB 1T7YA 1XGRA 3CDGA 2K3HA 3ECUA 3MBWB 3RZWA 3H0TB 2OX5B 1KIUB 3B8SA 1V05A 4F7EB 3DC0A 1AHWC 3CK0H 1IILE 1J1XH 2IAMB 1G5AA 2RALA 5DRWB 5E6SB 1F97A 1EUUA 2CNZA 3ZLQC 1KLGB 4IRJD 1GS7A 4Z7QE 1L9OA 3K5RA 4IKJA 5DS1A 5H35A 1IKNA 4HMCA 3ZO9A 2Q7NA 3BGFB 1QW8A 5KVGL 3RWGB 1F3RB 4KDWA 2ZSVB 3T65A 4X4XB 2C3HA 5TFSH 3NVQA 3RVTC 2HUHA 5C08A 1OTTD 4MZRA 4OZ4A 3GSUA 4JGUA 2H0EA 4OZHA 1LD9B 4ZUUB 2PCPA 3BKYH 3DHPA 1JXJA 2CLVB 3O4LE 5F6HI 3HR5B 1PLCA 4IBWA 2VISA 3KW7A 4NO0A 3WNNA 4B9KC 2B9BA 4MA3A 4NHCL 1RLWA 3OWRA 4GXUN 4QY8A 2BCMA 4HAGA 3U1QA 2PLTA 4O2CA 3WEXA 1JN6B 5K1JA 4U3SA 3BEVB 5HYFA 2EXYD 3H9SA 3HE7C 1T80A 1Q1JH 4XX1G 4F58L 1IMHC 2GY5A 4BH7B 1ACZA 3GJEB 3QIWC 1MVFA 1QBLH 5CJ5A 4U1SB 5DFVD 5I74C 4OFYD 3ZHKA 3F04A 4AEEA 1CZ8H 1DP0A 4GH7B 3TJHD 2PMZA 1RK0B 1KYUA 2X4NA 3BIKA 3DOSB 3FQNB 4B60A 5K1NA 4WV1B 4AYEC 5I18H 4O00A 3LOWA 1IGMH 5DURD 1NOLA 5DA4A 4BWUA 5T1DL 4L4JA 2RH0A 5HY9B 3Q9PA 1A7NL 3BQVA 3OGCB 3IDIB 5EA0L 1ETZA 4G6JH 4P9HL 5GGQH 4BH8B 4YXHH 3L7EB 3VI4B 4DO5A 5I1AB 3K46A 4O9HL 4ZSOA 3BFQG 2WSDA 1VKXB 4LKXB 1X5LA 1FBIH 3BP7B 4AV0A 5T5FL 2HT2C 3QIBD 1BM3L 3WMPA 4RGOL 3ZL4L 1MFDL 3BT2L 4U6HA 4G8GE 5EIIA 1MFNA 5D93B 4EZMA 3H9HB 2CQVA 2E75C 5E4OA 1XSJA 1CFTA 4ISVB 4LSVH 4PJ5E 4R97B 5FC9A 2ISDA 4M6NL 3K2IA 4EDXB 5HGAA 2HVKB 2ED8A 4FHKA 4R2GC 3ESNA 3U30C 1RPKA 1E0OB 2IV8A 2L04A 3G6JE 3CZSA 4KJWC 1YQ2A 4P49A 3BAXA 1TDQA 3ZIYA 3S3SA 2JJTC 1T5WA 2RHEA 1MUJA 2E3VA 1FFNB 3AS3A 2GSGA 4UIKL 5DI8B 1JZHA 1AO7E 2HYMA 1JK8B 4PJCE 3TPKA 1FE8H 5C0IB 2ED7A 3WDIA 5D1QB 4ZS6D 3LIZH 3X1EA 4KH9A 2LV4A 3B5GA 3DBXA 3QCVL 1YUHA 5F88A 4PLKD 5AW5B 3D0VA 4DAGH 4OTXH 4DTGL 1MNNA 4XE5B 1UOLA 3JZ7A 3L95A 4FFWC 1XAKA 4MCNA 1I8KB 2JB6B 3S35L 3AUWB 2C7UB 1CU4L 4TVPL 3ML9A 2QGEA 4PG2A 4WTQA 5EBWA 1SDDA 4KQ3H 1FIGH 5SX4I 4RRPA 3T1WA 4MXWH 4YXKH 1E8XA 2Y6SD 5DJ2A 4JLRB 2MCG1 3TFKD 4Y1AB 5JHDA 1P4LB 3BDXA 4J7RA 5GSRA 3U9WA 1A1MB 3OGOE 5HPMA 2QELA 4X98B 3V0GA 5JA8B 2PKDA 2QSCL 3MRMB 4NQDE 3CZLA 3GS7A 3SDCB 1MDTA 3C12A 3DHMA 1CVSC 1RULH 4HAFA 1E40A 1U95B 2PXYC 3V55A 3BVDB 4RAVB 4ZRGA 1MCWM 1SHSA 2J4WL 3POHA 1IM3B 1NGWB 2SEBA 4JFQA 3OKNA 1ZRUA 4OD1H 4DQOL 4F2EA 1XF4B 3K7UA 4DCQA 3DXAB 2R56L 4E9RA 2H1PH 3PJLA 2WYTA 4KRNA 2J8UF 4F15C 1QSZA 4GNKB 4O5LL 2VC2H 4G70B 3STZA 4M7LL 4LU5L 4HWBA 1Z0MA 3V6FB 4YZWA 4OD3L 3MBXH 3AJ7A 3D0LB 4JY4A 4KKRA 3HLKA 4XPTL 2WVVB 3NPSC 1EFXB 3QUYA 4OIIH 4IRZA 4PB9H 1MHCA 3A67H 2VLJD 1JFQL 3SE9L 4FNTA 2VN7A 3T2OA 2BVTA 3QRLA 3I75A 4P4RA 4P5MB 2W0KA 4G9DA 1R3JA 1WD8A 6FABH 1LP9A 4UTAA 1XEDA 4OGQC 4U1IB 1J5HA 1WAEA 5HYSG 3V0WH 4L4TB 4M3JA 5T1MA 4ABQA 2VN6A 1G7HB 1A6TA 2IDTA 5D7HA 1HWWA 4FX5A 3SDYH 3A6OA 2CUIA 1A21A 1F56A 4DP8X 5L6YL 3ZW3A 4I18A 1OM3L 4OLWL 4PREB 1DEEB 3OKEA 3GHBH 3IJEA 5E56A 5EO9A 5ABDE 3K91A 3OQ3B 3I85A 1BLNA 3BVNA 4FG0A 2FSEA 3T3MF 3GGWA 3PYCA 3EOAA 1Z5LA 4CUCA 2AGJH 1I3RA 5EU7E 5GHWH 1RSYA 2HLAB 1UVQB 4MQ7A 4FP8H 5F7HA 5L2JB 4N2HA 3LKQA 1USZA 5F7EH 3SGEH 4KKBC 1CLOH 1QWNA 4L8DA 1SLXA 2XBTA 3MRQB 3NIFE 5CCHE 4QLWA 2N59A 2RFXA 5C08B 1U8JB 25C8L 2FECL 4HPYH 4OZHB 4NAQA 3VW3L 2DLIA 4FRWA 3MRPB 2NY6D 1T0OA 2CU9A 5FYLD 4LRNH 2F6AA 2R0ZL 4I87A 4TSAL 2JKIS 1OP3H 2WZAA 1J8HA 1IC5H 1XGPA 3LZOA 4OZFH 1OT1A 3QFJE 3E6HB 4GRLD 4N0YL 2ITEA 4NI3A 5FUOH 3L9BA 3LH2H 4JZJC 4A7TA 4CVZB 1S7VA 3AM8C 4OM1H 5K9QG 1INDL 2G2RB 3IU4H 1MCCA 1EO8H 7CGTA 2IPKA 3RTQC 2HT4D 4OUUA 4AIOA 4Z7UA 5CR1A 4XN8A 3KEDA 4JPVH 3B9KA 1I1CA 4OFYA 1UURA 1UCBH 3IGAB 4QXWA 1S78D 5K9JL 3U1PA 4FNRA 5F89B 5I8EB 5HDLA 2F8XC 2ZONA 4P3DB 1I75A 1VACA 3UAAA 1OM9A 2Z92A 3CZJA 4L5FH 5AWNH 4NN6B 2X4NB 3A4AA 3U48A 4PJXE 3BIKB 5DO2D 3QEUA 2B1AH 1KCSL 1NCDH 1R3HA 3CFEA 3OLIA 5MI0B 1AVAA 2C1OA 3K2MC 1UWXH 4YHYB 4IJTA 2GBUA 3CLFH 3KPMA 2YJLA 3N6YA 3PWVB 5D7JB 1MWAA 1UQSA 3Q5OA 1FC2D 5EZOH 3R7QA 1OCRB 3SKOB 4Y2NA 3F00A 3KM1A 5FA4A 3SQOL 2CLZA 2PCFB 3KLSA 1M2OA 1GVIA 4L9LC 3WXVH 5HD8D 2BDNH 3O6FA 5I8OL 4U1KA 3S3JA 3QIBA 5DCCA 1GGIL 1BYOA 1GHFH 1R3LB 2NY5H 1GA2A 2NY4C 3DJ9A 4ZSOB 3I3EA 3VUAA 5EFIB 2VR7A 3MSPA 5CGBA 4DGIL 3NJMA 1KXQA 4UF7C 3RY6A 4ZJ9A 1R24A 3JVGC 3PL6C 4ERSL 4DP6X 3N42B 4Q9BA 1RZJH 4WSJA 5DMGC 4PJIE 5D5MF 1TZAA 4I1NB 2WZPD 2RTTA 2CPCA 3ZJAA 4FA7B 5JHLA 3HAEA 2X70A 4N8CH 3D2TA 4DN4H 2ZOKA 2ZCHL 1E3FA 1G4MA 1TPXB 4IQHA