3L1FA

Bovine alphaa crystallin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
97
Chain Sequence
SEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVERAIPVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Alpha-crystallin A chain
publication title Crystal structures of truncated alphaA and alphaB crystallins reveal structural mechanisms of polydispersity important for eye lens function.
pubmed doi rcsb
source organism Bos taurus
total genus 16
structure length 97
sequence length 102
ec nomenclature
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l1fA01
1WFIA 3EUDA 4YL9A 2Y22A 1RL1A 3IGFA 2XCMC 4RZKA 5DS1A 2WJ7A 3VQLA 4ELDA 2O30A 3J07A 2Y1YA 3GT6A 2N0KA 3L1FA 3QORA 4M5SA 1GMEA 4M5TA 2K8QA 4MJHA 3VQMA 1EJFA 4JUSA 2CG9X 3L1GA 3QORD 3Q9PA 1X5MA 2RH0A 3QORC 4ZJ9A 2JKIS 3GLAA 3N3EA 4PBDA 4PCKA 2KMWA 1WGVA 2KLRA 2MNWA 4YLCA 3GUFA 3W1ZA 2BOLA 5DS2A 4YLBA 1SHSA 4YE0A 1WH0A 3Q9QA 2CR0A 4YDZA 4I88A 4FEIA 3QORB 3AACA 3L1EA 5LUMA 3AABA 4JUTA 2N3JA 2WJ5A 2Y1ZA
chains in the Genus database with same CATH superfamily
5IEKA 3CVDA 1NCIA 1H3PH 2DW5A 3UZVA 2JXMB 4WSJA 5DFTA 5H37G 1B90A 5JUEL 1GPOH 4GAGH 4OFYA 5FYKU 2XTJC 4Y5XC 1DJSA 3WXWH 2OV0A 5FKAA 2ZUTA 5DDHB 2DWDB 3EH1A 4WHTB 3FZUC 3FOLB 4FNRA 5MI0B 1SVZA 5KS9B 1QEXA 4B9ZA 3JWNE 1YG9A 1BFOA 4Q2ZA 4CNIA 5LN8A 2Y3NA 4X42A 2X6MA 3VDBA 1ID2A 1BVOA 2BY0A 3FSWA 3G5YA 1WJ3A 4K3JL 4JFQA 3C9NB 2WJ5A 4F7CA 3BGMB 2GSGA 4WTQA 4FQ2H 3TCLB 3TIEA 1CURA 4XRCA 3UIZA 1TJGL 1XZWA 3QYMA 1SHWA 4M7LH 5E2WL 1Q9KA 3NGBB 5ACLA 1MCQA 4OIBA 2O4EA 4G5ZL 3CVHA 1OWWA 1OP3K 3L81A 3I74A 4P5TD 2ZX9A 3MOAL 2BIIA 2V9UA 5AZEH 5JW4M 1ZVHA 1YVLA 2IBZX 5IESH 4DK3A 1KXHA 3OGCB 4LP5A 3BFQG 1ZHBB 5DK2A 4KXBA 2C26A 1X9QA 2FATH 3RL2B 3B37A 2HVBA 4OLUL 1NMAL 4GUOA 1LWJA 5AKRA 1BSIA 1INDL 3POHA 5KBPA 1ZVSB 4F93B 2FJHA 3R06B 5GRVL 3MLYH 4FN0A 5C0RH 4QI3A 4CSSA 1P7HL 1IFRA 5I5RA 5M95B 4XMKL 4X4KA 1NAMB 4EUPB 4M56A 1IBGL 2DTML 3A47A 1OQOA 2MH4A 3WTVA 4ZMNA 2WUCH 3AWFA 3BP6B 1NCHA 1FJ1A 2Z31C 3O6LL 2FYVA 4HUUA 1OM3L 2ITDB 1HU8A 5D93C 2PCPB 1HNGA 1AGBB 2XA8L 1URZA 4HF5H 1P9MC 3U7AA 4AZ8B 1E5AA 1D9KD 2XICA 4HKJB 4HULB 4NO3B 2UWEA 4NN5C 4XMTA 5DR5H 4R90H 1KIUA 2PP8A 4PGEB 4KI5C 2FECL 1J10A 4MKMA 1VADB 3BKJL 1YYML 4DP6X 5B3JE 3LKRB 1H8LA 1JZJA 4OSUH 3RWJB 3BRFA 3MLUH 5ADPL 3MGTA 4GIAA 5F1KC 5IW6A 1NAMH 1FVEB 4EUPH 4HK0B 4TNVF 3PJLA 4RX4D 1ZGLP 4I89A 4BRVA 3QZWB 1CFSB 4WV1A 3V4PH 3FMGL 3MRKA 3I6LD 2MHAB 1GZQB 4G1EB 1P7BA 4I13B 1NDGB 5CEXB 3GMNA 4RFNB 2ESVA 2WIMA 3RNKB 3T4YA 4ENZA 4F27A 5CBAA 1D6VH 1DTUA 3IRPX 4HGMA 1XL6A 4ZO8A 1MHHA 1A66A 5IMKB 3HJ0A 2C5DC 3MRRA 2Z93A 4L05A 3DHMA 5IB4B 3ILPB 2X70A 2A73B 3AC0A 4OLVL 5ISZE 1EEYA 3L3IB 4LAQL 4BCXA 2EE0A 4JPKL 2RFXB 2K3TA 2PYFB 5E6ID 1W6WA 1SRDA 1G6RL 5E9AA 3ZRSA 3OHMB 4Y9FA 3VI3A 2OM5A 3T0BA 2JB6B 3B1TA 2DYRB 3EJZC 3KBFA 3W56A 3WNKA 1OPGH 1YEFL 5IFJA 2G75A 2HFTA 3DX7B 1CLVA 3C60D 3EYUH 4Q0XH 5CZRA 4DGVL 3P73A 5KSUB 3MODH 2F9BT 3T0EB 1DUZA 3I50L 5TF1L 3EOYG 4MZ3A 5IB1B 1XAKA 3ZUNC 1BEXA 1CL7I 4I0CC 3O41B 4MAYC 3VWJA 1LDPH 5IUCA 3FQUB 3VFNA 1OTSD 3HZKB 2ZNXA 2CIKA 1MY5A 2IQ9L 1ZT1B 2ESVE 4A7VA 2D2CC 1RULL 2VDQB 2WSKA 4B9GA 2QZ5A 1JZGA 3HZYB 5H94A 1E42A 2H1LM 4HZ1A 5DJCB 3H4FA 2OYKA 3RFRA 4S0HA 1P5VA 3S5ZA 4S1QH 4WK0B 3PV7A 4IKLA 4RQQA 3PDOB 1SVBA 5EO0B 4ELMB 2GCYB 1JVOA 4Y2DD 2DQGL 1PQZB 3ARFB 3GTTA 1MPAH 4NSKB 4PWEA 3HS9A 3LNGA 2EEFA 2P8LA 5DMGD 4WKZA 2ZUQC 5DK3A 3VI3E 4I2XE 2XPGA 2V37A 1S9XB 2H1PL 3FRUA 5C97A 1XF2B 2QHRH 4YHIA 2DDQH 5EF2A 2EDMA 3UZEA 1CU4H 3VXUA 3D3VE 4FXKC 1J8KA 4MQSB 1B4LA 3EKCA 4KRPB 5D71L 3G6AA 4NHCL 3F7YA 2J25A 2H4EA 1U8IA 5DMKA 5I0DA 2PYEE 2VDQH 5IQMA 2Q2LA 1CQYA 3LQAH 4MYWB 1EUTA 2XWXA 3CHPA 3R7RA 1JGVH 1E27B 3EAKA 5IMOA 1EANA 4AX3A 2MPVA 2ZUXA 2HRPL 4UMGA 1MUJA 3EYOA 4XOAA 5KZCD 15C8H 4WTWA 4JAMA 4OM1H 3U7YH 1M9SA 1RKRA 3WJLA 2HJFA 3ZRCC 1NFDE 5DFVD 5BOPA 3DETD 1I4FA 4Z8FH 3VXMB 3MV8B 1W2KT 2Q3XA 5DWPA 4PRDA 3SE4C 2DLGA 2Z4QB 3CVHL 5FO2A 2HTKC 5B1JA 4LPYA 2AXGB 1IAIL 1HAWA 3UTOA 3VQ1C 5EO1A 4CVUA 3BSHA 3BUBA 1HDMA 3O3DB 3WY2A 1LQBC 4AQEA 1L9TA 1NKOA 4LSPL 1C5BL 2Q8BH 1X5FA 4XB8A 1A7RH 4HUXA 4WHYH 1IM3B 5EU6B 5ILTL 2V8MA 2ZOLA 5F1IA 3QEHA 3EADA 1V27A 4NQED 3IJEB 4Q6IC 4PJIB 1FFNB 1YQVH 5BQDA 3UPRA 1BWMA 4IRSC 5DK0B 3NDYE 1HL5A 3IJSB 1G7HA 4P4KB 3ZDYF 3WNPA 32C2B 2WMPB 2B20A 3FHQA 3RL1B 3TA3C 1IC4L 1TJIL 5FUOL 2UZXA 1FNSH 5CLXA 2IMNA 3QI9C 1DJYA 1XH0A 2EXYD 3BO8A 1EO7A 4Z7UF 1Z9NA 2LFGA 4A7QA 1TZHA 4JHVA 1E9QB 4CSZA 4DKEH 2DJSA 3OXSB 5IG7B 1AGFA 4JRYE 3FT4B 3MBEA 1CDGA 2MCMA 2OZ4H 3K74B 2FEDC 4NJAH 2QKIC 4N2BA 4PLKD 3MNZA 1A6UL 1NEZA 2ZCHL 3QRGH 3PAUA 2BZ7A 4W9GC 1JHLL 3DRTB 5EC2B 3QWQB 3UEZA 1VFOA 2YEVB 4JBSA 1F3JA 3IPEA 3D30A 3LEXA 5FA3A 4NQXA 2OP4L 1BZ7A 2A38A 5KSAA 2PW1B 4AQ8C 4OGZA 5TE6L 2N1TE 3D48R 4N8CL 4UTBL 1S7UA 2IDTA 2J20A 3E8UH 3F01A 5I5IA 3SY0B 2ZWSA 4C8XA 5I1IL 1IGJB 4GT0A 1BJMA 3CDCA 3SDCD 1IGCL 5JHMA 2HP4A 4X7CC 2OK0L 3FT2A 2YIHA 2D3VA 2OMXA 2XKNA 4YDNA 1C16B 4GRLB 1INEL 3IFOA 3BAEH 3GEWB 3PAZA 3F7QA 4WFGD 1ED3B 2BVQB 4WZ9A 4PTUB 4N5EC 3A4EA 5J4MA 2GG1A 4IGBD 3KEHA 1KIQB 2A6IB 2WINB 5C07E 4ZMYA 3GBDA 3ULVE 1BOYA 2EDDA 4RZCA 4ZFOB 3C2AL 1OGAB 5MENB 2BMKA 5D1ZC 4JM4H 3KWTA 3S36H 4E9SA 4NNPL 2P5EE 3MOBH 3RFZC 3BH4A 3L9EA 4TRPL 3O4OC 1A8ZA 4L1HA 4WLCA 5JHDB 3HRZB 1XHHA 4DO4A 1XVSA 2BLFA 3IFLL 4XVUD 2MCG1 4AUJA 4F7PA 2BDNH 3W9DB 5D8JL 1OF2A 4J3OD 2F7OA 1RSFA 3B9KC 1IFHH 2DOCA 3IETA 4BQ6A 3AAZB 4GS7B 3QZNA 4LGRB 4HJJL 4X5LA 3ZDZB 4EZMA 4GAFB 3GKWL 3N85H 5LBSA 4AE0A 4Y7OC 5DJZA 5KW9L 3DGCR 3MUGB 4APQB 4XVOA 4HC1A 3FUMA 5E9DB 2CKBB 5AVTB 1OAXH 5EBWA 3BZ4A 3VFWA 5JHAA 3GF8A 4OF5A 4JCMA 4HAFA 1G7PA 1O7VA 1XGQB 3FYIB 4NZDA 5L7XH 3T0DA 3TBWB 3BVXA 4OD2A 1S9VB 4C56A 2C3VA 5C09D 2LFEA 1XWVA 5HHOE 3IMTA 3KBHE 4I3GA 3U2SA 4KVPA 5E2TH 3GQFA 4I7ZC 5DC4B 3ZT5A 3IDYB 2R1XA 1OAZH 2VXQL 4MNHB 3RAJL 3VE0B 4QD2E 5TFSL 2VLRA 2CO2A 3IJYA 4HUMB 4IK7A 4N1HB 4E36A 4HZAA 4DO5A 4NNYA 4FYSA 5EUKA 1G9HA 2WQUA 2H6UA 2P8MB 1UWXH 1SOSA 4HA1A 3DA0A 4GG6E 1LO3H 1YYLH 2CKBH 1MCIA 4L37B 1UM4L 1TVDA 5EBMB 4LSUL 5KVMC 3GSXA 3FUEA 1ACYL 2H2SC 1IC1A 4Y5XA 3B34A 1IEAB 2J56A 4HISA 4HU2A 3HFFA 1KXVA 1CQKA 5HYQA 1GMEA 3RBGA 3R7QA 4HUWB 2H3KA 4XPGH 2GIYA 2ICEB 5EUOA 4RWHA 2Y1VA 5JQIB 2E8ZA 1KDIA 4R7NA 2VH5L 2BS71 1DZBA 2WXIA 4C56E 2C1PB 4Y16C 2BSTA 2VJ8A 5JW4R 3D4YA 5DS2A 3WS3A 1T1XB 5T1LD 1Z0MA 3MI6A 3O11A 3OKLA 1A9BB 4WUUA 3IAGC 4PJXF 3FO2A 2ZCKL 4N8VB 3RWGB 5JA9A 2D03H 1XGZA 5CJXC 3MA7B 2Q86B 2JQAA 4UV7H 5C0GA 3CFTA 2NY5L 5ES4B 3ARGC 4XXWC 3K8LA 3MXWH 1PY4A 3L4YA 4P3CL 2OMYA 3OAYH 1YHPA 1Z9LA 3SO5A 3NK3A 1TCMA 2IPUK 3FL7A 2XKUA 3BUYB 4UOW0 4X5WA 2BZCA 2IFGA 4NUQA 4ODWB 5BO1H 1BYOA 2VWEE 1X5MA 2CR3A 1K6QL 2Z7UA 3GRGA 3S4SG 2OMUA 1MCOL 1TR7A 4XNYL 3LAFA 4IBTA 3L4TA 1ZEAL 2COQA 3LMJH 4L4TE 5EZIL 3ZOAA 4OV6F 4BUHA 3IBEA 2DQTH 3GSRB 4F33A 1E6JH 1D6EB 5F21B 3N1GC 4FYQA 1FNLA 4NKMB 1G4RA 5D72H 3EH2A 2EE2A 5HDBB 3MLWL 3SDXF 4TUKH 5TDOA 4A2FA 5CHNB 1CFVH 1E90A 3O4LD 4G7YH 3BIKA 2I25N 4LVEA 5DWUH 1UM6H 3WEXB 1E4KC 3FRPA 1RZJL 2JKIS 2Z31A 2OSLA 1SF3A 4JR9L 3ISWA 5C86A 4XMPL 2NR6C 4JG9A 4JKWA 1R17A 1AKJD 3QDGB 1CDIA 4MMZB 5DS8A 3U46A 4ZX5A 4L8DB 5AEAA 3T2QA 3RGBA 1Z3GL 3WEOA 4KHTL 3MJ7B 4L3EA 4KC3B 1YO4A 5DD0L 2YFNA 2Y2WA 3KCWA 3FFDA 2G30A 2QT6A 4HWBA 4M7JL 4CJ0A 1E3XA 5HHPB 1YNLH 2BVUA 2E75C 1XEUA 3WXVL 1KGUA 1UWGL 1YEDB 2VKWA 3N42B 5I1JH 2FBJL 4PJAB 7PCYA 2ZD0A 4BUGA 1CPUA 4TLSA 2ZP0T 4I77L 5AD0A 4I85A 5BW7C 1XGUA 4MMXB 2ZOKA 2HFFB 5J1AA 2I9TB 2BCMA 4ZPTA 2GABA 5D1QB 7PAZA 1SEQL 3RA7L 5IEHA 3JVGC 1O7DC 1ANUA 2PCFA 2YLKA 4FG4A 2A9BA 1OD9A 2W0FA 2W5PA 3KHQA 3NCWA 1TIUA 4YN3A 4S1RH 1BAWA 43CAA 4ZTEA 5FF6A 4X9FA 3CFEA 4OQTH 1IVLA 1HH6B 5LBSL 1HHGA 4PJCA 4TOYH 3Q1SH 1YN6B 4Z7OB 1NOFA 4ZW6A 4LP4A 4HC1L 4O2CA 3CFNA 3UEQA 4DK5A 3IF1A 4ODVH 4X4XB 3VXPA 1TSRA 4R3SB 5A2KH 3GS0A 2HKAA 4BK8A 4ZXBB 4TLUA 3VTTA 2NXYD 2YPKA 4G6AD 1N2RA 4MAYA 3ZN6A 1EGJA 4BQ8A 4G6JL 4OUUA 4BFRA 2JKTM 1GGTA 4O4YL 2ED8A 1IQWL 1A47A 2HT2C 2W59A 4EOWH 4L8CB 1F86A 2D7PA 5IOKA 2UZIL 5LG1A 3MV11 5AVUB 1Z9OA 5HJ3A 3BIBX 1DFBH 2NY6D 3BQUC 2F58L 3FO0L 1T0PB 1A5FH 1E30A 4XC3H 3AT9A 3C5ZC 4LHQB 3MMEB 1YEJL 2YRZA 1TEFA 4Z9KB 3TC9A 4P5TB 1BAFL 3VI4E 1DVSA 5C08E 3N1PC 2IOOA 3B5GA 3F7VA 5LAXB 4HFWB 1T5XB 4YE4H 3QRBA 2XVLA 2BM3A 1JS4A 3QSKB 3TN0B 2ARWA 4R84A 1NBYB 3QWOB 5CINL 5T3ZD 1ZPLA 2ARJB 1XBRA 2H1XA 4PG9A 2UXVA 4PJCE 4PBDA 2NY1D 4G42A 1HN1A 1KJ3L 2VDLL 3WN5C 4CW1A 2A77H 2IG2L 4I9WD 2XXMB 1MCDA 1CXLA 2TAAA 1QLRA 4LLQA 4GW5B 3OV6A 4XC1H 3K6IA 3N1MC 3C09B 3TZVA 3SGEH 2C4FT 1U8LA 2ZF8A 1LNUA 3P11H 5I8OL 4L2LA 3NABL 1HCZA 3OXRB 4OCSL 4WCYL 2G0KA 2VUKA 3UADA 5LXGH 2Y2YA 2HUEA 3CBRA 4N22A 3TNMB 4BCYA 4YSAA 4F58L 1R33A 7CGTA 5IGXH 4TPRH 2VN5A 3SE4A 3QPKA 2G3XA 4BH8B 2ZYSA 4TSCL 3QXVA 3VQ2C 3ZQWA 5DFAA 3MRBB 5F93C 1J5OH 1N7ML 5FOJA 3PRZA 4XCFL 3KPQB 4U7MA 3MBWA 1X7QB 3G5XA 3MR9B 4NIYE 3X3GH 5T3XD 1NCUA 3VD2A 4L4VD 3BMWA 5C0BA 2EC8A 3DX4A 3HNSH 1JOIA 3X14B 4GG8B 2NUPA 1GRWA 1IBDA 2YAPA 4FQHB 1UVQB 3GWJA 4OQ1A 2Y7SA 1PJ9A 1OB1B 4LVOB 3G3LA 3WFEL 1LVEA 3MCKB 1HI6A 2FLRT 4Q6IA 3VWKD 1JVKA 1JFHA 1DHKA 1OK8A 2QEJA 5A40E 1IMHC 4IRSA 2F54E 4N2GA 4XE5B 2G2RA 2H41A 4XNZC 1N8ZB 1UFGA 2XQBH 1QI5A 1ZVYA 3S37L 1IRAY 2X4OA 4N3UA 3TA3A 5M94B 4KZDH 4QYAA 1SXBA 5HGHB 4EKJA 4M7KH 4DVBA 2BFVH 5IHBA 3QI9A 4N8UA 4PGCB 3MROA 4PS7A 3P4NB 4G1MB 4XPBH 2ITCA 5KS9E 2AZUA 4Q7DA 3V5HB 4JG1L 5LGJA 2OR9H 1RURL 1EIBA 5C92A 3WFBL 2A0LD 2QELA 1Y1UA 2WYTA 3VFVB 5JQ6L 3S35L 4DN4L 3T4AB 1OKEA 4AEHH 1QACA 1J0ZA 5C0BE 1WS8A 3Q8AA 4QOKD 4RGNB 1JNJA 3UGXA 4HWBL 2B4CC 4BDVA 5T5FH 1RERA 3HI6H 3EDFA 5F3HA 1KXQA 1E6OL 5L8LB 2HLAA 5IVOA 4AQ1C 4QTIL 3MV9E 3KCPA 5I1GL 3O81A 4U3CA 2KZWA 1F11A 4AM0B 2HX8A 4OJFL 2FHBA 1HT6A 1QBLL 5D7IE 3PLYA 5EOQH 2X9WA 3BVTA 2XN0A 3WL9A 3WDJA 4YDKH 3BZFA 4XBMA 3VRJA 4A67A 2DM3A 4Z7WB 1KJ2A 3RE0A 1F58L 1NGQH 5B39G 3PF2A 2BSEA 3US9A 3MREB 4AQAB 4KJWD 2G9KA 2ZPKH 3Q6GH 4HH8A 4PJ8D 4Z7QB 4HALA 3EF4A 4P04A 3FTSA 3Q0HA 2OI9B 2Y7QB 2ADGB 1GY2A 3GIVA 3ECWA 2QMJA 2GEEA 3C08H 2XN9D 2YXWA 1XR9B 1J7VR 1NQBA 1WBYA 5DD1L 4BZ2H 3BPOC 3VCLB 3VYNA 1XGTB 1DLFH 1EZUA 2ENSA 1P5UB 3BN9C 2AV1B 2ZXDA 1F4WL 1FN4B 5ID0A 4W93A 3RVWC 2PNDA 2VZUA 1BVKB 4B7IA 4BKSC 3LVEA 4BFKA 3JTSB 5D1ZA 2DF3A 5GGUA 1W0VB 3SPJA 3HPLB 1H6FA 3RFZA 4ODBD 3LN5A 2R0LL 3GMLB 4P0DA 3E1ZA 3V4LA 1L6XA 1Y0LB 2NZ9D 2ZKMX 5DCCA 2ZG2A 4XGZB 2SODB 2EEAA 2RQEA 4LVNC 2KDYA 4PBVC 1EGJL 3U0PA 5EZJA 3GK8H 5FEBA 5I19L 1TOXA 3HHSB 3UTTD 3X11A 1G1KA 3GO1L 2X4PB 3SDDC 4XBPB 3V9FA 5CLZA 3SE8H 3CZFA 4QRSA 3DHJA 1WFMA 1TNNA 4DPBX 2BIOA 4EI6A 2Y7LA 5T1KA 1DQMH 3WMSA 3D69B 3F64A 2J7LA 1IKFL 4OZHA 5FHAH 4M5SA 2BFGA 4GY4A 5D7LD 3UZQA 1FH2A 2JKRM 4FJYA 4YQXH 4HJUA 3SGEI 4U1LB 2E56A 4N6RB 3MRPB 3OR6B 4PJEF 2R69H 3IDXL 3PAVA 1WBXA 5GGSB 4PUBH 3ZL4L 1NLBL 5IM7B 4P2OC 5TPWL 1M7IA 3GMRB 1J88A 4V11A 4L9LC 3DX9A 4OLXH 1UWYA 3WE6B 1E9PB 4NQEB 4OF7A 5K39A 3THML 3UTSD 5KJRL 2Y06L 1DE4B 4WWNA 1YECL 4ONHA 5AW6B 4R6UA 2KC0A 3B2PA 3N44F 3NIGB 5GS0C 4EBQH 5EFIB 2ZUSA 2FGWH 3ARDB 4OIAA 4H25B 2YUXA 2EECA 1N70A 2APSA 2HYMA 3KXFA 4HQQL 3MRDB 1BD2D 5AW7B 1EJ8A 4L18A 1MZZA 1QFOA 3AW5A 5I8EA 3GSQA 4QHNB 7FABL 1PBYA 4OZHE 4S2SB 3M1BA 4ZFZA 3LDBB 1YEHH 4CADB 8CGTA 1DDHB 2E5EA 1NCAL 3FQRA 4KVCH 2ZWLT 3RKDC 3UO8B 1MIEL 4OJAA 4Y8DC 4Y16A 1KCRH 4KXZH 1OQXA 1PW3A 2XNAB 4X98A 2FYYA 4XNQA 1KTKE 4LNRA 4MS8C 1XGRB 5B38G 4GLRI 1HKFA 1PX8A 2IDUA 3M88A 2J88H 1AS8A 1OGPA 1W0WB 2VDPB 3FAWA 4JFEE 4DP1X 3V0VB 2YKLH 3WDIA 4YSPA 2UZYB 2GFBA 2L7QA 3ARGA 4XXWA 2DWYA 4Y4KD 2C1OA 5E1AB 4AXWB 4ZYKA 1UXSB 2FBRA 3M46A 3D5OF 1OTUD 1NC4D 2AQNA 1YMMA 3OKOB 1A8JH 1JZ3A 4F37K 5KANI 4CVZB 3IFNH 3O3AB 4R4BB 2KKQA 1GGIH 3LH2L 1FL3B 2DQDH 1MIMH 2EE9A 4GMSH 5E94A 3DGGA 3K46A 4NWTL 3DMMD 1YPZA 3FULA 2V5TA 3IN2A 3MXVL 3OKMA 1MVYA 2OXHB 4NRZB 3QEQB 2D7MA 3BFOA 3CFBA 5JDSB 2VSCA 4WI6A 3DYPA 1ND0B 1E4KA 4UNUA 3ARED 3S5LA 3ZHFA 3OX8B 3BPLC 3U6RB 4KKAD 5C0AA 3LZFH 3NOIA 3QNYA 4F7MA 1H3XA 1DUYA 2DWEA 2VL4A 2NR6A 1JV5B 1WD8A 4P06A 4AC4A 1BYNA 4DKAA 2Q9OA 3HR5B 4IMLA 3RWHA 2Q3AA 5TQ2H 4DVRH 4CA4A 3JWDC 3FUIA 4TVUA 1AI1H 3FQTB 4N0CD 1EZVY 4UILH 2A9DA 4IBZA 1S5IH 3QUZD 1LYQA 2B0SH 4JZOB 1FZJA 3JVFC 3QIWD 1LE5A 2XACC 4Z7NE 1NCCH 2DJMA 1MFEL 3H56A 4P46D 4TQHA 4ZNEE 5BJTA 3ESVF 1J8HE 3IMRA 1HQ4A 4KVNL 3SQOH 5ETUB 5K1VA 2EYSA 2Y1AA 1MVUB 4MWFB 4YDVB 1CC3A 5FV1L 1K4CB 3UJIH 1ET5A 3BRGC 1S7SB 1H19A 1U93B 5H2BB 2FNWA 4W9LC 1I7RA 2OAAA 4QTFA 4HCIA 2IF7A 1MLBB 1AVAA 3SGDI 1AY1L 2X87A 3EYVA 2WWMC 5CILL 3CZSA 1RQ5A 3QA3B 4GI9A 5K93A 3ZUCA 4O2FB 4H20H 5FM5M 4ZD3L 5C0AE 4WFHE 3WENA 3QAZC 5I1HH 3JVGA 3RHWK 1R3KA 2BHYA 5BV7C 1AZVA 4XX1G 1OAYH 2WN3A 4ZUSA 2OJZH 4WI0B 1RPUA 3APCA 2R7EB 4DGIL 4WWKD 2K78A 5LQBH 1T89C 2WQSA 4Y2OA 1TU2B 4M8RA 3NIDE 4PJDB 4DT2A 1J1PL 2XZQH 4JDTH 3DLQR 2XFXA 4GW1A 1D5MA 1K5NA 4X7TA 2DQJL 3CLWA 3MOQA 1CMOA 1E0OB 2KL6A 4OW6A 1NMBH 3RVUC 2A4ZA 5ENWB 3K8MA 3NAAL 4KX7A 1VFBA 1RZ8B 1B3JA 2CO6A 1G7IA 4MA8L 2Y25A 3WUWG 1PIGA 4E9RA 1KNOB 3AU1B 2H6PB 4L5FH 4DOHB 5LWYL 5HD8C 4PP1D 2H26A 3FT9A 3MPCA 1AZNA 4K07A 3C5ZA 4LIQL 3SGKC 1IC5H 1FUNA 4GAJH 5LO7A 3VM5A 1NLDL 3WTUA 5I0WA 4JRXB 4KKCD 3GSUA 3IBOA 4GSQA 3KWVA 1JZHA 4PD4J 4KXZI 3BUQA 4NQDD 4ZS6C 4MVBD 1RSYA 3FN3A 2AJSH 2QVTA 1U95A 4XVTH 5EIVA 4XCCL 4PRPE 4PGBB 2GJ6D 3ZXAC 2GJRA 2OTPA 4ODSH 1CBVH 1QRNE 4WDIA 1LO0L 4APXB 3X2QB 5JLZA 1KG0B 5HDQL 5F7NC 3RGVD 2J1YA 3SJVB 4PY7A 4HLZH 3TO4B 3L3HB 2EIZB 5BO0D 2I07B 3P4OB 1OAUH 2V0AA 2VB5A 1DO5A 5C2BH 3C5SA 4QJ3B 1AKJB 4AYBA 2DQCH 2IWKA 3Q2LA 4UAOB 2OYPA 1I8UA 3UYRL 2WLLA 5K9OB 1KY6A 4X0KB 1CXFA 2O6CA 3PGDA 3QWRA 3SGJC 4AQZA 2BP0A 1OEZW 1LXMA 1DJXA 4U1MA 1A1OA 2PLTA 2WTPA 2VMJA 3N42F 3V0HA 2P45B 2NUTA 1JXDA 4EQ3A 1EFXB 3CFKA 1COBA 3E3QE 1P4BH 3V0EA 4BZ1A 2Y6SD 1KENH 5EN3A 3TASA 1WZ1L 4LL9A 5KTEL 2QQKH 2X4SA 3KPRA 1XMWA 2YEZA 4KY1H 1AQDB 1OIOA 1A14L 4JDZA 4JL2A 4ONFH 5B8CB 3V7AE 3B6SA 4J4PD 4PW3A 1RMFL 4Y4FD 3QDME 4KJQD 5SWSA 5AYTA 1QAWA 4YWGL 3ZE1E 4CMMA 4NN6B 4DQOL 5I71B 3CE1A 3PQYB 4MZIA 4WFFE 2Z9TA 4XMUA 4U1NB 4XZUA 3QJZA 3UJJH 5MERA 3CZEA 2CO3A 4KQ4L 3NGBC 3GJEA 1F3DJ 3UBXB 4JNXA 3OKEA 3BGFB 3QXDB 4I1RA 5INCB 3UO1L 1RL1A 1T21A 3V9EA 5I15L 5I75C 1QSFB 2GITA 4YPGB 1EAJA 1KPVA 3MRQB 2DQUL 3B2MA 3HVDA 4PCSA 5HPMB 4JPWL 3S3SA 3H9ZA 1EVTC 4AQ1A 1T1WA 5DI8A 3DYMA 1Z9MA 1KJMA 1K4DB 4OBSA 3KPRE 3EYSL 1SYSA 4E9YA 4FG6D 5IJVA 2WUBH 3KLKA 5C7XH 5A2FA 1RFDL 3MFFA 1G4MA 4H1LA 5FO9A 2FZ3B 3QCUL 2WTRB 1NZRA 2ATPB 3W39A 2WM0A 2QQNH 4P3WA 3GKZA 5F1OB 3QPXL 5GZND 1KCKA 2A5UA 1FZOB 1Z9SA 4LFHG 4PREB 5IFHL 1YLBB 2WWKO 1JHKH 1TTBA 5IWLC 4MAUL 4WI8A 4F1SA 5DJ6A 2D7NA 4DUXA 5F0JB 3TS8A 4TSBL 4TUJA 1S78D 1MNNA 5CZKA 1TDQA 1WCQA 3OB8A 5IB3B 2CNYA 3NACH 3BEWA 1QNIA 5I1LA 2R56H 4JLRA 2E6JA 5DRXA 4X4YB 4FQXB 4WHDA 1I8KA 3HMXA 3KPSA 3RJDA 1J05A 4DERA 1IGTB 5DA0B 5C70A 1U6AH 4PJ5E 4G8AC 4AMKL 1NGYB 4AGNA 1KIRB 5E1QA 5GRUL 3RWDA 4ZW8A 1QVOA 3VXTB 2VXTH 3ELQA 4HT1L 1OARL 2JB5H 3JV6B 5AZ2H 4JFXB 2DH2A 1BGXH 4U3HA 1RZFH 3SDDA 2CK0L 1UT1A 3BVWA 3WCYA 5B4MC 2CR0A 3VH8B 3RY5A 4EPSA 5EBLA 4WU7B 4PU2A 3V10A 5T3ZH 1MCWW 1NCDL 3VMOA 4UT6A 1VZHA 1F6LL 3CTTA 5FYJH 4ZMXA 5E2UL 4IRZA 2LU4A 4Z7UA 1FO0L 4L4VB 3UGEA 1BQHA 4A68A 2HPTA 5A2JH 2MQ3A 2YD2A 4ZI8A 3G08A 3KZ8A 2AW2A 1U2HA 3O0RL 4P2OA 3B9AA 3UAJC 5L0QB 4L9LA 4HIEB 4LSTL 4B9FA 1JZ8A 3FFCE 1J9SA 3T0EC 3WIFB 3MRIA 1DJZA 3KVQA 5A2LH 1T83A 5I1EL 1D5BA 4R96B 4QUOA 1YEEL 3O9WD 2E9GA 3FH7A 4UQDA 3EIFA 1C9SA 4GKZA 2ADIA 3FNKA 4KO5A 3STLA 4U31A 4H0HB 2DQIH 4U2ZA 1S7QB 3GBML 2WC7A 2CHDA 2BWQA 2ENYA 1EHLH 3QO0A 5AENA 4ZUWA 2RACA 4QRUA 1LK2B 5E08H 4R26H 5AB2A 4QRTA 5JXEA 2AV7A 1O9VA 2X4NB 3ARFC 4O2EB 1WCBB 1HJBC 2JFCA 1SPDA 3HI5H 4ZNCD 3R8BB 3LJ3A 5ISZD 4IRJC 5E8DL 2AK4E 3E80A 3SDAC 3RB5A 4NC1C 5A6MA 2LE9A 4F91B 2YPLB 2Q20A 3IJ9A 4NHUB 4XHJD 1HXKA 5FCUH 3D85A 5FC9A 1QR4A 2NT1A 4NKDB 4Q6KA 4LCWA 1K8IA 4KRPC 4KTGA 1JGUL 5CD5D 4Z7WF 5CCGE 3FSOA 1TQBC 2H3XC 4NDMA 4PBWD 1ZMYA 5BCAA 3HKFA 3T6XA 4ZMVA 1D7CA 4MXVE 5BOJA 1SVCP 4HEPG 5C0CD 3WIIL 4UT9L 3DXAD 1CD9B 4HU8A 4AYEC 4HUCA 4IU2B 4F15B 3GHEH 4NT6B 4KK5C 1V54B 2VR7A 4H8WH 4WI2A 4M6OL 2N01B 1O6TA 5J1SC 1JUFB 4QXTA 2MCPH 2VLLA 4E0RB 2F53E 2Y7MA 3KNBB 2WLKA 5FECB 3PL6A 4GUPB 2VJ0A 3AZUA 2XWDA 3HS0B 4HV8B 1E5CA 2UXFA 2FO4A 5DA4A 3DUUB 2JK5A 4HEMA 4OIFA 3F7RA 5BVJB 2R2HA 1Y7VA 4U1KA 1RUAH 3QUKA 4JJOA 4X99B 2FAUA 4XO5A 4DCQB 2JNZA 4M62L 4LCWE 3H3PH 4PJBE 3P54A 1YMHA 3NQKA 1H8NA 3KLAB 3D3VD 2M8XA 3HNVL 3TH2T 5HVFB 1JWSA 1DN2A 1N5AA 3UTTB 2PYED 4RFOL 5K9QI 2VW7A 1XBDA 2F18A 3LRSB 1G0XA 4P4KC 3G7TA 1ZLVH 3QFDB 1Q94B 4IKIA 4IQHA 2H0EA 5KVFH 4RDQF 4R0LB 3N0PB 5HYJA 4UINH 3P2DA 3VMPA 4XMXA 4YBQD 2ENQA 3JTBA 2VM3A 1OTTD 4BIKA 2XG5B 1A7OH 1Z3RA 1PZ5A 3B9VA 4F7TA 1G1CA 3WY1A 2Z4TA 3QIBB 3KYMB 3FB5A 4MDJA 1FL5B 2IGLA 2NCMA 3OR7A 4NX0A 4X6BA 3Q2VA 4BHUA 1JCVA 5PCYA 3EJYC 3DBXA 4H8QA 2QSTA 4GRWB 3GJFB 1U3HD 3HMXL 3QJQB 1KJVA 3GHPA 3ELAT 5CN1A 2VABA 4EE2A 3DIFB 1ES0B 3NIGF 1DQLH 3FTUA 5DYFA 2XQYG 3UTQB 2EICA 1N8OE 4A63A 4PJXA 3T3PB 2FVNA 3W0WB 2CM6A 4U33A 3ZTJH 1BM3H 1PFCA 3BH9B 3PWUA 4R7DB 3T2PA 2I5YL 5HGDA 2C9XA 3IVKA 4CSTA 5HHNB 1KEGL 1B0RA 5HI4D 3BMVA 4WW1B 1Y18B 1HZLA 3AS1A 4GRLC 1HESA 1N59B 5BVPL 4G6ML 1HL9A 1IBFA 2W81C 5I28A 1MXGA 1WFTA 1P53A 3BP4A 3GJFH 4IRZL 4XN8A 2IAMB 3WHXB 2NYYD 4BKTC 4JL1A 4F2EA 2R29H 4LPXA 3POCA 3EFOB 4TVPH 2YRPA 5E00B 4ERSH 3OJ2C 3QDJA 4QHUA 2IGTA 1JPEA 1T5WB 3BP7A 4JRYD 2VO8A 3KPMB 4GUQA 1NGPH 1AO7A 3NEEA 3UG3A 2WXKA 3SDXA 3P2TA 4KGJA 3IE9A 3ZTCC 4K7PL 5JNYB 4Q9RL 1TSHA 3O6ML 4HLEA 3GMMA 4JM2D 3SGKA 5KVGL 3QQ3A 2P47B 2P7TA 3CNKA 2W80C 3OVUB 3B2XA 1U3NA 1YRKA 4EMZA 2V33A 1PFOA 3D51A 1E4XH 3PXHA 3EBGA 4MD5A 1KGJA 1VFAA 4NXSA 4E41D 3UTZA 3Q5OA 4YX2L 2VE6B 1FA4A 4YAQA 4DP9X 2VKXA 4O5LL 3QFGA 2WVVA 3DOIA 4ZFQA 1NBQA 4HPHA 5DZAA 4QY8B 1XIWD 3ILQC 5DEGB 4AJYV 4G8FB 2ZWYA 3CAFA 5E8NA 4APQC 1VFUA 4K7FB 3TTYA 3VVWA 3MUZ1 1M7XA 1ETA1 2PP7A 1KBGH 3RIFF 1BPVA 1Q9LA 1XXDC 1EJFA 2MQGA 1G7MB 4G71B 3VSUA 3OZLA 1FNFA 4POZC 3ZLQC 4FZEL 5HHXL 1U8MB 2J1KA 4FFWC 1PIFA 1QYGL 35C8H 4S0SD 5C07D 3AREB 3TYGL 3ULVD 3GXPA 4UM9A 4PRHB 3FB8A 4X6EA 4GYBA 3SDXE 1GIGL 4YSCA 2ATKB 3PJSA 3VX1A 5G4MA 1G9NL 3IDYC 2YBRA 1IGML 2P5ED 1J5DA 1ZCRA 2ZT9C 1ETZB 3OKDA 1CD1A 1P7QB 3CVIH 3KS0H 5LGYA 1XF4B 5C0IB 2A1WL 4PS8A 3QUZB 3ULUE 2DM7A 4M43L 3C8HA 4KO6A 2AJ3A 3KE0A 3FN0L 3MRNA 4JE0A 3MGAA 3C87A 3ZQ9A 4WU5A 4IOIB 1PG7X 3BQVA 2R0ZH 4WHTA 5FYJU 5DUMH 5JOFA 2VZ3A 3QUXB 5KOMC 3LRMA 2X6CA 2EINB 4PAZA 1BJ1J 4K3EL 3VFPA 4G8GD 5EF1A 4KKBC 2JLLA 1TJHH 4NZRH 1F00I 3MV7E 2XV6B 3ASWA 4OCRL 4KV5F 4JKLA 2Z8RA 3QQ9D 1KUMA 1IUZA 4N24A 1QI3A 5ESAB 1S7VA 2D3NA 3BGMA 3IJHA 2DBLH 4M6AA 2VR8A 5TE7L 1AR1D 4JKPH 5HHOD 4FXGC 4U05A 3ARXA 4CC4A 3NIFB 3KH3A 2OW6A 4GBXC 4OI9A 2PPFA 2JI2A 4JN2B 4WWKB 5D2NE 4PB0L 1GZPB 3WFCL 3CIAA 4C4BA 4FMFA 3HN3A 3DUHA 1VA9A 4D9QD 1SQ2N 5HVHC 4I18B 5EU3B 4MA1B 2ZYRA 3ZK0A 2P3YA 5AALA 1ZHBA 3VRIB 1KGCE 1QZ1A 4BEIA 3HN8A 3TJPA 1NGWB 4LCYB 4WI9A 2YQ2A 2H0JA 4LHUA 4RA0C 3ZHLA 2X09A 1HL4A 5HYEA 4MBRA 1OE1A 2BNQA 4PRIA 5DFWH 4UTCA 3QZOA 2JJSC 5IQNA 1AIZA 4KHXL 3R06A 1KPUB 3SBWC 3EH3B 1UH3A 2WIIB 3SOBH 3A67H 4J7RA 4UDUB 3GXNA 2QVFB 4QRPE 2OBGA 2DYPA 3U30C 4BINA 4JFVA 3AWEA 1UACH 4YIQA 2NQCA 2V7HA 1EXUB 1GZHC 4X5QA 1TYJA 4K5MA 3A6OA 3V4PA 3BP6A 4OI8A 3IKCB 4HIPA 1BLIA 3FCTA 2IVFC 2V5SA 4CBPA 4YXLL 1KBKA 2X4RA 3AUVA 4Y5YB 3FT0A 4MMZC 4FDWA 2BIMA 3QHZL 4HKJA 4BM7A 2ID5A 2FL5B 3PWLA 4D0DA 4YL4A 1TETL 1ZV2A 5E95B 5FUZL 4KZEL 2A9NL 5JUEH 2GIXA 2EUXA 4NM4L 3HE7A 4LLYB 4WK4B 1MWOA 3HC0A 3IS1X 3DSFL 2EZ0C 2X0WA 5E5MB 1F1AA 3RWJA 4HOWA 1A9EB 2VDOL 5CZXC 1CFNB 4W9HC 2AJVL 1RIVL 5FO8B 1T3FB 3L5WB 4L4TD 2N0MA 3SCMD 1PTZA 1B4RA 3NJLA 3I75B 3QZWA 2PXYB 1E4XI 1M7DB 1GMIA 2MHAA 1JGEA 1ZY9A 1H6UA 3KPNA 1ET8A 4G1EA 4NRYB 3CLEL 4JFFA 3ZZLA 1FNEB 1SOQA 2Y6TE 1WHOA 2F7QA 3ZVVA 4MMXC 5E2WH 4WTXA 3L9RB 2FJFB 3DX2A 4G5ZH 5D1QC 2LTQB 4M1GL 1P6FA 1M1XA 3JT2A 1MREL 5IMKA 3ATEA 3MOAH 1UWEL 25C8L 1S5HA 2A73A 3WJJC 4TKWA 2BNUB 4J8RA 5EEWA 2BVPB 1V3LA 3HNTH 4G8EB 4MJIA 3RWFB 4E9TA 4POYA 3ULUL 4I0KA 3VXNB 1HNYA 1EERB 2KLSA 3VW3H 4WTZG 3KM2A 5CXPA 2CHZA 3CZJA 3MZGB 4KRNA 4OLUH 5TDNA 3UAJA 1NMAH 4MYPA 2RH0A 3QZBA 1INDH 4RNRB 1RZIB 5E6YA 3DX7A 4W1TA 3QC5X 2R4SL 2JIXA 5CIPA 4EDXB 4Z7VB 1IL1A 1WA2X 3F58H 5CS7A 4PWHA 4XMKH 3NG5A 1I7TB 3CFDA 3FQUA 4L1BA 4Y4FB 2NX5E 1IBGH 1Q38A 4JFFE 3HZKA 1O7SA 4YK4B 1BIHA 4NN7C 5CJ8A 3O6LH 1T2XA 1C5CL 1L5GB 1U8PB 3Q3GB 3UYPB 4Z7AA 5DJCA 4X2UA 1U33A 1D7BA 1QO3B 1ZHLA 2XA8H 3NN8B 1OP4A 3RDTB 3PDOA 3JWOL 1TZ8A 1CF8L 5HYSB 4P5TC 3GM8A 3U9UA 5BNXD 1PQZA 1KB5A 4PVMA 3KLLA 3BX7C 3ROLA 4MJIE 5C9KA 1KB3A 1YYMH 2L04A 3Q5YA 5F7DA 1Z5LB 3DYOA 1YN7B 3UAEA 4BD4A 4IRJA 3SDAA 1QUPA 4QO1A 5ADPH 1HE7A 4BXSV 2AI0L 3IPBA 4LRNL 1G6RB 3FU6A 1HHKA 1P4IL 3TBSB 4DZ8B 3BPCA 4CMHC 5J6GB 1TJXA 4V1DA 2V2XB 4ZTPL 3FMGH 2EC9T 1BVLB 2FT6A 2JCCE 1TMQA 2NLJB 3GMPA 5FFGA 2ZZUT 3JUZA 1EUUA 1PY0A 1E27A 1A7NL 1WAAE 1DVQA 4FS0A 3B3IB 1WO2A 4XN1A 1HSAA 4PS4L 5E2JA 4I4WB 1QWNA 1H15B 1ASPA 3KJ6L 4HS3A 5KYXB 4H0GA 5L6YL 3QXAB 4ODUA 1M2VB 2X0UA 4ZPVB 2MOVA 3ORJA 1FZKB 1CGVA 3M1OA 4OLVH 2JTDA 1MAMH 5IB5B 4LAQH 4GRMA 1X5KA 5GGRA 3CH1A 4JPKH 1ZHKB 4JRFA 2Z65C 4U49A 1D9KC 2NZ1A 5JO5B 1G6RH 5EF0A 2YRBA 1IKOP 4JGJA 1S7TA 2FE0A 4JS7A 2OTWB 4G82A 1NICA 5DLLA 5C08D 2ENJA 3O3DA 4B9JA 1YEFH 3QXUA 3W57A 2RCSL 4FKEA 1LP9A 3L3KB 4HF5L 4RMRA 4YBHA 3FONB 4YDIL 4DGVH 5IEKB 5K9KA 1PX3A 2MIZA 4HK3N 3UZVB 6TAAA 3I50H 2AVGA 4PJEA 4R90L 1ZTXE 1IJ9A 4H40A 4NP4H 5K69A 5EU6A 4LVOC 5C71A 2O93L 1U3ZA 2NXZD 3IJEA 1DBML 3AQXA 4NENA 2IQ9H 5A6LA 4KH2A 1IC7L 1RULH 3QJVB 3IJSA 2EH7L 2XXCB 4JQVC 4CNIB 4M5YL 4OFKA 3WU1A 3GT6A 1K2DA 1I3UA 1N3NB 1EEZA 2VERN 4ABVA 2K7QA 1JI1A 3V4PL 1WT5C 3RUGF 3NFSL 3G5YB 2DQGH 4JFQB 3V6OE 4F7CB 3TIEB 2C9PA 4XRCB 1KN4L 1Q9KB 4UCFA 2ATAA 1D6VL 5IG7A 2C9QA 2NZIA 2GJZB 3B7RL 4HG4J 5E6IC 1G0DA 1ML0A 3CVHB 4EF3A 2H1PH 2OTUA 2COVD 4ZMWA 1JCKA 4RGNC 5D71H 1LP9E 4NHCH 4CVWA 1HH9A 3ZQXA 5ANME 5KAQF 1LHZA 3C60C 5T5NG 4M48L 5TE4L 3DRTA 4PJEE 4FNQA 1ZS2A 5DK2B 2E86A 2ZXQA 4PJ9D 2GTZB 2HRPH 2F5AL 4N2EA 3CHRA 4OLWL 5CN2A 1JK9A 5DUPL 1G0YR 1OTSC 1NC2A 2YJLA 1QG3A 2XA3A 3QGVA 2FJHB 2ORBL 2VLJE 2C4XA 2F54D 4XP6L 4R9HA 4FTDA 1DVXA 1A4CA 4M1DH 3EH4B 2J2ZB 1I85A 2QTVA 2DM2A 2GTQA 2XX1A 5DU7A 1ACZA 1IAIH 1KCLA 1C16A 2OI9C 4GRLA 4KO9A 4HSAC 1ZLSL 4ELDA 4I0PD 4M3HA 1ED3A 1FJ1B 4HUUB 3E2HB 3W3BA 3M1CA 3LIUA 2E0PA 5DMGC 1KIQA 2A6IA 4N0YL 5ISZB 3HBPA 1P5UC 1C5BH 2KQNA 4LSPH 5J12C 4F8LA 1NPUA 4EZJA 3WO4B 1BV8A 3DIVA 5ILTH 1TITA 1TEGA 4EI5D 1JAEA 2IOIA 3H7BA 5DZJA 1UOWA 2Q10A 3MGTB 2FECI 4MJ5A 2QHRL 3MV9D 5ICXA 5IW6B 1I3GH 2XDHA 3HR6A 5ESVB 2XWRA 1IC4H 1TJIH 3GS4A 5AOLA 1KC5L 5AKVA 3MRKB 2XWJB 4B5ZA 4QRRA 1SNRA 3L3JA 5DFVC 4Q97A 2NDFA 4P23D 5IJKC 2ESVB 1L9OA 2L8AA 1DBKL 3T4YB 5T1MB 5CBAB 4I88A 3DSNB 2YQGA 4JFUA 2BNRA 2DIAA 1KB5L 2Z93B 2CH8A 3CD4A 2VQTA 4Z8FL 3G6JE 1A6UH 3SKMA 1EEYB 2ZCHH 3G6DL 4KJPD 2GKIA 1JHLH 5E6RB 2E9IA 1NM9A 4ANKA 2DKSA 4W9DC 3VI3B 4I2XB 1ZTXL 1VIWA 4E2OA 4YDLC 1C8PA 2Y5TA 4QRFA 3D3VB 5TE6H 5IFJB 3BLPX 4N8CH 4YLBA 4YBLC 4B0MM 4UTBH 3HI1A 3ZYJA 5BUPA 2EEXA 2JKSA 2F19L 2PYEB 3P73B 3WLWD 5I1IH 2OW7A 4YHYC 1DUZB 2F5BL 1IGCH 3EYQD 2AQ2A 3EUDA 4ZT1A 3VWJB 3EHBD 2OK0H 4QRRE 4LLVA 1UA3A 5CR8A 2J8OA 4D0BA 3VFNB 5EBMA 4HPYL 4BFIB 2CIKB 1INEH 1GYCA 5D7KE 3QUYA 3U6XA 1I1AD 2XPZA 1X6LA 1P5VB 1AS7A 2WLMA 2RHEA 2BNRE 3NMEA 3C2AH 1WH0A 4Y1AA 4A7SA 4NNPH 1AZZC 5G5DA 1ZXKA 3CDGA 4PLKC 3PWPA 4TRPH 3JXAA 2P8LB 3QJXA 2C1PA 2AC0A 4WKZB 4AI7A 1WISA 1T1XA 4LT7A 1H6EA 4PVLA 3IFLH 3QS3A 1A9BA 3FRUB 3ABKB 3T3PF 1VESA 2GY7B 2IJ0C 4FXGA 3VXUB 1R3LB 2Q86A 4GBXA 5D8JH 3F7YB 4DEPB 5H35A 2VRAA 4JG0L 3T5WA 5I6XB 1L9PA 1JF5A 4JDEB 5IMOB 4HJJH 4UOW1 5JPNA 3SDCC 2R2BB 2OFQA 1ZPUA 2B7DT 1MUJB 3GKWH 3TBYA 5KW9H 2IADA 3FUJA 4PFEA 3UPCA 4JAMB 3QT2A 3QFJA 3JTTA 2ADFL 1JBJA 2HJFB 1IAMA 5EBGA 2AFNA 2GW5A 4NQVA 4W9ZA 1PKQA 3V8OA 1D6EA 1C08A 3NA9L 4XCNA 4IGBC 1ILUA 4KUCD 4LLDA 1MRDL 2MKWA 4NKMA 4TUOA 3HG1A 4KDTC 5ERWA 2JJSA 1MSPA 1KGWA 2H2PD 2WP3O 4OF8A 3SBWA 1ZSDA 4DP8X 2OSWA 1DFXA 3Q8EA 4K73A 4ZSOE 2MNWA 2OKMA 5EO1B 3JUYA 4L0YA 1HDMB 2VXQH 4WI5A 3RAJH 4AQEB 1IAII 2CCVA 1GZHA 5TFSH 4GUCA 3SKJH 3DI3B 2JVUA 5J89A 2AMGA 4JVPA 1WFNA 3CC5A 2FNBA 2Y0SA 1XB3A 1D7DA 5IROD 1UA7A 2R1YA 4JFED 1KTJA 1OL0A 3QEHB 1UM4H 3E7JA 4JPQA 1I9JL 4LSUH 3UPRB 2DPKA 4LARL 2XHNA 1FE8L 3QYNA 1ACYH 4DNLA 3PNRB 1PZDA 3QFJE 3F84A 2WWOA 1XF1A 5D5MA 5FM8A 2WXMA 3GXIA 4GXUN 1PKQE 1G9ML 1XD0A 1YEDA 5K9JL 3BO8B 4M8UA 3EGDB 3INUL 2FIKA 2VH5H 3HG1E 2VL5B 1HEHC 4OF0A 4OQTA 4BWTA 4OLYL 5KG9A 2D9QB 1CZ8L 1JNHB 4DKFL 4F7EB 3VD0A 1F41A 3FTXA 1BFVL 2J8UA 4HCRA 5FW7A 3MBEB 1DSWA 1U8NA 5IIEA 2ZCKH 2HFFA 1G1OA 3EJRA 3WAJA 5DT1L 3VGAB 3OJVC 5D1QA 1KLGA 2NY5H 4CGUB 2VW6A 1HS6A 5GZOA 4PV8A 4F5CA 4UV4L 3BYYA 4P3CH 3HRPA 1FBIL 3WJJA 4L29B 4HOMA 3LEXB 5FA3B 3O2VL 3P2BA 4NQXB 1QSEE 5BPPA 4QXWA 4W6XB 1FHGA 1R34A 2V17L 1BZ7B 1K6QH 5KSAB 3QR1A 1BZ8A 8FABB 3T09A 3GTVA 1ZEAH 5EZIH 2AEIT 3ZW3A 1S7UB 1Y6NR 1OE3A 4G59C 1I1FA 1OO2A 1E28B 2ZSWA 4S0TD 1REIA 4GI6A 4R4FH 1A7QL 4XN4A 5D5ME 3FT2B 3ULVH 1P4UA 2ZWZA 3MLWH 2OMXB 2XKNB 3RDJA 2OPCA 3AWGA 5HDLA 3CU7A 1J8HD 3IPFA 2NY0B 4DP0X 2VDKL 5D2LF 4UQCA 4UZUA 3D39D 2YGVA 1RZJH 5E8EA 2J8UE 5FPIA 5C0ND 3K4DA 2W38A 4XMPH 2WN2A 3CGTA 3L13A 4DJMA 2FR4B 2BMKB 5HHOB 3IKKA 3G5ZB 5DMIL 1MHCB 3TNNB 3ZYZA 3IAQA 1TQUA 4P5TA 4ZODA 2QADB 1Z3GH 5ABDE 4KHTH 2CWRA 3DGDA 5LAXA 1E7UA 3PABA 4F7PB 1G7LA 3DECA 2ZXWB 5DD0H 3B3BA 1Z9PA 2IPKA 4GG6B 1OF2B 3LEVL 2M1KA 1HYRC 2IGFL 2FT7A 3F7PC 3L4XA 3IETB 3WXVH 4D2NA 4B7LA 1BYPA 3MXWL 1UWGH 3ARQA 4HKXA 1MW0A 4DP2X 3MUHL 5JW4Q 1CFQA 2FBJH 1Z1WA 1VENA 4EXPX 4I77H 1B4JH 1DJIA 2QFRA 3CVCA 4AGOA 4DH2A 5IHUL 3OHXA 3ULSA 3Q1EA 5EBWB 3BZ4B 3I6KA 4LCIL 2DQTL 1YEGL 4P2CG 3MFGB 3ULAB 1IEBA 1SEQH 1X7TA 3RA7H 3B5TA 1Q9OA 4LBEB 3STBA 3WTXA 4C56B 2VMEA 4OCNC 4X7EC 2A4EA 3SPHA 4KKQA 3CN4A 1I8AA 2YD1A 3U2SB 4G7YL 3ZGHA 4BH8A 3WV0A 2CRZA 2V9RA 5L4JA 1PKOA 1D9KA 2R1XB 2PWGA 3A4FA 1LWRA 4UAOC 5A2BA 3IJYB 3KPQA 1V5JA 3VA2C 2G2NA 4NNYB 1CWVA 3IDUA 3ESOA 5LBSH 2JE8A 4A6YL 3WEBA 4NUGL 4HC1H 3OM3B 4G9FE 1MW3A 5F9WB 1CLOL 3VGBA 4DETA 3GSXB 4L4TB 2OMTA 4JZNA 4OZGE 4RX4A 3ILDA 2VTFA 3HG0A 3EBAA 2JH2A 4G6JH 1KY7A 2AXWA 4O4YH 4PRPD 5F6HI 4ZMOA 1JIBA 2VM4A 5HYQB 1KZYA 2VDLB 3F12B 4XE0A 2UZIH 1MCFA 4JQVA 3SPVA 3MRHA 3RU8L 5EUOB 4MQXD 1QRND 3WIHH 2F58H 3FO0H 4R7NB 3IDNA 4QNPF 1WT5A 1DBJL 2VXUL 1RZKH 2BSTB 1YEJH 2CDEA 2KBGA 3AG4B 4XNXL 3BVNB 3O11B 3OKLB 3A5VA 5A2CA 2WWKT 3QORD 3O45A 5JORB 4GEIA 1DJWA 3DV6A 3LOWA 1ZGLM 3IDIA 5HTSA 3B83A 4ZOCA 1QLFA 2C9UA 5E6IA 4ZMQA 5C0GB 3VFVA 2BOLA 5CINH 2OMYB 3NBNA 5I1CH 3FTVA 2JJTC 3FUDA 4Z7VF 1KJ3H 4GIOA 2C9VA 2VDLH 4BZ2A 3C60A 2OMUB 2L0DA 2IG2H 2JKLA 4YEFA 4POUB 5IT2H 2WCGA 3NSXA 4OGXL 1HEZA 1LEKA 2NXYC 4G6AC 3I6LE 4FX5A 3UDWC 2I7OA 2C7UB 5I8OH 4OCSH 1V7NL 3OLEA 2JKJA 4WCYH 5CKGA 4Z7WA 4HCRL 3X1NA 5F7LB 4C58B 5I17A 3NCJH 5TDOB 2I9LA 3OGOE 1FORL 2OMNA 4XOCA 4F58H 2C8NA 3QDMD 4TSCH 1KN2L 3GXDA 4KU1A 1IBYA 1WUNT 1N7MH 4KTYA 4LE8A 3FRPB 4XCFH 3HLKA 1QASA 4Y2DA 2XRAL 4WFFD 3GBLA 2OSLB 2O6FA 2IXQA 4JFSA 4QXUH 3ZO9A 2DLEA 2HKFL 1IEHA 1FNHA 1H8OA 1VF5C 4IYKA 4CJ1A 4AJWA 5DS8B 5DO8A 3U46B 2BSCA 3HFML 2JSFA 2QL1A 3B56A 4ZK8A 3JTSA 4Y2LA 3GIZL 2B8OT 3WFEH 3GSNA 3V7MA 4ZUTB 1CDBA 3IWVA 1MXDA 2X40A 1A25A 3FFDB 2IPUG 4Z95L 1ZSHA 2IBZY 1BZQK 2ZXCA 2X1PA 3KMDA 3RRQA 3IM1A 1SOKA 3I9GL 3S37H 5CD3A 2P5PA 4ZUVA 4X5PA 2Q5BA 5AD0B 2R9HD 2X4PA 3IJ7A 5IJKA 2YXVA 1F3DH 3TWYA 5J1AB 5FA4A 1E5BA 4JG1H 4ZPTB 5CF3A 1RURH 1RJYA 3WFBH 5GGQL 5JQ6H 3EBIA 5TH2A 4DN4H 5IEHB 2VZ1A 1P6AB 4PR5A 3WKYA 4X9YA 2PCFB 2B5IB 1HC1A 4AGLA 4AQOA 1L6ZA 4UQEA 4N6RA 1KCVL 4HWBH 4JE4B 3CXFA 4B9CA 1JG9A 1E6OH 2Z7WA 4QTIH 3TEUA 1EV2E 5IMLB 4FRWA 4ZO9A 4IBYA 5I1GH 3RY4A 2Y72A 4OJFH 43CAB 5FF6B 3CFEB 3D9AL 4TN9A 1QBLH 1HHGB 1GW6A 4PJCB 1VFMA 4NQEA 2CE6A 2NXZB 4PVNA 3VWKC 1G5GA 4O2CB 2FQFA 1FL6B 3SPGA 4ZO7A 2N7SA 1ADWA 5CU9A 2R0WH 3QJTB 3CPLA 4FMKA 4PJ5D 3VXPB 4D9RE 3G9VA 3CH8A 1BA9A 1N2RB 1UD6A 5EFIA 2FGZA 1N10A 4OUUB 4BGLA 3D0LA 1PVHA 2B16A 4QHNA 5GRVK 5DD1H 2CPCA 5HJ3B 1TT6A 3L17A 5BZWA 5LDUA 4CADA 1J0YA 1F4WH 1AYOA 2E27H 4NB7A 5KYYA 2QLVB 4DF9A 4H8WC 4A39A 4MXWH 4Z77A 1CGUA 2GUOB 5B3JF 4ZO6A 4EN3D 3F7VB 2K6WA 2SEBA 4R5XA 3FU5A 2R0LH 3H4HA 2ERJB 3WMQA 2LT9A 5IQ9A 1XGRA 2Q8AL 2DMGA 1XGYL 2BERA 2XZZA 4OIIL 4PG9B 1UGNA 3T3ME 2GJJA 4KK9D 4G42B 4MBOA 5E1AA 5SX5K 3GINA 1KF9B 3FFCD 1UXSA 4PSPA 2CLZA 4CW1B 2CSPA 2DEXX 3GNML 5JW5A 1QLRB 3MRMA 4LLQB 3H8NA 4DP7X 4X4MA 1RHFA 3OKOA 3SDCA 4KJWC 4ETQA 2GIMA 3TZVB 2ZUVA 1C5DA 1U8LB 4PJ8C 1IKFH 1AJ7L 1LNUB 1UKQA 3KD4A 3KYOA 5ACZB 2AQSA 4CVZA 1BQRA 5GSRA 3WFZA 3Q9QA 4DQAA 1DQJA 4A1RA 1MHEA 5EEZA 2NQ3A 3A21A 2JF1A 3H9HA 3OZ9H 4JHWL 1KPRA 4IGBA 1Z7JA 2K6YA 1FAIL 2Y1ZA 1JF6A 3IDXH 4KDTA 2G4GA 3QJHB 1N68A 1R3HA 4S10A 2BCKA 1NLBH 4PWGA 3MBWB 3G5XB 4Y19E 1YEKL 5TPWH 3V95A 1ZA6A 3U83A 5JDSA 4UAHA 4Y4HD 1GKEA 4P5RA 5BRQA 4GP8B 4KGLA 8PAZA 5C0BB 5KJRH 3GBEA 1JJUA 2AK4D 2Y06H 2H9GA 4TTGA 1EDHA 2UYLB 1ETJA 3U6RA 2NUPB 1YECH 2NZ9C 5FS5A 3F8UB 3PWJA 3SN6N 4GFTB 4ZRGA 1QD0A 2QR0A 3FPXA 1K85A 3KL3A 2W0PA 1HI6B 5LHDA 4AKOA 1EEUA 4FQ1L 3FQTA 3LQMA 4HQQH 4IRSB 1J11A 3NFNB 2OCFD 4R0LC 2JKNA 7FABH 3MV01 4OCYL 4TL4A 3K72A 4IW4C 2NY4D 4PN6A 5EA0L 2ZAGA 4OJEH 4WFGE 1AZBA 4DVBB 2YMXL 3D09A 4TQEL 1NCAH 2WXNA 3QI9B 3MROB 4YDVA 4MWFA 1K72A 2ITCB 1MIEH 2F53D 3PIQA 3VI3F 1P6WA 1S7SA 2D9CA 5FGCE 3H1ZA 1PDKB 5C09A 1QA9A 2NNAA 4IDJL 3LZLA 3GSNL 4EXKA 3BPNC 5FGBC 3BDYL 3QA3A 1OGSA 3FFOA 4IKKA 4O2FA 5F0MB 4BDVB 2DQEL 5F3HB 1PF3A 3S4SB 4Q56A 1I31A 2HLAB 4WAFA 2HJKB 3Q8FA 3KCPB 1PY9A 1YNTF 4PG2C 1F11B 1SGKA 4WI0A 3PHOA 5D1XA 5EZLA 1IAKB 3NZHH 2QV2A 3BKCL 5I6LA 3D34A 1NFDF 1MRFL 3WL9B 3EJSA 2EDTA 2D3JA 1KJ2B 3KGSA 5ECGA 2P26A 3LH2H 3O6FD 1SXCA 5ENWA 1KBBA 4K4KA 1R4XA 3MXVH 4NOFA 2E4FA 3GIVB 5B7MA 2Q2EB 2RQ8A 3FJTA 3BRDA 1NL0L 1WBYB 1UJTA 1KNOA 1L0YA 5C09E 2NTFA 5FYKE 1Q90A 4GKNB 5T1LA 5BMFL 5ID0B 5IJCC 1D5RA 3A4DA 1BMGA 5D1ZB 2WSDA 5GGUB 3VYOA 1I8MA 3CDZA 3AACA 5HDRA 1E65A 3RFZB 3LN5B 4FD0A 2X88A 3O4OB 4KJYB 4Y4KC 4P5MA 1NJ9A 3B2UD 4PV9A 5D1XE 3OLDA 3ZSSA 1X7SA 3U0PB 4GAYA 3UBHA 3MJ8A 2X2JA 3X11B 1MFEH 3GSOA 3R0MA 4AGMA 4KVNH 2LU5A 4CVXA 1LEGA 3CZFB 3PYCA 2CM5A 5HHME 4EI6B 1CYXA 2OJEA 2AAAA 3DMMC 4OZHB 1YY9D 1S7RA 3NA4A 4H88L 2XZAL 4Z0BL 5FLUA 5SWZE 3UZQB 1AY1H 4APXA 3O4LA 4P9ML 1CICD 3T2OA 2EDHA 4JM2F 2B59B 4ZD3H 5F9JB 1LL1A 2EVFA 1MIML 3AREC 4ODHL 4WENB 5DJ2B 4NO0D 4F8QA 2NY3D 1UXLA 4WF7A 4GT7A 4J23A 1ZS8A 4KKAC 3L3HA 5L2JA 1GSMA 1PAZA 4DGIH 1M7IB 2HT3D 3NCMA 3DX9B 4JFEB 3RX7A 4BYHA 1AKJA 2CJUL 5DZLA 2YC1A 1J1PH 4JK0D 4N0CC 4ONHB 1CE1L 5F89A 3IGKA 3QUZC 1UFUA 2DQJH 3US1A 3VXSE 3QIWC 3FUFA 4G8IA 4RESB 3NAAH 4P46C 4TXVB 4GAAA 4IDLA 4PJ7E 3KXFB 4WKXA 4HD5A 4NCC1 1LDSA 2B0SL 5I6PA 3QUXC 3ULVF 2WSPA 5FDWB 4ZX4A 1TQSA 2IBBA 1BWWA 3M1BB 4ZFZB 4LFHD 4CKQA 1GC1L 3O4LE 2ISDA 3FQRB 1HINL 4JO2L 2YMOA 3H55A 4AW4A 4EUPG 2LW3A 3FSVA 1UB6A 5BZZA 4Y16B 2LVEA 1JZDC 4X98B 2FYYB 3MNWB 4LNRB 3ATBA 1NLDH 3TWCL 1N64L 2IFFL 3RPIA 4LAJH 4D3CL 5I0YA 3HIZA 1M9WA 2PABA 4WWKC 3UBXA 4B6ZA 5I6NA 3QXDA 5INCA 2KZKA 2GFBB 3RWIB 1SLVA 5LGKA 5JIQA 2C1OB 4ZYKB 5BXFA 2CBQA 2I32A 2X89D 4FNSA 5EV7A 4XCCH 1JXGA 1YMMB 3ULUD 5I1DA 1BBDL 4P2QE 4KH9A 3LY6A 4Z7NB 1USZA 3AABA 4P2RD 3QW9A 4N0FA 1UB5B 1LO0H 4MB1A 4MSWB 1K4DA 4YXHH 5HDQH 4LO9A 3UDWA 5G4NA 4XPTH 5E94B 4LZKA 3M8OL 3DGGB 5FYKL 4MXQD 5FOBB 3CHOA 2WTRA 3R18A 4NKOB 3OKMB 1ZLWH 2BXZA 3FCBA 3H9YA 3WUZA 3MV7D 3WD5L 2NY2D 3CFBB 4PP1C 4QCIB 2KLRA 3LNFA 1QHQA 1MCJA 3X12A 1U8KA 3KYAA 4AJ0A 3VSQA 1EHKB 4WNSA 3T6WA 5C0AB 5IV2B 3QNYB 1VSCA 4GG6F 1DUYB 2DWEB 4M8VA 2CBTA 1RUKL 2DEWX 4WO4D 4KKCC 4F92B 3C8DA 1N4XL 2VC2L 4IMLB 3RWHB 4HDIA 3ILEA 4MVBC 5CP3H 3OSVA 5IB3A 5E2VL 1WFJA 3NIDB 3QQNA 1V3MA 2A6DA 1WZ1H 3WELA 4EKXA 5KTEH 2ARJQ 1FZJB 1BJ1H 2ZIDA 1II4E 1LE5B 1A14H 1KGCD 2PR9A 5F9OL 4BELD 5BJTB 4K2UH 1RMFH 4GKLA 1HQ4B 2W8CA 4N6QA 3RGVC 1BQUA 2D2OA 3JV6A 3E9UA 4YWGH 4DQOH 4JFXA 4JJ5B 4LHJB 3VXOB 5CWSB 4ORGB 1I7RB 1U4FA 4LQFH 3BHBA 3FT3A 2IANE 4KQ4H 3N2JA 5AFAA 1URLA 4IJ3C 4FCAA 3VH8A 3EYVB 3C12A 4QRPD 4MCYA 1MI5D 2WXFA 4TUUA 3EOTL 1OP5H 3UO1H 2W0KA 2XTLA 5I15H 4OF6A 5D1ZI 3RUGA 4N90E 2LQRA 1HL8A 1D5IL 1R3KB 1CCZA 2QTEA 3B7YA 2DQUH 4GPVA 4ZUSB 2EDFA 3MACL 4L4VA 3UOAB 4JPWH 1DEEA 4WUKL 5C2BL 5D4JA 1GS8A 4Y2OB 2XSKA 3Q8CA 4F2FA 2MOGA 2WGXA 1LO2L 2XFXB 4GW1B 1I7UA 1K5NB 3CFCL 4X7TB 3EYSH 5ELIA 2E7HA 2OL3A 1KYUA 4NZTH 3VWKA 4CC0A 5E1GA 3ZL1A 1RFDH 2IMMA 3FTZA 1J9CT 3LQZA 12E8L 3QCUH 1JI2A 4LHUD 4J4PC 4WHYG 2CO6B 4Y4FC 5AYUL 1HHHA 3MJ6A 1JRHL 3ECBA 4YK4C 3QPXH 1KTLA 4EIZC 1RIUL 4J3UA 5IFHH 3F85A 4RFEA 4MAUH 5IB2A 4HIIA 2APVA 3RDTC 4PLJD 2JKXA 4TSBH 1KFAL 2H26B 5E7BA 3RUGE 3SOTA 4MJJA 4HJ0D 5T3XE 1WCBA 2AEPL 4QOKA 3F5WA 3GSUB 2DKMA 1FO0B 2Z8WC 3HUJA 4AMKH 3FB6B 3QXTA 1FGNL 1GYWA 2HH0L 2QGEA 2VDML 4HSCX 4NKDA 5GRUH 1U95B 4AM0Q 4HT1H 1JZ2A 4FG6C 1OARH 4WSKA 2CUIA 2PMZA 3JWNC 2CK0H 3ESPA 2AMUA 5IHZA 1N12A 2BP5M 3M7OA 5CEYA 1KYFA 4WDIB 5JLZB 4NI3A 3V0DA 4DGYL 2NX5D 4PJ8A 1BLNB 4TNEA 3N6YA 1E9OA 1J8SA 4PY7B 3ZE1B 4XPAL 5E2UH 2XN9A 1E7VA 3DOSA 2YSSB 3ECVA 1FO0H 2QQNL 1NWPA 4GUPA 1L9NA 2YD5A 5MEPA 4XP5L 1S78C 5CLWA 3PGCB 4M5ZL 2WB7A 3B9DA 2MNUA 1G6VK 3O0RH 2DZEA 1TFHA 2WLLB 3MTRA 2IBGA 4LSTH 1M42A 5DS1A 2WQXA 2BP0B 2IWGA 4MDRA 1CE6B 3HUJE 1KTDA 4U1MB 5EC1A 1A1OB 1BX2B 2NUTB 2XZCH 1I8LA 5F96L 4JFPA 2K3HA 5I1EH 5ICYB 3O8XD 1YEEH 1T6WA 2WLIA 3KLAA 4N87A 1L4IA 3ARZA 4OLEA 2X4SB 2Y2TA 3C2SA 1OV8A 3KPRB 4HUKB 2CALA 2YEZB 4Z18A 3UTTA 3Q06A 3LRSA 1VZIA 2CBPA 4R0LA 3SE9H 1CDHA 4EJ1C 1DSYA 1T7XA 2VXTL 5IF0B 1XFPA 3VI4F 1PZBA 1UJ3A 3ARSA 3TJHD 2F08A 2H8PA 4S11A 5FB8A 1MFDL 1UZ6E 2XN9E 3EDJA 4XZUB 2WQAA 4W9FC 5D7LA 5DMYA 2JTYA 5B38B 5E24E 5KSBA 4X9BA 3V2AR 4BKLB 5E8DH 4FG2A 3DO7B 4P07A 3NCEB 4D7PA 1SXSA 3RB7A 4IS6B 2UY6A 1FL5A 3VSVA 3BKMH 5T3ZL 1T21B 1HX0A 3L4CA 1QWUA 3FUNA 2IDCA 1OK0A 2Y23A 1JGUH 3EOAA 1KPVB 2OYLA 1DQDL 3GJFA 5FGBA 5LBVA 3CXHK 2NSMA 1Q0YL 3UTSA 1ZK9A 1ES0A 1E8WA 3WIIH 4UT9H 4RDBA 4AQ1B 1T1WB 1JF1A 5DI8B 2EDXA 3UTQA 1FZMB 1KJMB 3RIAK 3O9WC 3V5KB 3X1FA 1FNAA 4R5VA 1SYSB 3E0GA 3BH9A 5IJVB 3NSJA 4R7DA 5A2IH 3SBQA 4F2ME 2LABA 4M6OH 2CDGA 3LNHA 3MFFB 1ITCA 1BD2A 1CYGA 4H1LB 1I1YA 5FO9B 4DHLA 4FA7B 1KELL 3FOMA 1Y18A 2AJXL 2P80D 3RIKA 1XTMA 4FEIA 1ODAA 1PS3A 1KOAA 1Z9SB 1C12A 4HAGA 4QR7A 3UBFA 3IMWA 2DQIL 3E2HC 1VRSA 5T3XL 2Q7YA 1EMTL 1I3RA 5B1KA 3WHXA 5DJ6B 5CAYB 5E00A 2ZE0A 5IQ7L 4JB9L 3BKYH 4TUJB 2QGCA 4U1GC 5E0FA 3WO4C 5KVEE 5E08L 1TTAA 3KPMA 1F02I 4XHJC 5I0XA 5EOCL 1T0NA 5F1SA 1BW8A 1HYSD 3OZKA 2OL3L 2ZCZA 3BEWB 3HNVH 5EWIL 1J0HA 5I1LB 4JLRB 1R9FA 4NRXA 4AL8H 4RFOH 4PTTA 2O72A 2PTTA 4JFYB 3KPSB 1MJJB 3EZ8A 1J05B 4H1LH 3CQQA 4Y4KA 3FFCB 3GUTA 1FHNA 4K0OA 1ID5I 2V7NA 4ELKB 1NC4A 3RWDB 4LVNB 4PY8J 3AADB 2WNXA 4Y9EA 5JA8B 3HC4L 1DQTA 1BD2E 4M29A 2VLJD 4QY8A 2E6PA 4ADGA 2BSBA 2FHFA 2EUWA 4KNQA 5IJBC 4K7FA 4UQ3B 5EBLB 4N26A 3DMMA 4JFOA 5MP6L 4H7VA 2WZPD 3QQXA 1RXLA 4YC2C 3K2KA 3BUDA 5E6UB 5LDSA 3VSTA 2MOQA 3HMXH 1ASOA 1CTOA 3CDYA 3EO0A 1VGEL 5F1NB 3ZMNA 3ZZQA 1M56B 3AREA 2VN4A 1DJGA 4N8VG 3EYFA 2D8KA 4ZMZA 1OT1A 5D7IF 1RUAL 4P2OB 4JQIA 3APMA 3P3TA 4OI7A 1OF0A 1P4LA 4M6NL 1USQA 2I5YH 2W65B 3HAEG 3EBHA 4GSDH 5C0IA 4F80A 2FX9L 2CPUA 3QUZA 4XMLH 3H3PL 1D5BB 2YMTA 4QRAA 3VWJC 1CFBA 4U2YA 3QIWA 3CPUA 3OB0H 4WIQA 4Z3JA 4GKZB 2ADIB 3STLB 4G6MH 1OTTC 4P46A 3LHAA 3ESNA 3FQ2A 1NIFA 4IRZH 2OJ1A 3BAIA 5KVFL 4NP9A 3ZYOA 5A43C 4RIRA 4KKRA 2F53B 3QO0B 1WAEA 3ENEA 3IYLW 2WBJD 4YHPA 4ZUWB 4ELME 4N86A 3ZX1A 4OZFG 3HZVA 3M17A 4QRTB 2AV7B 1NGZA 2WP3T 2X6UA 4ZTOL 1CS6A 3BAKA 3K6NA 1VERA 2J44A 3LEYL 3QS2A 1A4BA 4Q9RH 3O6MH 5DF0A 4K94L 5HP5A 1JPFA 4XNDA 2XYCA 3HB3D 5D2LA 3RURA 3VFTB 1AFVL 2EYRA 3UZEC 4JZJA 2G0LA 4LCWB 1K8IB 5FCSH 5AW0B 3WMPA 4DP5X 4WWKA 4JN2A 3V6FA 4DEPC 1BVZA 4NDMB 1DCEA 3VXQB 1S7WB 4YX2H 4HWZA 5I6XC 2FEEL 1WS7A 4O5LH 1GL4B 1DQLL 4OGAD 4Q9CA 5EU3A 3DJRA 5HI4C 4URKA 2EO7A 2HZHA 3TM6A 5CEZD 3L3GA 4QRRD 3O6FB 2CUMA 4KQ0A 3RJOA 4D9LL 4LCYA 4AEIL 3MV8E 4EO5A 2P5WD 5CBEA 4QXTB 1E4HA 2CCLA 2VLLB 4FZEH 1XCTA 2NYYC 1AP2A 4JHAL 1WZMA 4XVJL 2X6AA 5E6SB 3VG0L 4ACPA 4DSYA 1QYGH 3PL6B 1WVZA 1SEBA 3TYGH 5KVEL 2FO4B 4CC1A 3FUHA 2JK5B 1GIGH 5A16B 3ZPDA 3ARTA 1NKGA 3L95B 5I9QB 3H42L 1G9NH 1BVNP 1IGMH 3LKOA 5BRPA 3GHBL 5GRXG 5DURD 1S9KC 3DK0A 4JM2C 3BPLB 3UPAA 2A1WH 5HI5D 1O9WA 3BAYA 4M43H 4CILA 1DVFD 1YMHB 2V2WB 3NFPB 4PJIE 2VDNL 4UQ2B 1J9TA 4KROD 1JWSB 3ASOB 3H9SD 4R97B 3FN0H 2NY5C 4TL5A 4NQDA 3S5YA 3LYRA 1AQKL 1UUSA 3L08A 4FFZA 4JO1L 3TESA 4KUCF 1F97A 3MRJB 2VRQA 1MHPL 1WQVT 1XIWC 1OLZA 1YJDL 2F74B 2HLFD 1SHMA 3P77B 3RVXD 3N1FC 4J3TA 1T1ZB 4AY0A 2GJ6A 1CFNA 3E6HA 3QE5A 1FI8C 4OCRH 5BUGA 3II3A 1M7DA 1PZ5B 4OD3L 5F0LB 4F7TB 4NRYA 1CICB 5JHBA 3RGVA 3CSTA 2HKHL 3FB5B 4MDJB 3ULVC 5TE7H 2NY3B 4MJ2A 3OR7B 4CL7A 3HG5A 4LCCC 5D96C 1FIEA 3IDGB 4PB0H 3WFCH 1U41A 1KJVB 4V2BA 4Q9BA 2NSQA 2VABB 1MEXH 1RZJC 3AG2B 4AT6A 3EDKA 2DJUA 1N67A 4Z1PA 2BVPA 4G8EA 4E5XA 3RWFA 4P57B 5DZNA 3GYRA 4LSVL 4TNGA 3VXNA 2LOEA 1LGVA 5TGBA 1JYWA 3SZ6A 4NQDE 4KI1A 3PWUB 3A23A 4B9PA 3BLBA 2WXLA 4MFHA 1B0RB 1A6AA 2WKGA 3U0TA 3ZDXF 2V5YA 4KFZC 4H13C 4KHXH 4LKXB 4EDXA 3IN0A 5TDPB 2DL2A 4Z7VA 5IMMB 3U6XS 2VDOB 3D07A 3P1VA 2EKSA 5I18L 3WGUB 4J4PA 3BP4B 1BQSA 2NTSP 4Y4FA 3QQ9C 1AHWC 2PWDA 4TM9A 1Q4NX 3CZLA 5FXCH 4LPCA 1H3UA 3V52L 5AVQB 2YQ3A 4QHUB 1A6PA 1L5GA 1U8PA 5CGTA 1FF5A 3Q3GA 5MENE 1MF2H 3BP7B 4FXTA 1AR1C 4OZIE 4YXLH 4JQIL 1QO3A 4L0PB 3NN8A 3SDXB 4RWYH 3AB0C 3QHZH 3R4RA 1TETH 5JHDE 4KZEH 2ODHA 3QRLA 2A9NH 2QADC 1SJMA 3ZKQD 4QNPE 3H53A 2VGLM 5SWQB 1BMWA 4JY6A 3GMMB 3QQ3B 4RCAA 3VXRE 3DK2A 2HTLD 3DSFH 4JKPL 1Z5LA 4PGDA 1QSED 3EO9L 4Z7NF 3MYJB 4ANXA 4MD5B 1VFAB 4MA3A 2VDOH 3UTZB 3LIZL 2Y3AA 1BZOA 2AJVH 2J1XA 1G6RA 2CDFB 4OAWA 4WO0A 3QYCA 5EO9A 3ZDZE 5J6GA 2V2XA 3ARRA 3KDPB 5EORL 3SB3A 4B50A 1BVLA 1HCVA 3MCLL 1F90L 3KYKL 1KYAA 3CLEH 1YEIL 5E7FA 4N0UA 1FC1A 5E8NB 4MJ6B 4B96A 1GCFA 4GXFA 2CXKA 5KANG 3AVEA 1DCLA 1NEUA 1Q9LB 4N5ED 4CU6A 2BPBA 5FKPA 3MV7B 1H15A 2NY2B 3IXTB 4MX7B 1KYDA 1MREH 5GZNA 1UWEH 4XVSL 1L3WA 4BFFA 25C8H 4ZPVA 4UM9B 1TJMA 3FB8B 4X6EB 1NKRA 5IB5A 5I8KL 3ULUH 3PJSB 1ZHKA 1GAFL 3CSGA 3QNXA 3DDGA 2YBRB 4C4KT 2F68X 5JO5A 1L9MA 2P8PA 3NIDF 1SJEA 5GZOD 5D2NB 1RZKC 3OKDB 1CD1B 1NUFA 2ZJSL 4HJTA 4PYHA 3TT3L 2R4SH 3BD3A 5F9WC 2BHUA 2J21A 1IX2A 2VWEC 4LASL 3B9KD 1ZDSA 4YL9A 2AJ3B 3MRNB 2DD8H 1DZ0A 3L16A 3TVMD 4LCUA 4WU5B 5JOEA 2XIIA 4M02A 4XMVA 4N0UE 4BJLA 1KXVC 5JOFB 5LB1A 3U2JA 1LE9A 5C3TA 1C5CH 3O3UN 3ECQA 3VFPB 3UTPE 2ZKWA 3U4AA 1N3NA 4Q4EA 4NCDA 1J0JA 4LLWB 3RGHA 2EIBA 4TV3A 3NZUA 4QRPB 2GYSA 3JWOH 4XCYA 1CF8H 4NPYA 1GH7A 1S7VB 2WZ5A 2BVEA 2AP2A 4JY5L 3IJHB 3OF6D 1UYWL 4FZ8L 3CFUA 5JW3L 1IKNC 4XOEA 2N7AA 4HWUA 5DVNA 1NPJA 2GJZA 3UC0L 3R19A 4HMDA 2WNKA 1I8IA 1MJ7L 3FCGA 2CIIB 2AI0H 3P9WB 4FFZL 4LRNH 5GSVA 1P4IH 3L9YA 2PP9A 1QR1A 5I75B 4UBDD 5FR3A 2WQRA 5DQJA 2O5ZL 2EDBA 4ZTPH 5TQ0L 1RVFL 2AAVA 3HNTL 2CCWA 3HG3A 4PMEA 5FM4A 1WPCA 4G9FD 3VW3L 2GTZA 1A7NH 3RLSA 5IW1B 2X5PA 4AYFA 4G3YL 4LHUB 1QP1A 2BNQB 4PS4H 2H2SD 3O9WA 4PRIB 3KJ6H 4WWOA 4CN6A 5L6YH 2BJML 3ZKXB 5HDBE 2CK2A 2LAAA 4B95C 2FH6A 1WICA 2F1BA 4PJGE 2CNZA 1TNMA 3FU9A 1QW9A 3F58L 2NDGA 2XXFA 4HBQA 2DYPB 2J2ZA 1FLTX 4YIQB 2V7HB 4BHUI 3V4PB 3ZKMD 4ZZKA 3X13A 2P49B 3FCTB 3BWUF 4G43A 5I26A 2RCSH 2X4RB 3QDGE 4WVRA 4YDIH 2YS4A 5ISZA 1G94A 1ZLWK 1WLHA 3PWLB 4FLOA 4D0DB 5DRZA 4FQLL 4GQ9L 3HE7B 4PLNC 2H45A 1YC7A 2QBWA 3HC0B 5EOCJ 1DBMH 2AK1L 2KERA 4JFTA 3D4GA 5ESQA 4J3WA 1NWOA 1IC7H 3MRCA 3MCYA 3S35X 3D33A 4I5BA 2EH7H 4U6YB 4BE5A 5C0CA 4M5YH 2XV0A 2X7LA 3DXAA 3L48A 3F00A 4TTDC 3LVTA 4W9CC 3OLIA 5ESVA 5BS0D 4PJAE 2J5LC 3TF4A 2XWJA 3ZE1F 2HWZL 1JGEB 3KPNB 3NFSH 2IWEA 2NX5B 2HX7A 4N20A 4ONGH 3AM8C 4JFFB 4QKTA 5CGYD 2WY3B 2Z8VC 4XBEL 5J9PA 4UTBA 1HIML 5D6CA 2ALAA 1MW2A 1J8RA 1KN4H 3CZGA 4AOFA 5T1MA 2DH3A 1VEOA 3DSNA 5AG8A 1UM5L 1BQKA 1DANT 1M1XB 3ZZ1A 3QJSB 3QBTB 2B5IC 1S5HB 2WQVA 1G87A 2YGPA 1MAML 4J8RB 1X5ZA 4MJIB 1CGTA 1PG7L 5TTRA 1R0AH 1XR8A 2C3XA 4M48H 5HY9A 5TE4H 4JO5A 4NXKA 5CGBA 1QBBA 4I2XA 5CCKL 3EXLA 4A7GF 2OMVA 2F5AH 3AQZA 1OP5K 4OLWH 5TDNB 5DUPH 3GB7A 3PP4L 3D3VA 2NXZC 3PAYA 4FLHA 3ARBD 3P4MA 1E67A 5C0CE 1Y6KR 2JIXB 2PYEA 5CIPB 2ORBH 3DXAE 1A6TA 1TTRA 3HE6D 1IL1B 1TYRA 4XP6H 4NP4L 1ZIAA 3CFDB 4YNYA 2CLVA 4YGVB 1YNTA 2QKSA 4H8UA 1ZLSH 3R8QA 4BFIA 5B21A 3MKKA 3RYMA 2XIBA 4GH7B 4WGWB 1IU1A 1NFDA 4L1TA 3K4ZA 2CZNA 1N6QL 1IB5A 4N0YH 1S8DB 1ZHLB 5FHBL 4X80L 1MJ8L 2XUWA 4MMYA 4TQIA 3IB4A 3U9UB 1KB5B 3K91A 43C9A 3ROLB 2GK0B 5F7DB 2VDRL 3H54A 2MTAA 2XOTA 2ERJC 2F6AA 5CIPH 1U3HA 2F1EA 4PVBA 4IRJB 3SDAB 2Z8SA 4QO1B 1GGBL 1MAJA 5G2NA 5ITFB 4YHLL 5BQ7B 4U4IA 2A7BA 1HHKB 2C3HA 3BPCB 3F04A 2YN3A 4V1DB 3DX8A 1R3LA 1FV1A 1KC5H 1K5WA 3GMPB 2YUVA 2YR3A 1DBAL 1TQBB 2A2QT 2VXQA 4PYGA 5F97E 1A9VA 2KPNA 2AGJL 4JDEA