2ZPKH

Crystal structure of p20.1 fab fragment in complex with its antigen peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
EIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGWINTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREGPGFVYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG1-lambda P20.1 Fab (light chain)
publication title Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification
pubmed doi rcsb
total genus 44
structure length 208
sequence length 216
chains with identical sequence I
ec nomenclature
pdb deposition date 2008-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH02
1EVTC 4WI3A 3WS3A 4LRIC 2Z93B 3FO2B 1KJ2B 4JM2F 4D9RD 4XCCL 5DRWA 4ZUSB 5FHAH 4NWUH 1BWWA 5CP3H 1FSKC 2VXTL 4HX1A 4LMQI 1IGYA 3RFZC 3QUXB 2OR9L 1KPRA 2NYYC 4R96B 4JDZB 5FUOH 4NKOA 3QI9A 3G6AB 4E41B 4XAWH 3TC9A 4MCZA 1PG7L 2DBLH 5D7LE 1MWAB 3BVNB 5FYJE 4S10A 1T7XA 1R3JA 2D7TL 3GO1L 3MRDB 5IV2A 3VXSA 2RFXB 2P8LA 4MD0B 3BD5A 4LRNH 4GG6A 2PO6D 5EG6C 1I1YB 5ICZA 1KCSL 4ZAKC 5T3XH 4OZHE 1MI5D 2H2PC 4P4KD 3LEYH 2DQJH 2BRRH 1DEEA 4DKAA 4RFNC 1RZKL 2E27H 3FKUS 4M61B 1KGCD 3CCHB 5ITBH 4OGAC 1JWMA 3PQYE 4X9IA 1P4IL 4PG9A 1S5IL 1DBMH 5GISH 3RUGE 1HSAA 2ZSVA 4DGYL 2UVFA 1UWXK 1AO7D 3MV8B 3IDYB 3T09A 1GSMA 2OI9B 3FT3A 1E4XH 3HFMH 4X8JB 5F9WC 4ELKA 2OQJA 2VLKD 2R56H 1NCDL 3V6FA 2HT3D 3UC0L 4ZODA 3NABL 4TTDC 1ZE3C 2PYFA 5GS0H 2O61A 2XXCB 2BY0A 1QSVA 4KHTL 3V52L 4DKFL 3C5SB 3MRJA 5C0CE 4Z6AT 1F4WL 1A7BA 4UT7H 2A83A 4L3CA 3TH2T 4I18B 4OM0H 3RRQA 5IHUL 5HVGB 2FHFA 1JV5B 3X17A 4JGMA 1CL7I 4E41A 1MCKA 4WHDA 2VL5A 3U48A 1T4KA 3WFHA 1MWAA 1LO4L 1I4FA 1UJTA 3BOVA 2FHBA 2RFXA 2VOTA 3F62A 3AGVA 3HE6A 5JDJA 4HIXL 1GAFL 4FQLL 5F9AC 1YN7B 4RGND 4OZGB 2WINA 3MRQB 5CEYA 1QSEA 1UM6H 1YMMB 5C0AB 2IFFH 1TTGA 1QR4A 5B8CB 1NFDF 4JFZH 3TT1H 3WSQL 3NZHH 1HWGB 1L7IH 5GGRB 1EVUA 2Q7NA 2IF7A 1J8HB 3BP6B 5DJ2B 3SCMD 2RHEA 3AROA 1E6JL 4OD3H 4HK0B 3RY5A 2EE3A 4QO1A 5TDPB 4TULH 5KVGH 1IAMA 2DQTL 3FTGB 3B5HA 1RUML 5AZEH 4X4MA 2I9LB 3MRGA 1GGYA 3V2AR 3VH8A 2ZCHH 4RZCB 1YUHB 4NJ9H 5AD0A 2HH0H 3RVTD 3RKDD 2XPGA 3PWPE 4H8WL 3TNNA 2FECL 3WUWB 2XNAB 1YMHB 4IRJD 5I15L 1QSZA 4NQTA 3M1BB 4NQCA 3DWTA 5F96L 1Z2KA 1OGAD 3O45A 5E1AB 2DN7A 1QBMH 2QADC 2M2DA 1QZ1A 4PJIB 4J2XA 3H9YA 5HD8D 1NC4A 3MUJA 1MCQA 1GXEA 2W0FA 5H37G 2IH3A 4OKVA 4PJGB 3DI3B 4R4BB 3WXVH 2ZUUA 3VFRB 4J3TA 1RIUH 1UKQA 5GSVB 4X7TA 3K8KA 5LGHH 3SE9L 1UWEH 5HBBA 1ZT4A 5IESL 4H8WC 5C0EA 1VEMA 1IKFL 1UCBH 2EDLA 4LVEA 3MRKA 5DHYA 4LSQL 5HHOB 3MXVL 2AXFB 2X6MA 4ZUVA 2E7LA 4P5TC 4QF1A 2LTQB 3QR2A 1JK8B 3RWJB 1YEHL 4WFGD 3X3FL 3DMMD 3MV9E 1JZ6A 3MLWL 3I3DA 5K33A 5FUZL 5EO9A 3MUGA 5DURD 1AKJB 4RNRB 2X70B 4Y5VA 4P48A 2BZDA 3KXFB 3MO1B 3SE4A 3BGFB 4JO1H 1RUQH 4NC1C 3WXWH 2I25N 4RZCA 5ISZE 1Z3GL 5IVNA 3CU1A 2XQBH 4FXGA 1S9WB 1BVKA 2QSCH 5ADOH 5C0JA 5GRJL 4IMKA 3W82A 1LK3H 2GQHA 4ELMA 1NCBH 4I3GA 5JIIA 1S7SA 4YDIL 2XZQH 3INUH 4TNWF 4N5UA 2AP2A 4G6KH 4MB3A 3BN9D 4UILH 1X5HA 3QEQB 4M6MH 1LDSA 1IAIL 3L3KA 1MJJB 3ILPB 1ND0B 4PJGA 3OKOA 1CZ8L 3ARTA 3LD8B 4Y16B 2C1OB 5KJRH 1LP9B 3QQ9C 4JFEE 4JZJB 3OAUL 1B6UA 2VAJA 1F5WA 3DRQB 4MJIB 3TJEH 2PW2B 3U4BL 4WWKD 1OY3B 4QRRB 4QRQB 1I9IL 5I30H 1V05A 2Y07L 2BK8A 5TF1H 4FQXA 1L7TH 3VRIB 5JQ6H 5KN5A 1JRHI 2FJFB 1U3HB 4PB9L 2BOBA 4KUZH 4RISH 4ERSH 1ZT1A 4U3HA 1IL1B 3EO1A 5T5FL 5F70A 4P99A 3CZFB 1RURH 3PGCA 3VXME 3WFBH 3KXFA 1QSFE 3D87B 2VDQH 5A2JH 5LKNA 4DK6A 3O11B 1ORSB 4LSDA 3T0ED 2DL2A 3KPLA 4FQJH 5IMKB 5EOTA 3FMGL 4HD9A 2NXZB 2QQLH 3BPOB 2DKMA 4GFTB 3UPCA 2W9EL 5AYUH 3TIEB 4ZSOB 5FO8B 1KTDB 1JUFA 3RWEA 2MQ3A 3V6ZB 1JZ3A 1HYSD 4OF0A 1NBQA 4PP2B 2QSVA 4UTBH 1XCTB 4Z0XA 5FKAB 1QRNB 3DVNA 4P3WA 4K7FB 1WWAX 3DTXA 3QDMA 4LHUD 5DJYB 2QQKH 3KPRD 3PGDA 2OP4H 3RKPA 4U2ZA 1LP9A 3K81A 4PBXA 3EFDH 4XHQA 3VXRA 1G7MA 4WEBH 5GRVK 5IUSA 1EX0A 4LVOC 2BNRE 1OAKH 2V5SA 1K4DA 1AHWA 1KTKE 1JHLH 1U8IB 1A7NL 3CDCA 5D6CA 1C5BL 4R7DB 3VRIA 4D9RE 4Z0BH 4HPYH 2VE6A 3ARDA 5A2LH 1JPSL 1P1ZA 3VRLF 2BNQB 3SKOA 1MVUB 3KYNA 4YZFF 3GB7B 4QNPF 3QXAB 1I7TA 1Y18A 1IL1A 4DKEH 2DQEL 4AG4L 5CINH 2EDKA 3IXAB 1TXKA 4YR6A 5I16A 3CVIH 4X6EB 1TVDA 3QI9D 2YK1H 3OXSA 1CCZA 4U1KB 3F5WA 4OSUH 3QNYB 3QSKB 4IIQC 4ZOCA 5ACMA 4KJPD 3W5NA 4HBQA 3MOQA 5IFHH 2NXYC 4U1SB 5FGCE 5IFJA 4JFHD 1PSKL 3VWKB 3WUZA 1W72A 3ARUA 2XRAH 4LKCA 5E6IB 1R0AH 4K94H 1MI5E 1KTDA 4WEMB 3MTRA 3V6ZA 4NZUL 1N6QH 4F57H 1SMOA 4F37K 5GGVY 2CJUH 5FKAA 4YXLL 1QRNA 12E8L 4R90L 3MLVL 4K7FA 3WNPA 1KGCE 2NY7H 4LGSB 4PTTB 1AXTH 5IEHA 4F58H 3UYRH 4RQQA 3N9GL 1AO7E 5CJQL 4TNVF 4JB9L 1W8NA 2B1AL 2E9IA 2Z8VC 3L3DB 4KTDL 3L6FB 4JKKA 1A1MA 2Q8BL 3GSNL 5DRZB 4KDWA 3FQTB 4XTRD 5I19H 3SHSA 2EDEA 3OAZH 3SDDC 1S7TB 1F58L 1NLBH 4PGCB 2ZPKL 1NFDE 1A6VL 3HKFA 3UTOA 4YHPB 5D96B 4W6YB 1HHGA 1PD6A 3GB7A 5DQDL 4Y4HC 2HFGL 4JY4A 4LEOA 1D9KC 1D3CA 4K23H 4HIIA 3LMJL 3ALWA 4E41D 4M9OA 3O0RH 4WV1B 4JHWL 4OQTA 2H1PH 1EBAA 3OF6A 3W2DH 1MHPH 4U1GB 5DJAB 2D4DA 4CVXA 2ADGB 3C08L 4N0YH 1ZHBA 2X1WL 3RDTA 4RGNE 5E6IA 1CF8L 1NGYA 5CSGA 4X80H 4G5ZL 5FO7B 3TYGH 4PJBA 1T1WB 1UCTA 2HT2D 3KYOA 5DJCA 3T1FA 3E6FB 4P5KB 5TDNA 2X89D 3ARBA 4OCMC 3U7AA 4NQEB 4I0PA 2AJYL 4MAYC 2VMFA 1INDH 5TE4H 4PTTA 4FQIH 4D0DA 2G5RA 1KPVB 5D1XC 3FQUB 3LKQB 3S35H 3V0WL 5JOPD 2KL6A 1ONQA 3L7FA 4Z7WB 1C08A 3MV8D 3KHQA 4HG4J 5BZWB 4KJWC 3DYMA 4YH6A 2LVCA 1Q0YH 3VI3F 3O3BB 1T03H 4PRAA 5HHQA 1UM5L 4O51A 3L5XH 5EO1B 2W60A 1S7TA 3LKPB 4NQCD 3CMGA 1YQ2A 1TZIA 2XV6B 3PP4H 3DGCR 3QISA 4ZUTA 4CVWA 5E8EA 4HHAA 3ZE2F 3QUKB 2X1OA 3BGMB 1NC4D 3IFOB 3WIHL 1KLUB 3IDGB 3GSRB 5I0ZA 4H0HB 3GUTB 4JPIA 2V6HA 5JW4R 3VWJA 1MNUH 4LIQE 2HJKB 3GJFH 32C2B 3BP5B 5IK3B 5JNYB 2UUDH 1HCFX 3RA7L 4EBQL 2YD8A 5E03A 4NUGL 1J88A 2FBJL 1MEXH 1HH6A 5C7XL 1YJDH 2ADIB 2IPTH 1YMMD 4GKNA 1MCEA 5DFWH 1N7MH 3TNMA 3WJLA 4WFGE 5GGUB 5DI8B 3LV3B 1Q94B 1J8HD 1U9KA 2HFEB 4K71B 2B4CH 2ZOLA 3B5GA 4XNXH 2A6KA 4PJEB 4K3DH 1AC0A 3PF2A 2EIEA 1WUNT 5DR5H 5J6HB 3ULVD 5BZWA 3PDGA 5FV2A 3O3BA 4LGPB 5HYSG 3QIBC 1NMCB 1NLDL 4EI5B 3HC0B 4C57C 1OM3L 3LQMA 5MI0C 2DM7A 3JV4B 4HK3J 5D7SH 4OZGF 1DUZB 2ZUSA 4UT6H 2Q86B 1A1OB 5C8JB 1FGVL 4OUUB 2UZIH 3BGMA 1U3YA 3MJ9L 5E0QA 3IFOA 1KLUA 2V9RA 4YDJA 4NC2B 4NFDA 3P40A 1BEYH 4LBEB 4YHYB 5E5MB 3ZDXF 5BV7H 3VCLB 3CFJB 3T0AA 1CE1H 3ULVF 5BVJB 5IK3A 1SEBA 4RWYH 1MF2L 3HLAB 4KAQL 2FEDC 4JPVL 3IF1A 5F7NC 3KYKL 4K3HA 1NC2A 1IILE 4LLUB 2H32H 3IDMB 1T1XB 1W0VA 4O2CA 1ZOXA 1I1AB 2ICWI 3MA7A 1XIWC 4ELMF 4PJIF 5GGTH 1Q94A 4MA8L 5HI3D 5IB2A 5B3NA 3AC0A 4NKIH 3QG7H 1ACYH 1AKJD 4LLVA 4XNMB 2I26N 3OJ2C 4PJGF 5D70L 2W59A 3W9EB 2P43B 3KXFD 3T0EE 4C56B 1TCRA 1IE5A 3T2NH 4KJQC 4S0TD 3V5DA 3HC0A 3GMLB 4GO6B 4XPBL 3I85A 1DQTA 4BFEA 2AABL 1WISA 5KSBB 5ANME 3VRLE 1DUZA 5IT2H 1OSZA 4YZFE 5C8JA 1EGJA 3O3EA 4RAVA 4QNPE 4M6OH 2DQCH 1A7QL 5IBTL 3V0VB 3QEQD 4RMRA 1TZHB 3KPRE 5ID0B 3QDMD 3QZWA 4I2XA 3X13A 2BNUA 3LVEA 4Y16D 4FQ1L 3C2AL 3CFJA 2A6IA 3MLPA 3CDFA 4JFFB 3ULUH 3VXRD 4HLZH 3RWIA 4MJID 1HINH 2J6EL 1KLGA 1RQ5A 4K9EH 5IROC 4QRRD 5TGBB 4XH2A 4O4YL 4XCNB 5JMRA 1VGEH 1YEGL 4PRPA 5I73C 1HIML 1HN1A 2DLHA 4EI6A 1U3HD 2J2ZA 2VERN 3HE7C 4MNGB 1YEEL 2EE9A 4AMKH 4GKSA 1IC5L 3KPQB 4KQ3H 1TFHA 4RMTA 1HOCB 5D2NB 3H6JA 5C1MB 1IEHA 2C9AA 4MDJA 2D4FA 3MRNA 3BPCB 5I75B 1K9TA 5F7DB 4Z7NE 1PX3A 1LP9F 4WI9A 3BQUC 3B2UC 4XNQB 2Z91B 1MCOL 1T1ZB 5D2LA 1XGPB 1RMFL 2A77H 3VXSE 4APQC 4Y4KC 4Z7VB 3GSXA 2NXZD 4JFHE 2QR0A 1QLEH 1NH6A 1S7UA 2CLRA 1M4KA 3BGAA 3FO9B 4X4ZA 1S5HB 3PUCA 2VLRB 1FHGA 4AEIH 2ICWB 4IM8A 4JKMA 5DVOA 3U0WH 4F7EB 4NSKA 3O2DH 1T2XA 1QRND 3HC3L 2IBZY 3PGFL 1VKXA 1TZHA 3TO4C 5B38A 3MCLH 2FZ3A 2BSSA 1Q0XL 1QBLH 1U8HB 4FTVB 3GNMH 3IKCB 4X9HA 1II4E 4NNXB 1KACB 1T7VA 4NP4L 1CGVA 5DWUH 3OGCB 5HVHB 5IR1B 4JY5L 3OPZL 1NGPL 1WT5A 1DUYA 4DVBA 3ARGA 1ZLWH 1V7NH 3EHBC 3U6RA 3ARZA 3IRPX 1PG7X 5C0FA 4HXAH 1GC1H 2BNQD 5SX4I 3SE8H 3SY0A 1DN2A 3ZLQC 2A9NH 6FABL 1JZ4A 1BBDL 1HOCA 4KZDH 1TENA 2F5AH 4PJDA 1J1PL 2ATPA 1J05A 5EC1A 4E41E 3ZDZF 3BPCA 1R3KB 3QEUA 2OTUB 3B2VH 4BKLA 2JB6B 1HNGA 5JW3L 3AREA 4C58B 3NCCB 2Z91A 3ZL4H 3VI3E 1T1ZA 5EBWB 2AQ3A 2AI0H 4XHJC 1FNSH 4JG0H 3EJYC 3JZ7A 3VWKD 2V7HA 5E6ID 1CFTA 3GKZA 4F7MB 1CU4H 5L0QC 1PYWA 1CICC 2VLRA 2QQNL 2B5IB 4PREB 3ZE2E 2R2CA 5DMYA 5KVDH 3CFIC 3RVWD 3ARBD 3U1SL 1YEFL 5E2TL 3E0GA 4PRNB 2FBOJ 5L7XH 2XKNB 4IOFD 5T33H 5F97E 1FP5A 1TETH 5JOPE 4FTVA 3CD4A 1C12B 3IKCA 3HC4H 3MV8E 3CX5J 1FRGH 3MA9L 4J12A 1ZGLP 1BFSA 4XC3L 2F8XC 1IC7L 3P11H 4DVRL 1A7PH 2HKFL 2H3NA 3O6LH 3BRFA 4HUNB 2E9JA 1I9EA 2CDEB 1T22B 2EYRB 3HI1B 1WBYB 4NQCE 4LSPH 4ISVA 3BO8A 4ZFGL 4PJBF 4ZPTA 2AJSH 5HYJA 5FHBH 1F8TH 4UMGA 4P23B 3MLZH 4X0KA 3TBVB 3HNSH 1ZSDB 1UVQB 3L3HB 1Q9OA 5CJOH 4OAWA 1A9BA 4ODBD 3VW3H 4Q74A 4NCC2 2YD7A 5A16B 1MIEH 3KPMA 2OTUA 1U41A 3VWJD 3TN0B 1Q1JH 1F4YH 2X4PB 4Y1AB 5DMGC 5GJTL 4XC1H 5J7CC 3PIQB 2X4QA 3WL9B 1P84K 1MFCH 2D7PA 2OXHA 2HYMA 4UBDC 3RVXD 4AT6A 4JEGB 4F7MA 3F6LA 3THMH 1YMME 3P30H 4OF3A 4G8GA 2J4WH 3OHXB 4XGZB 1RUPL 1FPTH 1MCWM 3H3PL 3NPZB 4NQED 2DI8A 5ITFA 1MJ7L 2K3TA 4PRNA 1J8HE 2H45A 4X7SH 1ZVYA 2I27N 2F74B 2XKNA 2XIDA 1C5DB 4H5SB 3B8SA 1UZ8B 3P9WB 1ZTXL 1CTOA 1QFWL 3GKWH 4Q2ZB 4IOIA 1ZK9A 4L4VA 3HCVB 3QPXL 5FUCC 1OGTB 1YY9D 2VXQH 3KLHD 1A6WL 1IM3B 1FO0L 3UJTH 1Q9KB 4HJ0C 2R8SL 1WFNA 2GYSA 1IGTB 2FEEI 4JQXC 2D7OA 1KIQB 2CKBL 4JO4H 2Q76B 4K3EL 4ELME 3BIKB 1W0WA 4K3JL 1EERB 4NPYB 3TBVA 1ZSDA 1SYSA 3Q2CA 2ZUXA 1MRFL 4X6FB 1RZ8A 4PJGE 5I71B 4AK1A 2NPLX 3TN0A 2SEBB 3MBEB 5IMMA 1IEAA 4Y1AA 3D3VB 3LQZB 5I9QC 2OR7A 4Z7WF 2NNAB 4ZD3H 3S8WA 4XAKD 1JNHB 1FG9C 4XXCC 3D6GA 4WO4B 3CXHJ 2X4TB 1KJMB 3MYJB 2VLJB 3SGEI 2R2BA 1NC2D 5GJSH 3QULA 1KCVH 1B88A 5MENA 5DFVC 4LRIA 3KS0J 3V7AG 2R1XB 2FECI 4YAQB 3SPVA 5BOPA 4HBCL 4BSVB 3A6BL 4KMTL 3LB6D 4UZGA 5HPOA 3KXFE 4PJ8C 1AI1L 4Q2ZA 4O2FB 3O2WL 5HYSB 1OGTA 4G7YL 1NKRA 3SO3B 2GIYA 4YHMH 3SKMB 4QWWC 4NO3B 4R97B 4J8RA 3KLAB 4F15C 1XH3A 5HHNA 5CGMA 3DUUB 2GAZA 3WEXB 4PJAA 5C09B 2VQTA 3QEQE 1XF3B 2FL5B 2QEJA 4ZAKA 3K8MA 1X5YA 3G04A 5L6YH 3I3EA 3QDME 4LPTA 5I8OH 4OJFH 4MDIB 1HXMA 2EDHA 3Q1SL 1LP9E 4PJEF 2XFXA 3L3GB 3REVB 4XZUA 3VXRE 3D85A 4A6YL 2ZCKL 4D9LH 1R5VB 1RPQA 3LN5A 4MJIE 2ITDB 4ONOA 1CLCA 3O2VH 3TP4A 5L8LB 4P2RA 4QRRE 1SY6A 1S9YA 3VA6A 2CUMA 5EU4B 4XBEH 4OB5L 3MODH 3L5HA 1DBJH 3QWQB 4PD4J 5FYKD 1ES0A 3UDWC 1ADQL 5IVOA 3JV5A 1I1AD 1NPUA 4LLMA 3WKNA 3RY6C 4JPKH 3MMEB 4QHNA 4K8RH 1MJUL 4NNPL 3AXLB 3I50L 4GKZB 1FYTA 3TCLB 3R0MA 4GS7C 5F9JB 4UDTA 3LKRA 2G5BB 2MOVA 3GSOB 4C56D 3DO3A 5AZ2H 1IAII 3V0AC 4J6RH 4XMLL 4NO3A 3JWDL 1J18A 2VXUL 2E5EA 5DQ9B 1T66C 3CFKA 5ABDE 1A6UL 4ALAL 5A43C 1WJ3A 2AJUH 4YC2B 3WE6B 4ZSOE 3RL2A 1GL4B 3BWUC 4YFLI 3WEXA 2AJXL 4LIQH 4XP4L 4AM0B 4PJ9C 3EKCA 1MLBA 1NDMA 4PLNC 1QRNE 4ORGB 5IB3A 3BZEB 1QR1A 3TT3L 1O5DT 3ZDZE 5T1LA 4QT5A 4NN7C 1QHPA 3QG6A 2EH8H 3UJIH 4QRUB 1SM3L 4JFFD 3IU4L 4OT1L 1X5ZA 2XN9B 2EECA 4Z77B 1T6WA 3Q48A 4LSUL 4JHZA 4ONGL 4L3EB 3WFDL 2WLYA 4EQ2A 4MA7H 4AENB 5DT1H 3H9ZA 2AV7A 2YXFA 3ARGD 5I6XB 1RZJC 2IANA 4JZOB 4OGYL 2BNQE 5GRWA 1NCWL 1UACL 1LO3L 2YZ1A 4RMQA 4PJ5B 3DVGA 5ACZA 3AXLA 2DMBA 3RHWK 5HHXL 2DYPA 3L3OB 1NBVL 1EA9C 1NQBA 4MVBC 1YY8B 4NGHH 1DQLH 1IAIM 4QRPA 2ARJB 3V4VL 1R3HB 4ZO6A 4FP8L 2GT9B 1FNGB 4JY6B 1UFUA 5F1IA 5TDOB 4P9HH 4JO3H 3IJHB 4PJBE 1NCCL 5ESQB 3VJ6B 5KVFL 2VLRD 3EW3B 3NPSC 4JFDA 1XF4A 2GSGB 3A6CL 1ZGLA 4POUB 1NMAH 4GMSH 4YDKL 5ENWB 4XWOC 4XXDB 3CXDH 4Y5YC 4P5TA 3QHFL 4GXUN 4QXGL 5JXEC 4FTVD 4Z78A 1VPOH 2Y7QA 3OX8B 4HV8B 1E28B 5CGYC 1RZIA 3WD5H 4L8BA 4M1CC 1U93B 1ZVSB 4KWUA 3P4OB 2XZAH 4CNIB 4YXKH 4X6BB 4ZFFB 1IZKA 4DTGH 4YXHL 4KGLA 1PKOA 5C0IB 2CLVA 5I1GL 4M03A 3VXUB 4LSRH 2H9GB 3DV6B 3L3OA 3UAJD 4E0RA 2XG4A 1MELA 1CFVH 2UYLB 4HKXB 2NMSA 4J1UB 1MLCB 1U8PA 3G6JA 1AQKH 1UKSA 4U0RB 2X4RB 3QXUA 2WWMC 1SYVB 3I6KA 3DBXA 1KT2A 2C3WA 2DQFA 3U46A 4QY8A 1FIGH 4Z7QF 5GRYA 4NO2A 1M7IA 4PV8A 5ESQA 5FK9B 1LMKA 3VXTA 2BHZA 1UYWH 1KTLB 4NQEE 3KAAA 4RA3A 1NBYB 3CDYA 3PHQB 3CU7A 4EOWL 1HSBB 3FQNA 5DEGA 3GMPB 5C0DA 4L8CA 1IQDB 1U8NA 2RQ8A 3GIZH 2DIJA 4P57B 1ZLVK 1CDGA 4Z7WE 4GAGL 3OR7B 3V6BR 5GZNC 2NX5B 5HPMA 3QIUC 2VITB 3TPKA 2EKJA 5LXGH 1ULVA 1G6RH 1S7VA 4ZOAA 1H3XA 1ZVSA 1LD9B 1OLZA 4CNIA 1MCPL 3SKNA 3EYQC 4E9LA 2A9MH 5L88H 4KKAD 1UXWB 5CD3A 2BVOA 4JG1H 4P23D 1KXTB 1HEZA 1JYVA 4TSCH 4TSAL 3R8QA 3GI8H 5HVWA 5EIIB 3WDIA 3QAZB 4RGMC 3TN0D 4Y1AD 3NCMA 3FT2B 5HI5C 1YYML 4XAKE 5ETUA 2IADA 3CH8A 5DEFA 1OP5H 1RIVL 4GW1A 1F11A 3T0BA 2OZ4L 1YNLH 1KIPB 4PIRF 4RIRA 4CMHC 4HK3N 3DX6A 5FK9A 4OIAA 5EOCH 1MHCA 1ZA6B 2DM4A 3MLUH 3TZVC 3STLB 5EUOA 1K4CA 3S5LG 1UZ6F 5JPMB 2VDPH 3QHZH 2YA2A 3VG9C 3SDDB 1ROWA 4GSDH 4OLXH 2IGFL 2IQAB 3C6SA 3QNZB 4WUKH 5I1HH 3OJMB 4PJEE 1I3GL 2P24A 2X4NA 1U3ZA 1KJ2H 2UZXB 4FA8A 4Y4HB 1UM4L 3E3QC 1D9KB 2NYYD 1F3RB 2A38A 5HSFA 3QP3A 5J1AA 4IIQA 3NFPA 1XR9B 1J86A 1MREH 2I07B 3I9GH 5DQJA 3GMRB 1YEIH 2WLZA 5I18H 1UXWA 2CQVA 3GSNB 4EUPG 5TQ0H 1CE6A 2X9WA 3OKNB 3U9PH 3RZCC 1DVFC 4O9HH 4AQOA 4I2XE 3WNOA 4QTHA 3O9WB 5T3ZL 4HKJA 3D3VD 3H8NA 4HC1L 4LF3B 3OWEA 1S3KL 2E6JA 1ED3B 5EPMA 5E9DB 1A6ZA 4TTGA 2CK0L 3CLEL 3ZMRA 1J0IA 3WMSA 2E6QA 1A7OH 4ZQKB 2VLJD 2QKIA 1FVDB 1MRDL 4Q6IB 1NUGA 2HKHL 4M48H 3U7WL 1U8QB 1ZWIB 5CZXD 2R4RL 5JPMA 3S9DB 3HMXA 5FA4A 1A9EA 1JFQL 5JXAH 2VXVL 4YPJA 4HFWB 2DKUA 1CK0L 3S88L 3X12B 1FYTD 5CLWA 3HRZB 1NGZA 3MRFB 2NY4C 5D71L 3BE1H 3MLRH 4Y4HA 3TO2A 4C56E 4J3UA 4NO0B 1D9KA 4WRLA 2XACC 4MS8C 5L2JB 3LIZL 4HCRA 4QGTA 1N6VA 4L8SC 3FN0H 4AIZA 1UQSB 3ZKND 1AGDA 4JDVB 3VD3A 2MPAH 4MXWH 4ZG1A 4G6AC 2HA1A 3P77B 4XB8A 4GBXC 1S7RA 4POZC 1X3DA 5C09D 5IWLC 5JA9A 5CIPB 1QLRB 3SQOH 2X4UA 5IB5B 2YBRA 3MZTA 3T3MF 1RHFA 1OQOA 5ID1A 4MAYA 4JFFE 5CSZB 3QEHA 5A3IC 1FZMB 3BKJL 4XPAH 2Z8WC 5D1XA 1KB5A 3IDXL 1U8LA 2VXSH 4BZ2L 3BPNC 2I9TB 1RZGB 1FVDA 3TBWB 4WY7H 4NQVA 4KU1A 4MNGE 1FBIH 4XNZC 3PV7A 2IAND 5DJZB 5HDQH 5TE7L 1WAAF 1NJ9B 3W9DB 5HHMB 3X3GH 4NFBA 3ULVH 1B90A 4XWGH 1DQQB 3RPIB 2AK4B 4NZRH 2VKXA 3BRGC 4FXLA 3KPPB 4UV4L 1IGFH 5JO5B 3MRFA 3TBSB 4LU5H 1MCJA 2EIZA 2FCBA 4HS6A 4I3SL 2ED7A 5MEQB 3QCTL 5DC4B 2AQ2A 4O2EA 1G9MH 5B39G 1F90L 3C8KA 1UQSA 4S1DC 2AXGB 4JDVA 1HWHB 1BM3L 3J7HA 5C3TA 4G8EA 2VLRE 4Q9RL 4IBLT 4ZTOH 5D1QC 5FYJU 1KEGH 1KENL 3V8CA 2KKQA 4Y0GA 4R8WL 1B0GA 3QRGH 4JPWL 4S1RL 3HZKB 4JRYA 1N5YH 4KVNL 4XT1C 3SBWC 1CFBA 4P5TD 4FTVE 3IDNA 1XIWB 5DYOB 3NACH 1AD0A 4OLZL 4HIJB 5JHLL 4JN2B 1EH9A 1WZ1L 1JGVL 1U8JA 2ITCB 2RAMA 3PP3H 2YMXH 3BUYB 1BIIA 3ZKMD 3Q6GL 2XN9D 2Y23A 4L3ED 5I76B 4TUOB 3GBLA 4Z7QE 1HHKB 1IEBA 3VXPB 3D5OF 5CP7B 2A6JA 1LK2B 5JW4M 3H7BA 1YNTA 1CL7H 2DOCA 3T8XA 3QIBA 3EOTL 1KB5H 1WV7T 1CFNA 2HRPH 4Q7DA 1H3TA 2HFFB 4FFWD 4L1HA 2AGJL 4PJ5D 2A2QT 5EBMB 3O4OB 3O4LA 1YEJH 1IMHC 5JIKA 1O0VA 5L2KA 4ODHL 1IQWH 2VQ1A 1BOGB 1GGIL 2PETA 3RWCB 2WBJB 4G8IA 3LDBB 4JDTL 4ETQB 4Z8FL 1RIHH 4FQHA 3CVHA 2NLJA 4Z5RA 4GRWH 1DBBL 1OLLA 1TNNA 1ZT7B 5EU6A 4E42B 4MJ4A 3QQ9D 3IFPB 1U6AL 4QTIL 1PQZA 1BFVH 3PXJA 4M3JA 3TWCH 1LILA 1FAIL 3WFZA 4P5MB 3ZKXC 3BKCH 3FT4B 4LSTL 5I73B 3RAJH 5D8JL 5IHLB 4DFHA 2VKWA 4CN4A 1XIWA 5GZOD 3QXDB 1DQJB 5DYOA 4HIJA 1CI5A 5F1OB 1Q9LB 3MJ9A 4YEFA 3G6JF 2K1MA 3R0NA 5I17B 3S34L 3LRHA 5I76A 4PJXA 4TPRH 1VEOA 1HHKA 3GHBH 1VA9A 4XVTL 5BO1H 3VXPA 1I8KB 3HZYA 5B4MC 1FL3A 5CP7A 4J3VA 3HAEA 1MHHB 3HB3C 3OV6A 3P0GB 4WFHD 1UZ6E 5ALCH 2ICEB 1RJYA 2VIRB 4JJHA 3VXUD 2DQGL 3MGTB 4WHYH 1YPZB 3IDIB 1CGYA 2M26A 2ZZUT 3DUSB 5BRZB 3NTCL 3RWCA 1K3IA 4Y1AE 3FQXA 3OQ3B 3PDOB 4U1IB 2B1HH 3TO4B 4MXVF 4GAJL 1TJHL 1DP0A 1OCWL 4MQTB 3C60C 4E42A 1G84A 5ESAB 2CIKB 5C2UB 4WENB 3BW9B 2BY1A 5IROA 5MENE 4HUVB 2LVEA 5TQ2H 2FRGP 5EN2A 2LFGA 4YFLF 5FCUL 1QFOA 2YC1B 4KPHL 1D5MA 5KTEL 3T77B 4QLRA 1D5ZB 3HE7A 4PUBL 5HJ3A 1KIUA 3P4MA 4RBPK 4KKLC 1AGBA 4DUXA 2RJMA 5EZLB 2NX5D 3MJ7A 3MBXH 1RVFL 5F88B 5KOVC 3T0VA 3QWRA 1LQSR 5F6IC 3ZE0F 3QDJA 2XWBA 2BVPB 3DXAB 1AC6A 3BQUA 3EOBB 4XP1H 2J6EA 3U0TB 3QCUL 4APQA 4Y4KA 4PJAE 4P2CG 3RJDA 1QFUL 3NA4A 4TSBH 1V3JA 35C8L 4JE4B 1FQ9C 5E2UH 4OI8A 4FFVC 4LP4A 4EVNA 1CYGA 3D3VE 1JRHH 2XWJA 3LN4B 4N0CC 5FDYA 1GGBL 3TO4A 4PTUA 1V5JA 1WICA 3RGHA 1W2KT 4CVUA 1JWUB 2R69H 4ENEC 2IH1A 3JBG7 5DHVA 2VLJE 1I8LC 4YLQT 1KOAA 1QFWI 4KZEL 1MPAH 1WBZB 1QNZL 3B9VA 3CMOL 2I60L 1MVFA 4YHZL 1BAFL 3CFDB 2VDMH 3S5LB 3KYMB 1RHHA 4M02A 1J0ZA 1R5IB 1UB6B 1X5JA 3SDDD 4F3FB 5MEPA 4DQOL 1MCIA 3T3ME 5EDXA 1FYTE 1KELH 1RK0B 3FQWB 4HZAA 2VZ3A 3WLBA 1SHMA 2G2RB 2GSIB 2LE9A 4G42B 3FZUD 3FO1A 4Y4HD 4DZ8B 1D9KD 3U0PB 2BY2A 2VTFA 4BQ8A 4TRPL 4YIQA 2PTUA 1G6VK 1JL8A 2O26U 1PY9A 2YS4A 3U0TA 5BVPL 4NWTH 3MRHB 4KTYA 4EUPB 4KKNA 3L3IB 5SWSB 2W92A 4KTEH 1Y0LA 3QWOB 4FNLH 3WFCH 4LVNB 2HTKC 1CICA 1MIMH 5IKCB 4F37F 2FWOA 4PRDB 4HWZA 1U91B 1MQKL 3ZKQD 4K7PY 1NMBH 3RI5K 2ZP0T 1IRAY 2B2XH 4MAYD 4ZMAT 1NFIA 2OBGA 3GSQA 5E9DD 43C9A 1MCCA 5F93C 3HG1A 4Q0XH 1BX2A 1QFWM 3QUYB 1ZHKA 3ECBB 2VZUA 4NQXA 2Z31B 2JE8A 3V4PH 1LE5B 2IANE 2FGWL 4WTWA 5DJDA 4ZFZB 2O93L 4ODWA 1SVCP 5FOBA 4JM4H 5DLML 2W07A 2GJZA 3CSGA 1R5IA 4WJ5A 3N85L 5CMAA 1AE6H 3UO1L 1WEJH 3AS0A 4H1LG 3B9KC 3G5ZA 4G42A 3BKML 4QRPE 4R0LB 5C2BH 4Q6YA 1XZ0B 2Y6SD 4L29A 1CLZH 2LU4A 3A6OA 2C1PB 2FX7L 1A6PA 5DO2C 5JHDA 1NGQH 4A2LA 4LLYB 3OKEB 2HVJB 1CXLA 3V4UL 7CGTA 4MCYB 1KNOB 1SVZA 4JFDE 3SDXA 5FHAL 5DJ0A 4NWUL 1EHLH 4HFUH 3JWOH 1TDQA 1F13A 3KWWB 4F2MB 5FFLA 4PRDA 2CKBB 4JRYD 4U6TA 4YDLC 3DLQR 4QRSA 2X4OB 4X4XA 4PR5B 1JTTA 2OL3B 1MFNA 2IPUK 2YEZB 5FUOL 2F58H 2I24N 2XN9E 4XBGB 2EDNA 5I8KH 1LNUB 5HDOA 1HI6B 2P49B 3ULSB 2VDKH 1ERNA 3S3SA 3QUZC 1E6OH 3T3PF 4N8CH 4X6DB 4OFVA 5HHMD 1KTRL 1BZQK 5J57B 3G5YA 1DBAL 4WIQA 4JQXA 2A0LD 3D9AH 2CD0A 2AK4D 2DQJL 3LEYL 5D1ZC 2D7NA 4NYLB 4F15B 2ORBH 4KVCH 3G6JE 4Y88A 4HF5H 4GRLC 3PL6C 3PWJA 5ITBL 5FAAA 1XZ0A 1TJIH 2NY5H 5DJXB 1DBML 4MNQA 5GISL 2J8UB 1J5OH 4OZFH 5EIVA 1QEWB 5I1CH 4QRTB 1UA6H 5CZVH 2R56L 3MRPA 4M1GH 1N59A 5H37H 1I3RA 1MAML 1FFNB 2MQ0A 3DNKA 5DVKA 2AW2A 4XXCA 2FEDD 1FO0A 3MRMB 2JCCB 1JGDB 1X7QA 4U49A 5E4EC 5E2WH 3UBXA 5GS0L 2DBJA 4RCAA 2FX8L 2DICA 3QA3B 3M17B 5FYKH 4U1HA 4UT7L 3EZ8A 1XIWD 2BMKB 5B3JE 2VDRL 4OM0L 4MXVE 5E8DL 2HN7B 4LSSL 1LNUA 2K9UA 1HI6A 4NQDA 4GS7B 4PJ8A 2J12B 3RP1A 4A6YB 4P4RB 4X6DA 2J8OA 5JW4N 3D18A 1T7YA 1Y6KR 4WFHE 8FABB 3C5JB 4KJQD 4U1MA 1GPOH 1UM6L 3VXUE 3FQRB 4WCYL 5CJBA 5GS0C 1YECL 5E8PA 3TT1L 1WZLA 3NZHL 4NYLA 5IVXA 1L7IL 4P2OB 4N8PA 2WBJD 2CPCA 1WIOA 5DJXA 5HXMA 3D2UB 4TULL 5KVGL 5B39A 3NN8B 1UXSA 1DN0A 1UH3A 1MHEA 3ZE0E 1QVOA 5AZEL 3K1DA 3JTSA 4PGBA 2QHRL 4M43L 2IPKA 1MFBH 2UV3A 3BEVB 5F7UA 4E5XA 1KBGH 4X4YA 4HS8L 5EUOE 4Y2DC 1XR8A 3AFLA 1QBML 1AFVH 2DJSA 3UDWA 1ZLUH 3WYRA 1O7VA 3MCG1 4DN4H 1H5BC 3MLXH 3M17A 4PJFB 1TVHA 5FB8A 2DLTA 3RY6A 3OB8A 5I8CA 1F02I 1F3JB 1AD9B 2I5YL 2NX5E 3SDAC 3WXVL 5JR1L 5J0BA 4NZDA 3QWRD 1RIUL 2BDNH 5GS1B 5C07B 1XT5A 3ZTNL 3B2UD 1UWEL 3FQRA 1XGQA 4X98B 5E8NA 2EXWC 1G7LB 4BUHA 1ADQA 1RV6X 3CK0H 4PJ9A 4U3XA 1GIGH 5EZIH 1EJOH 3H9SA 1FDLH 1VADB 2CRMA 4LDEB 5JUEH 1EO8H 2E9BA 4L9LB 3TO4D 4Y5YB 5DRXA 1A6AB 3S4SA 5M7QA 5DFTA 4XPTL 1I9JL 1VFMA 5DDHB 2BP3A 3WXWL 1KF9B 1CN4A 4P46C 2VUYA 1KJVB 4M1DH 1NCUA 3HI6H 2XQBL 4Y5XC 2R1WB 1KFAL 3MCKB 1BGXH 2QSCL 3DV4B 4U05A 5ADOL 4R3SA 4HUKB 1LK3L 2NY3B 3GMNB 1NCBL 4N9OB 3EHBD 4MLIA 4G6KL 1YPZF 2J7LA 3TA3B 4PJFA 5CJXC 5LCVH 4UILL 3SDCC 1PLGH 1Z5LB 1GGCH 1R3LA 1YDPB 3F7YB 3HUJA 3Q3GA 2PF6A 5K9QG 3ETBF 5F1NB 5AAWA 1URLA 2JKXA 3EDDA 3HR6A 2X4SA 1BQHG 1IC1A 4JANB 2XWTB 3EGSB 4HUUB 4D3CH 3ARWA 2JELL 2HLFC 2W91A 2NY2B 4QHKJ 5TF1L 1L7TL 5TE6H 1K8DA 5KSVA 4X98A 1NFKA 1FL5B 2WP3T 3EJYD 1MY7A 4GH7B 4KUZL 1AY1L 4RISL 4FFZH 1VENA 3U9UA 4ERSL 1CICD 4WU7A 5H2BB 1D6VH 3KPNB 2V2TA 5C9JA 4YWGH 3CFBB 2A6DA 4XBPA 1RURL 2C7UB 2ADJA 5C6WH 3WFBL 1QBAA 1IKNC 4Y5YA 3MJ8A 2VDQL 5SX5H 5IIEB 1GOFA 5JXEA 5DDHA 3MRLA 3VFPB 5CLTA 5J12C 4FQJL 2YD2A 1OB1B 4KROB 2QQLL 3PV6A 4NN5B 4OZIA 1WC7A 2F15A 4H20L 3TLRA 1LE9A 4K2UH 3DO7A 2DDQL 2UWEB 2R2HA 4JAMA 3CGTA 5FIEA 3X14B 4NZJA 5I1IH 1O7SA 1PFCA 4R9HA 1XGTB 1EEQA 1FJ1A 2HTLC 1TLKA 4HMDA 4YO0A 5DD5H 1X5XA 2QQKL 3ZYJA 1T7ZA 4JZNB 1RZJH 4Y4FC 2ZKHH 3DUHA 4LFHG 4OD1L 3EFDL 4XMKL 4WEBL 5KOMC 1ZA3B 1OAKL 4RGMB 5C0RH 1LGVA 3DVFA 5JHDD 1U36A 1BJ8A 5DMGD 1BVLB 4LCYB 1JHLL 1KPUB 4Z0BL 2DRUA 2F19H 3C6LB 1NCAH 5SWSD 5F9DC 3WHE0 3DX8B 5DUBA 3UTQA 4Y8DC 2DTMH 2VZTA 3QJHA 4JRYE 1S7XA 2ED8A 3MNVA 4DKEL 4ZTPH 3VFUB 5J9PA 5CINL 3CFBA 3VFNB 4FMKA 5GGSA 3GEWB 4BH8A 2CR6A 4UINH 4N1HB 2VC2H 4OZ4B 1P6FA 3CSYB 3CVIL 4CADB 3TPUB 2Z92B 2YK1L 4OCSH 5SX4H 4N9GA 1F6LL 3QEGH 3S3PA 5ADPH 3QUYD 1KEMH 2KDGA 1GHFH 2Z31D 1JGLH 3QIUA 4JREB 1YZZA 2ZCLH 1WTGT 1D6EB 3U4AA 5HHME 2XRAL 2YKLH 3AY4C 1R0AL 1HDMB 4K94L 3TV3L 4HJ0D 3CAFA 4AH2B 1N6QL 4F57L 3HHRB 3X14A 4EN3B 2ZUQC 1BD2A 4ORZC 3DGGA 3LKSB 3NOIA 4H1LB 2BX5A 2VZ1A 2VDOH 2XY2A 3OMZA 1T04B 1S7QB 4F58L 3UYRL 4MNQD 1BMGA 4WDIA 1IBGH 4G7VH 2HLAA 4G9DA 5INCA 3E6HA 3O3DA 1U95A 5L9DL 1RZFH 4XCCH 1L9NA 3RIAK 3BSZL 4PY8J 3IU3A 5I19L 1VFOA 5C0CB 3AB0C 3ARVA 3OXRB 3O3AB 3L5IA 4K94C 2P44B 2VXTH 1VFAA 4JVUA 3WN5B 3S36H 3O6KH 2R23B 4NDMB 3B6SB 1CFQA 2BSRA 3TZVA 3S96B 3NMEA 1OT2A 4AY0A 1CDJA 4RGOL 5IW3A 3CSYA 4K23L 3BT2L 4Z18A 2DAVA 1EEZA 3GO1H 5F9OH 5DD0H 2R9HD 2H1PL 3W2DL 5H35B 2WK2A 2F53A 2NY4B 2CO6B 4HEME 4NQDD 2EDFA 2IAMC 3B9DA 3P2TA 2PW1A 3MV7B 5F89A 2D7MA 5JOFA 2QBWA 5FM5M 3KJ4C 3RNQB 2GJ6B 2CRYA 1BECA 3MRRB 1RZKH 1T20B 1N5AB 5KSAC 1OVZA 5HHVH 2F8OA 3R8BB 5LJYH 4MQ7A 4HAFA 1P4IH 1W72L 1S5IH 4UIMA 1INDL 3ARQA 5TE4L 4GBXB 1U58A 4FQIL 4DGYH 4EIGB 3QFDA 1JPFB 3LEXA 1P7KA 3DX7B 3RZCA 1DVFA 5HGDB 1P6AB 3TIDB 3PWPB 1NCDH 4OD2A 2APWA 2CH8A 4ZNEA 3MLSL 1CDIA 1G7JB 3IDJA 5DS8B 3PNWB 1PG7W 1Q0YL 1NAMB 1T21A 2KQMA 3MRIB 2EDXA 4GUPA 4ZPVA 3TFKC 3L5XL 1LEGA 3OXRA 4X6DF 5INDA 3V52H 4J7RA 4GOSA 4WFFE 1Z9MA 4IHOB 4OI7A 5IBLC 5IHUH 3Q0HA 1T0PB 4QXTA 1INQA 2EC9U 1A3RH 2VAAA 2E7CA 1CT8B 2OJZL 2DQUL 2BVEA 2PR4H 3H2WA 1MNUL 3LS4L 5KS9A 4XRCB 5H35A 1U92A 2IPUG 4MA1C 3QDJE 4DUVA 3EDKA 4HC1A 1X4YA 3PWLB 4BH7A 3WDJA 1JJUA 1FC1A 2GJ6A 3QIWB 4L8SA 1RK1B 1T66D 1CGXA 3EOAA 2JCCF 1EEYA 1YPZE 5TH2A 4JJ5A 2DI9A 3VFOA 4P2OD 5ICXA 5D1QB 3U2SA 2R1YB 4GBXA 3B83A 3WV0A 3ABZA 5I2IA 2B4CL 5IB4B 5IWLA 4GG8A 2A73B 1NDGB 1FL6A 2ZOKB 5JW4Q 1WK0A 3UTTA 3G08B 4G8FB 5K9QI 5ISZB 3W11D 2GUOB 1DEDA 1P4LB 2GITA 3CFCH 3PNWA 4JFPA 4QHLA 1U8MB 2YZ8A 1IGML 1JN6A 3FOMA 2N1KA 4LVHC 4ZYKA 3L95A 5D7SL 1YJDC 1KG0B 1FYHB 4RMVA 1FN4B 2MHAA 4PRIA 2P7TA 3RDTC 4JFEB 3MFFB 2B4CC 4JO2H 2B0SL 2P8MA 1QTYT 1TMCB 3VE0B 3IXTB 4MVBD 4MD5A 5C0BB 1JGEB 3D0VB 1I8IA 5FA3B 5C07D 4RWYL 2BXYA 2OSLB 1P53A 2NY0B 3RBSA 1JF1B 5CS7A 1YEHH 3X3FH 3WS6C 1CFSB 2P5EA 3IVKA 4NHUB 2YPLB 4R7NB 5D1QA 3VXMB 4U6HA 1K8IA 5IHZA 4PB0L 4PJFF 3QG7L 1VB9A 3UPRB 2ZOKA 1ACYL 4F7TA 1NBZB 5BV7C 3IETB 1EUTA 1QLFB 3SBWA 1XF2A 3PHOB 3P4NB 4UTAH 3IJYB 3LH2H 1S8DB 2XZZA 4OLVH 4MJ2A 5GRJH 3BHBA 3ARXA 4PV9A 3VGGA 3Q6FB 4ONFL 4PY8I 4YDIH 3DYPA 1BQUA 2Z8RA 5IFAH 3DROB 1UWGH 4Z95H 3G5XB 4M1CD 2NY3D 2P8PA 4X5LA 3V5HB 4M6OL 2DQCL 1U8KA 2VR4A 4H26A 1QYGH 3AAZB 3L5WA 5D5MA 5FDWB 1CLOH 2NZ9C 4XCYA 2OYPA 3C5ZC 3O6FC 2BNRB 4NKQB 4HGWB 3UTPD 3RHWF 4AEEA 3ZT6A 5CBEB 3OKMA 3ZSTA 3ZHLA 2ICCA 1V3MA 3ULUL 1I9IH 3QDHA 2P46B 5JHDE 1I1FA 1HINL 1BQHB 4MAUL 2EXYC 1T0MB 3ELAT 3EYFA 3L1OH 2ZNXA 4HWBH 1H3VA 1LVEA 3S7GA 4RAUB 4PGEB 3X11A 1VGEL 1DSFH 5SWSE 3JUZA 2VABA 1CFSA 5ESVA 5FF6B 1QP1A 3A0OA 1G0DA 3RX7A 2CMRH 4ODUA 1JTPA 4KQ3L 5H94B 1VGKA 4M5ZH 5SWZA 1REIA 3CFEB 1X4XA 2IBBA 3K2UL 4X9GA 2XXMB 3FMGH 5FGCB 2EYSA 3ULUC 3IFNH 1FE8H 1S8DA 2IFGA 5GZND 2W9EH 5CUSH 4K9EC 4P4KB 2G75B 2VDLH 4KROD 4MX7B 4OBRA 5FUCE 1QLEL 4S2SA 2PCPB 2ENSA 4UQ3A 2XA8L 4LPYA 1HE7A 5A40E 4XX1G 2DJUA 5IMOB 2LAAA 4AEIL 1BPVA 3RIFK 4XNYH 4HH9B 3EYQD 4ZS6D 1BD2D 2AV1B 1LEIA 1VACA 1E27B 3PWVA 2QSQA 1MUJA 2KBGA 5I1JL 5CBEA 3N0PB 5HDLA 4BZ1H 1QBLL 2NTFA 1A3LL 4MNQE 5E7BA 3VH8G 2Z9TA 4Q9QH 1QFHA 4WHTB 2XKSA 1A7NH 3GI9H 5DWUL 1T7WA 1N2RA 4D8PA 1FCGA 3BFOA 1T0MA 5HI5D 4J3XA 4UDUA 5IP4A 4GW5B 4J3OC 1V7NL 3C60A 3C6LD 5BQ7B 5FF6A 1C16B 3VXOB 4HXAL 2JK5A 1RULH 2XZCH 1GC1L 2UWEF 3OJDB 1FFPA 3BZFB 1P7QB 4HIEB 3TZVD 4IJ3C 5H94A 3ARRA 5DD1L 3HMWL 4LCUA 4FG6C 2F5AL 4WEUD 4NBYB 5ELIA 3VDCA 3B2VL 43CAA 1DDHA 4RGNB 5IOPB 4NQDE 4G6FB 1IM9A 3GRWH 5D7JC 3P73B 3EYOA 2AI0L 2EE6A 5I1LB 4X6DE 3PWNA 4JG0L 4NZUH 4D9QE 3JWNC 3TEUA 1V7ML 4UQ2A 1T1YB 1AQDA 3ZKSD 3NCFB 3IFLH 4YXLH 2HAZA 4KRPC 3MLVH 3WNMA 5KVDL 1GC1C 3RTQB 3EO0A 5IVXE 2JJUA 1WBXB 1P4BH 5K9OB 1CS6A 3SGJC 4PLJC 3EYUH 3NVQA 5CJQH 1JNNL 4JB9H 3VFVA 4D0BB 2OJEB 1N4XH 1TETL 3Q5YA 4KTDH 3FB5A 3G6DL 2HWZH 2Q8BH 3HC4L 3VFMB 1AR1D 2EEBA 5HYFA 3RZCD 3BRDA 3GSNH 4DZBB 1FRGL 3P9MA 4D0CA 1A0QH 4UT9L 1ORQB 4EQ3A 5C08B 4U6XA 3SOBL 1HZHL 1QBBA 3P11L 5F1SA 1FNFA 1J0JA 3O6LL 1M71A 3JUYA 4H25B 4JKLA 4CDGC 1IT9H 3D0LB 2JCCE 4LSPL 2Q6WB 2DQDL 2OR8A 4IRZH 1FZJA 1I8LA 1VFUA 5DQDH 5ACLA 3OJDA 5FHBL 3BZFA 2CUHA 4UB0H 2IG2L 1F8TL 3OKLB 1EXUA 5T5NG 1ZANL 3HNSL 2BSTB 5IW6B 5CJOL 2PKDA 2G9HA 5LAXA 3WNKA 1MIEL 4X99A 3L9RB 3BX7C 1PDKA 3RGVC 1EPFA 2NY4D 4G5ZH 2DWEA 2YD3A 1H15B 3MV7D 4PRHB 3KDMA 3RWGB 3THML 4Q9CA 2GJ6D 5GS3A 5SWQA 1KSRA 2J4WL 4FHBD 2V2WB 4WW2C 5EU5A 5HYQB 1OL0A 4Q97A 1FPTL 4KJYB 3T65B 4KMLB 4G6AD 3V0WH 4X7SL 4YGVB 4G9FB 4GBXD 5MEOB 3D69A 1OF2A 1T5WB 4OV5A 4JM2C 1V8HA 1H3PH 3TBYA 3PWPD 2AEQH 1UM5H 4JFOA 2OCFD 3IJSA 5CIPH 4OFDA 5DK0A 2EO9A 3I6GA 4OCRL 1NUFA 2DWDB 1F4XL 3KNBB 3NIGF 4H25A 2X9XA 2YUWA 1A6TB 5E00A 2DLIA 1CXHA 5D6DC 2XI9A 4MZ2A 4HWNA 4GMTH 2HJFA 2WMPA 4JO4L 3WIHH 2V2XB 4YFEA 1I7UB 3GMMB 4LCCB 4PJFE 4PRID 5EIQA 2ZSWA 2H8PB 4P49A 1GZQB 3V9FA 4KK5C 2WIMA 4P2YA 1X6NA 3I6LE 5D1ZB 1A1NB 5F3BA 4NRXB 1CD8A 5KSUA 3B9KA 1HXYB 4QHUA 2FBJH 5C7XH 5KVMC 5BW7C 5CEXA 5E99L 1P2CB 4PRHA 4CMMA 5E94A 3QIWD 5GJSL 3VGAB 3CPLB 3P9LB 4S1DD 3VFGL 3T08A 3T4AA 2BCKB 2HMID 3FRPG 5IW1B 4PJCB 2RCSL 4B53A 2ERJB 5D1QD 4MGXA 1OAQL 2DQIH 4G9FA 4F9PC 3U30C 3OAYK 3BN3B 4LLWB 2XTJB 2WUCL 3T0EB 2ZUYA 1VESA 2R0ZH 3V79C 4WW1B 1T5WA 2ADFL 2PO6C 1CXIA 4NNYB 5IG7A 3WO4C 3FONA 1NLDH 1Q8MA 4NKMA 2XY1A 4J4PD 4OM1H 5ANMB 1J7VR 1OM3H 2F9BT 3KNBA 4YHML 3LKNA 5BZDA 4N8VA 1A6TA 2DF3A 3TJHD 4OZIE 4HUXA 5TJWK 1F6FB 1L6ZA 3VD7A 3GSVB 5JIPA 3QUZA 1VEPA 4NRZA 1AIFB 4HKZB 4N0FA 5IB1B 3V8OA 3RNKB 4OLWH 3HZVA 4LHJB 3GFUA 5IQ7L 1MH5A 3UTPE 1RJLB 5D1ZA 3GSWA 2FSEA 3RZWA 4DCQA 4EDXB 5CP3A 2HT3C 4ZUUA 4KUCD 5HY9A 4KAQH 4JPVH 1ZVHA 4D9LL 3EYVA 4MWFA 3FRUA 3KYKH 4GRLA 3VG0L 3PL6A 3QHTC 5C0BD 1VFBA 5DRWB 2Q1EA 5EWIL 2X1XR 3BDYL 1SJHA 1DBJL 3HNTH 1B4JH 2NY0D 1JHKL 2B39A 4HX1B 3S37L 3FOLB 1WIPA 4KGJA 1IGYB 1HQ4A 4LLDA 4GJTB 4MA8H 3B5TA 4M7JL 5EFIA 2BCKA 1KPRB 4NKOB 2BFVL 4JRWA 2YPLD 1FNEA 4K8RL 4MCZB 4LLWA 3RL1A 3BH9A 5D5MF 1QPXA 4WW1A 1R3JB 4NNYA 4LCWA 3VXSB 5IV2B 2P8LB 4WU5A 2W38A 1RZ7L 3BPLB 4KUCF 2P5WA 4RFEA 1A14H 1G7HA 4GG6B 5ICZB 1F3DJ 4MSWA 5AZ2L 2AABH 2H2SD 4CAGA 3FFDA 3K74B 1UGNA 4KY1L 1YN6B 4XNUH 2AJUL 3SCMC 4PPTA 3EJJX 4YUEH 5F1KC 1JWMB 1BD2E 4PG9B 1DBKH 1HSAB 2ZSVB 1H0DA 2BC4A 4K8RC 5I74B 1IFHH 3WKML 3FT3B 3NAAH 2BNRD 4ELKB 1MCRA 3RVTC 2OQJB 1U8OA 3JV6A 4YHLH 2EH8L 3UJIL 4IRJC 3V6FB 4LDOB 3ARFC 3WLWD 1IJ9A 4O4YH 7FABL 4YBHA 4BELD 1FNHA 5LBSL 4M8VA 3P0VL 1HIMH 2PYFB 3AVEA 4KI5D 2O61B 4FZ8H 3BAEH 5J13B 3QQ4A 5DT1L 3MRJB 4EIZC 3FOLA 1HKFA 5HHPA 1FVCB 1LDPL 2A83B 4L3CB 4P46B 1JMZA 5GGVH 1KIRA 3VFTA 1SY6L 1CQKA 1P5VA 1TIUA 4Y2DA 2VL5B 1T4KB 3WFHB 4DGIL 3ILQD 1I4FB 1QO3A 5C92A 1H5BA 3HE6B 2VB5A 1DQLL 4UOW1 2WINB 5CEYB 1QSEB 1JPTH 3QPQC 4JFYA 3BP4A 4P9HL 3RWDA 3SDAA 3ZHDA 3C8DA 3E3QE 1YEDA 2OMNA 4KI5F 3EYSH 1YN6A 3DMMC 1N64H 4S1QH 2NR6D 3A67H 5JW5A 3K1KC 4NN6B 3QO1A 1R3IL 3NCJH 1AR2A 4XP5H 2DIAA 2EDQA 3HNVH 4GMSL 4X5XB 5LGJA 5FV1L 1KJ3H 3MRGB 4HZLA 5TPWL 3VH8B 4LFHD 1OPGH 1VPOL 4JY5H 3OPZH 1W0YT 5AD0B 1NGPH 2Q7YA 2XPGB 4I4WA 4WUUA 3TNNB 3HS0B 3IS1X 4X7DC 4TVPH 2V7NA 4NQCB 5CD5C 2Y5EA 4P9HC 3D48R 3O45B 3OZ9H 2XKUA 3BN9C 1NANH 4BJLA 1NC4B 3TVMC 5E1HB 4YXKL 1FVCA 2AEWA 1TVBA 2W0FB 4NOBA 5J12B 4P46A 4G43B 6FABH 4HLZG 3ALPA 1BBDH 1TQBC 4UUJA 2IH3B 2MNUA 4OKVB 4OIIH 4Y5XA 4XB7A 1P7QD 3U83A 3EIFA 5D9SA 1AH1A 4WWKC 1MCSA 4U1LA 5E24E 3ZZ1A 1OAUH 1G7PA 3BIBX 1AQKL 3QXWA 4X7TB 2HVKA 5KS9E 5CJXA 4IMLA 5GQBA 5BMFL 3SDCA 1ZT4B 5C0EB 4G6FD 5T3ZE 3MRKB 4YHIA 5DHYB 3UZEA 3NIGE 4U7KA 2YOCA 3MV7E 4ZUVB 4QF1B 1FIGL 2GJ6E 5C6PB 3U1SH 1D5XB 1UYWL 5CHNA 1BF2A 4P3DA 5EO9B 4W68A 3MUGB 3RTQD 2FIKB 4X5XA 1RJZA 4Y5VB 1XMWA 1XCQA 1VHPA 2V5MA 5T1KA 3BDBA 4ZOBA 3TGXA 2JJSC 1EFQA 3GIZL 3NGBB 2WBKA 4I5BA 5C0ND 2HTKD 4DEPC 4DVRH 4EUPH 4PFEA 3HS0A 3O3UN 4FXGB 1GYAA 1GOHA 5DXWA 1BVKB 1U3JA 4M00A 5C08D 1HYSC 1IZJA 3N1GC 5C0JB 1IKNA 4ELMB 1S7SB 3GMQA 4M7LH 4C83A 5DJ6A 4NM8H 4G43A 5I1AA 5BOZG 3L3KB 2EYTB 5L88L 3OKOB 3QZWG 1JMXA 4PRIE 5ERWA 5HGHA 4TSCL 2QTEA 2O5ZL 3VD9A 1J0YA 5A2FA 3BKYL 5T1MB 1SMAA 4FQXB 5KN5B 2BOBB 4Y4FA 4RX4A 4PRHD 1OP5K 3H3PH 1ZT1B 4HDIA 1D5XA 5ICYA 3EO1B 4KH2A 1JZ8A 2G60L 2P5EE 1FZKB 1PEZA 2FIKA 3KYAA 2VDNL 3PGCB 2VDPL 3QHZL 3AB0B 2YWZA 4G9FD 3STZA 1ZTXH 1X44A 4KJPC 1EFXA 2NY1C 4WUKL 4NJAL 1RFDH 3KPLB 1JZ2A 5JPNA 1QD0A 5EOTB 5K93A 3RI5F 4CVZA 3OKKB 1ITCA 1JUFB 3RWEB 3DURA 3KR3H 5J11C 2CRZA 2CKBH 2DJ4A 4K3EH 3Q5OA 5D7IB 2BJMH 4HUWA 2OL3H 4K3JH 1MREL 3MRCB 4Z0XB 3MZGB 4HIHA 4V1DA 3DVNB 2D03H 2EYTA 5I18L 3OTTA 3KPSA 3DTXB 5B38G 3QDMB 3CX5K 2JIXA 3RU8H 3PGDB 2WQ8A 2CXGA 1D5IH 3AY4A 3VGBA 3BISA 4LAJH 5D5ME 3VXRB 3U9PL 1G7MB 3QDGA 3QB7C 4O9HL 5JORB 5D1ZD 5T1MA 1K4DB 1AHWB 5D6CB 4UU9B 3CH1A 5C0BE 2ZJSL 4LLAA 1G7QA 2VE6B 3ARDB 3MROA 3ZYIA 3QJFB 1P1ZB 2NW3B 2UY6A 3SKOB 3KYNB 1A7OL 1JNLL 4PBVC 3QUXC 1I7TB 1Y18B 4M48L 3B4NA 1FZKA 5I16B 2PYEA 1ZHLA 2YPLE 3ESVF 4YR6B 2VWEE 3OXSB 3F5WB 1QRKA 5JXAL 1AGCA 2XTJD 4O58L 3HPJA 1F6AB 3H9HA 2XG5A 3BE1L 3OKDB 5IFJB 2HG5A 2FJHA 2HT2C 1HHJA 1W72B 4LKCB 3OKKA 4HJJH 3DHJA 4OCYH 4NQSA 1J10A 5D7IA 3FN0L 3REWA 3BWAA 3KHOA 5GRXG 2LQRA 3MRCA 1WSST 4CU8A 2MKLC 2IAMA 3UJJH 2BOCA 5IEHB 3MACL 3LCYA 1PY4A 3IDYC 1ETZA 4PJCF 4RQQB 4CL7A 3SQOL 3Q1SH 5JORA 4A6YH 3FO0H 4OLYL 5KSAA 5GS0D 1A1MB 1D5BA 1B0RB 4BQCA 1G9NC 4UU9A 3K4ZA 3EFFA 4OB5H 4XPAL 1CDYA 5GIRA 3QJFA 4KI5E 1UEMA 2NW3A 4QEGA 1J12A 5C86A 4KQ4H 1OARH 1HHGB 2FD6L 2X41A 3BXNA 3AM8C 5IEKB 4WY7L 4I18C 2YUVA 2AJ3A 1DJSA 5T1DL 2VNCA 1FBIL 2J88L 3IB4A 1Q72H 4GW4A 4JY4B 4QYOB 2Y4SA 3FRPA 4LEOB 4NNPH 4U1JA 3TESA 3X3GL 3I50H 2QQQA 4HIIB 4XVSL 4L8DA 2O5XH 3OKYA 4NZRL 2WNGA 3CXHK 1F6AA 2OS7A 4CVXB 4MJ6A 3VXSD 3OKDA 5FO9B 1ZHBB 1MRCL 2VXUH 3HMXL 3RDTB 1NGYB 1UG9A 5BXFB 4PJBB 5B8CC 1OWWA 3KYOB 5DJCB 1CTNA 1G9ML 3T1FB 4JN1L 5TDNB 3ARBB 4ZUWA 4XP4H 4I0PB 5EUKA 1HH9A 3G9AB 4D0DB 5FECA 3TT3H 4HCRL 3VGHA 1KEGL 4G80A 4YFDB 1HK6A 3ULVC 1JVKA 4NO5A 1ONQB 1YA5A 3L7FB 3QRGL 1C08B 4Z7NF 1N5YL 3QFJB 4OT1H 1B0RA 4PRAB 5IVZA 5HHQB 5IJVA 4O51B 2BHYA 2CIIA 4ONGH 2R0KH 1NGWA 4N0UA 2W60B 2W65A 4JR9H 4GG6F 2X9YA 5EB9A 1TZIB 2MCPH 3PP3K 1G9MC 4ZUTB 4OGYH 3AU1B 4YPGA 5E8EB 4HHAB 5IEKA 3GJFA 3QNXA 3QO0A 4IS6A 4IDJH 5D7KD 5MHSD 4QYOA 1CL7L 2EDWA 2OM5A 3SGKC 4FQQB 1KB5L 4P46D 1DE4A 5HHXH 2HRPL 4JPIB 4XCFH 4ZS7H 1P7HL 3VWJB 4I8DA 4PD4K 1AGEB 4I48A 3V4VH 2C4XA 4LEXH 2AJZA 5FO9A 3HE6D 3KPOA 3BP7A 5BXFA 2EIDA 4RMUA 2FYYA 4G3YL 1HH6B 1QSED 3FFCA 2LTQC 5K59F 4OV6F 4GKNB 5F7KC 5F3HB 1NCCH 4LNRA 3TNMB 5KVFH 5HI3C 3UXFA 3HN3A 1BFVL 1GH7A 5D72H 3BH8B 2OX5A 3MOAH 4O5LH 2GHWB 3BKCL 2ZOLB 2A6KB 2HLFD 2YWYA 2CK2A 3BGFC 1TJGL 3UTZA 1TTFA 3WS6A 15C8H 2Y5TB 3QFJA 3CLFL 3LRSA 3MLTA 3MUZ1 2HT4C 1OD7A 2OTWA 5F7FA 5D7LA 5C08E 2ESVA 4P3CL 4O02H 2N7AA 4TPRL 3GHBL 3MNWA 3AU1A 1CBVH 4F7CA 3QYCA 3LS5H 2WBWB 4FQQA 4YDJB 1AP2A 3SKJH 3LD8C 4Y16C 1CXFA 4JZJC 2H32A 3MNZA 1AGEA 3M07A 1SEBB 3PQYA 3ROLA 3RUGA 1T89C 4GQPH 5DK2A 5GGTA 1FLRH 2BY3A 5E7FA 4ZO7A 3IF1B 2B1HL 1U3HC 1NC2B 5C70A 1W0VB 3C5ZA 3O6FA 5JIHA 5DJ8A 4O2CB 5F3HA 1EMTH 1BJ1H 4XP6H 4PRHE 3MA7B 1DQDH 4Y4FD 4LGRB 4X8XA 1RUKH 1I75A 3ES6A 4EOWH 3BH8A 3GK8H 4GLRH 1N6UA 3CVHL 5IB2B 1JPGA 3QQ3A 3LSOA 4LLVB 2JTDA 2GFBA 4G9FE 1A7RL 2Y5TA 2FX9H 1TCRB 3B3IA 3BPOC 3V5DB 4S1SH 2KQNA 3IYLW 1X5FA 4S0SD 3MBXL 5IBUG 4D94A 1A8JH 4X5WA 3G5VA 1MCPH 5JZ7D 1OSZB 3O3EB 4YX2H 1FZOB 4RAVB 2N4IA 1ZS8A 1CD0A 1ZAGA 1JE6A 2Y72A 4KKBD 4MXQD 4XP1L 4HWUA 5FCSH 5FYJH 4V1DD 4FN0A 4JQVC 5D7JB 3KPSD 3QZWB 4I2XB 3X13B 2BNUB 2DLGA 2A6IB 4ZDHA 4OUOA 2CGRH 2CKNA 5E2UL 1K5NA 4I77H 4YE4H 3RWIB 1Q9WA 4KRPB 4YEEA 3LKOA 1KLGB 4UIKL 1GCFA 4XH2B 1RIVH 4PY7A 2OZ4H 3NH7H 4PRPB 4FQXD 5KANG 1TCMA 4EI6B 2R69L 4XI5C 3IAQA 1JBJA 4JVWA 4XVJH 1GZPA 4GKSB 4H1LH 2D31A 2R15A 3WJJC 2R2EA 3EAKA 1PVHA 2VDML 5EU7E 4U1NA 4PJCE 4MDJB 2PYED 3MRNB 1MFAL 5T5NF 4PRBA 4I3RL 2IQ9L 2XTJE 1L6XA 3O41A 5GRUL 3LY6A 1UM4H 5D2LB 3VWKC 2XOTA 3TBTB 3GSXB 1MQ8A 1ZHNA 2QR0B 3O2DA 2EIBA 3GBMH 1S7UB 2CLRB 1G9EA 3RVWC 1S7WA 3HZMA 1FZOA 1KUMA 3VD5A 4R4ND 3RGVB 3K2MC 4NSKB 2VRAA 4F9LC 1VKXB 2EKSA 3BZ4A 5B38B 5D7JA 4NWTL 2IAMD 4DOHB 3NZ8A 2FZ3B 3MGOA 2BSSB 4KTEL 4Z7OF 3MV9A 4FNLL 4NT6A 4L4TA 1PX4A 1MIML 3S37X 3D39B 1QKZL 1E4WL 3U36B 3MV01 3WDHA 1RU9H 1NMBL 2DM3A 1DUYB 4KMQA 2B2XL 3SGJA 3TF7C 3OBAA 1UT9A 3ARGB 4DVBB 2Z8SA 3U6RB 3ARDD 1BBJA 5C0FB 2HKHH 4U6VL 1A64A 3SY0B 5HGBA 3NFNA 5D7IF 3ROOA 1KYOJ 1K6QH 4QOKA 1XGYL 3RIAF 5DD6A 2VXVH 4WV1C 4PJDB 3TFKD 2ATPB 1CK0H 1J05B 5EC1B 3QRFM 1DLHA 3QEUB 4BKLB 4U1GC 3AREB 1LO0L 1AE6L 4KHXL 1NAMH 4W4NA 1EZVY 3RVXC 3K4DA 5BS0A 3TBTA 1A4KA 1I8MA 2JB5L 1ZLSH 5C2BL 4GG6E 2AS5M 2V7HB 1CFTB 4HEPG 1CLZL 5DGRA 1PYWB 4JHBA 1FH5H 1OTSC 1NGQL 4RA0C 3RGVA 5DSCA 1IC4L 4GXUM 4HULB 5FOJA 1PAMA 2JJTC 4LARL 3KLSA 3JWOL 1FV1A 3D39A 4WW2A 1QA9A 2MTPA 3BKJH 3U36A 4MNHA 1MFDL 1RI8A 1QSFA 3IDXH 2H3NB 1XGRA 1IAOA 5K59E 4Z76A 5FKPA 4ISVB 5GSRA 1I7ZA 3BO8B 4ACPA 4ZPTB 3F7VA 5HYJB 5MP6L 4JM2A 5TE7H 1JWSA 2VDKL 2DMKA 5D7KE 5MHSE 4X0KB 4N8CL 4NZTH 2F5BL 1Q9OB 2R29H 4OAWB 5DMKB 4KXZH 4G6ML 1A9BB 1FG2A 3DSNA 3HR5A 3K0WA 3KPMB 1IGJA 3VFSA 5D6DA 1OOAA 3D9AL 3FB8A 5EOCJ 1FVEA 3JWOC 2OK0L 3OF6D 1CVSC 2ORBL 1T2QH 2X4QB 3QCTH 4KVCL 4HF5L 5CILL 4AT6B 5EZJA 3QUMH 3RDTD 1F90H 1TJIL 4IOSD 1J8KA 1QSEE 1NKOA 1J1OH 2F54A 4OLUH 1J5OL 4G8GB 1BM3H 4CJ0A 2FATH 2DL9A 4Q9RH 5CZVL 4I13B 2V17H 4M1GL 5ITFB 2WIIB 1KENH 4K71C 4XX1E 4I0PD 5BW7A 3KG5A 4JPWH 3UX9B 4S1RH 4HXBL 3DYOA 5BJTA 3FAXA 2CDFA 4IOIB 4JVPA 1BLNA 4X4ME 4L4VB 2J5LC 3QFJD 4EI5C 2GCYB 4M7LT 1NSNH 3Q6GH 5KVEH 2DLEA 3MREA 1HILA 4F9PA 4FRWA 2NY6B 1OAXL 1PZ5A 2NY5C 4JLRB 4JQIH 4ONHA 5IM7A 1EJ6A 2ESVD 1XF5A 2PO6A 1W0WB 2BSED 4ODSH 4YNYA 2GEEA 4AEFA 4DK3A 2AGJH 1SYSB 4PP1C 5DMKA 1WZKA 4YHYC 1J11A 1RZ8B 3NFSH 1INEH 1WWBX 5IMMB 1IEAB 4K07A 1AGFB 2GI7A 4RWHA 4JDTH 2DQHL 1I9RH 3EBAA 1AO7A 1DBBH 2WWKO 3GHEH 2AKRA 2VLKA 5GHWL 2R2BB 4BFIB 1I1AC 5EC2A 1NUDA 3O6FD 4EDWH 5CEZL 3QULB 4MB4A 2EH7H 3GIVA 3B9EA 5MENB 1MFBL 1G1CA 2WIIA 1I7RA 3PWUA 1A2YA 2X40A 3QH3A 1KBGL 3SPVB 1OTUD 5D8JH 4UV7L 2EXYD 3V5KA 4PS4H 1FSKB 4MJ5A 3WIFB 1OQXA 3MLXL 2GCYA 5E70A 1I1RA 1CWVA 3S34H 3VXNA 4J8RB 4JLRA 2X05A 5KANI 2VR5A 2BDNL 1XH3B 5HHNB 1EAJA 2GAZB 1N0XL 3M8OH 2EZ0D 2GK0A 4PJAB 1KC5H 4XPFH 2VLMD 3ULUD 4V1DE 4ZAKB 1L9MA 5F7EH 3G04B 3KPSE 5E6ZA 1HXMB 3NTCH 3ZT7A 3SCMA 4RFNB 1AGFA 2XFXB 5CWSB 4CW1A 5JDSA 4XZUB 3D85B 4L3AA 4ZO9A 2X42A 1CDBA 3LN5B 5I1DA 2Q87A 4P2RB 1S9YB 5EZIL 1AXSB 4HWEL 4OGZA 5JUEL 4BFIA 1ES0B 5F9WB 3F12A 3ORJA 1QUNA 3N1MC 3BUTA 4IRJA 4LLMB 5LG1A 3ARFA 4BQ9A 3WHXA 1OGAA 4QHNB 3HI6L 5D2NC 5KTEH 3ULUF 2H6PB 1DFBH 4RBPH 2PYEE 5EBGA 1FYTB 4L9DA 4PUBH 5GGQH 4Z7OE 5I75C 1TITA 4U6YA 3WIFA 4UDTB 4BQBA 3W0WB 2BVYA 3LKRB 5F7WC 2VLLA 5M94B 5LCVL 4AEHL 1RVFH 3R06B 5J6GB 2VQUA 1GGCL 5J3HC 3CFKB 2FR4A 1QHOA 4WI7A 3UCRA 4XCEA 4GRMA 5IBUB 4KRNA 3RL2B 5CJ5A 1W8OA 3GJEA 5D7IE 3QCUH 3C09C 5C6TL 3ARPA 1MLBB 1NDMB 4D3CL 5IB3B 3GDBA 1C1EH 4PGDA 1QR1B 3SN6N 4ODVH 1QFUH 3T2OA 3S97C 3RVUD 5D7JD 2EDYA 5T1LB 4QT5B 3DMMA 3QG6B 5CWSA 5EA0H 4FFZL 2DB8A 1GGBH 1D6VL 5LVEA 4KRPD 4W81A 2C3VA 3RIFF 4JKPL 3TH4T 1AXSA 3WHE1 2BVQA 4PRPD 3VRJA 1NEZG 2AV7B 4N5ED 3BIAX 4KZEH 1DL7L 2IANB 5IF0B 3MJ6A 1ZGLM 3BESR 2QJDA 4I1NB 2L0DA 1NL0H 4HSQA 3DVGB 5ACZB 3U7YL 4I9WE 2H6PA 2DYPB 2QADB 3MQIA 4DQOH 3DARA 4F80A 4K2UL 4BQ6A 3W0WA 3TVMA 4QRPB 5I1IL 4OCXL 5KG9A 5DVMA 5DEZA 5F1IB 3R06A 5J6GA 3CDGB 4LPXA 5DD5L 1ACZA 4UNUA 1MCHA 5EZOH 1YNKL 3RWFA 1RZJL 4WWKA 2B5IC 3RQ3A 5DUML 3HPLA 5I1KL 1MFEH 2HJLA 5C0RL 4JFDB 1XF4B 2D9QB 1ZGLB 3RGVD 2CLZB 2IWGA 2AEPH 2F19L 4P5TB 1OWRM 1JTOA 1NCAL 1IVLA 1SJEA 3FHAA 4BSWA 4Z78B 1YQVH 2DTML 1MQKH 4H88L 2Y7QB 4Z9KB 4LL9A 3D39D 1LO5A 4CUCA 4ZTPL 1RZIB 1XGUB 4L8BB 2A74A 5D2LF 1WFUA 4OLEA 2VZSA 4NBZB 4OCSL 2JJSA 5E95B 2NY1B 5IF0A 3HAEG 4PLKC 1A5FL 1M6OA 1LO2L 5JLZA 4P23C 1KEML 2FGWH 1GHFL 1NGXA 2CLVB 3D25A 1JGLL 5DLMH 1N8ZA 5I1EL 2ZCLL 4N90E 3N85H 4E0RB 4H0GA 1U8PB 4LLQA 3G6JB 3MX0A 4LHUA 3ARED 4F7PA 2APFA 3BKMH 3I6KB 1VCAA 2FJGA 3DBXB 4XP9L 1CG9A 1KT2B 4M6NH 3CDGA 3KJ6H 2V5RA 4FZEL 2DQFB 4MYWB 4ZFOL 4OBSA 2FX7H 3U46B 4QY8B 4WI6A 4YHKH 1ZXQA 4HJGA 4NO2B 1M7IB 4PV8B 4HUMB 2YR3A 4M5YH 4YHNA 3VXTB 4G7VL 5DK3A 3V4UH 4P59L 2YPVL 4U3CA 2CLZA 3FQNB 3GGWA 5DEGB 1RZFL 5C0DB 4KK6D 4L8CB 1TZGH 1U8NB 3UTSA 1I85C 3BD4A 2W9DL 1HKLH 1G6RA 2V5TA 4PJDF 3S36L 3EJZC 3O6KL 5HPMB 2IBGA 3F7QA 3QFJE 4HQQH 4QXWA 3BI9X 1XGUA 4AJ0A 3RWHA 1JHTA 25C8L 1CDCA 3E2HC 1S7VB 4NCC1 5EOQH 3LZFL 2ESVE 3DJ9A 2O5YL 5F9OL 2H41A 5DD0L 3SKNB 2R0LH 3VI4E 5HYJD 1OHQA 4TUJB 5CD3B 2BVOB 4WFED 1FGNL 1DBAH 1HEZB 4PGJA 5I71C 4HW6A 4RAHA 3MBEC 4M7KH 3QXVA 1QQDB 3EZJB 3GSUB 2A1WL 4HH8A 4MA3A 1F45A 5HHVL 5ETUB 2IADB 3HA0A 2Y06H 4UAOC 5E08L 4WO4C 5DEFB 3CIQA 4FABL 1UB5B 4GW1B 1F11B 1LWRA 1AJ7H 4RIRB 5AUMA 1BQLH 3DSFH 3DX6B 4LVOB 1I1CA 1M7DA 5CZXC 5DA4A 4G8GD 1MAMH 1MHCB 2Z93A 5EUOB 1K4CB 3FO2A 4Y89A 1KJ2A 4ZUSA 5JOEA 4R26L 2M1KA 2FX8H 3C6SB 2P24B 1RZKC 3QUXA 2X4NB 2VDRH 3C87A 4R96A 4JDZA 5E8DH 4L4VD 3SO3C 4OCWH 1ZMYA 3G6AA 1A3RL 4LSSH 4R97C 2FEEL 4JFXB 3ZKNC 1S9KC 5J1AB 3BVNA 3DRTB 2PR4L 2NY6D 3MRDA 4IIQB 3NFPB 4MD0A 2VH5L 5DQJB 1KCUL 1KCRL 4XPHH 1I1YA 4J3SA 2NXYB 4OGXH 4DUWA 4TUJA 2VLME 1CE6B 3ULUE 2X89A 4KFZC 4WCYH 1YECH 1KB9K 4DAGH 1QQDA 1JI2A 2AK1L 3GSUA 4QTHB 1TTUA 4R4FH 4HKJB 1EHXA 4M61A 3O6MH 3CCHA 3T0XA 5EPMB 1VERA 4ZOEA 1A6ZB 4Q9BA 1UB5A 5E6YA 3MV8A 2L7UA 4X8JA 4K8RD 2QHRH 3SKUD 4M43H 2QKIB 4N1CA 3CFCL 1IGCL 5MEND 2YD1A 4HS8H 4OF6A 3ARFD 5FA4B 1A9EB 4FQPA 3R1GL 3LEVL 4TOYL 3C5SA 2WUBH 4OZFG 3AM8A 1NGZB 4I18A 3TO2B 1JV5A 2I5YH 1B3JA 5JR1H 4JFXA 3VGDA 4JO2L 1CR9H 3DRTA 4YC2C 2PN5A 5LQBH 4AIZB 1AGDB 2OXGA 4BYHA 1KN2L 3ZTNH 1R6VA 4J23A 1YN7A 1T2JA 4OZGA 1S7RB 3MRQA 2BERA 4GQ9L 1MWAH 1YMMA 5C0AA 1MJ8L 4ZAKD 5B8CA 3SDYH 4U0QB 2H2PD 2X4UB 3QPQD 5GGRA 2YBRB 2VISB 1J8HA 3BP6A 4RMSA 4WHCA 5DJ2A 5ID1B 4MAYB 1KN4L 3QEHB 4L4TE 4KI1A 3D85D 3N50A 3ZKMC 4CN1A 4HK0A 2PUQT 3DI2B 1EAPB 5D1XB 5TDPA 1KB5B 5GXBB 1U8LB 4OGAD 4P2RD 5AG8A 3FTGA 4NHCL 5I6XC 2I9LA 4LCIH 4PRPE 4XPTH 1I9JH 5DD3L 1YUHA 1OSPL 4NQVB 2KH2B 2QL1A 2ENYA 4FFWC 4UTAL 3WUWA 4QXUL 2XNAA 1YMHA 5BCAA 3LH2L 2ZG3A 4OLVL 1KFAH 3M1BA 1PKQB 4PJAF 5E1AA 3AS2A 1OP3H 4QOKE 1FORL 5CD5D 4TTDD 4PJIA 5DMJB 4CDHA 4GRWB 5IFAL 1UWGL 3FB7B 4Z95L 1G9NH 1X5IA 1KXQE 3TVMD 3W0WD 2X1PA 2EIZB 4HS6B 4U2YA 3SGKA 4R4BA 2AAVA 4K7PH 5D2LE 1QYGL 2HFTA 4O2EB 5BS0E 4TUKL 2PTTB 1CLOL 3VFRA 3GBNH 5J4MA 3C8KB 2D0GA 5GSVA 5L8JB 2CUIA 4G8EB 3ISWA 2ZWLT 4FQCL 4BA8A 2JELH 2IALB 2EDJA 5TF0A 5HHOA 2Z35B 1B0GB 3ZYZA 2AXFA 2D0HA 4M6AA 3UBXG 3L1OL 4HWBL 5GZOC 1JK8A 3RWJA 4DOHE 1AY1H 1DSFL 4JRYB 2VISA 5T1LD 3IDNB 3TM6A 1AD0B 1H3UA 1X6LA 3D39E 1U8JB 2CMRL 1AKJA 1EAPA 4RNRA 2X70A 1BIIB 1OAZL 5DMIL 3MO1A 4M5ZL 4FFYH 1IEBB 1NEZB 2NZIA 2A6JB 3MLYH 2LAGB 3H7BB 1YNTB 3QBTB 3T8XB 3QIBB 1S9WA 3IFNL 1FE8L 1CFNB 4XMPL 3ZE1F 5CUSL 1PKQA 5MI0B 4H20H 2VDLL 2WV3A 3O4LB 3BZDA 1DLFH 2DDQH 5L2KB 2DYPD 4M62L 2QADD 4PJDE 2VQ1B 4U0RC 3W5MA 3FB7A 1P69B 3QEQA 4G8IB 4QRPD 4XNYL 5LWYL 1MJJA 3ILPA 1ND0A 1YEKH 4FQHB 3CVHB 4Y16A 2NLJB 4YQXH 4Z5RB 4ESKA 2C1OA 1L4IA 5GRVL 2PTTA 4OD1H 4C4KO 4WTXA 4JZJA 4XMKH 5EU6B 3DRQA 4MJIA 2PW2A 4BZ1L 1PQZB 2F54E 3JV0A 5F8QC 4QRRA 4Q9QL 4QRQA 2AJVL 1T89A 1M7XA 3GI9L 4JFDD 2IALA 4X9BA 5FYLL 1WLHA 2FNBA 2FJFA 2VZOA 2Z35A 1U3HA 4OF7A 4FQ2H 2Q8AH 2AXHA 2PTVA 4DGVH 1J87A 3UTSD 2RGSA 1RULL 2XZCL 2YD9A 4LNVA 4W6XB 3CZFA 3N1PC 5CSBA 4KK9C 4PJXB 4LPCA 4YDVB 3O11A 1NEZA 3HZYB 1ORSA 1FL3B 3MOBL 4RRPG 5IMKA 3HAEB 4B7LA 2NY1D 5HYJE 1F2QA 4U33A 1NCNA 1GOGA 3GRWL 4WFEE 3TIEA 4ZSOA 5FO8A 4MB5A 1RJYB 2ICWJ 2ZNWA 3TV3H 2R0WH 1RD6A 4PP2A 1XCTA 3QAZC 3IFLL 1H3WM 3QCVH 5CGTA 3FQXB 5DJYA 4JQVA 3LHPH 1P4BL 5A2KH 3EYUL 3S4SG 1N4XL 2VLKE 2HWZL 4G8GE 4PYGA 3PJSB 5L9DH 1U8IA 3BSZH 1A0QL 4R7DA 4BM7A 1EEUA 5EN2B 5DVLA 1D5MB 2DD8L 2BNQA 1MVUA 3F7PC 1IT9L 3HE7B 5IGXH 1WQVT 3QXAA 5HJ3B 4IRZL 3P4MB 3FZUC 1AGBB 3WJJA 3QUXD 4UB0L 3IXAA 4L4VE 5A2IH 3MJ7B 4RGOH 2D7QA 4X6EA 3BT2H 3BJLA 4U1KA 2JF1A 4W4OC 1CIDA 4YDVA 1BVZA 3QNYA 1DR9A 3JTTB 2XWBB 3QDJB 1Z0MA 3BQUB 3IDUA 3IRZA 4U1SA 3UROR 3VWKA 4APQB 4Y4KB 3LQAH 3WFEH 2AXJA 5GRZA 1SEQL 3O9WC 4EVNB 4LQFH 2QV2A 3MXWL 1W72H 4OTXL 2CR3A 5B3JF 2XWJB 4F9LA 1F3DH 4PTUB 5K9JH 1CGUA 2IH1B 4Q6IC 5DHVB 3MLSH 3L3DA 3L6FA 1C5CH 3PJSA 4G6JH 1H3PL 1YYLL 1CQYA 2AEQL 4W6WB 5DRZA 3FQTA 4LAQH 4MHHG 1CVRA 1RHHB 4PGCA 1OGAE 4YHPA