2ZPKH

Crystal structure of p20.1 fab fragment in complex with its antigen peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
b'EIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGWINTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREGPGFVYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG1-lambda P20.1 Fab (light chain)
publication title Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 208
sequence length 216
chains with identical sequence I
ec nomenclature
pdb deposition date 2008-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH02
1I9RL 4IRSB 5HI4C 1J8HD 1KTLA 2VL4A 4WWKD 3FQRB 3EYUH 1MREL 1ED3A 1BFVH 1DQDH 3LKSB 3FKUS 3RDTC 2GITB 3WEXB 5E2JA 2XQYK 3NCCB 1EO7A 5I0DA 4OD2B 1DVFA 1FRGH 2VISA 2KQMA 1IGFL 4U1KA 1RURL 1P4LB 3B4NA 4XCCL 3K80A 1OP5K 3JTSA 5JHDE 1UXWB 2EKSA 1FL5B 5HHOB 2R4RH 3WFEH 3GHEL 2DLIA 3MCKB 2VL5B 1IC4H 1OGTB 3GRWL 1BAFH 4QRTB 1UZ8A 3BEWB 5B4MD 2ENSA 3DX6A 3EFDL 4U31A 2V9TA 4HWZA 2Q76B 2EH7H 1F58H 2HTKC 3BE1H 4NQSA 2YBRB 4XNYL 3RWIA 5I15L 2F5BL 5KS9B 1B6UA 1AQKL 1OM3L 3LEYL 2DI9A 5DJDB 3TT3H 4YAQA 4N90E 4WI5A 1QVOA 3O6FC 3MREB 3QWRD 5EPMB 4UTAL 2W9DH 3OF6A 1ZSDB 4DFHA 4G6FB 1FVCA 1S7WA 3MA7B 3BQUB 2EDLA 5TGBA 3LVEA 3BGAA 1FYTD 5KSVB 4KJYA 2VITB 5JQ6L 1YYLH 4ZXBD 3TZVB 3QCTL 3VXME 3HTLX 4EBQH 5F9JB 4OLYL 1VEOA 1KJMB 3MRNB 1SJHB 2C26A 2NZIA 5C7XH 3FOMA 5T1DH 4MAYD 1P5UA 1FP5A 4NFDA 2GT9A 3MOQA 4XWGH 5BV7C 1NAKL 1QNZH 5DSCA 3N85L 4OFPA 4YHPA 3K8MA 4HIJB 5D7SL 1T20B 2DQEL 2WLYA 4MXQC 3HRPA 1T83C 4APQA 2WW8A 2O5ZH 5B38B 4UILH 4PJ5D 2X05A 3EW3B 4PRPE 4DVRH 3HLAA 4P3CH 5TFSL 1JRHH 3N1FC 4N8VB 3CDCA 4R8WL 3WDIA 4ZG1A 5D7IF 1ZS8B 4H8WC 2CKNA 5IFHL 1BJ1J 5CCKL 1KB9J 5CKAA 1S7QA 4KK6C 3QNZB 4OF7A 3FT3B 4Z18A 4C56B 5JHDD 4NQXB 4JANA 4TSBL 4V1DA 5DQJA 1FIGL 4PJ9A 3NZ8B 3TVMA 4JPVH 1ZWIB 2NZ9C 1DE4A 1TLKA 4OT1L 1N5YL 1D5IL 4PJ7B 4PJAE 1EEYB 3V4VH 5L6YH 4LSSH 4DUWA 3WO4B 3GBMH 2APBA 1TETH 1NCNA 1RMFH 1CD1B 1QSED 4DGYH 3TLRA 2NY2B 1I4FA 2IPUG 5JW3H 5KVGH 2AQ2A 4HGWB 4N90D 1KCUH 2H3NA 2B39A 4PJEB 3D0LA 4HXAH 5F6IC 5BMFH 3G08A 2YD3A 4X8XA 1AGBB 3ZSSA 3WMSA 5KS9F 5CZXD 1LP9E 4ENED 4I3SH 2FO4A 3QUZA 4FTVB 1DQMH 1IKFL 2W60A 15C8L 4XMKH 2OZ4H 5C86A 3SGDH 4WJ5B 1ZLVH 4PUBL 3VXMD 1RUQH 1OT2A 5MEQB 4U6HA 1GOHA 5IEHB 3S97C 1SEQL 5TE6L 3G04B 4UNVA 1IL1A 1DEEA 1U93A 1ZHBB 3FO2A 2FWOB 2ESVE 3ZT7A 3UTTB 4FNLH 1S7XB 2DJ4A 3ULUC 3FQWB 4DTGH 5BXFA 1ZLUK 1FHGA 2A0LC 4BUGA 2AABH 5D93C 1ZTXL 2DL9A 1AY1L 1OLZA 4MSWA 2V6HA 2DQGH 4BUHA 1OTSC 4ZMAT 3RUGE 4P9ML 1OGAE 1R3LA 2I9LA 2UVEA 1MNUH 4M7KH 3P73A 1IZKA 1JZ5A 3VXRE 1K5NB 1NCCL 2DD8L 2APXA 2F58L 3CFKA 5FF6B 7FABH 1REIA 1QR4A 4TSAL 4XRCA 3T2OA 2NY6D 3JUZA 1N64L 4OLXH 3FAWA 3E2HC 4JO1L 3HAEB 5JXAL 4XAWH 1IVLA 4ORGA 4PB9H 1IQDA 1JYWA 1NCAL 3PGDB 2Y6SD 5C1MB 3WFCL 5IB3B 3U82B 4UQ2A 4L4TB 1C7SA 5EUOB 1F4HA 4UDUA 3RA7L 4I18A 1G84A 4YUEL 2OBGA 1U8PA 1ZVSB 4ZFGL 3P9WB 4XPBL 3QIWB 2ZPKH 4EEEA 2C7UB 2NY1C 4K7PY 1RZ7H 5CEZE 4UAOB 3FRPA 1UB5B 4FHBD 1BZ9A 1J9CT 1XF5B 4Y5XC 1U8NB 5DVLA 3WIFA 4GLRH 4XXDA 5DEGA 3O6MH 1FVDA 1GIGH 4LCCB 4Z7UE 5FECA 4DZ8A 4XP5H 4PJ7F 5SWSB 2Q8AL 3CMOL 2OR7A 3GKWL 4JJHA 2JCCE 1F11A 1RK0B 2GHWB 2O26U 4QHNB 1H3TA 4NPYB 4XMPL 5EZIL 4X8JB 2KL6A 2YPVH 1OLLA 4JG0H 2EE3A 2NLJB 1OPGL 2BVQA 3P4OB 1KGCE 2Z31D 3QCVH 2W92A 2H45A 4ZOCA 4HKZA 3HE7C 3OXRA 3TYGH 2F53E 3EYQC 4JKPL 2LVCA 3IU3B 3RPIA 1JF1B 5FAAA 4G9DB 2BRRL 2X1XR 4FXGB 3H3KA 5CP7A 5IMOB 4JY5H 1YN7B 3VWJD 4N0RA 2PKDA 3QRGH 3VWKD 2G5BA 4IHOB 4GT7A 1JF5A 4OD1H 4I77H 4Z77B 4UV4H 1PZ5B 5C2BL 4GUPB 1I85C 1T0NA 4HWBH 2XPGB 4JPIB 3FO9B 3B9KA 1XF3B 3X14B 1RUMH 2IG2L 1X7QA 3MRBA 3T2NH 1TCRA 2VIRB 1PEZA 3VFOA 3EDKA 4X4XB 3VXRD 4AENA 4P23D 5IT2L 2CLRB 2IPTH 3O6KL 2BY2A 4ZFOA 1BQLL 3KWWB 2N56A 4NCC2 4WTXA 2BFVL 4J6RH 3G5VB 3GMOA 5E2VH 1VERA 3BP4B 1BFOA 2AXGB 4QRPB 1XH3B 2DOCA 5FCUH 1FORH 5E08H 1ZT7B 2D7OA 5D1ZA 3DO7A 3MRGA 1SYSB 1NBYB 1CGUA 1NC4D 3CSYB 2OTUA 3L3DA 5K9OB 3K4DA 5L2KA 2KH2B 4P2OB 3CLEH 5DD0H 5B8CC 5CEZD 1MPAH 1QFUL 3O9WD 4R4FL 4CDGC 4CVZB 4L3EE 5BCAA 1CVSC 1W0WB 4DK6A 4MHHG 4OCWH 4M48L 4OKVB 3MZTA 3EJZD 4EI6B 2XRAH 2AW2A 5J11B 3ROLA 4DVBA 3SBWA 5D1XD 3B2UC 4Z95H 3WXWL 1A4KB 5FOBB 5C6TH 2B1HH 3F12B 3KPRA 1WAAE 1RULH 5M94B 5T33L 3QEGL 4NN6B 4JM2B 3C09C 3GSNL 4JKKA 4KQ3L 3WFDL 1KGCD 2ICCA 3RBSA 4UBDC 4FQCL 2F5AH 2Y4SA 1OAYH 4FXLA 4NZTL 1MFAH 2VXQL 2F53D 1S5HB 3WKML 1J1PH 4G8GB 1WFNA 4X4MA 4QXUL 1VFBA 2IANA 3BWAB 3VI3E 4GRLD 4OSUH 3LQMA 3BESR 3S7GA 2F19L 2YZ1A 3HUJA 1F3DJ 4XCNA 2R23B 5FOJA 2P5WE 3T04D 5JOPE 4BZYA 1QR1A 1J7VR 4O2FB 4WFGD 5J13B 1JV5B 1JGVL 2A38A 1ZANL 3O4OC 2PYEE 5CIPH 3WJJA 5J3HC 4NRZB 4CN6A 3ZKNC 2M2DA 4YEFA 2WBJD 5CHNA 5CJXA 3SKJL 2CJUL 3S36H 3ZL4L 1LK2B 3OX8B 3MGOA 4WUUD 1LWRA 4L9LC 3NN8A 2BVEA 1NCBH 2FSEB 1CGSH 1JPTL 1Q9WA 4N0UE 4PTUB 3RL1B 4U1SB 1A21A 1RJZA 3FB8A 5DURD 1DQJB 3MACL 5E8EA 4GKSA 4XP6L 4CGTA 2HFGH 1NSNL 1A3LH 2EKJA 3C5ZA 4K3JH 1CGWA 1P6AB 3DRQB 3R0NA 2X4TA 4ODVH 4GBXB 4QHKJ 3W9EA 1DVFB 2P47B 2RR3A 1XF2B 1PLGH 2N1KA 1S7VB 1CBVL 5FCSH 1ADQA 4PRBA 2X4RA 1OP5H 3BHBB 1EGJA 1KTDA 1JGLL 3SDDA 5D6DA 1MWAH 5TDOB 3AXLA 2QSQA 3OHXB 2XG5A 3MR9B 3GNML 4UTBH 1WCBA 3TWCL 1WWCA 3EFFA 4FQJH 3H42H 4KKCC 5INCB 3DECA 2V17H 1IILE 4I8DA 5MP6L 1JL8A 3CVIH 1DCLA 2XFXA 4XC1L 3RGVC 1P69B 3VH8B 1R24A 1I7TB 4L4VA 2XNAB 5F89A 4OLVH 3MUGA 1MCKA 5DVOA 3QZWB 3VXSB 4YHML 2VDKH 4L8CB 2F74B 3P40A 3H7BB 1HSAB 5DMIH 3BSZL 4M1DL 4QCIA 4YHZL 1IGCL 1VDGA 2BVYA 1CLZH 2IGFL 1IBGH 2Z91A 4XAKE 4P59H 3RWGB 4OCNC 3KR3L 3BH9B 5DR5L 1QRNB 5DMGC 4PGEA 4G6AD 4GXUM 3LZFL 3M8OH 3IJYA 3OKMB 2P5WD 3BI9X 1ZHKA 1A7QL 4P3DA 3SE8H 1RZIA 5I19L 3H6JA 5J89A 4PJ8C 4YHLL 2ARJB 4M61B 1S7SB 3AFLA 2V5MA 3WYRA 3VFMA 3FB6A 3VGBA 4PRNB 3HNVL 4XP4H 4UOW0 5D1QA 1JJUA 4Y5VB 3RX5A 4XVTL 1ES0A 1YNKL 4KUCD 4R9HA 5E8PA 3MRPB 3VFNA 3CX5J 1DLHA 5DMYA 1NDGB 5I1JH 4PRDB 3BP6A 2E27H 4K7PH 4O51B 4KXZH 4Y8AA 5IQ9A 4XBEL 5CBAB 5D7JD 3T65B 4WO4C 1BMGA 1OF2B 5JOEA 1U58A 5IB5B 4HAGA 1PY9A 2ZP0T 1RUAL 2OLDA 1SY6L 5C9JB 2X4UB 3QWOB 1MI5B 4NWUL 4DK3A 4OI8A 5SWZA 1WCQA 3O3EA 4R4ND 4HBCH 5E9DB 3IKKA 1UACL 4U1MA 5TH2B 3BMWA 4TUKH 1PEWA 2DQTH 2GCYB 3QUMA 1CFSA 4P5TA 2EDTA 2IAMD 5I8KL 4NO2A 4D9RD 3DJ9A 1JNHB 1G6RL 4QRRB 4HS3A 2JELL 3TP4A 4BZ1H 4N5ED 3D1MC 1OAZH 1NEZB 2V2XB 4PG9B 1QEWB 1A6VH 4NO3B 5AWNH 3CVHB 4D8PB 3UJIH 4ODXA 1A22B 2H9GA 1FL6A 1WEJL 3O3BB 5CZVL 3MROA 2R2EB 5KZCD 2A77H 1NGZB 4R6UA 3SDAB 1DEDA 1MEXL 2FYYA 4EDXB 5I18H 1HHHA 3KYOB 3UCRA 4LF3A 1UM5L 2VXVL 1OARH 4GMSL 2XZQL 4HZLA 5D2NB 5KVEL 4XAKD 3QIBB 1UQSB 5FKAA 2OL3B 4KRPB 2FX9H 3QNXB 4O9HH 5IOPB 1PKOA 5EUKA 3KDMB 2APFA 4M43H 5E2TH 3QEHB 1OQOA 3BKCL 3JZ7A 4PLNC 4QRSB 5DD3H 1ULVA 4XH2B 1DBJL 1MFDH 4PRAB 1JZ7A 4MQTB 3ZE2E 2NY3C 5FGCB 1AFVH 1Z5LA 3S98A 1MHEA 3BPNB 3MLSL 1I7UA 5EIVA 1ZLUH 4K7FA 4K3DL 3V7AG 4K3EL 2CDEA 2V7HA 4HIIB 2EO1A 1MHCB 4Z7QE 3CFCL 4YBLC 4XTRD 4MJIE 2BZDA 5EZOL 3GSNA 1EHAA 1T1XB 1E4XH 1QO3B 2BC4A 2G9HA 3PG2A 2JB6B 2R69H 3VFSA 4Z9KB 3HB3C 4H5SA 4GKNB 3KYMB 5T1LD 2YEZB 4MZ2A 1U8IA 5IMLA 1AJ7L 1D5BA 1QSVA 4U1LB 1BF8A 3RVTC 3MXVH 2ZNXA 1JGEB 2APTA 1FIEA 4FXKA 2ZOKA 3QR2A 4QF1B 5FYKH 1YEHL 4OM1L 1JPFA 1D7FA 4WV1C 1JK8A 2CKBH 2OI9C 3Q6FA 3DX7A 2ZZUT 4JFDA 4UNUA 4Q0XL 4D0DB 2C3GA 3ZDYE 4S0SD 1KFAL 4Q2ZA 1T4KB 2DKSA 4ENEC 4FQLL 1KB5L 3KPPA 2EEAA 4ZSOA 2X9XA 4ZNCD 1HQ4B 4H8WL 1ERNA 1MRDH 5EBMB 2ICWJ 3ZZ1A 2GFBA 3QUXA 3G5YB 4G9FB 3TIEB 3NGBB 3QB7C 4NKQB 3QDMB 1ETZB 2EYTA 1XCTA 4OIAA 1NGXB 1U95A 4OCXL 5IIEB 2W59A 2DLTA 3S36X 3DO3A 2IFFL 5IMKB 2D7MA 12E8L 1WUNT 3VXNB 1X6LA 1I9IH 2A6DA 3CX2A 3LQZB 5IHUL 2VN4A 3TC9A 3S35L 4ZPTB 1KEML 4ZO6A 3MJ7B 2EDRA 4P2CG 3TBSB 4YHNB 4Z0XB 4ZTOH 3L5HA 2FX8H 1K2DA 4EN3D 3EOAA 3T0EA 1NFDE 1C5CH 1U3HB 2JIXB 1A4JB 2D03H 2XA8L 5LG1A 5EIIB 2GTWB 3BDXA 4G3YL 4KQ4L 3BPCB 1RVFL 1CICA 2FHFA 4DFIA 1KBGH 4X6CA 2BNRB 1XFPA 1WBYA 2LU7A 2PYFA 3FB7B 4ONGL 4RAVB 1Z0MA 5FUOL 1XGRA 4D9LH 4MJID 4K9EC 1CL7I 3GIZL 2YUVA 1JMZA 3BWUC 3SDCD 5I1LB 1Y6KR 3GHBL 4JZNB 4XVJL 5I2IA 3CPLA 3ARXA 3ROOA 2FB4H 4NO5A 3ULUL 3GMQA 3RPKA 5F7HA 1BEYH 2G2RB 4M7JL 5BRZA 4D3CL 1DDHB 5K93A 4R96A 1HOCB 4I0PB 5HI3D 3VMOA 1F6AB 1EAPB 1H5BB 4JRXB 2BJMH 3TIDB 3DMMD 3HAEG 1N4XL 3QEQA 1QBAA 1G7MA 3MOAL 4HJJH 4OV6F 5HGDA 3DO7B 2B7DT 3D2UB 4P4KA 4POUB 5FHBL 5KJRL 2IQ9H 3V2AR 5HSFA 2UYLA 5E1AA 4P5MA 3PWLB 3O3DA 1CGXA 1UCBL 3MCLH 4JLRB 4HKXB 5GRJL 4UUJB 3UPAA 1TTGA 3KJ4B 1U8HA 4XPAH 4JHAL 4LU5H 5JUEL 2R1YB 5BS0B 4DOHE 4YH6A 1G0DA 1KULA 4H20L 4HKJB 1M7DA 3HPJB 4J1UB 4DVBB 2X70A 5GGSB 4JY6A 4L5FL 3CXHJ 1E4JA 2HKFL 1KPUA 1QSFE 4RMSA 3OTTA 2CK0H 4RMTA 3DBXA 4D2NA 3W39A 4QHKI 4X7CC 4UINL 1E6JH 4OFYD 5AAWA 4FZ8L 3RFZC 2A74A 3TT1L 3MV8A 3EO0A 4IRZH 5JPMA 4LP5A 1RZGB 3PQYE 4H25B 1KLGB 2D0HA 4BSVB 1PG7H 3I75A 4UU9A 1BIIB 3IXTA 1XGQB 4JFQA 4IIQC 3HC4L 4Z6AT 1NCWL 3R1GL 4P23C 3MGTB 4E0RB 3VXOB 2CGRH 3L3IA 5DJZA 3LS4H 5ITBL 2MWCA 1TJIH 4CN1A 1KB9K 2HJKA 4J3TA 4GXUN 2R29H 5F7DA 3EJYD 1WT5C 4HS6B 1S7UA 1KTRL 4PJIE 3GSWB 1DFBH 1U8JB 3L3KB 5FYLH 3VJ6A 5GJTL 4Q9RH 3GJEB 2EH8L 4YDKH 4JR9H 3UYOD 3M17A 1R3HA 3RGHA 2PTUA 4PRIE 3VRIA 2I5YL 4GXVH 5JTWA 1YMME 4MDJA 1EEZB 5GGQH 4XBPB 1RIUH 1Q1JL 1IM3A 3KVQA 4URTB 2H32A 3ARZA 3O9WC 1TQBB 4OJFH 1MFCL 3PWPD 2YWZA 1U8OB 4JFOA 1V3JA 4MVBD 4NZUH 3W0WB 1A6AA 2ICWB 4KTDH 5KW9L 3MFFA 4WFFD 2OP4H 3MNZA 4KK9D 4YIQA 3O6FA 4V2BA 3MBEC 2YD8A 5I1CH 4QGTA 4LP4A 2QKIA 3VXUB 2X4QB 2Y36H 1INQB 4E41A 4Z7VA 2AEPH 4MQSB 3PP3K 4KMQA 1AGEA 3WSQH 1EMTH 4ZUWB 2E8ZA 1O7SA 3FT4B 2AERT 1F90L 1Q94B 3NH7H 4OQTA 4LMQE 4F7PA 1INEL 5JR1H 1KT2A 4KY1H 3DX8B 4F37F 5FA4B 2D0FA 3Q1SH 2BNQB 5FKPA 3DV6B 2FECL 5DWUL 2ED9A 1A6WH 4PGBA 1J0IA 4U1GB 5DO2D 1QSFD 9CGTA 3Q2CA 2XY2A 5EDXA 2J8UA 5CUSH 3H3PH 1BVLA 3IDMB 4O2EA 3EAKA 3REWA 1JNLL 3H9SB 2VWEE 2AKRA 5A2FA 4XX1G 3RTQB 1WJ3A 4PFEA 1JFQH 1YZZA 4NYLB 3PQYD 1E6OH 3CZFA 1UJ3B 5DFTA 4KHTH 1G0XA 4S1RL 2C1OB 3BZ4B 1MHHB 3HZKA 2W65B 3UO1L 1T7WA 3LKNB 3IDGA 1I75A 1L7TL 5IJKA 3UTPE 3LMJH 2BCKB 2QQKH 4Q6YA 1NLBH 4QHMA 3U0TB 3HE6D 4X4YB 2JJSC 3GK8H 3E6HA 1WBXB 3STBA 5EOTA 4YFLF 1VESA 4X7SH 4TVPH 3SCMB 3WS6A 3HZMB 2Q87A 1K4CA 3F58L 3VFNB 3GMLB 2R2BA 2ORBL 4HG4J 2QTEA 2XZAH 1AIFB 3VE0A 1H3PH 4P46A 2FBOJ 3O8XD 3EYUL 4IBLT 4PRID 3ZHKA 1YMMD 1DQDL 3N0PB 1YN6B 1GXEA 3B9AA 4K23L 1NBVL 3FO1B 5H35B 2P5EA 1NMBH 3VG9B 1Y0LB 2CDFB 2WV3A 3SO5A 4AT6A 4JPKH 4LCWA 3KPNB 2FL5A 1M7IA 3WFEL 4LKXB 3CH1B 2YD5A 2X4SB 1BAFL 2XZCH 1A3RH 4MXWH 5GRVL 1KLUA 4JAMA 4XPTH 3VXQA 4X83A 3UP1A 1KNOB 3V0VA 2EH7L 2KBGA 1F58L 2C1PA 3BE1L 2DAVA 2VDRH 3NIFF 4D0CA 4RCAA 5KSAB 1IT9H 2J2ZA 3HMWL 3TT3L 4YFLI 1G7IA 4OF5A 2FLBT 4Y19B 1UM6H 5GS0H 3UYPA 4HIEB 4IOFC 1PBYA 2IH1A 3KPQA 3RVWC 4XT1C 5DJYA 4ZPVA 1QSZA 3NFNB 1C12A 2P24B 4JG1H 5SV4A 1IGIH 3WNMA 4YHYC 3T2PA 1I9JL 3EDFA 4MD0A 3F6IA 4C58B 1CWVA 1MCQA 4EBQL 4F7PB 4YDVA 4JQVC 1OTTC 4JFYB 4NQTA 1JWSB 4KJQC 3W11C 4YXHL 1U3ZA 3UTPD 2PO6B 2HTLC 2WWMC 4XWGL 2NTFB 1FNLA 1KJ2A 3QJHA 1AGFA 2ICWI 2XICA 2XTJC 1II4E 1UKTA 1PY4A 4L4JA 2J6EA 1I1AC 1V3LA 4Q6IA 1JNNH 1YUHA 4NNPH 3WLWD 3BOVA 3BEVB 5CINH 4PJFA 4PYHA 3MLVH 1I8LC 1NJ9A 3IAPA 4MZ3A 2A6KB 1CT8A 3ARGA 4NQDD 1AXSB 1I1YB 4DVRL 1JRHL 2Z35B 4NC0B 2BHZA 1DUZA 2APWA 5MENB 2CIKB 4GKZB 4H1LA 1CFQB 4LLVA 4K8RH 3VGDA 3QIUA 3E3QC 1B3JA 2VLKE 4OM0L 4LPWA 1MSPA 2MQCA 1YY9D 5GIRA 3OKLA 4Z0BL 5ITFB 3WO3B 1AD9B 5BQ7A 3VDBA 2EDKA 2A9MH 2QSVA 3QCUH 3TPUA 4WDIB 3EJJX 4WTZG 1EVUA 2VTFA 5F7MC 3S96A 5JLZB 4JFPB 3HNSH 5DD6A 3HCVB 3V4VL 3QT2A 5L6YL 4KKAD 1XCQA 4Y16B 3GBML 3HE7A 1TETL 1AKJA 1NEZG 4MJ5A 3PL6A 3ESUF 4R0LA 5F1NB 5JW3L 2ZKHL 5KVGL 5CJBA 4P2RA 1ZT4B 4LSPL 2HVJA 1A3QA 1I1FB 4HXAL 4QY8A 3QI9A 2B20A 4MLIA 1T21A 1RHFA 4RRPA 4YC2C 1RJLB 4QOKA 4LDOB 5AD0B 3IKCA 1DQML 1DTUA 5EOCH 1LO2H 3BYYA 1LO5A 1BQHB 4Y4HB 3BRGC 2ZCHL 4JKWA 3MCG1 2PXYA 1KCSH 1K8IA 1RUQL 1NKRA 4R2GB 3L3JB 4G5ZH 4LSVL 4ZFFB 2F54B 5A2IH 3ILPA 2R1XA 4FNLL 2PTVA 2GJ6A 2XWBB 3ZKMD 1B0WA 4JPWL 2Y07H 3VI4E 3BJ91 4WTZA 1Q9LB 2AABL 4UZGA 4XTRC 1UWGL 4EDWH 5CZKA 1LE9B 5F88B 1RU9H 1CFBA 3R06A 2DQGL 2HN7B 4P2QB 2IWGA 1U8QB 4HCRA 4XC3L 5E4EB 1CGYA 5E8DL 2APVA 2P1YA 5IESL 1P9MC 5C9KA 5E7FA 2DYPD 1HDMA 3VW3H 4M7LL 4AMKH 1Q0YH 4BFIB 4BQCA 4YX2H 2X5PA 3T4AA 5D7LE 3VFGH 7FABL 4ZO7A 3P4MB 4PV9A 1T5WA 5DMKA 3MRMA 4OLXL 1E27B 4M6OH 3F7YA 4XAWL 2ADIA 4ZODA 1U92B 4ZAKD 3I6KB 3VXPB 2ZWLT 3IETB 3HRZA 2HLFD 3BZEA 1JZ6A 3RX8A 4M02A 1A2YA 1D5MA 3AREA 4U2YA 4Y2DC 2XWJA 5HYJE 3VRJA 1NGQL 1R3IH 3RWFA 5ICYB 2ZPKL 5CGYC 3O41A 3QO0A 3IDXH 4JFFA 3ME0A 1VGEH 4HPYL 4QXWA 5MEPA 1LK3H 3I84A 2W38A 3O6ML 4J12A 3NZHH 5BVPH 1GIGL 1U8HB 3DV4B 4LLQB 3NCYS 4XP5L 1FJ1A 3FOLA 2ICEB 3L3HB 1T1WA 1CTOA 1N6VA 1PYWB 3QDJE 1M71B 1I3VA 4JG0L 4YGVB 3V7MA 4WW1A 3KPSD 1E4KA 1A1MB 4Z7WE 1P7QB 4EIZC 4YDIH 1Y18A 3QFJE 4PRHE 5ADOL 5IHZB 1AR1D 4BZ2H 3GMPA 4M00A 3KLAA 3I3DA 5KAQG 3M1BA 5E8NA 4L8BB 4JVPA 3CX5K 5CWSB 3V79C 3QHZH 4JY5L 4IJ3B 5DQ9A 3QRGL 3EYOB 5KVDL 1G6RB 4OD1L 4UV4L 5D2LB 1IGYB 2X9YA 4Z78B 1P7KA 1SQ2N 3GMMA 1FDLL 4HWBL 3PWNA 4Y5YC 4N0CD 3RDTB 4PJCB 1D6VH 5CMAB 3KXFB 5LQBH 1N0XH 1Y6MR 3GEWB 5ANME 1V3KA 1B4JH 1RUML 3FQXB 3T2NL 1BJ1H 3OGCB 3WN5C 1R5WA 4OUUA 2ITDB 4QNPF 5HI3C 3MQIA 3RNQA 3IFLH 5D7LD 3UPRB 5EORH 4R3SB 1BD2A 2FH6A 4DJMA 4WI3A 4ZQKB 3VJ6B 2B8OT 3O0RH 3LDBC 2RIKA 3BGMA 3UTQA 4TULH 5DD1H 1MJ8H 3WIHH 4C57C 3CC5B 3C6LD 5FCUL 3ZE0E 1FORL 1HSBB 1S7TB 1ZGLM 1FZMB 2IBGA 5KSUA 1GGUA 4ZYKB 5HYJD 4K9EL 4U7SA 2H8PB 2FGZA 3X13A 4ALAH 4JRYB 3BZDA 1MPAL 1LD9A 5CS7A 2PTTA 4ZD3H 4OCLC 1OL0A 3TBWB 1HEZA 2BOCA 3PP3H 1WV7T 4JHWL 3REVA 2XN9B 4G8IA 1GZPA 2W0KA 4MCZA 4RQQB 3OKYA 3D25A 2OJEA 3L1OH 2VAAA 4U1HB 5DZOA 5JMRA 3SY0B 5J1SC 1IGTB 4LL9A 4OD3H 4Z95L 4Y4FD 4GQPH 4RAUA 2CIIA 4QYOA 2ZOLB 2Q7YB 2NY4C 2B1HL 3ZDZE 3QDJD 2GJZA 5GS1A 4NQED 4Y1AA 1AHWC 1CG9B 1S9VA 4JJ5B 3BKJH 3SQOL 1J05B 2VLJA 4C55A 3LRSA 1OCWH 5CD3A 5IJVA 3OKDB 5TPWH 5JDSB 1IKNC 2YD9A 4FFVD 4QRQB 3QFJD 4PRHD 1J8HA 4ZUSB 3QQ3B 3SKOB 4WWKA 4MDIA 1J1PL 2AI0H 1TVBB 1CLYH 2B5IB 2H2PC 3I85A 4GRWB 3QXVA 4QWWC 1J5OH 5FK9A 1C08B 1FZJB 5EZJB 1N7ML 1OAUH 2ADGA 3DXAD 3VGFA 1ZGLB 5GS3A 2CSPA 1S9YA 4M6AA 3H2WA 5LGHH 4M6NL 4S2SB 5ETUA 3GBNH 3I3EA 4XZUA 3EOBA 1A7RH 1U36A 4J8RB 2UWEA 3EYFA 1HH9B 4QHMB 1KB5B 5D2LF 1JHTB 1YEDA 3GIVB 2WMPA 1A6TB 1F97A 3AM8A 2GYSA 4D94A 3DUUB 3TJEL 2COQA 1CGSL 2DTMH 5HHQB 4GJTB 3SE9H 1WBZB 3FFDB 4OZ4B 4BQ6A 1X5LA 2VLRE 3ZHLA 5JNYB 4HC1A 3OKNB 5C07E 1AO7B 2EIZB 3N06B 2LQRA 3C60D 1IAIM 5BVJA 4PLJD 5EU4A 2HFGL 3LN5A 1A3LL 3QWRA 3FTGB 5TDPB 4K3JL 3PHOB 2FRGP 3ULVE 4RFNC 2X6MA 4ODVL 3JV4B 4P2YA 2YS4A 5L8JB 1FYTA 1UGNA 4LGPB 5D72H 1A7PH 3CFDB 5MHSE 4KTYA 4F15C 4ZXBA 5I1KH 4Z7NE 1JGDB 4EXKA 3LKOA 5E6ZA 3OJDB 3ECBB 4XPHL 1RFDH 3RU8H 5BW7A 5CBEB 5TE7H 2BNUA 4UTBL 4NQVB 2EYRA 2HFEA 5DO2C 4MAYA 4FQJL 2DIBA 3H42L 5LCVL 3DROA 5CEZL 2BSSA 2V17L 3RZWA 5DYOA 1WF5A 5DEFA 4XCEA 3I50L 5HPMA 1U3YA 5C08B 4DEPC 3P77B 1BM3H 4DQOH 1LDPH 3T4YA 4PJ5A 4X5XA 5I74C 3TEUA 3MNWA 3QSKB 5IB1B 5D93B 1CLZL 4EQ3A 1YPZB 3QA3B 3FZUD 1SJVA 5HDBF 4RA0C 3LB6C 4N0FA 4FZEL 4G6KH 2X4PA 4P59L 4GW1B 4OKDA 1MIEH 2I26N 4Y4KD 4PY8J 4H26B 3K3QA 3M8OL 4YO0B 3QJFA 4YDVB 5JIPA 3SE8L 3IRPX 2AJSL 3OQ3B 2IFGA 2XWTB 2ZUWA 4GRWF 1HHGA 5JHDA 4NSKB 1Q0XH 4D9QE 3PV6A 4RFOL 1SMOA 5D6CA 4MNQD 2OQJB 4K8RC 1A8JH 3F5WA 2W0FA 1W8NA 2BOBB 2V5SA 5GGSY 3E2HB 3NIDE 3NACH 1NC2B 1IQWH 2K7PA 4OGYH 1TQCC 4XP1H 1ZVYA 3BAEH 2OSLA 1ORSA 43C9B 3VGHA 2YPLB 5ISZD 2VLRD 3MJ8A 5I1JL 1B90A 4HEPG 4K7PL 1G7QA 5H37H 5KBNC 1QSEA 3OJMB 4PJBE 5C07D 4CVWA 3SKNA 2Q3ZA 1U42A 2YN3A 1CYGA 3WNOA 2NY1B 2GTZA 2A83B 3LKRA 3U0WH 2R1WA 4CNIB 4Y5XB 4IOSD 4HBCL 3QXAB 3MA9H 3L7FA 1K6QL 4MCYB 4Z7OF 4G8EA 2V5YA 4ZO9A 1UB6B 3HR6A 3I02A 2DQTL 5IBTH 1U8KB 1DQQA 2RQ8A 2VB5A 2ATPB 5MHSD 1NL0H 1A5FH 3BVNB 4OLEA 4ELMB 4OUOA 5E6YA 1MFNA 5HHPB 3BDYH 3HNTL 5L2KE 3CXHK 4PB0H 5IFAH 4UT7H 3UBXB 4MNGB 1LNUA 1RJYB 4BZ1L 5TDNB 1V5JA 1R6VA 5IEKA 5EU5B 1CE6B 2AP2A 3BX7C 5AWNL 2BVTA 5HD8D 1Z9OA 1JZ3A 3C08H 2VWEC 3HE7B 4LLUA 2NPLX 2P46B 5E6IC 1G7HB 5HYQA 3QO1A 2A77L 4F9LC 1INDH 3RJQB 1I8KA 4MJ2A 2UV3A 3PIQB 5HYSG 1CVRA 5K9JH 1R5VA 4TSCL 4NUJB 5MEOA 3DVIA 2A6IB 3A6OA 1JPGB 3OGOE 3ULUF 3HI1B 2FJFA 5C6WH 3ARDD 3FAXA 4X4ME 4F7EA 1MUJA 2FX9L 4O9HL 2IANE 5DQDH 5IKCA 5T1KB 3VMNA 1EZVY 1YPZF 3P4NA 3HUJE 3MYJB 5E2TL 2R9HD 2VC2L 3ILPB 4JN2A 1MFDL 4D9QD 3ARFC 2D9QB 2GJ6B 1YNLH 1R5IB 5FYKD 1SM3H 4W6XB 3TN0B 4X7DC 2LVEA 2LFGA 4ODBD 1ZK9A 4W68A 3TCXA 4P9HC 1J86A 2AK4B 4I2XE 4MJ4A 4XHJC 5DGRA 5FO8B 4WI4A 1TVHB 3GMRB 1G9EA 1A7BA 3QQ9C 1MVUA 3KYKH 3RZCB 1NGPH 3CLFH 2JKXA 2I07A 3FRUA 1I3UA 4NM8H 3C5SB 4JFHD 4X99A 3GO1H 5GSVB 2QJDA 4UV7H 4IRJA 3SDXB 4JDVA 1YY9C 1WZMA 5B8CB 5JPNB 1OT1A 4RGOH 2Q8BH 2WBWB 1BOGA 3U4BH 2WWKT 4M62H 5IW1A 4O58H 1T04B 5HYSA 1LP9A 1ONQB 2V2TB 2PW2A 5H2BB 3NAAH 1QKZH 3STLA 4HJGA 4MD4B 5FYJH 2Z31A 3MLWL 2ADFH 3TA3D 1JYNA 4LLMB 5HGGS 3QUYC 1MF2H 3DVNB 4KKAC 1JNJA 1S8DB 4IEFB 1KEGH 1HXYB 3ULVH 4U49A 1M05B 4YDJA 3L9RB 4PJGA 3QG7H 2HT4D 1XGTB 3P9LA 2J8HA 2CKBL 8FABA 5JOFB 2XWJB 1CE1L 5I1GL 3C09B 4KK5C 4L29B 3S88H 3E6FB 1BZQK 2D2OA 1F3JB 3VWJA 5ESQB 5HHNA 3B83A 4UT6L 2NY0C 3VWKA 2AJZA 3MTRA 5DD5H 5C0EB 4PREA 3D18A 1SVZA 3IJHA 5CSZB 1CXKA 3D3VE 5I66B 3RNKA 3IF1A 1VADB 3I6GB 1DLFH 4PY7A 5I17A 4XNUH 1ZA3B 1F8TL 4WU7B 5BO1H 3VXRA 4P23A 1I9RH 4P3WA 4UB0H 1CFTB 3PXHA 1A9BB 2P8MB 3V6BR 3O4OB 1MREH 4LCYB 2LAAA 4LLWB 4ETQB 4JHZA 3VGAC 1BQHG 4KGLA 1VFAA 3QNYB 2P42B 2X1OA 5DC4B 4L9LB 4PGDA 4GOSA 4HG4K 4ZTOL 2CUMA 5CGTA 3DUHA 2DMKA 3V5DB 3BP7A 2JLLA 1NC4A 2VN7A 4I5BB 3V6ZB 2YUZA 3L5JA 4OAWB 3UROR 3STZA 3U1SH 4XVUC 3GRWH 3O2DA 3N50A 2IQAB 4LCUA 1HYSC 3CDGB 3KS0J 3JWDC 3NCEB 3GUTA 1X4XA 3P0YL 4Z7UA 4D9LL 4JM4H 4Y88A 4ZAKC 4IOIB 1TZIB 1U2CA 1QPPA 2F5BH 3RVXD 2JTDA 1XIWD 3LEYH 4AL8H 1B0GB 2FB4L 5D1XA 4OV5B 3KLHD 1M6OB 4NN7C 5EZLA 5CILH 2OMBA 4AH2B 1PD6A 1SJEA 1CK0L 3SDXF 3VXTB 4K3GA 4RA3A 4Y2OA 5DJ2A 5KN5A 4KJPC 1RK1A 2BJML 2L7UA 1Z9MA 4EZMA 2WINB 3QDGB 5IGXL 3ILQD 4HJJL 3RGVB 2F53A 3SHSA 3UTZB 5HHMB 1CIUA 4JZOA 1BHGA 1ZMYA 3CNKA 4GRLA 3OAYK 1FL3A 1T5XA 2OJZL 5DS8B 4LNRA 1X5FA 1KIRA 2QR0B 4NKIH 4XCYB 4XPAL 4RGMB 1HQRB 4NJAL 1MCDA 4LU5L 2PCPB 5CKGA 5ICXB 5BZWA 3D3VD 3IFPB 3N85H 3WE6B 2HJLB 4AZ8A 1R3KA 1CDBA 5D7SH 2WBJA 5B3JF 4OZIB 3DIFA 3D39B 3CDYA 3RKDC 4IMLB 4WUUA 4PJ8B 5FYLD 3O11A 3LKQA 1T1YB 2FECI 5JW5B 3ZHDA 1E6JL 3MRFB 3UJJH 2JJSA 1I3GL 2J12B 5LJYH 4J4PD 4NQCB 3U7WH 2VZOA 3H0TA 4IRZL 3L95A 2BHUA 4MNHA 3X3FH 1W72L 3BIKB 4JFXB 2VABB 4GW4B 3V4PH 1PG7L 3DSNA 4M03A 3I6LD 1OWRM 4JY4A 1FN4B 3PWJA 4J3XA 1N5AA 1IC7L 2KDGA 1FIGH 4WO4B 4OCSH 1K4DA 2X7LB 3EYSL 4WU5A 2CGRL 1NBZB 4OT1H 3LS4L 4P49A 1TJIL 3OZ9L 4G8FA 2R29L 4JHBA 4QHLB 4U1IB 1JIBA 4WW2A 4HUXB 3MJ9L 5DK0A 1TVDA 1DFBL 5HJ3A 3BIBX 3CK0H 3BKMH 3C6LC 1EFXD 1R0AL 5A3ID 1VEMA 3RBGA 4Q9RL 1BJ8A 1IEBB 4JR9L 3BMVA 5JORA 1WAAA 2J4WH 4YDLC 5C09B 4PY8I 1DSFH 1AP2B 3SE4A 1JI1A 3VFUB 1IKFH 3JV6B 2RB8A 4OJFL 1UEMA 4I4WB 4UIMB 1CF8H 1NGYB 4NZUL 4F7TA 2CLZA 4KTDL 5ICZA 3BDBA 2OP4L 1S78C 5HGHA 4M3KB 5E5UB 5JIKA 3BJLA 2FR4A 3FB5B 5TE6H 3UJTH 4LRIA 3U4EA 1EMTL 1GCFA 4GS7C 2Q6WB 2AQ3A 1CN4A 1ADQH 1JHLL 4X6DB 5F7WC 2FHCA 4Y89A 5DRXB 4ZSOE 5JR1L 1AY1H 2YA2A 3Q1SL 2FEEL 5GS2D 4L8SA 4TTDC 2J1KA 2IADA 3EGSB 3HPLA 4P9MH 1A6WL 2ERJC 2A6JB 3MV7D 5BZDA 3NIGE 4OZIF 4I13B 2CUHA 4N0UA 1CIDA 5CUSL 3H3PL 3TO4D 4M8QA 3IDJB 2NY3B 1FZKA 2I9TB 3K0WA 5D7JA 3UDWC 3LOWA 3VFPA 5DFVC 3UX9B 4IRSD 1KF9B 5AUMA 3S5LB 3NPZB 3ES6A 4JO1H 3TO2B 2ED8A 1E6OL 3MUZ1 1NAMA 2BMKA 3PJSA 4N0FB 4AG4L 1I8LA 4L3CB 3WFCH 4LHJB 4YBLB 2EE9A 4X5WA 3T0EE 4B50A 3RA7H 1Q9KB 1ZVHA 5D8JL 4LRNH 2FO1A 2IAMA 2JJWA 1WIPA 4C56E 2Z0BA 4XPBH 1MCWW 1FFQA 3G6JB 4U05A 5E00A 5HHOD 2K7QA 3U0PA 1MY5A 4X6CE 2F15A 3GK8L 3L5WB 4PR5B 4BKLB 1H3UA 4X7SL 4TVPL 2H6PA 4P0DA 3L3OB 4PJ7E 1T3FB 2N7AA 1IAOA 2CRIA 2Q8AH 2VERN 3HS0A 1AGCB 1HNFA 2UWEF 5CEXB 1H3PL 4TTGA 5DRWB 1WWWX 4XMLL 1XGPB 4WV1B 4PP2A 1HH6B 2OI9B 5BRZE 3TVMC 5GS0D 4FFYH 4XP9H 2V7NB 4NRXA 3CH8A 4ZUVA 1S9XB 4PJEE 4JZJA 4QRUB 4XGZA 3WFBH 3O4LB 4JEGB 3Q5YA 4YNYB 3RWEB 1JRHI 4G6FD 3QEQE 5ESAA 4JGMA 3LKPB 2ED7A 5ID1A 2NXZC 3BQUD 4JPKL 5F9OL 4K94C 1O5DT 5F6HJ 1MAKA 3RWHA 3PE9A 3VXMB 3TZVD 4G42B 1JPSL 2XZCL 3QUMH 4MXWL 4U7MA 4XPTL 2DWEB 5BJTA 3GGWB 3KYNB 2ADJA 1Q38A 1IEAB 4LSRL 1QA9B 3QUZC 5C2BH 3AS3A 4O2CB 3RX7A 2AJYH 3CUPA 1IT9L 2YPKA 4KKBC 4X6BB 4X6DF 4OBRA 1EDQA 1KIQB 2IG2H 4YZFF 1J8KA 1IZJA 4Y4KC 5E2WH 2QHRL 1A6ZA 2P7TA 2BSTA 5FM8A 5C0BB 2CD0A 3O6KH 4HSQA 2R2HB 3FONB 4P4RA 5I1IH 5GGTL 3LEXA 4PRPB 3AROA 4PV8B 4PLKC 5I8EA 1FAKT 4CU7A 3EHBD 3MV8E 2GK0B 2J88H 3PDGA 1P9MA 3MLTA 4F7CA 3AGVA 1JN6A 2Q3AA 3SE3A 3UC0H 3LPGA 4MX7A 5T1LA 5EU7E 5GGRA 3SGDI 5DJ0A 3U7YL 1G7LB 4C56D 1AQDB 4L4TE 4C83A 1DANT 5EUOE 4AM0B 3RWJA 4LIQE 3PWUA 4H88L 4CADA 4HXBL 4WHTB 3NCJL 1JNNL 2DQFB 3W9DB 2NXYC 3IDNA 4PJAB 3G6JF 3ULVC 5EU6B 1C5DA 5IW6A 1G1YA 3S34L 3LV3A 1ZHLA 3WXWH 5ACZA 3VCLB 3ZKQD 4I18C 2NY2D 3L3GB 5BRZD 5SWSE 1HILB 5F1OB 4LKCA 1RHHA 4ELKB 2HFFB 3GSNH 4K8RL 4KWUA 5GRXG 5TF0A 1EJOH 1LP9B 3AVEA 4HUUA 4FQCH 4OGXL 5F97E 1NDMB 5I16A 1GZQB 4FTVD 2CDGB 2YXMA 3W81A 2VXQH 3BT2H 3WKMH 4CW1A 5LGKA 4Q9BA 1VKXB 4MA8H 4LVOB 2F19H 1YQ2A 4WNQA 3OR7A 4Z7VE 1U2HA 4BSJA 1MCBA 5EBLA 4EUPG 3HNSL 2ESVB 4EN3A 5CIPB 2Z4QA 4WRLA 3UTTD 3MRQB 3UBXG 3AMLA 4HS8H 3FFCB 4JKMA 4A2LA 2VZSA 3MJ9A 3QG6A 3GDBA 5IK3B 1QLFB 3HN3A 3NABL 2GUOB 5JO5B 3SKJH 2NW2B 3N9GL 3D0VA 2NY5C 3RUGB 3QFDA 1OGAB 1BIHA 1JPTH 2ZCKH 3GSUB 4MJIA 4IIQB 4MAUH 1FO0A 1Q9OA 3Q0HA 3SDCA 1WIOA 4DGVH 3KPLB 3MACH 4I0KA 4XP6H 1KCSL 1NSNH 5DJAA 1OB1A 1UZ6E 1DUYA 3SO3C 4CVUA 4G5ZL 1N6UA 2V2WA 3P0VH 3B9KC 4MWFA 5F21B 1NMCC 1BBJB 1PJ9A 4P48A 3DMMA 3THMH 2DWDA 4QRPE 1T7XA 3UZQA 4BFGA 4EI5B 1KN2H 2NW3A 2VOTA 4L4TD 1RIHL 2A73A 1CBVH 3NCBB 3FHAA 4EDWL 2E9IA 2EE2A 4EUPA 2VRAA 3FT2B 3QH3A 3QIWD 1GVIA 3GSOB 3MUJA 1G9NH 3QRFM 3GNMH 1XT5A 3O9WB 1E28A 4CAGA 3VW3L 5D1ZC 4XC1H 4YX2L 2UZYB 4MQ7A 4PJAF 3VFGL 5SWSD 32C2A 5C0IA 3MBEB 4ISVB 2JF1A 2JCCB 4JQXA 4TQEL 2VUYA 4M6OL 1FFRA 4BFEA 4NWTL 3TGXA 3MJ6A 5FUCE 4P9HL 1IGCH 4XX1E 4JDZA 4Z8FH 5HI5D 3MSPA 4UOJA 4P57B 1DP0A 3EZJB 4OFYA 1LP9F 5DR5H 3HZYA 4N1HB 3LZFH 5EOQH 3SBWC 1R3IL 5L8KB 4UNTA 2HRLA 3IDXL 1VGEL 3OAYH 3C8KA 5FO7B 1LEKB 3DX9A 1KPRA 3IFNH 3KPMA 1LK3L 5BVPL 4M5ZH 1TENA 1L7IH 4BH8B 3IJSA 2Z8SA 4BYHA 2AV7A 4HFWA 4I48A 1KTKE 1UVQA 5DJCA 4E9LA 2ZSVB 4A6YA 5EB9A 1F2QA 5DK2B 3WS3B 3B5GA 2LE9A 3RUGF 2BP3A 4YDIL 4RNRA 3QAZC 5F3BB 1PKQA 2M26A 1I1RA 1ZLWH 2GSGA 1RUAH 3ZMRA 1SY6H 3VFVB 3WJJC 4N9GA 1D5ZB 4PGCA 5I1DA 3EDJA 4WUKH 1LEIA 5CJXC 5GRWA 5B22A 3QHZL 4QRPD 4HHAA 2PF6A 2VJXA 2G75A 3PWPA 5ALBL 2ENYA 3EDDA 5T1MA 3G5XA 1HKFA 2FATL 5IMMB 3QBTB 4HZAA 1A1NB 1OAXH 3X11B 1G6RH 2XQBH 3RVXC 2JELH 2GW5A 4P2OD 5M7QA 5D7KE 1D6VL 5LQBL 1N0XL 3KLHC 4XWOC 1B4JL 4L3EB 5J57B 1BVKA 3C5ZC 3VFWB 4OBSA 5HXMA 4YHOH 4KDTA 3U6RB 1FNSL 2NX5A 3IFLL 5KTEL 4JVWA 3GSQA 3LRHA 2A1WH 4PPTA 3O0RL 1CZ8H 2Y7QB 4Z7UF 3SQBA 1QSFA 4TULL 5DD1L 1MJ8L 3WIHL 1ND0B 2O61A 5DA0B 1FPTH 4JM2D 2JCCF 3SDDC 5D6DC 3VXSE 5HDLA 3B5HA 4WEMB 2C3VA 3K8KA 2QQLH 2HMID 3RWCB 4CJ0A 3JWDL 3HC3H 4DKFL 4PJXB 1BZ7A 4BSWA 3V5HB 2H32H 4G8GD 2D7TH 2FGWH 2WP3T 2DM7A 2DIJA 1T6VN 3L6FB 1CDYA 1QRNE 5FM5O 2Z92A 4ZD3L 4RAHA 4NKMA 1DBJH 4HUVB 2P5WB 3OKKB 4U6YB 5I8CA 4YHYB 3CFIC 1HI6B 3MLSH 4CMMB 2PYEB 4OD3L 2J7LA 3HE6A 1YMHB 4PJHB 5DI8A 3CGTA 2N4IA 1H15B 4OQTH 2VR9A 2YK1L 3QULB 4HJ0D 2E3VA 5DHVA 2IADB 4U3XA 5C8JA 4PJIA 3BKJL 5MERA 5C0GB 1YQVL 1OCWL 1XGUB 4NNXA 5EZOH 5TPWL 1FFPB 2K1MA 3D69B 1EO8H 3CCHA 2PETA 4HMDA 3C6SA 4LSDA 4GAFB 4XNMA 4X98A 5F6HI 2XTJB 3O8XA 4YFDB 1KELH 4PRIA 1I1AB 4QXTA 3W82A 1YMMA 5BV7H 1CLYL 1U91A 1ZHNB 3MRJB 1OAUL 5D1QC 3GFUA 1XR8A 3MFGB 3VFRA 4FP8L 5IVNA 1A1OB 4JFZL 3S4SA 5E9DE 2CKBB 4NKOB 5LGHL 2Y5TA 3DWTA 4GBXD 3GBNL 1YEHH 1FFOA 5D7KD 4JE4B 5CGMA 3V6FB 5A3IC 5D96B 4Q0XH 4F80A 1S7RA 3SKUD 2LU4A 2MSPA 4F7MB 4W4NA 3CFJB 1KFAH 2VE6A 3QXTA 2E7HA 5I76B 1TZHB 4KTEH 3S3PA 5EO9B 3ARGD 1CD9B 3MV9A 3SE9L 2NR6D 2D31A 5DT1L 1HHJB 5EN2A 2HG5B 2NNAB 1MCJA 5D5MB 5I1EL 2VXUL 4P5TC 3RWDB 2BSED 3T1FA 1UH2A 1YDPB 4R26H 3VXSD 3OAUH 4TUJA 3ZE1E 12E8H 4X0KA 4OGZA 4ONFH 1WAAF 3ARUA 1YEEL 2Z93A 4OTXH 3G6DL 1BECA 3WLBB 1A7PL 1KEMH 4MD5A 3TBVA 5D2NE 3SJVB 4LHUB 4LAQL 5F1IB 1QRND 4YC2B 1U0QA 4HIHA 4PJXF 3C5JB 1RFDL 3RU8L 5HGAA 4AJ0A 2SEBA 5A40E 2GSIA 3PGCA 1CGTA 3GB7B 4G3YH 1XZ0A 1I8IA 3DVGA 5HHVH 1A6PA 1SEBA 1U6AL 5FGCE 3OBAA 5DVMA 2VZVA 4M6MH 4IRSC 4UMGA 5T3ZE 4AEEA 2WUCH 1P6FA 5KG9A 5FUOH 4M5YH 5D9SB 1BM3L 3BZFB 5BOZG 3GIZH 1P2CA 5SX5K 43CAA 4PJHF 1FFNA 1LDPL 2X4NB 4MQXC 3ZTJH 4NQDA 3Q3GB 5F7EL 4M7JH 1TFHA 2XKNB 2P8LB 4KUCF 3MMEB 1MIEL 2VZTA 4NKDB 3ARYA 3K4ZA 4FMFA 4HLJA 3LD8C 2VDLL 2HLAA 5T5NG 4KC3B 3JWNC 1EV2E 1A7NL 2NCMA 1CD8A 5DRNB 3G6AB 2OZ4A 5E9DD 1D9KA 5GHWL 5T3XE 2GAZB 3HZVB 5KJRH 1VGKA 1AXTH 2RFXB 3IFOB 1UCBH 1XF4A 3D85A 3WL9A 3KPOB 1B0RA 1IQWL 3OKOB 4QRRD 5E94A 1NPUA 5GRJH 4NCDA 4J23A 2H26B 1KJ2H 3EBAA 3ZYZA 4G80B 5JUEH 1QQDA 5HY9B 1MCIA 4OB5L 5INDB 1A9EB 3NFPB 4OZHB 1SMAA 4GG8A 4H20H 4Y2DB 3WHXA 1IAMA 2YD2A 4LVEA 4L5FH 4PJDB 5E70A 2DS4A 2HKFH 4UQ3A 3SDAD 2BDNH 5L9DH 2A9NH 4C54A 2OTWA 3TZVC 4G9FE 1JYVA 4KKLD 1DL7L 3QDME 3BXNA 4UINH 1PVHA 1W72B 4H1LH 1ODAA 4OZGB 1W0VA 1NL0L 2CRZA 3TT1H 1A5FL 4GQ9L 2AJ3A 1RUPH 5A1AA 3BDYL 3NPSC 2X1PA 4PB0L 4KRPD 5IFAL 3O45A 3DGGA 4AIZA 3TNNA 5FB8B 4WENB 4D0BB 3QUXC 3CU1A 1OSZA 2VMFA 1HKLL 4AEHL 3QUKB 4X9IA 3HC4H 3N1MC 1L6ZA 4JO2H 3R1GH 4JREC 1YEFH 1SYVA 4MMXC 1F45A 4NDMB 5K9KA 3MLRH 4MMZC 3L7EB 1HCFX 1CXLA 4S11A 2VLLB 1FH5H 5T3ZD 2X2YA 3RVVC 1INDL 3O3AB 4HX1B 4QHUA 3MZGB 4K94L 4XI5C 1IC1A 4S1DC 2XG4A 4WHYH 2VLJE 3PABA 2DYPA 5ESVB 1GHFH 4JFEB 4BQBA 5EC2A 5BOPA 5IR1A 2EH8H 3T0EC 3PNWB 1CFNA 5DUBA 3HI6H 5C6PB 1J8HE 4Q58C 1G9NC 3B8YA 4LEXH 5ERWB 4Y5YB 3OAZK 4OLUH 4U1NB 2AXFA 3CJJA 1CICC 5DQDL 5LAXA 2YC1B 4ZAKA 1CCZA 1MFCH 1MFBH 3WN5B 4AIOA 5T3XD 1KCLA 4CN4A 5KW9H 4MGXA 4JRXE 1EHXA 4I3RL 1IAKB 4ZUUA 2Q86B 4GG6A 1SM3L 4DZBA 3LDBB 2IALB 3QXDA 4CVXA 1HINH 4X7TA 5CSBA 3TBTA 4YR6B 1H8SA 2ZUQB 1HHKB 5F9AC 5IB2B 1F90H 2L4OA 4I9WE 2BSRA 3CLFL 4GAYB 1JUFA 2ATKA 1MCLA 4NM8L 3V9FA 3GO1L 5CJOL 4HCRH 4UV7L 4DGIH 5DJ8B 4P5KB 4ZFZB 2FJHA 1FNGB 4O58L 3K2MC 5ENWB 4G9FD 2EYSB 4M3JA 5ALCH 5GSRA 3GSRB 3VFTB 1QKZL 3CFBA 3QDMD 4WEBH 2YZ8A 1FNEB 5FYJL 4PJDF 3KPSA 2ADFL 3LN4A 1MF2L 4F57L 3H3BC 3IDIB 4YHKH 5EO0B 4LBEB 5E8OB 3ZDXE 4XBGB 3ULVL 2DJUA 2NY4B 1G7PA 1EIBA 2VXSH 2FZ3B 3MRRB 4S1RH 1OTUC 4OZGF 1AHWB 4HUWA 2CRMA 1T22B 4LQFH 1AC6A 1DBML 3S88L 5IHLB 1L7TH 5IFJB 2I27N 2DTSA 3O3UN 3DX9B 1NFDB 1U3HD 5IB4A 1IGML 2JIXD 5C0FB 4ONHB 5ID0B 4TN9A 2OR8A 4CU6A 2HWZH 1ORQB 3ZE2F 2BNRD 2WIIA 4FQHB 3IXAB 4XNUL 4NO0B 3F58H 5BO1L 3HKFA 4BQ8A 4CJ1A 3SPVA 5J6GA 5D7LA 5EU7C 4PJ5E 3T0BA 5D7IB 3TCLA 4CU8A 4UB0L 4HH9A 2D7PA 4LARL 3ARBB 3DNKA 1A0QL 2EO9A 4Z7QF 4X6FB 4K23H 1NBVH 3S9DB 3JWOH 4S1SL 4OGAD 3C6LA 4I0PD 1JCKA 1JZ8A 4F3FA 4JRXD 1MCNA 2XQYG 3U46B 3CFEA 2X1WL 1EX0A 4G7YL 3D2UD 5HYJA 3U1SL 5A43C 3PHQB 1JWUB 3BO8B 3S35X 3VMPA 3VXUE 4F33B 5F7LB 3SKMA 4NRYA 4I9WD 1I3RA 4RFNB 2V9RA 2G5RA 1TDQA 4KFZC 4JM4L 2M8XA 4NHUB 4BFBD 4IDJL 1QSEE 4AL8L 4DOHB 4Q9CA 1FV1B 3MLYL 5BS0D 1IE5A 4YPGA 3HMWH 4OLWH 4Y4FA 3IDUA 2IPKB 1PQZA 3BRDA 2JK5A 5CILL 3QDJA 5IG7B 2BNQE 4NQEA 1BF2A 5J6HA 1AGDA 4GKOA 1NCTA 1Z6JT 3GJFA 5F7NC 5FDWA 4NC1E 4ZFOL 4Z7WA 5DDHA 1B4RA 1LHZA 2KZWA 3KNBA 4XPFH 3QFJA 4PRHA 1G6VK 2WWKO 1I9JH 3K46A 3P11H 4TUOA 4GRMB 3HC0B 3RQ3A 1L4IA 3PQYB 4DEPB 5J1AA 4YXHH 5LGJA 3TNMA 3MXWL 3DXAA 3MRLB 4NKIL 3UDWA 4XXCA 1WTGT 3HR5B 5I74B 2W07A 2DQJH 2OYPA 4ZDHB 3OR6B 5IF0B 1MWAA 5FA3A 3FN0H 1NFDF 5ANMA 4J3SA 4ZS6D 3MRCB 4QXGH 3HG1B 2CRYA 3JSSA 3F7VB 3WNKA 4HDIB 2YXFA 2DQDL 2DQIH 2FEEI 2HYMA 4KMLB 2DL2A 2BRQA 3S37X 2JE8A 5IJKC 3UJJL 3MV11 5GZOD 4FQ1H 1KG0B 3U7WL 4X6EA 4LLDA 2O5XL 3C60A 4LNVA 1TQCB 3X3FL 2BVOA 5C0DA 4OM0H 2FX7L 3NCYP 5IBUB 3TYFB 3V4PL 4Z76A 5J56B 1GGYA 4Z0BH 3WS6C 1JE6A 3FQTA 1LE5B 1EXUB 4E5XA 3W0WD 4OCSL 1FG2A 3U2SA 4LEOA 3IS1X 5JZ7C 4P46C 4KI5C 3VXUD 1HXMA 1K8DB 1KCRL 4ETYA 5FUCC 4NOFA 3NFSL 4JM2C 1YY8B 3CK0L 4E42B 3BKML 3S3JA 3IT8D 3UTSA 3VDCA 2ZKHH 5DJ6A 1JWMB 4P99A 4MJ6A 5DJXA 4LSPH 1MJJB 4O02L 1KYOJ 2XZZA 4KRNA 2BNQD 2J4WL 1NFIB 3WUWG 5H94A 4LAJH 4HUMB 1DSFL 4RGNC 1YC8A 2NYYD 4BH7B 4HV8B 3X12B 4HC1H 3BUYB 3MRDA 3IVKB 1CF8L 2ZCHH 3H9SD 1U8MB 1MCSA 1I7RB 4DKDC 5E6IB 5IV2A 3RTQD 5J13C 1E4WH 4PJGE 4LSVH 4Y4KA 4BA8A 3UJTL 4ODUB 3W5MA 4FQXB 4F2MA 1ZT1B 1EUUA 3Q6GL 4G43A 2HAZA 3BGFB 4JPWH 3H9HB 3OB0K 1ADQL 5EH1A 1DBKL 1D5XB 1S3KH 1PDKA 4HQQH 4Z5RB 1EGJL 1UWGH 4MNQA 2Y1VA 2WLZA 4RDQG 1VACB 2JJTC 1I7ZB 2BVPA 4KJWD 2E6JA 1WTLA 4X4ZA 3LSOA 5E5RB 4XC3H 2CXGA 2YRZA 5E8DH 1C16A 3ABZA 5IESH 4MB4A 4ZUTB 4K55A 1BX2B 4M7LH 1KPVA 2MHAB 2VDPL 5ISZA 3SCMD 2EDEA 3ARFB 2VLRA 4ZOAA 4MYWB 4FN0A 3MRKA 5C07A 2X89D 5SX5H 3ARRA 3WUWA 3NMEA 2ITCA 2YSSA 4PJIF 4GBXC 5LXGH 1LEGA 5KVFH 4LVNC 4ODWA 4Q6IC 1TNNA 3KS0H 1BBDH 1MLBA 3WFHB 2DKUA 5IUSA 5I1HH 4JDTL 2MCPH 3V0WH 1P1ZA 2P48B 3RVUD 4LRNL 4BQ9A 5E99L 2LTQC 3ARGC 3BW9A 1FAIH 1NGQH 2X4OB 4DN3L 3CSBA 4HPYH 1T7ZA 3GSVB 3DHMA 4OCYL 1A7OL 3B6SA 3BP5B 1N2RB 4UDTB 3QIUC 4NBYB 5F7KC 3QUYB 4IRJD 4RWYH 3AAZB 5KSAD 4IS6B 5KSBA 4WI8A 4FFYL 2UVFA 3QEUA 4XP9L 4Y19D 3GSXA 3I9GL 4HWEH 1MLCA 3DRTB 3WFBL 2CLVA 2NY0B 4Q97A 1B2WH 3T77B 2BVUA 3RIAF 1RZ8B 5ADOH 4LLYA 5GGUA 3ARDA 4BK4A 5HGBA 2EDXA 3PL6C 4R0LC 3OWEA 3OXSA 1EH9A 3D6GA 3P9MB 3B3IB 3QUML 2KPNA 3G5ZA 3J7HA 3ARPA 3QI9C 5KVDH 3ZTNH 2CUIA 4FQQA 4PBXA 1T66D 4RIRB 5DRZA 1F4WH 4FFWD 1VENA 4UT9H 2ZSWA 3C9NA 5C0JB 2AGJH 2PO6D 3DURB 4WFGE 3GI8H 5IVZA 1UYWL 3NCFB 2AJYL 1FDLH 2IH3A 1FZOA 1IGJA 3MLPA 1U8LA 2PXYC 2BY3A 4MA3A 3VGAB 2HVKA 4KUZL 1ZA6A 4U4BA 5CEYA 3EO1B 2XT1B 4WUUE 4QNPE 4MA7L 5E2WL 5B39B 4P2QE 5I71B 1AD0B 4PJBA 5EWIL 1S9WA 2DB8A 1Z9SA 3V5KA 4V2CB 4WIQA 5I1IL 1IM9B 1OW0A 3EUUA 4LMQI 4U0RC 3MRIB 3MRHA 4KK8D 1DN0A 3QXUA 4L8DB 1CFVH 5MEND 2J88L 1ACYL 1YEIL 3VD5A 1UH4A 5I1AA 3OAZH 5FO9A 3P30L 1YJDC 4NC2B 1PGRB 1CD0A 1T2QH 3SN6N 2VLKB 4GW5B 3UC0L 5E7BA 1FNFA 3TA3A 3U9PH 1BLNA 1QFHA 3BD3A 5A2LH 4K9EH 1X3DA 4NN7B 1QLEL 5J9PB 4X9BA 3BKYL 3RI5F 5DTFB 4JHWH 4FG6D 1T1ZA 1UWXK 4YQXH 3FQUB 3F7RA 3MNVB 1A14H 4Y16D 4KKLC 4PTTB 4R7NA 5E5MA 4HKBB 1D6EB 1N3NB 3AREC 2DBLL 2L0DA 3FCTA 3SQOH 2HJFA 4U6XB 3SGKA 5IM7A 5L2JA 1EJOL 4OZFB 2WNGA 3OKEA 2AK1L 4X5LA 1R3JA 1KIPB 1FCCA 3AC0A 4EVNB 2ZCLL 3BT2L 4QT5B 2ILLA 2DLFL 4Y4HD 5EO1A 5SWQA 1F3RB 4LCIH 3GI9L 4POZC 4MA8L 1G7JA 3PDOA 4LOUC 2R8SL 1H0DB 1N7MH 5DA4A 4R2GD 1MQKL 3U9UA 3ZSTA 1OAKH 3B2VL 2F54D 1JMXA 3QQ4A 5IROA 4NHCH 4RZCB 3PWVA 1MVFA 3JUYA 4M6NH 1KJVA 2ZUYA 1UEYA 4HS8L 5IVXA 2AV1A 3LHPL 3T0XA 1E4KC 4OFKA 3ESVF 3JWOC 4RFEA 2PUQT 3JTTA 4I2XA 1OQXA 2E7MA 5SV3A 4N8PA 1MH5A 1I1CA 1FGVH 4MLSA 4PJCE 1RQ5A 3KXFE 4P2QD 4HULB 3T8XA 3TJEH 4GMTL 2ZCKL 3NCMA 4MAUL 4DGVL 1XIWA 3X3GL 1HHIA 1FVEA 5F3HA 1KTLB 3TJHD 1ED3B 3P0VL 3QPQD 3SOBL 5A16A 3THML 1YNTA 3LS5L 5EFIA 4XNQA 1KN2L 2VISB 4U1KB 2QBWA 4D9RE 1UM4L 3JTSB 2UY7A 2EKSB 4YDLB 5FV1L 1N59A 2EXYD 2DM2A 4XPHH 3PP4H 1G9NL 3FMGH 1UZ8B 4JRYE 3DX6B 5LCVH 1QTYT 3U36A 5CEZH 4HWZB 3O2DH 2D4FA 2QSCH 3D3VA 3DETC 3FO0H 4NQSB 3RWIB 2XKSA 2DRUA 3I50H 2BK8A 1CXIA 4YBQC 3QHTC 4YAQB 1MCFA 4QGYA 4W6WB 4NQUA 1QVOB 3P4LA 5EU3A 4GS7B 2FEDD 1FVCB 4Z8FL 3HMXA 1S7WB 1MJUH 1P7QD 5TGBB 4FZEH 5KANI 4J4PA 4JQIH 4KJYB 3IGAA 2ERJB 4ZNEE 5EOQL 2VDMH 2AJSH 4GRWE 5GS1C 1X5YA 5EBWA 5HVHC 5EC1A 3IFNL 4QTHA 3GMNA 4RFOH 3WCYA 3FOMB 4R7DA 4M5ZL 5HI4D 2GT9B 5JHLL 3MLXL 1CU4H 1L7IL 5TE4H 5DSCB 1MOEA 4WWKC 4YHPB 3RDTD 3VI4F 1MRCH 3KXFD 5J7CC 5CAYB 2VAJA 1WC7A 4APQB 1RZKC 4OGAC 1EFXA 1X44A 1NGWA 1P84J 4R4BA 4YHIA 4U1JA 3HLAB 4TRPL 1BREA 4HGMA 6FABL 3CSPA 4J7RA 1OWWA 2RJMA 2FJGA 4LLDB 4WUKL 4NT6A 4Z7OE 4WTWA 4DCQA 3ULSA 1K6QH 2EDFA 4XNZC 3WJLA 3AM8C 5B4MC 3O2WH 3BD4A 2VQ1A 1S7QB 2HTKD 1DN2A 2R0LL 3DUSA 1NUDA 3KJ4C 3HNTH 4JANB 1OAXL 4V1DB 4S0TD 5DQJB 2XQBL 4PJ9B 3TVMB 3AU1A 3P3YA 5GRUL 4KVCL 1DE4B 4JRYD 3KG5A 5F7FA 2YKLH 3BH8A 1T0MA 4LIQL 3KPTA 4TYUA 1N8ZA 4YHOL 3TFKD 2XN9D 3TH2T 5KVMC 2NXZB 4HK0A 4O5LH 1TMCB 1I4FB 2A1WL 3WHE1 1I8MA 2H3NB 1CZ8L 4ZXBC 2FIKA 3D0LB 2K3TA 1H8OA 3G08B 3MV7A 5DHYA 4NN5C 1FPTL 5C08E 3RL2A 4TSCH 1XR9A 5BW7C 2FO4B 3QUZB 3TO4A 4KDVA 3ULUE 4ODTH 2W60B 3DTXA 1QLRA 2ZUSA 2QQLL 4MAYC 5E1HB 3HC3L 4IRSA 4HPOL 4KV5E 2ZUTA 2PR4L 3RY6A 3FQRA 1QBBA 2D7TL 2KZ1B 2FGWL 3LKSA 3QXWA 4U6HB 4Z7WF 4JN1H 4LSTH 3IDYC 2GITA 1IL1B 1DEEB 1U93B 2VC2H 3FO2B 2IF7A 3WEXA 4ZS6C 4XVSL 1ZAGA 3NVQA 4OD2A 2DJSA 2NY7H 4OFIA 2WQRA 2Y9RT 1WZ1H 1P4LA 2VQUA 5BXFB 3OB0H 3NTCL 1UXWA 4OFVA 1QBLL 1FL5A 5HHOA 1QFWM 1B6DA 3MCKA 3SGJA 2VL5A 4MSWB 5GZOC 4XHQA 2YA0A 1OGTA 4H0IA 4OQTL 2ZJSL 3EOYG 1JGUH 4QKXB 4QRTA 4LPUA 1JHKH 3BEWA 1R3LB 2I9LB 3K1KC 4KK6D 2Q76A 2FLRT 3P73B 1EO8L 1OP3H 3WD5L 5MI0C 2YBRA 5EA0H 1F42A 5B38G 3CFKB 3O6LH 1K85A 5KS9A 1KELL 4XRCB 2IBBA 1MRFL 5DJDA 1QP1A 1AO7D 2MKWA 5BV7L 2NXYB 4HF5H 4N8VG 2AJXL 3MREA 5EPMA 4LGRB 4ORGB 3TH3T 1YYML 1IQDB 3MLWH 1ZSDA 1X9QA 3NA9L 2FCBA 4C4KT 3MA7A 4UQ2B 3BQUA 5IBUG 1Z2KA 4UDUB 4I18B 5KSVA 2VITA 3U30C 3ZE0F 5IP4A 1U8PB 1CE1H 3TZVA 4ELME 5I1GH 1CQYA 2R0ZL 1X4ZA 5F9JA 5HYIA 4MNGE 4UT6H 1WICA 5TF1L 1KJMA 1BZ9B 4KTEL 5CZXC 3MRNA 1SJHA 3WIFB 4XXDB 2P49B 3OPZH 5DEGB 5GXBB 1FVDB 4FQ2H 5GPRA 5FECB 4DZ8B 1CTNA 4DAGH 1S5IL 4NOBA 1F11B 1CLOL 4HIJA 3RTQC 1T20A 4R26L 1F8TH 5C08D 3RIAK 3OAUL 3ULUD 1J1OH 1VPOH 2EICA 2XYCA 3EOTL 5B38A 5HYEA 4ONFL 2BVQB 4GFTB 4OTXL 2A0LD 3U79A 3ZKXB 2CXKA 3JVGA 4HKZB 4N8VA 3OXRB 4WY7H 5T5FL 3RPIB 2JB5L 1OTSD 3T1WA 4EIGB 1ZS8A 2YMXH 5CP7B 4ACPA 1NBQA 3QYCA 3QNZA 3FT3A 4FQQB 2G5BB 1UKQA 2WP3O 1Z0NA 5HHVL 4C56A 4NQXA 1VB9A 4L1DA 1T0NB 3NZ8A 2NY6C 1ZWIA 1RUKL 4M6ML 3SO3B 1OD7A 3B9KB 2WUCL 5JQHC 1NMCB 4OI7A 1T2XA 1KN4H 3P0YH 4M5YL 4PJ7A 1EEYA 1X7QB 3MRBB 2Y6SC 1TCRB 2YPLD 4ZOBA 3VFOB 4AENB 4HLZH 3ZLQC 1CD1A 1PKQE 4X9HA 4ZFOB 3SDXE 4HGWA 1CK0H 4PJEA 1JYXA 2MQ3A 3GMOB 1AGBA 1BFOB 1IAIL 3AB0C 1HIMH 3S3SA 3PWPE 4FTVA 2H41A 5IGXH 2YN5A 5D1ZB 3MRGB 2E8YA 3RI5K 2RHEA 4WFFE 1P4IH 3ULVF 2OTUB 3L3DB 4WJ5A 2OJZH 4IRJC 1AXTL 5L2KB 3SEPA 5MEQA 5IEHA 4YE4L 1F4AA 5E2UL 3GKZA 3G04A 1GAFL 1ZHBA 2FWOA 1KJ2L 1NMAH 4NJAH 3UTTA 1S7XA 3FQWA 2J6EL 4KZEL 2NX5E 2Z31C 1UWXH 1WLHA 3Q5TA 3EYQD 3ROLB 1C7TA 3INUL 3KPRB 4F9PC 2AEQH 2BDNL 5L9DL 2A9NL 3VWJC 2EDWA 6CGTA 1I3GH 3VWKC 1K5NA 1T66C 2UUDK 4PIRF 5FF6A 4MS8D 2PO6C 1RUPL 5DF0A 4K7PX 1W72H 5L7XH 1VFBB 2IANB 3HAEA 3UMTA 5T1KD 5C70A 3WDHA 1J0YA 3HUJB 3PGDA 4JCMA 3LIZH 2OX5A 1IC7H 2HRPH 4XCNB 3AY4A 3D48R 3KLDA 5IB3A 1QR1B 4JO2L 1G9MH 1AE6L 1UKSA 4L4TA 3QAZB 1YEFL 3EYSH 5EUOA 3MLRL 1NCDH 1NEUA 2MMXA 3DI2B 1XF1A 3TN0D 1EO5A 1FH5L 1ZVSA 3OZ9H 5DUMH 2R2CA 3QIWA 1KLFA 4KK8C 5CHNB 2DQUL 3MJ9H 1MCRA 1UB5A 3MGOB 1XF5A 1U8NA 1GHFL 3NIDF 3NN8B 3RZCD 4H0GA 1R0AH 2G60H 5L0QC 1LO0H 1Q9WB 1J0KA 4LCCA 1DR9A 4LGSB 3HI6L 1L9NA 4NBZB 5SWSA 5B39G 1RJZB 1GPOH 3FB8B 4LEXL 1J88A 4OLUL 3LH2L 1RK0A 1QPXA 5KANG 1FO0H 1QFWI 5E8EB 4GKSB 4KROB 4QHNA 4NPYA 3JV5A 2EECA 3C5ZB 4X8JA 1IJ9A 1MFBL 2X4TB 2NLJA 3P4OA 4OF3A 1KYOK 5JW4R 3EJZC 3T0VA 3W9EB 4JB9H 4U2ZA 3QDGE 1KOAA 1CDIA 3B2UD 1HINL 5D1XC 4NUGH 4PRBB 2X4RB 3IU3A 1JF1A 4G9DA 1KTDB 4ODHH 3SDDB 4FXGA 5IMOA 3AXLB 1YN7A 1JHLH 1WCBB 4NGHH 2NX5D 3FN9A 5JIHA 4UBDD 3EFFB 4IHOA 3MV9E 2KKQA 4M7ZB 5LBSL 5HDQH 4Z77A 4HCRL 1PZ5A 2DLHA 3D3VB 4DGIL 2XFXB 4GUPA 1DANU 1JTOA 2XPGA 1R24B 4JPIA 3FO9A 4L4VB 4Y4HC 5F89B 5JMOC 3MUGB 3LPFA 1H8NA 4GRLC 4OZIE 1XF3A 1MHPH 3X14A 3D39E 5ALCL 2E7CA 4WEBL 4R2GC 4MB3A 2VIRA 4X4XA 4QCIB 2CLRA 3RY4A 4MA1C 1HWGB 1A02N 4YHKL 5J3HD 2Z91B 3KWWA 2DMCA 1RZJC 1OVZA 4ERSH 2VXSL 5I9QC 4AG4H 2WBJC 3G5VA 4PGEB 3BP4A 1GH7A 4LQFL 2AXGA 4QRPA 1XH3A 3IJYB 3WKNA 1ZHKB 4P3DB 1RZIB 1ZT7A 5D8JH 1SYSA 1NBYA 3BRFA 5ADPL 2R39A 3HUJF 3CSYA 5K9OA 4P2OA 3SDYH 3VFMB 1F6FB 3FB6B 4K71C 2HWZL 1X5JA 5D1QB 4CVZA 1W0WA 4U0QB 1ES0B 5E8PB 4OKVA 3H8NA 4ODSH 5I6XC 1DLHB 5D71H 4NQDE 4EI6A 4XMLH 3BP6B 5IQ9B 5LKNA 4A6YH 1EFXB 5AZ2H 1U58B 3PDDA 1A4KA 5FOBA 2P44B 3F12A 3JWOL 2FIRT 5JXED 4JM2A 1I9EA 5SWZB 3O3EB 2QL1A 3W2DH 3ARVA 5D70H 4U1MB 1J1XL 4WW2C 1Q8MA 3A67H 5F9OH 3QDGD 3QUMB 1CFSB 3RGVD 4P5TB 3NBNA 5JW4Q 1BQSA 1S5HA 5HHMD 4NO2B 4G8GA 1JPSH 3BWAA 5AYQA 3KLSA 4HS3B 4AEIH 3QHFL 5I30L 4WI2A 3SE4C 4LSRH 2R23A 2C9AA 3MV9D 2X9WA 2QADB 4O2FA 4OCRL 1IEHA 1JV5A 4ODXB 2FEDC 1XMWA 2H9GB 1FL6B 4X6DE 4OLWL 5KOVC 4NRZA 3MROB 3FN3A 5DMGD 1LK2A 1MJ7H 3D39D 3OX8A 3VH8G 2QHRH 4G6AC 2GQHA 2FYYB 4LRIC 2J8OA 1HHHB 3CU7A 4PJ8D 3MUHL 4PG2C 3QZWG 2FSEA 5JA9A 4LF3B 2JJTA 3GJFK 5L88L 5GGTH 4XPFL 1G0YR 2GI7A 4PTUA 3RL1A 4U1SA 4HZLB 3P11L 5C0CE 1PAMA 3ALXA 2YRLA 3VD7A 1DQJA 4NQCD 5FKAB 3KJ6H 4HFUH 4L8SC 3CDFA 2RGSA 5EUKB 5C0AE 3DRQA 2K9UA 2W0LA 3U7YH 2HT3D 2DQJL 4GBXA 1BP3B 4H88H 4WO4D 4HXBH 5D7JC 1XF2A 1Z5LB 1MHEB 1S7VA 3NCJH 4HK3N 1I7UB 1TJGL 4K7FB 3FN0L 3LD8B 3BHBA 4OI9A 3G6JE 4QXGL 2CDEB 2V7HB 3LCYA 5TDOA 2O93L 3OHXA 3MR9A 4R4NC 1X4YA 3S34H 1ZKAA 1BGXH 2DQIL 2ARWA 5H37G 5INCA 3GSNB 4Y0GA 5DHVH 2C4FT 4RMVA 1IRAY 1E0OB 4FQ1L 2IAMC 4A2MA 3VH8A 1I7TA 2BC4B 2XNAA 2PNDA 5C09D 2G9HB 3VXSA 3QZWA 4FFZH 2GY7B 3VFSB 4OGXH 4L8CA 1PZUB 4N5EC 4H5SB 1D9KD 2F74A 3H7BA 1HSAA 3O4LE 1U8IB 3B9EA 5IMLB 1D5BB 2P43B 3TFKC 4GG6E 4F58H 1RZKL 4MB5A 3RWGA 4FXKB 3BN9D 3D85D 2ZOKB 2IMNA 3TF7C 3BH9A 1JPFB 1QRNA 5HDOA 1JK8B 3Q6FB 4UIKH 3DX7B 4JFDB 2RBLA 3OKMA 2YUXA 2C3XA 4K07A 4Q2ZB 4JZJC 1PG7X 2ARJA 4PS4H 2MOVA 4RISH 4M61A 1S7SA 3NABH 4AQOA 3KPPB 3VRLE 4ZSOB 3NPSB 4HGKC 3DOSA 5F9DC 3U48A 2EIBA 3N9GH 1AC0A 4ZS7H 2GFBB 4PRNA 3QUXB 4O4YL 1EEQA 1M4KA 1TTUA 4Y5VA 2EYTB 1XCTB 2B5IC 1U95B 4HC1L 3MRPA 4M93C 2AS5M 3OG4B 3KPSE 3AMKA 4JREB 1NDGA 2NY3D 4PRDA 4O51A 1WGOA 25C8H 5C0BE 5C0CD 2A6DB 2OTPA 5CBAA 3T65A 1OF2A 1LDSA 1E4WL 5IB5A 5JW4M 1J18A 5DVKA 2KQNA 5C0AD 5C9JA 2X4UA 3QWOA 1MI5A 3RRQA 5E9DA 1K2DB 3EOAB 5TH2A 3T0WA 3WFZA 1RIHH 3T0EB 1S3KL 4NZRL 4HQQL 2GCYA 2DQCH 1CICB 3CMGA 3LAFA 1JNHA 1RIVH 2GIYA 4QRRA 4X6CB 3N1QC 1XAUA 5DLML 1WBYB 3HA0A 1TPXB 2PYFB 3HB3D 1VFMA 1NEZA 2V2XA 4PG9A 1QEWA 3I3BA 5FV2A 1XGRB 3SE3C 4NO3A 1GJIA 4D8PA 3CVHA 4FQIL 2IPUK 5EU6E 3RVTD 4TQEH 5I2IB 3CPLB 3ROOB 3O3BA 4NO5B 5FUZL 3GMQB 1AI1L 4NWTH 5LXGL 2R2EA 5BRZB 1FNHA 5KVFL 1NGZA 3SDAA 2QV2A 4JGUA 1HZHL 4P9HH 4R96B 2R0KL 1FBIH 4EDXA 1BBDL 4EJ1C 3R8BB 3KYOA 3O4LD 5I1HL 2MCPL 3V0WL 5IWLC 3QEQB 1G7MB 1FNAA 5HGDB 5D2NA 3QIBA 1F5WA 4ORZC 4P4KB 1FAIL 4EOWL 1UQSA 3F8UB 2OL3A 3QNXA 2UYLB 5E1AB 4P5MB 4F8QA 5IOPA 3O3DB 2JJVA 4PBVC 3KDMA 3MJGX 3QEHA 3A6BH 5EBGA 4QRSA 4LPXA 4XH2A 4PRAA 4RBPK 3FRPG 4RWYL 3V0AC 2W91A 3FFCE 1PG7W 1M7DB 1V7MH 1YC7A 2X70B 4NQEE 4JY6B 3MLZH 1G9MC 3UYRH 1HN1A 4HIIA 2J5LC 4HWEL 1KPUB 1MHCA 4EN3C 1B2WL 1NANH 3DBXB 5C0BD 3W39B 4DN4H 1WK0A 4WI9A 1T1XA 1QO3A 3NIGF 4PRPD 1PFCA 4N1EA 2A74B 2UUDH 3MV8B 3EO0B 5JPMB 3T3PE 2JB6A 3C87A 5ALBH 1P84K 1TZGL 3I75B 4GKNA 3DXAE 4HBQA 3KYMA 4NZDA 4UU9B 3IXTB 3ZTNL 1F4WL 1SBBA 4JFQB 4UT9L 5GQBA 2YEZA 2FATH 4XPGH 2AGJL 1DQLH 3GI8L 4YJZL 3S8WA 3SDCC 2AJUL 2IC2A 4U1LA 4M4PA 3WUZA 1JGEA 4QF1A 3L3IB 5DJZB 2HJKB 4D0DA 4WHDA 4W70A 5F7DB 1S7UB 1FNSH 5KTEH 1T4KA 4X6CF 5TJWK 3DMMC 5EU6D 4GAGL 4U7KA 1HQ4A 1T80A 5EBMA 3M17B 1CFVL 1R3HB 3G5YA 3VRIB 1P7HL 4G9FA 3TIEA 1B88A 4MDJB 3QDMA 1ETZA 4W81A 1IM3B 2EDDA 1NGXA 1T2QL 5IIEA 2H32B 2D7QA 2Y72A 2AJVH 3UZEA 5IMKA 3JWDH 3U9PL 4DKFH 2OR9L 4JFOB 4QTIH 3VXNA 1A6AB 4PJEF 3LQZA 3MFFB 3MNZB 4ZPTA 4YIQB 1SVCP 3O6FB 1M7XA 1TCMA 2QKIB 5JDJA 4JQXC 3ZYIA 4E41B 3MJ7A 4Z7VB 4HAFA 2F8OA 3TBSA 4DUVA 1AGEB 4YHNA 3T3ME 4Z0XA 2ESVD 5D4QA 4YQXL 1A14L 1KENH 1U3HA 2ARJQ 2JIXA 1A4JA 2V5RA 1F4XL 3FFCD 3GRWA 5F8QC 3UTSE 2GTWA 2VNCA 5EIIA 2CMRL 3BPCA 1KT2B 3M07A 2YK1H 5FKPB 2BNRA 4MS8C 4MXVF 4PGBB 1YQVH 1N26A 3FB7A 4RAVA 4M8VA 1OGAD 3MX0A 4GSDH 4U6VL 2J8UB 5BV7B 1BVLB 4O2EB 4HEME 3REWB 5I1LA 4OZFH 4JZNA 2AKRB 4YWGH 3MOBH 4LCIL 3UAJD 5F1KC 2G2RA 3DSFL 3CZFB 4KI1A 3IAQA 3TN0C 1DDHA 3MC0A 1OAKL 1HOCA 4I0PA 4FP8H 2D3VA 4JFZH 3HZKB 1F6AA 1EAPA 2I24N 3EJYC 4NHCL 1H5BA 3AUVA 4JRXA 3C8DA 3TIDA 3IDGB 1UC6A 5GGVL 3RZCC 4U33A 4EI5D 2Y25A 3D2UA 4MNQE 2EDBA 4DW2H 3PWLA 1EHNA 1FGVL 5TQ0H 3BPOC 5AAMA 3E6HB 4JLRA 5FYKU 4DKEL 5EOTB 2VDOH 4HKXA 5EUOF 1Q72H 4UUJA 3RHWF 5ISZE 3N1PC 5DT1H 1K4CB 1T7YA 2R1YA 2R2BB 5HHXH 4MVBC 5I1EH 2VXUH 1MCOL 5BS0A 3VE0B 2DI7A 3K2UL 4P46B 2DLGA 3MBED 4KK9C 4HKJA 3HPJA 3NA4A 4J1UA 3ORJA 5GGSA 3N1GC 2P5EB 1YEEH 1A64A 3G6DH 2C3WA 3KHOA 4AT6B 4KDTC 4WI6A 4LAQH 5F6IB 4LCWB 4PJXE 2FL5B 1M7IB 4RGNB 1RZGA 4H25A 1KLGA 4GH7B 3PP4L 3FMGL 4BSVA 1KLUB 1LILA 4JAMB 5FFLA 3VXQB 1BIIA 1XGQA 3V0VB 1PW3A 3O2DL 4Z7VF 3UTSD 1VEPA 2C1PB 2QSCL 3FO0L 5IW3A 1U6AH 4D0CB 3MGTA 2DQHH 4E0RA 3VXOA 3RIFF 5KSBE 1G7IB 2XXMB 4PJHE 4IDLA 4HS6A 1UENA 2BXYA 4Q74A 4B7LA 2IH1B 3GSWA 3KPQB 1U8JA 4NBXB 1NUNB 5F7EH 3L3KA 1MJUL 5DJYB 4ZPVB 1C12B 3GJEA 4JQIL 3GJFH 1OOAA 3D87B 2J8UF 3ZO0A 5FGRA 4B5EA 4MD0B 2XTJE 2VDLH 3HE6C 2DM3A 2VDML 1EEZA 1A7NH 4XBPA 5HTSA 5GHWH 4LSUH 4WEUD 1UZ6F 4PGZA 1U8OA 3W0WA