2ZPKH

Crystal structure of p20.1 fab fragment in complex with its antigen peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
EIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGWINTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREGPGFVYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG1-lambda P20.1 Fab (light chain)
publication title Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 208
sequence length 216
chains with identical sequence I
ec nomenclature
pdb deposition date 2008-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkH02
2FCBA 4I0PD 3VXTB 1VGEH 3FTGB 1RZKH 3TH3T 2D7TH 1QRND 5GISL 2CLZA 3GK8H 4BSVB 1W72H 5HYIA 5DJAB 3FZUD 3IYLW 2Y23A 3STLB 4GXUM 5ILTL 1HXYA 1MFBL 4KV5E 2OTUA 5EU7C 3LQZB 3SKOA 4U0RB 2VLRA 3QO0B 4Y16B 4PLNC 5I71B 2VMFA 3O4LA 2BOBA 1OSZB 1BQHG 5EZLB 1XIWC 5BXFA 5KSBB 1BQLL 1T1XB 1VEMA 1SJHA 5E2TL 5EBMB 2NY5H 3NN8A 4NO0D 2G60H 2ZSVA 4NN6B 2HTKC 1PFCA 1YYLL 3MCG1 4GMSH 4BSJA 1UVQB 3JTSB 1R3IL 2EH7H 4PY8I 4BFEA 1JGUH 5DRNB 1T03H 4FG6D 4P5TD 5CEZL 3OV6A 3ZSSA 1P6AB 3MRGA 5DMIL 1CG9A 1ZVSA 4WW2F 3GMNA 4IRJD 4RIRB 1I9EA 4WTWA 2ZUXA 2G5RA 2OSLB 2OTUB 2NY7L 3K4AA 1G9EA 3EAKA 4DUXA 1GPOL 2X89A 2BOBB 4IOFD 3KYOB 5BXFB 5E5MA 1BAFH 4S2SB 3NN8B 3MUZ1 3RDTD 5FXCH 3V8CA 5EU4A 1JRHI 2PTVA 2W0KA 4ACPA 5IT2H 1CICC 4U1SB 2CUIA 4LARH 4L8CB 4M6ML 3U0WH 4Z0BL 5LBSL 3KYKH 4JQIH 2EEBA 2V9TA 1NAMA 1JTPA 1CG9B 3SGEI 1ZVSB 1NGQH 3PP3K 4IOSD 3QQ3A 1WZLA 2APXA 4WDIA 5C0NC 5DQ9B 1ERNA 3O2WL 5DA4A 2DJSA 2IG2H 4PG2C 1SY6H 4MWFA 1U95A 2A83A 4DZ8A 5KS9A 4X4YA 5HD8D 2OBGA 5EBLA 4EVNA 5C6TL 2NY4C 1WSST 1AKJB 5C92A 1DLFL 3DSFH 5E1AA 2R0WL 5JZ7C 5E8NA 5L0QC 3DECA 4Z7NF 1REIA 2MMXA 4JY4B 3HFMH 1U3YA 5GRJH 4BZ2H 1KT2A 3ZKND 2YD2A 3QQ3B 1DE4A 3EJYC 4XCNA 1A3QA 1UCTA 1QTYT 4DGYH 3BIKA 5IFHH 3CSGA 1RVFH 3OJVC 1IJ9A 1H9VA 4KK9D 4HLZG 2GI7A 3GM0A 3MBXL 1KIRA 4K3JL 2APBA 5T3ZH 4MWFB 1FL5B 2AEPL 1CL7H 4W6YB 1KPVA 1WZKA 2BHZA 4X4YB 4J3XA 4JKLA 2R69L 3CLEL 4XHQA 5T1LA 1G1CA 1FNAA 3ORJA 3U83A 2YR3A 3IKCA 1IQWH 5E8NB 1TVBA 2X1QA 4HC1L 2PKDA 4XBGB 1TFHA 4LVHC 3H7BA 5EH1A 1KT2B 1NCCL 2ADJB 2WBJC 1RULL 4HJJH 4MA8H 2MFNA 1TETL 4XCNB 1DTUA 3BZDA 5D2LF 5C6PB 1FYTB 4AJ0A 3BIKB 4PJEE 4OD3H 1KIRB 5F3BA 2B4CL 2XA8H 1HHKB 3TPUA 4NQDB 4DKDC 1KPVB 4XRCB 3SN6N 3T2QA 3WS3A 2DQUL 2AI0H 3QH3A 3KPQA 3IKCB 4JO4H 3MRNB 3BEWA 1I8KB 2XRAL 1TVBB 5BOPA 5JPMA 4HJ0D 1F4YL 4UILL 2Q8BH 4JJHA 2FIRT 4Q0XH 1I1YB 3RUGB 1NC2A 4F80A 3WMSA 4JCMA 4PYHA 1I8MB 1JMXA 5GS0H 3QXUA 4K7PL 1IAOB 2VUYA 4PBWD 2IBBA 5F3BB 2GJZA 4LVOB 3TPUB 2EIZB 2HT2D 1HSBA 1YEKH 3OKMA 3WS3B 1ETZB 5T3XE 3QQNA 1YEFL 5DMYA 5HI5C 3I6KA 3GJFB 4OLEA 1OVZA 3KPQB 1ED3B 5T3XD 4ZNCD 2C5DC 1Q9WA 3ILQC 4U49A 5E00A 1WCQA 3SE9H 1MI5A 3CDGA 1NC2B 5KSAC 4F7TA 4KJQC 1GGYA 1XF3A 1LMKA 3FFCB 4OF3A 4LFHD 2V7HA 2X1WL 1S9YA 4KQ4L 5HI4D 4KJWD 2H9GB 4I0KA 2JCCA 2GJZB 4NO3A 2DD8L 1HSBB 4XX1E 3JZ7A 4R4BA 4CVXA 4LKCA 1JFQH 3MRJA 1CF8L 4OZHF 3RX8A 4BH7A 3N1GC 2YPKB 4J3WA 3OF6A 5TFSH 4M8VA 5CMAA 1UYWL 3I6KB 2EDJA 1YA5A 5CJXA 2FIKA 4PRIE 4GAJH 2IH1A 3GRWL 4GG6A 1Q9WB 3BH9A 1RY7B 4LGRB 3BQUC 5KANG 3T0EA 3C2SA 3GIZL 5E00B 1UWXK 2E8ZA 5ISZB 4PRID 4AQOA 3GSNL 3CDGB 4X99A 4I3RL 1EFXB 1CXLA 1XF3B 4M02A 1LO5A 1AY1H 4EZMA 4JM2A 3SCMD 4Z7WA 1S9YB 2GY7B 3S35H 5C86A 5DS8B 1AD9A 5F88A 2X7LA 2JCCB 4NO3B 5I1LA 1KPUB 3QUMA 1MQKL 4KKNA 1PZUB 4R4BB 4LSPL 1C16B 3KPLB 3SDCB 4BH7B 4I18B 5HYSA 1NBZB 1G9ML 4NNPL 2DTMH 3BI9X 5FYKH 4P5KB 3Q1SH 5IF0B 1VKXA 4GG6B 2YKLL 1BQHB 1RJYA 5F96H 3W0WE 4X99B 4MNGB 2CDFA 5CCKH 2KZWA 3W0WD 2AXHA 2IANE 3MACH 4GO6B 3QCUL 3AGVA 3OHXA 4JM2B 3I02A 1QBLH 5IROC 4Z7WB 3TJEL 1YNLL 1AD9B 2IAND 3LVEA 4NKOA 3BUYA 1GCFA 1RAMA 3P0GB 1EA9C 4PRNA 1QLRA 5HYSB 1CFNA 5SWZD 1VKXB 5SX5K 2XNAB 2HLFD 2PXYA 3O6FA 3TC9A 4HK3J 3CMOH 1NQBA 1RJYB 1S7VA 4FP8H 5INDA 1OSPL 2MJWA 1WGOA 1A21A 2CDFB 1J8HA 3UDWC 1TXKA 2D7OA 2YMXH 4LU5H 1BZQK 5E24E 3KDMA 2C3GA 3QJFA 4PRHE 1FL3A 4YBQC 4KDVA 1IC7H 2ICCA 1TZIA 3S5LB 2CR3A 1DSFH 1ACYH 1MIEH 4PRHD 5J89A 3DIFA 4OGXH 5LGJB 5BO1L 4XT1C 4PRNB 4FMFA 4QRRE 4X6EA 4PTUB 1QLRB 2C4FU 3U7YH 2VSDA 2BY2A 1MHHA 3CPLA 4QRRD 4Y8AA 5EU3A 4A6YB 2BFVH 3RWFB 3DMMC 5IB3A 1MCWM 1LQSR 2ENYA 1QZ1A 3MNZA 1V3MA 5INDB 2AK1L 5JXEC 1KCLA 3CSYB 4L8SB 4U1HA 2YEZA 5DD6B 3JTTA 3P0VL 5CSZB 3RWCB 4OQTA 2HG5A 2PF6A 3KDMB 3UTPE 1AXSA 1M05A 4NBZB 2B4CC 4OFDA 4MQTB 4MA3A 1FL3B 1J0ZA 5BRZB 5CFHA 4KI1A 3UTPD 3U6RB 1IARB 5F1IB 2LABA 4MS8C 3MYJB 4FA8A 3GBLA 4LNRA 4HUXB 5J06A 1R3LA 1SBBA 1B0RB 3PL6D 2WWMD 2Q7NA 4L1HA 3ARXA 4C83A 3CPLB 3GSVA 4XXCC 5EU3B 4O58H 5IB3B 2X4PA 1W8NA 5D1ZA 1M7IB 2GKIA 4NYLA 1MCPH 1K8DB 3ESUF 3SGJC 3T4AB 2BNUA 3JTTB 2E27H 2HG5B 2WINA 3QZWA 3T2NH 4TNVK 1S7UB 3U36A 4PY7A 5L2JB 2ZCLL 4OUUB 4WUKL 4Y5VC 3PIQB 4LNRB 3OKEA 3TIEB 4XNQB 4G6JH 4JRXA 4DZBA 3VWKD 4QHKI 3DI3B 1IL1A 3MZGB 5DEFB 4KKAD 3V4VL 1D5XA 5TDOA 1MLCA 4RWYL 1ZANH 4NYLB 2X1XR 1MH5B 2C1OA 3IVKA 3UC0L 4RFNB 4P23A 1OTSC 1VFAB 2BNUB 1G7PB 1U8JB 3BWUC 1IBGH 3GJEA 3QZWB 1LE9A 1WBZB 4LVNB 4IS6A 4X0KA 4YH6A 1UM4H 1S8DA 1A7BA 4YBHA 3P4OA 5K9QG 1JWMB 3O3BA 3PJSA 3IU4L 1R24B 3GMOB 1A6TA 1CR9L 2VDLL 3HG1E 4DZBB 3MRCA 2XZQL 5E1HB 2VKWA 2P5EA 4DGVH 2UZIL 4LSSL 1XT5A 4D0CA 3UP1A 5FUOH 1TQCB 5BVPL 1IL1B 1OD7A 3HG1D 3O6MH 4ZS7H 5FOJA 5BW7C 4FABL 4FQPA 4R6UA 1MLCB 1DQDH 1S5IL 1PVHA 1U92A 4IJ3B 4EUPA 2C1OB 3IVKB 1GAFL 3QIBD 5SWSE 2FB4L 4QWWD 3V9FA 3ZDYF 4LL9A 4X0KB 5SWSD 4D9QE 5J7CC 3DBXB 3M17B 1KNOB 3OAZH 1BOYA 1MAKA 4XP5L 4Z77A 1FNSH 1G9MC 3PJSB 4ZOBA 3QNXA 4FFZL 2YD8A 2P5EB 4KAQH 1ZHLA 4WU7A 4MLSA 1VACA 3GSQA 3UAJD 4HAFA 2PUQT 2VDQL 1ZT4A 1A4KA 4KY1H 1QQDA 3FQTA 4WFFD 1HWHB 4ONHA 5HY9B 2VLLB 3RL2A 1N0XH 2HKHH 3TBWB 5E2WH 4GBXA 4RDQG 1UENA 5KVDL 4G6KH 1A1MB 1M6OA 3QNXB 1VGEL 3WS6A 1RZKL 2D7TL 1ZHLB 4BKLA 3MBED 4WU7B 1M7DB 4JGMA 3OKLB 5KVFH 1U91A 1ZT4B 2J5LB 1A4KB 1J1OH 1OARH 3MRRA 1U3ZA 3H3PL 5I1DA 4NN7B 5MP6H 1S7TA 3DUUA 3EFDH 1R6VA 1QFOA 3IDYB 4FQ2L 4ONHB 4QHLA 5D5ME 2G60L 4BH8A 3RL2B 5F9JB 4Q6IB 4GMSL 4FQXA 5EFIB 4GBXB 1QO3B 2V2TA 3VCLB 1YPZA 2EH7L 3PGDB 3ZDZE 1JGUL 2K9UA 2ZG1A 3CZFB 2FGWH 2OCFD 4JDTL 3VFSB 1NMBH 1QLEH 1KEMH 2NCMA 3H6JA 3O2DA 5TDNA 4KU1A 2HH0H 4LLUA 2DWEA 2BDNL 1MWAB 3AB0B 1J5OH 3QUYD 2FYYB 3CIQA 2Q20A 3ROOB 2QQLH 3TN0B 3T3MF 4MAYD 5I1DB 3B6SB 1S7TB 4W4NA 2GJJA 1UB5A 5T5NG 2V7NA 3ZZ1A 5EIQA 1BAFL 4QHLB 1RJZB 3QXTA 3T1FA 5A2JH 4FQXB 5IT2L 2V2TB 1YPZB 4JRWA 3RZWA 3WXWH 4LARL 5IEKA 3D69A 1YNTA 4QOKE 4ELKA 1FFRA 3KYKL 3PV7A 1U8MA 3F7RA 2IADA 2OX5A 1NGQL 5KS9F 4QOKD 3BN9C 4YDJA 2PTUA 2DWEB 2QR0A 2N4IA 3AREC 1QG3A 1DZBA 1LVEA 1CS6A 2IG2L 4XNUL 4XH2A 1UB5B 5IG7A 2V7NB 3WIHL 4UIKH 4ODSH 1X6NA 3MREA 5JNYA 1ZHKA 3RZCA 2Y36H 3T1FB 3GUTB 4M62L 1NFDE 3DSFL 2GCYB 1EJOH 3B4NA 5JHDB 2XQBH 3HFML 2NXZD 1P1ZA 1U8MB 5GRJL 4BZ2L 2IADB 2HTLD 5HSFA 1ZA6B 4EN3C 3FOMB 1MRFH 4PS4H 1HHIA 1EGJA 4F37K 1CXIA 4HEPG 5CSBA 3CFEA 4MYWB 4DGYL 1RVFL 2SEBA 3UTSB 5T3ZL 5F7NC 5LXGH 3N9GH 2OL3H 3FAWA 3QXWA 3WJLC 3MMEB 2X4QB 3SQBA 3D9AL 4AG4H 4OZ4A 4ZUTA 4UBDD 3EYUH 3KPSB 1KB5B 5DFWH 4HLJA 1HHIB 4HJJL 1RK1A 3U1SL 4OGYH 4MA8L 3CFEB 3R1GH 2DMKA 1A5FL 2SEBB 3HZYA 3QFJA 4PJIA 4U6YA 1CXEA 5BMFH 3WEXB 1OP9A 3KS0H 2XA8L 2OLDA 1A7QH 1YDPB 4AL8L 5FM5M 2NPLX 5HHPB 4XP9H 2AI0L 1II4E 4G8GB 3GSUA 1OLZA 1U9KA 2H8PA 4CKVX 4MCZA 4TSAL 4OZ4B 5ID0A 4HKZA 4BK4A 1NLDH 2Q8BL 3P30L 1A14H 4PJ9B 4YDVA 4ZUTB 1C12A 1WUNT 4P3CH 5HYQA 4PGEB 1OP3H 4KTYA 3MGAA 4QT5B 5GS0L 2B5IC 3O11B 4XB8A 1Z6JT 2F74B 2DLIA 3SKMA 5IB4A 2F5AH 2O5ZH 2XG4A 4QTIL 3HZYB 3GMLA 4H0GA 4MJ6A 4NO0A 1HCFX 4J8RA 3MJ6A 4DN4H 4GS7B 1YEKL 1YJDH 4P5TA 1V3JA 4JCLA 5EWIH 1O7SA 4I0PB 1GH7A 2L7UA 3KHOA 4Q9RH 5GJSH 2RJMA 4P3WA 1QRNB 4GW5A 3I84A 4IRJA 4N1EA 4HKZB 4I3GA 2D3VA 1XGRA 3SE9L 1C12B 5HYQB 4JHWH 4FQCL 5IBLD 3PGFH 3MRIB 1EBPA 1FNGA 4GMTH 4NHUB 4NRYB 5IB4B 3GMLB 2HAZA 4MJ6B 4NO0B 3LEXB 3RDTA 3UYOD 1CBVH 1VERA 4J3OC 2BC4A 1KENL 4P5TB 4EBQH 1JFQL 4P57A 4YXKL 5TFSL 1WITA 1H5BC 5HVHB 5L7XH 4GW5B 5HVGB 3TO4D 2WV3A 4RRPG 4GAJL 4JZJC 4GRMA 1CFTA 1GIGH 2Z92B 2YRPA 3RVVC 1A6VH 4J7RA 3SO3B 5J3HD 1AY1L 4XTRC 4G80A 3VRIA 2B7DT 4YE4H 2GJ6E 2ZNXA 5IKCA 3QIUD 3SKNA 4YDLB 5E8OB 2GJ6D 1N5YH 3HMWH 4OFIA 5JPNA 1DFBH 2V5MA 1A6ZB 1PSKL 5FYKL 1JGEB 1ZE3C 3Q1SL 4JY5H 4XBPA 5HHNB 4GRMB 3QHFH 1CFTB 1NDGA 5F96L 4K2UH 4HBCH 5CCKL 3FMGH 1SVCP 3ARFB 1NCBH 3VG0L 3QQ4A 3MACL 4KZEH 3AS2A 4ZUSB 1QBLL 3NTCH 1FORH 3C6SA 1FNFA 4ZFFA 3EYSH 4U7MA 5C0EA 1A3LH 4I13B 4D9LH 3SKNB 1H3XA 1XGUB 3HN3A 4X9HA 5JPNB 4O2EB 4E9LA 1LDPH 2OMNA 5TE7L 5D1QA 1T1WA 3VXNA 4XBPB 3M07A 4K7PY 3CMOL 5TE4H 4FP8L 4HKBB 1T3FA 4DKFH 2YMXL 4LU5L 2XT1B 3QQ4B 1NFIB 1NSNH 5I1GH 1IC7L 4ZFFB 3L95B 5IB5A 1ZGLM 1DSFL 1ACYL 1MIEL 4OGXL 5HGGS 3E0GA 4W4OA 3HZVB 5DJ6A 3CSPA 3KGRA 4GAYB 5H35A 4O2FB 1OCWH 1I4FB 3U7YL 4LAJH 2AJXL 2BFVL 3E1F1 5FGCE 3VXNB 3ARTA 2HVKA 3B5GA 5HPOA 4LHUD 2CIIA 1T3FB 5KZCD 3ROLA 3QNYA 4QRQA 1KGCE 2IPKA 2Z91A 5IBTH 4APQD 3P3YA 2VXTL 1R3JA 4DQOL 4XVSH 1OB1B 4PJEB 5F9OH 1T0MA 3C8KA 3LY6A 5C07E 4M93C 4ZO8A 4OM0H 1HDMA 5DLML 4JPKH 1UM6H 5C07D 3VRJA 3C5ZA 1S9KC 1OP5K 1BFTA 3MRKB 3C60B 5K93A 5E2JA 5IHZA 2M26A 4LVEA 4O5LH 3QUZD 3WUWG 4O58L 3X13A 4E0RA 5HYEA 2CIIB 5I15H 3LKRA 3QNYB 1CQYA 4QRQB 1MCPL 3IXAA 5K9OA 2IPKB 2Z91B 5J6HA 1R3JB 3T2NL 3C08H 1KFAH 5IW1A 1KULA 2VAJA 3MRFB 4MCYB 3MRDA 3C8KB 1WIUA 1OAXH 2YRLA 3S4SA 4ZXBB 1LO3H 1HDMB 5DO2C 2DQFB 4ZOAA 3VRJB 3MRQB 1HHJA 3O4OB 4PRIA 4WV1C 3MLPA 5LWYH 4LRNH 2NMSA 3X13B 4E0RB 1G7HA 1MCEA 1OAUH 4S10A 3MUGB 1T20A 4IDJL 3LKRB 3SCMA 1FV1A 1ZANL 3IXAB 4ZOEA 2DN7A 3FB6A 3OSKA 4CNIB 2R8SH 4PP1D 5F9DC 3OB0K 3EO1A 1I85C 1IBGL 2CSPA 2F58H 4KUZH 1K5NA 3FB8A 1NL0H 5A40E 3RGVD 5FKAA 1OAKH 2MCPL 5E99L 1Q1JL 2AW2A 2FHCA 2EDKA 5E9DB 5DD1H 4DGVL 3KPRE 1X5LA 5FUOL 1RJLA 1J1PL 1JWSA 3O6ML 4ZS7L 1R5WB 1WZ1H 1G7HB 4HIXH 2DM4A 1KIQA 2HJFA 3W0WA 3KPRD 4OBSA 4XVTH 1DQDL 1KJ2H 3SCMB 4R97C 3CFDA 2IH3A 4AH2B 1AGEA 2IANA 3VRLF 1VEPA 3BXNA 3EO1B 2RB8A 4XCCH 3NH7L 3DWTA 1FRGH 5D1XD 2W60A 4OV6F 4OSUL 3RVXC 4MXVE 2HVJB 1FNSL 4H5SB 3WKNA 3MGTB 4JO2L 4I77L 5F9AC 4JY6B 4G5ZL 4Z18A 4RFOH 4J3SA 2R2HA 5CJ5A 1JWSB 1UZ8A 2LTQC 4EXKA 1TPXC 3KJ6H 5GJTL 5DMKB 1Q8MA 1IGFH 4P2CG 3CFDB 1MOEA 1G7QA 4KY1L 2IH3B 2FL5A 1I1AC 2Z8SA 3AMLA 1KYOJ 5C0DB 3BXNB 3LAFA 4M5YH 1KB9J 4PRHA 2C3HA 3K8KA 5J12C 1N0XL 2HKHL 2DLGA 4FQ1H 1OTUD 5SWZB 4QRRA 4G6KL 4NUGH 4RISH 1JYNA 3QPQD 4PJGB 2R2HB 1UZ8B 3GGWA 3O2VH 4IRSD 4YFLI 2HFFB 5KVFL 1CICB 5FGBA 1OTTD 4ORZC 4WW1B 1AJ7H 4AIOA 1J1OL 4KGJA 1OARL 1ZT1A 3NFSL 5MP6L 5I73C 2V2WA 4PRHB 4MD4A 3E6HA 2DTSA 4L3AA 2HT3D 5I1CH 2RCSH 1KELH 1JNHA 3PL6A 2Y5EA 1T04A 4F7EB 5GSRA 1QKZH 1RQ5A 4YHKL 1EIBA 4QRRB 3B2UC 3FN9A 1IKNA 2FGWL 4CN6A 1NMBL 4RX4D 3OPZH 1QLEL 2OMBA 1KEML 4OCLC 5KTEH 3Q3GA 3WO4B 12E8H 3ULVF 3OKOA 2H41A 1NEZG 3UXFA 3LKNA 1CQKA 1H3WM 1JUFB 2ARJQ 1YY8A 4R7DA 2NW2A 1FO0B 3E6HB 3QIWD 4LPXA 1FNEB 4Z7VB 4RA3A 3MROA 3T77A 5TGBA 4F2MA 5T3ZE 1X9QA 2KQMA 2IBZX 4G8FA 5F3HB 5GRVK 5T3ZD 1MNUH 5I1EH 4V1DE 3Q3GB 5CBEA 5E2UL 3E3QC 3OKOB 5JA8B 4L5FH 1FHGA 3DGGA 2EDTA 3DYOA 4YQXL 3S36X 2X6MA 3MLYH 4YDIH 4R7DB 4GAGL 2NW2B 4RA0C 4UIKL 1IAMA 3IT8D 2KDGA 3TA3C 1L0XA 2I60H 2WBJB 2Y36L 3VWKB 2X4UA 4G9FE 5TGBB 1PW3A 3HG1A 4LCWE 4FFWC 1CLOH 4JQVC 4G9FD 1Z3GH 2FEDC 4HFUH 5TE6H 1ZK9A 2ICEB 1ZOXA 1TENA 4LCWD 3U30C 3ARVA 1MRFL 4L4JA 1F11B 3O9WA 3QIBA 4NZUH 4PS4L 5CBEB 3RA7L 1KXTB 3DGGB 4Y2OA 5C09E 5SWSA 3LB6C 1NAMH 3QEHA 2DBJA 1CGYA 4ZS6D 5C09D 3BO8B 4PJAB 3CVHH 5GS2H 3N9GL 5DSCA 3TBVA 4CADA 5B8CA 2X4UB 1YEIH 4M43H 5GS0D 1DVFB 3VGBA 2E9WA 4LQ1A 2LV4A 3VFGH 1QPPA 4AG4L 2NXYC 3EJZD 4OAWA 4PJIF 1KSRA 2EDQA 4X7TB 1YC8A 1KEGH 1JPTL 3QIBB 4K55A 3DYPA 4OGYL 4PIRF 1KB9K 5I19H 4HK0B 4QTHA 5SWSB 2X4TB 4WUUB 3O41A 1S9WA 1I1RA 3KPNB 4OT1L 5BMFL 5ACZB 3VJ6A 1A7PH 3CSBA 3WHXB 3LRSA 4CADB 3TBVB 4LQFH 4WO4D 5IMLA 3WNOA 4UUJB 5DVMA 2AVGA 4OAWB 1A14L 4YEEA 1RIVH 1Z0NA 4P3CL 3VD4A 3OAYH 2QSCH 4RQQA 4H1LG 1CIDA 4P2QE 1HKLH 5BS0E 1TCRA 4P2OC 5ALBH 4FFVD 3V8OA 5EZIH 1O5DT 1A1OA 1MREH 1Z9MA 2F5AL 2O5ZL 5KSUB 1AGDB 4P2QD 2IQAA 1BBDH 4MQ7B 2DWDB 4DN4L 1JPSH 2ADFH 5E6ID 1YJDL 4J3VA 5D5MA 1VADB 4PGCB 3LRSB 3AUVA 4GXVH 4L9LA 2VDNL 4HWUA 1U2CA 4Q9RL 1XF1A 4X6DE 3MBEB 1JF5A 3KLSA 4WEMB 1NANH 4UB0H 3VMPA 3QUYA 4JHWL 4UU9A 4M1DH 1JP5A 4RQQB 3PGFL 5FYKE 3GI9H 1TCRB 4GMTL 4MAYA 1MCBA 1A47A 3MLUH 2FBJL 5FYKD 4C56E 1B6DA 1JZ3A 1BOGA 2GITA 2IQAB 1I1CA 1KG0A 1CBVL 3JVGC 4K3HA 35C8H 2FX8H 4C56D 4UDUA 4MJ5A 5D5MB 4EBQL 1E27A 4M6OH 5FIEA 1QR4A 3OTTA 2DF3A 5L7XL 4JVPA 2AQ1A 4OQ1A 2Y25A 4QOKA 2DQGH 2J8UE 3RTQD 4HAGA 5DUBB 5GGQL 3L5HA 4PLKD 4EDWH 2HRPH 3FO9A 4KJPC 1ZGLP 3H2WA 4HMDA 1ITBB 2AS5M 4NO5B 1S9VB 2BSSA 3VFRB 2BZDA 5FYJH 2Q3AA 5M95B 1A6VL 5DF0A 1LE5A 4E5XB 2XKNA 4Y5XA 4HC1A 3W5MA 1KOAA 4YE4L 5CGMA 4Q9QH 3GMRA 1BOGB 1NBVH 2C7UA 3F6IA 2P4AB 4L3EA 1NUGA 3CH1B 4QGTA 1FJ1A 4MJ5B 5FA3A 3UTZA 3HMWL 4P46A 3D25B 1NFDA 2I26N 4G7VH 5ABDE 4YZFE 3CNKA 5FUCE 1SBSH 1UEMA 4JY5L 1XR9A 4LP4A 5B39G 3SY0A 1FP5A 3V5HA 5AUMB 4ODHH 3FO9B 3T3PE 3QHFL 3V6ZB 2VAAA 4K2UL 2BSSB 1SM3L 3MC0A 5MEQB 3FMGL 1LE5B 4TN9A 1NCBL 2XKNB 1T1ZA 2ED7A 1I9RH 4Y5XB 4KZEL 3LEVL 4QHMA 5DWUL 4JQXC 1EEZA 1BGXL 1D9KD 1FORL 3ARPA 4RMUA 3K8LA 4XPAL 3EYSL 2HN7A 3DUHA 4NN5B 2R2BB 1BFVH 2RR3A 1FJ1B 3JV6A 4HSQA 5T5FH 5FA3B 2L0DA 2D4DA 4PJ5E 1NFDB 2AXGA 1LDPL 1XR9B 3SY0B 4PJ5D 3QUMH 3QJHA 2R56H 1IGYA 5TE4L 4J3TA 2VAAB 1FSKB 4DKFL 1QFWH 5DHYB 3ZDXE 3DO3A 4UI2A 1T1ZB 1NCWH 1NSNL 4QHMB 4KROD 3T0WA 1C5BH 4CMHC 2FLRT 3C9NA 1BJMA 3BEVA 2HN7B 3ILPA 5F9WC 5J11B 4C4KT 3JV6B 3NZHH 1CZ8H 4OZFH 1X5IA 4ISVA 4LSRH 5DEZA 1BLNB 1OWRM 1F42A 1IM9B 2EXWC 4H0IA 3RX5A 3WFCH 1KTKE 4X7SH 2EYTA 2EC8A 2AXGB 4ZFZA 3QXAA 4RCAA 3LPWA 3MJ7A 1I8LC 4N0YH 2AJSH 3E2HC 5J13C 1D6EA 1AIFA 4ETQB 4YHPB 3SDAD 5F6IB 1QFUH 4IMLA 5FK9B 4XVSL 1UH2A 3G5XA 3V4UH 4ZAKD 2OXGA 4RMTA 5F7WC 3ILPB 3VXUD 3DX6A 4OM0L 2ZUSA 4WCYH 4JPKL 2VWEE 2V9QA 1UM6L 4ELME 4R0LC 3L7EB 4YHZH 2OP4H 2EYTB 4Y2DC 5ECJE 4ZFZB 1IAIM 1FLTX 4O5LL 3AY4A 2ZUQC 3REVB 3MJ7B 3QBTB 4GJTB 4PJDE 1CVSC 3OR7A 3Q6GH 5I15L 1AIFB 1YEDB 4KHXH 1EHLH 4XHJC 3LQAC 3PWVA 2BY0A 1PX3A 4IMLB 1X5KA 4I9WE 5I2IA 3PHOA 1KN2H 1G0YR 3AS1A 3RWIA 3DRQA 4XVUC 2AEWA 4NDMA 2WWKO 1ORQB 3RFZC 2Z8VC 1C5CH 1F5WA 5D96B 3UTTD 5LWYL 1RZGA 2X4OA 4LRNL 3NA9H 4Y4KC 4YUEH 3FN0H 4FFYL 5HGDA 1OAUL 3OR7B 4GH7B 5ESAA 2XICA 3G5ZA 4K94L 3S35X 2BXZA 3PWVB 2VDOH 2R8SL 4U6TA 3RWJA 2OK0H 1U8KA 3QIUA 4KUZL 3BP4B 3I75A 4TNWK 5ETUA 2GJ6A 1NL0L 4WWKD 1V05A 3SGEH 1YECH 5HGAA 3TVMC 3C5SB 4JKMA 5GGUA 4QGYA 4CVZB 1ZTXH 5ICZA 4KDTC 3RWIB 2MHAB 3DRQB 1DQTA 4YK4C 3TO4B 3WN5A 1K8IB 4NDMB 3F12A 4K71B 2YD1A 4YBLC 1UZ6E 5DD1L 1JZ7A 1RZGB 2X4OB 3WL9A 3T8XA 1YY9D 1WZ1L 3AROA 2JJTA 2VYRE 1KCRH 1MCSA 5F8QC 5HGDB 4C58B 1KBGL 5ESAB 5FB8A 3G5ZB 1FPTH 2W65A 2QQKL 4HIHB 1A4JB 4XCCL 1U8KB 5ETUB 3HI1A 2GJ6B 3D0LA 3C8HA 1J18A 1FRGL 2DYPB 2IJ0C 4MHHI 3KJ4B 3HMXH 3QHTC 1SEBB 3EYVB 5A3IC 1UCBH 4PGDA 3ZL4H 2PCPA 4Z7OE 5DC4B 4YLQT 2CRIA 1FFOA 5D7IB 1MRDH 3VXOA 3QXDB 4R4FL 5D2NC 4RFOL 4TOYH 1DQMH 3EDDA 2JKXA 1JTTA 3WL9B 3KJ6L 4TNVF 5GGSY 4M7LT 2IFFH 5JDJA 1BBJA 3REWA 1IGFL 1MVUA 5FB8B 3TNMB 3MR9B 3EHBC 4X7CC 3NIFF 2W0PA 1OWWA 4M5YL 3VMNA 4F8TA 3HI1B 1EDQA 3HUJF 3RNKB 3L5XL 3QG6A 3WIFA 4PGZA 4EUPH 3FO0H 4PGDB 5DVKA 3HE7C 3TT3L 2PCPB 3G6DH 2GK2A 4U1LA 4FQ1L 2V17L 4MXQC 1FFOB 2JJVA 5D7JD 3T2OA 1Y6NR 3VXOB 1DDHA 2VLKE 4NUGL 4RISL 4LHUA 1ONQA 5HDQL 2ZCKL 4JHBA 1FE8H 3O2VL 4APQA 3HB3C 2VLKD 2VITA 1AC6A 4X98B 2XFXA 4LEOA 4KVCL 1BBJB 5DZLA 1AJ7L 3ISWA 4MVBC 1MPAH 2XPGB 3D39E 4LCUA 3I3EA 3ZE1F 4YFDB 4F7PA 2GHWB 3D39D 5I1CL 5C07A 2MQ0A 2RCSL 3WIFB 5FOBB 3S3PA 2Y6SC 4IIQC 4UT7H 4U1LB 1QKZL 1NBYB 2NW3A 4Y5YC 4GKOA 1YEEH 4H0HB 3QUZA 5IEHB 1DDHB 2FJGA 2HFGH 3OPZL 4OLXH 1MFAH 1ONQB 1O7VA 3TBTA 1J12A 4PJHB 5I8KH 4APQB 1U8PB 5I8EA 3NGBB 4LEOB 1GC1H 5JUEL 4U33A 4NHCH 1W8OA 2H1PH 3DSNA 4TRPH 5CZKA 5F1NA 5D93B 1F13A 3TJHD 4XAWH 4WJ5B 3LIZH 4OLUH 4EN3B 4F7PB 1GGBL 2I5YL 1JWUB 3I6LE 3VFUB 1GOFA 4R26H 5BV7C 2VR5A 2NW3B 4QLRA 3WXVH 3QUZB 2GTZB 3I6LD 2J8HA 4WU5A 2X4SA 2IMMA 3GMMA 4L29A 3L5WB 5TJWK 1MNUL 1TVDA 5I1EL 1SYVB 3D48R 1RIHL 3GSXB 1LNUA 1PY4A 5IOPB 4JR9H 5I8EB 4I1NB 4L5FL 1JCKA 2FX7L 3TNNB 3RGVA 2ZJSL 4PLJC 2BNQE 4YDIL 3MOBH 2F8XC 3MODL 4MDJA 2I60L 1G7IA 1WC7B 3JWDH 2BNQD 5HHVL 1M1SA 5FHAH 1U3JA 4ODBD 3GMQA 4ONGH 2G2RB 3KYMA 1I3RA 1CLOL 1Z3GL 5TE6L 3ULVH 4WU5B 3KPRA 4QRUA 4Z7NE 2FZ3A 2X4SB 3GMMB 5EOCH 4P2RE 2G5BA 3MXVH 4K94C 4NZUL 2F15A 4LEXH 1LNUB 2UVEA 2FH6A 4DUVA 4XVJH 3RVTD 1T1YA 5D1XA 3MNWB 1NAML 3FQRA 4I5BA 3RGVB 1W72A 5B38G 4X9GA 3X3GL 3S88H 4MDJB 4KRNA 3MLSH 4UQ2A 3CVHL 4BQBA 1PYWA 3IDJA 2IGFH 4YHLH 1CGSH 1HE7A 1NDMA 1YEIL 4M43L 4YHMH 1FC1A 4F15B 5CJBA 1Q94A 4DK6A 5I1IH 3VFGL 3G04A 5EU6E 2YPLE 1DLHA 4HGKC 1ULVA 1YN7A 3KPRB 2FZ3B 5EU6D 5ERWB 2YPLD 2G5BB 4HPOH 4ODUA 1U36A 1NGXA 1F90H 2CIKA 5CUSH 3DX7A 3SDDD 1HH6A 4NRXA 5D1XB 4I5BB 1QBBA 5D2LE 2EYRB 4BSWA 5C0AE 5SX4I 1IEAA 1EAJA 5IB1B 1A7PL 1PYWB 5C0AD 1NDMB 3FQNA 5EA0H 1RMFH 5MERA 3OZ9L 4IRSA 4PJ8D 3HNTH 4OGAD 4WI7A 3VH8A 2BK8A 5DRXB 2AEQH 1TDQA 3RGHA 5A1AA 1HKLL 5ALBL 1B0GB 4U3XA 3ZKMD 3DX7B 5EZIL 4E41B 2IPUG 4NRXB 1OP3K 1ZSDB 1KTLB 2EEDA 4JZJB 1BBDL 4U7SA 1IGIL 4G42A 1JPSL 3FAXA 2ADFL 2NYYC 1TQBC 2F19H 4GXVL 3OGOE 4RX4A 3FQNB 1FIGH 1MCNA 1SY6A 2ORBH 4F37F 3QG7H 1KPRA 2N56A 5I16A 2EDEA 2IAMC 3E6FB 2JELH 5AAMA 1HK6A 4UB0L 4XI5D 1ZS8A 3VH8B 3EYQC 1I1FA 4S1QL 3P9MA 4M1DL 5GZNC 2BHUA 1RUML 2CKBA 3GI9L 3QCTL 3V7AG 3TESA 4OZIB 2QQNH 3MLUL 1WF5A 3QIWA 4KK8D 1IGJA 5EU5A 1MELA 2EDRA 4RGNE 35C8L 1GZPB 3PP3H 3MLRL 2FX8L 2J8OA 4U0RC 4Y16C 1BVKA 4M6OL 1A6WH 3TWCH 5I71C 2V5RA 4RGND 1I7RA 4OZGA 3VDCA 4OZHE 3VD3A 5D72H 2DQGL 4ZPVA 4NN6C 2Q86B 4G9DA 5I16B 1Z5LA 3GB7A 4EDWL 2HRPL 3VGAB 4J4PC 1YUHA 2H32H 1ZS8B 4V1DA 1HSAA 4K9EC 1T80A 5CEYB 5JTWA 4LDOB 5H2BB 5FYJL 3LN4A 1CXKA 1VDGA 3PUCA 1QA9A 2AGJH 1U3HD 5KAQG 4Q9QL 3AM8C 1KLUA 1NBVL 4LOUD 2MNUA 3QIWB 1IGJB 1RUQH 3SGDH 4XPTL 5EU5B 2Z8WC 4Z0XA 3ZLQC 5IMKA 1AD0A 2D0FA 4G9FA 1I7RB 3RIFK 1NCDH 1FVCA 1SBSL 4PREA 2AKRA 1DBMH 1NMAH 2X70A 4ZPVB 1XF4B 4OCSL 4G9DB 4Z95H 4ODHL 3GB7B 1YUHB 1HSAB 5GGTA 2X1OA 1FVDB 2BSTB 3W11D 2YD9A 1I9RL 4W68A 4CAGA 1A9EA 5C09A 1I9IH 1KLUB 3ET9F 4NQSB 3AXLB 4Z0XB 1FAKT 1QBAA 1IC1A 4YGAB 5T5FL 1AD0B 4JG1L 5LCVH 5IMKB 1F3RB 1S3KL 3FHQA 5EZJA 1B4RA 5JW3L 4LCWB 2KKQA 2AKRB 1T4KB 4PB0H 1U2HA 2X70B 3QUML 2R56L 3OR6B 2NX5E 4NWTH 4AT6A 1QFWL 5HI3D 2XWJA 2X09A 3OAUH 3MCKA 2NX5D 1EHAA 5HDBF 1NCWL 4M7KH 1G0XA 3TO2A 2R23A 4ZNEE 4WI5A 2XACC 4WO4A 3NZHL 1CZ8L 3NCYP 4P99A 3WFCL 3VE0A 4I2XE 4M3KB 1RURH 4N0YL 4OCXH 2AJSL 2AQ2A 2ERJB 2YZ8A 3AAZB 4KKLD 2QSVA 4P2QA 5CZXD 5IW3A 5BS0A 1PG7X 1JNJA 3V4UL 3B9KD 1ODAA 4QRSA 5E6IA 1ACZA 3H9YA 3TO2B 2VISB 1VPOH 5H94A 4LBEA 4WCYL 4NFBA 1OM3H 2Z9TA 4FXLA 1LEKA 1BJ8A 3V2AR 5CGTA 4JM4H 4YHNA 3V6FB 3VE0B 1TTGA 2XOTA 4X6DA 2GSGB 1EH9A 3QDGE 4LRIA 4P2YA 4Z78B 1OAQH 2JJSA 2NLJA 5DD3H 4NQCA 4NJ9H 3Q6GL 4PJCE 4KHXL 1EHLL 4XNXH 4JFYA 3QDGD 3V6OE 2FO4A 3HRPA 5E6IB 1BF8A 4U6XB 4OLVH 1RIUH 5L6YH 4ENED 4EOWH 3G6AA 4LLAA 3S37X 2NY2C 1CDIA 4NCDA 2WNGA 4OQTL 4CVWA 1VHPA 1LEKB 3RTQA 1IAIL 1F58H 1F02I 4LHQB 2X4NA 1C5CL 1VCAA 1A2YB 5KVMC 3K74B 3UX9B 2J8UA 4N0FB 3KR3H 3B5TA 4GRLD 4YUEL 5IR1B 3FN0L 4GKSB 1WWWX 1E0OB 2Z8RA 5C0JA 2UYLB 4JFYB 4JDVB 2CDGB 1QSEE 4CW1A 5AD0A 2OK0L 3MRPA 4XPGH 4HMCA 2J2ZA 5AG8A 1FNLA 4C56B 2A0LD 1J0HA 1QSED 2HMIC 1YECL 1BFOB 3G6AB 3QDJB 1AQDB 5EG6C 5DJYA 3BMVA 2ITDB 1V7ML 3ARBA 1YMME 5I0ZA 1UKSA 5EOQL 1PLGH 1RZ8A 1IFHH 1FCCA 4Y1AE 4F3FA 4DUWA 4XPFH 1YMMD 1FCGA 3CFCH 3LCYA 4KI5C 3L3JB 3BP5A 1KCRL 4KDWA 5DD0H 4ZOCA 3DI2B 5I76A 3HHRB 1AR1C 1U8NB 5I75B 1D9KA 4XWOD 4EIGB 1FPTL 5SX5H 1E4XH 2HT4C 1FVEB 3UMTA 3ZDYE 3HMXL 1K4DA 1UCBL 5EIIB 1ZLUK 5IQ7H 4X8JA 4KHTH 5GGSA 4PJ5A 5I73B 1VFMA 4TOYL 4F33A 1DQML 4F3FB 3O3AA 4I18C 5D71H 5CD3A 3SPVB 2FRGP 2HRLA 3BP5B 2IFFL 5IUSA 5CJXC 5I76B 4OTXH 1GYAA 2WAHA 1D9KB 5DTFA 1QEWA 3T0EC 4JFEE 3NOIA 5IGXH 2XZCH 2R1WA 3VFTB 1RZ7H 3G5VA 4JFED 4RGOL 3LSOA 1K4DB 4OCWH 3FO0L 3GKWH 4JM2C 2R9HC 3MLXH 5GGSB 5DQJA 3P73A 4RRPA 1JZ4A 3G08A 4YO0B 5E8EA 4EI5D 1FE8L 2VLRE 3SDAA 4CUCA 3O3AB 3NBNA 1YEHH 3FB7B 4P4RA 4G6AD 2VLRD 4KROB 3T2PA 1R5IB 1QEWB 3O4LD 2OR8A 1XGPA 1TTUA 3FCTA 3T04D 3MRLA 4P48A 1JHKH 1KJMA 2VDPL 2FSEA 3G5VB 3QCVL 3QXVA 4XCEA 5F21B 4U1IA 3SKJH 4UT7L 4GRWB 1C5DA 4G43B 4YFEA 3C87A 4ELMA 1YEEL 1MFAL 1UA6L 1DN2A 2WLYA 3UBXA 5I8KL 3G08B 5E8EB 5DMGC 3SDAB 3TA3B 4R3SA 1KXQE 4PJDA 4P4RB 5CP3A 4KK6C 1GC1L 4K3EH 4TPRH 5DYOA 1GOGA 2PXYC 5J1SC 4ZAKB 5I0DA 1SHMA 3GSWA 2H1PL 1GZQB 2OXHA 3RVWC 3VXUB 1ZEAL 4AIZA 4L8SC 2CUMA 4XAWL 3MRLB 3LIZL 4OLUL 3T3ME 2FSEB 3MFGB 4XCEB 3FRUA 1F4WL 1S78D 2EYSB 1Q0XH 1L4IA 4ELMB 3WXVL 5EUKA 5DJXB 2AV7A 3UBXB 4QEGA 2A9MH 1ES0A 2JTDA 4JPIA 1RU9H 4YPGA 4EI6B 1NAKH 5GS2D 2ZSWA 4JR9L 5IIEB 4RMWA 3MLWH 3VFWA 1I3VA 5JIKA 4WWKA 4B41A 4AENA 3GSWB 2NXYB 3BPNB 1G0DA 3EO0B 5H37G 4YHYB 3PQYB 4POZD 3JWDL 4J1UA 5KVEH 1H3UA 5FHAL 3UTTB 4LCYA 3VFPA 3VXRE 3A0OA 3G6JF 2XYCA 3ULVL 1N26A 1NKOA 3VXRD 1ZV5A 5EOCL 3MXVL 5F89A 4JPIB 3UROR 1ZT7A 4LLDA 5IBUB 1RHHB 4WWKB 3IJSA 5C0BE 1UB6A 2P24A 3GSOB 3S88L 1OT2A 1NLBH 3MLSL 3LKQA 5C0BD 1CFQA 1RZFH 4UV4H 5T1LD 2IGFL 1JZ6A 2JK5B 4J1UB 4OB5H 1N6QH 4YHLL 1CGSL 4ZYKA 4LVNC 4YHML 3OL2A 3X3FL 3VFPB 3WUWA 2AQ3A 4X7DC 3GHEH 1UKQA 3CGTA 1WBYB 4HPOL 3MLVH 5F89B 2C3VA 3BGAA 1F90L 3UPAA 3MV7E 1DCLA 4UOW0 1EO8H 1EO5A 4FXKB 1YZZA 4QXWA 3IJSB 1UB6B 3MV7D 1A0QH 1UWGH 2X4RB 1EGJL 3MLZH 3LKQB 4PRDA 4P23C 3QA3A 5D7JA 1ND0B 3RWDA 4GW1B 4OV5B 4N5EC 5ADPH 4NBXB 2LAGB 5CD5D 4OD2A 3BE1L 4R7NA 3LV3A 1G1YA 1RMFL 4L8DA 1K85A 4MJIB 4FN0A 2FECL 4U1JB 2VLKA 5JIIA 4Z9KB 1CDCA 2Q1EA 2GFBA 3HNTL 4NQUA 5CBAA 4LHJB 2IALA 1MFEH 2C3VB 2Q6WA 4AYFA 4RMRA 5C6WH 5HBBA 4LSTH 4IRZH 3FN3A 4DJMA 3R8QA 4EQ2A 1MAJA 2ADGA 2DLEA 2ZUTA 5FYJE 1JZ5A 3M8OH 3QA3B 5D7JB 3RWDB 2F19L 1JIBA 5FYJD 1FIGL 2R0KH 4OD2B 1AGFB 3LV3B 4R7NB 3BQUA 2ORBL 4KKBD 3QG7L 4XCFH 2NY6D 4JFPA 4PUBH 3P77B 4XC1L 5AYUL 1F3JA 1DQQA 2UZXB 5CBAB 4X5WA 2CK0H 4Z6AT 4K8RH 3IDIA 2FJHA 2EDYA 5FO7A 1GSMA 3MRHA 2QQNL 4OZGF 3GZKA 4HJGA 1OPGH 3D39B 1JV5A 4B50A 4H20H 3WD5H 2ADGB 2J5LC 5KN5A 4WI3A 4J23A 5IMOA 3LH2H 5CINL 1A6WL 4PY8J 3TLRA 3B9AA 5EOTA 5JLZA 4NN7C 2VLJE 5HGBA 3VXMA 2MQ3A 3IDYC 5D72L 3MUY1 3QI9D 4JFPB 1VA9A 3WFZA 1E6OL 4GBXC 2OL3A 1UXSA 2D4FA 1F3JB 2E7HA 2A77H 2BSRB 5DVOA 1DQQB 1HN1A 3O45A 2C3XA 1FH5H 2B1AL 5IROA 5C7XH 4RDQF 3WS6C 2LU4A 4WW2B 4OKVA 2YK1L 2AGJL 3MV11 3BESR 1NGWA 3MRHB 4HJGB 2XTJC 3U7WL 2K7PA 2P44B 4AY0A 1RUQL 3AB0C 2BNQA 4XNMA 1ZLWH 8FABA 4UQ3A 4TSBH 1G6RH 5SWQA 5KN5B 4TTDC 1ZAGA 3S6CA 5JLZB 1U8HA 2EO9A 2G75A 4X7EC 1XCQB 2QJDA 2RIKA 1DBML 4N9GA 2Q3ZA 4Z95L 4FQXC 3O8XD 3BZ4A 3UDWA 1ZWIB 2XWBA 2AXFA 2ICWA 3MUJA 1R5VB 4HQQL 4P2RA 3D3VE 3FQXA 3VDBA 1LO4H 3C5JB 2YN5A 3L6FA 1IEBB 4XBEH 2DDQH 4F57H 1E6JL 3D3VD 2EZ0D 5D8JH 1DANT 1I9IL 4NKDA 3E2HB 4F9LA 2BNQB 3BPCB 3KG5A 1NMCB 3IXTA 3JWDC 3U46A 2OM5A 2Q76B 3MV9E 4MNHB 5LCVL 4BYHA 3NFPB 1U8HB 1JGDB 2UY7A 2G75B 4OUOA 5C0CB 3DUSA 4JO1H 3MV9D 4QO1A 2YD5A 4MMXC 3O6FD 2YPLA 4PB0L 4WFEE 5T5NF 1BD2E 3BP7A 5JW5A 4JGJA 3BZ4B 4M9PA 3I2CL 4NWTL 3RKDD 2AXFB 3FQXB 4PV9A 1NEZA 1BD2D 4U2ZA 3OAUL 4BQ6A 2ZUYA 1MHCA 4WENB 5GQBA 5GS1B 4ALAL 4YR6B 4ODWA 5D2LA 1YN6A 3B3IA 5C0AA 1GHFL 1RUKH 4LLQA 3IXTB 5J1AA 5DUPH 5JORB 4JFQA 5KBNC 3P2TA 2Z31D 4XXCA 1BM3L 1B90A 3QRGH 4JFOA 4PJ8A 1SEQH 5DVNA 3WLWC 5EU6B 1RURL 9CGTA 4OCXL 5E8PA 3BP7B 5JW5B 3LKSA 1IGMH 3UEZA 2J4WH 3SDDB 1RSFA 5KG9A 2IPUK 3U9PL 1A3RL 1CLYL 1MHCB 4M6NH 2A73A 2KQNA 5CZVH 1UXWB 3S98A 2N7BA 4K23H 4X6DF 1OQXA 1VPOL 2VJXA 3B3IB 5DQDL 5C0AB 3V79C 1OM3L 5J1AB 4NWUH 4LSQL 4JN1H 2R4SL 4JM4L 3CMGA 4JEGB 4PJ8B 4JFOB 4LDLB 3ARUA 3M1BA 3AS3A 3DRTA 5D1ZD 5MEPA 3DROB 3RPIA 3IFPA 4XNXL 5DFTA 5KG9B 3ULUC 3HE6D 4FTVB 4YBLB 2VXSH 2A73B 2NTFA 1Y0LB 3WFDH 3BPLB 3RIAK 1MJ7H 4OLVL 2VABA 4XXDA 3W39B 5L6YL 4HIEA 4HWEH 2OZ4A 1IE5A 3BP6A 4N0CD 2DJUA 1T22A 2R1XB 4A6YH 5FDWA 1INQB 1FDLH 1F58L 4GS7C 3HTLX 3LPGA 4OZHA 3H9SB 5L8LB 2WBKA 3CFJA 3M1BB 4FNLH 3KR3L 4NT6A 4I0PC 4FZ8H 2YBRB 5T3XL 5FM8A 5ICYB 1U3HA 1TJIH 4MX7B 3FZUC 4JPWH 1MAMH 2HJKA 4XPGL 3HNSH 2NTFB 4YZFF 2X42A 3SGKA 1WFTA 4H8WH 4RGMB 1DN0A 4HIEB 3CXDH 4NKQB 5FF6B 3T0DA 3HAEG 3BP6B 4HLZH 5FDWB 1T22B 1TLKA 4MA7H 2MPAH 4LLWA 4HWBH 4GFTB 2XWTA 4FG6C 4P5TC 4XPFL 1DBKH 3JWNC 3K0WA 3HE7B 4H1LA 5HVHC 4IRJC 4HGMA 2HJKB 1WFUA 4LKXB 4ZQKA 3LN5A 1E4XL 1NCNA 5GRUH 2E6JA 1PDKA 3VRLE 4KTEH 3SO3C 4L1DA 2ZUVA 1WLHA 3A6BH 3BW9B 4IOFC 1LD9A 1E4KA 3RI5K 5IQ7L 4KHTL 3X11A 1ITCA 3RDTC 5AZ2H 2OR7A 4NQXA 4XCYB 1I3GH 4YDLC 1QFPA 1CD0A 3W81A 2A6JB 4UDTA 5D71L 5DK2B 2NX5A 1F6AA 2W1NA 2K1MA 4Y5YB 3OKKB 3V52H 3F7PC 2FATH 3FQUA 3QDHA 2AJ3A 2UWEF 4LDEB 3ECBA 1EZVX 5IGXL 2XZCL 4JO3H 5CJQH 4XWGH 3OJ2C 3KLHD 4ZNEA 5JO5B 4OCWL 1EMTL 3GKWL 5DGRA 3SDXA 3MLXL 5HD8C 4PD4J 2W0LA 5AAWA 4JJ5B 1T21A 2NY3D 4D0DA 4UDTB 5HYJA 4TNWF 2NX5B 3B5HA 4WI9A 1H8SA 1U6AL 3B9KA 1ZLSL 1Z2KA 1LEGA 1FN4A 3O0RH 3ZKNC 2AJ3B 1OP5H 5A2FA 4MAUH 1Z9SA 1JHKL 4KK9C 3HRZA 1BIHA 5E6YA 1J05A 2GK0A 3BZFB 1JYVA 4Y4HD 4YPJA 4KXZH 1N7MH 4JVUA 3R06A 4NQVA 5MEOB 4M6AA 5CLWA 1T21B 2IQ9H 5B39A 4I2XB 1CDHA 3LKPB 4HWNA 4J2XA 3MV01 3BX7C 1A7NH 3AREA 1MHEA 2W59A 4PJCA 3KXFB 4TPRL 3B9KB 2PYEE 1LEGB 1N5AA 2YD6A 2XY2A 4ZUWB 4NZRH 3WJJA 4L4VE 3ULVD 2PYED 3DVIA 1KJ2A 5IHUH 1NCUA 2Z35B 3IFOA 1PBYA 2QQQA 3BT2H 4ZSOE 4CN1A 2HFEA 1Q0XL 1VFBA 3ARQA 2LU3A 3OB0H 4DW2H 4GRLA 4GUPB 2VZSA 3MJ8B 1IGCH 4HV8A 4NQTA 3F65A 4W4OC 2YSSB 3QDGB 4XPHH 1V7NH 2VZ1A 1RU9L 4HJ0C 1MHEB 3KHQA 1NAKL 3I3BA 1JGLH 2W9DH 1JPFB 4CJ1A 1QSEA 3S36H 5CEXB 5DK0B 5IFAH 1LILA 3V5DA 1KJ2B 3RZCD 3WJLA 3IFOB 2VE6A 3BAEL 1FFPA 3TCLB 2HT2C 4P5MA 5F7YC 2HFEB 3IDXH 4YGVB 1VFBB 1YMMA 3BPOC 4P9HL 3PE9A 4IBLT 4HV8B 4M8QA 4Y1AA 2CO6B 2VRAA 3TH4T 5T1DH 4HX1B 1D6VH 5FO9B 4QNPE 4Z7OF 1A7OH 3IAQA 4WI2A 5I6XB 1B0WA 1QSEB 3ARZA 3VWJD 3VFOB 2BRRL 3K4DA 4PGBB 1NLBL 1BZ9A 1V3LA 4UNUA 4BQ8A 5HI4C 5L8KB 2DKUA 1B4JL 4JFHE 4KJWC 3BOVA 3JWOH 4UV4L 4HS8L 2BJML 3UJJL 2VE6B 4OB5L 2JJWA 32C2B 1HIMH 1N3NA 1FFPB 4JHAH 3TF7C 4P5MB 5EUOB 2CO7B 4JFHD 4I4WA 4NPYA 4X9IA 5E5UB 1YMMB 4OGZA 4M8QB 4LP5A 2BCKB 3GHEL 3UZVB 1HILB 3MLVL 3GKZA 5CGYD 2OTWA 1KJ3H 1EO8L 5DDHA 4LSUH 3OXRB 5BQ7B 1I7UA 1KJVA 1A0QL 2IAMB 4YIQA 3SCMC 4QXTA 1ZMYA 1BZ9B 2VL5A 3MLZL 4PD4K 5IB2A 2AEIT 4HXAH 1PX4A 5ADPL 4MD0B 3RL1A 1CGXA 2B0SH 5LGKA 4NPYB 4OCYH 2ATKB 2E9JA 4EI5A 3QNZA 2Y1VA 5DD5H 1PG7W 3C2AH 4FMKA 4G8IA 2O5XL 5C1MB 4ZTPL 4GLRH 1ZHBB 2BVOB 1MFEL 2CLVA 3IRZA 4WGWB 5DDHB 1NKRA 2OQJA 3HAEB 4LSTL 4IRZL 1G6VK 1I7UB 4PJFF 1I7TA 1KJVB 4PTTB 4JFEB 4YIQB 1P84K 4QXTB 3U4AA 5ALCH 2YN3A 2GT9A 4NJAH 1N59A 5A16A 4JFXA 2GUOA 2R0KL 2CLZB 2F53E 4XCFL 3OGCA 4EI5B 1KB5H 1HXYB 3VFVA 5HYSG 1TZHA 4DEPB 2MSPA 4G8IB 2F53D 3SKOB 3CFIC 2VLRB 2JJUA 2BVPA 2HLFC 2E8YA 2CK0L 4Z5RA 2DQEH 3O4LB 4K8RL 3GNMH 2CLVB 1QSFE 4F9PA 3ZTJH 2OQJB 4HT1H 1SJHB 5K9KA 1D5BA 3B8SA 3MRBA 1OPGL 2ZSVB 3DV4A 1P4BH 4OF8A 3WE6A 4UT6H 2JB6A 4H88H 4FQJH 6FABH 1YNKL 3HLAA 2B39A 2GT9B 3QDMA 5JXAH 5FM4A 1N59B 2ZOLA 3KWWA 3MRGB 3S5LG 1ZVHA 2R39A 4D0BA 3DV6A 3QAZC 5FKPA 3TZVD 1YYML 3WUZA 3GMNB 5BVJA 5C9JA 2BNRE 3CVHA 2B1HH 3N1QC 3VFVB 4YXHH 2IF7A 5ITBL 2A77L 2BVPB 4WHYH 2CDEA 5E08H 5C7XL 3H3KA 5E5MB 4I48A 4DVBA 2DBLH 1H8OA 1D5BB 3WO4C 2P5WE 3MRBB 4BFIA 3DV4B 5EU4B 4AMKH 2FNBA 5FGBC 4TSBL 2CKBH 2P5WD 1G6RL 3CAFA 5D70H 5D2NE 2ZOLB 2CR6A 2GIYA 1MJ8L 1NAMB 4Y89A 3NA4A 5J6GA 5BVJB 3VXRA 3MCLH 5C9JB 3PL6C 1T83A 3CVHB 4WDIB 2WWMC 5DRWA 4K3GA 4Y19A 3UPRA 3TYGH 1LO4L 5GS3A 1U95B 3UBXI 1LK3L 2A83B 4XBEL 4DZ8B 5KS9B 2DDQL 4I48B 2C1PA 1MHPH 2ZKHL 4V2CB 5D8JL 5C0BA 3DVGA 5EBLB 4EVNB 2VXQL 3GBNL 3DJ9A 5E1AB 1T66D 1FZJA 2H2SD 4TULH 1CDJA 4UINH 1L7IH 3RX7A 1SJEA 4CN4A 3DX8A 3CC5A 3THML 4JO1L 2JB5H 1WBXA 1QD0A 4P9HC 2VXUL 5D1QD 3VXRB 5J6GB 5TDPA 1JPST 1PD6A 3VWKC 1DE4B 1RZJH 3QUKA 4ZUUA 4M00A 3MUHL 4KKAC 1N4XH 5TF1H 3HKFA 3CCHA 3MV7A 5C8JA 3NCJL 4NQEE 1RI8A 3HR5A 4PG9A 1ZHNA 5C0BB 4BELD 5T1LB 3OWEA 5GGTH 1RUKL 4JFDE 4NQED 3QZWG 4POYA 5EO1A 3BIAX 5DUPL 1BQSA 4O51A 3PWLA 4JFDD 3DX8B 3PWJA 3PABA 1Q0YH 3CC5B 2EC9U 3H7BB 1WBXB 4PJXA 1SEQL 1AP2A 1MRCH 5E56A 3QQ9D 1IGML 3EDJA 1DVFC 2NY2B 2J4WL 2X41A 1VEOA 1QR1A 1E28A 3TYFA 1IGTA 3CFBA 4U05A 3HR6A 1G7JA 2QSQA 4JFZH 4M6NL 5ACLA 3VD9A 3PWNA 4M7JL 3N50A 1FZOA 5CZVL 2Q7YA 1LO0H 3HR5B 3QIBC 1MVFA 2FJFA 3RIFF 4K23L 4QWWC 3EYFA 3QH3B 1KC5H 1MFCL 5MENE 5EO1B 3BEWB 3CUPA 4JN1L 3C5ZD 3IDNA 4O51B 5F7UA 5JPMB 4WV1A 4LAQH 3GBMH 5MEND 3PWJB 1L7TH 3PABB 1AP2B 2CLRA 4S1DD 1K2DA 5ID1A 4NKIH 4OLWH 5FHBH 3L9RA 3I50L 4FQQA 1RZIA 1I85A 1IGTB 1BX2A 3OMZA 3EBAA 1JI2A 1G7JB 4JZNA 3UAJC 2EKSA 1OAZH 3OKMB 4JN2A 1KTRL 2ZUWA 3WFDL 1MJ7L 2ZG2A 5T1KA 4MA1B 4HWEL 3PF2A 3QI9A 2VLJA 1FDLL 5L2KE 3EYOA 1MI5B 4TUKH 5DRZA 4N1HB 1MCHA 4F7TB 5HHME 1FG2A 2B2XH 4FNLL 5D7SH 5ID1B 4FZ8L 2V7HB 3L9RB 5HHMD 1TJIL 2HYMA 5DJDA 5T33H 3MJ9H 3MBEC 3MLTA 4JPWL 1MAML 1BX2B 4JN2B 4CVXB 4LKCB 3MRJB 4NZTH 3F7VA 1OW0C 1S7SA 5CMAB 4H8WL 1TJHH 2WW8A 2FIKB 1CGTA 2IH1B 4UIMA 4Z7QF 1T7YA 3BH9B 4DOHE 3T0EB 3QI9B 4MA7L 1WWBX 4XP6H 3O8XA 2MPAL 3HC3H 4HWBL 1MLBA 4L9LC 4OZFA 2CRZA 1LO5B 3H7LA 4OD1H 3NAAH 3JXAA 2FX9H 3L3KA 3D3VA 4JGUA 1FL6A 1FGNH 5F88B 1UACL 2X7LB 4ODVH 5TQ0H 1JJUA 3MLTB 5I1LB 4DTGH 3QUMB 3QUYC 2YPVL 3NCFB 5GRUL 5F1SA 1GOHA 2JF1A 4KC3B 4YWGL 5JQHC 3A6BL 2F54E 5B4MD 4ZTOH 1J8KA 1MJUH 5HHOA 3MV9A 3MXWL 5LAXA 3NCMA 5D7IF 2QADD 4OF0A 2F54D 2I9TA 5AZ2L 3O8XB 5F93C 4BZ1H 2EDOA 1I3GL 1BQUA 1JZ8A 1MLBB 1QSZA 1BD2A 4OZFB 4QXUH 3OHXB 3I02B 5I18H 3L3KB 1FL6B 2DIAA 3V52L 3SDXF 4KK5D 4NKOB 4GG8A 4S0SD 3BUYB 4KFZC 4JO3L 5CJQL 4XWGL 4QY8A 3NIFE 1CI5A 4D94A 3ARSA 2Z31A 4Y5XC 3PNWA 1WIPA 1CFNB 4IMKC 3I9GH 3MV9B 3HUJE 2PXYB 3O6FB 2W38A 2YD3A 1P2CA 4NN5C 1S7VB 2M1KA 3QSKB 1J8HB 2B20A 1L9NA 1MFNA 2P7TA 1BD2B 1EEYA 2NXZC 3QJFB 2HTLC 2Y9RT 1TZIB 7FABH 2DM2A 4GG8B 3HI5H 4R2GD 5JMOC 1EVUA 3UYRL 3DIFB 3MOQA 1FSKC 1Y18A 4M7LL 1V5JA 4X6EB 5E7BA 3EOYG 3ZE1E 1MHHB 3UZQA 1NC4A 3JV0A 1NPUA 5ITFA 3IAPA 4PJCF 2I07A 1N7ML 4E42A 3BFOA 1QPXA 4RAHA 1P2CB 4OIAA 5J11C 3MNZB 4J6RH 3UJTH 2IQ9L 4Z8FH 4PJHF 1PQZA 2D7QA 4U1HB 2YEZB 4WI8A 1C1EH 1A7NL 1KCSH 2P7TB 2PTTA 3WIIL 3HE6A 1HOCA 1AXSB 1M05B 4UBDC 4MA3B 2A6IA 5GGRY 4L8BA 2HWZH 2PN5A 3U9UA 4NZRL 4XMLH 5ADOH 1R3LB 3TBYA 5F6IC 3IFNL 3WFHA 5IHUL 2WUBH 1MCQA 4C83B 2OJZH 3BT2L 3GSVB 1AHWA 2J88H 2X4PB 4O4YH 3EFFA 5D1ZB 1IGCL 1F6LL 4XMKH 3HMXA 5E5RB 1XGQA 3U48A 4OCNC 4YHOH 3EGSA 3IRPX 4XPHL 2PTTB 1V7NL 4ZMAT 3HE6B 2WINB 4PGJA 3U36B 1CTNA 4HH8A 1JGLL 2W9DL 4PY7B 5AZEL 2A6IB 4L8BB 3S96A 3S36L 4JG0H 3U9UB 1F2QA 2ZG3A 3ZTNH 5IFAL 3B43A 4X4XA 3OKEB 4JRXB 5CP3H 3TBYB 3WFHB 3EZJB 3VA6A 5D6DA 1AHWB 3PWUA 3FHAA 2NZIA 1D5XB 2F8VA 5IV2A 5TDOB 3P0YH 3EFFB 2RBLA 3HS0A 2DQHL 1MSPA 1AKJD 3EGSB 3O9WD 4P23B 5EC1A 4JZOA 2R1YA 2ZZUT 3GJEB 5T1DL 4NBYB 4TQEL 1LE9B 2W9EL 4IS6B 5D96C 1F4HA 5IBLC 3S96B 1A7OL 1S8DB 1G9NL 3FT2A 4NUJA 5EZOH 1R3HA 3P4OB 2LAAA 5FFLA 3O3BB 4D9QD 3VU2A 4XMPH 1WCBA 1A6TB 3I6GA 3JWOL 3MRCB 2ATPA 4D0CB 1UG9A 3MQIA 4KVNH 1INEH 4YX2H 5JR1H 2VZVA 1U92B 1BZ7A 4EUPB 3O6KH 4P2OA 4XNZC 3TO4C 3RBSA 2R1YB 4K71C 5HPMA 1BECA 4Q58C 1H8NA 1KJ3L 4BJLA 4LSUL 1RUPH 2K7QA 3U4BL 2XKUA 1T89A 4HHAA 4D3CH 3FT2B 4NUJB 4EKXA 3V4PH 3NCEB 1FYTE 1R3HB 4WEBH 5J3HC 3R8BB 4MHHG 3L3DA 4Z77B 1D5ZA 4IM8A 1HQ4A 5EDXA 1E4WH 3K2UH 1IZKA 3QIUC 1CDYA 4K8RD 3GK8L 1W72L 2P43B 4OCYL 3KJ4C 1IT9H 1QACA 3LEYH 5DD5L 1VACB 43CAA 3GSQB 3P9WB 4CJ0A 5FUZH 3VI3E 4WIQA 1QQDB 3FQTB 3WN5C 1BWMA 3KPOA 5DJ8A 1EEQA 2NY5L 4HHAB 4OF6A 1T03L 1D5ZB 4Y4HA 1NGZA 5ALCL 1N2RA 4NJAL 1M6OB 5IK3A 5KJRH 5EN2A 3BVNA 5IJKC 1AXTH 2M2DA 4BKLB 2C3WA 2NY3B 2COQA 2XTJB 4I3SH 4X6CF 2AAVA 3QEQE 5ELIA 2C4FT 5DHVA 1U91B 1PEZA 5IESH 3MRRB 3PHQA 4ONFH 3QEQD 4NRZA 3GNML 3DUUB 3VI4E 1L0QA 2PYEA 3F7YA 1MFBH 4HT1L 4BH8B 5ILTH 4EDXA 4M61A 1P4BL 1CE6A 4UT6L 4L4VA 5GRVL 4H88L 4Y4HB 2WBWB 1JTOA 1TZGH 3N1PC 1S7QA 1N2RB 1VFUA 2H3NA 4OLZH 5JXAL 3U0WL 3ZT6A 3WNKA 1SYSA 1FAIH 4JQIL 4ZSOA 5EN2B 5TDNB 4LLUB 1R3IH 1PZ5A 3QWRD 1S7RA 3DETD 4MSWA 2EIBA 5IVXA 5CEZH 2B1HL 1NH6A 4AK1A 3STZA 5ISZE 3PHQB 2ED9A 5E08L 4NRZB 1SY6L 4L3EE 4JQXA 2VERN 2VIRA 1CK0H 4OI8A 4Y4FD 5DC9B 2PYEB 3F7YB 4APQC 4L3ED 4EDXB 4KZDH 3NGBC 4AMKL 3W82A 2NY7H 2VOTA 4P46D 1ADQA 2CKBL 5IEKB 3D69B 1YNTB 5D70L 4ELKB 4G6FD 4TVPH 5D93C 3HC4H 4ZSOB 1ZLWK 3VD5A 2EDLA 4G3YH 3GJFK 1FZKA 4YDJB 2E7LC 4HS6A 3ZMRA 2QR0B 1W0VA 4MSWB 3SDCD 3UTQA 4MQXD 1FZMA 5IFHL 1Z9LA 3QUZC 4LMQE 3STZB 5JOFA 3TYGL 2VIRB 3VWJA 4MNGE 4XH2B 5IG7B 1CL7L 4L3CA 2YC1A 1U93A 1MHPL 3MREB 1XZ0A 3GEWB 1SVZA 5JNYB 1ZHKB 3RZCB 2EDFA 1HI6A 3O2WH 5D7LA 1IQWL 3T65A 1M71A 4TULL 4UINL 5ICXA 1L7IL 5FECA 4OFYA 1P1ZB 1AC0A 1QP1A 2JB5L 1FZKB 1HYSD 3P9LA 4HS6B 2E7CA 1FZMB 5E6ZA 3W9DA 2XV6B 4OD3L 1N4XL 5TF1L 2NZ9D 5JOFB 3VXPA 3BKMH 3PP4H 1DBBH 2XKSA 3VWJB 1G9NC 1CDUA 1I8IA 3FT3A 4GT7A 2YC1B 1U93B 4LFHG 3GMPA 4PJXF 4PP1C 5HDBE 1HI6B 1I75A 5GGTL 4EXPX 1HCVA 4JO4L 1HHHA 3T65B 4R0LA 3S8WA 5ICXB 2DIBA 1J0JA 2X2YA 2AEPH 4F7MA 3RGVC 4HFWA 5FECB 1W0WA 3S4SG 4Q0XL 1Q0YL 2R69H 1EEUA 3OG6B 4XX1G 3BISA 1MRCL 1A1NA 1RK1B 5JOPE 4F15C 3W9DB 4AEFA 4WTZA 3QFJB 4PJIB 4U6YB 3VXPB 5JOPD 1PG7H 1ZVYA 3KYAA 2KL6A 4Y7MA 2H32A 3B9DA 4U31A 3GSUB 1KC5L 5TPWH 3E8UH 3SBWC 5BRZE 2B4CH 2WIMA 2BX5A 1RZKC 2H8PB 4Q2ZA 3DVNA 4MCZB 5D1XC 5ID0B 2YA0A 4LAQL 4YDVB 3GBML 2DQUH 1F8TH 1L7TL 1XF5A 4Y4KA 2F53A 1AR2A 1IAKA 3U7AA 2XQYG 2PO6D 4NIKB 3TGXA 4WHDA 4NKIL 2V5YA 3GSRA 1H3TA 4OLWL 3SKMB 4RBPK 4J8RB 4CRPA 2NY5C 1QSFA 3PXHA 1OAZL 1MEXH 5EB9A 2H32B 1HXMA 1IM3A 4KDTA 2APVA 3L5IA 3S37H 4Z7UF 2HLAA 4B7IA 2P45B 5FDYA 1B6UA 4LPTA 3TZVA 1MCWW 3DVNB 2NY1D 4IRJB 5FO8A 3L3IA 1XGRB 3TM6A 1YEFH 2F53B 1XF2A 1OTUC 4GKZA 2B2XL 2BNRA 5GXBB 5D7SL 1FNGB 4R4ND 3QPQC 3S35L 1LK2A 4YAQA 5T33L 2OR9H 4IRSC 2RGSA 3RDTB 2BC4B 3BD5A 1OTTC 4N8VA 2A6DA 2P5WA 4NZTL 4P57B 3EDKA 4KTDH 5EO0A 2DTML 4KQ4H 1TJHL 2BY3A 4NNXA 2HLAB 1DP0A 2DD8H 1IKFH 3TZVB 4WNQA 5D2NA 2HT3C 3BUTA 2YA2A 4XP6L 1AFVH 1O0VA 4HWZA 1T2QH 2UY6A 3HC3L 2ZPKH 1UYWH 2BVUA 1CD8A 4OD1L 2OZ4H 4G80B 3VRIB 5IMMA 4UOJA 2FX9L 2H6PA 4M1CD 5CAYB 3SE4C 4ODVL 3GSNH 5I74C 5TQ0L 1WQVT 1JBJA 4I3RH 5IKCB 3VGAC 4DTGL 3BDBA 1B9ZA 1ZXQA 2FR4A 1KCUH 4N8VB 2A6DB 4LASH 3MYZA 5DHXB 3HCVA 3UTOA 1AI1H 1KV3A 2CXKA 4H26A 4EQ3A 2XN9E 4ZTOL 1A6PA 1LP9F 3L7FA 1NGYA 3QIWC 5CP7A 5AEAA 1MQKH 4BZYA 2XN9D 4LSPH 1NDGB 1FNHA 2D31A 3FKUS 1G9MH 4JKPH 2R2EA 3MFFA 3R0MA 4N68A 4OJFH 5JA9A 4DKAA 3RIAF 1CFSA 3C6SB 3OKDA 2D03H 5C0EB 1P7HL 1J11A 5I30H 4NQEA 4JKWA 4F7CA 3BGMA 3ZYOA 4H1LH 4IIQA 5GHWH 5BZDA 4JFDA 3C09B 4H26B 3ARDD 1AGCA 5AYQA 5DJCA 3I9GL 4UOW1 1PY9A 4JFFE 5D1QB 1T1WB 3SEPA 2X9WA 1LEIA 5KAQF 4M7ZB 4JFFD 5MI0B 4FQLH 1HHGA 5DURD 1QVOA 1QHPA 3FONA 1KGCD 1ZGLA 3VW3H 5CLTA 5GPRA 2C26A 3BN3B 3PV6A 1OSPH 3TIDA 5IB5B 7FABL 3HI5L 4RAUA 3LHPH 4NQEB 5DVLA 5DJ6B 5C0FA 5H35B 5KVGH 4JFDB 3CXHJ 4ZS6C 5MENA 4GRWF 1RFDH 4CDGC 4KMLB 1CFVH 1KXVC 2HVKB 5GZOD 3UJTL 5BO1H 3R0NA 5GGRA 1LEIB 3ROLB 5GS0C 4Z8FL 4PJ7F 2UUDK 2PR4H 3UYPA 1C1EL 2E27L 1QVOB 3EJZC 4NP4H 5DJZA 2Y7QA 1SQ2N 5DFVD 2M8XA 3T4YA 3PV6B 1T0MB 2HWZL 3RI5F 3TIDB 3BPOB 1DEEA 2ERJC 4KRPD 2AERT 2H2PD 5ADOL 4LGPB 1S7XA 2P8PA 4G6JL 3C5ZB 1P7KA 3TFKD 2WUBL 3KYNA 1NANI 2OJZL 3TN0D 5MENB 5IHZB 2J88L 3BYYA 5L2KA 4O4YL 2QV2A 4XMKL 3KAAA 4WO4C 5A43C 3MV8E 5C71A 5K9OB 4YHOL 4QRTA 5J6HB 2UVFA 5F44A 3O3DA 1MY7A 3MV8D 1HEZA 2Y7QB 5IW1B 5F6HI 3RU8H 1UM4L 3MRDB 2BVQA 1DEEB 3S4SB 4JG0L 4FFVC 2VQ1A 8CGTA 1K6QH 1JHTA 3BYTA 1S7XB 2P8PB 1HHJB 4PRIB 4WUKH 1DBAH 5E6IC 1X44A 4XZUA 1IZJA 1JYXA 1TTFA 3P0YL 1T20B 1FV1B 5HHMB 5JHDE 3FB6B 3G6JE 3HA0A 4ONOA 4QRTB 3RWGA 4DN3H 2FEEL 3U2SA 1ZLUH 4U1KA 5GRWA 3UPCA 3O3DB 1K5NB 3FB8B 4LIQH 4LRIC 2BVQB 3JV5A 5FKAB 2VKXA 2JJSC 4L4TA 3UC0H 2VQ1B 4V2BA 3VMOA 3D85A 5EC2A 2F54A 4KAQL 1RJLB 2V9RA 5DXWA 3P4MA 4KVNL 1KIQB 3IU4H 1INEL 2BMKA 1VENA 2HJFB 3BDYH 3W0WB 1P9MA 1VESA 3EO9H 5JR1L 1CR9H 2VDLH 3O6KL 43C9A 4LSSH 1AGEB 3RTQC 2P8MA 2IANB 4JB9H 4U1KB 5BVPH 3U2SB 2AABH 4PLKC 3BSZH 1VGKA 3KPSE 4R96A 1X5XA 5I17A 1IILE 1J86A 2W60B 3KNBA 4P3DA 4D3CL 3V4PL 3K2MC 3KPSD 4WEBL 5E2WL 2KBGA 2FB4H 2PW2A 4X83A 3TH2T 1NUNB 5I75C 2QADB 1E4WL 5EC2B 3K2UL 3EKCA 3VGHA 3HUJA 4PJBA 1QFWI 3CK0H 4G8GE 3ZE0F 1IT9L 5HGHA 3LEYL 1WT5C 5DC0A 3ZKSD 4HBQA 3KPPA 4G8GD 1G7QB 5FUZL 3VXTA 2FL5B 3FTGA 2P8MB 4RNRA 4NC1E 4XAKE 4BSVA 3QAZB 3STLA 4R96B 4PJ9D 3EFDL 4W81A 3GHBH 2EKJA 3KNBB 4P3DB 4XAKD 2VDQH 3LQZA 3CXHK 2PW2B 4RMSA 1ZLVK 2IBZY 3RY6A 1OSZA 1D9KC 1EX0A 4TVSa 5KJRL 1T1XA 5EBMA 1QSVA 4RFEA 3HUJB 2HH0L 3GGWB 1UVQA 3JTSA 3WSQH 5J56B 4I3SL 5FV2A 5DRNA 5HGHB 5KVDH 1QRNE 1J5OL 3MGOA 3QO1A 3KPPB 5CKGA 3GO1H 5IESL 1CU4H 1ZT1B 2QQLL 4ONFL 4RNRB 1TNMA 4R2GB 2V2WB 3AM8A 4MD4B 5E7FA 3VG9C 5LGHH 4RIRA 4J12A 3I85A 1JNHB 3PL6B 2OSLA 1T04B 5GSRB 2P47B 5IVXF 4OZGE 4Z76A 2P42B 3H3PH 4KROC 1TZGL 2P48B 2XTLA 3WXWL 3KYOA 1CVRA 4OLZL 1FAIL 4S2SA 1XGTA 4FQ2H 4RFEB 3ZT5A 3BJ91 2CH8A 5KOMC 4U1SA 5I8OH 3MGOB 4V1DD 2DQTH 3QO1B 4L8CA 4U1GB 4JDTH 3LKNB 4HUWA 2CJUH 5DGQA 4CU6A 1XH3A 3SE8H 1YY8B 1CK0L 1FIEA 4ODSL 2R0ZH 4A2LA 2BDNH 5GGVY 3SDAC 5DQ9A 4KZDL 1IAII 5C70A 3MROB 3T77B 4Z76B 1EFQA 4F2MB 1EJOL 4ZAKC 4G8FB 1A02N 2XQBL 3ZHLA 4TVPL 3HC4L 1XGTB 4G3YL 3RQ3A 4QNPF 1AKJA 1D5MA 2Y07H 1J10A 2O5YH 2EXYD 2VWEC 4JY4A 4HUWB 2OI9B 3ARGD 1XH3B 2NY0D 1J0KA 4C4KO 1JN6A 1UJ3A 4FRWA 3RY5A 2OYPA 4TSCH 4YHIA 5LXGL 2OL3L 4HF5H 5BZWA 4LPWA 3NPZB 3ARFD 4XNUH 3HG1B 3CZJA 4LSVH 1FL5A 3WIHH 3BPNC 2JIXD 4NM8H 4PFEA 3KPMA 1GXEA 3L5JA 4HUNB 1A6UH 3EYUL 4YHYC 4M62H 3O9WB 1D5MB 1KYOK 4LPVA 3R1GL 2PYFA 4XBGA 3QEHB 4ZPTA 3BKML 3PP4L 1DBBL 4W6WB 1JN6B 1UJ3B 1A7QL 1W0YT 2ADJA 4YHIB 2EE6A 5DSCB 5B8CB 1FYTA 4XP9L 4JDZA 5BZWB 3PGCA 2YUZA 1EERB 1P6FA 5GRXG 1HHKA 4WWKC 4NQDA 4XNYH 3D5OF 1NLDL 4XRCA 1JE6A 2A38A 3KPMB 2VR4A 3U4EA 2FGZA 5IWLA 4ZFGH 3MRNA 1I8KA 3D87B 3D9AH 4LLYA 3LD8B 4H25A 4QTHB 3O41B 2PYFB 1I1YA 1S9WB 1YY9C 3RUGA 5BS0D 4ZPTB 1C7SA 2QHRH 1PG7L 5A2KH 5DJ0A 3QUXD 3VJ6B 1I8MA 3C6LD 3MSPA 3U1SH 5EWIL 1IAOA 5F7FA 4JDZB 1A5FH 3PGCB 5GJSL 5TPWL 3E8UL 5IMLB 3V7MA 3WFBH 1CD9B 2F9BT 2EIZA 3DTXA 4AL8H 4UAOB 4HIJA 1ETZA 4NQCE 1F8TL 3CLFH 3U4EB 3GJFA 5K9JH 4I8DA 1G6RA 1ED3A 4NQCD 3QEQA 4TSAH 1JZ2A 4LLYB 1A1OB 4H25B 3WYRA 3P30H 3Q0HA 3C60D 5EBGA 1INDH 4HCRH 5DJ0B 3DNKA 3FFCA 1MEXL 2DIJA 4L9LB 3W9EA 3DGCR 2NR6D 4QTIH 3L1OH 3S37L 2H9GA 2VDRH 4XPBH 1MUJA 4P4KD 5E4IA 3QWRA 3DTXB 1GIGL 4HIJB 3X14A 4KKCD 3QUYB 5KW9H 2YPKA 2YHGA 4UU9B 1EO7A 4ZXBD 2DQIH 5D7JC 5ESVA 1G6RB 5E94A 4MAYB 3QEQB 1MCLA 4Y4FA 4FXGA 2Z4QA 3RAJH 5GRYA 2GITB 5ISZA 2OR9L 5J4MA 1KG0B 4FQCH 1EFXA 1N5YL 4UDUB 1CIUA 1E27B 4KTDL 3W9EB 1DFBL 5DS8A 1IKFL 1MUJB 3CVIH 4QOKB 3BH8A 1KPUA 3ARBD 1R0AH 1AFVL 1KENH 1C16A 3KPLA 3SDCA 1T2QL 3X14B 4YXKH 4I18A 3ZKQD 4HBCL 1MIMH 1NBZA 2ZPKL 5E9DE 1IC5H 2J1KA 5ESVB 3H8NA 2JLLA 4P5KA 5E94B 1QFWM 5IF0A 2OZ4L 5IFJA 4Y4FB 4LHUG 1KIUA 3NTCL 4FXGB 2Z4QB 1BQHA 3NCBB 5E9DD 4BK5A 5I66A 3GMRB 4JPVH 2C7UB 4Q9CA 4L3EB 1A3LL 5CILH 4D9LL 4MNGA 5DZNA 4N0RA 2L7JA 1KCUL 5M94B 5I9QB 5IQ9A 3UTZB 4LASL 4P46B 3RVUD 2G9HA 4G6FB 1AI1L 1R3KA 2NXZB 4WW2C 4ZFOA 3TJHC 3D18A 3X17A 3BH8B 3V5HB 1F2XK 5EU7E 4M48H 4GW4A 4JKPL 5IHLB 1PSKH 2V6HA 2XNAA 4OJFL 5IFJB 5LJYH 2VZTA 1EEZB 3LZFH 5I1GL 5I66B 3B83A 1XIWD 2D03L 3FRPG 2VC2H 2VZOA 3JBG7 5I30L 2HP4A 2HTKD 2DAVA 3VG0H 5IQ9B 1F45A 2UWEE 2VH5H 2G9HB 1K3ZA 1KLFA 1OCWL 5GHWL 1R3KB 4ZFOB 2DLFH 1UEYA 3D18B 1NBQA 3S5LA 4YJZL 5F7HA 5CS7A 3QJHB 5LGJA 1IGYB 5SWZE 1NMCC 3VFNA 3K3QA 4PTUA 5IBTL 4GW4B 4FQLL 1KACB 2A2QT 4PJGE 4MB3A 4A6YA 1NJ9A 5TE7H 3RWFA 3VW3L 3ALWA 3P40A 5F9OL 3C9NB 3BEVB 3CSYA 2WUCH 4L8SA 4I0CC 5DD6A 5CSZA 2PNDA 3LHPL 3RWCA 1JHLH 4ISVB 1CICD 3PHSA 1QLFA 1JMZA 3FOLA 1RUAH 3RVTC 1Y6MR 2FECI 5KVGL 1T7ZA 1BVZA 5GS1C 5BRZA 3QXAB 1BJ1J 3U6RA 1RFDL 1X5HA 5F1IA 4FZEH 3MYJA 2XQYK 1CFVL 4HUXA 2PO6A 1D6EB 4F9LC 4WFGE 4MZ2A 1B0RA 3VFNB 4BM7A 5C0ND 1UKTA 2PR4L 3VGFA 4WFGD 2AJXH 3Q5YA 3WHE0 5C0RH 3G5XB 4NP4L 5EO9A 1NJ9B 3C08L 1KFAL 5K33A 1W2KT 4LLVA 4HWBA 1S5HA 1OAXL 1C08A 1M7IA 1YJDC 1K8DA 3DX6B 1LO3L 1RK0A 4UTAH 3GFUA 2BOCA 4I9WD 2VXTH 3T4AA 3QULA 2VNCA 3BD4A 5J57B 4DQOH 2NY4D 3SDDC 3DXAE 1QLFB 3FOLB 5JZ7D 1S7UA 4ZO7A 5L2JA 4OUUA 3ZE2F 1MCCA 1BP3B 2X9YA 3DXAD 2DL9A 1CCZA 1FFNA 2W07A 3PIQA 4Z7VE 3F58H 1GGCH 5DLMH 2PO6B 3TIEA 4XNQA 1CXHA 2R2CA 1JRHH 3EJYD 3FFDA 4LNVA 1Q9KA 5DEFA 4UMGA 2F58L 5EO9B 4PJ8C 2VTFA 4Q7DA 2A74A 4OGAC 5I2IB 3PHOB 1WFOA 3RU8L 4LLVB 4W6XB 3BRGC 3CDCA 1S5HB 1C08B 1OAKL 1MH5A 1RK0B 1YQVH 5F7EH 3SQOH 2BOCB 1VFAA 3QULB 1K6QL 3DURA 4O9HH 3ZKMC 1G7PA 1U8JA 4GRWH 4XNZB 1WBZA 2NY1B 2N1KA 3IAGC 1DBAL 3BPLC 3ZKXB 1JWMA 1FFNB 4HIXL 1X6LA 1R24A 1G84A 4XVTL 3GMOA 1KJ2L 2AJVH 5D4QA 2WBJD 3FFDB 1Q9KB 4DN3L 4X5XA 3RWJB 2YUWA 2IWGA 3SGDI 3ZTJG 3QIUB 1UH3A 2EDNA 4LPUA 3I75B 4XI5C 2A74B 3VH8G 4IDJH 2XI9A 4LIQL 1QHOA 5HGAB 3ESVF 5GGUB 2EIEA 5ICZB 3DURB 5C08E 3LDBB 3WN5B 2DM7A 2J7LA 4KK8C 3BZEA 3F12B 4C54A 1UM5H