2JTDA

Skelemin immunoglobulin c2 like domain 4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
b'EEEMKRLLALSQEHKFPTVPTKSELAVEILEKGQVRFWMQAEKLSSNAKVSYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDVYKKLQKEAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myomesin-1
publication title Structural insight into the interaction between platelet integrin alphaIIbbeta3 and cytoskeletal protein skelemin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jtdA00
2V9TA 3DVFA 3OAZK 4ZYKB 3GMNA 2Y07L 3SDXF 5IFHH 1MLBB 3G6AA 2YD8A 3VFVA 3Q5TA 3QPQD 3HNTL 4Q58C 3TCXA 4JDVB 4Y8DC 3FQXA 5IW1A 4M1CD 4TOYL 1F58H 4NQDB 3EO1B 5DJAB 2IPTH 2DS4A 3DIFA 5D4QA 5CBEA 3HUJB 1G9EA 4MJ5B 3WSQH 4WWKB 1SYVA 5IQ9B 4PG9B 4ALAH 1F11A 1B90A 1S78C 3IF1A 4IOFD 3GZKA 3OB0K 4EUPG 1X7QB 5ALCL 1FFRA 4IOSD 5GS1B 3ARYA 3KYOB 4Z8FL 3TBSB 5E8NB 1FN4B 5C07A 5LQBH 4YQXL 3BDYL 5EC2A 1Z2KA 5C92A 2PYEB 4NQEB 4ZFGL 4YHKH 3O8XC 3O4LB 1GGIH 3MNVB 4C57C 1YJDC 3VFRA 1EXUB 1MH5B 3CSPA 5D7KE 5FUCE 4BSJA 3BRGC 4OI8A 4APQB 2EEBA 3LS4H 1AXTL 4OF0A 4WFFE 2ZUQC 2O61A 1NFDF 3WNLA 4PJAE 2IJ0C 3IJHB 4WFGE 3TBYB 3HHRB 35C8L 4N0YL 1I1FB 3G6JF 3RWGB 1L7TH 2IBGA 2R1WA 3MOBH 5H35A 4MD5B 5CP7A 3IKCA 1XR8A 3L3GA 2PETA 4MX7B 4LARH 5C0RL 4KVNH 4UT6L 1UCBH 4CVXA 1OPGH 2LQRA 3MUGB 5FM8A 4AEHL 2EIZA 1QHOA 2K7PA 3KPRE 5DDHB 4RRPG 5IJKC 5E6IA 5MERA 4ISVA 4LP5A 4U1NA 2EYSB 4YXKL 1RIVL 4I13B 2A83B 3W2DL 2DIJA 5GRWA 2R1YB 4X5XA 1AGFA 4G5ZL 5CD5D 3OXRA 1Z3GH 5SX4I 1U8KB 1NBVL 3QO0B 5CKAA 1VEOA 3BKJL 2C1PA 3C9NA 1RJYA 3TV3L 4J3SA 2EDNA 1BGXH 2QSQA 2C3HA 4JAMA 3Q0HA 4R4FH 3I6GA 4RMUA 1FGVL 2OR7A 2XKNB 3MQIA 1XF2A 5FGBA 4Z9KB 1HE7A 4MJ6A 2RIKA 3FO2B 3C5ZD 4P46A 1P9MA 2H9GA 2J4WL 5EO1A 3SDYL 2HMIC 1HK6A 4RMQA 1J8HB 2GJJA 2VZ1A 4K2UL 4GQPH 3C08H 5HHPB 4YAQA 3OKMB 2FATH 1NBYA 4H25A 4MLIA 1MFDL 5JXEA 4L29A 4GW1B 3QULA 1KB9K 4NKQB 5DMKB 4XC3L 1A7QL 1EBPA 1BOGA 1X5HA 3MLWH 3QP3A 5GJTL 3BMVA 1IGFH 4AIZA 4DEPC 4JZNA 5F6IC 3U36A 2X9YA 3BN9D 4OFIA 3TO4D 2NYYD 1UKQA 4JY5H 1KTKE 3KPOA 5TF1H 5SV4A 2E3VA 1DQLL 4I3RL 3C60B 4R3SA 2E8ZA 5CCKL 1MCQA 1HQ4B 2MQ3A 2Z8WC 1YEJH 1G7LB 2JELL 2R29H 2BSSA 4G6KL 4NCDA 1AQDA 3KYNA 2GK0B 2R2HB 3GGWA 5B3JE 1YPZB 2PW1A 5AD0A 1T04A 2AABL 2Z4QA 5HHME 1KXVC 1KFAH 4FQ2H 4CL7A 4GSDH 2FJFA 1MPAL 2BOCA 4XP4H 1PZ5A 2VXSL 4F7CB 5GGTH 5HYFA 3BFOA 4PJXF 3I6LE 2VABB 5JIHA 1ZKAA 4EN3D 4U6VL 4YXHH 4LCCB 3W0WB 3O8XA 1A6UL 3MRJA 1ZT4A 4DN4H 1S9XB 3IDJB 4E5XB 3VWJD 3O6KH 3MACL 4PR5A 3WHE1 3Q6FA 5EZOH 1F3JB 5EULV 5FCUL 5IT2H 1OTUD 2QADD 3ET9F 3BDXA 4M3KB 5JORB 2YMXH 4AG4L 3T1FB 5FO8A 3BIBX 3C5SA 1RUPL 5CHNB 2JB5H 5EU6E 3ARGD 5J7CC 4WU5A 5JXAL 4N0FB 4CDHA 1FAIH 1YNLH 4HIHA 4JPIA 1JHKL 1FG2B 2DLEA 1WFOA 4YHLH 5T1DH 4PJCE 4K7PX 4NZRL 1I3GL 4U1JB 1DEEA 1SVCP 2ILLA 3UJJH 5IJKA 3W9DA 3MODL 2LVCA 4QXWA 1WQVT 5IVNA 3IFPB 3BW9A 1NAMH 4GKSB 3NCYS 1TJHL 5DQDH 1PKQA 4MMZC 1MLCB 4KHXL 4M5YL 3L1OH 1YDPB 1RK0A 3GMRA 1AGDA 1RU9H 4OZHF 4TTDC 5FUCC 3FT4A 3H3BC 3P4MB 4RFOL 2D7PA 3GKWH 1I7ZA 4AMKH 1JPTL 4D8PB 1DSFL 1AGBB 4QXTB 3GSXA 1OCWL 2BRRL 3UJTL 1RV6X 2Q8AL 4M8QA 4EBQH 1HSAB 5IV2A 1OLLA 4ODHL 2Q3ZA 4LLYB 1BM3H 5HHNB 2FEDD 4GAGH 1KN4H 5JPMB 5BQ7B 1X5GA 2R69H 1XGYH 3Q6GL 3VFOA 2CLRA 3VXPA 2XN9A 2YD3A 1WFTA 2AGJL 3WEXA 2E5EA 4WWKD 3GSUA 5AAWA 2HKFH 4HMEA 1S7TA 2R4RH 1A2YA 5T1KA 1FGNH 1MIML 3BSZH 3PDOB 1K4DB 1HHGB 5HDLA 1D9KC 1RZJH 4QHMB 3RUGA 3B2VH 4JHWL 5F1IB 2PYED 4K8RC 1IGJB 4NQED 1CT8B 3MBEC 4OT1L 4PJ8C 2IMNA 4HZAA 1NMBH 1P4BL 2EO1A 3O4LD 5FYLH 4G9FB 3TIEA 1FL5A 2J6EL 4HT1L 2H41A 2XTJB 3PL6B 1CFSA 2AJZA 3G5ZA 4U4BA 1HNGA 5LWYL 4FQ1L 3ZMRA 4DZBA 3EJYD 4JRYA 4PTUA 5DVLA 2ICCA 3QEQE 2GY5A 2Z91B 4ODBD 2VAAB 1UKTA 3RY5A 4CU6A 5D7JB 1ZOXA 5DJ6A 5FCSH 1X4YA 1T0MB 2EE3A 3KNBB 4YBQC 3UP1A 5I1HH 2BVPB 3QFDA 3MCKB 5CGYC 3OWEA 1T4KA 2ZG2A 5HYIA 3FO0H 1BMGA 4M48L 4MB3A 4K7PY 2DLGA 4G7YL 2XRAH 2XIDA 2A6DA 1NKRA 2EIEA 2QSTA 1HN1A 4ORGB 3CZJA 1EAPB 4QNPF 2HJFB 1BFOA 1EEZB 1MY7A 4G7VH 5BXFA 2EXWC 3QQ4A 1X5LA 1RHFA 1E6JL 2VDQL 1Z6JT 4S0SD 1AGEA 3ZKND 1TETL 3DV6B 5F7MC 5IESL 5F7DA 4L3CB 4Q9BA 5E8OA 2I5YL 3RPIA 4N0UE 5I1LA 3SDDC 4KZEL 4Q0XH 3L3OB 3MRRA 4UINH 5CJ8A 1D5BA 1WBYB 4J4PC 2VZTA 3PP4L 1DVFC 3S5LG 4OGZA 4OD2A 2W92A 3EYVB 3B5GA 4HDIA 4M7ZC 4RAUB 5BRZE 5M95B 1J1OH 4C56E 2HH0L 4PJDE 3QEUA 3QXTA 3F7YA 3VI3F 2DMKA 2FRGP 4PLKC 3PWUB 4HX1A 4X6DB 1S7QB 4ZTPL 1A7OH 2AJXL 2HVJA 3DSFL 3PQYB 5AZ2L 3MV8E 2Q3AA 1MOEA 1YYMH 4KZDL 1E6OL 5EA0H 1XF5A 4XMKL 1J8HD 3UEZA 1P4IH 5LGKA 1XF3A 5JHLH 1I4FA 3QUZB 4YO0B 1QFUL 5BCAA 4XNQA 3TP4A 4QRRE 3CLEH 2M26A 3GBMH 1B2WH 4PJAA 5KW9H 1KLGB 4NQCD 5MEOB 5IMOA 1AE6L 2G75A 2YK1H 4JCLA 1X4ZA 2Y6SC 4Z77A 3UAJD 5IVXE 1N5AA 1DQJA 4HUUA 4OCXL 3VXOB 1U8HA 5B38B 2NY6D 3S35L 1CXLA 4FQJL 5D6DC 5D5MB 5J13C 2GQHA 3BGMA 1S9KC 3MA7A 4P3WA 1WUNT 2HKHH 5IHBA 5EC1B 5JOEA 1N64H 3KPRA 3C60D 4RISL 3QIWC 1PQZB 1U42A 4KUCD 1NLDH 4XWOD 1T6VN 1HIMH 3SBWC 1NEUA 4Y16B 2BDNH 2CJUH 2UZXB 3CUPA 3OSKA 1I3RB 1FFOA 3PDGA 5HYSB 1A3LH 3HNSL 4CN1A 2NY5C 4WUUD 2GJZA 1RUAH 4U6XB 1KPRB 1AH1A 4TSCH 1KT2B 2K9UA 1NGXB 2EICA 5GHWH 5KOMC 1B4JL 1OWRM 2Y1VA 3OGCA 4RFNB 1D9KA 1UEMA 4KRNA 4GQ9L 3MBEA 2IQAA 4PJ8A 3N06B 4OQ1A 1D5XB 1ADQA 3AFLA 1INQB 2HT3D 4QXGL 1DQML 5F7UA 3V0WL 5A1AA 2P48B 5HHVL 5D2LF 1YEDA 4BM7A 2VO5A 4UT7H 3VXUE 3ZDZE 4C58B 3FB7A 4FMFA 3LEYL 2BVOB 4I77L 3B9KD 3BE1H 1RUQL 3UTPD 3FONB 4NQVA 4WCYL 1MQ8A 5KOVC 4JFPA 2ZWLT 5EZJA 2GSGA 4OZ4A 4GOSA 5KVGL 5J6HA 2Z31C 5GGQH 1CDIA 1NBZA 3GSOA 5HDOA 3ZSSA 2DMBA 4NFBA 3KLSA 4MA1C 2MPAL 5FECA 2QBWA 4KMQA 1WICA 1TNMA 2K7QA 1OAZH 1HDMA 5EU4A 2YN5A 1ZVSA 1U8QA 5I8EB 2JK5A 2V5TA 4OFPA 2WMPA 3MV9B 4P2RB 4PGEB 1QEWB 1PEWA 3SDDA 4HCRA 2YEZB 3B83A 4WEMB 1UWGH 1UJTA 4J4PA 4UUJA 1KJVA 1DVFA 3F5WB 1RY7B 1VFAA 2XOTA 1ZWIB 3FB8A 3SDAC 1YEHH 2V9RA 4WY7L 3T0DA 3BQUD 4F2MA 4O51A 1R24B 3S88L 4NUJA 2I07A 4GXUM 3RFZC 3SE8L 2ICWI 1IEHA 3N50A 5I71B 1T5XA 1G9NL 5EO0B 2A9MH 4ZUTB 4XH2B 3ARVA 4MAYD 5E5UB 1BHGA 3HUJF 3KHQA 3TJHD 4V2CB 4HQQL 2A2QT 5I0DA 2Y4SA 1M05A 2NY0B 3QDHA 5J9PB 1YJDH 9CGTA 2F53E 4WGWB 4F80A 2CKBL 1QRNB 2YD5A 3H0TA 4LBEA 3QRFM 4YZFE 1J0HA 4LU5H 4K7PH 3KPQA 1BIIA 1YEGL 3WUWG 2HN7B 1CN4A 5EU6A 1TENA 3L95B 3MRDB 5LGJA 4J2XA 5D6DA 2KDGA 1FL3A 2ZCHH 4Z76A 4ORZC 4UQ3A 4PJCA 2H2PD 3BKCL 3KYMA 2DIAA 4FP8L 5IK3B 5IHZB 4KK6C 1E28A 2AJVL 3QIWA 2MMXA 4PLOB 2DQDH 3PL6D 4WUKH 2ATPB 3D39B 4KAQH 4KJPC 1K6QL 1QTYT 3IGAB 3N1GC 4FQQA 3SBWA 2VAJA 5IF0B 4KDVA 5GZNC 1KLFA 1MFBH 4YC2C 1YYLH 3X12A 2NR6C 5KSAC 5EPMA 3L5XL 2WM0A 3EYUH 4GAYA 3SKUD 4U1MA 3FQWB 4LPTA 4G8FB 1T2JA 2ZSVA 1GPOH 1SQ2N 4X7FC 5DD0H 4L8CB 3RVUC 4HIJB 3HFMH 1QFWI 4OCNC 3O3EB 4FRWA 3S3JA 4I0PB 3HS0A 3OX8B 1KF9B 3ZHDA 1WZKA 2EH7H 2P42B 2X4TA 1MHEA 4JZJB 5HYQB 4S1SL 5CINH 2GITA 3LPWA 4YDJB 5FO9B 3EJZC 3BUYB 3P73B 4UDUA 1ZLVH 3CDFA 5EZLA 1HHIB 3VWKB 4F15B 3QG7L 5SWZB 1CZ8L 4OF7A 2Z31A 2QHLA 3W81A 5CEXA 1Q9WA 2O5ZL 5MENB 4HAGA 1D5IH 3T2PA 1ES0A 1FIGL 3ZT5A 1KBGH 3TFKD 1RZ7H 2YA0A 1CI5A 3O2WH 3EOTH 2F58L 5ISZB 4BZYA 1AXSA 1CFQB 5EZIH 1DFBH 3RL2B 5I66B 4MCYA 4GMTH 5T5FL 1OAUL 3TNNA 1KYOJ 1MQKH 3DMMD 3IFOB 2VC2H 5KJRL 5KVMC 3QUZD 3BEWB 4MDIA 1GGUA 1XAUA 2EYRB 3RVWC 4GRLD 4O2EA 4AM0B 4Z7OF 5J11C 2UYLA 3QEQA 1UWEH 5GRVK 3SDAA 1P84K 4LEXL 1JPSL 3GJFB 4MSWA 2X4RA 4P9ML 1UZ6F 4ELMB 3FT2A 2F15A 5FYJD 4OIIL 5KAQG 3ARDD 3O4OC 4BQ9A 1CXIA 1HOCB 1QSEB 2GTWA 4K07A 4IM8A 3FQUA 3WIHA 3MR9B 3CVHA 3QDGE 2A9NH 5MHSE 2AJUH 2F54B 4YIQB 1YPZF 5JW3L 4X7CC 5DJCA 4RAVA 8FABB 5KN5B 3QHFL 2CDEA 4NN5C 2D4FA 1I9RL 4LAQL 4ZPVB 4N0CD 4OZIB 4XTRC 4ODSL 5TE4L 5MI0C 2AK4B 4PP2A 1I1YB 3OTTA 3T3ME 2Y5TA 1RJCA 3SE3C 5JTWA 3EFFB 2HG5B 2BNRB 2P4AB 4N0UA 2C4FU 2SEBB 5JPNA 2W38A 1N4XH 5H94A 5H37G 1KIUA 1DLHB 4PREA 5GS2H 2E27L 3VGDA 5BRZA 5ANMB 1KV3A 1V3KA 4Y2DD 4C56A 2Q86A 4ZAKD 3OR7A 1BD2B 2NY1B 2AQ2A 1MRFH 3MCG1 4JFYA 3X11A 3NFPB 2HT4D 5DQ9B 1CBVL 4BFIB 4Z78B 4WW2B 5CJQH 3MV8A 3DLQR 2CO7B 1ONQA 3MLRH 4N0RA 3LEXA 1CFTA 5E95B 4F7EA 3PNWB 4XP1L 3ZKSD 1I8KB 3M8OH 3GSVB 3FOMB 1FYTB 2IPUK 3L3DB 2MTPA 4X9FA 1G7IA 2IH3A 2P8PA 5B39G 4QRRA 5KSAA 3C8KA 1A3RL 2IF7A 1HKFA 1OAYL 4TSAH 3VFVB 1HKLL 2Q76B 1WCBB 4X6EA 2VDKL 4MZ2A 4PJEE 5IVXA 1NANI 2QQLH 3UC0L 3G08A 4PGCB 5IW1B 1CVSC 1YMHB 4YGVA 2DKSA 1FV1A 1Q9KA 1JV5A 1JIBA 2HFEB 4YHZL 1B0WA 4YWGH 3THMH 4J1UA 4M62H 5FHBH 5MEPA 3QEGH 4PD4K 1MCRA 3I3EA 3EYQD 4PJ9C 5BV7C 5I1AA 3MRHA 1JZ5A 5KS9E 4CNIB 1JGVH 3MUHL 4IIQC 5D7LE 3VXQA 3MV9D 1C12A 4LSSL 1KGCD 2J6EA 4X99A 3MTRA 2GY7B 5KSBE 1SYSB 1C7TA 1AY1L 3MJ6A 4I2XB 1HHKA 1JF6A 3QXDA 2JIXB 3RWIB 3VFRB 4CN6A 4HWZB 3KJ4B 5D1XC 4F57H 1INEL 4DVBA 2NXZC 4EOWL 4JGJA 4QLRA 3H9SE 4LPCA 3P0VL 3DO7B 2A73A 1QNZH 3QXUA 3ZLQC 3DVIA 4PRID 3TNMB 5C0IB 1QA9A 5TGBA 4D0DB 4K8RH 3HA0A 4QY8A 2OI9C 5C6TH 5KBNC 1ADQH 5E99H 5JLZB 4U0RC 4IS6A 1XR8B 3VXUA 1WBZA 4M6AA 3FT3A 4CVXB 4HS6B 4KRMB 3MJ7A 2MSPA 2Y07H 4UAOC 1G7PA 4JFZH 2BX5A 5I16B 2EKSB 3PF2A 1EMTL 4U1NB 2G60H 3IB4A 1AC0A 2EKJA 4TOYH 4M93B 1G0XA 1Q9OB 3UPRB 3ULUL 1U2CA 5GGRB 1YY8A 4PY7A 1TTGA 5HI3C 5A3ID 4LMQE 5ALCH 1G9NC 4Z8FH 4LLUA 4XNUH 5LXGH 4JAMB 5C6WH 4W70A 3ZDXE 1T5WA 3SE3A 5L0QB 3FKUS 3G9VA 4YQXH 4GW4A 2M8XA 4RWYH 1A47A 3N1FC 5E08H 1JUFA 3VXRE 5HYEA 3LZFL 4DCQA 4MJ6B 1NGQL 4HCRH 4P46B 4NWTL 1T1XA 2H9GB 2ADIA 2VKXA 1HI6A 1R3KA 3OKOA 4OCWH 4PRHE 1S7VA 3LIZL 1O7SA 3FN3A 2FX9L 1AO7E 4EI5D 1U6AH 1IGTA 4WI5A 3QZWA 4YAQB 3RWJB 1IAIH 3SOBL 2CXGA 4H25B 3TZVC 4XGZA 2XA8L 4XMPL 1S7UA 3QQ9D 1MF2H 1ODAA 5D2NE 3ZTNH 1GC1L 1JRHH 3C2AH 1EPFA 5J6GA 3R1GH 2VTFA 2B4CC 3DUSB 3WNPA 3QCUL 5AWNL 1F90H 4UT6H 3PWNB 5BO1H 5IGXL 2LU7A 4JB9L 5IP4A 1RFDH 1XF4A 4GFTB 5E8DL 3QFJB 4X6DF 5ERWA 4HHAB 4G8GD 4Z7WB 5SWZD 1CFVH 4X6FA 2VLMD 5C0BE 3RKPA 4ESKA 3GI8H 2BSSB 2R2EB 1INDH 5ISZD 4L1HA 3GGWB 3GUTA 5JNYA 5AD0B 4PJ9A 4JFFB 2DQCH 5E2UL 2WV3A 2EO9A 2BY2A 4IIQA 1EBAA 3GJFK 4IRSC 1KENL 1C5BL 1ED3B 5D6CB 2FX8L 4HFUL 1U3HB 4IMLB 5E94A 3U2SB 2BVTA 2P5WD 4WWID 1MWAA 5JOFB 5D5MF 1NEZA 4G6ML 4QRTA 5EU5B 1X5JA 4YHOH 1UQSA 2FX7H 3O8XB 3NFSL 4POZC 3SCMC 3MGOA 4WV1C 1ZT4B 3LV3A 4LHQB 5C0GA 1B0GB 2NY5H 3KGRA 5D1XA 5FUZL 4L4VD 3LB6C 4RGOH 4XI5D 3BZFB 3Q6FB 4OLYH 3U0WH 2B39A 2D7MA 4TRPH 3C5SB 4UIKL 5BVPH 3ULUE 1I1AD 3V79C 1A7QH 2MCPH 2IMMA 4TPRH 2J5LC 4Y5XC 5GJTH 2W0PA 1QYGL 3V8CA 1R3LA 5ILTH 5DS8A 1U3YA 2AK4D 4HIHB 1T1WB 4ZFZB 2O5XH 6FABL 3HPJB 1I9EA 1YEKL 1DEEB 3NIDE 1GYAA 4G8IA 2YC1B 4DTGH 5BVJB 4LLDA 1JYNA 1EZVX 2AEQH 3KPLA 4XBEH 1NC4A 4HXBH 3HI6H 1T3FB 4KI5E 3K2UH 4G6KH 5FA3A 5DUMH 3RX5A 1AGDB 5DJDB 1BD2D 4NNYB 4P5KB 3FT4B 3VE0A 4S1DC 3MRPB 3O3DA 3KPTA 3BXNA 2XG4A 3IDUA 3TT1H 4R90H 1BLNB 4QXUH 2XQBL 1T89C 2Z92B 3UTSD 3CH1A 4X7TB 3V4VH 5DK0B 1FYTD 2Z8RA 3OAYK 4U6VH 5F7NC 4GAJL 2DD8L 5DVNA 4X4XA 3I85A 2G9HA 3MRQA 2GYSA 3BUTA 3MOAH 2F8VA 4IRJB 3DX7B 3FOLB 2DBJA 3WBDA 1D5MA 4OFYA 4EVNA 4RNRA 3ZHKA 2H6PA 3BAEH 3U4EA 4J6RL 3VFOB 3TGXA 5ADOL 3NCBB 2P43B 3VXPB 3TZVA 1FIEA 5TPWL 3QDGA 3DJ9A 4KKAC 1I75A 3MRLB 3WIHH 3CVHH 1D6EA 3ULVF 1G0DA 1KJ2A 1A2YB 4HIXH 3RGVC 1L7IH 5JW5A 5F89A 2GAZA 4GJTB 1ZHBA 5DA4A 1XGTB 4DEPB 5D71H 2PXYB 1RJZA 4RA3A 3LRHA 2GEEA 1M7XA 4K3JH 4WTZA 1FC2D 4Y1AE 4OF5A 2JIXD 3TIEB 3LKNA 3WN5B 4Z7NF 1IQWL 1FL5B 4F9PC 1ZHLB 3SDXE 4M6MH 4POUB 2AJZB 1R3HA 4M5YH 4R26H 2E8YA 5D70H 5CS7A 4YHPA 3S3PA 4D94A 2FL5A 4CMMB 1BBDL 1OOAA 1ZS8B 4PTUB 1J0JA 1TVDA 4O2FA 2W60B 4JRXB 2OZ4L 4WI2A 4LSPL 4ZMAT 1F6AA 4QCIA 3VFUA 4IRSA 2NLJA 1MRDH 1C5DA 4HFWB 2J1KA 3DO3A 4I5BA 1T4KB 4PIRF 3SGDH 4F8TA 3C2SA 5D2NC 2GT9B 4RX4A 1EDQA 4O5LL 1JZ6A 1EZVY 3RI5F 3SCMA 3TA3D 4WV1A 5HY9A 3C09C 3SQOH 3FRUB 3SKMA 3QQ4B 1DLFH 2EDFA 3IDNB 4RA0C 4X5WB 3RU8H 1CF8H 4HJJH 3RWEB 4I3GA 4PJEA 5A16A 3HRZB 1KJMB 1OP5K 3RPIB 1NFDE 4XVUD 2OK0L 1MHHA 5T3ZL 2X9XA 4U1KA 2DQEL 3D85B 3MRRB 2LAGB 4PJGE 1JMZA 4Y5XA 3I02B 5I9QB 3G6JE 3BPOC 4OD2B 1C16A 5BZWA 4MQ7B 5KS9A 2UWEB 3GBLA 3NABL 3O81A 3S9DB 4XX1E 4JHWH 3LKRB 4HUVA 3QYCA 4MDJB 4U7MA 5KSBA 4HX1B 3GB7B 2HVJB 1WWBX 2J6EH 3FFCB 5GRYA 3T4YA 2DQUL 4N1EA 3VFWA 4M1DL 2XNAA 2PUQT 3LN4A 1IEAA 5DRNA 3VGBA 1I4FB 5TDNB 1BQHB 1KB5A 4TUJA 3H9SA 4S1RH 1U92A 4L4JA 3U6RB 2VZUA 2NY7L 1EUTA 4O9HL 1MCPH 1YUHB 2AXFB 2G75B 3TPUA 3ALXA 1T89A 1JYWA 4XC1L 3UROR 3ULUC 1VGKB 1DQJB 1U8HB 4LQFH 4TYUA 5T3XL 3G5VB 4QWWD 3BGMB 1NBQA 2ARWA 4XCYB 3QFJD 2OSLA 3KXFE 1WC7A 2CDFA 1NCCH 5DVMA 4Z7QF 2BSRB 2OTWA 5I17B 1LE5B 1YN6A 1PLGL 1QFHA 1CGXA 4KI5C 4KXZH 3HAEA 5CGTA 5B4MD 5GGVL 4KZEH 2VDOH 1IL1A 3VMNA 1XH3A 5E1HB 3O41A 4JFFD 4DAGH 3U7YH 5I1KL 2A0LD 5KVEH 2FCBA 3RGVA 5C2BL 1I8LC 2HH0H 4ELMF 4NZUH 4K3EH 5KVFL 1WJ3A 2AJXH 3DSFH 1RVFL 1P7QD 5AG9A 1UYWL 4NM8L 4LPUA 3K3QA 2ATKA 4F9PA 2V2WB 3VXRA 3HI1B 5DD5L 3OAUL 4P23D 4OCMC 2BFVL 3MUJA 4OZIF 1X5KA 3MSPA 2X4UB 2Z8VC 3T09A 4PRHA 3O9WD 4KK5D 3QDMD 4FZEL 4P2OC 1AO7A 4OBSA 1KG0B 4HKJA 3BT2H 1JPGB 5JIKA 4FG6C 1AP2A 1IM3A 4XCNB 4HXAL 1JTOA 4QRQB 1UVQB 4PP1C 5D2NA 1NH6A 5J6HB 3QIUB 2R0KH 4P59H 3OZ9H 2FECL 2AQ1A 5LJYH 3TM6A 4PJXE 3JXAA 1KSRA 3F6LA 4QTIL 4JPWL 5FECB 3BVNA 1QBLL 4IHOB 4PRBB 2G5BB 1FCCA 4PJBB 4R4NC 4WW2F 1HDMB 5EU4B 2B1AL 2EZ0D 2GJ6E 2R0ZH 3GIZH 4LCWD 2EC9U 4LPVA 1BQLL 3EW3B 5IROC 5C0BA 4ONOA 3GK8H 1KEGL 4NHUA 4JJHA 5DFVD 4FNLL 4JREB 4BFEA 4CVZA 4ODWB 2EDXA 5CEYB 4FQLL 4AK1A 4F2MB 3LKSB 3GIVB 5BV7H 1NDMA 3NPSB 1HHJB 1RIUH 2XPGA 4RIRB 3DYOA 5FUOL 3ARWA 4LOUD 2CR3A 3QG6B 1ZLVK 1T5XB 1CQYA 4WO4B 2FO4A 5L6YL 1QVOB 1QBMH 1S7SA 4WHDA 1MWAH 1Q0YH 5IUSA 5HHVH 4IRJD 5I1IH 1DTUA 1E4XH 2NY2B 3WL9A 1AD0B 3LEYH 4TNWF 4I77H 2FDBP 5DRZB 1A9BA 4EDXA 6CGTA 5DJ0A 4LFHD 3S97C 4OZHE 4PLJD 3VFPA 4LSRL 4P3CL 5DR5L 3SDCC 1P69B 5KVDH 5E1AA 3KPQB 5I8OL 1IKNC 2Q6WA 5EU6B 3LN5A 4K3GA 1XGPB 4MQSB 3OKKA 2IGFL 3IXTA 1S7RA 4J3UA 1N3NA 5M7QA 2ZUXA 2PXYD 4LPXA 1GGBL 4XAKD 1KOAA 3WFBL 4BZ1H 4KTDL 4Z76B 1ZT1B 2UUDH 3RDTD 1WAAE 4H88L 3WNMA 3UO1L 3DRQB 1BAFL 4KJQD 4YHNA 2X70B 4H1LA 1JNLL 2CR6A 4ZOEA 2Q87A 4CKVX 4H26A 1C5CL 1EFXA 4JRXD 4JHAH 1I3UA 1MAKA 2MOVA 2XWJA 1SY6A 3R06A 4XBGB 3RWHB 1I8LA 2DTMH 3DXAB 4G9DA 2FIKA 3EGSB 1R3IH 5ICZA 4U1MB 5FIEA 2Y7QA 5CKGA 2P24A 3V7AE 2LU3A 3KJ6L 3PJSB 3SO3C 3D0VA 3MRMB 4FN0A 3QNZB 3JUZA 3MRKA 1T1ZB 3WO4B 4NOBA 1JWSA 1H3WM 4P2OA 1W2KT 4ZFFA 4JPKH 4UOW1 5JUEH 1E27A 5ICXB 3ILQD 4JKLA 4UU9B 1A7PH 1MIEL 2Y5EA 4UDUB 4MQXD 1E4WL 1S7XA 4OLZL 5DGRA 3U83A 1IGIH 1P1ZB 2WWMD 1X6NA 1SBSH 5AUMA 5CEXB 1BF8A 1BX2B 2XG5A 1F6LL 1MJJB 4MA1B 3V0AC 1KJ2H 2B4CH 4WEBL 4BQBA 1W8OA 2VXTH 4DGYL 4ELKB 4QNPE 2DQTL 1KTRL 5BZDA 2ZPKL 4PJHE 4Y1AA 1JGEA 1UADC 3SDXA 5DRXA 5IROA 3LMJH 2CGRL 4MQTB 3GNML 2CLZB 5CAYB 4HS3B 4MDIB 4O2CA 1UXSB 3JTTB 2APVA 2W1NA 2AAVA 2EEAA 4J8RB 4O2EB 3FQNA 1W72L 3RGHA 3WXWL 2UYLB 3TF7C 1NCDH 2OQJA 4G43A 1MCEA 3SDAB 4LHUG 3O6FB 2W9DL 4Z7WF 3D6GA 1TVBA 2ZCKH 1HINH 1ZA6B 3VI3E 3VXNA 4R8WL 5CLTA 3U9UA 1OF2A 3HAEG 1H3XA 1Z0NA 4JFEE 4WW1A 2PYFA 4JM4L 5AZEH 4RAVB 4UV4L 3FMGH 1UM6L 2CDEB 4P4RB 2JJUA 1KCKA 4LSVL 1R5IB 3UBXI 4PP2B 2Y5TB 4OGAD 4LPWA 4J3OC 3SDCA 1QBBA 3UTQB 1L9MA 1NFDA 4L8BA 4N0UB 1IKNA 1TJIH 5DJYA 4Z6AT 4M6OL 5JPNB 2WP3O 2HFFB 4NQTA 2MQ0A 4L3EB 3KDMA 4GXVL 2BJML 3G6JA 4PREB 3DTXB 5C9KA 1V05A 4XVSL 3GMQB 5DHVB 1GZPA 1FNSL 4PJDB 2B2XH 3KWWA 2FJGB 3TVMD 3QQ3A 1U8JB 32C2B 5LAXA 4I18C 4B0MM 2RBLA 1FE8L 3LEXB 1CFTB 2A77H 3VJ6B 1IJ9A 4GRWH 3T65B 4BH8B 4DKAA 5KANI 1RZ8A 1U0QA 4QKXB 5H2BA 4YC2B 1G7IB 1DUYB 1IEBA 2P8PB 3W9EA 2OR9L 4C4KO 3C8KB 3RVVD 2VZ3A 4CAGA 1MJ8H 3DX8B 1KB5H 1J05A 4PB9L 1I7UA 3QIUD 1KCUH 4KK8C 3L9RA 2QQKL 1HEZA 5IVXB 4L4TE 1PSKH 2D9QB 3G08B 1NQBA 4QGTA 3N9GL 1FV1B 4JZOB 4HC1A 1JV5B 4U6HA 3QPQC 4YDKL 2NPLX 3T0ED 2LTQC 2X4QA 3KXFA 1VFUA 3MRCB 3EOBA 4HWNA 2A6IA 3VI4F 5TE4H 3QWOA 3FO1A 2DLFH 3VXQB 1M7IB 4D9LL 1QQDB 4YDIH 1L0YA 3MLSH 5A40E 2Y36L 3K4DA 1F97A 2DWDA 2VLLA 1B6DA 5IFAL 1FNLA 4IOFC 3KVQA 4M9PA 1HHKB 1J1PL 3HAEH 3MRIA 3MLPA 2X89A 3QXDB 4KDTC 4ZFOL 4OGYH 2R56L 5IWLC 3K2MC 1G7HB 2BSTB 4DVBB 4PRPD 2PO6B 1RZIB 4WO4D 2V17H 3RIFF 4ETQB 1OAKL 5I74C 1I8MA 1SJHA 2V2XA 3OG4B 1Q94A 3AS1A 3AVEA 5F7KC 1OTSD 5HJ3A 3TYFA 2V7NA 3QWRD 5EO9B 5IBTL 2NW2A 4M5ZL 3MJ7B 4EUPB 5JHDD 4Y8AA 3STZB 1G7PB 3IVKB 3MRGA 3GHEH 1EK3A 3T4AA 5K9JL 3E8UL 4IRZH 4N90D 3MRNA 3DWTA 1KCSH 3O4OB 3CX2A 4N5UA 4X8JB 3DUUA 2O26U 3L3IA 1FJ1B 1IQDA 3NTCH 3BWAA 5F8RC 4PJXA 1CDYA 1SEQL 5TE6H 1M4KA 1BVLA 2E6JA 2B20A 3HUJE 5JMOC 1MRCH 4ZPTA 1OP9A 4WHTB 2EXYD 2VLRB 2PNDA 2GJ6A 5MI0B 1B3JA 1QSVA 5CD5C 3MRFA 3B9VA 3ROLA 3HC0A 1F4WH 3CFJA 1DE4B 1CE6A 3DXAD 4LCYB 1R3JB 4JANA 2PYEE 4NQEE 2B5IB 4M61B 3MLXH 1HILB 3O4LE 4I4WA 1CGWA 2ADIB 1HI6B 5IB2B 2CUHA 3OKOB 2GK2A 5T1MB 1JCKA 3CFDB 4R2GD 4TVPH 3CU7A 3C5ZC 3FTGB 1H3TA 3K46A 3QZWB 3T0AA 3MFFA 4I18A 2AI0H 3SKJL 4XGZB 4MXWL 3MYJA 5CEZH 1J5OL 1F5WA 2UWEF 3O3AA 1FLTX 4KTYA 2F53B 4OZHA 1GIGL 1JYVA 5IHLB 3GSNA 3HE6D 1QHPA 1YMMD 5JQ6L 4JO4H 4R7NB 3BN9C 3FFDA 1S5HA 4HUXB 5E2VL 3BRDA 3VW3H 3AC0A 5EBGA 3TO4C 4YK4C 2NYYC 1NMAH 3ULUH 3DBXB 7FABL 1U8IB 2IPKA 5JNYB 1TXKA 1WAAA 4CU8A 1CD8A 5JQHC 3CK0L 3PWLA 4CW1B 4IIQB 4PRNA 4XNYH 1HCVA 1BP3B 5C0FB 5E94B 1H0DA 1DQQB 1AGCB 2OJZL 2P7TB 3GSQA 4H1LH 4QRTB 4RAHA 2VXQH 4DKEH 3O6FD 4KDTA 3LV3B 1JNHA 4LLWA 5IWLA 4EN3C 4YFLI 2VSCA 3CDGA 3QO1B 1SY6H 3BKML 3LIZH 1LO2L 4HV8A 4FQXD 4W6XB 3VWJC 1J8HE 3RKDD 2VDPH 3HMXA 1DBAL 4P5TB 1J8KA 5EIIA 5ITFA 4DGVH 3GDBA 5ESQA 1OTUC 2QADC 2X4PA 1PFCA 3S96A 1K4CA 4NQCE 1RURH 2ITDB 4CDGC 1R3LB 3PWPB 3DX9B 1J11A 5BOPA 4P5MA 4ONGH 3JWOC 3O11A 4NO3A 1T2XA 5I73C 4JFOA 4JVWA 2G5RA 3STBA 2ZUSA 2YBRB 4Z7OE 5DWUL 4G8IB 1HXYB 2ICWJ 4R97C 3M17A 1HWGB 1A0QH 2I9LB 1N59B 3O6LL 4L3ED 3S36L 3WXVL 5DF0A 5MP6L 1UZ6E 1YEEH 1LEKA 2D2OA 3TWCH 1G9MC 5KSVA 5CSZA 4IDJH 5DEFB 5FA3B 5BMFL 1XR9A 2GSIB 5F6HI 1FL6B 4QHNB 1MHPH 1NGPL 2BK8A 5L9DH 4KTEL 1W0YT 5F9OH 2IBZX 5ADPL 1NCAH 1YPZE 3O3DB 4UIMB 1W0VB 1UG9A 3G6DH 3BXNB 4KK9D 4WUUE 4PJHA 1LO5B 4M8VA 5I8CB 4Y4HB 5HYJD 5SV3A 1BVZA 4U49A 4JFQB 2I9TA 5GS3A 3CSGA 1JFQH 2XKSA 1F2QA 3QHZH 5HPMA 3B43A 2CKBB 2FBJH 4NJ9L 4BSVA 1T20B 4PJBF 1GJIA 1MCFA 5ID1B 4C83A 2VDLH 3C5ZA 4EVNB 4RNRB 2H6PB 3LQZA 3D2UD 2FEDC 1ZHNA 2MHAA 3E2HB 4N5ED 1SM3H 4Q2ZA 5GGVY 4YBLC 5INCB 3UTPE 1JTTA 2VKWA 4A6YA 1N7MH 4U1GB 3NGBB 4JFEA 2K3TA 5DQJB 4PBVC 1A02N 1A21A 5CWSA 3QRGH 5JW5B 4PGBA 2H1PH 2NTSP 4WWKC 5D8JL 4UT9L 3WLBA 1GAFL 1XGRB 2Z35A 3VXSB 5MEQB 1FZOA 4P9HL 4CADA 4YGAB 5IFJA 1B9ZA 3TO4A 5F88A 3VH8G 1V7NH 4XNZB 3CC5B 4YHPB 3KPNB 3U7WL 4QHUB 2PO6D 3BH9B 3JWDC 5T1LB 1Q9LB 3D3VD 1IZJA 1DQDL 5F7HA 1KJ3H 3BIAX 3WE6A 3GRWL 2ICES 1S9YA 3RNKA 5C0EA 1F6AB 4QHLB 4V1DD 3CVIH 1Q0XL 1WSST 1QO3A 2FB4H 4MHHG 5EUOB 3BP4B 1BECA 1MFNA 1C5DB 2XWTB 1OSPL 3VD3A 4I48A 5D9SB 1BWMA 4AQ1B 5FDWB 5CD3B 2UV3A 3O3UN 3SCMB 2FGWL 3CIQA 4WV1B 3RAJH 4Y5YB 1MREH 5IMLA 1VKXA 4EN3A 2CUMA 4HIEB 5DC0A 3NAAL 2W65A 1J87A 4LEOA 1RHHB 3NCMA 3VWJA 1FORL 2HVKB 4PJEB 5A16B 2IBZY 4L4TA 5TPWH 3LEVH 2A6JB 1MHHB 5CJXC 1DANT 3Q3GA 3CFCH 3D5OF 1JWUA 4LSTH 3ZKNC 2QL1A 5DD3L 4G80B 5D72H 4PJIE 2VLRD 4HC1H 3DRTA 4FXKB 1FZMA 1C16B 2QTEA 5KS9B 4HULB 5D7LB 2WUCL 2QSCL 2A1WL 1JJUA 4JKPL 4NWUL 3OKNB 5KSBB 2OS7A 1MCOH 4G9FE 5CZKA 1U8PA 1Q1JL 4ACPA 4Q9RL 1HH9A 2XNAB 3CPLB 1IM9D 1IEAB 5D1QB 4M43H 1A5FL 4FFYL 3BPNB 1RMFH 2P8LA 3H9SB 3M1BB 2BMKA 4KRPD 4OV5A 2DQIL 5DURD 5GISL 4XMLL 3IETA 3Q1SH 1BFVL 1KPVB 5I1EL 3L5IA 3I84A 5C71A 3PWJB 2R4SH 4X98A 1ZLUH 3S5LB 4ZOCA 5TE7H 3MXWH 3CD4A 1RZGA 3RP1A 1AD9B 2CDFB 5DQJA 2CIIB 1H15B 2DDQL 3ESUF 3KAAA 4ZYKA 1AR1D 3C6LB 2HFGH 1MLBA 2EDJA 1B4RA 5LGHL 4Y5VC 4F8QA 2HYMA 2OK0H 2AJYH 5EIQA 3C60C 5HD8D 1A1NB 5C0CD 4JDVA 4NO2B 4XWOC 2Y06L 1XIWB 5DJAA 1GGCH 1WFNA 2R8SL 3IS1X 2DQFA 3NABH 3HUJA 3R0MA 5I15L 2HRLA 5E9DB 4MJ5A 4WWKA 3BGFB 3K1DA 2YPVL 4PG9A 1J0ZA 1FPTL 4NP4L 5GJSH 3GO1L 5A2IH 4DFIA 2NTFB 1X7QA 3OKLB 2VN4A 5GS1A 5HHXH 3TBSA 5E8NA 1FN4A 3LRSB 2BNUB 5DHXB 3PQYE 1BZQK 2PYEA 2VZVA 4GMSH 4LCCC 1YQVH 4NQEA 5CJOH 4ODVH 3B9EA 3O4LA 3MNVA 4Q97A 2UUDK 4XCCL 5DT1L 1EXUA 1NGZB 2HT3C 2VQ1B 3ME0A 1MH5A 4PRHB 3U9PL 1JGUH 4D0BB 3B9KC 1AP2B 4XVTH 2DJUA 3IJHA 5KSUA 4U31A 2DQGL 4DVRH 1I1FA 3RWGA 5C70A 3U0PB 3T2NH 1UT9A 3ABZA 3VXTB 1RUML 4IDLA 4RCAA 5FYJE 4PJDF 4RGMB 3GBNH 3O6ML 5D5ME 5J56B 1UEYA 2KZ1B 4MX7A 4UB0H 1PYWB 3NCCB 4LCIL 2VDNH 4DUWA 1BBJB 4WI7A 2AJSL 2ZP0T 3BMWA 2W9EL 3MUGA 3O2DA 5F1NA 3QUYB 5DDHA 1KC5L 3GSNH 3K4ZA 1EJ6A 1IC4L 1UB5A 5K93A 2EYSA 1CXKA 3WFZA 3QCVL 2IEPA 5CJXA 2A83A 2XY1A 4FXGB 4GG6B 1WITA 3FB5B 3H9HA 3KYAA 4CVZB 4HWBA 4QTHB 5F3HB 1CLZL 5DUPL 3ARZA 1X9QA 2R1YA 3ZKMD 5DJZB 3QO0A 4PYHA 1GCFA 4I3SH 4Y4HD 5KVFH 4UBDD 5ALBH 3UCRA 2DQJH 4MZ3A 5IVXF 1RVFH 3IDXH 2R0LH 4XPBH 3VG0L 3QXAA 1SVZA 3BQUC 4OCYL 3VRJB 2W91A 2XKNA 3UZQA 1OB1A 1UM5H 4XPGL 1OTTC 4NO5B 43C9B 2WUBH 1IC7H 4NHCL 4W6YB 2V6HA 3FO2A 3QH3B 2DBLH 2NX5D 4MAYC 3TH3T 1A9BB 1K2DB 3BN3B 3TJHC 2BXYA 1ZVHA 3TJEH 2EH8H 1J8HA 1L6XA 1OGTA 4H8WL 4TQEH 4WIQA 1NKOA 4HKBB 3OKMA 4LSUL 3LN5B 3HMXH 5D1ZB 5EUKA 3B6SA 4GW1A 4NQCA 3IXTB 3ES6A 5DMKA 4YLQT 4QTIH 5HVFB 1B88A 3NVQA 3PP3K 2GTZB 3VXSD 3INUH 4PJ5B 4OUOA 3ZYOA 3MNZB 1QPPA 4KROD 2AJ3B 2B1AH 2NW3B 4X80H 2CLVB 2X4NB 2H2PC 3UYRH 4Y5VA 1U93B 2VN7A 3CX5J 1I9IL 4O58H 3C60A 2MCG1 5T1LD 3VD9A 1HQ4A 3PL6C 3MV9E 3ZDZF 4BK4A 1G7LA 1JP5A 1KGCE 4E41D 2D03H 3WFDL 3S98A 1KIPB 4AH2B 1G6RL 4LVNC 4GXUN 1OQOA 2GK0A 5EH1A 2WLZA 1EGJL 5AYUH 1YPZA 5A2LH 3BRFA 5FHAL 3QB7C 2GUOA 2XZQL 5F7EH 2BP3A 2L0DA 4XPFH 4H0IA 4NUGL 1HZHL 1I85C 3F7VB 3WUWB 4AL8H 4F7CA 5C9JB 1T7WA 3D0VB 1L6ZA 2VABA 3EO9H 5CUSH 4Z7UB 4LCCA 4Z7NE 4O00A 4KQ3L 4OLVL 1YNKH 5EFIA 4PRIE 4OB5H 4E5XA 1S9XA 4KMTH 4XPTL 2ED7A 3BP6B 3RPKA 3TPKA 4HS8L 3JV4B 2MQCA 4P3CH 1F3JA 3U1SH 43CAB 1CXEA 1QRNE 4K7FA 4PRDA 1CE1L 5JORA 1S7XB 4XAWL 3T1FA 1NSNL 2HTLD 5ENWB 2YD6A 3J7HA 1ACYL 3OR6B 2ZOLA 4JR9L 4XPAL 1GGBH 4A6YH 4KQ4H 3FQTB 4KTDH 4N0FA 5E6YA 1BJ1J 2OR8A 5JA9A 2YPLB 1ZEAL 1DN0B 1FG2A 1UH2A 5HGHB 1CFBA 2V5MA 5E6ID 3OKDB 3QCTL 5IKCA 3IFNH 2HLFD 2HJKB 4U1JA 3W11D 2XICA 3CJJA 3TFKC 1QRKA 1JGEB 3EDFA 3D39E 1J18A 2Q8BL 3IFPA 5D1QD 4GKSA 1OHQA 3WHXB 5DC4B 4FABH 5CMAB 5EDXA 1MLCA 3Q2CA 2N1KA 1CU4H 5GRJH 3EIFA 3DMMC 3FQNB 4S1QL 4OQTA 5I1CL 4N8PA 2DQHH 3QUZC 3P4MA 4ZS6D 3ECBB 2YR3A 15C8L 1Q38A 3CFEB 4FOMA 1KCRL 4N1CA 4D8PA 1AGBA 4PBXA 3BQUA 3T2QA 3KJ6H 3L7FB 3UYPA 2Z93B 4HPYL 4WW1B 1HSAA 5HHNA 3B9DA 4MAYA 3PGCB 4FFWD 2F5AL 2PR4H 1S3KL 3MZTA 2OP4L 5BQ7A 3M45A 5JXED 4N0CC 3SDCB 1XIWD 5GRXG 3KG5A 5DJYB 1MCBA 5C86A 7CGTA 1J0KA 3VRLF 4PJGB 5E9DD 4G8GE 4PJIA 1IAOB 3TYGH 3E6FA 1A1OB 5DMJB 5SWZE 2IFFL 3BP7A 1AKJB 5EOCH 1YY9D 2VLME 1WTGT 2FBOJ 1AJ7H 2IANB 1Y6KR 3PDOA 5MENE 2BHUA 4DGYH 1K4DA 1HHGA 3PGFH 3KWWB 3JWOH 1OARH 4H20L 1MVUB 4QHMA 5ISZE 3MGAA 3QQ3B 5LAXB 1IGJA 1U2HA 4ZAKC 1CT8A 3PV6B 3IYLW 4G9FA 2FYYB 2HT4C 4NJAL 1MNUL 1MEXL 3PL6A 1F02I 1G9MH 3HI5H 2P5WE 3W9EB 1SJEA 4K23H 1FBIL 1CDHA 4NFDA 2Z91A 4DQOL 3G5XB 4ELME 1T0MA 3IU3A 3KNBA 1HEZB 1JF5A 3RHWF 2J8UB 1I85A 2BVPA 3MCKA 4L4VE 1S9VB 4N8CH 4YFLF 2E6QA 3S37X 1FNGA 3H42L 1Y6MR 2P45B 4UQ2B 5FK9A 3FO9B 4D2NA 2BVQB 4ORGA 4G6FD 3EOBB 2A6KB 3QUYD 2HJFA 5L7XH 4MAUH 1DBKH 1EEZA 3NIGF 3QWOB 3FO1B 1H3UA 2KL6A 4OZIE 5CIPB 3EYQC 3GSWB 2CRZA 1A6WL 1CR9H 3BX7C 2XZAH 2AK4E 3EBAA 3I3BA 3RQ3A 4M6OH 4L3CA 1K8DB 1T7YA 2BNRE 1PG7X 3EDJA 3QBTB 4HUKB 3MXVH 1MJUL 3N1PC 1PEZA 1PG7W 1WBYA 1U95B 5IW3A 3GRWA 2AEPH 2QQNH 3HC4H 1CLOL 1KIRB 4F7PB 5E2JA 3MNWB 4KHTL 2QHRL 5ANME 3OJMB 3S6CA 1IT9L 4JG0H 1BD2E 4JPVH 1T03L 5HHQA 1UA6L 3PWUA 1S7QA 3FN0L 4NPYB 1I8MB 3WYRA 3PQYA 2FH6A 3GHBH 4XXCC 3UTSE 3MCLH 5E2TH 4F37K 1FYTE 3DMMA 2O5YL 2CPCA 3VMPA 1LE9A 3QUZA 4YO0A 3JWDH 3NCJL 4OCSH 3F6IA 4PS4L 1LDPL 1J1XH 3MBXH 1I1CA 4QRPB 4YE4H 4OZFG 3T4AB 2EE9A 1KLGA 2YWYA 4NRXA 5F96H 1R5VB 2C4XA 5MEOA 3MX0A 5IMMB 1FZKB 3D1MC 3N9GH 1IQDB 1DBML 3VXOA 2YKLL 4B41A 2L7UA 4PJ5D 4JDZB 5B38A 1MFEL 5D5MA 5I6XB 3AAZB 3NCEB 1FLRH 2Q1EA 2VXUH 1BVLB 1LD9B 3QPXH 1NCUA 5EC1A 1SBBA 4ZPTB 5EUOF 3TH4T 3GM8A 3U48A 3BYTA 1RSFA 2CMRL 1IFHL 2KBGA 5DVOA 3O2DH 1MCWW 3S34L 5A3IC 1W8NA 3QUXB 4JRWA 3TESA 1I3RA 4I2XE 5HYSA 3I50L 4U6XA 2XT1B 4I4WB 1LO3H 3ARQA 3WLWC 1KT2A 3ISWA 4HWBH 1UH4A 1NGXA 1F4YH 4LLVB 1JPFA 4JO2H 4PJEF 2QV2A 1LK3L 2YRPA 4X9BA 4UV7H 2FSEB 4WI8A 4ZAKA 5DTFB 2FLBT 2ENSA 3MYJB 1UKSA 4I0PC 1M1SA 1YEFH 4JRYD 5TQ0L 3NMEA 5KS9F 1TIUA 2HA1A 1V5JA 3QQ9C 1A6ZB 3BKYL 2AKRA 2BVOA 3RX7A 3GSNB 5KSBF 4EQ2A 5K9QG 4JZJC 1N2RB 3FONA 1E4JA 1C1EL 5LCVL 1X5AA 3FFDB 1S5HB 3X3GH 5DJXB 2DRUA 3A6CL 2YPLD 4F15C 4Q9QL 2FECI 3AY4C 4HH9A 1ETZB 2WNGA 3NCYP 2B1HL 3QDJB 5HBBA 1FSKC 4ZO6A 4YDLB 2FR4B 1VGEH 3RBGA 5SX4H 4WFED 1FQ9C 2P47B 2ZKHL 1LMKA 4EXPX 3DVNA 1CLCA 4LGPB 1I8IB 1HXMA 1KYOK 1SJXA 3MV9A 4PGEA 1QEWA 2FD6H 2YEZA 1JNHB 5SX5H 1ZWIA 4DN3L 4OD3H 1R24A 5F97E 2OTUB 4P2QB 1NLBL 1IGYA 2IADB 3PHQB 1OWWA 3ZHLA 4ZUTA 1K4CB 4XH2A 3ZO0A 4XXCA 3CFKA 4PRIA 3TCLB 3HMWH 4P5MB 1ZGLM 1I1AC 5C6PB 4JFOB 3IDMB 4KUZL 5J9PA 1WIPA 4LRIC 3H3PH 4FQIL 1QRNA 3M17B 3QFJE 5JW4M 1ZTXL 4NQUA 4Z5RA 4Z7WE 4NC2B 4NZTL 1AKJD 2HN7A 3RVXD 3SGDI 1XR9B 4LKXB 1U8LA 2IAND 2MWCA 4LIQL 3U46B 2EDTA 1VEPA 4JFFE 4OJFH 2ICWA 3EOAB 5IK3A 4PJHB 5IHZA 2DI9A 3VFTB 1QKZH 3WHE0 2ORBH 2VXVH 2ATPA 3D39A 4F58H 4HJ0D 5F9AC 3IGAA 4PGDB 4Y4FB 1N8ZA 1A7NL 5IF0A 4PV8B 5TDOA 1CIUA 2ITCA 4MA7H 4BSVB 4WFHD 3RTQB 4OQTH 3ZYZA 1IGCL 3RZCB 4G3YL 4GKNB 3FQWA 4OD1H 4FMKA 3C8HA 3GMMB 1AFVL 3VCLB 4G8FA 3F58H 1T66D 3P0YL 5I8KH 1ZHNB 4KY1H 3KHOA 3WFCL 4HPOL 4ZG1A 4L8CA 4Q2ZB 4ZS7H 3QDME 4HIJA 4GG6F 3O3EA 4I0PA 1NCWL 5J8OA 5CWSB 1P6FA 3OX8A 5I19H 2VUYA 1OM3L 4JQIH 1FDLH 2CQVA 2EDRA 1SHMA 3IRZA 2P8MB 4JZJA 5L2KD 4P48A 1PX4A 5HYQA 1FZOB 4CADB 5EU7E 1G7JB 5IFJB 2QJDA 4YDJA 4WDIB 1U91B 4HKZB 3P73A 4Z95L 3TO4B 2J8OA 4G8GA 1HHIA 1ZLUK 5SWZA 1YQ2A 3AY4A 3MUZ1 1H3VA 2DLTA 4LCWE 1MFAL 3B2UC 3KJ4C 5ADPH 5MENA 1A4JA 4ZUSB 3B3IB 1WIOA 4K71B 3RNKB 1S9YB 5F1KC 4LLMB 2WWKO 5ISZA 4POYA 1QO3B 1CFQA 3VI4E 2AS5M 3MUY1 3CNKA 4ODTL 3RL2A 3ULUF 4K9EL 3L5HA 1F3DH 4OLUL 1ROWA 2VR4A 1V7MH 4F37F 3IFOA 2WBKA 3OPZH 1Z9SA 4HF5L 1CICD 4XPHL 3OKEB 2VRAA 4NDMB 4QRPD 2P5WA 1CYGA 2EYRA 5DZOA 4X7SH 4U1SA 4AM0A 3K74B 1VKXB 3S37H 5T3ZD 2UZIL 2LU4A 4EN3B 2W65B 3P9LA 3CZFA 2I60H 3TA3C 3EOYG 1HHHB 1QD0A 2LE9A 2ZCLL 3V5DA 4YDVB 1KPUB 3IDGB 3V6OE 1YECL 3VFSB 1H5BC 4KI5F 4ELMA 4P2CG 4GG8A 4L4VA 3TH2T 4RSVA 1DR9A 3MR9A 4ZD3H 4LIQE 2RFXB 4HW6A 4OCLC 4K3DL 3DRTB 4YIQA 1FZMB 2ADGB 4XVUC 3MLZH 1PG7H 5KN5A 2YZ8A 3ARGB 4DKFL 2YD1A 1I1AA 4ZPVA 3DV4B 4M7KH 3NA9L 3V6FB 4OZIA 1ZVYA 5FO7A 4LRIA 2IQ9L 3QUXD 4XAKE 2Y6SD 4KC3B 2AK4A 1I1YA 2BNQD 1YC8A 5L0QC 4O02H 2HG5A 3ZTJH 2BNRA 2F5BL 3P30L 4Z7UF 1U8PB 4OCRL 5D7SH 4Q6YA 4XWGH 3MROB 1F42A 1A6TB 2HWZL 1NGYB 5E56A 3BPCA 4JKWA 5ANMA 4TSBH 2NY4D 2WAHA 1VPOH 5T3XD 4JRXE 2E9BA 4JO3H 3S8WA 5IHUL 1BD2A 4OV5B 2WANA 2VDRH 5D93B 5DQ9A 4BFIA 4TUOB 3MLUL 3U79A 1A14L 4Y19B 3PNWA 4XCEB 3V52H 5F9JB 3UTSA 1I8KA 5T33L 3DROB 1FYTA 3L3DA 3B9AA 2IPUG 1AIFB 1D5ZB 1T6WA 3B5HA 1QFOA 3NAAH 1F4XL 5TFSH 3UZVB 1Z9MA 3CGTA 4FFZH 3LHPH 5HGBB 3V5KA 2Q76A 1WCBA 3QDJD 3RBSA 4XNXL 4YBLB 4PGCA 1VFBA 1YMHA 3VDBA 2AV1A 2HFEA 4LSQL 3A6BL 1NPUA 5AG8A 4WGVB 5B4MC 5FYJH 2VZSA 2DQFB 5EOQL 4K94H 3EZ8A 1IBGL 4CNIA 2UWEE 4BH7A 4JN1L 3JZ7A 2HT2D 1K3ZA 3QJHB 2YA1A 3L5WB 3V8OA 4PUBL 1U3HC 1N5YH 2C3VA 1SYSA 3UJIH 4HH8A 1WT5C 4I2XA 1KUMA 3FFCE 3LPGA 2HRPH 2JIXA 1MFCH 3RWIA 2DL2A 3BJ91 4HWZA 2X44D 4P2QD 4P23C 2OLDA 1ZANH 3WIIL 2XZZA 1DL7L 3DO7A 1CG9A 4NM4H 1O0VA 1RZKC 5FAAA 1TJGH 3NACH 4PJGF 5I1EH 1EERB 2OL3L 5KSUB 3TNMA 5C0IA 4D0DA 2VL5B 3LQAL 3BH8B 3GJEB 1XCTA 1D3CA 4WJ5B 5GZOD 2OX5A 3FZUD 3QEQD 3ZL4L 5JLZA 4H5SA 5EOTB 2RCSH 1IAKB 1A9EA 2DDQH 4HS6A 3SGJC 4M1GH 5F1NB 3OJ2C 5EU7C 5C3TA 5HGDA 4LNRB 2D31B 1H5BA 3W82A 1UB5B 2VISB 5I16A 5IB1B 2EKSA 1RUKH 2XA3A 5DJ8B 3BWUC 4ZFOB 5E4EC 2XZCL 3O2VH 5TDPB 5JR1H 1Q9OA 3H9HB 4Y4KB 3UPRA 5GGRA 2VR9A 4HWEH 2YPVH 3N85H 5DFVC 2XTLA 1XGQB 4ERSH 1JNNH 1GOGA 4Y4FD 2J8UF 1CS6A 3QXAB 5JW4Q 3S4SA 4XVJL 2X05A 1NCBH 4KPHH 4YFEA 1T2QL 3KYKH 1OB1B 4Z0BL 3RTQD 2J88L 3RZCD 2C1OB 3U9PH 2NCMA 2D7TL 4KK6D 4QOKD 1RAMA 4IRJC 1V8HA 3V6OC 3ULVH 1OGTB 4NRZB 5ICYB 5IR1A 2DQGH 3RWJA 4PLJC 5EUKB 3B6SB 3IFLL 4NQCB 1E0OB 4XP6L 1T1YA 1WEJH 3ES6B 4QRRD 5KSAD 2YXFA 3DUSA 2P44B 3PWNA 2NY6B 4PY8I 2PXYC 4X5LA 4XCFL 3PXJA 3QFJA 4HHAA 4ZDHB 4PJBE 4Z7WA 2NY3D 4Y5VB 4RZCB 5GRUH 1TZGH 1FFPB 2WLYA 3WN5C 1RIHL 1MCWM 4KJQC 2E9IA 3QUML 2R2EA 4FQPA 1DBBL 4HJGA 1RULL 1H3PL 3WFEL 1MJ7L 4M3JA 3ZYJA 4M6NH 4JFFA 3A67H 4QYOB 4WUUB 1ZMYA 2GUOB 3EYSH 5JZ7D 3DECA 4NNPH 3L5JA 4YHML 1ED3A 3SE9L 5D6CA 3TT3H 1U3HA 4IMLA 3OJVC 3U2SA 4PRPE 3JV5A 5JOFA 1WT5A 3V7MA 5EU5A 1M6OA 1Z0MA 1I1RA 3GI9H 5EFIB 3LSOB 4XBPB 1B0GA 4OLXH 4YNYB 4X4ME 3TLRA 4P23A 4M7LH 3BZFA 4ZXBB 5ABDE 4NO0B 4K7FB 4PRDB 5EORL 3P2TA 3B9KB 4FZ8H 3RZWA 2D7NA 3KR3H 2OTPA 3RWDA 5JHDE 2ZOLB 3ILQC 4XP5H 1K5NA 4N90E 4OLWL 4MQXC 5I9QC 3CCHB 1KIQB 4N9OB 1T1WA 2WWMC 4ZFZA 2VB5A 4MJ4A 2F19L 1TTUA 3SGJA 3HPJA 4K9EC 5GGRY 5IKCB 2WWKT 3BYYA 2HLAB 4L5FL 5TH2B 2R0WH 2YC1A 3AB0B 5BVJA 4MNQB 3ZT7A 5IFHL 5IEHB 1T3FA 4NOFA 4S2SB 3K0WA 2NXYD 1U8NB 3FN9A 3LD8B 4W6WB 1UACH 5DJDA 4NNYA 4P5KA 1F58L 4DZ8B 3W5MA 2IPTL 4KVCL 3MRPA 1FRGH 3QIBD 5HI5C 1N0XH 2XZQH 3WIFB 3DXAE 1CK0H 2NZ9D 4MWFB 2X4SB 4Y19D 3WSQL 4ALAL 1BLNA 5GRVL 2Z92A 4X7TA 5DMIH 3BQUB 5DK0A 1QFWH 5F6HJ 3NFNB 5EBMA 5I1JH 4LRNH 5LQBL 5BOZG 4ZO8A 1XCQB 1WAAF 4KQ3H 3QQNA 2J12B 4OM1H 4RMTA 3HR5B 4HEME 1ITBB 3DETD 1GGIL 4MAYB 2KKQA 4IRJA 3DX7A 3V6OA 3FOLA 2LAAA 1II4E 3GJFH 2XI9A 3LS4L 4F7MB 3T0BA 1NFIB 4ONFH 4WHYH 4OGAC 4PJIB 4MJIB 1YMME 1ZA3A 3E6FB 3MRLA 5JO5B 3MLVH 1L7TL 3BP7B 3VRIB 4NGHH 3MOBL 1ZEAH 3IU4H 1JHLH 4LHUB 4ONHA 1EV2E 3EZJB 1GHFL 3HPLB 1XGTA 2PXYA 3MV7B 5HDBF 4LARL 5DK2B 4F3FB 4KVNL 1UCBL 2E7MA 1OPGL 4FQCH 5TQ2H 4XZUA 3SN6N 3WN5A 4G8EB 1ZHLA 3TVMC 3HTLX 4GH7B 1WISA 1CD1A 4N1HB 4PJ9D 5DGQA 5J12B 2NNAB 4CMMA 1TPXC 1MAMH 4LVNB 1MCCA 1ZS8A 1IGML 1SJEB 2APXA 1YNTB 4OM0H 1UWXH 2W60A 4JRXA 4DOHB 1CXHA 3AGVA 4CMHC 5C0AB 1NAKH 2R2BB 1T7VA 1ND0B 1Z3GL 1TZIB 3IU3B 3RVVC 2DL9A 4HFWA 2VLJB 5CZVH 4JDTH 1BGXL 2GT9A 3QIUC 1FNGB 3V6BR 5FK9B 4R4FL 1CDJA 4YBHA 1KN2H 4QRSB 4GBXD 3MLYH 4MA8H 3O0RH 3FRUA 4PJHF 4PFEA 5C7XH 3IDNA 4X5WA 3EJJX 4XXDB 4LF3B 5ACLA 4MCZB 3RWEA 3HRZA 4Y4KD 3IT8D 3HZKA 5ACMA 1KJMA 1LP9B 3C08L 3OAYH 2AXGB 3D85A 2FATL 4JREC 3I02A 4L3EE 3FHQA 3PWVB 5EN2B 2Z8SA 2M1KA 4MQ7A 2UWEA 3JUYA 1IGFL 1D6VH 5LBSH 1R0AL 4RMRA 3LKRA 2KQNA 3NPSC 1WZ1L 4MDJA 5HHQB 5L88L 2YSSB 2P5EB 3GB7A 4JY5L 3V4UH 2VDMH 1RQ5A 4WO4C 5TF1L 2F74B 1MEXH 3FFCA 1DN2A 3QHTC 4GW5B 1C08B 3QI9D 1EHLH 2NY2C 5I76B 1YEJL 3DMMB 2R29L 5HYJE 1OTSC 1LE9B 5IVOA 4YUEH 5TDNA 1BQHA 3G9AB 3ILPB 4JG1L 3U6RA 4GRLB 5E03A 4NRXB 1YUHA 2AXFA 3CMGA 1VHPA 2APFA 1KFAL 4GSDL 4WI6A 4XP4L 3P11H 1VGKA 2H32B 1VB9A 3G5VA 5GGTL 3ARDB 5E00B 1C7SA 3OQ3B 3P9MB 4WU7B 4BZ2H 5IQ7H 5L2JA 4XCYA 5SX5K 4YXHL 4AEEA 1AQKH 3GEWB 2BSRA 2Q7YB 4AEIH 3CSBA 4HBQA 5I17A 1LE5A 3MJ9A 1FZJB 4HD9A 5MHSD 2EXYC 4GLRI 5EZOL 1WIUA 2CIKB 4HMDA 1N6QH 1H9VA 2YMXL 2ESVD 3SKNB 2JB5L 1G0YR 4NYLB 1NL0H 5DJ2B 4LVOB 1FNHA 1P7HL 1JPFB 2IG2H 3ZYIA 1FAIL 1YNLL 5FA4A 4UILH 5DD6B 5T1DL 4Y2DB 1FYHB 4YX2H 3D3VE 4NQXB 4ZAKB 2P49B 4R2GC 3REVB 1Y18A 1OP5H 2V2WA 3UJJL 4V1DE 3TVMA 3HI1A 5FM5O 3PXHA 1EO8H 1NAML 3D9AH 2CK0H 3WO4C 5DQDL 2V7HA 2NZIA 4ZXBD 4NO0D 2B0SH 5DD1H 2X4UA 2AKRB 1RU9L 1LO0H 3AXLA 1U8OB 2C4FT 3EAKA 1NC2B 4LDOB 3ARRA 1KG0A 4OGXH 3GKWL 2NMSA 1JPGA 3UXFA 1DUZB 4KI1A 4AMKL 1BZ9A 4P49A 3WD5H 4XCNA 4D3CH 1XFPA 1UVQA 4QRQA 5KZCD 1LO4H 3QIUA 4HH9B 8CGTA 1G7MA 1KEMH 4XP9H 3LB6D 4EBQL 4MNQD 4IHOA 4PRBA 1JYXA 2G5BA 1BM3L 5FM5M 3Q5OA 3DVNB 4PJBA 2VLRE 3MA9H 1BWWA 3OG6B 4EZMA 4GAGL 1KN4L 1X5ZA 1HXMB 2WIIA 5SWQA 2AV7A 4YXLH 2R69L 1XGYL 3B4NA 3L3HB 1MSPA 2RGSA 3UPCA 2V5YA 5E2WH 1BEYH 4ODWA 2VERN 1I3VA 2HKFL 5CEYA 2R4RL 3O6FC 3SGEH 3EUUA 4BFGA 4GUPB 3LKSA 3U30C 1FGNL 3GIVA 4U3CA 4U6YA 3BSZL 1LK3H 2VMFA 1HHJA 5GIRB 5FYKD 4PRPA 4RIRA 3VD5A 1IGYB 3B2VL 3QG6A 4FQXC 4JO1H 1EEQA 4WO4A 3RKDC 4I0KA 1QVOA 1NMBL 5FYLL 3CFKB 4PRIB 1JZ7A 4TVSa 1AD0A 4X4MA 5DRZA 2AERT 1OAQH 3DGCR 3V5HB 4DGIH 3QWRA 4G6JH 1I7RB 3CMOH 4MJID 3ARFD 4Z5RB 3ARTA 1RZKH 3O3BB 5CSGA 3BDBA 5JHDA 4Q9QH 4CJ0A 4E42B 4W81A 5I1HL 4HBCH 4LHUD 1U8LB 1XGPA 5DI8A 3FO0L 3NOIA 3A0OA 1S5IH 3MV7D 2XRAL 5C0CE 1ZT1A 4IEFB 4MVBD 3OV6A 3W5NA 2ICWB 3DRQA 1CGSH 2VNCA 4G7VL 3R8BB 2YD7A 2X70A 3S3SA 1PBYA 2FNBA 3WS3B 5DZLA 4J23A 1TCRA 1N8ZB 2EDOA 1T22B 2X1WL 5TDOB 5C0AD 1YEIH 4Q0XL 1IKFH 2ITCB 3VRLE 4UINL 1P6AB 1VACB 1BJ1H 4XBGA 3RWHA 1JWMA 3V4PH 4AEFA 3ARSA 3DXAA 3P4NB 4B7LA 3EGSA 2VLJD 4P3DA 1J1OL 3DURA 3E6HA 4HLZH 4P57B 3UDWC 4RMWA 3VXRD 3T08A 3TBWB 4EDWH 4EI5B 3PJSA 1A7OL 1G1YA 3MRMA 3QNZA 4N5EC 4KJYB 1Y6NR 2JJSC 1YYML 2PW2B 1A6VH 2VSDA 5EA0L 1UM4H 1T1ZA 1OGAB 3PWPE 1EEYB 1QSZA 1P4IL 5JHLL 4OTXH 4IMKC 5GSVA 2QEJA 3CLEL 4BKLA 5ICXA 4LASH 4UU9A 1B2WL 5KW9L 5I1DB 2YK1L 3ARBB 4GRMA 5I18H 4G8GB 1G6RB 1YMMA 5EWIH 1P1ZA 1FFQA 3CLFH 1BX2A 3BHBB 1QLRB 1FSKB 1A4JB 1MJJA 2PTTA 4DW2H 1JK8B 3ARED 2P5ED 2PO6C 1FVEB 2HKHL 4O4YH 4ELKA 2MJWA 5C0BD 1N64L 3JWNC 5IIEB 1DDHA 3HB3D 3NIGE 4MHHI 4HIIB 5FFLA 2BVYA 3VGHA 1NLDL 2LABA 5J3HD 2CLZA 3RA7H 3D69B 4HS3A 1HIML 1UXSA 3JTTA 4TVPD 3GM0A 2P5WB 4RFEB 4J8RA 2CJUL 3MPCA 4U1SB 4PRAB 1A3LL 2VH5L 3QNYB 3P9LB 3CZFB 3R8QA 1FVCA 3O6FA 4TSCL 3VFNA 2EYTA 3V5DB 1HCFX 2IWGA 5GHWL 5CEZD 1CL7I 4GG8B 2F8XC 1ZA6A 2ICEA 2NX5E 4L4VB 4KUCF 4FQXA 1KLUB 4E0RB 5I30H 1DBJH 1T83C 3X3FH 3VU2A 1FVDB 4X8XA 4P4RA 1I1AB 4TULH 2COQA 4ODUB 5FO7B 2W0LA 1JNJA 1F8TH 4UT7L 3I9GH 2KUTA 1R5IA 4EJ1C 3DVGB 3BE1L 3QUKB 1CLYH 3VXSE 3UTQA 3I2CH 3MJ8A 5C09B 1A7RH 3ELAT 1GGYA 2HFFA 1QOKA 4L3EA 4TNVK 5C08B 2B5IC 3BPCB 3DTXA 5DHVA 4D0CA 3GMQA 5BS0B 4PJDA 3KLHD 1JI2A 4XHJC 4MXVE 4NQSB 3HC3H 2FJGA 2VQUA 3UTZB 4E41E 1GXEA 4ODTH 1NJ9B 4OFVA 1U8JA 32C2A 4K9EH 5EUOE 1OAZL 3KPMA 2Z9TA 4KRPC 2VIRB 1V3JA 3UTSB 3VJ6A 4BH8A 3T65A 4OSUH 3KS0J 4N8VA 1QLEH 1NC2D 5HYJA 1DUYA 3LS5L 3D0LA 5IVZB 1UWGL 1P4LB 3UBXA 3ZE1F 3DX8A 2FHFA 1YEHL 4WTXA 5E0QA 3V5KB 4I0CC 5EG6C 1W0WB 3EFDH 4L9LB 3UDWA 2EE6A 1VFBB 3M07A 4JZOA 2AV1B 3D2UA 4JN2B 2DI7A 5HD8C 2AQ3A 2JJSA 2A9ML 2ARJQ 1U9KA 3MRCA 4R0LC 12E8H 1AI1H 4QF1A 4BH7B 2IQ9H 1CIDA 1M7IA 4MA3B 1QQDA 4FG6D 4IMKA 1MI5B 2F5BH 2C3VB 3HNVH 2CH8A 3MJ9H 3HLAB 4LU5L 4K7PL 3VFMB 4CVWA 4OUUB 1KELH 1G7HA 2BSTA 1Q72H 2JJTC 2PO6A 4MB5A 1I9JH 1CG9B 1RZIA 4OZGB 1PY9A 3D3VA 4ETQA 4P5TC 5DLMH 4L1DA 4PJIF 4V1DA 3P77B 4WUKL 3BP5B 1XCTB 4KAQL 4PJ7B 3T1WA 4X0KB 2OCFD 2VJXA 3CH8A 4H5SB 1IGMH 1A9EB 1MFBL 5EO9A 3H7BA 1YYLL 3RX8A 3T04D 3RI5K 3TA3B 3TBTB 5JA8B 4EUPA 3IVKA 1LEGA 5HGDB 3STZA 1H5BB 3EYUL 5ELIA 3HNTH 4HMCA 2WBJD 1IE5A 4ENED 4X8JA 4ZQKB 1FJ1A 3IAPA 5DD0L 1GPOL 2ZNXA 3MLTB 4LQ1A 3HFML 1T83A 3JSSA 2I27N 4JY6B 4HEPG 1JF1B 3ZE0F 1EVTC 5E9DE 5GSRA 4WHTA 2EH7L 2VLRA 4X6BB 3ZKMC 3C8DA 3ESVF 3S4SB 3OF6A 5ACZA 4Y4HC 3AS0A 4UBDC 3BDYH 5CINL 4ZFGH 1DE4A 3AS3A 3BIKA 3LDBB 1RJLA 4LCYA 1R3JA 5CSBA 4M61A 2CDGA 4MGXA 1HILA 4DWHA 5IB2A 5T1MA 1AXTH 2XXMB 3CFDA 1D5IL 4P99A 4MJ2A 4EIGB 4RRPA 1IM9A 3FTGA 1KBGL 5IR1B 1X4XA 1JPST 1RZ7L 3O2WL 1LP9F 3EOTL 3E2HC 35C8H 2HJLA 4N0YH 5EZIL 1DFBL 1OGAD 1Z5LB 4U1GC 3NGBC 1T1YB 4GMTL 2AXHA 1MQKL 3ALWA 2VC2L 4M7JL 5C0RH 4CJ1A 2F53A 4Q6IB 4AEHH 3CXDL 3TN0B 1P5UA 2ZJSL 1FNFA 2D3VA 1UWEL 3ARBD 3S35X 2BXZA 4KROC 5INDA 2H45A 4R7NA 4YXKH 1RIVH 3WMSA 4HUXA 1LNUB 1KNOB 3KXFD 4XNZC 3WNOA 3W2DH 1U3JA 3DBXA 4HJGB 4KKBD 1S9WB 2DJ4A 4GG6E 4NN6B 1U8IA 5C0CA 1BVKA 2A9NL 2AJUL 4JFDB 4G5ZH 4R0LA 1NBVH 5D7IB 1OD7A 3BKJH 4CW1A 3TV3H 4YHIA 4PG2C 5C0FA 5C0DB 3NZHL 1DQQA 1FGVH 1AGCA 2P7TA 1V3MA 1JTPA 3E0GA 1M6OB 5IB5A 4LCUB 1P7QB 3D48R 3IDYC 4Y5YC 3KLDA 1N4XL 2J4WH 3SDYH 3QO1A 4P23B 5JIIA 2JJTA 3F65A 4MD4B 4K2UH 2E7BA 5C2UB 3O9WB 1MFDH 4P5TA 1MRFL 3QDMB 3RNQB 1R5WA 1SEBA 3RWDB 3EYFB 1BQSA 5DUBB 4UOJA 5CJQL 4U0QB 4XC3H 1DZBA 3MLRL 1K5NB 3TBVB 5I0ZA 1XMWA 2ITDA 2Y9RT 3FCTB 3M8OL 3PWPA 3DX9A 1UWXK 2GI7A 4PJ5E 2YBRA 3MGTA 4IJ3C 5C09D 5HI4D 1HXYA 5IBLD 2BERA 3RL1A 2I9LA 1N59A 2X5PA 1DQLH 3BEVB 4I3RH 4TNVF 5C08D 3U4AA 4L3AA 5CCKH 4TSAL 3W11C 5BS0D 2JELH 5DEFA 5E4EB 2GSIA 1FL6A 4LCWB 2QQLL 4QHNA 2BVUA 5JDSB 5D1QC 2JTDA 1A8JH 4YWGL 2AABH 3BPNC 4M62L 4UDTB 5FHBL 3QEGL 1F6FB 1MPAH 4UIMA 1W0VA 5FOBA 2RB8A 1JGVL 1LO5A 3QA3A 4ZS6C 2M2DA 2B8OT 4UOW0 2VXSH 5I8CA 5EU3B 4Y4HA 3GMOB 4RDQG 4UI2A 5EBMB 4JFQA 1U58B 1A6UH 4Z7UE 5L8KB 5IEKB 4WVRA 2CKBA 3MACH 1G1CA 3MJGX 1H3GA 1T20A 2EC9T 4KKCD 3VGFA 4RGNB 4F57L 5FCUH 5ID1A 2EDQA 3C6LC 5EORH 4TNWK 1IAIM 4AG4H 4FFWC 1RUPH 3MO1B 3HN3A 1QNZL 5K59E 5INCA 3PIQA 1XIWC 1ZA3B 5JXAH 4U6TA 4LP4A 5C6TL 3U4BL 4ONHB 1JHKH 1ADQL 1XZ0B 5E99L 3BGFC 5F1SA 1MI5D 4NZRH 2YPLE 1I3GH 5J0BA 4L5FH 1YY9C 1XGRA 2X6MA 4KK8D 4XZUB 4OFDA 1IILE 3MODH 1G7QB 3RDTB 3VXSA 1ERNA 5MEQA 1XT5A 4WFEE 3D18A 4JFZL 3SY0B 1TJHH 2OJEA 3VD4A 1C8PA 1CD1B 4KHXH 2OYPA 2G60L 3DGGA 3CC5A 4FA8A 3KPNA 4PB0L 4QHUA 3BH9A 4RFOH 5T1LA 1Q9LA 4KVCH 3UTTB 5DHVH 4E41A 1JPTH 4AZ8A 1DSFH 4QHLA 3X14B 4CN4A 5EUOA 3BP4A 4BA8A 2QR0B 2XWTA 4PG2A 1OCWH 2BRRH 3UJTH 5FGSA 4XNUL 5LXGL 4NKDB 2BSED 5D9SA 3HZMA 2Q8AH 5CD3A 5FDWA 5E8EB 4RWYL 2UZYB 4ODHH 5E08L 4RGMC 4QT5B 4Y5YA 1ZGLB 3IAQA 4HIEA 5CJ5A 4HCRL 1YZZA 4R96B 2A38A 3QUYC 1RHHA 1A6PA 4OCWL 2AXJA 3Q6GH 1KTLB 2HVKA 4BQ6A 2VLKB 3HZKB 5FB8B 2IAMB 4HUWB 5JIPA 1U6AL 2AGJH 2A6JA 1CVRA 1IAIL 3HG1B 1M71B 4G80A 3T3PF 5F1OB 4FXKA 5BW7C 1MIMH 1MF2L 2VQTA 3K8KA 3ZTNL 1A1MA 1JRHL 1GHFH 3C2AL 4HGMA 3R1GL 5D7LA 2IANE 1F90L 5BO1L 1O5DT 3OKNA 4OT1H 1F4HA 4DK3A 1RFDL 1P4BH 3VG9B 1IC5L 1MUJA 4HT1H 3QZWG 1CFVL 4AT6B 5LWYH 4FQ1H 3SPVB 3CPLA 3VDCA 2GCYA 3GI8L 2WQ8A 5D1QA 5HXMA 1INDL 2DN7A 5HVGB 1EX0A 4HSQA 3M1BA 4L8SB 2DQCL 5B3NA 1UH3A 4WFHE 1JI1A 3IJSB 1CXFA 4M48H 5D1ZC 4YEFA 1ZT7B 4G7YH 2J8UE 1KPVA 2D0HA 4U33A 3PWJA 3TN0D 3S5LA 5L2JB 4YHOL 2FX7L 4NZDA 5DRWA 1AD9A 5EB9A 2R9HD 2CIIA 4LL9A 1H15A 4P2YA 5J57B 1E6JH 2NY5L 2VDQH 3C6LA 1TETH 4RGOL 5HSFA 5IESH 4EUPH 3ZDYE 4JFED 2I5YH 3CX5K 4OLYL 3U0WL 5E5MB 1A1NA 4TRPL 4JFDD 5L2KE 4NO2A 2UY7A 3PP4H 1NEZG 1XIWA 5BVPL 2DJSA 3DX6B 5F70A 3STLB 2MCPL 4TPRL 5E9DA 4UTAL 1R0AH 4OZFB 1X5IA 5ILTL 2APBA 5FA4B 1WZ1H 2O5XL 3GMPB 1FFNB 5GGSB 5L88H 2NTFA 4WEUD 4ZTPH 3OKLA 5KTEL 1GC1C 5AZ2H 2XQYK 2YA2A 4DTGL 4KZDH 1Y18B 1E6OH 1T21A 3G5YA 3LRSA 3TVMB 2BNUA 3DI3B 2AEQL 4XBEL 4HXBL 3HI6L 4XMKH 3K2UL 2V7HB 2CXKA 4I1NB 5DUML 2ADJB 1QFUH 1TPXB 4N9GB 1NGZA 4JQXC 2VQ1A 4JG1H 3AXLB 5ID0A 1L9NA 1LGVA 4CMHB 1AE6H 3F7QA 4QRPE 4D0BA 3BO8A 4PV9B 3V6ZA 5K9QI 5DYOB 4X6CB 5T3ZE 2EDEA 3RJDA 1BZ9B 3TT1L 4R90L 1WGOA 4OCXH 4QXUL 2BRQA 2GFBB 3V4VL 4OAWA 3S35H 4FQJH 1QSFB 3U0PA 2BY3A 4U7SA 3VXTA 4MB4A 5E6ZA 1G7MB 3HZVA 1JZ4A 5EBLB 2EDHA 5DMGD 3BZ4B 3IKKA 3IDIB 1PYWA 4RISH 4Z0XB 1BBJA 4JE4B 4HKXA 3T0EB 4L4TD 1IMHC 3MOAL 3QUYA 3K1KC 1VSCA 2D7QA 2WIIB 4FXLA 5SWQB 2AV7B 2IC2A 4JEGB 3BAEL 4YHYB 1JGDB 3HNSH 2CSPA 4JQVC 4FXGA 4GG6A 2BNQE 4LSDA 3FB5A 5F3HA 4QTHA 5BW7A 3WIHL 3CVHL 1B4JH 3KPPB 4HIXL 5DJZA 1L7IL 3UYOD 3KLAB 4U6YB 1SMAA 2OL3B 4GQ9H 2YXMA 4LVHB 5D71L 3BPLB 1WV7T 4PRPB 1GGTA 3VRJA 5T3XE 4K3JL 1MCHA 4QXGH 1DQMH 3RIFK 2C5DC 1UJ3B 4NO5A 3V0WH 4RGND 4M6ML 43C9A 4ZUWB 5E4IA 5B21A 1WBXB 3DSNA 3LVEA 2E7LC 5KG9A 4R26L 5D70L 3QH3A 1K2DA 1RUQH 2EDWA 3OGOE 1J0IA 4WCYH 2Y23A 4ZUVA 4B50A 1MCSA 4HKBA 4LHJB 4WTZG 5JHDB 5D1ZA 5KVGH 4NKOB 1MRDL 3H9ZA 1PDKA 3U0TB 5DI8B 2AP2A 1TQCC 5F3BB 5FKPB 1VESA 3WDHA 4X4YA 5C1MB 2MPAH 3RVXC 3QDJE 2BY1A 2GTZA 4PJ5A 2XACC 4OZGF 3MNZA 3SQOL 1L0QA 2AJ3A 2NW3A 1PZUB 3S7GA 2CLVA 2IH1B 1DLFL 2X4NA 3CFBB 3RWCA 3JVGC 2CRMA 1U93A 3RU8L 4AENA 1TCRB 4PJ7F 4NQDD 1CF8L 4HJJL 2BC4B 3TO2B 2LVEA 3UTTD 2PTUA 4HJ0C 2KZWA 4L9DA 3T8XB 1AC6A 1KIPA 3CDCA 4AH2A 4PY8J 4WY7H 1JWMB 3PGDB 3S88H 4P3DB 3DURB 3SE8H 3E6HB 4KWUA 1CD9B 5IM7B 4A2MA 3F7VA 4R2GB 5HDBE 1G9NH 3LKPB 4P2QE 3WUWA 2JKXA 5C9JA 2EC8A 1T66C 4Z7UA 2I26N 3NA4A 4A2LA 4HQQH 4APQD 5JW4N 4D9QD 4JKKA 1MELA 4JQXA 4AYFA 3BP6A 2CKBH 2VLKD 2IAMD 3EHBD 2C3GA 2FEEL 5GSVB 3JV4A 2VITB 3DARA 2C9AA 4S1RL 2V5RA 43CAA 4BKLB 3HG1D 1YEGH 3QUMB 1H8OA 3HE6B 1MCPL 4GRMB 5ENWA 3DYPA 4R4BB 1YMMB 3OR6A 4ZNEE 2DIBA 4MNGE 3FQTA 4LQFL 4HK0B 3BKCH 2YPLA 2OMBA 2PTTB 1DN0A 4FP8H 1EHXA 5HGHA 2AJVH 3ARPA 3OKDA 1NCCL 2HJKA 1DDHB 1K6QH 2Y72A 5E7BA 3AMKA 2N4IA 4R6UA 3JV0A 5GS0D 1JBJA 1CGYA 4WNQB 2YPKB 4JM2B 1WTLA 3WHXA 1BZ7A 2DTSA 1BPVA 4H0GA 2VDOL 4JQVA 5CMAA 4X7EC 4DAGL 2H2SD 3PP3H 1CICC 3L5XH 3HZYA 3ECBA 1FVCB 3O45B 3U7YL 3VFNB 2EYTB 5KVEL 2KPNA 2QSVA 3CFEA 3U30B 4BELD 4JY4B 4NZUL 2ICEB 5LVEA 4K3EL 4QOKE 2OMNA 4FQXB 2H26B 3L7FA 1GZQB 4ZOAA 5FF6B 2Z93A 5I6XC 1OVZA 1CGUA 1FNEB 5CZXD 3CSYB 1S8DB 5D7IF 2E7LA 2OXGA 4Y7MA 4YFDB 2KQMA 3I75B 3PGCA 1EH9A 4S1SH 4NN7B 3TEUA 1FHGA 1OSZB 3MJ8B 3PHOB 3BT2L 3QUXC 1CWVA 1TZHA 3QG7H 1CZ8H 4LVEA 4PJGA 2DLIA 1IAOA 1A1OA 2O5ZH 3N1QC 3NH7L 2R0KL 4P59L 3OZ9L 1AKJA 3VXMB 4D0CB 1FIGH 2FH8A 3HE7B 4BFBD 2IANA 4KMLB 2ED9A 2F58H 4X7DC 4OLEA 4MXQD 4JHZA 1MVUA 3X13B 2QKIA 2NY4C 5FGCB 5BJTB 5T5FH 1OAUH 5T5NG 1MY5A 1CDBA 4U1LA 3KPMB 3PV6A 3JVGA 5KJRH 2R0ZL 1UC6A 3VGAB 2FYYA