2JTDA

Skelemin immunoglobulin c2 like domain 4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
EEEMKRLLALSQEHKFPTVPTKSELAVEILEKGQVRFWMQAEKLSSNAKVSYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDVYKKLQKEAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myomesin-1
publication title Structural insight into the interaction between platelet integrin alphaIIbbeta3 and cytoskeletal protein skelemin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jtdA00
1U6AL 2X4NB 4HIEA 2ITDB 3NH7H 2WZPD 4RFEA 4NZTH 4ZUWB 3LKPA 5B8CC 5ANMA 4GG8B 5B38A 3ZO0A 3QQ3A 3HE6C 4J3WA 3V7AE 4KKBC 2GCYA 5ESQA 1NGPH 4KFZC 2BNRD 2XQYG 4P2RD 3ULVH 3PQYD 2AV1A 3M07A 4F8TA 4OZGE 5F3HA 3DGGA 1NCDL 5IIEA 2BY2A 1FV1A 4XTRD 5IEHB 5EOTB 2GTZB 1EAJA 1RUQH 4MCZA 1DANU 3ARGB 5D1QC 2FJGB 2Z8VC 4LLWA 1MNUL 4CAGA 1D9KA 3DRQA 2X4SB 1A6TA 4DK3A 4UTAH 2EECA 4N0FA 5DEFB 2EEDA 4Z7UE 1XT5A 3RVWC 1DBAH 4NQTA 1QQDB 4LK4A 4OFPA 3S97C 4JDTH 2BXZA 3RDTC 3JVGC 3NTCH 3IS0X 1UJ3A 2AXFB 3RHWF 5FECB 1M71A 1ZTXH 5SX5H 3N1GC 1OSZA 1SEQH 4F7CB 4Q2ZB 2CK2A 4OTXH 3LS4L 3HMXH 4OD3L 3FQNA 2D31A 2EIDA 1NL0L 1MCFA 1QA9B 3HCVB 4FFWC 4YIQB 3MJ9H 3ULVE 4KK6D 3LSOA 3MTRA 5FKAA 3B9KC 1S7WA 5C0NC 2YC1A 1BIHA 2AJSL 4F80A 4BZYA 2BSED 4JFXA 3O9WC 2JCCB 1OGTB 2DM2A 4ZUUA 1P1ZA 1RVFH 2DWEB 1UWXK 3MFGB 3RVUD 4M3JA 3QHFL 4HPOL 4IMKC 2WIIA 1NAML 3FFCE 4F37K 2Z31A 3RWDA 5DK3A 3C08H 3U4AA 3CDYA 4ZOCA 3PHOA 4EDXA 3SDXE 4G9FB 3VXRD 1U42A 3MRDB 1I4FB 5BMFL 1OT2A 4PV8A 5ESVA 3H42L 3SKJL 3VFPA 3MGOA 1XGQB 1F3DJ 4QOKA 3HG1D 3MRGA 2A0LD 4MHHG 3BX7C 4Y5VC 1AHWC 1R3JB 2HVKB 3C6LC 5D1ZC 5B39A 2GW5A 3OAZK 1TVBA 5F6HI 2IMMA 4XNZB 3TIEA 2HLFC 5CSBA 5D5MA 4EVNB 1HINL 4XCYB 1XF5B 3WJLA 4OZIB 2DQEH 1MUJA 4K94H 4UOJA 5AZ2H 4DUWA 2A1WL 3G5ZA 1H3PH 3O3BA 2ADIB 5EO9A 4P57B 1IL1A 4QWWD 1I1AC 3FONB 5TH2B 1N8ZA 1NMAL 1YJDL 3VJ6A 1SBSH 4Z7NF 2J3SA 4G6FB 3BMVA 1I9EA 3SCMD 4OCXH 4APQA 1JF1A 4PJXB 4KRNA 4PJ9D 5MI0B 5E8PB 1ADQA 3QFJA 2HWZL 5T1LB 4HDIB 5IGXL 3JWNC 3SKMB 2L0DA 5KSUA 4I3RH 5K9QI 3BT2L 4DGVL 4WTXA 1U8JB 3NIDF 4P5KB 3Q5OA 1CBVL 2IBGA 1V3MA 5AAMA 3P4NA 4JFEA 5HI3C 5BVPH 1YEKL 1PD6A 3UZVB 1KLFA 5IMOB 3MRKA 1I3VA 5I66B 2D4DA 3EUUA 5C09A 3VGEA 3ZDYE 1FIGH 1XFPA 4FQIH 4YPGA 1WT5C 2C1OA 25C8H 2E5EA 4ZUTA 5GGUB 1G0YR 1LO0L 1A6WL 3MJ6A 4LNVA 2YSSB 3NCFB 3RIAF 3WN5C 1KJ2B 1MHCA 5C0EB 4UDTA 2F74B 1EFXB 5CJBA 1FFNB 2RB8A 2KPNA 3OB0H 5C08E 3INUH 1RZGB 1W2KT 3CLFL 5TDOA 3SE9L 3VFNA 2E6JA 4RIRB 2R0LH 1JN6B 4UMGA 2EYRA 4LVEA 1LP9B 3GO1H 4V1DA 3KPSB 1QOKA 2V5YA 1NEUA 5EU6D 3MZGB 1AKJA 1MFCL 1IARB 1SJVA 1D5ZB 3GBNH 2D03H 5FCSH 3PWUB 1ES0A 1UFUA 1KN2L 3QQ9C 5D2LB 3ZHKA 1S9KC 3MJ8A 5GRJL 3IU4H 1AJ7L 1DQDH 3BE1L 4NJ9H 3VFMA 2PTTB 3VDCA 1NPUA 2C1PB 3MLWL 2J8UE 5FKPB 3BPOC 1F3JA 3PHSA 3AB0B 3BWAB 4FZ8L 5D72H 3PL6D 4LU5L 4PJIA 4OCSL 2VITA 5EIIA 4LRNL 5FYJU 3QG7L 2COQA 5CAYB 2VLRA 4WO4C 1AGEA 4J2XA 4R0LC 3W5NA 1MREL 4Y19D 4WWKD 5IB3B 5CZXC 5ISZB 2NY2D 5DR5L 3I50H 2BVOA 2DIAA 3V4PL 4Y4HB 3IFOA 4WY7H 3LRSB 2FHBA 1QYGL 3IDYC 4G7YH 4I3SL 4FFYL 4JO1H 5I1IL 3QUKB 4YFEA 4R4BA 4XVJL 3WMSA 1B2WH 2WBWB 5D6DA 5C1MB 4HC1L 3T2NH 2FJHA 3A67H 2I9LB 1K3ZA 5FUCE 5C0RH 4OCMC 2YMXH 1SEBA 2BY3A 3C8KB 4RZCB 2AK4D 2IG2L 4LSPH 5C2BH 4OZGA 4YO0A 4JAMA 2QKIB 3P0VH 2OMNA 1K85A 3UBXI 3QJHB 5F96L 4YDJA 2H1PL 1KCVH 2HKFL 1KJMB 4BA8A 4P9HL 2P43B 3EOBB 1A3QA 4F3FB 1QHPA 2VLJB 4M61B 4WI7A 4LSRL 1JTTA 4AM0A 1EJOH 5K9JH 4PJGF 4Z7UA 3K81A 4LQFL 1JMZA 1Z9LA 3DUHA 1NBVL 2CRZA 1FLRL 2NZIA 1JHTA 5GSRA 3QUMA 3ETBF 1MLCA 5HGHA 3IDNA 3DMMB 4FQ1L 1IAKB 4S2SA 3QAZB 4NN5C 4TPRH 1FL3B 3C5ZC 2JJWA 2Q7NA 4YHPB 4CU8A 5DUML 5HYSG 4FFZL 4H88H 5IV2A 4M7LH 3SDAA 3CC5A 3PWLB 2HJFB 1KCUL 1KPUA 4NUJA 4RGOL 1F6FB 2IADA 5T3ZD 3G08A 1R24B 1IAOB 3FO2A 1LD9A 1CFNB 4Z7OF 1J8HB 3B9DA 4NKIH 1SMAA 3GK8L 3GMQB 2QSTA 3UTSD 4HBCL 1ZLVH 4OIIH 5I1AA 1KENH 1YEHH 3MRBB 5DHVA 3QDGE 3IGAB 2WWMC 4HFWA 1DANT 4ONFH 2BSRB 3I6KA 4LLMA 2V2TB 1DUYA 3I75A 4QHNA 1HEZA 4K8RL 2D3VA 4X4YA 3TZVD 1CDJA 3OGCB 3IFPB 3V2AR 3TBVB 2VLMD 5IEKA 4H8WC 2VTFA 4Z95L 4NWUH 2I25N 5GGTL 3EJJX 1MF2H 4ELMA 3FFCA 4HIXL 2B0SL 4OQ1A 4NOBA 5EG6C 5CLWA 4V2CB 1WBZB 1JGEB 1PEZA 4FTVD 4ODVH 1XCQA 3LS5H 3D2UB 3FN3A 2OBGA 3NA9H 4R90H 1T4KA 4JY4A 1I8IA 4JREB 1A02N 4ZS6D 1FZKB 4WI4A 1AXIB 3DUSB 2HTLD 2APVA 1NDGB 4LNRA 1N4XH 4BZ1H 1T04B 4LSVL 4NQVB 1LVEA 3WO3B 4FABL 2WBJB 3U6RA 2VXTL 5ADPL 5HHOE 1OD9A 3SHSA 3EDFA 2P8LA 3RPIA 5E6IC 4U05A 3KLHD 2ZUQC 1FL5B 1U36A 3C5SA 3LPGA 1S7SA 1MCWW 2A9MH 1BM3H 3HMXA 5HHQA 3N1PC 4O2EB 4ZOEA 1PKQB 5FO8B 3RA7H 1QKZL 2YKLH 5ESAB 1RUPH 4F7TA 5MP6L 3MJ9A 2OQJB 3DMMD 3CFBA 3ORJA 3STLA 4I4WB 1G6RB 3QIUA 2APXA 2HFEA 3EFDH 1UM5H 2JK5A 3BZ4B 4TRPH 5E70A 5GGRB 4K8RD 1ZT4A 3TEUA 1LWRA 1ZHNA 4HFUL 3BVNA 2Q7YA 1ZA3A 3EOTH 3GJFK 1BLNA 2DKMA 2W60B 4HX1B 4H5SB 3LMJH 1KJ2H 4XGZA 4Y4KA 1F2XK 3X14B 3GSNH 4KWUA 3FB8A 2HVJB 4TTDC 1JZ3A 2QJDA 4XPFL 1INDH 1EJ6A 5HGAA 5HYJD 5E99L 3CPLB 4JDVB 4PRAB 4R2GC 3GUTB 2EDQA 5GS2H 1RJYA 1D6EB 1S7RB 5IMLA 4R97C 3MRPA 2EYTB 1PZUB 4OIBA 3D18A 2OM5A 1KELL 3T0EC 5DT1H 5GPRA 1HXYB 1VADB 4LLUA 1JWSB 3QO0A 3FO1B 4L4TD 1NFIB 1R5WB 4ISVA 2FB4H 2YD1A 4X4XA 2ARJA 3O4LB 4PBWD 2VDOH 1X5HA 3MXWL 4JFHE 4PJHF 4EIZC 4Z7WB 3ULUH 5D2NB 3P4MB 4JDZA 4EDWL 4NQUA 2Y1VA 4MNGE 1F02I 2BC4B 3Q5YA 2X4OA 2ADJA 5BVJA 3V7AG 1QSEB 4LLDA 2EH7L 2X4RB 2HT4D 2XXMB 3KPLB 3O6FC 2ZSWB 1T66D 3SE3C 1GGCL 5C9KA 3VXMD 5EU7C 4AEFA 3U82B 3G6JE 3BZEA 5ADOH 1KBGH 4NKDB 4WDIA 1I9IL 3C2SA 1PQZB 2J8UA 4KHTL 4FS0A 1PX4A 2V2WA 2ZSVB 4HLZH 4PGBA 1N3NA 4EUPG 2GFBA 2HT3D 1DL7H 3HZVB 4WFGE 3AM8A 3KPNA 1G7IA 1UYWL 3I6GB 1T2XA 4R26L 1TQBB 3VGFA 4Q9QL 4OFYA 4U0RC 1WAAF 3LN5B 1H8NA 4JPWL 1GIGH 4DWHA 4GRWF 3WD5H 2OTUA 5DQ9B 1C5BH 3H7BA 4DGYH 1YEJL 3VFVB 5D2LE 4U1IB 5L9DL 2GQHA 2OL3B 4UBDD 1IC5L 1MCDA 1S5IH 2G60L 4IOIB 3ROLA 3MODH 4WW2A 3LZFH 5JQ6H 5LCVH 2LFGA 1B3JA 1GAFH 4U1MA 2VJXA 4LEOB 3BZFB 2D7TL 1DVFB 1PY4A 4PJ7E 4OM1L 5DK0A 1MSPA 4JFPB 4OD2A 2HAZA 5DF0A 3QDJE 1MIEH 4KK5C 1U3HB 1D3CA 4XVUD 1LGVA 2DF3A 1Y18B 4ZO6A 4WENB 5JQHC 2EXYD 4J6RH 3M1BB 3HPJA 4GMTH 2VN4A 1ZS8A 2R0KL 4XBGB 5JXAL 3C8DA 1FYTE 1OAKL 1T7ZA 4F57L 5L7XL 3EFFB 5MEOB 1YY9D 4XP9H 1JK8B 1RSFA 3I6LE 2VISA 2H32H 4NRYB 5CGMA 1JWUA 1M7IB 5D71H 4Y5XA 1SM3H 1OF2A 5I1JH 3IVKA 5H37G 3N85H 4HULB 1F3RB 3BQUD 1MI5E 1J0ZA 1ONQB 4NZRH 5FA4A 3RGVC 2C7UB 3BD3A 4QRTA 1OD7A 3QUZC 3EW3B 3RZCC 4NNPL 1NMCB 4JG0H 4N0YL 4NZJA 5BO1L 5D1XA 3EIFA 3KPTA 4K3DL 1WBYA 4MVBD 3TPKA 2WMPA 4HQQL 2J12B 2VLJE 5CEXA 4P4KB 1KGCE 2E3VA 2X4SA 2F54E 2HKHL 2EXWC 2XQYK 3RUGB 1X5FA 4TULL 5FYLL 1IC4H 4NRXB 1LEKB 4GW1A 5BV7L 1CXIA 3QDGA 4PLKC 5IROA 4PRPB 3MCKB 1DSFL 1RJLA 1J18A 1EMTL 2GSIA 4Y16C 3VFTA 3D1MC 3FOLA 1UWGL 2YD9A 3THML 3NCMA 1CLZH 4XNYH 1ADQL 2IMNA 3K4ZA 1DP0A 1TDQA 2X1XR 4YAQB 5FHAL 3NFNA 2EC8A 3STZA 4BQ9A 2Z31D 3RNKB 2ZG2A 5F88A 3TF7C 3VXQB 2ZG1A 2GAZA 4HH8A 3WKML 3RIFF 1DVFD 1O7SA 2J2ZA 4OKDA 5A3ID 1T3FA 3MXVL 4N9GA 1QA9A 2NW2B 3ZDXE 4NCDA 3UTTE 1WF5A 3DETD 1A3LL 2NR6C 4HZLA 2AXHA 5GHWL 4QKXB 1A0QH 3GSVB 5HHOA 2IPTH 3DV4B 4G6JH 1MJ8H 1JNNH 2XRAL 4QOKD 1W72A 1OGTA 4XXCC 3ULSA 5HDOA 3PV6A 1ZVSA 5J7CC 4Y1AB 4UT9L 3QG6B 4FQQB 5SV4A 3MRIA 3S9DB 1A7NL 4UIMA 1HNFA 4UQ3A 3DSFH 4KKAD 5MENB 3TCLA 4OCWL 2X70A 1OTTD 1U95A 1U8HB 1U8NB 4XPAH 3V6FA 5FYLD 1UCTA 5D96B 5GGQH 4RAVA 1R3HA 3V0WL 3U79A 4ZXBA 1OTUC 2YK1L 5KSAB 4XPHH 4I48B 3SDCB 2X5PA 4PUBH 4Z7VB 2VDQH 3P4OB 1F90H 5FYJL 3VGGA 3UBXB 3QFJD 4C56A 2OK0L 2AKRA 3UX9B 3FT4B 4DQOH 4I18B 3L3KB 5IMKA 2RIKA 3WE6A 2NZ9D 4Z7QF 1TQCC 4K7FB 4MA8L 3RRQA 1T7VA 4PGZA 3RWGA 4Q74A 3QPXL 4JFED 2DLIA 2HH0L 4P46B 1C08B 4KHXH 3CAFA 5C09D 3L3DB 3QCTH 4YDKL 4D0CB 1U41A 4J3OC 3ZKNC 4U1NA 5IB4B 2HFFB 3IFLH 2VZSA 2RAMA 4TTGA 2OI9B 3DX6B 4X5LA 5DRWB 1IZKA 3R0NA 1YNKL 4WEBL 1ZEAH 2VSCA 4AH2B 3S96B 3O11B 1KB5A 1NGWB 1TJHL 4U3XA 4JM2C 3MZTA 3NAAH 1Z6JT 4HIHA 2NY3C 2VIRB 1WAAE 2J7LA 3GNML 4XP5H 2IH1B 3QXTA 4HF5L 4CVXA 4LCYB 3AREC 4MNGA 3MRJB 3UJTH 5CS7A 4JRYE 1RZJL 5I1CL 2OTWB 5GGSB 4G6ML 1XF3A 1F45A 2IGFL 1LK2A 3FAWA 3RWIB 1BQSA 2WV3A 5B3NA 3G6JA 2FR4B 4NT6A 3EYQD 4MDJB 2ORBH 5FYJD 3DGCR 2OL3H 4NFDA 4YK4C 5E2UL 1PG7W 1EFXA 1NGZB 4FN0A 4R7DB 3GSNA 5MEND 5FO7B 4R3SA 3QUML 1N6QL 3O4LE 5D7JA 5IBLD 1BFOA 3VXTB 2OCFD 4MXQC 5EIVA 3VXSB 1HSBB 1QBBA 2VLRD 4D9QD 3JXAA 4Y7MA 3BDXA 3ALWA 1R5VA 3V4UH 4PTTA 2OYPA 4U31A 2DM4A 3C9NB 4NGHH 4UU9B 3JUYA 4KGJA 1QBMH 3B9VA 5E94A 4PJGA 3NH7L 4X5WA 5D2LA 2ZUTA 4CADB 2O26U 5HVFB 3Q48A 3WHE1 4W81A 5E1HB 3VA6A 1NGPL 3MV9A 4PJ7A 5CP7B 3ULVL 1JPGB 3QDJA 4HG4J 4YHZH 3FQTB 4JO2H 4QEGA 1ITCA 3ZYIA 3CH1B 4D2NA 4NIKB 1FYTA 1AFVH 4QXTB 4Y2DA 3FMGH 3WEXA 4OQTH 3B6SA 4HV8B 1V7NH 3W0WE 3MLSH 2P46B 5FA3A 4UTAL 1JNHB 2W1NA 4QGYA 1I8LA 2YA2A 1FNEA 5EZOH 1DBAL 2K9UA 3O3AA 3MOAH 4JDTL 4YHYB 3O8XC 1ORQB 3TO4B 1MI5A 3NACL 4GQ9H 4M6ML 1OCWH 1R6VA 3NTCL 4U1GC 4OGXH 1YEFH 4G8GE 3DTXA 1BZ9B 4NQCB 4PREB 1YA5A 2NW3A 1EK3A 1ZTXL 1CG9A 3RL1A 1U92A 3SDAD 2SEBA 3V5HB 1LDPH 3HMXL 4F3FA 3QQ4B 3BEWB 3H6JA 4LCCC 4JR9L 1TETH 3CUPB 2F54A 3RQ3A 3LPFA 3QXVA 3MJ9L 5DUPH 2BMKB 3QUXA 1WZ1H 3VXNA 1CFTB 1FNHA 1VGKA 1XGPA 4ZFZA 1X5ZA 1CXKA 3SY0B 4KH2A 2AI0H 1RVFL 1I8MB 1FL3A 1AE6H 1CFVL 2ZOKB 3QFDB 1FBIH 5IFJA 3X3FH 1QLEH 3BPCB 4JB9H 2VDKL 1B4JH 1UZ6F 1QEWB 3PXJA 1CVSC 2YD7A 1U8MA 3EYOA 1HIMH 3BWUC 4I0PC 3E8UH 3C08L 3CZFA 2H32A 3VH8B 5J4MA 3IF1B 1R24A 5GZND 3U7WH 1EX0A 5EOCH 1U8QA 1V3JA 3ARBB 2MPAH 4EI5C 5HHPA 2GTWB 5IK3A 1AC0A 3UTTA 1KC5H 2IANE 3WXWH 3H8NA 4PRPE 4MJIB 3R1GH 2V2TA 2NXYC 4LLQA 3LRGA 3X17A 4NKMA 5IB1B 4UV7H 3U0TB 4IS6A 5FF6A 3P40A 3QXUA 1KACB 2ZUWA 3OGCA 5IB2A 5DYOA 2V7HA 1C7TA 4MWFA 5I1DB 1XGUB 2B2XL 1A4KB 4YHKH 5EUOF 3IFNH 5AZ2L 1WCBA 3WNLA 2EE9A 3MJGX 1H3PL 4U1LA 1WIOA 4XBPB 1NEZA 2DDQH 3MRHA 4XMPH 1B6UA 5H2BA 3T8XB 4LDOB 4TUOA 3GEWB 2APWA 3BESR 3DUSA 3B5HA 3QIUD 4GJTB 4M4PA 4NQCD 3ARDC 4R4FL 3P0YH 1UM4H 1XH3A 2F8VA 3D3VB 3AMLA 5M94B 4W68A 5HJ3A 3TJHC 3VE0B 4XVTL 2P8MA 4ODUB 4I3RL 5FDYA 2APBA 3P73A 3SPVA 3EDDA 5HBBA 2DLEA 3H3PH 1NCTA 3IKCB 4Y4KD 2R1XB 5TE4H 4GW4A 1T83A 3PWJB 3L3IA 4JZJC 4L8DA 1A4JA 2EZ0D 3FRUA 1T1WB 3GSUB 3L3GB 1HH9B 3QNYA 3JWDL 5JO5B 5B8CA 1FIGL 4FQIL 25C8L 3O4OC 3HE6A 3BZ4A 3KDMB 4TSBH 3KPMB 1AR1D 3N1MC 4GMSH 3W9EA 4POZC 3ROOB 3O2VH 1DBBH 1WSST 4FOMA 1OL0A 4XC3H 3INUL 4RWHA 1AC6A 1PLGL 3FZUC 3U4EB 4L8CB 2HJLA 2R0LL 2FWOB 1WAAA 2I24N 1VERA 5CD5C 5ERWB 5D1QA 5J3HD 3FTGB 4HAGA 1IFHH 5T1DL 3GBNL 2D03L 1NDMB 3CPLA 5J1SC 4JRYA 4ZNEE 1DBKH 5DSCA 1IM9B 4F9PA 2EIEA 3IU4L 2X40A 3QHTC 4X9BA 3QDME 4NJ9L 3TBYA 4IDLA 3IJYB 3ZE0F 5IQ9A 3RDTA 4XCNA 1G9NL 3JVGA 5SWSB 3BYYA 3TPUA 3OAYK 1LE5A 4QXGH 4M1GH 5D72L 4U6XA 1DUZB 1WC7B 2OR9H 2R69H 4P48A 2A38A 3TVMB 2KZ1B 4HLZG 3ARFC 4N8CH 5I8CB 2AEQH 2KDGA 4OFYD 3SGKC 1KXVC 4HAFA 4JFQA 2HRLA 2Q76B 1AXTH 2AJVH 2PUQT 5FB8B 4JO1L 1GGBL 3B9KA 1NGXB 3V7MA 3BJLA 1EIBA 1DFBH 1RUMH 1HHGB 3B9AA 4ONOA 5DJCA 4J7RA 3T2NL 1T5WB 1AO7E 3O9WA 3CDGB 4QHLB 2XKNB 3A67L 1Z9OA 4I8DA 4X4ZA 4TSCH 5C0RL 4JGUA 2YMXL 4XWOC 5I17B 4IMKA 5GS1C 1J10A 5C0CA 3F6LA 3I6GA 3VXSE 3P0VL 1NUGA 4HUUA 1HWGB 3CFJB 4HPYH 1KCVL 5HVWA 5DMGC 5BZWA 4KUCF 2FYYA 3W0WA 4U1IA 1EJOL 5K9JL 1T80A 2EDJA 5CD3B 4W6WB 5HSFA 2ICES 4JFFA 2QTEA 3LEXA 4Q7DA 5JIHA 3HR5A 3MRLB 3C6LA 5D1ZA 4B53A 4FRWA 5CZKA 4G8GA 2EDHA 4PGCA 2EDOA 5DD6B 3LDBB 32C2A 2YRPA 1KSRA 5BQ7A 3MYZA 4M7LL 1W72L 2R1WA 2WLYA 3HI5H 1OWWA 4XHJD 1TITA 5C0JA 2GK2A 1I1AA 5M95B 4KDTC 3CXDH 5FK9A 3L5WA 5E8OA 4MZ2A 5EC1A 3ILQD 4BQCA 5C7XH 3VRJA 1RFDL 1I9RL 4NKIL 2P47B 2MCPH 3HFMH 3WSQH 1HN1A 3OJVC 4QF1A 1NUDA 4G8IA 2A6KA 2Z8WC 1TTFA 4OIIL 4U1HB 2JELH 4PJAF 1YEHL 3MYJB 3MMEB 2RQ8A 1KIQB 4ONFL 1OVZA 2DKUA 5L88H 3E0GA 3TIDB 2PR4H 3QDGD 2WIMA 4IHOB 5BJTA 2JKXA 3DVGA 3QIBC 1NCWH 4UNUA 2C7UA 1KCSL 1KNOB 2PO6B 4NWUL 5C0AE 4OQTA 1MF2L 4WU5B 1SY6H 1T22B 2DM7A 2NXZC 2R9HD 4ODVL 1A21A 3LS5L 4NDMB 3NA9L 2UY6A 4L1DA 4R90L 5DO2D 1WT5A 1XIWC 1ZVYA 1IGJB 5HHNB 3HN3A 4NC1E 4K9EL 3NA4A 2WWKO 4LCWE 2B5IB 2WQRA 1N4XL 4NRXA 3WN5A 2IANA 4YFDB 3JV6B 4P2OB 4X6DB 3GSWA 4OUOA 4PRPA 4MB5A 5HHOD 3MR9B 1CDCA 4ZMAT 3LKOA 5D7SH 1HILB 1A9BA 1MHEA 5F1IA 3VGHA 2E27H 4UNVA 2CIIB 2A9ML 1BM3L 5DJDA 1U3JA 2CIKB 4LVNC 1IQDB 3MRFA 4F7PA 1KB5L 3RA7L 4IRSC 1IGTB 5F97E 2YKLL 1RUPL 1VCAA 1EA9C 3MJ7B 4G9DB 5E00A 5EU7E 4NFBA 1EEZB 2VWEC 4G6AC 4S11A 5T5NF 1ETZB 1UM5L 4TRPL 3L5JA 4OKVB 2VL5B 3P77A 1P2CB 2VLKA 1N5AA 4QTHB 3KJ4B 3ESVF 3AS2A 5E8NB 4ZXBD 4MJIE 3V6ZB 3OSKA 3EOTL 4BUGA 4JM2F 3BUYA 4WO4A 2DWDB 2BNQE 4C56D 3CIQA 5E8EA 3O45A 3LMJL 3W39A 3QG6A 4HWEH 3GSNL 1SJHA 2I60H 3K0WA 4KAQL 2FO4B 3HZKB 5IJKA 3TNMB 5DHYA 4ORZC 1C12B 3W11D 2GT9A 3QB7C 1A7PH 4F33B 2GJ6E 3VWKB 1ZHKB 5DT1L 3CFEB 4FQLH 2PO6D 1HYRC 2EDWA 4XRCB 4C83B 3G5XB 3JV5A 1ZANH 1C7SA 4P2YA 1GZQA 5LGJA 2CDEA 1RUAH 1T21A 4X83A 3REVB 1XR9A 1KG0A 2FB4L 1FCGA 4RMRA 2VDOL 3ULUL 1K4DA 1E6OH 3VGDA 4JZNA 3W9DA 1KIRB 4JFHD 4GSDH 2XV6B 2EDFA 4QRRB 5DUBB 2VQTA 1Z9MA 2BERA 2HFGH 1Y0LA 1YMHB 1Z3GH 2CH8A 3ZL4H 3C6SB 3F8UB 3E6FA 1I7UB 4NPYA 4OFVA 4ZNEA 2XWBB 3TM6A 2FNBA 5TE7H 2P24A 2PYEB 3QDMA 1KBGL 2IAMB 3TA3B 1HQRB 3MLUL 2CDFB 4W4OC 3CCHA 1KPVA 3C5ZA 3RWCB 1JFQH 3ZDZF 3CLEH 3GMOA 3RY5A 1ZV5A 3MNWB 2IH3B 4JPKH 1DL7L 4MJ2A 3MCLH 4MD0B 1LO3L 4GKSA 3C60C 5IFAH 1M6OB 4WFGD 3E2HB 1AXSB 5ITBL 1GIGL 1MLBB 2FIKA 3BRFA 3DX9A 3WD5L 1L7IH 4PJDF 1FGNH 1C5BL 1LEGA 1QTYT 4DGYL 5IKCB 1FSKB 3QXDA 1S5IL 3MUJA 1SHMA 3MODL 3LZFL 2BFVH 5JQ6L 3WNOA 1YYMH 5I1LA 1MRDH 2XPGA 1AO7A 2HMID 5E9DB 1UB6A 2ED9A 1CD1A 4F15B 3MV9D 5HHVH 5EU5B 4HKBA 4QTIH 1DN2A 4XP4H 3MGTB 2V9TA 2W0PA 4J6RL 4MMXC 4ELKA 3WS3A 5C0FB 2YUZA 4FHBD 3D9AH 2AK1H 4F37F 5LAXB 5F9AC 4D9RD 1JCKA 5K59F 1FYTD 5A2JH 5CJOH 1LO2H 1TIUA 4XP9L 1MCPH 3N1QC 3PWPB 3WFCH 5K9OA 5DZLA 5DI8A 4HUMB 1A1OB 4CADA 2QBWA 5GS0H 5D71L 3I6LD 4H1LB 1SM3L 1WK0A 2XT1B 4X99B 1A1NA 2DBLH 3CFCH 3HKFA 5IHZB 5E6IA 1WEJH 5T3XD 1TJGH 4NZRL 3LH2H 3BFOA 1MI5D 4M1CD 1IM3B 4WCYL 1FFPA 4QXUH 3HR6A 3RWFB 4MAYB 4RDQF 4PGDB 5AZEH 1NMBH 3VWJB 3OKOA 1CFQB 5JPMA 4XZUB 3VRIB 5MERA 5DQJB 4BQ8A 2X4QB 3L7EA 4MQ7B 1KV3A 2B1AH 4B0MM 3OKNB 3QSKB 2QQNL 3PHQA 2YPVH 1DBMH 1I85C 1A14H 4LLYB 4PJHB 4OLWL 3IDGB 1FN4B 1JGLL 1JZ2A 2XNAB 1IC4L 3RNQA 2R15A 3ZKSD 5L2KE 3BP4A 4MAUH 3QUXD 1EBAA 3ARWA 3X13A 4KQ3H 3QI9B 1X5JA 3NGBC 3M8OH 5DRNA 4EJ1C 1ZT7B 1HE7A 1YPZE 3KG5A 4GBXB 5HYQA 3OF6D 4NM4H 1E27B 4RWYH 5C0AA 4UT7H 1CVRA 3BEVA 3EOAB 4ETQA 3WHXA 3F7VB 3OQ3B 3NZ8A 2FBJH 5DRZB 1B0RB 1A6AA 5E9DD 2OP4H 3MLTA 4DAGH 2P5EB 4JN1H 2IBZX 1QD0A 5DURB 4RGMB 4KJQD 4LCWA 4MJ6B 1RI8A 1S5HB 4GRWB 2VR9A 3UTTD 1K5NB 2H3NB 3ZYJA 5EU4A 3SY0A 2IPTL 2EC9U 4G6JL 1MJ8L 1YQVH 3H0TA 1Z5LB 3BIKA 4NN7C 1I8MA 4P3WA 1JZ5A 5ITFB 4LVHB 2ZOKA 1IZJA 4HCRH 2XTJC 4ODBD 2C4XA 1K8IB 3BPCA 4HUVB 1QEWA 1X4ZA 4I3GA 3MSPA 3DSFL 2O5ZH 4OZHF 4QRSA 4RAHA 3CMOH 3BGMA 3O6FA 2H2PD 5CUSH 2CUHA 2MNUA 3SE3A 3T77A 4XPAL 1YN7B 1XEDA 4DJMA 1AI1H 1S9XA 3UBXG 4XCCH 1GCFA 3U2SA 1J0HA 5DD5H 4UOW0 4MAYD 4FQCH 4HKJB 4JEGB 1ZLVK 4XPHL 4YLQT 4PLJC 4PUBL 1EXUA 5IOPA 4YC2B 2VDQL 5GXBB 1F90L 1S7QB 2V2XA 1A6PA 5IESL 3NN8A 1N2RA 4P23D 4F58L 3QZWA 1SY6A 3IDJA 5CJXC 2BNQA 2B20A 3TBTA 1GH7A 3VFRA 3B2VH 4A6YA 1OPGH 1Q38A 4Y8DC 4MA3A 3LB6C 5I9QB 1A8JH 5D93B 5HHXH 1QO3B 3OMZA 1HHHB 4NO3B 3WLWC 3MGAA 1GYAA 3MREB 4CU6A 4KHXL 3KYNB 3T4YA 1XGRA 2FSEA 2BVQB 4QRUB 4U7KA 5J89A 3QCTL 4YBLC 3TV3L 5IR1B 2GJ6A 4WV1B 1JJUA 1KYOK 1OGAE 3IFLL 5MEQB 1PYWB 4AENA 5KVMC 4I5BB 4KKBD 4X6BA 3K7UA 3V6OE 4K71C 4CMHC 1W0YT 1I9JH 2R2BB 3BO8A 2AP2A 3QA3A 1BD2E 3NAAL 4J1UB 2LTQB 3ARUA 3O2WL 3PWNA 2P5ED 4RRPG 4XP5L 1BPVA 4XHQA 1OP5H 5DDHA 3MOBH 3MFFA 1XF2B 4Y5VB 1AHWB 1CDHA 4MA1B 3NIGF 5E5MA 2FEEI 4JKPH 5TGBA 4PLOB 1LNUA 1AD0B 1FNAA 1F4WH 1HWHB 4JRYD 3RVVC 2Z91A 3RVWD 2P1YA 2ZOLB 1YEIH 4HK3N 2NMSA 2OS7A 2ORBL 1GGIH 3G6AB 4HWZB 3ARSA 3ZYOA 1ORSA 3RDTD 1R5IB 3RGVA 2AW2A 2OJEB 5CMAA 3D0VB 3QUZA 4AL8H 3VDBA 4LP5A 5FUZH 2ZNWA 4DEPC 3RZCA 1ZHBA 4HGKC 2CJUH 3FN0H 2FWOA 5F9OH 4WU7B 5ILTL 5AD0B 5ERWA 4ZFGH 3V4UL 3F7YA 3I9GH 4JLRA 4NGHL 1QFHA 5F89B 1Y6MR 4XCFL 4Z76B 1U8KB 4HKZA 4X7TA 4Z77A 3MX0A 1QBML 4FFWD 2E9IA 3SO3C 5HGDA 3B9KD 3BSZH 5KVFH 3QEGL 4GH7B 5C0ND 5INCB 3F12B 4Y16A 5EA0H 5D7LB 5DC4B 1QLRB 3O9WD 1D9KC 2MJWA 2QR0A 4PYGA 3HAEA 2ZZUT 4PLNC 4L3EB 1P53A 5FUOL 4YHZL 5SWZB 1MFBH 2WUCH 1J1OH 3T08A 1F11A 3WFEL 4HMEA 5C0CD 2NY4C 2YBRB 3C2AH 1JNLH 2H8PA 5C3TA 3DI3B 1T1ZA 2X44D 4GRLB 4OF7A 3KPOA 5FV2A 4RAUA 4EN3C 4LBEB 4M93B 3FMGL 5F7UA 5CBAA 1MCCA 4OQTL 4ZOBA 3QUYB 1IAIH 4DOHB 4Q6IB 1V7NL 3MLSL 5HI5C 3HLAB 3NZHH 1LO5A 2PXYC 2F8XC 5ID1A 3W0WD 4IMLA 1VFUA 1FNSH 4ZQKB 2OR8A 3T2PA 5A40E 3MOAL 3EDJA 3SE4C 1UKSA 3BUTA 4JFFD 1MFEH 3C87A 3A6CH 1QFOA 4LARL 2H9GB 4GQ9L 4GKNB 12E8H 4ODXB 4QHLA 4XXCA 4HXBH 2XQBH 4O58H 2UWEF 1YEFL 1BQHA 4OGXL 3C6LD 5D1ZD 5AWNH 1WWCA 5HGBA 4X7FC 3FKUS 4G8GD 3CVHA 2HLFD 2V5SA 4LIQH 4MS8C 3S98A 4U1JB 3CZJA 3T04D 2D0FA 5F7WC 2R39A 4RMSA 5IM7B 5BZDB 2ADGB 4JY5H 5JOPD 4BFGA 4RMVA 5ACZA 1VACB 4M6NH 3KS0J 1I1AD 3H9SB 3VGAB 4PJEF 3EYSH 1LEIA 1TETL 1CLYL 3BKMH 3OKMA 3FN9A 4R0LB 4X5XB 3BYTA 4RFNB 5DUPL 4K7PH 1WZ1L 3QEUA 3EYVA 5L2KA 1E4JA 4KV5F 5KG9B 1QFPA 4QNPE 1PGRB 1AGBA 2AI0L 1NBZB 3GIVB 3VMNA 3GSQA 3VH8G 1W0WB 1AE6L 1RY7B 1FBIL 1YPZA 4JG1H 4P5MA 3X3FL 1QLEL 3RKDC 4JB9L 1B4JL 5KSBE 2Y23A 3O3EA 3VG9B 1DQJB 2P5WE 5CJQH 1HIML 5BW7C 1RV6X 5HI3D 3M17B 3E8UL 2PW2B 1DBJH 3FQRA 1BAFH 1MH5B 3U7WL 1A6UH 3FQXB 3S36H 4Y4FB 3IJSB 3PABB 4GAGL 4MNQB 5IUSA 2A74A 4TUJA 2MPAL 1WGOA 4P2QE 2AJYH 1Z0NA 1KC5L 1UM6L 2LAAA 4K23H 4M3KB 3UTZB 4MNHB 1V7MH 3QIWB 3G04B 2ZCHH 3R1GL 1TPXC 2IAND 5F1KC 1GXEA 3GKZA 2C4FU 5BV7C 4JM2A 4QT5A 1YDPB 4RQQB 4PY8I 3RY4A 3O3DB 2IBZY 3EHBC 3DIFB 4OGYH 4YR6A 2NNAA 3MA7B 1Z9SA 4YHKL 4WTZA 3IFNL 5DJAA 4JHZA 1JGUH 1IBGH 2XN9B 3AROA 5EBGA 3SKOB 4PJBE 2Y7QB 1CGXA 2DDQL 4XMPL 1CGUA 2VYRE 1I8KB 2OMBA 3QQ9D 2M26A 2Y5EA 2YR3A 3K1DA 3DXAD 2H41A 1CWVA 1S9VB 5K33A 1QACA 1DQTA 4FXKB 3P0YL 3ES6B 1T5XA 5MHSD 1HXMA 1EH9A 3LRHA 5GZOC 1Q0YH 2VLKD 4NC2B 5L0QC 2GUOA 1BJMA 1LILA 4JFZH 4XNMB 1FYHB 2OTPA 5KTEH 4E0RA 4ZFFB 4YDLC 1QRNB 5K9KA 1RULH 4WO4D 1S7TB 4DKDC 3H3PL 4FQ2H 5F7HA 4HBQA 1MFNA 5CZXD 1G7PB 2EC9T 2MHAB 1F4XH 4LSSH 4MSWB 5GRZA 4CNIA 1FHGA 4QYOA 1U93B 3DBXA 2AV7A 4NRZB 5H35B 1RUKL 5DJ6A 5DJ2B 4NWTL 2W0KA 4U6HB 4WUUE 4DVBA 3UAJC 4GAYB 2DI7A 2J88H 3T65B 4B7IA 2DQCH 2B7DT 5E56A 2A77H 1OGAA 1OM3L 5DXWA 2Q8BL 4JPIA 3V6OA 3BDYH 3JBG7 4DN4L 4HCRA 4GMSL 3O2VL 1DBBL 4WFFD 1FG2A 3VXUB 1NGQH 4O5LH 1BBDH 1SYSB 2EYSA 5I1GL 3Q6GL 2JE8A 2FX9H 1BD2A 2E9JA 1M7DB 1E6JH 4AZ8A 4RMTA 1UA6H 3VI4E 4U1KA 1C12A 4J23A 1IFHL 3RTQC 1XR8A 4K2UH 1AD9A 1NCCL 1Q9LA 3KNBA 1KULA 3O8XA 1J1PH 4OI7A 5ETUB 1UZ8A 3QDMD 1QR1A 4UILH 1CE1H 4XRCA 4QXGL 3BH9B 1FNGB 5JR1H 3C5ZD 2B4CH 3TT1H 2RGSA 4OCNC 1BOYA 1L7TL 3TJEH 4AEHH 4BH8A 4PJ8C 5IHBA 4EI6A 2OR9L 4M7ZB 2R69L 2BOCB 2X4PB 2CLVB 2AGJH 5HY9B 3L5XH 4N8CL 4OBSA 1I3RB 2AEQL 3DHMA 4OV5A 3CK0H 3V5DA 3NFSL 3PIQA 15C8H 1MCOL 1SVZA 4LCCA 4LRIC 3UTOA 5SX4I 4RA0C 1CXLA 4F7MA 1EUTA 1IGFL 4NKOB 3VD3A 5E6ZA 1FORH 3I84A 4GRMA 1WTGT 2HFTA 3DX8B 1K4CA 4UT6H 1CF8H 1QRND 5EUOB 1DFBL 1S7UB 1DLHB 4NQXB 1YEDA 5H94A 1KT2A 5EOCJ 4O2CB 4OF6A 5JHDB 1BP3B 4TSCL 1AO7D 1CYGA 3U36A 4X7EC 1MVUB 4I0PA 2VDRH 3K3QA 4PD4J 3QULB 2EDKA 1JE6A 1HHJB 1ZAGA 3FRPA 4LLAA 1EO7A 4NQSA 3TYGH 1PG7H 4HHAA 5DK2A 2UYLB 3ZSTA 2E7BA 4D3CH 5I75B 3MV7B 1G0DA 3WFDH 1NLDH 4EI5A 4CU7A 5C0GB 3VDAA 5E4EC 1J0IA 2XZZA 2C3GA 3HUJB 2BNUB 4UUJA 4XCEA 1JZ6A 5CEYB 5T1MA 4ZFOB 1YYLH 1BGXH 3QBTB 1K6QH 1LO4H 3GRWH 5I1HH 5E6ID 3MV8A 1UB5A 5EU5A 3FT2A 4N8PA 5ICYB 4YJZL 4EOWH 4EXPX 4PRNB 3V6BR 1T7YA 1HHIA 1G7MA 1XZ0B 1I7ZA 5SWZE 3OHXA 3ULVC 5DTFA 5J9PA 2NY6C 3HI5L 1G7QB 2AEPL 4C58B 4ACPA 3SDYH 3CXDL 3KYOA 2VDNH 2VWEE 1T20B 4DOHE 1C5CH 4LGPB 5F93C 5JW4N 2IPUK 3GGWA 3ARDA 2YPKB 2MCPL 2JIXA 3WSQL 3NIFF 2A73B 4N5EC 2JELL 1YMMB 2E9BA 4WGWB 1JUFA 4FQHA 5L88L 4D9LH 3MNVB 2PR4L 5TF1L 1KTDA 4ZUSB 3T2QA 3QH3B 1NCWL 3MV01 3ZTNH 1T03H 4DKFH 3GMPA 5KSBA 3TWCL 1FE8H 2P5WA 4TTDD 1SY6L 5I30H 3WNNA 1TMCB 4KDWA 3FQUB 4R2GD 1IT9L 2XFXA 1NLBH 2CQVA 4A6YL 5KN5A 4CMMB 3VD9A 1JBJA 2I5YH 1FZMB 1I1YB 1M1SA 3L6FB 1HQ4B 3T0ED 4P2QA 4H25A 4HH9A 4YDVA 4LCWD 2EDNA 4RFOH 1ZT1B 5E08H 1P9MC 4HMDA 1ZMYA 1IAII 2FEEL 4JHBA 1M05A 5D7SL 1K9TA 1UJTA 4HEME 4YBQC 4GBXA 1MPAH 3VXPB 3MV7D 3OWEA 2E27L 5DJZB 1N5YH 3BKJH 2X42A 1EV2E 3PJSA 4EQ3A 1CE6B 2W0FA 3DECA 4F7EA 4JFDB 4PJBA 1RIUH 5DHXB 3O6FD 4TNVK 1PEWA 1OTSD 1QVOA 4ZS7L 1BQLH 4X6FB 1ZGLA 1EHXA 4M8QA 5ID0B 4QHMA 1S5HA 1AGDB 4R7NA 1IEAB 3RWEA 5J12B 3U1SL 4D8PB 1FVEB 5I2IB 1JP5A 5JXED 4NQEB 1MJJB 5DEZA 3B4NA 2EDTA 3VI3F 4RNRB 2ADFH 5JW5A 5KS9F 4M9PA 4XT1C 4ZAKC 4ZPVA 3REWA 2BNQD 1UXSB 3SGKA 2ESVB 5IMMA 3MRCA 4YFLF 3NFPB 5LQBH 1T89C 3F58H 2C4FT 5F6IC 4DKEH 2PKDA 4K94C 2IJ0C 1ZSDA 2VR4A 1HH6B 4L8SC 4WUUA 1FL6B 4YGAB 4N0UB 4QRPE 2IQAB 2D4FA 3TT3H 1N59A 4FQLL 4HKXA 2GJ6D 3CH8A 4XNQA 1CT8A 1ZANL 3I2CH 2Y5TA 5DJ8B 1RUAL 5GS1A 4PB9L 5CKGA 4KK5D 1CTOA 4UI2A 3D87B 3UXFA 3IXTB 1KJ3H 1BHGA 5ICZB 1E6OL 1JPSH 4PJAB 4GSDL 4WW1A 3CSBA 4YHNB 3KPRD 4NO5B 3KXFE 5TQ0H 1U8PA 1YUHA 2HFGL 3DVIA 5ELIA 3WUWA 1Z3GL 2HT2C 5CSGA 2HG5B 3BPLB 1Q94B 4Y5YB 1X9QA 4FQXB 2CD0A 5C0BD 1RIHL 1VKXA 1CICB 4LCUA 2DJ4A 1WBXB 2FEDC 4IOFC 3MNZA 4DZBA 4YGVA 2PYFA 2A2QT 5A2IH 1W0VA 2MKLC 5EC2A 3VXUE 1JFQL 5DS8B 4D0DB 3RGVD 2F58H 3CLEL 1I1FA 3DLQR 1F6AB 2H2SC 2C5DC 3QUZD 3RZCD 1AQDB 3BGAA 5IFAL 1G7LA 3VRLF 1HSAB 1T0PB 2WINA 4ZUVA 3T4AB 2VABB 1EEYA 4KDTA 3CVHL 1S9YA 3H9HA 3SDDB 1KLGA 5FUCC 3BP6B 5EO0B 1JYNA 1FGNL 4AG4H 3IU3B 1AD0A 3PUCA 2EXWD 3B3IB 3EAKA 4IOSD 3BP5B 2GSGA 4ODWA 1KB9J 2DMBA 1DE4A 2BFVL 5K93A 1A2YA 1RK1B 5F9DC 4MA7L 4PLKD 4ODHL 3FO0L 1XCTB 4Y16D 4RGNC 3QIBA 1II4E 1KUMA 1V05A 4JFYA 4ZYKA 2HRPH 3GSOB 4MLSA 4CGTA 2WANA 3N0PB 1BBJA 4XP4L 2Y06H 3IDMA 3P9MB 1A9EB 1VB9A 1CXHA 1OAYH 3D9AL 1KFAL 4H1LG 4S1QL 3WDJA 2VERN 5GQBA 3ZE1E 3VFSB 3ILPB 5KJRH 3DX7B 1QBAA 2EIZB 3N50A 5CJOL 1LO2L 1MCPL 1EAPA 1CK0L 2NY3B 1OB1A 4BJLA 8FABB 3WFCL 4Y89A 3FFDA 1Q72H 5D1XC 5GS0L 3AREB 2A6JA 4HIJA 3QWRD 1QG3A 2NR6D 2DBLL 4P4RA 3CFCL 4PR5B 3HC0A 4OLXH 3ARGC 1K2DB 1WEJL 3FB5B 3G5YA 1TJGL 2F53E 1F4HA 4POUB 4LVOB 1KOAA 4QXUL 1T2QH 2FL5B 4LPTA 4Q6YA 1NMBL 5GGRY 5FHBH 5SWZA 2G2RA 3NOIA 4IRSA 1JV5A 2GHWB 4BH7A 3OTTA 2MKWA 2B1AL 4MXVE 1UWEH 4PY7B 5F7LB 3U9UB 1QSFD 2YPVL 4TVPH 4ZTPH 4Y2OA 5D5MF 4DVRL 5KW9H 2R2EB 1NJ9B 3ARTA 5JZ7C 5JLZB 1FG9C 4KQ4H 2CPCA 1OTUD 1TCRA 3TBSB 3HUJE 2D7QA 4FQPA 3N1FC 4MAUL 3T1FA 2VDLL 2UY7A 5L2KD 3QHZL 4WNQA 3M8OL 1UCBH 4BFBD 3DRTA 3AXLA 4NM4L 3GJEA 1F8TH 3HS0A 4UT7L 3FB7A 4YXHH 1IGYA 4RISH 5I16B 2FBJL 4YHLH 1TXKA 2BRQA 1R3LB 4OGAC 4GUPB 2GITB 4FZEH 3BGFB 1TLKA 1TZHB 1H5BB 3QWOA 3T3PF 1BFVH 2VE6A 4JN1L 4NP4H 3ZKND 4MQTB 3GRWA 4JCLA 4PJFF 5FOBA 2Z92A 1NAKH 3NCYS 1S8DB 5IF0B 2Z93A 1YN6B 3TLRA 1FH5H 3L1OH 4OLYH 4PJDB 3WBDA 4HMCA 1DQLH 1YQVL 1AGCA 3GIVA 1MRFH 3K80A 1FFOA 4IEFB 2K3TA 4JM2D 2EKSB 1QSVA 4OM0H 3HZYA 4PJCE 5JPNB 5IFHH 4CN4A 4HCRL 4PRIB 2NY3D 3QR2A 1CL7H 4QY8A 3WDHA 1D5XB 3ARED 4JRXB 4XB8A 1RZKH 4E42A 2O5ZL 4H0GA 4OZFB 5EPMB 3CMOL 2F5BH 3H3KA 5EO1A 2XA8H 5MEPA 4XH2B 4DCQA 5TDPA 5KAQF 1FNFA 4DFIA 1MJ7H 4PRBB 1AI1L 4XNZC 4BFIA 1M7XA 4XCCL 5E2VH 4I2XE 4K3GA 4U1SB 4L3CB 4W4OA 2KBGA 4FQCL 3TN0B 4LPYA 3UCRA 3OKDA 2IWGA 4KROB 1WIPA 5A2FA 3CFDA 2Z4QB 3UDWC 1T1XA 3PV7A 2ZPKH 4TNWF 5BCAA 4KTDH 2O61A 3V0VA 2P42B 2CKBB 4LFHG 4PRDA 4JN2A 3LKRA 4MXQD 5F3BA 3MBEB 4RX4A 3QNZB 3T0VA 1OPGL 5F9JB 5MI0C 3RWHB 4HT1H 1NSNL 1JYWA 2AQ3A 5KOVC 1KB9K 4PJIF 5HHXL 5J6HA 4JFDE 5CSZA 4K3JL 2I07B 2QQKH 3BH8A 1Y6NR 5I19H 1GOGA 2Z35A 4KK9C 4QRPA 4CDGC 4AIZB 3OR6B 4FXKA 4PJ5B 3HC3H 1OP3H 5CILH 3IETB 2M8XA 4L29B 4XMLH 5DD3H 3BXNB 4NQEE 3HI1B 3O6KL 3R8BB 5JOFA 4X6EA 1JRHH 1DR9A 1BOGB 1VPOH 1BD2D 5CIPB 3T2OA 2ESVE 2NXYB 1F4YH 3D0LB 3MOBL 3KXFA 2MHAA 4JPVH 3EYFA 2NTFA 5L6YH 4JKPL 5D7JC 3DO7A 4KI5C 5JORB 1VA9A 1DN0B 4UDUB 3EGSB 3WHE0 3MRRA 5I8KH 4P3DB 3CSPA 3L5HA 2BVTA 4X6CE 1GGIL 3CNKA 2DTMH 2ITCA 5DJ0B 4GG6E 3NMEA 3HC4L 1QFWM 3O8XD 3U7AA 2FRGP 4JRXD 4OAWB 4NO0D 3LV3B 4AL8L 3SKUD 4H0HB 1FDLH 4Z7UF 5FUZL 5IHUH 4E41D 2CLZB 5EUKB 4LLVA 3VD4A 3KYAA 2CJUL 3HE7B 1HI6A 3FN0L 4KPHL 3QCVL 3CFIC 5F9OL 1CXEA 2F9BT 3ULUC 1NC4A 3PGCA 3TN0D 4KJYA 2NLJA 4ZFGL 3FL7A 4OLEA 2FZ3A 3AB0C 1I85A 3I9GL 3EOYG 1BQUA 3LKQB 2LAGB 4E5XB 2DLFH 2H26B 4XNXH 4LASH 5DWUH 2IF7A 5CWSB 1GZPA 3S35X 3BSZL 5KVFL 5E95B 3V0AC 4OZHB 4PS4H 4Y4HC 3AMKA 2Y25A 4EQ2A 2AXGA 2CR6A 3P30L 3VW3H 1MCHA 4Z0XB 3LN9A 3MRNB 4KRPB 2FJFB 2G5BB 2I9TB 4OV6F 4FMFA 3ULVF 1U58A 1WLHA 1MFBL 1J1OL 2BOCA 3C09B 3P2TA 4U6YB 1BEYH 1NCAH 3GBMH 3K2UH 3C2AL 1JNLL 1CU4H 4HWBH 4I0PD 2Y07H 2Q6WA 4NJAH 4LHUB 1G9MH 4PJ5D 3MO1A 1FVCB 2ZJSH 4LSQH 2AJZA 1IAIL 2HTLC 3FQWB 3NZHL 1TJIH 3RX8A 4L4VE 4EI5D 1FNSL 1NFDE 5AG9A 1AH1A 4X4ME 2P45B 1KLUA 4P5TB 1SYVA 4IRJB 2E7CA 2R0WL 1R3IL 3SDXF 2NXYD 12E8L 1CDYA 1P84K 3MRMB 4HXBL 2P4AB 4O58L 1WWBX 1EHAA 2F53A 4RSVA 2W65A 5AWNL 4FNLL 4YHIB 2BDNH 3MV8D 3LKSA 5IW3A 1HDMA 2JTDA 3WCYA 4WHTB 3QJFA 1QLFA 1TFHA 4WJ5A 1DEEA 2KUTA 3WIIL 4MD4A 4JY5L 4YZFE 3G6DH 1P4LA 3DMMC 3QAZC 1WVZA 1Z2KA 5INDA 4M6NL 5IVXE 1REIA 3QEHB 3EYSL 1FO0B 1AIFB 3BKML 3BW9B 5KSVB 3A6OA 1T6WA 1BVLB 1U8IA 3ARDD 4HJJH 4P2RB 4U0QB 5EBWA 5C3LD 4K7PL 4U2ZA 1GGYA 4HS3A 4JO3H 4G80A 1QUNA 4N8VB 3ZKMC 1MY7A 2D0HA 2R2HA 4N0CD 3TJHD 3LN4B 5F1SA 3U0PB 1BREA 3BHBA 3IDIB 4JFOB 4JZOA 5CJQL 1BIIA 1NBQA 5I76B 2P5WD 2VQ1B 1JPFA 1DBJL 3K74B 4MHHI 4QCIA 3RBGA 5F1OB 1BAFL 5BRZE 1A6UL 3S36L 2MCG1 3UPRB 1EBPA 3GIZL 3V52H 1MHHB 5F7MC 3RIAK 3OXRB 4OZFH 1MWAH 2AJYL 1RURH 2XZQH 4NNYB 2FGWL 3D25A 5I18H 4G43A 4NHUB 2VL4A 4P2QD 1L0YA 5L8JB 5ALBL 4POZD 5EN2B 2XACC 3O0RH 3OJDB 4S1SH 4JREC 1T0MB 3ZT7A 2BHZA 4DZ8B 4MD5B 5DVLA 4ONGH 4XP1H 1FZJA 3FZUD 3SOBH 4CUCA 4PJCA 1FJ1B 2X7LB 5D7IB 1XF1A 4OGYL 3RGHA 2HLAB 5CD5D 2WBJC 3Q3GA 2IPKA 1W8OA 2E8ZA 2X1QA 1JGUL 2IALA 4ZSOB 2CKBH 1IBGL 5T1KA 5KVGH 3MRQA 1UXWA 3FQUA 3EO0A 2OX5A 3OKYA 3FO9B 4KXZH 3U48A 4YHMH 1GJIA 1DLFH 4I2XA 2P49B 1NC2B 4I1NB 3S4SB 1VFAA 4NQDE 1Q0YL 1KIPB 2K1MA 2DICA 3S3SA 1ZXQA 4JFZL 4OIAA 5EZLB 4WUKH 4OUUA 4CVZB 2FD6H 4YFLI 5E6YA 5KTEL 4BSWA 3HHRB 1XGYH 1BZ7A 1RULL 1NQBA 2YEZA 4HW6A 5HPMA 1EGJH 3VXRB 3ARFD 2J8UF 1C5DA 2JF1A 1U8OB 2V6HA 2UWEB 2D9QB 3QT2A 1F4XL 2BOBB 4HUWB 1JGDA 2X1OA 4LSSL 5HHME 3BZDA 4JFDA 3NABH 5DVMA 4O2FB 5E8DH 5KVEH 4G7VL 5CIPH 4G42B 4MXWH 3HG1B 4XNUH 2J88L 4WUUD 2XWTB 2DQCL 4OD1H 3QRGH 5ICXB 2A77L 3RJDA 5H37H 2AQ2A 5CJ8A 5I6XB 3BDYL 2C3VA 3TGXA 1XIWB 1WICA 4PJEB 4NQEA 1MJJA 1NGQL 5IW6B 5FO9A 4F9PC 3A6BH 3Q1SH 4HGMA 4XWOD 1CDUA 4WW2F 1QP1A 2LU3A 1INEH 2W59A 43C9A 4XPTH 4WI9A 1U91A 1E6JL 3IAQA 1BF8A 4C57C 2QL1A 4EN3A 4F2MB 2AERT 5DMGD 2GK0B 1L0XA 3X3GH 3HB3C 5DMKB 1MIML 3PP4L 3SCMB 2PXYA 4MMZC 3TH2T 1MQKH 3ELAT 1U8LA 3BAEH 3GJFB 4PJ9B 5DA4A 2DQHH 1D5MA 1NCUA 5D2NC 1FL6A 2PW1B 3SE4A 4CW1A 1CL7I 1J05B 3CFKB 3QO1A 4X6CA 1NAMB 2Y9RT 5EBLB 4GG6A 4UILL 1CE1L 3BP7B 3EO1B 2QSCH 5AUMB 5JR1L 3TT1L 2IBBA 2NX5E 3GSRA 3WL9A 5C07E 4AEHL 3TJEL 3QXAB 4JHAL 4QHKJ 1JVKA 5GIRA 1QBLH 4X0KB 2J1KA 1NC2D 2AGJL 5IVZA 4D0BB 3WIFB 3WFHA 1MFAH 2FHCA 15C8L 3GMMA 3O41A 5F9WB 5KVDL 4Z78B 1N64H 2IFFH 4KKCC 2ICWB 4LKXB 4G8FA 2ICEB 1C16B 1FORL 2XZCL 1Q94A 5I71B 2A6IB 4CRPA 7FABH 2DQIH 3MLXH 1AY1H 1TQBC 1WBXA 4X80L 2XY1A 4KK8C 4DUVA 5HYSA 1KTLA 1BF2A 3QIBD 4YBHA 4OZ4B 4AIXA 3PNWA 5EU6B 4KJPC 2CKNA 5CHNA 2E7HA 3Q5TA 3KLAB 4BKLA 1KIUA 4HK0B 2AJ3A 5BW7A 5JUEH 1H0DB 5FYKH 2VDRL 4XMKL 1OP5K 3V5KA 2NXZD 3B8YA 4R4ND 3BP6A 4Y0GA 4D3CL 4LCIH 3VFWB 1OAUH 1XIWD 2HJKB 1U3HC 2P8PA 3WFDL 3DETC 3HPLB 1JRHI 2E9WA 4L4VA 3OKLA 3C5JA 1DEDA 1NFDA 3NCJH 3PL6B 2YD5A 4X4MA 3D39E 1FO0H 5BOPA 3WDIA 3GI8H 1YYLL 1K6QL 1LO4L 3GRWL 1RAMA 3KPPB 4Y19B 3LQZA 4WWKB 3G9AB 2J4WH 1ND0B 3JTSB 4EOWL 2NY2B 2EDEA 1XF4B 3K8KA 4MX7B 1BFSA 1X7QB 2DB8A 3Q6FB 4IRSD 1OTTC 4HJ0C 3WO4B 3AS0A 3SDYL 5IG7B 5EBMB 4L8BB 2VDNL 5IVXA 3IJHA 1C5CL 1GL4B 2WSKA 3KYMA 4HUXB 4X7SH 4G6AD 3F5WB 4PRHE 2Q3AA 5C8JB 3NPZB 4PJFA 1NMCC 4OLZL 1JPST 5C6TH 1BFTA 2AK4B 2RJMA 4D9LL 3TO2A 5BXFA 4P4KC 5FYKE 5TDNA 3QEQD 4Z18A 4MDIA 2ZUVA 2FLBT 2X4TA 1P4BH 1T03L 1EHLH 4MGXA 3U46B 1RMFH 4LGRB 1FE8L 1MCEA 2QSQA 3ZE2E 5J11B 1KPRB 2GY7B 1XAUA 4LKCA 1I3GH 4X8JB 1GC1H 4PP2B 1YEGH 4PTUA 4M6OL 5BRZA 3ZT6A 1NLBL 3PWVB 3FB6A 2AEWA 4BM7A 2I5YL 3P9LB 2BNRE 5D9SA 5B3JE 1P7HL 1HHKB 3PQYE 3TBSA 3X12B 1F13A 3U30B 1AP2A 4YE4H 3L7FB 2OSLB 5E08L 1RZIA 2X4UB 2ERJB 1CDBA 4FMKA 4OLVL 3SJVE 4YNYA 4PV9B 2DYPA 1MPAL 2QHLA 1N5YL 3EKCA 1JWMB 2W91A 1A7BA 3OKKB 2F5AL 4EXKA 2KL6A 5DJYA 4WRLA 3DVNB 3X11B 5EU3A 4JVUA 3WFZA 3RTQA 1DDHA 3UTSB 3SEPA 1Q9KB 4HJGB 3BKYH 1RIUL 5JOEA 1OAXH 2DQJH 3LD8B 4S1RH 1LE9B 2GJZA 5IT2L 1T1YA 1BQLL 1R3KA 2HTKC 3AAZA 4KMLB 2R1YA 5IJKC 5D6CA 4G8EA 3TZVB 1M4KA 3GM8A 4NQDA 2CDGB 3LHPH 1S8DA 3TNNA 2DMKA 2G75A 1O0VA 2VOTA 4NN6B 1T0NA 4PJ8A 5GRUH 5D96C 2WM0A 1S9WB 4FTVB 4S10A 3RY6C 3G6JF 2ADFL 1HOCA 3C60D 5D7IE 5KSAC 3SDCC 5I1EL 3LS4H 4RX4D 2DL9A 4IIQB 5LQBL 4LRIA 3P11H 2YD3A 3OXSA 1NL0H 3KJ6H 5EPMA 4AIOA 1MWAA 4DKEL 1QHOA 2XWJA 3HTLX 1I7TB 5C92A 3JV4B 3E6HA 3LQAH 3DROB 4I18C 1FVDB 2X1PA 2Y72A 1IKNC 1GPOH 4WHDA 1INQB 5C0DA 5B22A 2X6MA 4QRPD 4EUPA 4RGNE 5LG1A 3GJFH 1G7HA 2W0LA 4P46C 4WI8A 3I2CL 1WISA 2R56L 5D2LF 3GMLB 1I7RB 3QHFH 3UTQA 2P7TA 1NAMH 2AVGA 4L9LB 5CFHA 1KJ3L 2NYYC 2YPLB 5JNYB 4MJ5B 1JPSL 3CX2A 1PFCA 3F7RA 3MBEA 3RL2A 4TSAH 3ULUF 2EH8H 2OI9C 4PJ7F 3I85A 3KYKH 5TQ0L 2KH2B 4LGSB 3MUGB 1DTUA 1DQQB 3KXFD 4V2BA 3SKJH 1YEEH 5HDQH 2I07A 3L3HB 2JJSC 4BELD 2NY5C 2C3WA 3K2MC 1A6ZA 5EFIB 3F65A 3U7YL 4I0CC 1X6NA 4IJ3B 4L29A 5LWYL 1EGJA 3HI1A 1UVQA 1ZA6B 2F58L 2MTPA 2NX5A 2CUMA 5C07A 4GXVL 3BOVA 3R06A 3TYFB 5HYJB 4JJ5B 4YXLL 4OFKA 2YA0A 1OWRM 5J06A 3QNXB 5TQ2H 3I02B 4OSUH 3VFOB 1NMAH 1WJ3A 4K7PX 1NC4D 3K1KC 4XVSH 4ZDHA 3FOMB 1B0GB 3OR7B 4GLRH 5J6GA 2JB6B 3KAAA 3DV6B 5F7DB 4GW5B 3D85A 4RA3A 4TN9A 2EDYA 1EEUA 4N1CA 4L4TB 2V7NB 4HS6B 3MROB 2FECL 5CBEA 2H6PB 1I75A 1UQSA 2HWZH 4FXGA 1X4XA 3SDXA 4A2LA 1KEMH 43CAB 4R96A 4OAWA 3D69A 2FATH 1ZGLM 2G9HA 5CINH 5LBSH 5F1NA 1CBVH 3PDOA 4Z8FL 2EO9A 2PCPB 3S5LB 3S36X 3RPKA 3HE7A 4H26B 3SGDH 3LOWA 5E2JA 5J1AB 4K71B 1ZWIA 1OAYL 2JCCE 2ILLA 2CK0H 4ODSL 3J8F7 4GS7C 4TYUA 3VXMB 1LDSA 4OT1L 5KJRL 2BRRH 1SJEA 1S7VA 1H15A 2ZUSA 5JW4R 5KS9B 1D5BA 1Q9WB 4MCYB 1Q72L 5C0IA 2E7LA 2YPLD 1H3TA 1F58H 2VDPH 3D39A 4ZO8A 4G9FE 4JHWH 1P9MA 2ATKA 1B4RA 4OLXL 1PZ5A 3ME0A 1Q9OA 4YHOH 3SE9H 4KRLB 4C59B 1T2QL 2YD8A 4JGJA 2F53D 3ZDXF 2YRZA 2XTJD 3GMNA 5FHBL 1AGFA 3WYRA 1KCRL 4OLUL 5I1KL 3AS3A 2BK8A 3WLBB 4YHYC 5F72S 4OB5L 2E8YA 3TO4C 3KGRA 4J8RA 4P9MH 4HIEB 3IAGC 4MB4A 1UWEL 4RFEB 3GBLA 5M7QA 3LKPB 3BE1H 5ANMB 5B38B 1PSKH 3QQ3B 1ACYL 4OZIE 5KW9L 3CVIL 4PRHA 1RHHA 2GCYB 5ESQB 1NANH 3MLWH 3BPNB 3ESUF 4LF3A 1V5JA 3S8WA 5GSVB 4P5TA 4PLJD 3S7GA 4FZ8H 1KEGL 4LRNH 2EDXA 5F3HB 3MLVL 3ARZA 2JJVA 3KPQA 3DGGB 5IB5A 1UCBL 1BX2A 5IIEB 4NC1C 4ZAKA 1FV1B 5A43C 1MREH 2WW8A 4NNXA 1S7XB 4NSKA 2ATPA 4PJXE 1F8TL 2XTLA 5BS0D 4MCZB 1T89A 4YXHL 3GMRA 1PX3A 4LLWB 4RISL 3MLYH 4EIGB 2PETA 3LB6D 1A6TB 5T3ZH 5C08A 4I3SH 4N0FB 5I1IH 3WLWD 2CMRH 4L8SA 4EBQH 4FZEL 3BQUB 1NGYA 1O5DT 4TUKH 4HC1H 4NP4L 2BNRA 2MOVA 2DTSA 3PQYA 4NO2B 2UZYB 2B8OT 1UJ3B 4PGEA 2AK4E 3LCYA 3L1OL 1FH5L 2BSSA 4N8VA 4O4YH 4OLYL 3H7LA 1M71B 1DQLL 4QXWA 4X98A 1KJVA 4OZFG 2Q86A 1YC7A 3ZTJG 5FCUH 4U7SA 2R4SL 3ARBC 3SJVA 1YC8A 1P7QA 2OJZL 5IFHL 1OSZB 1CL7L 1UC6A 4JY6A 4JFOA 1ZLSL 4RCAA 3FQNB 2D31B 1G7JA 5DLMH 5C2UB 1GVIA 4KI5E 2F5BL 5FGCB 2XA8L 2GIYA 4L9DA 3LSOB 4N1EA 5FKAB 1F42A 1MJ7L 1S7WB 3RVVD 2YC1B 5E2VL 1TZIA 1LP9E 4HGWA 2WUBL 3KPSE 4J4PC 4JFXB 4ZUUB 3VFGH 5F7FA 1P1ZB 1JZ4A 4OCYL 4DK6A 4HXAH 4FFZH 3S3JA 2CUIA 5A2LH 4WEUD 4OCRL 1TVDA 2WIIB 1NKOA 2Z31B 3RWDB 5T3ZE 4G5ZH 1FZOA 4RDQG 3ULUE 4RGOH 4GT7A 5EIQA 4EDXB 1YECH 2DBJA 4HT1L 1IAMA 3TBWA 2D7OA 1N7MH 4PV8B 1CDIA 4XB7A 3MGOB 3VFPB 2QQKL 2PF6A 5KOMC 5I19L 5KBNC 5ISZE 4QOKB 3CU1A 3MRGB 1YNTA 5B39B 5CILL 4NYLA 1TVBB 2X4NA 2ITDA 4XMLL 4IRZH 1D9KD 3TIEB 5EZLA 5DD3L 5LXGH 3UPCA 5DFVC 4Z95H 4ZUWA 3GM0A 5D5MB 1FC1A 4GG8A 1MUJB 1PG7X 1JRHL 2P44B 3T3ME 3G5ZB 3O3BB 1VPOL 2NY4D 5EO9B 1IL1B 1OARL 1F4YL 3DOSA 1BZQK 1U8OA 1N8ZB 4OF0A 3VJ6B 2G5RA 4JQIL 1BECA 5L6YL 4LQ1A 3QRFM 5HI5D 2F19H 4APQB 1JF1B 4FABH 5IEHA 2FX7H 2XWTA 2GTZA 5EOTA 3QFJB 3ARGA 2DTML 1FC2D 2O5YH 2FJGA 2OXGA 5KSUB 1MRCH 3BDBA 5DEFA 4TOYH 1F6LL 5DJXB 3OPZH 5IHUL 1QQDA 3KR3H 1H3WM 4JFEB 4MS8D 4PFEA 4K55A 5MP6H 4M9OA 5C09B 3ZHLA 2AXFA 4AEEA 5FECA 2GK0A 4YPGB 2C1OB 3C8HA 5DMKA 4ZUTB 5LGKA 4XNXL 5DWUL 3HNVH 3S34H 3TVMC 5H8DA 1QZ1A 2AABL 1MHCB 4Q2ZA 3UJIH 4F7CA 3CFKA 4UDTB 2D7PA 2YOCA 2XZAL 2ZUUA 4K7PY 1J8HE 2A83B 3F62A 4LHUG 4YIQA 3HCVA 5E1AB 5TDOB 3VFNB 1L0QA 2EYRB 4Z5RB 1A3RH 3QXAA 4BK5A 3RKDD 1JIBA 4V1DB 1CCZA 1G6RH 5AYQA 3UJJH 5TPWH 1AKJB 3GBML 1CU4L 2JCCA 2Y07L 4NJAL 5EOQL 4X9IA 1U0QA 1G9ML 2DWEA 2B1HH 2ZJSL 3MJ8B 4M1DH 1UKQA 3CX5J 3WV0A 3L95B 3VFMB 1TJIL 1F3JB 5DGRA 4M5YH 1CIDA 5EZJB 1IE5A 5HDLA 1A6VH 1TZGH 4G9FA 4PJIB 2KZWA 2VITB 3MRDA 5EIIB 2J8HA 1I4FA 4MQXC 3IKKA 2VLRB 1AGEB 5AAWA 4EDWH 3EHBD 2BDNL 2X05A 2KQNA 2QLVB 3EYUL 1XGQA 3KLAA 4APQD 2BVOB 1C1EL 5EWIH 1ROWA 1R3JA 2HVKA 3G6DL 2YWZA 1DQML 2VXSH 1GGCH 3KS0H 2VXQL 4N8VG 4R4BB 3T0BA 4EVNA 4XCYA 4XAWH 1XF5A 3QPQC 4OZIA 1PKQE 1WZLA 1I9IH 2FJHB 4HJJL 4HLJA 4JO3L 1V3KA 2ADIA 4P57A 1CFSB 5IWLC 4FQJH 3FONA 4LPCA 5TH2A 1SEBB 3UDWA 5GS0C 5GRVL 4OZGB 4YO0B 4JAMB 3QDAA 1W8NA 4R26H 3PF2A 1MCLA 5A1AA 4YDJB 4U2YA 3TFKC 3V95A 1F97A 4PJXA 5E8PA 2AQ1A 1VSCA 1MFDH 5T1LA 4HDIA 3W11C 1YNLL 3H9ZA 3SKMA 4PB0L 4AM0B 2ED7A 4Z7UB 5EBMA 1UGNA 4ZNCD 1OAQH 1U8JA 4P5KA 4ZPTB 35C8H 3V52L 1JHTB 5GSRB 3QUMB 3UAJD 2PO6C 1MLCB 5HGHB 3IDNB 2AJUH 1MWAL 1L9NA 3SGDI 1RURL 2XZQL 5J0BA 5I18L 4V1DD 4BQBA 5IMOA 1AKJD 3MACH 3OV6A 5I66A 3O0RL 4S1SL 5IV2B 3BKCH 4KDVA 5GGUA 3SDAB 3CC5B 3UP1A 1KPUB 1ZLWH 4BQ6A 4XP1L 2YXFA 4NUJB 3SOBL 5JXAH 2B5IC 2YSSA 2DYPD 2IADB 3G08B 1RIVL 1KJ2A 5C0EA 2F74A 3FO2B 4P2OC 3S4SG 1LD9B 1FFNA 4YH6A 4O51B 1RZGA 3RTQD 5CLTA 4Z7WE 5KVGL 3ARXA 5D2NE 5DEGB 4RIRA 1JN6A 5DHVB 2AXJA 4YHML 1DLFL 4HFWB 4GFTB 1LP9A 1DUYB 3I75B 3KPSA 2X89A 1NUFA 4QHNB 1HEZB 1QSEE 1D5ZA 4NUGH 4X4YB 3H9YA 3IS1X 3PWUA 3JUZA 4NQDD 5D70H 5E2WH 5IEKB 4NZTL 2FD6L 3S88H 4PJ8D 4ELMB 2QADC 3FFCB 5IW1B 4HD9A 2PTTA 1ZVHA 2C1PA 1XCQB 5FKPA 1EGJL 3MA9H 3KJ4C 3V6OC 1T4KB 3BWAA 4JY4B 5GGVH 4M43H 2BP3A 1JNJA 5E8DL 5KVEL 3NABL 4LSDA 1B9ZA 1HCFX 5L8KB 4LNRB 5FYLH 3AC0A 4MXWL 5HHMD 3AY4A 1LE9A 2VLLB 3U6RB 4XNUL 5IB3A 1RUQL 2OZ4H 4M48H 5ISZA 4OD1L 3QRGL 4J12A 4JQVC 4Y4HA 1HKLH 2P8LB 3LRSA 3RPIB 3T0WA 2BZDA 3C5SB 1G1CA 2CSPA 1S7SB 1ADQH 3QUKA 4WI3A 2RFXB 5HHQB 3A6BL 3Q1SL 5FHAH 1P5UA 3LIZH 1U9KA 2GI7A 3VWKC 1INEL 1A7RH 2BHYA 3CX5K 4XPTL 4F7TB 4AYFA 2I9LA 2VH5H 3CFBB 3STLB 3VGBA 3X3GL 3QIUB 3C8KA 4RZCA 5DZNA 2HFEB 2A6DB 1E4KC 3CSYB 6FABH 1MQKL 2YUWA 2QKIA 3BAEL 3QJHA 1ZT4B 1KJMA 1FGVH 3SKNB 1SEQL 4WHYH 3UYRH 4OTXL 3BVNB 3EOBA 4M7JH 2KKQA 2XRAH 1ZA3B 2VLJA 2VDMH 3P9WB 4M61A 1BLNB 2QSCL 4XGZB 4Y4KB 3FB8B 3ULVD 1A7NH 3OJ2C 5HGAB 3TA3C 2IAMC 2NY6D 4MJ4A 1OP9A 3DMMA 1IAKA 7CGTA 4OCWH 3VMPA 4YHPA 1RJYB 5IMLB 1N64L 3MRPB 2IFFL 4NCC2 1CDGA 1VEOA 3D18B 5CJ5A 3V0WH 4NCC1 4JKMA 3PWLA 2HJFA 5T33H 4WEMB 4LLUB 2CO6B 3FFCD 7FABL 2DQIL 1AY1L 3MLXL 3D85D 3QO0B 4N5ED 1IAOA 1OP3K 1ITBB 4ISVB 4X4XB 1CFNA 2ARJB 1J8HA 4QGTA 1IGMH 3RUGE 1FSKC 5JTWA 3GMQA 1VHPA 2NPLX 3MRBA 3IGAA 2BSRA 5JUEL 4X7CC 2ADJB 1L9MA 5FYKL 5BVJB 5F70A 4LLDB 4NKQB 5KANG 3I02A 3IFPA 4F15C 3TBVA 4YDKH 4LCIL 1OAUL 3BZEB 2KQMA 1OLLA 2DQEL 4K94L 4WDIB 4GAJH 1WBZA 1JGEA 3VU2A 2J8UB 2V2WB 3NCJL 3D2UA 5LGHH 4PGBB 2GFBB 3GI8L 1FZKA 3KPNB 1G7IB 1SBSL 1NDGA 4NZUH 2J4WL 4YBQD 3GNMH 4OCXL 1T04A 4NQVA 2WBJA 5I73B 2OTUB 2YHGA 3DYMA 4AEIH 3H7BB 1RZJH 5I1CH 4Y1AE 1FL5A 4G6MH 3B2UC 5HYEA 2GKIA 4U33A 3GKWH 5HDBE 4LDEB 3ROLB 4WW2B 3RAJH 4JO4H 4URTB 4O2EA 3VWJC 1PKQA 5FO8A 4U1MB 5BVPL 2C3HA 5DK0B 5ESAA 4PRHD 5MENE 2OQJA 4OD2B 2Z9TA 4XBEH 5C6TL 3QUMH 1N6QH 2NY5H 4I4WA 1G6RA 3UEZA 1P6FA 3HPJB 4D9QE 1J9CT 5FEBA 4DW2H 4M7LT 4KGLA 2NY0B 5GGRA 4HG4K 3DURB 1P4BL 4MQSB 4JKKA 4ZAKD 3WFBH 4Z7VE 3A0OA 1BWMA 1RMFL 4UINH 1IILE 5I74B 3U4BH 3RX5A 3QI9C 1QPPA 3RFZC 1I3GL 2VISB 1GC1L 1FAIH 4N90E 5C08D 2W60A 1JWUB 4HX1A 1YEGL 4H5SA 4J3VA 4OF3A 1P69B 3TH4T 4KVCH 4GBXC 4Y5XB 1OF2B 3IVKB 3X14A 2HVJA 1IEBB 3GO1L 5E7FA 4LOUC 5GSVA 5FA4B 1CD0A 1ACZA 2B39A 4JDVA 4YE4L 4PRAA 5DHVH 3GUTA 3LQMA 4QRTB 1D6EA 1S7RA 1KN4H 4EEEA 4KRMB 1DQDL 2EYTA 5A2KH 4NM8H 5D1XB 3E3QC 1VGEH 4RGMC 1WBYB 1WITA 1S7XA 3SJVD 4O02H 1HXYA 1P7QD 1OY3B 1VADA 4WVRA 1JWSA 9CGTA 3FO1A 4M62H 5CEXB 3IYLW 1NFIA 1R5WA 2WP3T 3STBA 4AJ0A 3O4LA 4PG2C 4Z7WA 3BKYL 2HT2D 2VAAB 4LVHC 5D2NA 1OAXL 2DQJL 3P4MA 4S1RL 3BQUA 4GW1B 5LVEA 3RVXC 3WIHH 3QDGB 2Y6SC 2BC4A 2FEDD 3I50L 3NACH 2GY5A 1RJLB 2GSIB 1O7VA 4M6MH 4GKZB 3VFTB 3FOLB 4WY7L 4IOFD 4NO2A 1QSEA 2X4RA 3VCLB 2VB5A 3LHPL 3KPLA 4G7YL 2ZSWA 5GRVK 3ARRA 3VD7A 5GRUL 1TCMA 1B2WL 2H2SD 3HA0A 5J56B 3NFNB 3CD4A 3STZB 2YZ1A 4NKDA 5F88B 1PQZA 2GAZB 2ZSVA 4O9HH 4YC2C 3P11L 1UH4A 1WWWX 4JR9H 3KJ6L 4M7KH 5JA9A 1T3FB 3GI9H 3HZVA 4LSPL 4N9GB 5C2BL 3EJYC 3LQAL 1EHNA 1WFTA 1QNZH 4HZLB 1AQKH 3LN5A 1GPOL 2EDDA 2NY0D 5HHOB 3J7HA 3MLZH 5DQ9A 1W72B 3ULSB 4C55A 5I9QC 5D93C 3PV6B 4GOSA 1ZVSB 4RGND 1CFVH 3VFVA 2OL3A 1RHFA 2Z0BA 1J8KA 2VDKH 4IOIA 5SWQB 4ELME 2VN7A 3MRIB 4UIMB 4WV1C 4UQ3B 4LEOA 3BZFA 4HWUA 2BCKB 1DVFA 4TSAL 3TCLB 2EH8L 4JFPA 2X70B 1U95B 3KYKL 4TPRL 1CGSH 3V6FB 1EZVX 3DO3A 1U3HA 4RBPH 4RAVB 1Y18A 4H88L 1R3HB 3T09A 3KWWB 3M1BA 4ZXBB 3CU7A 4FA8A 1IEHA 1YEEL 3NPSB 5HDQL 4XBGA 2LTQC 1MELA 5D1XD 1A5FH 2VXVH 3K8LA 1SVCP 3EFFA 4PBXA 5MEOA 3ARGD 4C56B 3BRDA 1JK8A 2AKRB 4MA1C 1SJXA 4NRYA 2X9XA 3H3BC 5IMKB 1M7IA 3WE6B 5FGBC 5I8OH 2B2XH 1KENL 3RWGB 4FFVD 1ONQA 5TQ2L 4OSUL 4RMUA 3S35H 4NQCE 2OZ4A 2R23B 4XVSL 4U1NB 4R4FH 5JZ7D 3S5LG 1N0XH 5I15H 4P4KA 3TP4A 1KB5B 4XVTH 1UG9A 1J88A 1KEML 1ODAA 2NY7H 3ZZ1A 2FATL 4HIHB 5DJXA 3RUGA 5CINL 1J7VR 5LBSL 4BZ1L 4CVXB 4J3TA 1LEKA 2B4CC 2FBOJ 4MNGB 4AQOA 1TNMA 3MCKA 1RU9H 2DQDH 2CK0L 4L4JA 5DC9B 3JWDH 3HI6H 2GJJA 1XF3B 1LK2B 2BRRL 3BN3B 1YPZF 4OGAD 5IJVB 3G6JB 4NT6B 4YAQA 5SX5K 1MOEA 3RNKA 1F58L 1T6VN 3VXQA 5J13B 2VDPL 3DUUB 3GSNB 4GRLC 4JHWL 2LV4A 4R3SB 8CGTA 4DGIH 4M93C 5GRYA 5D7JB 1BFOB 2A83A 3QUYC 4G9FD 5JMRA 1PLGH 4Q6IC 5E1AA 2NW2A 3EFDL 4LSUH 4YHOL 2DKSA 4PP1D 2DI8A 4G6KH 3D48R 4Z5RA 1RK0B 1QSZA 5B38G 4HUKB 2L7JA 4R9HA 3O6LH 1R5VB 3GSVA 4PTTB 1JYXA 3DV4A 5T1DH 4P9ML 5E94B 4PJGB 4X5WB 3V8CA 4Y1AA 3OG4B 1KJ2L 3FAXA 3RVTC 1PSKL 2CRYA 4FQQA 4QHUB 1CGYA 3L95A 1P5VA 1G9NH 3GFUA 1INDL 2VZ1A 2JB5H 3MV9B 4PJ7B 1WCQA 5MENA 5EZJA 3QDJB 1U8HA 1L4IA 1U8NA 3OX8B 4HEPG 3EJZC 3VGAC 4N68A 3RY6A 3SQOH 3T1WA 3K4AA 5CCKH 2FDBP 5KSAA 4G6FD 4RFNC 4I48A 3SDCA 3D3VE 3BISA 1FYTB 4Z7VA 4X6DF 3P4OA 2ENSA 4Y2DB 3WEXB 4YWGH 3B6SB 3UBXA 3MLYL 3GSXB 5FA3B 5T3ZL 2ZUXA 5T1LD 1FNEB 1GGBH 1PY9A 2CMRL 3FT4A 3O3AB 4I18A 3L3KA 4EBQL 1IKNA 1WIUA 3GHBH 2AAVA 2J5LB 4K7FA 4KK9D 4TUKL 2I26N 2ZCKH 4K3HA 2Q20A 3VG9C 1MI5B 2EEBA 1D7FA 4P46A 3DTXB 1C08A 1CFSA 1MAJA 3HNSH 3HRZB 4UQ2B 4O4YL 4Y4FC 3L3DA 1CLCA 5F7EH 4D0CA 5FCUL 2NW3B 5IB4A 5ADOL 2ICWJ 1CG9B 2HFFA 3RL1B 1PBYA 1U92B 2SEBB 3DX6A 4UTBH 5DRWA 3QIWC 1ZLUH 5DLML 3T0DA 4AH2A 3S96A 3O11A 1EFXD 3GZKA 3WJJC 1NGWA 2F54B 1XGTB 1URLA 2M2DA 5D7JD 4KI5D 2VIRA 3QUXB 4S1DC 4ZPTA 2IH1A 3VXNB 1VGKB 1XGPB 2JJSA 4ZFZB 4LCYA 4DFHA 5GS2D 5JW3H 3MRJA 4DKAA 4FP8H 3QQNA 3KPSD 3VFGL 2X89D 4UAOB 2OTWA 5IFJB 4HXAL 5GGSA 2NY1B 3JWOH 4RRPA 3RWIA 5ALCH 1W72H 2FR4A 1U8MB 5LCVL 4MDJA 3EYOB 4G5ZL 5SWSE 4ENEC 3CZFB 1GAFL 2H32B 3Q2CA 5ENWB 5FGSA 4LAJH 1YECL 3ULUD 1NGZA 4R7DA 1E0OB 1MIEL 3OB0K 4X8XA 5FO7A 1RFDH 1I9RH 1N7ML 1U8QB 4O51A 3QDJD 5B39G 3KLSA 4CL7A 3VXTA 2DLHA 4XAKE 5HHPB 5DEGA 4GMTL 5IK3B 3VXSA 3UTTB 1HSBA 4LLQB 2EICA 2XG4A 4NKMB 5K9QG 5ISZD 3C9NA 2VZVA 1TENA 4IS6B 4Y2DD 4UU9A 4Y4HD 5FF6B 1FCCA 4BSVB 5IB2B 1F5WA 4IRZL 5LXGL 4PG9B 5DYOB 4OBRA 2V7HB 1KCSH 4MWFB 1RZ7H 3EZJB 5HVHB 5HI4C 5I1JL 3ZKXB 1WCBB 3N85L 5IW1A 3BD4A 4U1LB 1NEZB 5CP7A 3MRHB 5H2BB 1JPGA 3WIHA 3OZ9H 4O00A 4Z7NE 2RHEA 4TUOB 4K9EH 3FQTA 2N4IA 4JG0L 3MOQA 1XH3B 1WWAX 2F19L 3DSNA 3CH1A 4LAQH 2VLLA 2FX7L 3V4VH 5HJ3B 4QXTA 4P23B 2O5YL 4W70A 5E2TH 1EZVY 2P8MB 4HV8A 2VLJD 1JNHA 1KGCD 3P73B 1MRCL 3NIDE 4IBLT 3SPVB 4TOYL 3OPZL 4WHYG 2F54D 2RFXA 3KR3L 1KB5H 4GW4B 4WI2A 4B5EA 1ORQA 3L3IB 4L8DB 3TO4A 1A4JB 3FRUB 3QNYB 1BZ9A 5B8CB 1HYSC 1CLZL 5B4MC 1IJ9A 3ARPA 2D7NA 4XNYL 4NQCA 2A6DA 4PREA 3HE6B 2UVEA 3CSYA 4JQXC 2NY1D 5KAQG 1WFOA 2DD8H 4M7ZC 3HNVL 3S34L 1JGVH 3SKNA 2WNGA 3UJIL 3W9EB 1B88A 4ZO9A 3V5HA 4LSTH 4K07A 3QQ4A 3BEWA 4C56E 3ZKMD 3CUPA 2HYMA 5DD0H 1J8HD 2HJLB 3OGOE 2BMKA 1A3RL 4PPTA 4KAQH 5DVNA 5D1QB 1CFTA 1G6RL 3UJJL 5TPWL 1A0QL 1JNNL 2LU7A 4QNPF 4JRYB 2PNDA 2B1HL 5DSCB 5CGYC 3QFDA 4B7LA 4N9OB 4M1DL 1KTKE 3TBYB 4JKLA 5KSBF 5IQ9B 3N9GH 4XCNB 3RDTB