2JTDA

Skelemin immunoglobulin c2 like domain 4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
EEEMKRLLALSQEHKFPTVPTKSELAVEILEKGQVRFWMQAEKLSSNAKVSYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDVYKKLQKEAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Myomesin-1
publication title Structural insight into the interaction between platelet integrin alphaIIbbeta3 and cytoskeletal protein skelemin.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jtdA00
5KTEH 3ULVD 2Z4QA 4K7PL 4PJ8A 5TDOB 4PRNB 2X10A 5HD8D 3TA3D 1C5CH 1RURL 3PGCB 4N8VB 4X6FB 4AZ8A 1A5FH 2BY1A 4Y5VC 4PJ9B 1HI6A 3H2WA 4MXQC 3GSQB 2A6IA 3GSWA 4WNQB 5ICYB 2HVKB 3NABH 1B2WL 1F4XH 3ESVF 4JFHD 2CGRH 1Q9OB 5HHMB 4RSVA 1S9VB 5TDOA 4PRNA 5FF6B 3PGCA 1JGUH 4N8VA 4X6FA 3BIBX 2X4PB 2GHWB 4DFIA 4J3WA 4PJ9A 4TNVF 3SO3B 4JPIB 5CJ8A 1WVZA 3MLSH 3GSQA 3MFGB 3MLVH 1W8NA 4WNQA 4NN7B 5TQ2H 2HVKA 4XWOD 5ICYA 1XF5B 2OR8A 2ID5A 1Q9OA 3IT8D 5HGGS 1S9VA 3LMJL 4YNYB 5FF6A 4OGYL 2FECL 2X4PA 1UACL 1P4IL 3B2UC 2E9JA 1A9EB 4JPIA 2IALB 5TPWL 3T0DA 3UPAA 5D2NC 1QEWB 3QG7H 3QXUA 12E8H 1XF5A 3LAFA 5K59E 2V6HA 4YNYA 4PJFB 4AEIL 3EO9L 3JWNC 4HSQA 2JLLA 3V4PL 5I1HH 3MOAL 5ESQB 2DM3A 1A9EA 5FGBA 2IALA 5GIRB 4YX2L 1QEWA 5B38G 1R5VB 4MX7B 1JPTH 2YZ1A 4ODUB 3N06B 2VJXA 1MIEH 4PJFA 4P5TD 3OZ9L 4JQVC 2DM4A 2Q76B 4JREB 5ESQA 5EN2B 2BDNL 1KBGH 3SDDD 4ACPA 5GIRA 5A2IH 4R4FH 2W0KA 1OPGH 3TT3L 3EYQD 3B8SA 5ERWB 1R5VA 2W07A 4AJ0A 4MX7A 4ODUA 3HMXA 4MXVE 3VJ6B 3RHWK 6FABL 4X6CB 1KIRB 1Z2KA 5KS9E 2Q76A 2AJXH 5EN2A 1HINH 3KLSA 1U3YA 4ZO6A 3AS3A 4OGAD 4QF1B 3LOWA 5ERWA 3KPPB 4I0CC 3ZTNL 2IGFL 3VJ6A 1RIUL 3O4OB 1QSFB 4X6CA 1KIRA 1H3GA 4X9FA 1WFUA 2MKLC 5ANME 1TQCC 3W5NA 3H42L 2EDEA 2F53E 3T0EC 3VG9C 4QF1A 5KS9F 1F90L 3KPPA 2VWEC 1KJVB 5F9WB 1CQKA 1SY6A 2QTEA 3KYMB 1QSFA 1C12B 4Q0XL 3S35H 3KR3L 2ZPKL 4E42B 1CD1B 2WMPA 1OAZH 1RZJC 1WLHA 2W0FB 1OF2B 5JDSB 4J6RL 3HE6B 4YHKH 3FJTA 1KJVA 1N6QH 1KJMB 2DLIA 1X5FA 3H8NA 3KJ6L 3KYMA 3M45A 2JJTC 5EOCJ 1C12A 2DQTL 3OF6A 3SOBL 4OIAA 5EU6E 1OP3K 4D8PB 4XPTL 4E42A 4YHZL 5IV2B 1CD1A 3QPXL 4NQED 1SJEB 2W0FA 4G5ZL 3JTTB 4I18B 1OF2A 2P48B 3SGJA 4IOFD 5E9DD 2FD6L 3QQ9C 5DR5L 5JDSA 3QQ4B 3HE6A 3T4AB 1CS6A 3L5JA 4F15C 1KJMA 5L6YH 4HC1H 1XF1A 5MEQB 2PTUA 4D8PA 5IV2A 5DHVB 5EU3B 1SJEA 3JTTA 2UYLB 4I18A 5C8JB 3S88L 3OAUH 3QQ4A 2C3GA 3T4AA 1RULL 3LCYA 5FYKL 3MXVH 1HKLL 1AGDB 4L5FL 2LTQC 5MEQA 1DBJL 4NQTA 2NNAB 4WFEE 5HHOB 5DHVA 5EU3A 4M93B 3TH4T 4WW1B 1GSMA 4NFBA 2UYLA 2WUBH 1NH6A 2XQYG 5C8JA 3WJJA 3S8WA 2GQHA 2XZQL 4KK8C 4EI6B 1CGUA 1I75A 5BJTB 2K7PA 3IDXH 1N64L 3HZMB 5SX5K 1AGDA 4JFFB 4JO3L 4BSJA 4PG2A 4MA7H 3KJ4C 5ISZD 5DJ8B 2NNAA 5C2BH 5HHOA 4WW1A 5SWSD 3CJJA 4JFXB 1U58B 4EI6A 5BJTA 2PKDA 4Y4HD 4CBPA 1RZFH 3HZMA 4JFFA 2AGJH 3HAEH 5DJ8A 4P5KB 4XAWH 1HILB 4LCUB 1ZLSL 2H32H 1IAMA 1T0NB 5D7JD 1A3QA 1EGJA 1Q1JL 1U58A 4JFXA 1LDSA 4HJJH 4OAWB 2BRRL 1HXYB 2D0FA 4UV7L 3O9WC 1HE7A 2V2TB 1YEEH 4KC3B 1A64A 3MGTB 3TLRA 2I9TB 5HDLA 4L1HA 1IM9D 4P5KA 4U4BA 1HILA 4U1JB 5F7YC 3KYKL 4LCUA 4LRIA 5D1ZC 2R4RL 4LSPL 3RAJL 4PD4K 1TJGH 1T0NA 1UQSB 2W0PA 3QJFB 4NN5B 5CBEB 3BE1H 4P5MB 2DWDB 1G7JB 1I1YB 3GRWL 4OAWA 1PG7X 1HXYA 2WWMD 5F7EH 4KVCH 5INDB 2V2TA 3M07A 4QCIB 3MGTA 1L4IA 2Y23A 2I9TA 4Z7VE 1P4BL 2AXGB 1IM3B 4QHMB 2DWEB 2HT2C 4XCEB 3MRJB 4U1JA 3V9FA 1NAMH 4MAYC 4NWTL 3O6KH 1TPXB 1UQSA 3QJFA 5CBEA 1L9NA 4P5MA 2DWDA 1G7JA 1I1YA 4G6MH 1FRGH 5FYJU 4A2MA 3SHSA 5LCVL 5INDA 4QCIA 4DOHE 3LDBC 4MA1C 4F7PB 2AXGA 5DA4A 1IM3A 4QHMA 5I71C 3SCMB 1C7TA 2DQCL 2DWEA 4XCEA 3MRJA 4BZ2L 2HT4D 3I6KB 1QNZH 4Z7VF 5MI0C 5TFSH 1DBMH 5DMIH 1GPOL 3QXDB 3NCMA 3WFCH 1B4JH 3FT2B 4OFPA 4LPYA 4F7PA 5SV4A 2NY6B 2VDPL 4NN6C 3SCMA 1H0DB 5CEZD 1DN0B 1F58H 5AYUH 4PRPE 1HWGB 3H7LA 3I6KA 1YY9D 4D3CL 1U8LB 4GKSB 2DM2A 3QXDA 3WIFB 1J11A 1JWMB 4QOKB 5JQ6H 3O4LD 1U3HB 3FT2A 1DSFH 2V5YA 4KY1L 1H0DA 1DN0A 5CCKH 1IE5A 3VGAB 1I1AB 3H9SB 2W92A 1JJUA 4KXZI 3WHE0 4RAUB 4ZODA 1U8LA 7CGTA 4GKSA 4OZHF 3WIFA 1KJ2B 3WIIL 4QOKA 1JWMA 1U3HA 1P6AB 3BPNB 3VXTB 3ULVH 2VXUL 1TVBB 1JF5A 4P4KB 3QUZD 1K6QH 1N6UA 2B4CH 1I1AA 2P46B 3C08H 3H9SA 4OQ1A 3EOTH 2VR9A 1L0XA 4OD3L 4LCWB 1EUTA 4RAUA 1HHGB 1KJ2A 3KPLB 3ZT7A 2VB5A 5A2FA 3VXTA 3G6DL 1DQDL 1MI5D 4PJ7E 1CF8L 3DUHA 4HPYH 4B5EA 1TVBA 4P4KA 1M7IB 3EO1B 4EDWH 1MCHA 3FCTB 4OKVB 1PSKL 5C3TA 4M4PA 3BH8B 4LCWA 2HVJB 3I9GL 2QQNL 1HHGA 3KPLA 5T33L 2BJML 1JYWA 2QADB 1OCWH 4YBLB 3ES6B 5M95B 1BEYL 1QSFE 2P7TB 3KXFB 3O3BB 5C08D 1M7IA 3EO1A 3PNWB 4JHAH 5HVWA 4HS8L 1NCWH 2YC1B 3FCTA 2Y6SC 3KPSB 1JNJA 4JFDE 4QGYA 4OKVA 3N1PC 2V5SA 4PJ7F 1ED3B 3BH8A 2HVJA 4HF5L 1RHHB 1RSFA 3ES6A 3X14B 3BP6B 3HMWH 4G6JH 1HYSC 5TQ0L 4J7RA 5DJZB 1ZLUH 3JWOH 2P7TA 3O3BA 3KXFA 2YMXH 3PNWA 1V7MH 3D5OF 5IVOA 2YC1A 3KPSA 4YDJB 1YEDB 1TZHB 4ODVL 1DQJB 2ZSVB 3E0GA 1FDLH 1MQ8A 1ED3A 3QDGB 4R26H 4MA8L 1KPRB 1RHHA 1HWHB 3QRGL 2VLMD 3X14A 3BP6A 5EOCH 5E94B 5B39B 2WP3O 5DJZA 4Y4FD 1X5AA 1WT5C 2R0LL 3CSYB 2HH0H 2HTLC 4YDJA 1ZK9A 1YEDA 1TZHA 2J6EL 1DQJA 2ZSVA 4ODHH 3QDGA 4OSUL 1KPRA 3NH7L 3VXUD 5E94A 5B39A 4HG4J 2GI7A 5TF0A 3EOYG 2AVGA 2CRMA 3CSYA 1DLHB 3QWOB 4CN4A 5IMOB 1P4LB 1XAUA 4H88H 1UFUA 4IRZH 4RMSA 2B8OT 1F4WH 1RVFL 1NC2B 4ODSH 4LVNC 2ADFL 1ZEAH 4P9HH 4DVRL 1DLHA 1T66C 3QWOA 5IMOA 1P4LA 1ZLVK 1PLGL 3ZYJA 4OUUB 5F96L 5E2WL 4MQTB 3ARSA 4RFOH 4LPCA 1NC2A 5BZWB 1YEGH 4JFFE 4H0IA 4U7KA 3PDGA 3AROA 2IJ0C 4ELMB 2VXVL 4OUUA 3RTQB 2PETA 4FQXC 5C0BD 4J23A 5DD1H 5DUPL 1VA9A 1V3MA 3HR5B 3ARTA 4M1DH 3QCUL 5BZWA 1ZLWK 4JCMA 4Y2DC 1WWBX 3FQXB 4AK1A 4OZIB 1F4AA 3ZKMC 4H26B 4ELMA 2AAVA 5ADOH 1XF2B 4QRQB 2P5WE 5GS2D 3RTQA 1O7SA 3TVMC 4WTWA 4JM2F 5F72S 3HR5A 5C86A 4KMTL 1NC4B 3WBDA 4UDTB 3FQXA 3ET9F 4OZIA 3DOSA 1MCPH 1CDUA 4H26A 3UBXB 1XF2A 2J1KA 4QRQA 3GNMH 4KI5C 2OZ4L 3VH8B 1WISA 4X4ME 1AE6L 4NIKB 4PLNC 4OV6F 1OTTC 1A3RH 1NC4A 1CFVL 4Y4KC 4QLRA 4UDTA 5D7LB 3ZHLA 2ESVE 4X83A 3UBXA 4PTTB 2AP2A 4H25B 3RWFB 5DWUH 4KDVA 3VH8A 2AK1H 1QLRB 1EHNA 3S37H 3QA3B 1EBPA 5D7SH 3RNKB 5D7LA 3HUJF 2P1YA 5DO2C 3F7RA 4PB0H 1RMFL 5EO9B 1CLYL 2FHBA 4PTTA 4H25A 3RWFA 4DUWA 1SY6H 3IDIB 4IRJD 4FN0A 1FO0H 1QLRA 4OLWH 1MFBH 4X0KB 3OKLB 1A6VL 3QA3A 1QTYT 2NW2B 3RNKA 1BM3H 1Z0MA 4M6OL 1T80A 4L8CB 4OQTL 1RIHL 2XQBL 2VXTL 5EO9A 1TQBB 3FT3B 4K55A 2QL1A 1GC1L 3IDIA 3T04D 3RX5A 4Z95H 1BVZA 3MBED 4QOKE 4X0KA 3OKLA 3EDFA 3G08B 4K07A 1ACZA 1JPSL 4OGXH 2NW2A 3QFJD 4GRLD 2X4TB 4OLXH 1IT9L 1NUDA 3S5LB 2NY1C 4WEMB 4L8CA 5D70L 3P0VH 3E8UL 1NLDL 3FT3A 3H9SE 1PZUB 4JG1H 5IWLA 1BQUA 3ARDD 5JZ7C 4UNVA 3OGOE 3G08A 3SDAD 3JWDL 2XI9A 2I27N 3MLWH 4NUJB 3VWKC 2X4TA 3PV6B 4XCCH 5L9DL 3S5LA 2IEPA 3HE7B 3UTOA 3IDNB 4JZJB 1EFXD 2R0KL 4XPHH 3U9PH 2HKHH 4LCWE 4PV8B 1KB5B 3WKNA 3UX9B 1OL0A 4JGJA 2QSVA 5DHVH 5T3ZD 4PS4H 2BVUA 2IBZX 5FGCB 3MUJA 4OI7A 5J1TC 4NUJA 3PV6A 3VXRE 1LO0H 3HE7A 3TYGH 2BNRE 5AAWA 3IDNA 2BVTA 4JZJA 4FRWA 3CFEB 1U36A 2XQYK 2Y5TB 4Y16D 1S7VB 1F3RB 3QHZH 4PV8A 1KB5A 3FB8B 5F71A 1UCTA 2ADGB 1E27B 2WIIB 2ZUSA 3KXFE 3LB6D 4QNPF 1R0AH 5DJDB 5L8KB 3RVTD 3KPSE 4KDTC 3CFEA 1A6PA 2Y5TA 4APQB 1S7VA 3T0WA 5CGYD 3FB8A 2XZZA 4LP4A 4N0FB 5FYJD 2ADGA 4YDKH 1E27A 2WIIA 3X11B 4CNIB 1Q0XH 4ALAH 3X17A 1DFBL 3ZYIA 5JMOC 5DJDA 1FHGA 4X5LA 4LHUG 4OBRA 2VDQH 5LGHL 4APQA 5C2UB 3OPZH 5I1AB 3QDGE 1YMMB 3O45B 4N0FA 3TCXA 4ZOAA 2A74B 3X11A 4CNIA 4M03A 4XTRC 4LAQH 3SDCC 3EKCA 4M61B 4Y5VB 2Y5EA 4LSQL 4NZRL 3CFBB 4M43H 4RAHA 1CTOA 1XCQB 4DGIH 5I1AA 1ODAA 1YMMA 3O45A 2EDNA 2VAAB 2YUWA 2A74A 4ODWB 5CLTA 4EN3B 4M61A 4Y5VA 2ZUTA 2YD3A 1X3DA 2W9EH 3CFBA 3C5ZB 1I3UA 1KXQE 2GJJA 1XCQA 1GAFL 2ZNWA 4NKDB 1NBYB 3R8QA 4YHOL 2QSTA 4TVPD 2VAAA 3H3BC 1H9VA 1AKJD 4ODWA 4EN3A 4HS3B 4QKXB 4B7IA 4MS8C 4NNYB 3C5ZA 5IEKB 4NZJA 5D2NB 3N9GH 1URLA 3Q48A 4NKDA 1NBYA 3LKOB 5C0JB 5MHSD 5DFWH 5J6GB 3WDIA 3UO1L 5DMYA 3NCFB 3SGDI 4DK6A 1QBMH 4HS3A 1GGCL 4PLOB 1KT2B 4NNYA 2X44D 4ELME 5IEKA 5I73C 3OKYA 5D2NA 2PYFB 5D8JL 4DW2H 3LKOA 3O8XD 2RBLA 4G9FD 4NUGH 2ICEB 5C0JA 5J6GA 3RGVD 2H2SD 1WICA 4EQ2A 1A7OH 1F6AB 3V6OE 1NAKH 1NKRA 4OZIE 4D9RE 1KT2A 2XTJE 4OKDA 3QR2A 1LE9B 1I4FB 3NCCB 3QYCA 2PYFA 3BIAX 3VG0H 2XYCA 5TE4H 3RZCB 5L7XH 5INCB 2ICEA 4ELMF 2F54E 3BMWA 3IRPX 4KWUA 1IBGH 2JELL 4JQVA 5I8EB 1VB9A 1F6AA 3VD9A 3CZJA 3CVHB 4FNLH 4WFFD 2GJ6B 3E3QE 4GSDL 1RJLB 4WWKC 1LE9A 5TE6H 4WFGE 1I4FA 3HC0B 4JB9H 4Z8FH 2UY7A 5GXBB 3RZCA 5E4IA 3VXSB 3F7QA 3QB7C 5INCA 1GGYA 4CGTA 4RMUA 1QFHA 3S36H 4MXQD 4DGVH 5I8EA 3CFIC 3LIZH 3CVHA 5IQ7L 2GJ6A 1MY7A 4P48A 3IS1X 1I3RB 4JY5H 4Y2OA 5D7LE 3HPLB 3AVEA 1RJLA 2PNDA 1MCLA 4ZXBC 5GGVY 3O3AB 3DTXB 5IBTL 2I25N 3HC0A 4WI9A 5A2KH 3MLRL 1DQLH 1AD0B 1IAKB 5DHYB 3GSRB 3VXSA 2YUZA 2UUDH 3IDUA 2VZ3A 4O58L 4XWGH 4JRXB 1I3RA 3HPLA 5JLZB 3PP3H 3BPLC 4M4RA 2B20A 3CFDB 3O3AA 3DTXA 1IGIH 2BFVH 1AD0A 1IAKA 5DHYA 5HYJE 3GSRA 2EXYC 1YNTB 2YD7A 5KTEL 4HJ0D 4OIBA 3TBTB 4JRXA 1IFHH 5JLZA 2PW1B 4EUPB 3CFDA 1T2XA 2J5LB 1UH3A 4QTHB 3DVGB 5HI3C 4WWID 3NABL 1L6ZA 1F4XL 2EDBA 1FYTE 2JJTA 1YNTA 4AG4L 2CGRL 2X1WL 4HULB 3UC0H 5EWIH 1AC0A 3TBTA 3GSOB 4GAFB 2PW1A 1JGUL 4QRRE 4EUPA 4YHNB 1W2KT 2DQDH 1T6WA 4P3CH 4QTHA 4LSRH 2R69H 3MLSL 3DVGA 4Q9BA 1JGVH 4OM1H 5E8EB 5DD5H 5TQ2L 2NXZD 4PTUB 1G6VK 1CVSC 3WO3B 2LTQB 4ZOCA 5BRZB 2ATKB 1XCTB 3GBNH 4FFZH 3QIUC 5D72H 2VKXA 3GSOA 1G7HB 1JCKA 1QRNB 1Z5LB 4FP8L 1ZHLB 4N5EC 4YHNA 3MJ9A 2OTWB 3VFTB 3W5MA 2F8XC 3AS0A 1OGAD 1VEOA 2NTFB 4FTVE 5E8EA 3SO5A 3QG7L 5F9OL 4PTUA 1CCZA 12E8L 5BRZA 2ATKA 3KJ4B 1OWWA 1XCTA 2YBRB 1IMHC 1J7VR 4CUCA 5BZDB 1G7HA 1QRNA 1Z5LA 5I1HL 1TFHA 1ZHLA 5F7FA 3UTTB 1T7XA 1NCAH 2OTWA 3VFTA 4C4KO 5I0DA 1V3LA 2NTFA 2ZCKL 2BOBB 3UTSE 2GY7B 1T1ZB 3TJHD 1VESA 1JPTL 3T0ED 1NCTA 4LASL 4PJEF 2YBRA 3Q6FB 4N1HB 4FG6D 4PP1D 4NGHH 5BZDA 5ADPH 2IQ9H 4Y19E 1EK3A 1DANT 5EUKB 3UTTA 4B41A 4HIEB 3BOVA 4MA3B 3CXDH 1NCBL 4G6FD 4R4FL 3HAEG 2BOBA 2ZUUA 3U83A 1OPGL 1T1ZA 4PUBH 3O9WB 3D0VB 2APXA 1ZVYA 4OB5H 3W0WD 3Q6FA 1RI8A 1JYVA 3G5ZB 2EC9U 5E2TH 3AXLB 5D1ZB 5EUKA 1BJ8A 4HIEA 1HINL 5KSUB 1JRHI 5DXWA 4MA3A 1UXWB 5TJWK 4MWFB 3MUGB 2AEPH 4X7EC 1MCOH 1YMME 1CDIA 3O9WA 1KLFA 3D0VA 2AW2A 3AREB 1RZ7H 1NPUA 4GRWB 1FG2B 3G5ZA 2EDRA 3AXLA 5D1ZA 2BCKB 4LK4A 5KSUA 3BO8B 1UXWA 3PF2A 4MWFA 2J4WH 3MUGA 1U8JB 1TXKA 3MV7B 4F80A 3CMGA 3MXWH 4MA1B 5T3ZH 3AREA 5I71B 1FG2A 3QFDB 1PZ5B 3S35L 4HFUH 1OAZL 5MI0B 2BCKA 4ZTOH 3SDYL 3BO8A 1P5UA 4NRYB 4X8JB 5IB2B 1YYLH 2CR6A 1U8JA 2IFFH 3CLFL 4YHKL 3MV7A 4DQOH 2EZ0D 3KDMB 1N6QL 5EU6D 4KK8D 3QFDA 4NWUH 1PZ5A 5I8OH 2VTFA 4NFCA 2R2EB 1RUAH 2GSGB 1VHPA 1NMBH 4NRYA 5D2NE 4X8JA 5DEFB 5IB2A 4ZYKB 1UYWH 4ODTL 3TF7C 1FIGH 5GPRA 4EXKA 3MNZB 3KDMA 4K9EH 4NKOB 5CKGA 3H0TB 5FYJH 2CDGB 3ARUA 3DV6B 3CX2A 4HC1L 1SM3H 3QXTA 4X7FC 2Q6WB 2MNUA 2R2EA 4U0RC 2GSGA 2NY5H 4N0UE 3WLBB 1FPTH 1ZXQA 4K23H 5J4MA 5DEFA 1K4CB 4ZYKA 3OAUL 5JW4R 5DJYB 2BXZA 3MNZA 3K4ZA 4NKOA 3H0TA 3MXVL 2CDGA 1AD9B 5HBBA 1U91B 3DV6A 5F1IB 2EECA 4WFED 1XZ0B 2Q6WA 5D2LB 4JPKH 2GY5A 2F8OA 4WHTB 5H37H 3L5HA 3WLBA 2XIDA 2WUBL 2EO1A 1K4CA 2VOTA 1CDYA 1S7TB 2XRAH 5DJYA 1JGLH 4M7ZB 5E0QA 1AD9A 1U91A 5F1IA 1F42A 4HAFA 1XZ0A 4P3WA 4I8DA 1J10A 5D2LA 4MA7L 2GJ6E 4Z78B 1T2QH 5CD5C 4GXUN 5C2BL 4WHTA 4L3EB 4OLVH 1WIOA 4OCMC 4XCNB 2Q8AL 1S7TA 1PKQE 4HGKC 5IBLD 4MAYD 4L29B 5EU7C 1RZGB 3RY4A 4OCXH 1E4KC 2AGJL 5CGTA 4Z78A 4RMQA 4XAWL 1KB5H 5FM4A 1M7DB 4L3EA 1NGPH 1MCIA 1KN4L 4LEOB 4XCNA 5BMFH 4WTZA 4GBXC 1A14L 1NFKA 1BIIB 5F7HA 1QUNA 4NQXB 2IPKB 2XPGB 1Q9KB 4L29A 1RZGA 4I0KA 1YEEL 4R6UA 4UU9B 3ZHDA 4F37F 1M7DA 35C8L 2A0LC 4QHKI 1CLOH 4LEOA 4MZ2A 4U1SB 3GSXB 1CGYA 1P84J 1T1WB 1BIIA 3SE3C 4NQXA 1V05A 2IPKA 2XA8H 2XPGA 1Q9KA 2AXFB 4M8QB 1AJ7H 1ULVA 5F7EL 4KVCL 1GH7A 2VXSH 4MQSB 1FSKB 3HZKB 3OKNB 3MRCB 4UU9A 3TZVC 1S9WB 2WWKT 4F9PC 5IFHH 4UNTA 3PL6B 1CGWA 5D6DA 3O6KL 4U1SA 5LAXB 3GSXA 1T1WA 3BGMB 3T0BA 2WBKA 1JV5B 5J11C 2AXFA 4M8QA 4UT9H 3DECA 4RGNC 3D3VB 4X7DC 5FO9B 1B0RB 3HZKA 3OKNA 1RUPL 4PRHD 5DT1L 3MRCA 5D1QC 1S9WA 3TT1H 2CJUH 3PL6A 4RWHA 5LAXA 1NUNB 3BGMA 5F7DB 5TFSL 1VCAA 5IHLB 1DBML 3MRBB 2ADIB 5DMIL 1JV5A 4PJCE 1V8HA 3WFCL 1B4JL 2NZIA 5GGVH 3D3VA 3QIWB 5FO9A 1B0RA 2V5RA 1Q0YL 4PRPD 2X4UB 3DETC 1FGNH 4Y88A 2XA3A 5CILH 2DIJA 1F58L 5AYUL 3PHSA 2X6MA 4OT1H 3T3PE 3IGAB 3WV0A 5HYQB 2H2PD 2XN9B 4XC3H 3GO1H 3PJSB 5F7DA 5I17B 3MRBA 2ADIA 3B6SB 4KTYA 1VADB 3D85D 3VXMB 5JQ6L 1CFQB 3OG4B 5I74C 3QIWA 4KHTH 1DSFL 4FABH 2X4UA 1DR9A 3JWDC 4PJCF 4O2EB 4ORZC 5CCKL 2IAMD 5DLMH 2BK8A 3IGAA 5HYQA 4FQXB 3DYPA 1BVKB 4MLIA 2XN9A 3MJ7B 3PJSA 5E7FA 3TPUB 2GW5A 5I17A 3B6SA 1VADA 1TJIH 1B0GB 1B90A 2R29H 3VXMA 1MPAH 1CFQA 3ULVL 3C2AH 3ULUE 1AR1C 5M7QA 4O2EA 5AYQA 1K6QL 5KVEH 2FSEB 2J88L 1E4JA 4FQXA 3C08L 1BVKA 1RD6A 3EUUA 3EOTL 3MJ7A 3TPUA 2W1NA 4XVTH 3VW3H 1B0GA 1MHCB 3UEZA 1U0QA 2X40A 3FAWA 4MNQB 1JI2A 2IC2A 3B9DA 4HKXB 2FSEA 5SWQB 1E4XL 1AP2B 3UTPE 1ZVSB 3T8XB 3ULUF 4GLRI 4C55A 5CJXC 1MHCA 1GIGH 4MNQA 1HIMH 1OCWL 2Z8VC 5EZIH 4Y4KB 3QUMB 4IRSD 1ADQA 1AGEB 1WF5A 4HKXA 3AY4C 4JFDD 1EERB 2LAAA 5SWQA 1FNSH 1AP2A 1ZVSA 1UA6H 3T8XA 3QI9C 4HZAA 4DUVA 3HZYB 3UAJD 1S5IH 5E24E 2XV6B 3GI8H 4QXGH 5HJ3B 5T5NF 3IFLH 3DHJA 1MCSA 4C57C 4Y4KA 3HMWL 3S3PA 4LLDB 3QUMA 2XKNB 1AGEA 3JWOL 1MH5B 1JP5A 1C7SA 4JGMA 3T0AA 1V7ML 1D6VL 3MLUH 3QWRD 5T1LD 4P2QB 3VWJB 1BFOB 1FDLL 5EH1A 3HZYA 1ZE3C 1V7NH 4R26L 1YEIH 2CKNA 5CSBA 1T66D 5HJ3A 4BK5A 2VL4A 1PDKA 3FKUS 5EOCL 1CXEA 4LLDA 4KKLC 2YHGA 2XKNA 3LN5B 4F7TB 4FZEH 1MH5A 2AJ3B 3WLWD 3P40A 2HH0L 4P2QA 3VWJA 5FUCC 1BFOA 4JO4L 4HWNA 4RWYH 3WKMH 4YXHH 4WV1C 2KPNA 3SDXB 2YA2A 4NBYB 4FZ8H 1IAOB 1RZJH 4S10A 3MRHB 3LN5A 3ETBF 4F7TA 4WFHD 5LBSH 1VENA 2AJ3A 3UZQA 3W2DH 3GSUB 4S1RL 4Y2DD 2HLFC 3QH3B 5I30L 3SDXA 4IRZL 5LQBH 3P4NB 1IAOA 2EDLA 4EUPH 3MRHA 3ZKNC 2JIXD 2P49B 4ODSL 5E1AB 1Z3GH 1ZEAL 2YA1A 3HG1B 1GGIL 3JZ7A 4P9HL 5D2LE 3TVMD 5IB3B 3GSUA 1MLCB 4DEPC 5DMGD 2AK4D 2W60B 3VRJB 3PDDA 2VLKE 3QH3A 2F58L 4LHQB 1GZQB 5GJTH 3P4NA 4RFOL 1PQZB 1DP0A 1QYGL 3QDAA 4CU8A 2NX5D 1IAII 2IANE 1YEGL 5E1AA 4JM2D 3HG1A 5IB3A 1K8DB 2VDNH 2APBA 2Z8RA 1F3DJ 1OTTD 1QSEB 1MLCA 3VRJA 2W60A 1S7WB 1WITA 2MQ0A 4TUKH 3B4NA 1GZQA 5DD1L 1PQZA 1AXTH 5C71A 3VD7A 2FHFA 5DVLA 1TNNA 5IB4B 1FFQA 4M1DL 3ARYA 4OF8A 5FV2A 1AHWB 4Z0XB 1MLBB 4WO4C 3INUH 3RHWF 4EVNB 4K8RD 4XMKH 3T3ME 1K8DA 1AY1H 4Y5YC 2D7TL 1I8LA 2P5WD 1QSEA 4LCIH 3RWIB 3U7YH 1F13A 2YA0A 1S7WA 3PP4H 5ADOL 2X2YA 3VRIB 4CMHC 1LO5B 2R9HD 2RAMA 1UEYA 5DO2D 3EOBB 5A2LH 4J3XA 2ENSA 5E8NB 2BHUA 5IB4A 3MFFB 1AHWA 4Z0XA 1MLBA 1FNEB 4EVNA 4KDTA 3B9EA 4YIQB 2Z31B 1MCPL 1NGXB 3RWIA 1SMAA 4PRID 4TSBH 5F88B 3VRIA 3GNML 2WINB 1LO5A 3DUSB 4CDGC 3FO0H 3EOBA 5KSAD 4L9LC 2E6QA 5IVXE 1VFAB 5E8NA 4G7VH 3SDCB 4MQXD 3MFFA 2P5ED 1FNEA 2ESVD 4YIQA 2BSSB 2N7BA 2Z31A 1UVQB 1NGXA 1OARH 5KZCB 4KXZH 5F88A 3ISWA 2WINA 5DWUL 3DUSA 4WGWB 2NY1D 2AK1L 3JXAA 1VFAA 1OT1A 3D3VE 3S37L 3SDCA 2YXMA 5D7SL 5D9SB 5JZ7D 1U8NB 2BSSA 5IVXF 5DD3H 1BZQK 5CEXB 1UVQA 1XMWA 4PB0L 3TN0D 4IDJH 3VMOA 1EAJA 3VWKD 1YC7A 1SY6L 4U1LB 4H20H 4GRWH 1FO0L 4I1NB 1HH9B 3DARA 3UTQB 4P2OD 4WDIB 1MHHB 2Q8BH 4P57B 5D9SA 3CX5J 3QPQD 1U8NA 4KMLB 1CGSH 1AGBB 5CEXA 4ERSL 4G6AC 4UILL 5AZ2H 1YDPB 2XN9E 4NZDA 4U1LA 4QOKD 1MCWM 1HH9A 1KELL 3QUYC 4Z95L 3UTQA 4WDIA 1MHHA 3AS2A 43CAB 4OGXL 4P57A 4EI5B 1MJ7H 4DAGH 4OLXL 1MCCA 3B9AA 3GM8A 5I73B 1AGBA 3FZUC 3IFNH 3P0VL 4XC1H 4EBQH 5KVMC 5CZXD 4JG1L 1YDPA 3G6AB 4NO0B 2PF6A 1KG0B 4PYGA 4AY0A 43CAA 1UJTA 3ZDXE 2E8YA 4EI5A 3MLWL 4XCCL 2GT9B 1I1CA 4X8XA 3S4SB 3RVXC 1FZKB 2VDOH 1QOKA 3ZDYE 2DI8A 2YN5A 2X89A 3EDKA 3G6AA 3U9PL 3T77B 3ZSTA 4NO0A 2HKHL 5IFJB 5FM8A 3FRPA 1KG0A 2BNQB 5DK3A 1BHGA 1MRFL 4MNQE 3VXRD 4PS4L 1CDJA 3CFCH 3T2OA 2GT9A 2BNRD 1S9XB 3S4SA 1FZKA 3ZDXF 4XTRD 5DURD 1P9MC 3QO0B 4WUUB 2XWBB 3T77A 4LKCB 4CU7A 5I66B 5IFJA 2BNQA 4ZUUB 1KLUB 1PD6A 2VN4A 3ZDYF 3T1WA 1P2CB 4XP5H 1S9XA 2DQHH 4WENB 2DBLL 4MCZB 1EJ6A 4RMWA 3QO0A 3VFGH 4WUUA 2VLJE 2XWBA 4LKCA 5I66A 4JKPH 4ZUUA 1KLUA 5F7LB 4JFQB 4YDKL 4KI1A 1P2CA 3LH2H 5D7KE 4ALAL 5IMMB 2BNUB 3NPSC 3BPLB 1UH4A 1UWGH 5HGDB 1BF8A 4LLVB 2QQLH 4MCZA 4P2QE 4Z7OE 2MJWA 4QT5B 2VDQL 4PB9H 2VABB 1BBDL 3VXPB 2VN7A 3I2CH 4I0PC 4MS8D 4JFQA 3MREB 3GRWA 3JTSB 3U30C 3X3GH 5HSFA 2CLZB 4KRPC 1F97A 1T03H 3EHBD 3QT2A 4H0HB 4LAQL 2BNUA 5DJ0B 5C0CB 5IMMA 5L88H 5HGDA 3QSKB 4YHMH 3BP5B 2GTWB 2Z93B 4LLVA 4QT5A 2VABA 3FAXA 1U8KB 3VXPA 1ZLUK 4Y5XB 4DGIL 4U2ZA 2W91A 4Z7OF 3MRQB 3MREA 3JTSA 4KK9C 3VE0B 2CLZA 2O5XH 4OFIA 2VDRH 3I50L 5DJ0A 4FQCH 5C0CA 1YEHL 3BP5A 2GTWA 1WIUA 2W9EL 2Z93A 3F7YB 1N2RB 5LVEA 3QNXB 4KRLB 1U8KA 4Y5XA 1ZGLB 5F70A 1T7WA 1D9KC 3MRQA 3VE0A 5C6TH 2X09A 1KCKA 2ZUXA 4M1GH 4F3FB 4J2XA 4MMXC 1GJIA 5GJSH 2VITB 3HG1E 4WW2B 3ARBC 5GS1C 3F7YA 1N2RA 1U92B 1PY9A 3QNXA 2P47B 3QDJB 3MV8B 4L8SC 3N9GL 2ED7A 5TGBB 1IGMH 1ZGLA 4L4TD 4WWKD 5C9KA 4KMQA 2MCG1 4MJIB 4F3FA 2HJKB 3BYYA 4OTXH 5C70A 3MA7B 4NCC2 1QBML 2VITA 3PGDB 1MEXH 1F3DH 4KROC 4WW2A 4H5SB 5C9JB 1WAAA 5IBUG 1U92A 3LV3B 3QDJA 3BN9D 2VZVA 3MV8A 4ZS7H 4DW2L 5TGBA 3WS6C 4ZXBD 4OCYH 2YK1H 4NUGL 5EOQH 1DBKH 4MJIA 4PJBF 2HJKA 1A7OL 4D9RD 4QY8B 2AJVH 2XTJD 3G6JB 4QXWA 3MA7A 3PGDA 1NAKL 3ECBB 4H5SA 5C9JA 3WNNA 4KVNH 3LV3A 2KDGA 3VG0L 2F54D 5TE4L 5L7XL 4CVWA 3R0NA 3ARFC 1IBGL 1XGRB 4NC0B 1JK8B 4QY8A 3G6JA 4KH2A 4RFNC 1GOFA 5KBNC 4WU5B 2EXYD 3ECBA 3IJYB 4W4OC 5TE6L 2JKXA 5FOBB 4JB9L 1PEZA 4Z8FL 2VNCA 4P2RD 5EO1B 2R39A 1XGRA 1JK8A 3DRQB 3W82A 1LP9B 3T2QA 3LIZL 3F7PC 3ARPA 4MJ2A 4WU5A 4B7LA 3JSSA 3IJYA 4NQCE 4ZOBA 3B5HA 3HS0B 5FOBA 1ADQH 1R5WB 1DQLL 4OUOA 3K0WA 5EO1A 2APWA 3LQAC 2BVPB 3KPRD 3DRQA 1LP9A 3U4EB 4XWGL 4AT6B 1KCUH 3ULSB 5JXEC 3BWUC 3UDWA 4TVSa 5JIHA 4Q58C 2XOTA 3HS0A 1IGIL 3QIUD 2BFVL 5HYJD 3TWCH 1R5WA 5T3XD 3VH8G 1DLFH 2J2ZA 3FQUB 4ONFH 3BKYH 2BVPA 2W38A 3U4EA 1KSRA 4K8RH 4AT6A 1IFHL 1VGEH 3ULSA 5F1NB 2VLRB 3TO4C 1MWAL 3U0TB 5B3NA 4XNXH 2J6EA 4Z7QE 1FYTD 3FQUA 5HYSB 1F11B 4J3SA 1VPOH 5FDWB 1RURH 1M6OB 1J9CT 5FYKE 4QRRD 5EWIL 3KNBB 4LFHD 2DD8L 4FS0A 4PJIF 5F1NA 5BO1H 2VLRA 1CL7L 3U0TA 2DQDL 4DN4H 4P3CL 1IJ9A 4LSRL 4LF3B 1JGVL 3VI4E 4OM1L 5HYSA 5DD5L 2HN7B 4KKCC 2OSLB 1F11A 5FDWA 1M6OA 1WBXB 4Z7QF 1U3ZA 4FFZL 5D1XD 5D72L 5DJ2B 3KNBA 5IG7B 2ILLA 1TITA 4KKBC 4FTVD 5C7XH 4LF3A 2X9XA 3LPGA 4U1GB 2YPVH 3LMJH 2HN7A 4PGBB 2OSLA 4ZQKB 1XF4B 1WBXA 2OBGA 2A6KB 3VI4F 5DJ2A 3RDTC 5JOPD 3ZE1F 5IG7A 5KVGH 3CIQA 4L8DB 2WANA 3V95A 4LFHG 1NCAL 1N0XH 3UTSD 5F8QC 3TA3C 3BSZH 4WUUE 1FJ1B 4BFIB 4HLJA 4PGBA 5SWZB 3GJFB 4ZQKA 1XF4A 4Y19D 2A6KA 4NGHL 5ADPL 4YX2H 4L8DA 4GBXB 2MQCA 1C08B 5EZOH 3CXDL 5IT2H 1WWAX 1FJ1A 4BFIA 2MHAB 3OZ9H 5L2KE 5SWZA 3GJFA 1E4KA 1J0IA 3WD5H 4OB5L 4OI8A 1JYXA 5DRWB 3AUVA 1X9QA 5E2TL 3V5HB 3QCTH 4GBXA 3D25B 1C08A 1ETZB 3K2UH 5FEBA 2AEPL 1MCOL 2MHAA 4U2YA 5F6IC 4F33B 6FABH 5FDYA 5EDXA 2H1PL 3SGDH 3TZVB 3ELAT 5DRWA 1RZ7L 3HCVB 5DDHB 3U0PB 5C0CE 3D6GA 3V5HA 1N7MH 3D25A 1ETZA 5LGJB 1SEBB 1IC4H 5C0IB 2J4WL 1U8HB 3OKKB 4RGNB 4YGAB 4F33A 3MXWL 1T7YA 5T3ZL 3TZVA 3ZLQC 4F9PA 3HCVA 5DDHA 3U0PA 3KLHD 4NO3B 3UP1A 1W72H 3C5ZD 2D4DA 3LS5H 2DBJA 4PRDB 4HFUL 4P5TC 1S3KH 2X4SB 1OY3B 4YGVB 5LGJA 1SEBA 1IQWH 1YYLL 5HTSA 5C0IA 1U8HA 5IROC 3OKKA 2IFFL 3SDDC 3I02B 4DQOL 1NSNH 4Q0XH 3RI5K 3K1DA 2KKQA 1YEFH 2ZPKH 3EYQC 5FECB 3TYFB 5EBWB 4NO3A 4NWUL 5I8OL 2J8OA 4PRDA 3MODH 1QZ1A 3QISA 2GK2A 5LXGH 2X4SA 1NMBL 1WAAE 4HPOH 1UXSB 4OQTA 1G9EA 4GG8B 3QDJE 4YGVA 3ESUF 1OTSD 3QNZB 1KTLB 1DL7H 3MV8E 3WFBL 1UYWL 1IARB 1FIGL 4WU7B 3I02A 2C4FU 3OJVC 5FYJL 4OGAC 4C56B 4YHZH 3BUYB 5FECA 3TYFA 1SM3L 5EBWA 4F9LC 5JXAL 1E4XI 4CN1A 4QYOB 4V2BA 1HEZB 2NY5L 4KQ3L 5F6HI 1FPTL 2C9AA 1UXSA 4JFZH 4GG8A 1FGVH 4HK3N 4K23L 3QNZA 1KTLA 3D39B 5FIEA 1MNUH 4WW2F 4WU7A 4XMLH 1WAAF 4I3RH 4BK4A 3EW3B 3SKOB 4C56A 3FL7A 3BUYA 1XR9B 1FVCB 3BRFA 1AO7B 4JPKL 4QYOA 2VR5A 4S1SH 4X98B 3MCKB 1HEZA 4OCRH 1FC1A 4JLRB 1RULH 5EBGA 3D39A 2XRAL 5CZVH 4L5FH 3DBXB 5DC4B 1JGLL 3SKOA 5F44A 1UT9A 1XR9A 1I3VA 1FVCA 3EYSH 1AO7A 4KTDH 1T2QL 2G60H 4KTEH 4O02H 1SJXA 5KSBE 1M4KA 4X98A 3MCKA 4J4PC 4HMEA 2XZQH 4JKWA 4OLVL 3V0WH 3R06B 4JLRA 2LVEA 5E6ID 4NC2B 1N64H 4YHPB 4J3VA 3DBXA 3IB4A 1G1YA 2MWCA 3RIAK 3V0AC 1N0LA 3QBTB 2ZNXA 4I5BB 1CZ8H 1INEH 4OCXL 2Q1EA 4HH8A 5HGHB 1LP9E 4JFPB 4RBPH 4Z7WE 4K7PX 1KB5L 4LGSB 4YXLH 3H3PH 4Z7NE 1NGPL 1SVZA 3R06A 5EC2B 3W9DB 5D1QD 5BMFL 4HUUB 4YHPA 5KSBF 2D9CA 4J12A 4NQDD 4UI2A 2IBGA 4I5BA 5HGHA 3ZMRA 3AY4A 1NGYB 4K3EH 4JFPA 3C09B 5DGQA 4HUNB 4P46B 2QJDA 3CSGA 3X3FH 5EC2A 1CLOL 2BRRH 3W9DA 1SMOA 3DETD 4HUUA 4N8CH 4Z7WF 4QTIH 2AEWA 2MCPH 5IM7B 1EMTH 3L95B 2WNGA 5FOJA 3WHXB 2B1AH 4GXVH 2VXSL 2DKMA 1NGYA 3RU8H 2C3VB 2VQUA 3RAJH 5MENB 4CW1B 4TNWK 3MOBH 5BS0E 4P46A 2YRLA 2XXCB 5IFHL 2B7DT 4WV1B 4XNYL 2EIDA 3HI1B 5F97E 1JHTB 3MLPA 2EYTB 3PP3K 5IM7A 3VDCA 3L95A 4UT9L 2DLTA 3WHXA 4BA8A 5IOPB 4NWTH 2C3VA 4Y4HC 3AM8C 1YPZB 4HQQH 3RWDB 4CW1A 4XNUH 5MENA 3TT1L 1XFPA 4FQLL 2CJUL 4WV1A 4OI9A 3HI1A 5T1KD 2UV3A 4XP9L 2YUXA 1EA9C 4WI3A 1JHTA 2J8UE 3N1QC 2R2CA 5GGSY 2EYTA 4R90L 3D2UB 5C09E 5D7JC 5GGVL 2DQCH 1L9MA 4PBWD 5IOPA 1QQDB 1HCFX 1YPZA 3RWDA 1FGNL 4DEPB 1MVUB 5CILL 2P43B 4N9GB 4OT1L 4D9LH 1OAKL 1S7QB 3VDAA 5L2JB 4XC3L 2K1MA 3GO1L 3SKJL 1YYMH 4D2NA 2NR6D 1INDH 2H9GB 4GMSH 3D2UA 5FM5O 4KHTL 3PWLB 4FOMA 1QQDA 2J8UF 4FABL 3SE4A 5J1SC 1MFAH 3MV9D 4OFYD 5A40E 1FNAA 1MVUA 5E8PB 3WHE1 4N9GA 1NEZB 5DLML 3LN9A 1S7QA 2BOCB 5L2JA 5T3XH 3VDBA 25C8H 3EFDH 2GSIB 2H9GA 4M00A 2R29L 1MPAL 4WO4B 5GS0D 4LIQE 3QI9D 3X12B 3I85A 4U1HB 4PJ5D 3C2AL 1A6WH 3PWLA 5JNYB 4RMTA 4Y5YB 5FYLE 1DJSA 1NEUA 5E8PA 4G8GE 1F6FB 3MBXH 3SKUD 1NEZA 3REVB 4BFEA 3WIIH 2BOCA 3WDHA 4Y8DC 4XVTL 3VW3L 2HT4C 2GSIA 2EDXA 4WO4A 1NCUA 3GUTB 3X12A 4HLZH 4U1HA 5JNYA 3UTZB 4Y5YA 4DKEH 4BUHA 2X1XR 2P8MB 4KKLD 3REVA 3U4BH 2PO6D 3SE8H 1TLKA 5J3HD 2VSDA 4L9LB 1GIGL 3QEQE 2GKIA 1HIML 5EZIL 3MZGB 3GUTA 2VXQH 3U79A 3UTZA 1XGPB 4OZFB 2P8MA 1FNSL 5T33H 1UA6L 5D7IB 2WAHA 4OFVA 4L9LA 1WZKA 4LMQI 1FFOB 3KPMB 1S5IL 4XPBL 3IFLL 3LKNB 3GHEH 2HLFD 2H45A 3K8MA 1N6VA 1XGPA 1XEDA 2XICA 4OZFA 3MLUL 3ZKND 2FJFB 3LS4H 1NBVL 4Y1AB 5D7IA 5KW9H 1MAKA 1FNHA 4M7KL 1FFOA 1V7NL 3T09A 1YEIL 3KPMA 4ZAKB 3LKNA 3P9WB 2YD2A 3EYOB 2IPTH 4WY7H 4FZEL 4RGMC 3OX8B 4R97C 2X9YA 4LLUB 2R2HB 2FJFA 3L1OL 3QRGH 4RWYL 4Y1AA 4YXHL 3PXHA 5HGAB 1RZJL 4ZAKA 2ERJB 1MCEA 1LDPH 3LD8C 2Q7NA 3LY6A 3EYOA 3OR7B 1R3IH 2J6EH 3TIDB 1LGVA 3OX8A 3O41B 2FJHB 4LLUA 5GRVL 2R2HA 5GZOD 2W65B 2NY2D 3CFJB 5I16B 3D39E 5HGAA 5LQBL 2DIBA 3VGHA 5FM5M 4LVOC 3O0RH 4KRMB 1XGQB 2YKLH 3SJVD 3OR7A 4X6BB 3V6BR 3TIDA 1Z3GL 1AO7E 3O41A 2FJHA 4LBEB 2VLKD 3FFCB 2W65A 3L9RB 3CFJA 2L0DA 5I16A 4XPAH 3FQNB 3VI3E 4MD0B 5GJTL 2IAND 5KANG 1J0HA 3BKMH 4XNZC 4PJHF 1XGQA 4M3KB 3IKCB 4X6BA 4J1UB 5DHXB 4Y7MA 5GRUH 3ZKSD 2NY4C 5ID1B 4LBEA 3FFCA 4Y4FC 5E2WH 3L9RA 5D5MB 4JRWA 3FQNA 4MD0A 3BPCB 1AXTL 2YSSB 2HYMA 2EDWA 3DYOA 3IU4H 3IKCA 4NFDA 4EZMA 1J8HB 4J1UA 2I60H 1MIMH 5I2IB 4XMKL 3ARGD 1NBZB 4GS7B 3V5KB 4F7EB 5ID1A 3VGFA 4LCIL 3U7YL 5D5MA 3QCUH 3IDMB 3BPCA 5E95B 4XNQB 2YSSA 2D31B 1Y6MR 4KUZH 3NPSB 1UC6A 3VFNB 1J8HA 3D18B 3WO4C 5I2IA 4XXCC 1NBZA 3V5KA 4EXPX 3MR9B 2ED8A 1A22B 4F7EA 3IAPA 2BSED 3GJFH 4TSBL 1FNFA 3U48A 2XG4A 4WTZG 1ZKAA 4GJTB 3U30B 3FO0L 3IDMA 3GKZA 2ZOLB 4PJAB 4XNQA 2B2XL 2D31A 5CKAA 2AV1B 1YZZA 2D4FA 3VFNA 4TOYH 3AFLA 3D18A 3QUYD 2DKSA 5EU5B 3MR9A 1IZKA 5TE7H 2COQA 1OQOA 1OARL 1ZMYA 1T04B 3CAFA 4NJAH 1EHAA 2ZOLA 4PJAA 1UADC 3O2VH 3WN5C 2G2RB 1T83C 2AV1A 1KN2H 4XP1H 3L3HB 5I9QC 1JPST 1YPZE 4JN2B 5DD3L 5EU5A 2O61B 4WGVB 4IDJL 1S8DB 4BUGA 5T5FH 4JR9H 1T04A 2YPLB 4H20L 1J5OL 5J06A 5BW7C 3A6BH 2G2RA 2Q8BL 3ARBB 2FEEI 3L3HA 4LRNH 1NCCH 4JN2A 1JNHB 3NA4A 2ICWI 2O61A 3LHPH 4L8SB 1S8DA 4MCYB 2XWJB 4GLRH 4LHJB 2YPLA 2WIMA 3VD4A 1H3PH 3DGCR 5D93B 4I2XE 5JTWA 4Z7UE 3OGCB 3HRZB 3QUXD 1D7FA 2VXTH 3HKFA 1W0WB 3ARBA 2XFXB 1MJ7L 4HWBA 4DAGL 4HC1A 1JNHA 2NY3D 3OV6A 3IFNL 4L8SA 4EBQL 4MCYA 1F4HA 2XWJA 3C6LC 2AJZB 2QLVB 5L8JB 3ARZA 4LSTL 3P9MB 4LPXA 5FO8B 1A1MB 5GISL 3ZL4H 2H41A 3OGCA 3HRZA 4YDIH 1W0WA 3B8YA 2XFXA 4P2YA 5DEGB 4Z7UF 1CN4A 1EXUB 2VDOL 4G6KL 2KQMA 2PR4L 4X6DF 3RUGB 1AGCB 2AJZA 2B1HL 3P9MA 3ARFB 5FO8A 1A1MA 1KUMA 4JFED 5L9DH 2VSCA 1GHFH 4IRJC 4RFNB 1PX4A 4YDVB 2H8PB 3CFCL 4I0PD 2R0KH 5DEGA 4JRYD 2QKIB 3T1FB 1P7QD 1EXUA 4KRPD 2M1KA 1OW0A 3IAGC 3RUGA 1AGCA 4GO6B 2BERA 3FN0H 2H32B 1RZIB 2HMIC 3U9UB 2FJGB 4S0SD 4KZEH 3ARFA 1JMXA 3HI6H 2ATPB 3EFFB 4YDVA 4FMFA 4LSDA 1QD0A 4XP5L 2H8PA 3MJGX 5DRXB 4G9DB 3DXAB 2QKIA 3T1FA 4EJ1C 2VLJD 4KHXH 2DQHL 1XT5A 4GRLC 1KPVB 1GCFA 2Y7QB 3BZDA 3VFGL 1TZGL 5E6ZA 5D7IE 3MJ6A 4V1DB 2H32A 1RZIA 3BKCH 4GRMB 3P3YA 3D1MC 3U9UA 2FJGA 4AQ1B 1JL8A 4JKPL 4POYA 3OQ3B 3IF1B 4RQQB 3UJTH 5D7KD 2ATPA 2YD4A 2EE9A 2EIEA 3EFFA 2V17H 3LH2L 1RZKC 5DRXA 1NBQA 4G9DA 3DXAA 1D9KD 3SDAC 1UWGL 4WCYH 2O5YH 3CNKA 1KPVA 4OLZH 4WJ5B 2Y7QA 4PB9L 4Y1AE 3NFPB 4V1DA 4GRMA 4LGRB 1S5HB 3VXQB 3IF1A 4RQQA 3KGRA 1E28B 1IAIH 4IBLT 5GS0H 3X3GL 3NCEB 2O5ZH 4JY6B 5D7IF 1T03L 2PYEE 3OAYH 3TO4B 5L88L 4YHML 1CK0H 4KJYB 2AABH 3RVUD 4WJ5A 4YBHA 1UM6H 1IGJB 1ACYH 3NFPA 4KROD 2FH8A 1JHLL 1WWCA 4NM4H 4PGJA 2DS4A 1S5HA 2ZUYA 3VXQA 2EE2A 2VRAA 4Y16C 1E28A 3NZ8B 5GHWL 4PR5B 4JY6A 2O5XL 3H9HB 2VDRL 2FBOJ 4EOWH 4PD4J 1I9EA 2RB8A 4FQCL 2CKBL 2VDLH 3TO4A 2CLVB 4KJYA 4GKZB 3L3GB 2EH7H 5C07B 3LB6C 3ZYZA 2AV7B 1IGJA 2M26A 3RVTC 2HP4A 3ZKXB 1M71B 5JOFB 3NZ8A 4FQHB 1VERA 5C6TL 2CDFB 4M1GL 4PR5A 4XZUB 3W39B 3H9HA 5GJSL 2CLVA 3ZE0E 3IFPB 5DD0H 4GKZA 3L3GA 1DEEB 5C07A 2KUTA 2AV7A 3CFKB 1JN6B 1M71A 1VFOA 5JOFA 1D3CA 4FQHA 2CDFA 4XZUA 3W39A 3RDTB 4OTXL 3T0VA 4RX4D 1MEXL 4PP2B 4W6YB 3IFPA 2EIZB 3TA3B 3KWWB 1RJZB 1DEEA 5D5ME 1QPPA 4ZS7L 3EYUH 5F1KC 3CFKA 3ZE0F 5CJOH 4OCYL 1JN6A 5EOQL 5GGTL 1DBKL 5FHBH 1CD0A 1HH6B 1UWEH 1GGCH 3RDTA 3ZO0A 2AJVL 1J8HE 1U8QB 4PP2A 2EIZA 4Y89A 3TA3A 4KVNL 3KWWA 1RJZA 1RK1B 5JXED 3MLXH 1YQ2A 1TIUA 5B38B 1ZHNB 1J1PH 1S9YB 2F8VA 1HH6A 3MUZ1 2CR3A 3OXRB 1K3ZA 1U8QA 1TNMA 4F58L 4HUWB 1IZJA 3STLB 2NXYC 3N1FC 4Y8AA 2IPUK 1RK1A 3EJYD 3RWEB 3NFSH 5B38A 1CICC 1ZHNA 1PBYA 1EZVX 1S9YA 2BVEA 3P30H 5IW6B 3NTCL 3OXRA 2ZSWB 1UEMA 2DMKA 4NQCD 3NIGF 4HUWA 3STLA 1MRDH 3V4UH 2UZIH 2FLRT 3RWEA 1KGCD 1IRAY 1IAIM 4RFEB 1U2CA 5IQ7H 3S9DB 3IDYB 3GSNL 4HCRH 1P84K 3FRUB 5IW6A 3U7AA 3O8XC 4BH7B 2ZSWA 2R1YB 1KCUL 5IGXH 4P5TB 3RGVC 3CSPA 2H2SC 4XX1E 2VZOA 1LO2H 4R2GD 3TWCL 3SDDB 4BQCA 2YPLE 1ZA3B 3HNVL 4HZLB 1DLFL 1EX0A 4RFEA 4O58H 4ZFFB 4ONFL 3B9KD 4HMCA 3BKYL 3C9NB 4DWHA 3V0VB 3FRUA 1L6XA 4KFZC 2X7LB 4BH7A 2B5IB 3UXFA 2R1YA 4UBDD 4K8RL 4P5TA 4AM0B 5JW4N 2J8HA 1FC2D 4XNXL 1A21A 2FIRT 3SDDA 1ZA3A 2O26U 3GKWL 3NCBB 3O6FD 4HZLA 4ZFFA 2XXMB 5K9QG 1VPOL 3C9NA 2I5YH 3DYMA 3V0VA 4BFGA 2X7LA 3PWPD 4FXLA 2XKUA 1CE6B 4YFDB 3LKQB 5BO1L 1H3VA 5GS3A 4AM0A 2ZWLT 5IB5B 4DN4L 2GCYB 3C6SB 4AG4H 4FFVD 5F1OB 1ZSDB 4L4VD 4F9LA 5FHAH 5E99H 1CE6A 1H15B 2C5DC 4K3DL 3LKQA 5L8LB 5AZEH 2Y1VA 5IJKC 5IB5A 4K94H 4MB4A 1JMZA 2GCYA 5C7XL 3RUGE 3C6SA 3OJMB 2YPVL 4XNMB 2YD5A 1K2DB 1ZSDA 5DTFB 4FP8H 5DJAB 3L3DB 32C2B 3TV3H 3PQYE 2XY2A 4U1MB 3UYRH 1H15A 3B5TA 2FIKB 5KVGL 2CRZA 4HJ0C 1X5IA 1N0XL 5F9OH 3BSZL 3AB0C 4NQEB 5IKCB 1T2JA 2FGZA 5E9DB 3H7BB 3FRPG 4XNMA 1K2DA 4JDVB 2PXYD 3A6OA 4BH8B 1IGCH 5DTFA 5DJAA 1UJ3C 3L3DA 2DQIL 4QXUH 32C2A 4U1MA 5ACMA 3Q3GB 2FIKA 4P23C 3UPRB 2ZCKH 4ZNEE 3S4SG 2FH6A 1BP3B 3FB5B 1OAYL 2HRPL 3QNYB 4LSSL 1BD2D 5EZOL 4NQEA 5IKCA 1QFWI 3WEXB 5L2KD 5IT2L 5E9DA 3STZB 4LASH 3H7BA 1DQTA 2H6PB 4R4BB 2Q7YB 4JDVA 4E9LA 3NIFE 4BH8A 4OZGB 3WD5L 1JPFB 3P2TA 2NXZC 4FQQB 5K59F 3Q3GA 5I15H 1NCBH 3UPRA 2A1WH 4KKAD 5EULV 3QCTL 3FB5A 2E7LC 5FCSH 3QNYA 3DROB 4HKJB 2CIKB 1OD9A 3C60C 3K2UL 1EO8L 3WEXA 3CCHB 3STZA 2H6PA 2Q7YA 4R4BA 1CE1H 5CJ5A 4OZGA 1O0VA 3S6CA 1JPFA 4HX1B 5J1AB 1T7ZA 4FQQA 4OLEA 3PV7A 3NIFF 3PDOB 2DQJL 1H3UA 5ISZB 4PGDB 2DTSA 1P1ZB 5F6HJ 1N7ML 3DROA 4HKJA 2CIKA 5SWSB 3CCHA 1IC4L 4QRPD 5DRZB 1BQHG 1FO0B 2A2QT 4OFDA 3OKOB 4Y4HB 3TJHC 1A7PH 1GGTA 4HX1A 5J1AA 4MXVF 1W72L 3LS5L 3PDOA 5J13C 3BD5A 5ISZA 1DE4B 4GKNB 4PGDA 1AQKH 1P1ZA 1S3KL 4FG6C 4PP1C 4U05A 5SWSA 1IQWL 4NC1E 5D7JB 5DRZA 1MHEB 5F7MC 1FO0A 1NSNL 1J8KA 1YEFL 5ECJE 3OKOA 4Y4HA 1G0XA 1IEBB 3AM8A 3FB7B 5HI4D 4K7FB 3SDYH 2V9RA 2HA1A 3WNKA 4M6NH 1JZ4A 3MODL 1DE4A 4GKNA 1IM9B 2KZ1B 1MFDL 5LXGL 3CLFH 4HPOL 1G7QB 2Y36H 3LKPB 1DL7L 2CRIA 5D96C 5D7JA 4G7YL 4J4PD 1I9RH 4ISVB 1MHEA 1E6JL 4JFOB 1SEQH 2H26B 1H3TA 1IEBA 1A47A 3FB7A 4K7FA 4WHYH 3ULVE 3OKDB 1OT2A 4ODTH 1IM9A 1PY4A 1G7QA 5B3JE 3LKPA 4JFZL 1FGVL 1EH9A 5T1MB 3SGKC 4CAGA 3C87A 4N68A 1MNUL 2OMNA 4HWBH 4AIOA 2FLBT 4ISVA 4NO5B 4XMLL 4CDHA 1X44A 4UOJA 4YWGH 3LQZB 4JFOA 4I3RL 2H26A 4ZUWB 1QBLH 3BEWB 1TENA 1CDHA 4JJ5B 2Z91B 3OKDA 3T2NL 5AUMB 4S1SL 1N4XH 4OCRL 1L0YA 1BX2B 2DB8A 5T1MA 5E2UH 3ULVF 5CZVL 4NO5A 3LQZA 4ZUWA 1K4DB 5MEOB 3BEWA 2EXWD 4JJ5A 1HNGA 2EZ0C 2UWEE 1NCDH 3EYSL 2Z91A 4PJDE 4KTDL 1EEQA 2G60L 3I75B 4KTEL 4O02L 5AUMA 4NHCH 3BRDA 3V0WL 2NY7H 2E27H 1BX2A 2BXYA 5E8OB 3KPQB 3QO1B 4GQ9L 4ETQB 5GGRY 1K4DA 5MEOA 3O4LB 1CZ8L 1INEL 4LDOB 3V7MA 1GGUA 2KBGA 2OI9C 2OXGA 3I75A 3B9VA 2Q8AH 5HPMB 5JHDD 1TTUA 1WBYB 4LLWB 4YXLL 3H3PL 4YBQD 3P0YH 2AEQH 2UWEF 2L4OA 5E8OA 4PJDF 3KPQA 3QO1A 5DRNB 3BQUD 4UTAL 4NNPH 3K74B 1TTFA 1M05B 4ETQA 5HY9B 4FXKB 1HKFA 3O4LA 3OTTA 3C8HA 1KN4H 4K3EL 5HPMA 1A14H 1WBYA 4LLWA 5DVNA 3QUZB 1QRKA 4M6AA 3X3FL 1NMAH 5DRNA 4N8CL 2DJUA 4QTIL 1M05A 3NOIA 2MCPL 1EMTL 5HY9A 1Z9SA 4FXKA 2B1AL 4GXVL 35C8H 2VUYA 5BS0D 3K81A 4R97B 2DQUL 3RU8L 1MI5B 3IAQA 3MOBL 3VD3A 2DYPD 2X4NB 3LQAH 3QUZA 4LEXL 2DL9A 1ERNA 1QACA 4YC2C 1DBBH 1QA9B 4LCCC 3MOQA 3LD8B 4LARH 4K2UL 4U1KB 1I7RB 3ZZ1A 5EUOB 2P8LB 1XGYL 5IBLC 1RQ5A 4HQQL 1MI5A 4XNUL 3IDGB 2X4NA 5C08B 5DVMA 3VFPB 2EICA 2OR9H 1CU4H 3CX5K 1NFIB 1JTTA 5FUZH 5J57B 1KULA 5C09D 1QA9A 5HHME 1RUPH 1KTKE 5DT1H 4UZGA 2BX5A 1FZJB 4U1KA 1NLBH 1I7RA 1BFTA 3TPKA 3RL2B 1DVFD 5EUOA 2P8LA 1RUKH 3QQNA 2OXHA 2RFXB 1I3GL 1MCFA 3IDGA 1UM4H 5C08A 1JRHL 5I6XB 1MREH 3VFPA 4D9LL 4X9GA 3HRPA 5IB1B 1NFIA 1J0ZA 1YYML 5HYSG 1INDL 4XNZB 4NYLB 1Q0YH 4GMSL 1KOAA 3TP4A 5JOEA 1EO5A 1FZJA 3MNVB 5E5RB 4OF6A 1IGFH 3RL2A 1AQDB 1QG3A 1TDQA 5H35B 3HZVB 1MFAL 4Y4FB 1G7LB 2RFXA 2UVFA 2ADJB 3JBG7 1FLTX 2JJWA 5IB1A 2V9TA 5F7KC 4NQEE 5JUEH 5T3XL 5LWYL 3LRHA 1T1YB 1U42A 4O5LL 5E9DE 25C8L 1R6VA 3EFDL 3PWNB 4PJFE 4NYLA 3MNVA 4UT6H 5FYLD 1AQDA 2BVYA 2FR4B 4LGPB 1A6WL 3VXUB 4G8GD 5H35A 1DN2A 3HZVA 4Y4FA 1G7LA 5I1CL 3LPWA 3LEXB 1S7RB 3MBXL 4ZFGL 2A9MH 2ADJA 4XP4H 1U2HA 3SO3C 2EYSB 1T1YA 3DLQR 4AEEA 3PWNA 1JTPA 4NN7C 1J0JA 3WO4B 4OZGE 1WFOA 4JZOB 2FR4A 2J88H 3VXUA 1HXMB 5EBMB 4PJFF 4DKEL 3FQRB 3S35X 1I85C 3LEXA 1S7RA 2W9DH 2UY6A 3U4BL 5FGBC 2EYSA 3SE8L 3QEQD 4FHBD 2E7HA 3GMNB 5C0EB 3GIVB 2H2PC 4X6CE 5FA4B 4TYUA 4JZOA 1CT8B 2VXQL 3OBAA 4XXCA 3SBWC 1BJ1J 1E4XH 1HXMA 3F6IA 5EBMA 1ZVHA 1UH2A 4WI2A 3FQRA 1WTGT 2WP3T 4OZGF 5HYIA 5ILTL 4UIKL 2IAMC 2EO9A 5I0ZA 3WN5B 3GMNA 3IJHB 5C0EA 5CS7A 5C0BB 3GIVA 5FA4A 1R3KB 3GHEL 3LRSB 1CT8A 2HJLB 1WGOA 3L7FB 1JZ6A 4X6CF 2EC8A 4JREC 1H3XA 1MWAB 3LS4L 3FOMB 5KW9L 3WN5A 3IJHA 1T83A 5C0BA 3OXSB 1R3KA 5JA9A 2X1OA 1D6VH 1CXLA 3LRSA 2HJLA 2IPTL 3HA0A 4WY7L 2F5AH 3L7FA 4KZDH 1FFRA 1SJVA 5E5UB 2FRGP 2APVA 2FEDD 1LO3H 3THMH 1MWAA 3QHFH 3FOMA 4OM0L 2ED9A 2NY4D 1VEPA 3OXSA 4ONHB 1LDPL 3V52L 1R3IL 2OS7A 4JO4H 4NT6B 3ORJA 3N50A 1EHLH 3EBAA 4IRSC 4QHUB 3KHQA 4DZ8B 3GDBA 1F8TH 1TJHH 3BHBB 4ONHA 4YZFE 3UAJC 3O0RL 2YKLL 2MKWA 4BQBA 3DSNA 4S1RH 4NT6A 3EAKA 3MRIB 3IVKB 4ZMAT 5I30H 1L7TH 4QHUA 3WJLA 4XPAL 3SGJC 4DZ8A 4KRNA 4IRJB 2D7MA 3HE6C 3MRMB 3BHBA 1GGIH 3BKML 3ZE2E 3Q2CA 3BUTA 3VFMB 1JYNA 3GBML 4RRPA 5HHOE 1HQRB 5JQHC 2Z0BA 5GRUL 3MRIA 5KJRH 3IVKA 2E7BA 5HGBB 4YZFF 2F58H 4B0MM 3TH2T 2FBJH 4I18C 1QYGH 1T7VA 3WLWC 4S1DD 1J05B 4IRJA 3MRMA 1MRCH 3VFMA 3MBEB 3IU4L 5ALBH 2LU4A 1HQRA 1C5BL 2I60L 1MIML 3QFJB 2FX9H 4NDMB 4GRLB 3VFUB 4HHAB 2C1OB 5HGBA 4PRBB 5CP7B 3OAZH 3CDYA 1NJ9B 3WJJC 1J05A 2ORBH 5C3LD 3ARDB 8CGTA 3MBEA 4KUZL 3SDAB 2D7TH 3WFZA 4L1DA 4MNHB 3QFJA 1OSPH 3VFUA 4NDMA 4GRLA 4HHAA 2C1OA 4PRBA 5CP7A 2AJSL 4YEEA 4M93C 3OKMB 1B6UA 1G9MC 4KK5D 1O7VA 1EFXB 1NJ9A 4HUXB 2BRQA 4RBPK 5DMGC 2VZTA 2OK0L 3ARDA 2X1PA 3SDAA 4TOYL 1XIWD 4MNHA 4MXWH 1MI5E 3QDMD 5TE7L 1FNGB 1MFNA 3DX8B 4JM2C 4JN1H 3OKMA 4QHNB 1P5VA 1EFXA 4FQJH 4HUXA 4NJAL 1FIEA 4Y16B 3O2VL 2NY0D 1S7XB 3C6LD 1J86A 5L0QC 5J9PB 3RI5F 4EQ3A 1KN2L 4XP1L 1MCQA 4O2CB 1I9IL 1UZ6E 3SEPA 5C08E 1FNGA 3DX8A 5C0AD 1W0YT 4K8RC 5DJCB 5T5FL 4JR9L 4QHNA 4LRIC 5I75B 2CXKA 3VGEA 3V6FB 4Y16A 1CXKA 5BCAA 3A6BL 1FZOB 1S7XA 4YFLF 2R9HC 4LAJH 5J9PA 1UG9A 3RY6C 2EKSB 4O2CA 2NTSP 4LRNL 1NCCL 4D0DB 1UWXH 3LHPL 1ZT4B 4PG9B 5DJCA 1PAMA 1DQQB 4BFBD 5C0NC 3V6FA 1UZ6F 1H3PL 2YS4A 2VERN 1FZOA 1VFUA 5DZLA 4ERSH 4P49A 3DIFB 5KSAC 3FN3A 2HMID 4UV4H 4UILH 2EKSA 1JZ5A 4MJ6B 4KJQC 1OP5H 3TIEB 4DKAA 1CG9B 4D0DA 4MQXC 1NMCC 3KPOB 4NP4H 1TVHB 1ZT4A 1KELH 4HBQA 4PG9A 4YR6B 5AWNH 1DQQA 1CFTB 1TPXC 4R0LC 4FA8A 1V5JA 2UZXB 2QQKL 3ZL4L 4XP6H 2OJZH 3DIFA 4YDIL 4YPJA 3VXUE 4MJ6A 1C5DB 3TIEA 1CG9A 4FQ1H 4E41D 3SCMC 4OCSL 3KPOA 1TVHA 4YR6A 4PV9B 3MLZL 1CFTA 2E9BA 1D5IH 1T89C 3TBSB 5J8OA 2AERT 3TN0C 2DRUA 3QZWG 2D7PA 5H94B 2CPCA 4L9DA 4W81A 1GHFL 3RIAF 4JEGB 1AKJB 4FFWD 4P2OC 5FGSA 1C5DA 7FABH 1KJ3L 1CR9H 3QPQC 4PV9A 4TSCH 1MRFH 3BMVA 3FN0L 3TBSA 2HKFH 4KZEL 4LHUD 4D9QE 5H94A 3HI6L 4HS6B 3RA7H 1BJ1H 1U3HC 1AKJA 2EDOA 1MCRA 2E8ZA 4KHXL 1G1CA 3VGAC 3TNNB 3BKCL 4LOUD 5CZXC 3Q0HA 5C0BE 3UJTL 3O8XB 4G9FB 4HS6A 4GG6B 5B8CC 2JJUA 5CEZH 1D5ZB 2V17L 1HOCB 2PCPB 2DBLH 3RGVB 3DI3B 3GEWB 3MA9H 3ALPA 4YDLB 4WCYL 4P4KC 2Y72A 3DGGB 2O5YL 4NBXB 1AXIB 4YFLI 4O4YH 5DJ6B 5KAQG 4OLZL 3TNNA 1L0QA 1PFCA 1R3HB 3O8XA 4G9FA 2PYED 1IAIL 5GS0L 4GG6A 1X4XA 1D5ZA 2CK0H 1D5XB 2O5ZL 1HOCA 2PCPA 4KJPC 3RGVA 1BBDH 1CK0L 5CAYB 1HHKB 4OZFG 3DGGA 5DJ6A 2FYYB 4RA3A 2AABL 3GMRB 1UM6L 1ACYL 4YPGB 4NM4L 4C54A 1UKTA 1R3HA 2I07B 4FQIH 3OWEA 3CMOH 1D5XA 3NN8B 4EOWL 4Q9RH 5I1JH 2VDLL 1DEDA 2G5BB 1FH5H 1MHPH 2JJSC 1G0YR 1HHKA 1WEJH 4X5XB 5CP3H 5AAMA 3UCRA 4D0CB 1UB6B 2FYYA 4JKKA 4YLQT 1I1FB 2EH7L 3GMOB 5DC9B 1OQXA 4XHJD 3GMRA 4WIQA 1HHHB 4YPGA 2AQ2A 3I50H 5DS8B 5BOZG 2I07A 5BVPH 3MRLB 1FL3B 1YEHH 5CSZB 3NN8A 2XZCL 4NPYB 1F2XK 2G5BA 2X70B 4X5XA 4D0CA 5DD0L 1UB6A 3JVGC 3I3EA 5CIPH 4GW1B 1I1FA 3GMOA 4BJLA 1KCRH 2E9WA 2VC2H 3L5WB 4Q2ZB 1HHHA 4YO0B 1T0MB 2ZKHL 5DS8A 2NXYD 1A6UH 4XMPH 3MRLA 1FL3A 4LVHC 5CSZA 1CD9B 3DMMD 2HJFB 1MJ8H 1LEGB 4NPYA 3SQBA 1CICD 1PX3A 2X70A 5IJKA 3EHBC 3NZHH 4GW1A 3L5WA 4Q2ZA 1MY5A 3EYUL 5CJOL 4YO0A 1T0MA 1OSZB 4AEFA 2J3SA 5FHBL 2FNBA 4A2LA 1UWEL 3PWJB 2EE3A 2R1XB 2HJFA 1LEGA 3ZSSA 4ZO7A 2LABA 4GAJH 3GGWB 2VMFA 3MLXL 3GK8H 4ORGB 1UM5H 1OSZA 3S3JA 1J1PL 2NXZB 3PWJA 2XNAB 2AXHA 2R1XA 2VDMH 4KAQL 3GJEB 3S37X 3L3JB 5KSVB 3NFNB 3Q6GL 4F8QA 1BGXL 5ICXB 3GGWA 1A7RH 1DQMH 3E6HB 2P44B 1OGAB 4ORGA 3NFSL 3IYLW 4IJ3C 3OJDB 4HXBH 1JFQH 3P30L 2XTLA 4ZPVB 3TFKD 1RV6X 2XNAA 3DO7B 1EUUA 2EDYA 3GJEA 5T3ZE 3L3JA 3QEHB 4JVPA 2Z92B 3DJ9A 5KSVA 3NFNA 2E7LA 5CINH 4OZIF 4LQ1A 1XR8B 3F6LA 5ICXA 1UENA 1MRDL 3V4UL 4Z77B 1HQ4B 2UZIL 3EO0B 2YEZB 1UGNA 3E6HA 1OGAA 2OJEB 3OJDA 2OL3B 2WUCL 3BN9C 3GJFK 1Z6JT 3PABB 4ZPVA 4MB3A 3DO7A 2F5BH 4HCRL 3HNTL 1TQCB 4YK4C 3T0EB 3QEHA 3V6OC 1CXFA 3VG9B 1W0VB 2Z92A 5IGXL 1FV1B 3K8LA 3TBYB 1LO2L 1XR8A 2CO7B 1CIUA 2XTJC 3U82B 4Z77A 1HQ4A 3EO0A 1GVIA 2YEZA 4YQXH 1JF1B 2LFGA 3KYOB 3FOLB 2VKWA 4G6FB 2OJEA 4JO2H 2OL3A 3PABA 3NPZB 4JQIL 5FYJE 3T0EA 2K3TA 2VZSA 5KS9B 3W0WB 1W0VA 1FV1A 5ACLA 4JG0H 3E3QC 3TBYA 3VD5A 3MCG1 5D96B 1JF1A 1U6AL 3KYOA 5E1HB 1YJDC 2JB6B 3FOLA 4M7LL 2I5YL 2AJUH 1YN7B 1MWAH 3AS1A 4UTBH 2HFGH 5KS9A 3W0WA 5GS2H 4XX1G 4HXAH 4H1LB 4W6XB 4F15B 3LEYH 3I3DA 4P23D 2V2WB 4WHYG 2JB6A 5TDNB 4M8VA 5B4MD 1FLRH 2DD8H 4C4KT 1YN7A 1CL7H 5FHAL 1OTUD 5E99L 2JCCB 3W11C 5AZEL 4I9WE 4H1LA 1X6LA 1P7KB 4K94L 3SGKA 3K2MC 2V2WA 2F15A 5TDNA 1ORSB 1U8PB 1MFCH 4LQFH 3PQYD 3C60D 3UJJL 3TV3L 5EU6B 3UYRL 2JCCA 2A6DB 3SKMB 3MRPB 1P7KA 1N59B 4IDLA 2YRZA 1WTLA 5CJQH 3VFRB 3PHOB 3ILQC 1TQBC 3L5IA 4Q9QL 3HI5L 5IWLC 1G9NC 1RUQL 2FX7H 5FGCE 1ORSA 1U8PA 4ZTPL 5T1DH 1IGCL 1S9KC 1Z9MA 3I84A 4AMKH 2ITCB 4QXUL 5MHSE 5EU6A 4Z9KB 2WBJD 1R24B 4TUOB 4PY7B 2A6DA 3SKMA 3MRPA 2V7NB 1N59A 3VFRA 3PHOA 4R9HA 1Z9OA 3VMNA 1QFUH 2Z8SA 1ZA6B 4MLSA 4O00A 5E8DH 4GG6E 3SGEI 2ITCA 3R8BB 1CXHA 1FE8H 5I15L 1R24A 4TUOA 4PY7A 4LPUA 2A1WL 1JHKH 2BSRB 2RIKA 5D1XC 2V7NA 3HE7C 3BRGC 4WUKH 1B0WA 1PW3A 4GQPH 4MZ3A 1MELA 4XI5D 1ZA6A 4OD2B 1CE1L 3TGXA 5GRZA 5FB8B 4NOBA 4MDJB 3QUKB 4WFFE 4MNGB 2BSRA 4GG6F 5HYFA 4NZTH 1RZKH 3F8UB 5EFIB 2YXFA 4LCCB 2H1PH 5E03A 2ZP0T 3S96B 3BP7B 4OD2A 4LSVH 4MAYB 2F53D 1A7PL 3DRTB 5FKPB 4NQUA 4R96B 5FB8A 4MDJA 3QUKA 4MNGA 4M6MH 4N0RA 1AQKL 2QQQA 5EFIA 3ZT5A 3OAYK 4JCLA 3AMKA 3LDBB 4LCCA 1MFEL 4APQC 1QBBA 4OCNC 2OTPA 4OGZA 3S96A 2WZPD 5IHZB 3BP7A 3VA6A 4E0RB 1WZ1L 4MAYA 5FKPA 3DRTA 3MRFB 3HFMH 2OP4H 4R96A 4M6NL 3HB3C 1NQBA 4YH6A 2Y36L 1CI5A 3EDDA 4NN6B 1I9RL 5IHZA 4Q97A 1SEQL 4E0RA 4ELKB 5A3ID 4Z7VB 4GKOA 4GMTH 3MRFA 5IUSA 5MP6H 3WFBH 1G0DA 4X99B 2VH5H 2RHEA 4HK0B 2GEEA 3QIBD 4HWBL 3SY0B 5DJXB 5JXAH 3DV4B 3UPCA 4YWGL 4ELKA 4DOHB 3FONB 1QBLL 4MHHG 4Z7VA 2FB4L 3FO2B 1FCGA 4KQ3H 3B83A 3S36X 2YD1A 4AEHH 4PRHB 4EN3C 1N4XL 4X99A 1JZ3A 1ZAGA 3KLHC 4HK0A 4UOW1 3C5ZC 4JPWH 5E2UL 1ZT7B 3SY0A 4TTDD 5DJXA 3QAZC 3DV4A 2VAJA 3E1F1 2X41A 3RBSA 4UNUA 2HFTA 3FONA 3RKDC 5DK2B 3FO2A 4IOIB 4RISL 1NCDL 4PRHA 4XAKE 4OZHB 4P0DA 4PRPB 1PG7H 4NHCL 1TMCB 5E00B 2NY7L 1D5BB 2E27L 4AIXA 1BPVA 1BMGA 1B4RA 4NZUH 4X5WB 1ZT7A 1OGAE 2ICES 3GBLA 1OTSC 3D85B 3OSKA 5DK2A 4IOIA 3E6FB 5HVHC 4N1EA 1I85A 4OZHA 4PRPA 5E00A 1R3JB 3VXSE 2IAMB 3P0YL 4TVPH 1D5BA 2AEQL 4X5WA 2BY2A 3K3QA 4AH2B 4NNPL 3S3SA 3D85A 3SBWA 3ROOB 2IBZY 1T20B 2Y07H 2C3XA 3K4AA 3E6FA 3T0EE 4Z6AT 4Q6IC 1D6EB 5DMJB 2VWEE 2D0GA 1R3JA 2CIIB 2IAMA 4YUEL 3OJ2C 1NMAL 3RX8A 4PJ8D 3NAAH 4AH2A 3G9AB 4CL7A 4JHZA 2D7QA 3MYZA 3RZCC 3LKSB 1Z0NA 4JRXE 1SHMA 3ROOA 3U36B 1T20A 4PJ7B 2KH2B 1QKZH 4HDIB 4RNRB 3W0WE 1SYSB 1D6EA 2CKBB 2RQ8A 4ZPTB 3KAAA 3LQAL 1Z9LA 4MD4B 2CIIA 3EDJA 3FT4B 2N4IA 1DBBL 4WEBH 3WSQH 2XWTB 3LKSA 4LARL 5E6IC 4C59B 4PJ9D 1X4ZA 3U36A 3BDBA 3CU1A 4PJ7A 2C3HA 4HDIA 4IRSB 4XNYH 4RNRA 3AMLA 1SYSA 4ZPTA 2CKBA 4JFDB 2W0LA 4MD4A 2OR9L 3HNSH 1CU4L 1QFWH 5HHMD 5FUZL 1YQVH 3FT4A 3QXVA 5C92A 2HTKC 1WT5A 2XWTA 2X1QA 3QRFM 3O6LH 1NLBL 1BQLH 4FQLH 5I1EH 2P24B 4IRSA 4X6EB 1AC6A 1CBVH 1RUKL 2AXJA 2JCCE 4I13B 5KOVC 5BV7C 4XP9H 2WLZA 4HUVB 4JFDA 1UM4L 5ENWB 1E6OH 1MREL 4J3UA 4R90H 5T1LB 1L7IH 4LVNB 5BRZE 4PGCB 1G6RB 1NUGA 4LNVA 2AKRB 1RPQA 1IGFL 1QRNE 4N8VG 3BAEH 1IILE 1W8OA 2QHLA 1QLEH 2P24A 5LJYH 4X6EA 1OAKH 2XKSA 3SKJH 4EKXA 2YD9A 2RR3A 4HUVA 5ENWA 2EIBA 4MD5B 4ZDHB 8FABB 5T1LA 3QWRA 1T3FB 2J5LC 5JUEL 3U0WH 2JCCF 4I77L 4PGCA 1G6RA 5GGTA 2AKRA 4UT6L 2BHYA 1J1OH 1F2QA 3UTTE 2X42A 1UCBH 4OD1H 3M8OH 4MD5A 4UT7H 4ZDHA 8FABA 2A9ML 1T3FA 4XP4L 4JJHA 1JBJA 3T3PF 2OM5A 4Y2DB 5JDJA 4KK6D 2IH1B 1ES0B 1JTOA 4NM8H 3KYAA 2JIXB 4S0TD 3TVMB 1CYGA 1C1EH 2W9DL 2HRLA 1HYRC 4Y2DA 2AK4B 3Q5OA 3VGGA 1R3LB 4CVUA 1ND0B 2IH1A 1ES0A 1UKSA 1CVRA 3GSNB 5F3HB 2NR6C 2NX5B 2JIXA 4WEUD 3V6ZB 1KV3A 3TVMA 4JM2B 2FGWH 4MNGE 3NCYP 1OM3H 2LAGB 1YNKH 1BECA 5E2VL 5JIKA 2AK4A 1QSFD 3JV4B 3O2DH 1R3LA 2L7JA 1ND0A 5L0QB 1EJOH 4GRWE 3F65A 1KCLA 3GSNA 5F3HA 4N90E 2NX5A 2NZ9D 2JE8A 1IGTB 5GS0C 1WC7B 3ULUC 3V6ZA 4JM2A 2P5WB 4XPBH 3MV7E 2OCFD 3LPFA 1HK6A 1DANU 3OF6D 3JV4A 5FCUL 4M5ZH 2DMBA 4GH7B 3WIHA 2F5AL 2AS5M 1IGTA 1NDGB 4KZDL 3HE6D 1WC7A 1NBVH 4GRWF 1QFWM 4BQ9A 4M7KH 1HDMB 2OL3H 1LO3L 3THML 2P5WA 3QHFL 4YAQB 4CRPA 1GGBH 4PRIB 3HUJB 1ZV5A 3EYVB 1WWWX 2PO6C 5KSAB 5J3HC 3BKJH 5D4QA 4ZD3L 5HHNB 3RY6A 1MOEA 3AREC 1H5BC 4TULH 4PGZA 1NDGA 3L1OH 1NMCB 2ESVB 2P5EB 4PJGB 5F89B 1IGYB 1EHLL 1HDMA 5BOPA 4TSAH 4YAQA 4PRIA 4R0LB 3HUJA 4X4MA 5E6YA 2ZJSH 2BZDA 3EYVA 4NQVB 1F8TL 2NY1B 1OLLA 1TJHL 5KSAA 3MV11 5HHNA 4K3JH 2ENYA 4NO2B 4HJGB 3IKKA 4M5YH 5DQDL 4Q9CA 2P5EA 2ESVA 4PJGA 5F89A 4PRHE 1IGYA 5DVKA 5H2BB 1L7TL 4XBGB 3F12B 3TN0B 1WZMA 4R0LA 3VWKB 3VGBA 4J3TA 1UKQA 4NQVA 5HHOD 5CUSH 5IHUH 4P2OB 4Z76B 4H1LH 4NO2A 4HJGA 1DBAH 1N5AB 4AL8H 5I1GH 5KJRL 4OZHE 5H2BA 4XBGA 3BEVB 3F12A 1T89A 2D7OA 2FBJL 2I9LB 3TN0A 4JFFD 3SE9L 5IFAH 2VDKL 3GMMB 3VWKA 3RGHA 1LK3L 4WI6A 4P2OA 1MRCL 3HC4H 4Z76A 5ALBL 1X5GA 4L3EE 1N5AA 1X5KA 2FX9L 1JVKA 4DN3H 5D2LF 3F5WB 1AR2A 4CU6A 3BEVA 4U6TA 1OAQH 2I9LA 4MVBC 3GMMA 4W70A 2JB5H 5GZOC 1IQDB 2NY2C 2ORBL 5B8CB 4RGOH 2DM7A 2EH8H 1AI1H 4IS6B 4NKIH 3WDJA 1OSPL 4UQ3B 3F5WA 4OCLC 1LO4H 4XCFH 2VLLB 3VFVB 1IQDA 5BQ7B 5B8CA 3AGVA 4IS6A 2AQ3A 4M7ZC 1FNLA 5C0ND 3VXRB 3VXOB 4MXWL 3T3MF 4UQ3A 2BNRB 1W72B 3RKPA 2VLLA 1IC1A 4JN1L 5I19H 2B2XH 4B50A 4KJQD 5DURB 4FQJL 3VFVA 5BQ7A 1INQB 3DUUB 1BWWA 5DQ9B 3WUWB 4KKNA 2ZG2A 4ODBD 3HTLX 1J87A 5EA0H 4JHWH 3VXRA 3ZHKA 5FA3B 3VXOA 4JDTH 3BP4B 4KU1A 3LRGA 1JNNL 2BNRA 1W72A 3RVVC 3ARGC 1A2YB 3CSBA 4Y0GA 4F57H 4ZSOB 4XT1C 3SCMD 1INQA 3DUUA 3WUWA 5DQ9A 5J89A 4PFEA 4LPWA 5EU4B 1BOGB 2JJSA 5FA3A 1J1XH 3BP4A 4N0CD 5KANI 4P59L 1J5OH 4LP5A 2IBBA 4XHQA 2FO1A 5D6DC 1A2YA 1YY8B 4ZSOA 2NY6D 1JNLH 4LVHB 4UINH 5EU4A