3RLSA

Crystal structure of yeast af-9 homolog protein yaf9
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
152
Chain Sequence
b'IKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSLERPHRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9 homolog
publication title Crystal structure of yeast AF-9 homolog protein yaf9
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 152
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rlsA00
2NDGA 3RLSA 5HJDA 3FK3A 5D7EA 2NDFA 5HJBA 5IQLA 5IOKA 4TMPA 2L7EA 3QRLA
chains in the Genus database with same CATH superfamily
4HOMA 4NCC1 3WNMA 3SE8L 4RH4A 3F7RA 1YEJH 2MCPH 5ALCL 2VMEA 2UY7A 1QLFB 4JJ5A 3LZPA 5D7IA 3C5JB 3RWEA 1LO0H 2ZXBA 3MPCA 3MREA 3ZDWA 4OV5B 2EH8L 4TUOB 2Z93B 1A7NH 1I7UA 4CAGA 2NCEA 5CP7A 2EEAA 3MQIA 3WUWG 2BOLA 2VMCA 2EDBA 4UTBH 4HZAA 2NX5B 4UAOC 5HHOA 3VMPA 2QHLA 3NJNA 3QS3A 1DLFL 1VZGA 2GIYA 3VXQB 3QUZC 4H8WH 3FUDA 5D8JH 4MS6A 4BDVA 3TXAA 2A6IB 4HWBH 2IF7A 2AK4D 3ATAA 1IC4H 2BSRA 2HSIA 5ECGA 4YDLB 4LFHG 1BOYA 5EEWA 5E4EB 4KDWA 3F5WB 1YECH 3S96B 4OJEH 3UCQA 3QG6B 1YEJL 2WCGA 2WXPA 1HEZB 4X7TB 1L3NA 3D85B 5DEGA 1A0QL 3QEQD 3A47A 1MPAH 5BO1L 4U6TA 3KZ8A 2H2SD 1UWEH 4H8UA 3AABA 3IMWA 4GKOA 2YHGA 4QWWD 2W07B 2R2HB 2H4EA 2NW3B 4AYID 3DC0A 4LHUA 4HSAC 1NLDH 5C0CD 3KJ4C 5FO9B 1ES0B 4L37B 2ZYHA 4FQIL 5I1CH 3CHXA 3SE3C 2V7NB 3ARBD 3U4AA 5DT1H 1PYWA 5JOPE 3UJJH 2J4WL 5AB9A 3BQUD 1NDMA 1EJOH 4BZ1A 1PY9A 1RURL 3P4OA 2LGNA 3IXTA 1IC4L 3FOMA 1DCLA 2DIAA 2A0LC 4PW9A 1TIUA 3OWEA 4DUXA 5F7WC 4PJGE 1BOGA 4NXKA 1GMIA 3SE4C 4MJJA 4MAUL 3RPKA 3BEVA 3QG7H 1NCGA 2FB4H 5A40E 3T08A 5IESH 2XXMB 4AT6B 1U8IA 4P5RA 2PXYC 1FQ9C 5D6DA 5K1JA 2XY1A 4N87A 2IPTL 4P57A 4X9YA 4BCYA 3APCA 4OM0L 2GTZB 2HFFA 4J3XA 1NLDL 4K7FB 3FB8A 1ZHNB 3L16A 3ULUE 3LH2L 1GR7A 3NCJL 5SWZD 2UZPA 4AE1A 3OAWA 5GS1A 3CCHB 5D1QB 5FGCE 3O2VL 1IAIL 1P7KA 1HWGB 1WZMA 4CMHC 3RWEB 5CJQH 3MREB 2AEWA 5JQ6L 4XO3A 4WWKC 1MCOH 1AGDA 2GI0A 4K5OA 1I7UB 2I26N 1TEFA 2AXGA 3MDJA 1S7SA 2ZUSA 1N5YH 2WP3O 3RWDB 4TNVF 1EVTC 4KMTL 1ETJA 2H26B 3ULAB 4NQCD 3IK2A 2X40A 3NPSB 4YE4L 4UUJA 4AC4A 4BH8B 4BDVB 2K78A 3PUCA 2ARJQ 1KB9J 2JKWA 4PRID 5ITFB 3N9GH 3OMIB 3QZWA 3VM7A 4ISVA 3BH9B 3MXWH 3T9WA 4KDTC 1OARL 2W9DL 5FR3A 1E65A 4PJIA 4N3UA 1JCKA 3WFBL 1WISA 5DEGB 4DETA 3REWA 4N24A 1ZIAA 4L1DA 5FS5A 1JBJA 3O0RL 3RTQC 1OTSC 3OC8A 4PMFA 2AS5M 1R3IH 1AXTH 4B3VA 3ZDXE 4ZXBC 4TM9A 1BXXA 3I6GA 1A6ZA 4ZMAT 4NZDA 5EHFA 3PNWB 3FT3A 5E6SB 4LSUH 1WWBX 4CGUB 4JCWA 3CZUB 3QUXD 1ZANL 3RZWA 3HEIB 5DHYB 5EUOB 5EZOL 4ELMF 4A7QA 1YUHA 3KHQA 2V33A 5C6TL 4LL4A 2FVNA 4LEOA 2AXWA 3MGOA 4D9RE 1ZA3A 2WLIA 3K80A 4BSWB 1WAEA 3TS8A 4OFKA 4IW4C 1SOQA 1JJUA 2O61B 4PWKA 1KV7A 1S7VA 1U8IB 1JFHA 4KKCC 2C34A 4XCEA 3NH7H 3D0LB 2GK0A 2DQGH 4IKLA 3FB6A 3IJEB 1RZFH 1NBZA 1R3IL 1LO5A 2OCJA 1E4KA 1OSPH 2YMOA 5IQ7H 2ARJA 3BN9C 5C09A 1ZKAA 2RJMA 1U8QB 1MXGA 3EOTH 2GPZA 1HZHH 3EH5B 3QZBA 1YEDA 2O5YH 4R2GD 3LEVL 3EXJA 2NLJB 4G8EA 5CO1A 1DQJA 1Y18A 4LKXB 1AGDB 2IVFC 5JIHA 1G1YA 1RIHH 3MRIA 4E41D 1J1PH 2WXJA 2OMTA 5AAMA 2VXQL 3EFFB 2QFPA 3C75A 3GMNA 3B9KD 3PWJB 1E8WA 3EH3B 4AC2A 3IU3A 3GXIA 4UMGA 2EC8A 3IDNA 3MV7A 1TZHB 3IF1A 4GKZB 4OBRA 4P2RD 3RGHA 4G43A 4XMZA 1RVFL 2DQGL 4HOZA 3K4AA 2VJXA 3VDCA 2UY6A 1OSPL 3HZYA 3I3EA 2OJZL 2WLMA 2X89A 3U6XS 4WI5A 1CVSC 2IDFA 5DMIH 1PZAA 3FQWA 3EOTL 3KAAA 3NIGF 1HZHL 4PJIB 3V0JA 2A83A 4PRAB 2ICWA 2XTJB 4RGNC 4BZ2H 1OV8A 4MZRA 4W9HC 1W0YT 1I8MA 1P0SE 2EE9A 3L1OH 1MI5B 3VFRB 1I1YA 4CC0A 2A6KA 2FQEA 2CRMA 1E3ZA 1RIHL 1A6ZB 3O2WH 3OKNA 4FNLH 3WKNA 1J1PL 3FT3B 3MUUA 4GW4A 5B1AB 5IMOB 3FU8A 5A2FA 2BNQD 1BEYH 1TNMA 1MWAH 4NKIL 4OZHF 1S9WB 1NCJA 5T1LA 1CDUA 1YUHB 3ARTA 5F1IB 2A7BA 3IJYA 4P2OC 1QBMH 3FTYA 4X9GA 1T0MB 1NGZA 3WD5L 1A6VL 3MGOB 5G4MA 3WN6A 1SMDA 2WLIB 4IU3A 1OOWA 5DLML 4JHWL 2MEJB 3UDWC 5DMIL 2EVJA 5J6HB 3MHZA 3HI1A 1X5YA 5C92A 1OSEA 1FF5A 1PF3A 2A4EA 1INQA 3KPRB 4XTRC 1MAJA 1LO5B 3KNBA 1TXKA 3JYBA 1UQSB 4P5MB 3WTUA 3ULVH 3VI4E 1AHWC 3CN0A 3IKKA 4FQLL 2Y7OA 1AG6A 3MRJA 2ZXCA 2MNUA 1Q9WA 5DK0A 2VXSL 3UAJC 1JI1A 3OJDA 4ZG1A 4N2NA 4ABQA 1QBML 3A6CH 1DP0A 4M7LT 2IGTA 2ZXWB 1UUSA 1IBFA 1CF8H 1OAZL 2V5MA 3N91A 4J6RH 5F89A 5CIPH 1B0GA 2C9AA 2YFOA 4IGBA 3IU3B 2WTOA 4MRBA 3IDNB 3MV7B 3IF1B 3ZQWA 1BLIA 1U8CA 1BREA 1COBA 2Z92A 3IDYB 3C8HA 2I9LA 4M7JL 1ZGLM 1WAAE 1WIPA 5IHBA 3W81A 1QSEA 2PMZA 2AC0A 2G9HA 1T22A 1BFSA 2VRKA 2DMCA 5EF2A 2A83B 2VE6B 1FGNH 2KZBA 4NWTH 5EEYA 5J6SA 2QSCH 4LLYA 3BAXA 2WO3B 3A6CL 4XBMA 1BBJA 5DGQA 3S36H 4NRYB 4CVXB 2KLTA 2FEJA 3VQ2C 1H5BC 4YHZL 1XMWA 2EADA 1YLBB 3VVVA 3JQOB 4FMVA 2ETWA 4A2EA 1HQRA 4M61B 3F2LA 3GS4A 4FAAB 2FHFA 4RNRB 4UV7L 1W6WA 5T1LB 1BAFH 1G9MH 1I8KB 3CUPA 3IJYB 1NGZB 1TJXA 2VB5A 3ZQXA 2ZG3A 3PWPA 5FM5O 4MCYA 5CU9A 5IWLA 4PJ5A 1NAKH 2A73A 4F24A 3P3UA 1GGCH 1ADWA 4KTEL 4XXCC 3QDGE 5KVEL 2NZ9D 3HMXH 4ABWA 3DRTA 5I28A 2VMJA 4QEGA 1FGNL 2MHAA 4ODXA 3PS6A 5GSVA 4NWTL 1E28B 3OPZH 3PAUA 3K6NA 4KNQA 4OLUL 4Y2DA 1OO2A 2ROXA 1J0YA 2HLAB 5DVPA 4FNRA 2OW7A 4NKDB 3MA9H 3TBYB 2X0WA 5B38G 1J10A 1RZKH 1X5KA 4E0RB 2FCBA 3K1KC 1CD1B 4U3SB 4OZIE 4NNPL 1KTCA 4YSTA 5C0BE 1Q9WB 5DK0B 3PPSA 4YVNA 1GW0A 3VWKA 3NIFF 1J12A 5E8EA 2Y69B 3NYKA 2BIQA 2JIXB 4W70A 4XHJC 3TA3D 1SFHA 1BF8A 2H3XC 3T2QA 3ZKND 4H0HB 3X11A 3O6FA 4LSRH 5F89B 3CPLB 1GGCL 4YSSA 4JY4A 4OGYH 1CD8A 4Y9BA 3EBHA 1ZDSA 5B22A 3K71A 5H37H 2Q20A 3NBNA 4XGZA 3O4LA 3POHA 2HG5A 5E2WH 1D6EA 3QIBC 3CC1A 1I1AD 3R06B 2DH3A 5BRQA 5ID1A 1QKZH 4YZWA 1S7QA 1XZ0B 3VGDA 8PAZA 2G9HB 1T22B 4QRRD 4ODUA 4JFDA 4TULH 5L88L 5BZZA 4KNSA 3TJEL 4IRSD 3BX7C 1A8ZA 2EEBA 4LCIH 5AVZB 3QJSB 2VLJD 4I77H 3RY6A 5T3XL 5IVNA 3JWOH 1NGYA 1UVQB 1NUFA 1NAML 2WSKA 3LIZL 2EXSA 1H19A 1QUPA 3NTCH 5IVXF 3U83A 4AX3A 1F18A 2X3AA 4D2NA 1QFWM 4LLMA 3MFGB 1GKEA 4KC3B 4ESKA 5KJ7E 1HOCB 5LQBH 1AD9B 1XGZA 3UJTH 3FMGH 1IAMA 3IVKA 3NABL 5FFLA 1QPPA 2I5YH 3QVAA 4YVUA 1ZA6A 4PB0L 3HBPA 4KO7A 1H15A 3SYQA 3HMWH 2J88H 2A6JB 3TURA 1EFXA 4ZUTB 4RIRB 2VXVH 3KR3H 4MD5A 5GGSB 3L5JA 2QQNH 3GD1C 4N0FB 4G9FA 4N1HB 4PQXA 3QJRB 2W60B 4V2CB 1E42A 1FSKC 1Q8MA 5D71H 2ZOKB 4ORGA 1KB3A 4LCIL 1I8LA 3N41B 5GSVB 4YHYC 2Z4QA 4Y2DB 2NY2B 3JWOL 1F58H 4M1CD 1RSYA 4K7PL 4M43H 2ZYIA 2Q2LA 3FHAA 4RBPK 5FHAH 3T2LA 3WV0A 5A7BA 3TEWA 3GGWA 5GGVY 1GY1A 1BFOA 2Z0UA 3GSUB 5KSVA 4PVNA 1KZYA 1ORSB 1IIIA 1U8OA 1FE8L 4R0LC 4EMZA 5D2NC 1PZDA 3FMGL 2QPUA 1C8PA 3FRPG 1W0WA 3LKQA 2HFGL 2FEEI 2PYEE 3HMWL 1U41A 3JUZA 3HVDA 4AVJA 1YA5A 1Y7VA 2EDLA 2EEFA 3L5IA 3RI5K 3X11B 5BS0D 1GIGH 4TVUA 5M94B 5D5MA 1KWKA 2CE6A 3HE7A 2RA1A 4RRPG 1RMFL 5F6IC 5FCUH 4Q7DA 1R5WA 4XGZB 3O4LB 1JFQH 2HG5B 1YQ2A 3QPQC 5DCCA 1CUOA 2ZJSL 3QFJD 4O02B 1D6EB 4PYHA 1DN0B 4H5SA 2EE0A 4GKNA 4M43L 2WTRA 5AVXB 3SO3C 5L9DL 4FXGB 2X2JA 1FV1B 4ODUB 4JFDB 4LARL 1J05B 5I1JH 5KAQG 4WI2A 4YDVA 4OJAA 4XNZB 1DDHB 1G0YR 4UNIA 5DVKA 2OYLA 1CE1L 2F53E 3P2BA 3ZYZA 4DW2H 1JL8A 3FUFA 1VPOL 2CDFB 2NNXA 1NGYB 3HFMH 3QXVA 4OJDH 3T65B 3RP1A 1M2VA 1DQIA 3P30H 4RZKA 5H8DA 4JHUA 2JXMB 4OY9A 4N2OA 1L3WA 4PJ7B 2PO6A 2IANB 3K6FA 4IBVA 1WSST 4JRXA 2ESVB 2Z0BA 4LPTA 1AE6H 4JO1H 5DD1H 1FYTA 2Q8BH 5AW9B 4NZRL 1K8DB 1ZA6B 5FCUL 1KJ2A 1MWAB 1JDCA 2GIXA 4UIMB 2OKMA 5IMKB 1I85C 1EFXB 1XIWC 1J5CA 4CDGC 3MLTB 3BWAA 4A6YA 1EDYA 2L4OA 4HV8B 5I19H 5DZVA 4KV5E 2AXFB 4KROC 1LO4H 4G9FB 3ZRSA 4J3OC 1KGCD 3MCLH 3FHQA 1Z9OA 4KK8C 1KC5H 2Y1AA 5D93B 3LZQA 3EO0A 4IEFA 1GS7A 3TIDA 4L3CA 4AYFA 1QRND 4URTB 2CU9A 3QQDA 4YDMA 3BZEB 3VWJD 4A63A 4C56A 5CBAA 2W5PA 5J06A 1WH0A 5CD5D 3NEEA 1A7PL 2VR6A 1JV5A 4O2CA 4JDTL 5DD1L 4F58L 1YY9D 2YO3A 5BRZD 3TCXA 3VG0H 4AENA 1KOAA 3KXFE 4ZJ9A 3QBTB 1X5AA 1PS3A 4XX5A 3FONB 2EYRB 4G6JH 4UT7H 2YZ1A 3QJQB 4NQEA 3SOBH 2VIRB 4M00A 2ZIDA 5LUMA 4LL9A 4CDHA 3K4DA 3WFDH 4HOXA 3DNKA 3OB0K 4OZGA 2CR6A 5EDXA 3EYOA 5J12B 3G6JE 3QT2A 4YPJA 2QPEB 4PH8A 2GJ6E 1PKOA 2X4OA 3Q8CA 4PJFB 2IGFL 3MBEC 1A9BB 5D7KE 2WTRB 4FYQA 1PIFA 1G9NL 1QAWA 2BSSA 1N7MH 2GJPA 2WQUA 4D94A 2G4EA 1CLVA 1A1OB 1KIQA 3QIWA 4NBYB 1T6VN 1TPXC 1ZV9A 2RQ8A 3KWWB 4B27A 4P9HC 5BZXA 1JRHL 1OD7A 4P23C 4R7VA 3TYGH 5J5EA 1M2VB 3RKDD 1JF6A 5DEZA 5F1NB 1KWGA 1S7TB 3JTBA 2QQQA 1JNHA 1RPUA 4G6JL 3TCTA 4UT7L 3AS1A 2PO6B 5CN3A 1LMIA 1DSFL 3FFDA 1FFNA 2VLRA 4ZS6D 1FYTB 3WNNA 1QHPA 5JHLL 2IV9A 3PWNA 4AVKA 5HY9B 3FSVA 5I73B 2R8SL 1KJ2B 2CHZA 5DJ6A 4X99B 4L4TD 3VQ1C 2H3NA 3BRGC 3I6LE 1Y0LB 3BWAB 3CFJB 4FD0A 12E8H 4G8FA 3ARWA 3QSKB 1MFVA 3ZHLA 1IMHC 2WLYA 3GFUA 3MRRB 2APTA 1C08A 4JGJA 4D9QD 2J44A 1OZUA 2EEXA 3CFCL 1PNCA 4L9DA 3T8VA 1H3VA 3QQDB 2D0FA 3D4YA 4YSEA 4C56B 2MJWA 3FQTB 2OMZB 4A7VA 2FBJH 4CMHB 4OQTH 2KQMA 3GQFA 4ZMTA 3EOAA 4YIQA 2YGOA 3CVCA 5F7FA 1T4KA 1BQLL 3S8GB 1NA8A 4KQ3H 1DLHB 3W0WD 3RVVD 2NY0B 5D4QA 1INDH 2F6AA 3DIFB 4Z7WE 5EOCH 1N12A 3MOBH 3ES6A 4WF7A 3HG4A 4CKQA 2XSKA 6FABH 2P24A 1NC4D 2QQKL 1OZTG 4L8DB 3CLWA 1S8DB 3EZJB 2XTLA 1LWHA 3SYAA 2CCWA 3M46A 1A9EA 1DJHA 2FEDD 3KEDA 3MGTA 4ZD3H 1UD3A 2GJZA 3NSXA 2X4OB 3TN0D 4PGDA 4L2LA 4JUTA 1B2YA 2BSED 1NM4A 4TQEH 5K5YA 2UWEB 1TU2A 3K8LA 4AE0A 5GZNC 4OQTL 1HVXA 2AZUA 5IB1B 3E6HB 1MIMH 1AZVA 3T3PF 1RUML 4A7UA 1KJVA 4JPWH 1NEZB 1OTUD 4PCYA 1KIQB 3BUDA 3FFCB 3QIWB 3U0TB 5E56A 4G82A 3HZ3A 4P8QA 3LQAH 1L9TA 2XLLA 1ZT7A 2VAAA 3V4LA 1A3ZA 3BKMH 3MOBL 3ARSA 2G9KA 3HG5A 3WO4B 8FABA 2V17L 6FABL 1MH5B 2JKNA 3FFDB 1FFNB 1YYMH 3EHBD 3VMOA 5DMKA 3AT9A 4LKCB 3CC5A 1FL5A 1YMMA 3KPMA 3PWNB 3EDFA 4JG5A 4ZD3L 4PHZA 2E59A 2NY4B 4HJGA 4FZEL 2EILB 2H47C 2VLLA 5LXGH 1GYCA 1OM9A 3ECQA 1DUYA 4HP5A 1ZAGA 1UD8A 5C7XH 1YEKL 5JLZB 2YPLE 4X7SH 4FQCL 4PY8J 2WWMD 2WLZA 1VIWA 2ZCKH 1CO1A 3RB5A 1OAUH 1JG9A 1WG3A 1RJLA 4M62H 1C08B 3DYMA 4WKZA 5DS8A 5DZLA 4DZBA 4PJXE 4E5XB 1AJ7L 1SF5A 5E2UL 2Q7YB 4NNYA 1JMZA 4JNXA 3SDDB 1NFAA 3MLSH 3KLSA 4GG8A 4R4NC 3T2PA 2WKOF 5JHDB 4MKMA 4JM2C 3BKML 4P3DA 1YYCA 3SGEH 3DA0A 5B1JA 3VGGA 4RX4D 1XCQA 1EH9A 4S2SA 3RZCC 3O3BB 4YIQB 3AVEA 3IAPA 1AGFA 2XWBA 5HDBB 5AG8A 3QEGH 4XZ4A 2X4NA 2AJVH 2ED7A 1KXVC 2YMXH 4XBPA 2F54D 2QEJA 4DF9A 2UXGA 3TYFB 5LXGL 4GBXA 1MRDH 2YD9A 2X1QA 4YHNA 4ZX3A 2VMFA 4KQ0A 3FQNB 3QXTA 3GXDA 2DEYX 2FBRA 4H0GA 4H20H 4N9OB 4X7SL 1IE4A 1NMCC 3DURA 3V0HA 5C0GA 5FYKL 5HP5A 1A9EB 1QR1A 3RWCA 3LKRA 3MGTB 4FTVE 2GJZB 2HLFD 2JJTA 1LK2B 5FOJA 2XKNA 4PGDB 4HIJA 3JYCA 5EOQH 3QUYB 3NDZE 1UOKA 4Z18A 1TU2B 3ESMA 2IWEA 5C7ZA 1A2YB 3ZRCC 3FOLB 1QRKA 1U2HA 2VL4A 3HIZA 1EUTA 4PWIA 2YAEA 1EAPB 4YHPB 4EI5B 5FKAA 4FCHA 4I9WD 4B6ZA 3QXAB 4N2GA 2LLNA 4QRSA 2FSEB 3QI9C 4CJ0A 4OZGF 3RNKA 5JORA 2FX8H 4HQQH 3OR6B 4POYA 5DFVC 3GMPA 1ZT7B 4AYMC 5CEZL 2XT1B 3FTGB 3QCTL 3CN4A 4LHJB 5HJDA 3FCSB 4PS4H 4FLSA 2R56H 5K1NA 4DP7X 5GGRY 4MFHA 3PU7A 4H20L 5A3ID 1GY2A 2F1BA 3P2DA 3C2SA 1FL5B 3CLEL 3VI3E 2YAMA 4PJ8D 1X5JA 4OLWH 3N43B 5HHNB 2YARA 1JNLH 4XN1A 5BZDA 4NUJA 1F3JA 1RD6A 3SBRA 2WLNA 4UB0L 4M93B 3QFDB 4V1DD 1VGEH 4ZFFA 2N7SA 3RDTA 2DYPD 5HGDB 1ZY9A 2XBDA 3P4MB 4HC1A 5F7HA 3FTZA 1VACB 2QDWA 4FYTA 4MB1A 5D7LA 3WNOA 4TS6A 3MNWA 4JY5H 2ZP9A 3FN3A 4QXTA 4PBXA 4GG8B 2DLGA 2F58L 2EIZA 3U4BL 2VQ1A 2XX0A 3H9SE 3PGFL 4PB9H 1TMCB 4EZKA 4QHKI 2UZIL 3QNZA 1XGTB 4PS4L 1SJHA 1ETB1 3R4DA 2R56L 4DO6A 1F4AA 2XX1A 3ARVA 3X1BA 2JQZA 2ZP0T 1AGFB 2WZAA 2XWBB 1DQDL 3ZRFC 4Y4HD 3MUHL 2Q86A 1U42A 4W9JC 4K9JA 4HG4J 2DQDH 4MXWL 4ILDA 3CFEA 5CSZB 4GBXB 1JNLL 4P07A 4BK8A 4QJ5B 2HUEA 3VFUA 1MF2L 3NZHH 1VGEL 4Z7VF 5ERWA 4WGWB 5EFIA 3E7JA 5A6LA 3BXNB 5CR1A 4AYSA 4PGJA 4FJ6A 1PKQB 2YN5A 2WBJA 1FVEB 2TAAA 4ZUWA 1PSKL 1X5MA 2ENPA 3DX6A 3GMRA 1KJMA 1WVZA 3CSYA 4KI1A 5AALA 5AZEL 1TCRA 1BDYA 2FIKA 2FD6H 3K72A 3QWRA 4PR5B 1FVCB 5FKAB 4IDLA 2XG5B 4QRSB 1VF5C 2PW1A 3BVVA 4YHKH 5JORB 2I60H 3CXHJ 1AGEA 3GMOB 3GMPB 4KDVA 4NSKA 1RPKA 4NO3A 5L8KB 1GYAA 2DQDL 3L5WB 5DZ9A 1X9UA 3BFQG 4GW5A 4LRNH 5AB1A 3TZVC 4ZFZA 2EICA 3KBFA 3HG1A 3NZHL 4F2EA 1NKGA 2ZOLB 1UEYA 2V3DA 2FUQA 2YKLL 3CFIC 5IY5B 4FA7B 4YDNA 4PJDA 3UTSE 5JIMA 4IJ3B 4UOW0 5BZDB 4ZO7A 4ZAKD 4NUJB 1TZOA 2ILLA 4NO0A 3DVIA 1HAWA 1LWJA 3QW9A 3RDTB 1AYOA 1CGYA 2YK1H 4JQXA 5IV2B 1A66A 1HINL 1SY6A 2FNBA 3RKPA 2BXYA 1R46A 4HF5H 2Y1ZA 1XGUA 3MNWB 4YHKL 3SPJA 3OJVC 5KG9B 1KGUA 1AHKA 3OHXA 1K2DB 2EIZB 2ZUQB 4N2MA 2VQ1B 5TPWH 3S5ZA 4Q6KA 5KBLA 2C3VB 3JV5A 3NGBC 5FO2A 3TCLA 6TAAA 1C12A 4NQQA 4EIZC 3DMMA 1K6QH 2XXCB 5KN5A 3IGAA 4FABH 1L6XA 3O8XC 4GRLA 4CGTA 4M1GL 5EUKA 1ZD6A 2JH2A 4DP5X 5EU7C 2YS4A 1ODUA 1KN4H 1OLLA 3DPDA 2Q86B 3ZDZE 3L3JA 4NM8H 5BV7H 3B3BA 5DJAA 5HD8C 3CFEB 3SDCA 1N0XH 5KVEE 5JYMA 4APQA 1RCYA 2DQJH 3MRHA 1SPDA 1IGJA 2BNRE 1SM3L 2WLJA 5AW1B 4EDXA 4FFZA 3VGHA 2J5LC 1RUAH 4Y9CA 2YK1L 1KCRL 1T1ZB 5EFIB 2XNAA 4N8CH 5IW6B 3L3OA 1M4KA 5TQ0L 4MJ2A 1EXUA 3BRDA 2OXGA 3HNVH 3DX6B 3GMRB 2B3RA 3GIZH 5KBDA 1KJMB 3L5XH 3CSYB 2UVFA 5F0LB 1UGKA 2W1NA 2D9CA 2P80D 1XSJA 2QKIA 5C2BH 1TOXA 3QUZD 4R9HA 3BP4A 5A7EA 1BMGA 4FZ8H 1NCDL 2EH7L 3HI6H 1KB5A 1K6QL 4QMEA 1T5XB 4FABL 5TDNB 2X3BA 1X9QA 2Q87A 1FNLA 1Q72L 1G1CA 1QSZA 2CBOA 5BV7L 1E4XL 2KPWA 3O9WD 4KZCA 4Z7NB 2AEQL 5EN3A 1N0XL 2BNUB 3IDMA 4X6BA 3MKKA 4ZFZB 2APSA 3B2VL 1XZWA 5IMLA 4I89A 2O6CA 4PJEB 5EF3A 4ANVA 2EP6A 3ELQA 4N8CL 2H0PA 2F1EA 4JY6A 2F19L 1CXLA 3GSNB 4CU8A 1AKJB 4K23H 1G0XA 2YQGA 4QRAA 4PRHA 5HYEA 3GXMA 3L5XL 2F8VA 4NO0B 2Q1EA 1E5YA 1FIGH 1AOHA 2NUTB 5T3XE 4JANB 3GMLA 1X5XA 4WNJA 2A0LD 1J9SA 3GSVA 4G7VL 5DJ2B 5DJXA 3MUJA 1ZEAL 3CZSA 4NIKB 2EUWA 3BPOB 3OHXB 3ZYJA 4J2QA 3DXAD 4GXFA 4F57H 4NWUL 4ZQTA 3TCLB 1INEH 3UTQB 1O7VA 1J87A 1JZGA 3DMMB 3VGBA 4JB9H 1CBVH 2YQ2A 4KRLB 3BI9X 4GSQA 4WUUD 1HYRC 4FQ1L 5IGXL 4NUQA 2CO6A 3RUGF 4PJ9A 5DJAB 4ENZA 3B6SA 1P6WA 1VGKA 3QHFH 1H9DA 4APQB 3Q05A 4KXZH 4J5VA 3PFQA 2NXZB 5IR1B 2B0SH 1AS6A 4Z8FL 1MCLA 2J71A 4ETYA 4WWKD 2XNAB 4HFUH 1SYVB 4L5FH 4QHLA 3RAJH 4EN2A 1X9RA 2H7WA 3VRLE 2QLYA 4L4VB 5E7BA 4FP8L 3I2CH 1EXUB 3EFOB 4C4KO 2OXGB 4JO2H 1Q0XH 5GHWL 5C0AD 4JE0A 2L04A 4JHVA 4ZPTA 1XH2A 1B6DA 3T0EB 2ERJB 3RFZC 5BVJA 5CLWA 3DVFA 4AW4A 4JRYD 2Y7QB 1INEL 2X4QA 4ODSL 1UJ3B 3F6LA 3HPJB 2R27A 1PG7H 4FTDA 4HZLA 4RSVA 4ICXA 1KB5B 2EKSB 4I87A 4NQDA 2HVKB 3U0WH 2EYTB 1FIEA 3MRDA 4M8UA 43CAB 1SGKA 3E3QE 4XZUA 3T3ME 3ZHFA 5I6XB 3D39A 4OZ4B 3D33A 3PWUB 3IDMB 4PJAF 2H9GA 3DHJA 3QHFL 4X6BB 3QXDB 4WTXA 5FLVA 3U6RA 2NY7H 2YSSA 1ILSA 1OTSD 5IMLB 3IDGA 3V0AC 1PZ2A 4AL8C 4PG9B 4AQZA 2VSDA 4HFUL 2YD7A 4L5FL 3S4SB 4ZXBD 3REVB 2JI3A 1W91A 1EERB 4CSSA 1HXKA 3WS6A 1I9IH 1Q0XL 4LOEA 4NZTH 4PRHB 1F4XH 2XFGB 2Q6WA 4LE8A 1U3YA 1NBYB 3NQKA 3ARDC 5KW9L 2BFGA 1WWWX 3W9EB 1MFBH 4Q9RH 3U0WL 4F33A 5DJXB 5FO7A 4YO0A 4MJ6A 3AU1A 3RPIA 4HDIB 2VLKA 2FT8A 3NESA 4EUPB 1FPTL 1MCCA 4B9IA 4PJDF 1JV2A 1CGVA 1HSBA 4BZ1L 5E8NB 4AMKH 4KKCD 1RAMA 1NFDB 4FJYA 3CFBA 3DX2A 4LU5H 5JA8B 2QTEA 4P5TC 1HK6A 2XQBH 3HHRB 3TH2T 1A02N 3BN9D 4TNWK 1SYSB 5FF6A 2VDPL 5KVDL 4ADJA 2JELH 2CO6B 2JQMA 3QRBA 4PJ9B 4LFHD 2VM4A 2D8KA 2A77H 4X80H 2C9VA 1VGKB 5FDYA 3APNA 3QK0A 5IB4A 5D96B 1DJYA 3FO0L 1ICTA 1VA9A 2OTUA 2FIRT 3QEHB 3DX9A 4M7ZC 5ESVB 2B1OA 1SDYA 3IFOB 1HHKA 3QNFA 3C6SA 4GG6E 3L4UA 2BP5M 5KS9A 4H8WC 4PD4K 4Q9RL 3W39A 3F12B 2HT4C 3QEUA 3KM1A 1IAKA 4JG1H 5CMAA 2ZOOA 1JGUH 3IEAA 5BVJB 2NNCA 5M7QA 1H3TA 3FT0A 4LGPB 3ESVF 4FFTA 2DQCL 4HZLB 2AKRB 3DSFH 4MDRA 4PG2A 4QRPD 4XAWH 1TKWB 3LKSA 3ZIMA 4JO3H 4B95C 4QOKA 4LCWA 3MRDB 2XQBL 5GS3A 1ZTXH 1EZUA 3D39B 4LESA 5B7MA 1XR9A 4XVJL 5D4JA 3G5XA 1BECA 1ACYH 3BD4A 3HLKA 4X80L 5KVGE 1R5VA 4PCKA 1LLAA 4Y5VC 1BM7A 1UACH 2YSSB 1YC8A 4M5TA 5J6GB 3L3GA 2ZAHA 1EXHA 1Q90A 3V4PH 4Q0XL 3QCUH 5E1HB 1TTAA 1BVNP 2NTSP 1LP9A 3IFPA 4U6HA 4WUKL 3F7QA 3T0XA 1NMBH 3D0VA 2O5ZH 5LDSA 3DUSA 1FDLL 3MJ6A 4HLJA 2LU4A 1A7RH 1VHPA 3DSFL 5LCVA 2TRHA 2VDMH 3HUJE 3QUKA 5AFAA 4ABUA 2Z35B 3MJ9H 2WINA 2FYYB 3CZKA 1FFPA 5INDA 1ZTXL 1U33A 1MZZA 4GO6B 3ARFC 4EN3C 2P5EA 1JV2B 1HSBB 3L81A 2GJJA 4UILH 5E1QA 1NOLA 1D9KC 1GYVA 3IRZA 1UACL 1PIGA 1MHEA 3N1QC 1BVKA 4XTRD 1X6NA 4IS6A 4XPHH 2P5WB 2PWFA 5KSUB 3CVHA 4AQOA 2XFXA 4LBEA 3C2AH 3WHE1 3A3YB 1DSYA 5AOIA 1GJUA 1V55B 2VSCA 4KX8A 4E36A 3ULSB 3HNTH 1TFHA 1UENA 4FQ2L 3V0WL 3HS0B 1NMBL 1NSNH 2YIHA 5ABZA 2KMWA 5C0CA 3LRGA 1GTNA 3HAEA 4L8CA 1H3WM 1SUHA 4K3HA 4ONFH 3CFQA 1A7RL 1C5CL 3UAJD 3PQYE 5KS9B 3QCVH 2ICCA 4OM1H 4M03A 5GGUA 4X5XA 5I26A 2DMBA 2OMWB 1LYQA 1HL4A 3QEUB 4ELMB 1IAKB 4YSQA 3BQUA 5CMAB 1ETZA 2CO1A 3AQYA 4HEMA 2ZX6A 4NP9A 2B8OT 1QWNA 1Y07A 5F21B 1OHZA 35C8H 4G8GA 4UILL 1BVNT 1FAIL 4F5CE 4MJ4A 3GI8L 2ADFL 1ZWIA 3JWDL 4D9LL 1JGDB 3LKSB 2DV6A 3GMQA 1GGUA 2BCMA 4QOKB 4Y16A 1J8HE 3MV8A 3V6OC 4WW2C 1U8NB 5J56B 1NICA 4QRUA 5K33A 3O6ML 1CI3M 2VQ4A 3QWQB 1XR9B 4TVPL 4FHKA 2G60L 4BWUA 1V7ML 1A8JH 4LMQE 2X53A 3FUIA 3UZQA 3HNTL 4JFVA 4LSPL 5LNDA 4MLIA 3U82B 3HRZC 4HFWB 1B0WA 1NSNL 3P11L 1Z9LA 2AV7B 5ANMA 3I6KB 1UXMA 2BP0B 3TO2A 3ARYA 5F1OB 3QCVL 1YEFL 4MXVE 1E27A 3QUHA 5FECA 1J5HA 1BM3L 2YA0A 4QYOA 5E9DE 4U6HB 3CDZA 3SD2A 1IQDA 1ZJBA 1E5BA 3PIQA 2R2BB 1JUFA 3H42H 5TQ2H 2VDRH 4P48A 4X9BA 4KI5F 3WELA 35C8L 2EECA 2P43B 4KXDA 1BQHG 1NBVL 1L9SA 2C7UB 2OL3B 3O45B 4ELDA 1ILUA 1RSFA 3AY2A 4NFBA 2IBZX 1G7JB 1IRAY 2DM3A 2KLRA 4ZTPL 5HJ3B 5HYSA 4HXAH 3LSOB 1EHLH 5D1ZI 4LLUA 2ZOTA 3U0PB 2G2RB 1FFPB 1NC2D 3BPCB 2BSBA 4HUCA 3HI5L 1MLCB 4JN2B 4UOJA 4HK3J 4AGPA 2ED9A 1KY6A 3C5SA 3LNFA 2C3XA 1LILA 2AK4B 2YBGA 4PRIA 2H8PB 4AZ8A 4DEWA 4FL4C 3ZE1E 4JS7A 1MHEB 1TJHL 4LDCA 3DYPA 3M1CA 4KHXL 5HDLA 4H0LC 1PMYA 4XN7A 3PXHA 1E4HA 2FATH 5ICXA 5CSGA 4JFOB 2NCMA 3QEQB 3NCYS 1OY3B 3SJVD 4N8VG 1GGBH 3H42L 4Y2OA 3LS5L 1ONQA 5C0CB 4BUGA 3HAEB 1EEYA 1IAII 1VFAA 1AD0A 2XWDA 5F7MC 3QIUA 4KJPC 4KPHH 1KZQA 3ARBB 5H2BA 4HJJH 3M1BA 3FQUB 1FFRA 1LTXA 2YPVH 4XHJD 2X9XA 3QUXA 4OZHB 4XBGA 4XPTH 5I8CB 1CGSL 3BQUB 2WMPB 3IGFA 3VTAA 3OKKB 5DSCA 2EDJA 3T0AA 2HN7A 3G5ZB 1A3LL 4H4NA 1BLNB 4XNMB 4ETQB 2RGSA 1MHHB 2VDLH 4Z7QF 3SDYH 4CBZA 1C5DB 1FLRH 2ICEB 3QIBD 3A24A 1IC5L 2OTWA 4V2BA 4AXWA 2LT9A 3BWSA 3KLHC 3ERXA 3KLAB 2YBRB 2R69A 3ZE0B 2AMUA 4A1RA 3DV4A 2A9MH 4CVUA 3LRKA 5FYKE 1AKPA 1QPXA 3OMAB 3ML9A 2VT0A 4WI8A 3T77B 4DK3A 1VCBC 5B39B 4WV1A 1DFBL 3KPSE 4GAAA 5SWZB 3TO2B 3PREA 1GS6X 2A74A 4Q6IB 1BZ7B 4ZOEA 3RRQA 3T1FA 3IFNH 4ODWA 4BINA 3PRZA 4N6QA 1IQDB 1E6OL 3V4VB 4K71C 1MCIA 4YNYB 4NKQB 1SXCA 1XF5B 2Q0ZX 4D0BB 2WVVA 5DHVA 4OCYH 3B7TA 1NLBH 5EU6E 5E9NA 5FW7A 1RZPA 2DL2A 4NQCB 1H6EA 1K5NA 3MLYH 2RCSH 2IAMA 2ZF9A 4MDJB 2MCMA 1T03H 1YPZA 1XGPA 1OAYH 4OUOA 3C5SB 1UB6A 1N26A 4POUB 4PRIB 1LP9F 2OX5B 3PP3H 5F7LB 2EDFA 4AZ8B 1XH3B 3H3KA 5GGTA 1KBPA 3HRPA 2IOOA 3QDJE 3E80A 1QZNA 5H94B 3WHE0 5HYJE 2E7LC 3VSVA 3QUMA 1LE5A 2BHYA 1P5VB 2HKAA 2TSAA 2QJDA 5AVUB 2FJFA 4K9EH 1RZ8B 4BWWA 4AVHA 4Y4FC 1SVZA 5TDNA 4NC2B 5F96L 4GAFB 1NIAA 5MEQA 2XG4A 1MCEA 1JGVH 5DJCA 4UDTA 3QIUB 5H2BB 2AXJA 2XN9E 4LGSB 2PR4H 3L3KB 1HIMH 4ONOA 4X5RA 4XC1L 2GSIB 4WFHE 3QUXB 4ECNA 5DJZB 1H0DA 4X9IA 4S1SL 5DSCB 1G9HA 3LEYH 3AU0A 3C08L 3BZ4A 4Y4KC 4L1TA 4UQ3B 4XNUH 3DPBB 3QPQD 4MS8C 1A22B 4HSQA 1BGXL 1IARB 2YAPA 2XV3A 3AXLA 3SDAA 3SKJL 3MNVA 1S7RB 4XN9A 5MI0C 3CK0H 4K9EL 3WFZA 5LAXB 5EU5A 3AG3B 4K3DH 1EPFA 4O02L 3EUDA 1JZIA 2EDMA 4WV1B 4JR9H 5DJDA 4AGQA 3D4CA 1KXQA 1HCZA 1P6FA 1R3LA 2ADIA 4ZFOA 1EGJA 2PR4L 3MV11 1G9MC 3T1FB 1F3RB 4ODWB 4PV9A 4R2GB 2UXTA 3V4PB 4DQOL 2Z91B 5FW8A 3QORC 4I0CC 2BERA 3EYVA 4DKEH 4YXHH 3NIFB 4JRFA 4RMWA 3HA0A 1MREL 3LEYL 5JW4N 1CCZA 4X98A 1RZJH 4Z78A 4NZJA 4E41B 1A4JB 3BYTA 3KE0A 5DHVB 4HLZG 2X7LA 5CGYC 3UZVA 1UHVA 1VZIA 2LW3A 1JZ2A 2IAMB 4XP1H 3VW3L 1G6VK 1NCHA 4PJGA 2VABA 5E5UB 1T83A 4P2RB 5EPMB 2L7EA 3ROLA 4J3OD 2VYRE 4K3DL 1RZKC 2MQ3A 3T0VA 3WSQL 1KB9K 5DWPA 1FL6A 2HRGA 1CFNB 2OMYB 3QO1A 3VSTA 5I0WA 4UQ2A 2VISA 4Y1AE 1FG2B 3CZLA 3QUMB 3X14B 2NY5H 4NC1C 1LE5B 4IHBA 1FAKT 4X9FA 4LVHC 4DFHA 1DZBA 3V9FA 3EJYC 1IGFL 1HESA 3CBKB 3V4UH 1TETH 4N8UA 5EEZA 1G7PB 4I2XB 1WD8A 2CUHA 5CXPA 1XCWA 1SBBA 1EEZA 2IFFL 1WBYA 4NPKA 2P9RA 2WVSA 4J3UA 3RVWC 4CUCA 5HVHB 5IVXB 1AYRA 2MPVA 4LSTL 5HYIA 2RALA 5GRXG 2BVYA 1E9OA 4FGMA 1UT9A 2BNQB 5HHQA 3TNNA 3IMBA 4NKOA 4TPRH 5BUAA 1ZE3H 2BRQA 4OCMC 1P4IH 1U8JA 2NRDA 4KVNH 1JPFA 4Z7UE 5EORL 4MJIE 4FNPA 4DN4H 1K9TA 2SEBA 3NP4A 4F8TA 4F93B 4C4UA 1MCWM 4JFEE 1IZKA 3MBED 2O5XL 4YBHA 2NY5L 4FS0A 1SXZA 3QYMA 3JWOC 3OKLB 3EJTA 3FUEA 4WZ9A 1IV8A 5FK9A 3CZEA 4M6NH 4YWGL 4X4KA 1BPLB 3DDFA 4N22A 3T4AA 3MCYA 4A6YH 2B2XL 2R83A 3FO9A 3IWUA 4HHAA 4LAJH 1IAOB 4QXVA 5ENWA 3S3SA 3WEAA 2ADIB 4KJYB 2W0LA 1IBZA 1FZMA 4KX7A 3BVNA 3GC3A 4R26H 1B0RA 1BD2D 3EYVB 4CSTA 1AS8A 4OQ1A 2XXFA 1AZNA 4HS8L 4WTQA 3V5KA 3ROOA 4WDIA 5IFJB 1CFTB 2VDRB 1FH5H 3V52L 2NX5E 4Z78B 2Q3AA 4J1UB 4DN4L 3TA3A 5JXEC 3M88A 3BAYA 2EUVA 1VRSA 4R5VA 3B8YA 3BD3A 3UZVB 3US0A 4AJVA 1RUPH 2GFBA 1E90A 2WP3T 3GSWA 1MFAH 3S8FB 2VAJA 2VABB 5F7YC 1KJ2L 4JVPA 4KKAC 3HZVA 2J1XA 3DSNB 4YPGA 2Z31A 3MRGB 3TBVA 2CQVA 1FL6B 3QO1B 4S10A 4KY1H 1AZBA 2CPUA 4QRRA 5B3JF 1LNUA 1UB5A 3A4DA 4XAKE 1IJNA 1UA7A 1YY8A 2XUWA 3P3TA 4PBDA 5C0DA 4XP9L 3DUUA 2XA8H 4PWHA 4LDOB 2DD8H 2GCYA 3ZT5A 4D9RD 1JVKA 4Z76A 1EEZB 1WBYB 5JMOC 4I48A 2ENQA 1F13A 4LEXH 5I82A 5LKNA 1N4XH 1F86A 2YPKB 5D2LF 4GP4B 1ZVHA 1T1WA 2AANA 1GAFH 3L6FB 5JPNC 1Z5HA 2PW2A 3IBEA 2QL1A 5IB5A 4RAVA 5L2KD 1RUPL 3QUYC 1BVOA 1MFAL 2D7NA 3F3HA 4IRZH 3RWGA 5SX5K 4XN2A 3VG9C 2DW5A 3ZGIA 5CINH 1P7QA 2C9UA 1GOFA 3BOVA 4GAGH 4MNGA 3B2UC 3QA3A 3NRQA 3D18A 3U4KA 4DKFH 1F2QA 3B9DA 1E30A 3NCYP 3PWLB 5JTWA 3N1PC 4J8RA 5E23A 4I0PA 2XBTA 5BOJA 1JF1B 1H3UA 5GZND 2CK0L 2DD8L 5G4NA 1PLBA 4U1NA 4I1PA 1TTCA 4F7EB 4TSBL 1GSMA 1DBAH 1AO7D 2LVEA 4U1HB 3C9NA 1S5IH 5D1QE 3T4AB 4LEXL 3VFMA 3FO9B 4DPCX 1VEOA 3K2UL 3HN5A 3IDIB 5HPMB 4P46A 1KGXA 3PLYA 4PVBA 2IDTA 1GAFL 4ATTA 2EXWC 2N59A 3L7FB 3EDEA 3WAJA 4CSZA 5FWRA 2GHWB 4HK0B 2AQTA 1TVHA 2PN5A 3V5KB 2YGVA 5DMGD 5F70A 5CINL 2WHVA 5HHOE 1YNTA 4DGVH 5F3HB 3RGVA 1MUJA 3TA3B 5KSBF 4FEMA 3VFSA 4UDUA 5FUZH 1GOHA 1J0KA 2PWEA 3P9LA 1RJZA 1WZKA 3L4TA 3GEFA 1BAWA 3I84A 1KCBA 4UM8B 2B59B 3HHSA 4GUCA 4HJSA 1JK9A 1I1AB 4J3OF 4YPGB 3CQFA 1WFOA 2V3EA 5GRVK 3TBVB 4F1SA 4MYWB 2WSDA 1BA9A 5IIEB 4QRRB 4PBVC 2CDGA 4DN3H 3S2AA 1IE5A 1F5WA 3ASWA 1YY8B 2C3WA 5GZOA 4IRSB 5E5MA 3PAYA 3BH4A 4FX5A 4LP8A 3OLDA 4OT1L 3CXDH 1PZBA 4D0DA 3RZCD 3EYFB 4Z76B 4I48B 5F71A 3W9DB 4YDJA 3WJLA 4OD1H 1E6JL 1RLBA 5EUOE 3BP5A 2ITEA 5FUZL 2CGZA 2W65A 4RAVB 5IB5B 5K69A 2DLHA 1M53A 1S9XB 3AREC 3RWGB 1UZGA 1UXWA 4TQIA 5F9DC 1DBJH 3MXVH 4PI2A 4HPYH 3WEOA 1LD9B 4MNGB 3QA3B 5KVDE 2BJMH 2FL5B 3BKYH 4BK5A 2WB7A 2ZWNA 3F8UB 4ZDHA 3OB0H 4DN3L 3WL9A 1WAAA 3KH4A 4GSRA 2IWFA 4XPAH 1JGEA 2HKHL 2ZUYA 1NANI 4JFSA 4OIIH 4U1NB 3D2UD 2DY2A 1RZ7L 3X1GA 2CAKA 2V2XB 3D25A 2WVTA 3ZKQD 3V7AG 3QI9D 4XOAA 5D7JC 1YN7B 1ZMYA 3KBHE 1XFPA 4UYPA 1G6RH 3O11A 3OKDA 5L6YL 4HAKA 5BRZA 3BUYB 3KM2A 2I32A 4AWJC 5AL0A 2Y36H 4W9IC 5DDHB 3MXVL 2NQ3A 1FO0A 3IMSA 4NNXA 4KUCD 1Z9PA 2PPFA 3BKYL 4DGYH 3CQPA 2A1WL 5BS0B 4UDUB 4FRWA 2Z34A 1TT6A 4R83A 4MAYC 5IJVA 5MP6L 2HX8A 1QFHA 2C9QA 1RJZB 4G71B 3QJHA 4XVUD 4IDJH 1ITCA 2OQJA 4DP8X 3H7LA 5E1GA 4BQCA 1E0OB 2E7MA 2P8MB 3ZDXF 4AEIL 3QFJB 4KQ4H 3V8CA 1X44A 1MCNA 4ONGH 3KYOB 4YSPA 1TTFA 3B2XA 4PJIE 2I9TA 1TR7A 2XTJE 1XB6A 4XPFH 3T3PB 3FS9A 4O51B 5E5MB 4JFUA 1MI5E 4WHTA 3VB8A 5PAZA 3MNDA 4D0DB 5HGHB 4QY8A 3Q43A 2FT6A 4OGAC 3TT1L 1EDHA 5KAQF 3CSGA 2D4DA 4R5XA 4OZIA 3GB7A 5JW4M 5DUBA 4DP0X 3QDGD 3FU0A 3RA7L 2PPCA 2MWCA 5FYLD 4URKA 4RDBA 4HCRA 5GSRA 3V6ZA 1HHJB 3BP5B 4DP6X 1IGYA 2CLRA 3CVIH 3MGAA 3L4WA 4ZTEA 4RMRA 2N1KA 1IX2A 3B9AA 1UXWB 1G7MA 2CDEB 1U8PB 4H1LB 2Y3AA 3VGAB 5D1XA 1HH6B 4F7MA 2VUKA 2VWEE 1DVFC 5B3SB 2P46B 4MSWB 2D3NA 5D70L 3WYRA 3CLFH 4WFGE 4XVTH 1D7FA 1XF3A 3B2DC 3WL9B 4NT6B 2CLVA 2Y5TA 3LQAC 1KELH 4O4YL 4UTAA 2LABA 3EOYG 1UM6H 4OIBA 2FBOJ 1PQZB 3RBGA 2KBGA 1DVXA 1QRNB 2VL5A 2IH9A 1XGRB 1A4KA 1R19A 2X88A 3ECWA 3VWJB 2IH3A 1XD1A 3VA2C 3EKCA 4U6YB 2BMKA 2XN1A 4FNQA 1DBMH 4NLHA 2CIIA 5I1HL 4I18C 1P7BA 1MVUA 1XCTA 3TZVD 1F6AA 3CVIL 4U1MA 3SKNB 5BRZB 4WI3A 3I6SA 1QBBA 2HT2C 4KTYA 3ARQA 4MMZC 5DD6A 4GH7B 3H3BC 4HYTB 4JGUA 1KBBA 2HTKC 1G5GA 4PN6A 1FO0B 4NNXB 1HZLA 1LDPL 1J9RA 2R4SH 3ZL4H 3BDYL 3WTYA 4TVPE 1DYZA 2YJQA 3MV7E 5FWQA 3KPPB 1J5IA 5IJVB 5FUCC 1HE8A 5T5NG 4ZMPA 3GSRB 1YNLH 2WBWB 2BVPA 5EV7A 4HULB 1OPGL 2DTSA 1TNNA 3UC2A 3M45A 5IJKC 3CFNA 3IMUA 4NAQA 4AQEA 1NCIA 1TZ8A 4LSSL 3MC0A 3E2HB 2NYKA 2I9TB 1T04A 1TSHA 1XB8A 1H8NA 5DJ0A 3LNEA 1RUKH 3QAZB 4LCCC 1BYNA 3DVNB 3ORJA 4GNKB 1C5BL 3NAAH 3ECBA 1G7QA 5G5DB 4DHLA 4HC1L 3ZMRA 3MUGA 5GRWA 3VSUA 5SV4A 3O8XD 5GGQL 4CN1A 2AJSH 4PSRA 3VE0B 3T1WA 5KYXB 3ZL4L 4F80A 3L17A 4BGDA 3LNGA 5C0IB 1NGWB 5HD8D 2CZNA 1KTLB 3LH8A 2Z8WC 4GQ9L 3SCMC 3WJMA 4WJKB 2DLIA 2BFVL 1F45A 3QO0B 3FU3A 3T0EC 4U49A 1R1CA 2GC7C 4JAMA 4LIQL 4X0NA 4L4TB 5CJBA 3VI4F 2ZWLT 4M4PA 3VXNA 1T2XA 4UQEA 3U1QA 3EFDH 3AROA 5F0MB 4MD0A 3BZDA 3RY4A 4LLWB 4QHUA 1RUKL 4LLDA 4WI7A 1QLEH 4UI2A 2Y5TB 4NRZA 3TESA 1MQKL 3GXFA 2PYED 3VA6A 1D5BA 1DJGA 1QI4A 1MCBA 4GT7A 4KFMA 3BSZH 3FRUB 1F11A 2IH3B 3N40P 1QHQA 2CK2A 3PGDB 25C8L 2BMKB 2FGZA 4NDMA 2WOYA 4PGBA 1ZHBA 2CIIB 4L9LB 4BXSV 1PAMA 4IIZA 1SOSA 4U1MB 2CM6A 3CDGA 1KTBA 3X1FA 5DD6B 2BOCA 2QHRH 1KCLA 4UM9D 3CPUA 3W0WB 3SGKC 3G3LA 1TTUA 5BVPH 5GRUL 3MBWB 2HH0H 5DMJB 1QQDB 2IH8A 5FYJH 1D5MB 3F7YA 3Q9PA 2JQAA 1MEXH 2UX6A 3G5VB 4KUCF 1W16A 4G9DA 4UF7C 3IMTA 2C3GA 4HKJA 1NC4B 4GLRH 3BLPX 3FB7B 3QR1A 2P49B 3FZUC 1QLEL 2QVFB 4GS7C 3L3HA 3KLDA 2JB6A 3HE6C 4JN1H 1ZOXA 2QBWA 5I5MA 1S3KL 3GBNL 4ZFGH 2GTWA 2YD3A 4IMKC 2Y7NA 3TN0B 3S88L 5C0EB 3DX3A 3ZHNA 1T04B 4PWEA 4N2EA 4YUEL 5DJ0B 5CJ8A 4R8WH 4FFZH 2FLRT 1A4BA 2WCPA 3L5HA 3VFWB 3KDMB 2JKTM 1BSIA 1SY6L 1I9EA 3IKCA 5D96C 4WWPA 3T09A 3UC0L 3MUGB 1EZLA 2QHRL 2X1PA 4PWFA 1Q1JH 4B9YA 1OQXA 2CO2A 4KH2A 3GDBA 1I7RA 2Y22A 1AR1D 5FYJL 3UL4A 2FRGP 1KBVA 4X8JA 4B9CA 2IGLA 1NUGA 3WJMB 1G7LA 1S78C 1U30A 2NR6C 3QXUA 4ES8A 4K0OA 1KSRA 4QT5B 3I3BA 3PWPE 4N0RA 4ZT1A 4JN1L 1IKOP 1MDAA 4LO9A 4R7NA 5I15H 5I6NA 2JJUA 2R1XA 4NS0A 5IB2B 1R47A 5K1VA 4ACTA 1EO5A 3VXNB 4HUNB 3T4YA 4N28A 3G6JA 2ZUWA 3FBKA 2XY2A 4QHUB 4V1DA 1P4BL 4LLDB 3FO2A 4PRDB 3KXFD 3UBHA 1WZ1L 3RVUD 1PW3A 3BMWA 1D5BB 1ZV5A 2EIMB 5CHNB 4M1DL 4HD9A 4X6EA 1IQWH 1L7TL 3ZHDA 1F11B 1Q1JL 4MMXA 5TK2A 5K59F 2Z1KA 2E27H 3WN5C 3AWGA 4IBTA 5E1AA 1HHIA 2Q7AA 3V9CA 4WJ5A 1KB5L 5AAPA 2AAVA 2WWKO 2GJ6D 3CDGB 2OAAA 2BVQA 3QZMA 1IUZA 3MJ8A 4LPVA 4Y4HA 3RHWF 2F54B 5FDWA 1AZZC 1WIUA 3FU9A 5FM4A 2W8CA 4G9DB 2EDEA 1E2VA 1NTDA 5T3ZL 3TBTA 4X0KA 3O4LE 3BKCL 3LAFA 2Q8AH 3F83A 1YO4A 2P47B 2VH5H 2R59A 1NL0H 2V7HB 1N2RB 3ARDD 4GP5B 4A37A 2CO7A 3DWTA 2R0ZH 2EDHA 4JFDE 2EINB 3ZTCC 1CLCA 3ARGA 3V55A 2DJMA 1S9VB 3WTTA 1I1FA 1L6ZA 1ZXKA 5L7XL 4J39A 3RU8L 5C6PB 3WMSA 5JHAA 4E2OA 4JFFA 1I8IA 4S1DD 5BV7C 2O6PA 1ADQH 4WU7A 3WTXA 4KZEL 3CHSA 4X6CF 1SMOA 4N5EC 2R0KL 3B34A 3X17A 5D1ZA 5IVZA 2IANE 3SE6A 1I7RB 5ACLA 1G7HA 2ESVE 3CH1A 4X8JB 2A99A 5AAWA 3BWUF 3PDDA 4EIUA 4FI7A 4Z7WA 4O5LH 4WK0B 1NGXA 5FW6A 4IBZA 5DQDH 4YDKH 5C0JA 2R1XB 5KZCD 1VEMA 4JGMA 1AQ8A 2R0ZL 4CJ1A 3QRFM 2A6DA 1EUUA 3BQVA 3BGAA 4G9FE 2HT4D 2OSXA 3MCKA 4ZAKA 4IBYA 4V1DB 1ZPLA 2MMXA 3FO2B 4OW6A 3CX5J 5F97E 4Y5XA 2DYPB 1UM5L 4HPOL 4LCVA 4U1GB 1U36A 1UT2A 3G6AB 2H45A 3OAYK 5KYYB 1RIUL 1KNOB 2ZYSA 4XN8A 4Y19D 2BSCA 3Q1SH 3SQRA 4KK5C 4R90H 3ULVE 1O5DT 2DQUH 3MRMA 5EBLA 2JJSA 1XDTT 1RERA 3RLSA 3C5ZA 3PJNA 3RFRA 4JREB 1JZ8A 4NI3A 2ALWA 3IJ8A 1SRDA 1W80A 2B7DT 4HH9B 1OAKL 2V9TA 4WO4A 4XCFL 4RWYL 4WSGA 4DESA 3EO1A 3FUKA 3P40A 1HE7A 5GJSL 4JDZB 5I17B 2V3FA 3JZ7A 3MJ8B 4Y4HB 3RUGB 1OSZA 5FDWB 3JV6B 1MNNA 3VNZA 2Z9TA 1KLUA 1F3DJ 2CGRH 2TSBA 4R96B 3MV01 4BFBD 3R8BB 3TBTB 1R3HB 2Y7SA 4HUXA 1PDKA 2QVKA 1GGIH 1AMYA 4Q2ZB 4X0KB 3RX8A 3ZTNL 3MLXL 3OSKA 1ZLSH 5L4FA 4MA1B 1FWXA 4PJFE 2BSDA 2VZUA 4G72B 1MQ8A 2FJGA 3HCVB 4XP6L 5EU4B 1JZEA 4GXUM 2YPLA 4PJCA 1M71A 5HXMA 4CADA 2VR3A 3V5HA 2DQUL 4Z3FA 2WM0A 2P80A 4XNYH 3R7RA 4XH2A 5CWSB 3VYPA 4AJWA 2M2DA 3A6BL 2BDNH 3ARFD 4XI5C 4EN3D 4QWWC 5BZWA 3QPKA 1D9KD 2D0GA 3DGGB 3FCUB 5IBUG 3V9EA 2BINA 4X7FC 4MA7H 4FF9A 1EAJA 1KPUB 2DLFL 5D1ZB 4IOIB 2VR5A 4PJAB 3PWVA 4ZMWA 4KV5F 5CZVH 1FYTE 2F68X 2IQ9L 4OI9A 1R3JA 4Z1PA 4NJ9L 1JXDA 4OGXL 2OW6A 3OKOA 4Y8DC 4QKXB 1RFDL 5FGBA 3VRIA 1MJ8L 6CGTA 1QFWI 4L8SA 4QRBA 2ZSWB 5JXAH 4JLRA 1T5WA 2H1LM 4L8BA 3MCG1 1YYLH 3NFNB 5LB1A 2BIOA 3SE3A 4GQPH 4OI8A 2ICEC 2O5NA 1G1KA 4FTVA 4ZAKB 1OE3A 4GIPD 4XNYL 4PY7A 1TQWA 3GSOA 3A22A 2XPGA 2XZQH 2BCKB 1PD1A 4OJYA 4WHYG 4C56E 5I30L 3ME0A 2E7HA 1P9MC 4JRLA 3QNYA 4C8XA 2O6DA 2XHNA 4QF1B 5ADOL 4MA7L 3SE4A 2WW8A 1GSKA 2VRQA 1EZSA 3MRMB 2J21A 1XTMA 3DXAA 3DUHA 1UWGH 5CZVL 4AITA 3ZTDC 2J2ZA 3W2DL 2PXYA 3GNMH 3VMNA 1BFVH 2VXQA 3CZFA 3I02A 2H41A 4Q9QL 2GQHA 1JYVA 1YDPA 2VDQH 3CFDB 1E4XI 3TC9A 3TPUA 1YYLL 1OSZB 1R34A 4EBQH 1O5PA 5EZIL 4AUUA 5TGBA 3MA7A 2IC2A 4QHNA 2RH0A 5GS1C 3AM8A 3FPXA 3UACA 4AQAA 3BP7A 4HUXB 1PDKB 4UT6A 1DVUA 2XZQL 1JPSL 3PJSA 5DA4A 5E2TH 3DIVA 1Z9SA 3ZHKA 1CK0L 1SEQH 2VR9A 1A3RL 3W11D 3KGSA 2UWEE 4PJCB 1M71B 4QHMA 3E6FB 3K4ZA 3C60A 3PP4L 3I9GL 5L4MA 5JR1H 2HLEB 1BMWA 4JRYA 3FFCE 2YZ8A 3QUZB 3GNML 5AD0B 3SY0B 1QSFA 3HKZA 5LCVL 1AXIB 5DXWA 5BZWB 3WDHA 2VDQL 2C9PA 1QO3B 4J2XA 2NOYA 1MRFH 4UIKH 1TZIB 4KDTA 4JPSA 1BIIA 2VDKH 4XPGL 3TH3T 4ODVH 1IT9H 5KYUB 4OLVL 2DDQH 2MPAH 4PTUA 2VO5A 2GBUA 3BAIA 1R3JB 2LHAA 3NCBB 3KL3A 2FGWL 1TZGH 4PS3A 3OKOB 3AITA 3RTQA 4ODTH 3LXUX 4ZW8A 3VRIB 1T66D 4IMLA 3KJ4B 4OCRH 3CVHL 3D87B 5DVOA 1RUQH 1OF2B 1T1XB 3IE4A 5LNGA 5ETUA 3U9UB 2DS4A 2CPCA 2V6HA 4LASL 1QR4A 1P69B 4NHUA 3ZVVA 4PTTA 1G9EA 5JR1L 1UT1A 1JWMB 3OZ9L 2XPGB 1WUNT 3P77A 3D8MA 2FYVA 2WAHA 3VQMA 2G75B 4DCQB 3VGFA 4Z7WF 3VRJB 2OSLA 3QNYB 5JHDE 5J11B 3J27A 1IL1A 2M26A 5CILH 2N0KA 3BHBA 4HUWB 3D3VD 2VDKL 3DXAB 3BIBX 1IT9L 1M6OA 2V2WB 5FIEA 2DDQL 3N44B 5BQ7B 2ZCLL 4N4YB 3STBA 4Z7AA 2J2ZB 3NJVA 4R2GC 1TZGL 3TO4D 1CE6A 4F8PA 2FEEL 4PRNB 1G87A 4DVRH 3NCEB 3U4EA 4WUUB 3EYQC 1OT1A 4OCRL 3DV6A 1RPQA 5DTFA 2WUCL 4UCFA 1UG9A 3EH2A 3IT8D 3NUKA 5GJTH 1A64A 4H26A 1JHKH 2H1PL 2APWA 3B9KC 1JPGA 5C07A 5K9KB 4OZFB 4J7RA 3UTSA 1E50A 2E3VA 2E6QA 1X7SA 4H25B 1L7IH 4WWKB 2A9CA 1Z9SB 4TUKH 5C0ND 5I6MA 2CBTA 1HXMA 4OF5A 3B5HA 4XT1C 1R3KB 2IIJA 1HEHC 2ZG1A 5C0AB 1IM3D 2R4RL 2GYSA 5HTSA 5AAMC 1CD0A 4JRYB 3E9TA 3V4VL 3VSQA 1BF5A 2LU7A 1F4WH 5KTEH 4XWGH 5DO8A 5T1MB 4AEHL 5B1KA 4OTXH 1IEAB 5CUSL 2A4CA 1NWOA 3FB5B 5DQ9A 4EIBA 1BIIB 1W9XA 3P9MA 4HKZA 4QDGA 4OFYD 3ELAT 4HD5A 4PTUB 4FMFA 4PW4A 4U1KA 4ZX5A 2QADC 4PJXF 2QTVA 3IRCA 4Y4FD 3FKUS 2XV2A 1L7IL 1HCYA 4IMLB 1BQHA 3H0TB 4ZXBB 5IW1A 5DZOA 1S7WA 2AK1H 3DI2B 4ZUVB 2BHZA 1FBIH 1L9RA 2W9EH 1FCGA 3BUIA 1P5UA 3LRLA 3HJ0A 3KGUA 2HJLA 1BP3B 4HHGA 1JHLL 3BVXA 4P2OA 4UANA 1FNSH 3S8WA 3K6OA 3BPNC 4Y4KD 2H6PB 4OTXL 3RWFA 5L4JA 4UBDC 4QNPE 1I1CA 3LRSA 3MRFB 3OPUA 4A2DA 2WXRA 2FR4B 1SZNA 2BNRD 3MLRL 3UDWA 1M6OB 3O4OC 3FUJA 5GISL 4WW2F 1T89C 1LWRA 3L9YA 1Y6NR 3B7YA 4LSVH 4L3ED 1CE6B 3ISRA 4E42A 1JN6A 3O3AA 2ADJB 2F5AH 4Z23A 4GUPA 2C1OB 3DV6B 1AMXA 5DTFB 1F1DA 3P9WB 4KUZH 5LGJA 2R69L 2AK1L 3TIEA 5CJOH 4A04A 1EHAA 1FBIL 5HVFB 1QUNA 2FWLB 2PWGA 1L9OA 5LWYH 5C07B 2X9ZA 3QORD 5F2FA 3D09A 1FC1A 1K3IA 2EIDA 1PKQE 3MRCA 5E6UB 3SBWA 1FNSL 3RTLA 5T33H 3MV9D 4XX1E 1MAKA 4ZUUA 1M1XB 4IKNA 3SKOB 2ZKYA 4JM4L 4X50A 3GXUB 3VH8A 4YHLL 3RVTD 1QEWB 1TQCC 1ET5A 2O26U 5CGYD 1GPOH 3AXIA 4JZOA 3C8KB 4P04A 2G0LA 1D3CA 3KPQB 2J1WA 5ICZA 4EZJA 3WS3B 4QRPB 4NX0A 4WY7L 4QRTA 3VI3F 2WWNA 5EO1A 5L4IA 3FYIB 3WY4A 1JE6A 3ABGA 1UCBL 2IJ0C 4KNTA 4CNIA 5HYFA 1KYOJ 5DQ9B 3P9MB 4HKZB 1KMGA 1WLHA 5T3XD 4QTHA 3R0NA 5E0FA 5I1AA 4NC0B 1QW8A 1TDQA 3OXRA 1AS7A 3EJYD 3PGCB 4LSQL 1W0VB 5GGTL 4FXKA 4KJWD 4KHTH 3B8SA 1OCRB 3RVWD 5C9JA 1E8ZA 5FHBH 3QUML 5IW1B 3KLKA 1ZVSA 5AOZA 2IV8A 3SGJC 2YR3A 2VITA 3OKEB 4PS8A 4PGEB 5DRWA 5E8OB 2R39A 5AZ2H 4AW7A 1ED3A 1GPOL 1JPTL 4PJHB 3BCFA 4IRJA 2NZ9C 4XC3H 2ZG2A 2YEZA 3SQOH 5D7LE 1UC6A 1NM9A 1KIRB 4ZTOL 4P2OB 3NCWA 3UTPE 3QJTB 2XYCA 3LV3A 1EGJH 1QASA 4M48L 4G6AC 4K8RL 3LNDA 5EEVA 1NC2A 1SEBA 2VZ3A 5EEUA 2R9HC 3L95A 5IWLC 1OB1B 1QMUA 1JGLL 4P4KD 2F15A 4XO5A 2E7CA 2I24N 3FH5A 2F8IA 3FSOA 4LIQE 1JN6B 1MJJB 1GC1H 3X13A 4AJ0A 1F4YH 2YD4A 3ZE2B 2WSPA 1I7TB 1UFUA 1UXSB 1AQDA 1EK3A 3DO7A 1AHWB 3ESUF 4HJEA 2B5IC 3TIEB 3KWXA 5AZ2L 3GK8L 3RIAF 1CPUA 1CU4L 3HG2A 4NI6A 3B9EA 4WFED 5DUPH 1E40A 5B21A 4JPIA 1M7IB 1Q38A 3MRCB 3ZQ9A 2IH1B 2QV4A 4AG4H 5BJTA 5IHZA 3GHBH 5LJYH 4DWHA 1AY1H 3ZKSD 3VWKC 3U46A 32C2B 4M3HA 1OCWL 5JXED 4ZUUB 3VH8B 4BE5A 3IETB 4IU2B 4GMTH 5KSAC 5KUMA 4WCYH 2RACA 1OW0A 4IOSD 4F8QA 7PAZA 4JFPA 2BWDA 3K5RA 3O6FC 2DQMA 5ESQA 5IEHA 5MENA 4C4KT 2FDBP 4HIIA 1DQLL 2I07B 3FC8A 3UP6A 4YXLL 5HVWA 4BSVA 1KIPA 3BUBA 3U36B 4K9EC 3QHZL 4CNIB 4Z7NE 2E76C 1ZLWK 3RL1A 2H6OA 3ZZSA 1KEGL 4A66A 3S5YA 3CFMA 2M83A 2CJUH 4A2FA 2NNAA 2VZ1A 2VDNB 3ZDYF 2OPCA 2ZAIA 3OLEA 4G42A 5DUPL 5F44A 3WHXB 4N6RA 1OIOA 1UA3A 4NBXB 4WSJA 3MRNA 3RY6C 4KVPA 1NBCA 2IWKA 4XCNA 3BN3B 3ILQC 1H5BB 1I8AA 4X5WB 1LL1A 3ECVA 1T7ZA 1HQ4A 3AG4B 3LKOA 3ULUL 1EAQA 2VITB 5DRWB 3NZUA 2Y7LA 4W9KC 4WO0A 3ZIYA 2XN2A 2MOGA 3LZFH 2YEZB 3FBQA 4YDZA 5AW5B 1AGCA 1U91A 3EDKA 4QRQA 4XE0A 5IM7A 2Q76B 2CHDA 4J8QA 1UJTA 3VXMD 1W72A 4OJCA 3DOIA 3GRGA 3ZDZF 3F7KA 2RD0A 2GSGA 3SPCA 4P2YA 4QAWA 1NC2B 4HWEL 4HS6B 5B7EA 2JVUA 5F7EL 2W88A 3KPOA 3GRWA 5FKPA 3RWJA 1N6QH 2BZ7A 2CJUL 2J72A 4JFQB 3BUPA 1J0HA 5KWYC 2XZAL 1NEZG 1FVDA 2BVUA 4ATWA 2R0WL 1GYWA 1FGVH 2ZUXA 4Y89A 3O3DA 3D5OF 1I8LC 2IXQA 2GUOB 1AQDB 5I8OL 3DO7B 4RISH 5FM8A 3STZB 3DOHA 3SJVB 4PV8B 1DN2A 1RZJC 4R0LA 2NYYC 4PPTA 5D2NA 2ADGA 1DVYA 3LZFL 3TT3H 2RMNA 1WEJH 3OXSB 4L4VE 4W4OC 2G5BB 4WNQA 3Q2NA 1KYUA 2G3ZA 4F9PA 1OANA 3WNJA 3WKML 1Q0YL 4KH9A 2HFEB 1RV6X 1VESA 5DEFA 1DEEA 2DWYA 4ZX6A 4XP5H 2F7IA 2FWOA 4WEEA 4JFPB 1CLOH 1LEIB 1PLAA 5ESQB 5F6HI 5MENB 2B20A 3GMMA 2NY5C 4MNQA 3RVXC 2CKNA 3FTVA 3HE7C 3GIVB 4TLUA 1KPRA 2GSMB 3QIBB 5JHLA 1OVZA 5CM1A 4RISL 3GJFK 3RL1B 3RNQB 1R24A 2HUHA 3Q6GH 1QI5A 4CVWA 3L1GA 5T3ZE 3HPLA 5FB8B 3PJLA 4OF8A 2XJLA 4H0IA 3W57A 3WXVH 2DWSA 3MJ7B 1FP5A 2FJHA 1LQBC 2WO4A 4OKVB 4U6XB 2NMSA 3L4CA 5KVFE 3H2PA 3MRNB 4U31A 4XNBA 5MEPB 2FSDA 3L1FA 4M6OH 4PRHE 2HP4A 2XWRA 1ZE3C 1ERNA 3OD3A 4YGAB 4ZO9A 3WEXB 2ZSVA 1IGIH 2VR8A 3PQYA 4OLYL 4DPBX 2E7DA 1T21B 4HUVB 2EDWA 1CLOL 3DHPA 3CFKA 4HU2A 4TQPA 4IBUA 4GKLA 3RWIA 4E9QA 3ZJAA 2JTDA 4F2MB 3WNKA 5DRZB 2XIDA 2UXVA 1XIWA 3VWJC 4G8AC 2JCCA 1NCUA 4NN5C 1YEHH 1NFDE 3KPOB 2LTQC 1BJMA 2AJUL 3PG2A 2CKBB 1J8HA 3LH9A 1FSKB 2K1MA 4YHYB 2H0EA 1B9KA 1FVDB 3Q01A 3VRLF 3W37A 4O9HH 3O3DB 3WENA 5SV3A 1K4DB 5FEBA 4M6OL 3UO1H 3RIFF 3T8XA 5AB0A 4Y7MA 5D7JD 3INUH 4B7IA 4Z95L 4R0LB 3K6SA 2R1YA 2YQ3A 5TDPB 5D2NB 2VXUH 1N64H 3AADB 3X1NA 5E9DA 2DICA 5EN2B 3NJKA 2FWUA 3L4XA 2FJSA 2PCXA 4G3YH 5F9WC 3TP4A 1B2WL 3VD7A 3P4NA 5CJ5A 1GZPB 2JTYA 3E2HC 5DEFB 2R29A 1DEEB 2V0AA 2FWOB 3QQ4B 1TTGA 2Y7MA 5DHEA 1ZLUH 3VTTA 2VR7A 3GMMB 4MNQB 1ID2A 4YJZL 4HW6A 1KPRB 3D39E 2G30A 3F7VA 4WKXA 5DD5H 5ADPH 5TE6H 4PJBB 4UOQA 4HS3A 3SO3B 2HWZL 3HTLX 1R24B 3NVQA 4JFXA 5D9SA 2VN4A 4WEMB 1PJWA 3JWNE 4MD4A 4QAMB 2ED8A 4BBWA 1B4TA 4S0SD 1FNFA 2VXUL 5DFWH 1N64L 1CFMA 2Y07H 2H5UA 4ANWA 3VX1A 3RYMA 2XOTA 4P23A 5GGRA 2M8XA 3IDJB 2JI2A 1CFVH 3QRGH 5B38B 4G83A 2D31B 2J55A 2OXHB 3KLQA 3S35X 3VQLA 1KIUB 1HT6A 5JZ7D 3L7EB 1H8SA 3STLA 5IK3A 4Z5RA 1HILA 2MQCA 2WIIB 2HPTA 1NPUA 5KSBB 3B7UX 3TBSB 4EVNA 3RWIB 1F4HA 2ATKA 1OP5H 2E8YA 1DVFD 2VLKE 1SHWA 3GBML 1UA6H 4QPEA 4CVZA 1FZKA 5SX5H 4KROB 5F1SA 3H3PL 4L9LC 3L54A 5C0RH 1IKFH 1UKQA 2EIBA 4GG6F 2P5WE 4NKMB 1QFUH 3MNZA 2CA3A 2W0FA 1Y1UA 4JX0A 3S3JA 4RFEA 4BHUA 5D7SH 2RTTA 1ET7A 2KDGA 4C4BA 1DE4B 1J11A 5C0FA 1C7SA 1FL3A 1QA9B 2X1XR 3E8UH 1DL7L 1NCCL 1CFVL 3QRGL 3VD3A 3OR7A 4ZQKA 1T80A 2YOCA 1OM3H 3MLVL 3GHEH 4HHWA 3OWRA 3ARRA 2VC2B 2J25A 1PTZA 2LVCA 4ALAH 5KS9E 2HT2D 1DR9A 3OKYA 2FEDC 4HT1H 4OF7A 3V0FA 5KOVC 3BVUA 2HTKD 4BFGA 4ELME 5CLZA 3SDXF 3RWHA 4NLAA 3UBXA 2V5RA 2H2PD 2MNJB 2QT6A 5I76A 1U8HA 4OCXL 5F8RC 1J5OH 1LEGA 1XF2B 2DQEH 2CMRL 2AJXL 4N1CA 1H3PL 1HKLH 3HB3D 5C0RL 3ENEA 3SKMA 4QOKE 1FO0L 1OTUC 2Y6TE 1QFUL 2WXGA 2VCOA 2NSMA 3BYYA 3KCPA 3MBEB 2LR4A 2XWJA 5EIQA 3E8UL 4HS3B 2E4TA 2JSFA 2J8UA 4JFXB 5D9SB 3C6LD 3P69A 5F9OL 1CIDA 2QQLH 3MACH 4YSDA 1HNFA 1CTNA 3VXSA 4LSDA 2VQTA 3S98A 4PREB 4NERA 3EHBC 4LPCA 3R1GL 5EU6D 2RB8A 1NCAH 5CEZD 1J8RA 4ALAL 3QQXA 3IJSA 3HUJF 5LO7A 2D7MA 5C97A 5GRZA 1TPXB 5HYQB 5JQIB 4FFYA 3SKUD 3N85H 5FOBB 3NA9H 2DJUA 1DJXA 1P53A 5GGRB 4QTIH 1ZGLA 4YHOH 4HJ0C 4DO4A 4FLOA 1BD2B 3TV3H 1KBGH 3G6DL 3IGUA 3SCMD 5JIPA 3QDJD 3FF7A 4LF3B 5HYJD 1HILB 4EVNB 4YBQD 2A2QT 4UAHA 2NYZA 2YKKA 4HCRL 4I88A 1IO4C 1YEEL 3GJFB 2PLTA 4J27A 1DZ0A 3H4HA 2GBTA 4LCYB 4CVZB 3DBXA 3DX8A 3ILEA 5DHXB 4Q9CA 2WYZA 4GAYA 5DF0A 5E6YA 3D9AH 5GRVL 3AAZA 2MFNA 2XN9D 2J12B 1DTUA 2BHFA 1S3RA 3NJIA 1IM9A 2W0FB 2DI7A 5CCKL 2OM5A 3N85L 5T1KA 3QEQE 3NA9L 4S0TD 4P0DA 1MWOA 1R5IB 5C0FB 4G6FD 4TOYL 4NM4L 5EIIA 2EC9T 3QDMD 3U1SL 4JM2A 4YHOL 1F56A 4UTAL 3RDJA 3OR7B 5C0CE 1PZCA 1KBGL 1NPJA 1OGTA 4EJ1C 1BBDL 4LLVA 1ZHKB 1LK3H 5B1JC 2JK5B 1JWUA 5DWUH 1CXKA 5TH2B 5GXBB 1KXVA 4OZHE 2CJTA 1GJIA 2FX7H 2HLFC 2FUTA 3UBXB 4CW1A 1TQTA 5L2KB 3NZ8A 3MYJA 1RHHA 4ZMNA 4B5ZA 1F90L 5IHLB 1ETA1 3BGMA 1LEGB 2K6ZA 5JUEH 1NBQA 3FZUD 4MCMA 3AWEA 3BO8B 3SKMB 1MY7A 2L8AA 4ZSOB 4AQ1C 3HE6D 4MXVF 4P4RA 4HIXH 4TF4A 3ZE0E 3W38A 3AY4A 2PUQT 2XWJB 1MXDA 3U7YH 1WFTA 4P3CL 1SDDB 4A7GF 4H2AA 2AAAA 4ZOAA 3VXSB 1NKRA 4ONHA 4Y1AA 3DK2A 4FQJL 4FYSA 1R4XA 3CU1A 4XBEH 1B3JA 2A9AA 3PXLA 1AO7B 3LD8B 4P2QD 5SWZE 1IFGA 5DQJB 4YLQT 3UERA 3KLLA 4D8OA 5DWUL 5LGHH 4YBLB 3SO5A 1RIVH 3R4RA 4KTDH 5IQLA 4I5BA 2FX7L 4N90D 4EAEA 5K9JH 3T0WA 2YJLA 4PJ8C 5IFAH 3FT1A 1ZGLB 3FN0H 1UWXK 3C09B 2AERT 4TVSa 1CFQA 3MROA 1BEXA 3OMZA 2ALAA 3NSFA 3ZE1F 1S78D 5ACMA 4JHAH 4AV0A 2NR6D 1NCBL 1FN4A 4NQCE 4F1ZA 1S6NA 4W9GC 1N59A 5IEKA 2YUXA 4JN2A 2F74A 4YHIA 3IDUA 4QXWA 5BQDA 1I7ZB 1CD9B 2KZKA 2IPKB 3QJFA 1DQMH 4PRIE 2XZCL 4MJIA 1IC7H 5J9PA 2PPDA 1OGSA 1CLZH 2BS8A 1UKTA 2FX9H 2XQ0A 1QD0A 3RIKA 2ZWSA 4JFEA 2R23A 4MA8H 1VFMA 1IM9B 4DVBB 5LGHL 4PVMA 4NFDA 4EDWH 15C8H 5EU3A 4DGUA 5CEXA 1RIVL 2MH4A 4NZUH 4ZOBA 3QUGA 4AH2B 1M6UA 3KL0A 4LVNC 1I9JL 3RL2B 1Z9NA 5E00B 3VFTB 5G2NA 5JHMA 3A4EA 4U6VH 5LBSH 1QLFA 1TYRA 3D51A 4XCCL 2P3YA 3RZCB 3C5JA 1N70A 1T0NB 4J4PA 4OV5A 4TUOA 2Z93A 4Y0GA 4BFOA 1NGQL 4BRVA 5AVTB 3S4SG 5TE4H 4L23A 2OZNA 2BHUA 4UOZA 4D0CA 4CW1B 1MZYA 1DQML 3NZ8B 1J1XL 3KVQA 1CLZL 4F7TA 3VXQA 4ZMZA 2ICWJ 1NMCB 3B5TA 5IHUH 2A6IA 1NH6A 4FCAA 3F00A 1SHSA 3PL6C 3RX7A 4AIEA 1NDTA 1R0AH 4O58L 3NCXA 3S96A 4Z7IA 2B9BA 5IFHL 1CMOA 2WBJC 3QG6A 2I69A 4EUPG 5I6KA 4GUOA 3GLEA 4OV6F 4X7TA 1AC6A 1IKNC 2ATPA 3HBZA 4FFVC 4UT9A 3V8OA 4OJFH 4K3EL 3GI9H 4RGMB 2MTPA 3DRQA 1AXSA 2W07A 1JS4A 2R2HA 3I75B 3QI9B 4DFIA 5FO9A 4N5ED 1TQUA 4HK3N 4L37A 4DJMA 2YFNA 3LRMA 5GS0L 5AVQB 3SE8H 2V7NA 3HJEA 3NIFE 5ALCH 1HL5A 4CN4A 3MROB 2X4UB 3UG4A 5A16A 4ENEC 1BW8A 1V3MA 1FN4B 2EH8H 3TBWA 1OHQA 1YPZE 4YHIB 5CBEB 4HA1A 1W6LA 1E8XA 4HGMA 1PFOA 4P2RE 3TA4D 1CBJA 1OGAD 1V54B 2OI9B 5J9PB 1EJFA 1DLFH 3TV8A 4IHOA 1HYSC 1V7NH 2R23B 1Z66A 3GI9L 1VFOA 4NQSB 3OAZK 4GRWB 1OP3K 1O0VA 2KDYA 3II2A 2GTZA 4JQXC 1XSIA 5EIVA 1AQHA 4K7FA 1F00I 1UH3A 1ZHNA 4D8PB 1HHHA 4Q74A 2P8LA 1PFCA 4LQFH 4IIQB 2NZIA 3CCHA 2B1AL 2BC4B 2E6JA 2CNZA 3ARUA 4P99A 5D1QA 5IVXE 5KYWB 1MLBA 1A0QH 1UGNA 3MUY1 5BO1H 1OXYA 4HWNA 3CN1A 5HDRA 4YK4C 2Q3ZA 4OCWL 3O8XA 3JWNG 3QDGB 5FCSH 2BNQE 3O6LL 4GRLC 4FQIH 5HI3C 3VAEA 2GEEA 3RWDA 1GOGA 4JFHD 3RURA 2DMHA 3S37X 3THML 4BRJA 4D0CB 4F37F 2J4WH 1MFCL 2H26A 3R0MA 5AQ0A 3TNMB 3SDCC 3UYOD 1P1VA 4PLJC 2H3KA 4F7TB 2R0LL 4ZW3A 4RMBA 1V7NL 4BH8A 1T6WA 5BPPA 1RURH 4FKEA 1YHPA 5ITFA 3AWFA 4IBQA 3H9YA 3SEPA 1QVOB 2F7RA 2N3JA 2CO4A 3ARXA 5CR8A 4MAUH 3L3OC 3BH9A 2J6EA 4M5SA 1AP2B 3O9WC 2PTTA 4LQFL 4HCGA 2ZQKA 2QGBA 4FNSA 3UX9B 2ATPB 2VM9A 4Z0BL 2GB2A 5HHOD 4XI5D 2IPTH 2QKIC 1KXQE 3DRQB 1AXSB 2BY2A 3KS0H 4OM0H 1YEGL 5I66B 4KXBA 4JFZH 3NRPA 3LH2H 3NCJH 4KRMB 3PNWA 1A1NB 1TJMA 2X2HA 3O2VH 3TZVB 1IAIH 2QSTA 5J1SC 1CDJA 5A16B 1JPEA 4WTZG 2B14A 4U1SA 4UM9A 5DJ8B 5DHYA 1ASOA 5EUOA 5JQ6H 4M8VA 4RMVA 1JXJA 5IT2L 4IYKA 3O41A 3TBWB 4LHUD 3T2NH 5I23A 5J11C 3QAQA 1TFPA 3FQXB 3EH1A 4KMTH 4BSWA 3P0VH 2AMGA 4G7RB 4FE9A 2O61A 4LVOC 3LCYA 4IHOB 1PPIA 3MOAL 4YE4H 1ZHLB 4GXVH 4L1SA 4A2GA 3D0LA 2G3NA 3IJEA 1JXGA 5T5NF 4ZMYA 4NIYE 4JFZL 1HHHB 5BRPA 1T7XA 2P8LB 3QULB 1U8QA 1OARH 1X6LA 1N3NB 2VW4A 2W9DH 4JMXA 2C4FT 2E75C 3NGBB 4WU5B 3WFBH 4X6CB 2WGNB 1MLBB 4C54A 2X4PB 5B1BB 4Z7UF 3O0RH 3UCRA 2NLJA 3KWTA 2L0DA 3O8XB 4BUHA 3RX9A 1QSVA 3GTNA 4LKXA 2DWTA 4XE5B 3KPLB 3T2NL 1SJEB 5E9AA 3EFFA 3P0VL 4XP4L 5CLYA 3PWJA 1C1EL 1ZANH 2C9RA 2XWZA 3NIDB 1JXKA 4PUBH 5EZOH 1Q9OB 2J5LB 4GKZA 1TZHA 4GXVL 5C6TH 4P2CG 1G7IA 3NJGA 2C1PA 2YRZA 3AW5A 1FHNA 1NFIB 3LVTA 2HPOA 2ZXEB 2PTTB 3PHAA 3RFZA 4OD3L 1JD9A 2PYEB 1XBDA 2XWTB 5D55A 4PRAA 3KWUA 5F7KC 4I3SH 2N4IA 2CSPA 4Z7OB 4JGNA 3CVBA 1L9MA 2FK9A 1MI5A 3VFRA 3DHMA 3QJXA 5DD3H 4TKWA 1MSPA 2YAQA 5IMOA 1DBKL 3TJHC 1WCBB 4JG0L 4KI5C 3LEVH 4B0MM 4UM9B 4U1SB 1ZLVH 1S9WA 3QC6X 4PUBL 2NW2B 3HAEG 5DC9B 5F7DB 5F1IA 3B1UA 4RZCB 4BFFA 1LO3