3RLSA

Crystal structure of yeast af-9 homolog protein yaf9
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
152
Chain Sequence
IKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSLERPHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein AF-9 homolog
publication title Crystal structure of yeast AF-9 homolog protein yaf9
rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 152
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rlsA00
3FK3A 5HJDA 3QRLA 2NDGA 4TMPA 3RLSA 5IOKA 5HJBA 2NDFA 5IQLA 5D7EA 2L7EA
chains in the Genus database with same CATH superfamily
4O9HH 1D2PA 3ASNB 4NQEB 5DEFB 4X8GA 2ZP0T 4NQUA 3AAZA 1ZTXH 1E3FA 1ZSHA 4HXBL 3DPBB 5FA4B 1HT6A 1B6DA 1RZIA 2L4OA 1IAIM 4LVNC 1AR1B 4E9WA 2BM3A 2A38A 2WVVB 1PYWA 1UB5B 2UX6A 1ZMYA 4TSBH 4E9RA 3WTYA 3OR6B 5CR1A 5D1ZC 2HRLA 3FRPB 5FV2A 1VKXA 2DLFH 4PJXA 3QWNA 3H2QA 5DRZB 3P77B 4MCZB 4X6CF 1N59B 4CC4A 4HJ0C 2P52A 3A6CL 1N0XL 2HB0A 1FHGA 5FFGA 1CTMA 4UI2A 2GJJA 3SDXF 4QHNB 2QFRA 5MP6H 5CD5D 1OCWH 5IREA 1K5NA 5GRYA 1B2YA 4LL1A 5IFHH 1JPTL 2ZYSA 4YDKH 1EZUA 4MJIA 5GZND 3Q6FA 3RIKA 1IGTB 2LW3A 1CXKA 3TVMB 1FBIL 3WE6B 1NCDH 4PI2A 4RGOL 4UMGA 5ELIA 4DP1X 2Y2TA 5D6CB 1JHKL 1RY7B 1MCQA 3LIZH 1G7QA 1CBJA 4WI0A 1A25A 5D93C 4DH2A 4H0HB 2EO7A 4XNUH 4Y5YC 2EP6A 2CO3A 5IM7B 5JW4M 1I8UA 1ZJBA 4M8VA 3U7AA 3UTPE 4XVOA 1U8KA 5JIKA 1LO2H 1V3LA 2C3VA 4ZTPL 4YDJA 1JI1A 1J0YA 1QHOA 4XMZA 3DUSB 4ELMB 3IFOB 3E9UA 3L8QA 3PIQB 4P07A 4TQIA 1LGVA 3IAPA 4XBMA 5HHVH 5IP4A 4AITA 1CLYL 3QWRD 5DDHA 4JCWA 4ZRGA 3L3HB 3RY4A 1XFPA 3DTUB 3FS9A 2YD3A 2LU7A 4PW3A 4I5BB 4GUQA 4AYID 3G5ZB 3LZLA 3DDGA 1HXMA 3CC5B 5HHOE 2Z65C 4Z7VB 4WF7A 1MI5A 3VMPA 5D7JD 1I1RA 1QWUA 4HJ1A 3IFPB 1A47A 1RUKH 1EHLH 3P30L 4GMTL 4U7MA 1R3LA 1EXUA 4LHUD 1JGDB 2YPLE 3VFWA 2APTA 2H9GB 3CPLA 4O2CA 5F8RC 3P9MA 4QRPA 1ACYH 1OHZA 5CINL 4S1RL 4XHJC 2IF7A 1HHKB 3ZZ1A 5H4ZA 3VD5A 3BVUA 3QZWA 2EICA 4WFGD 1G6RH 1TJHH 4QTHB 4Z3EA 5J56B 3EIFA 4AUUA 4HIJA 3NZUA 1EO5A 1O6TA 2WWMC 5AVTB 3KGRA 4JPQA 4YGVA 2DLEA 4YSAA 3KE0A 4PJEA 5DUML 3T6ZA 1L7IL 1EO8H 1JYWA 3CCHA 1BZ7A 1RZ8B 3DARA 4AENA 4WUUA 1FLRH 2AK4A 3RIAF 2AEPH 1CGSH 4KX7A 1DDHA 5FO7B 5T5FA 4BDVB 1EBAA 1EJ6A 4FQCH 1B90A 1V3JA 5IVXA 4GIOA 4HKXA 1MAKA 2YGNA 1XR9A 4PRIB 5GGSB 1W9XA 2D7QA 2HFGH 3HW7A 4P46A 4B9IA 3BP5B 3QXDB 4PVNA 3IXAB 1K2DB 2NT0A 4WWPA 5CJXA 3HC3L 2NZIA 4RRPM 4AQOA 5I1HH 4TUOA 4WWKC 5KYUB 2GTZB 1IGCL 1EX0A 3FQ2A 43C9B 1RZJL 1NBVH 4TVPH 1T89C 4N2FA 2AQ1A 3IDGB 3AXHA 1C7TA 2WKOF 1BM7A 1AXIB 5D7IB 2AJSH 2LGNA 3RZCD 5DVPA 2GQHA 2K9UA 2EDKA 4LASL 3SSGA 1ZT7B 3WNLA 3RWDB 2VSDA 2NDGA 2Y5EA 2QPFA 3VFVB 5T3ZD 2B16A 2XVGA 3BKYL 4H2AA 2OK0H 2WYZA 2OMTA 3OKYA 1FJ1A 3PPSA 1NGPH 2VIRB 4PYGA 3MRBA 5D6DA 4AKOA 5J11C 2XIIA 5D8JL 5A2KH 4XR8C 5BJTB 1OSPH 3W57A 1F4HA 5LQBL 3B7RL 2VC2B 2WXRA 1VEPA 4GW5B 3F7RA 4KDVA 5IBUB 4KJPD 3M46A 5AWNH 1IBFA 2ZUUA 2VN6A 4FNRA 4ANWA 1BAFH 2XPYA 3QDHA 1KEML 5DJDB 2RHEA 4HX1B 2X3AA 2QKSA 1KJ2B 2HKFH 4BSWB 2C34A 1YYCA 2YQ2A 5I6PA 4TS6A 4XPTH 4GW1A 4AVKA 2Q5BA 1Q9KA 4F2FA 3HI1B 1Q9WB 5DMIL 1FPTH 5KAQF 3ARQA 4IJ3C 3M8OL 2OZ4H 3FT2A 3S88L 2F6AA 4QRQB 5INDA 3WDJA 1EZVY 1U8MB 5D1XE 1E42A 5KANG 1QBBA 3MKGA 2IDSA 4M00A 2Z35A 4GRWF 4J6IA 4JMXA 3WNIA 5EEVA 1YHPA 2AAVA 2Y06L 3BPCA 2CUIA 4N0RA 3E8VA 3OXRA 3NDYE 3GWJA 3JWNC 2CBOA 1BWMA 2A9NH 4X4YB 2HG5A 4PR5B 4AIZB 3ARXA 2ERJC 5BZWB 5EWIH 5JPMB 5GIRB 3IJEB 4I1RA 4HC1L 4L5FL 4FGMA 5AOZA 1USZA 1GGCL 3IDMA 1JGUL 4FNUA 4U1JB 1BXVA 5AVYB 5D1ZI 1Y0LA 4WY7L 1MH5A 3PNRB 5A2IH 5C6TL 3VFSA 2DH2A 4R4FH 2AXWA 1WFIA 4GP4B 1EFQA 4G83A 3T2NL 3HAEG 3F5WB 4HJUA 3OHXA 5H37H 3TO4B 4YHLH 5E2WH 5IF0A 3EJYC 5DD6A 2AJVH 4OT1L 3JSSA 3N1FC 2PCXA 1QUNA 4M8QB 1NPUA 1SYSB 2UYLA 3B9DA 1UZ6E 3NN8A 4GO9A 4U7SA 1E8YA 3WN5B 3ATAA 2F58H 2I60H 1WAAF 3SKNB 3Q7JA 3IU4H 1ETA1 2GKIA 3MNWB 3IAQA 2VUYA 4IRSC 4JG0H 3R0MA 4P2RD 1IC7L 2X0WA 1A1NB 1D5ZA 4WGWB 43CAA 1TVDA 1BXAA 1QTSA 4RSYA 4J8QA 4HIEA 3KW7A 1OCRB 4N0UB 4PD4J 1DCLA 1IAII 3CV5A 1GC1H 2J3SA 3CVIH 2P24A 3N41B 4UU9A 4FNTA 5IHZB 2BP3A 2YAEA 1AOHA 3DX6A 4TYUA 4EIZC 2KBGA 2OJEA 1CWVA 4R97B 1KWGA 1ASOA 1ZHNB 1AQDA 3AU1A 5D7EA 3VNYA 4LIQH 4OCYH 4ODXA 4S1QH 1YEFL 4QT5A 4MNGE 1K6QL 1D5RA 1XF5B 2CO7B 5D1QD 4U33A 4KV5F 1DZ0A 2G75A 2WQRA 4JPVL 3FZUD 4JHZA 4NQCB 4BH7B 1N7ML 4BA0A 4LCCA 3ECBB 4LCIH 2A6DB 4PRPD 1DFBH 4C59B 3FOMA 3AQDA 4AH2A 4TOYH 3Q05A 3C5ZB 2VDLH 4OR1A 4X6EB 4RZCA 2BSCA 2A6KA 2X40A 3GPEA 4WW2F 3X3FH 1AHWC 1CLOL 1X7TA 3QUKA 4FFZH 1RZGB 2AI0L 3SKJH 5HJGA 1BZEA 4QHUA 5E6IB 5F7FA 4MNQE 3WIFB 1N2RB 4CKVX 3E0GA 3FTUA 4R4BA 1A9EA 1CTNA 4YDNA 5CLTA 4EN3C 4F92B 3KG5A 1TO5A 1RQ5A 1EAOA 5T5NG 3L3DA 5T3ZE 1XGRA 4HDIB 3CLEL 4WI5A 3IXTB 2WCPA 3S0PA 1U8NA 1XB3A 2GCYA 4HK0A 3WO4B 3R1GL 1WICA 4GUPA 3L3JB 4NQTA 4W9DC 5DK2A 1EJFA 3MLRL 3PP4H 5D1ZA 2VDMH 3KJ4C 4RISH 4JM4H 3A67L 5KN5B 2E6QA 1DVUA 3WLBB 1IKOP 1O5PA 4OZFH 2ITDA 4E0RB 3GS0A 4FQXC 4LKCB 1SLXA 3QI9C 1DVTA 2Q0ZX 2ZQKA 3FSAA 1GZHC 1QASA 5EC2A 3HG1B 1GYUA 3NJLA 5AL8A 2C9SA 4HPYH 4H4NA 5JOPE 4U6HA 2D7MA 4JFEE 1FYTB 4MA8L 4NQDB 4DKTA 1IGYA 5DLLA 3ZKNC 1KF9B 1TFHA 2F7QA 3DGGA 4XN8A 4Y2DA 2EDOA 1RCYA 3MBEA 1G9MC 3IETA 3OQ3B 2JLLA 3FQTA 3UTQB 4TLKA 3VG9C 3S5LB 2BVOB 4Y5YA 2YRZA 4U0QB 1QO3A 4GQQA 2K0RA 3IPEA 2IOMA 1NGYB 2G3MA 5JXED 5EEXA 1QI5A 1FNHA 1SJEB 2YKKA 3KYAA 4FHBD 1ZLUH 5JDSB 3BFWA 2P26A 2I5YH 3M6DA 3ILDA 3NAAH 4JRYB 4X2UA 3VDCA 2ZCLH 3CXHK 1HAUA 4F57H 4Y16C 1CXEA 1YEWA 5DRNB 4WWID 3G5WA 5K1VA 3BSZL 4AYGA 1ADQL 5EZIH 2B5IB 1JFQH 3HS0C 4A04A 2EIKB 2NY0C 2DMHA 2QT6A 4QRRD 3LS4H 2DD8H 2XZQL 1RHHA 5D7LD 3SDCD 4MAUL 4PJIA 1XH3B 2QHLA 4OM0H 2E74C 3EGXA 1LEGA 3IFLH 4XI5D 3CQQA 5E99L 4JRXE 4EIBA 4KVCL 5IMLA 1G7LA 4I1NB 1SRDA 2BRRL 3ESNA 1KN4L 1S9YA 3CK0L 3REWA 2ESVA 2HVBA 4OGYL 3ZO9A 3FFOA 1KIPB 2DQDL 4GEJA 3RIAK 1AGBA 3VFGH 1TU2B 4OCSH 4QWWC 5IQ7L 3MGTB 5CCJA 3FH5A 3C9NB 3QIBA 4RMRA 4QHPA 4I9WD 2CUHA 4M61B 3TBBA 4M1DH 4LMQI 1CU4H 1PD0A 1L9OA 2F1BA 4OJYA 3GIVB 4QAMB 3UH8A 3X12B 5IVNA 1KULA 3QQNA 5F7NC 5K1NA 4K55A 1BBDH 1MZZA 1U8JB 4J3UA 5IGXH 1I9IH 2VLLA 4HQQH 5ISZA 2BOBA 2BPBA 1S5IH 3D9AH 4Z7OE 4GG6F 2FO1A 3QXAA 4O58H 2HH0H 4WWKA 3VWJD 1J8HE 3UPRB 2V7NA 1Z9MA 4YSTA 4EDXB 3CZKA 2CIIA 3AG3B 1UT9A 4GXVH 4M43H 1T89A 1KTDA 5C0FA 3P3UA 3T6WA 3PAZA 3U7YH 3GIZH 2Q6WA 2Z31D 4XVTH 1NAML 5GS0H 4D2NA 1QD0A 4I7ZC 1UWXK 1UWEH 2RA1A 3LEVH 4O2FA 4Z7UE 5B39A 4QKXB 1OANA 5G4NA 3RUGF 3S5YA 4DGIL 4XMLL 3RVTC 1BJ8A 1V7NL 4E41B 1QFOA 4OF0A 4JUSA 2IVFC 3FO1B 3VXQB 3TYFB 1UD6A 3ARBD 4TQ8A 4KVNL 1WHPA 2QSTA 1PY0A 3MV7A 4CBPA 1U91A 5LAPA 2WQUA 4TTGA 4G8IA 1W72L 4JKLA 2FLBT 4UTAA 1H8OA 2JIXD 2Q20A 5CFHA 2OMWB 4LSUL 4PJHB 1SBBA 3S48A 2VLKE 5HHPB 2VDMB 4RRPA 2H8PB 2VZUA 2J6WA 3QB7C 2JKSA 2NY3B 4X80H 5J5EA 5GGRA 3NIGE 1T7ZA 2CHNA 4OZFB 3SKMA 1M05A 1RIUL 3HI5L 3E38A 3BKCL 4OV6F 4HHGA 1MCBA 2YC1A 4P23D 2NY6B 4EXKA 2NW3A 4DHLA 4FQHA 3D85D 6CGTA 3KHQA 3SODB 2ZKHL 4JK0D 3KYKH 1YEIL 4F7TA 5C2BL 4CU8A 3KGUA 4NBZB 2FJFB 3FYEB 4XO9A 1AG6A 1LYQA 4ZMAT 1S7XB 2X4NA 5E1IA 3FT3B 4PQXA 3B2MA 2X9XA 5DWUH 3FU0A 2EEBA 4NKDB 1F18A 4NUJB 4DO4A 2ITEA 2J8OA 1WC7A 1FN4A 3KVDD 3CVBA 1BMGA 1MCPH 1AS7A 5HI3C 1ND0B 5DZ9A 1IGFH 2E8YA 2WV3A 2ZKMX 3CSYB 2VERN 3QK0A 1FL5A 4X5WB 4KRLB 2X6MA 3IMBA 3QZOA 3EO9H 3VWKC 1OTTD 1AGCB 3IBOA 4WIQA 4N2CA 1BF8A 5KZCD 3QHZL 3FSOA 4HH9B 4PJXF 4KPHH 2YWYA 3AXIA 3FUFA 5FEBA 4TKWA 3WL9B 2E46A 4R83A 4WAFA 4NHUB 2WN3A 5IBLD 1ODAA 1M6OB 3C08L 1DBAL 2XUWA 4OZIA 3HRPA 1ZA3A 3BH9B 3U46A 4BZYA 4D0CB 1JK9A 2NY2B 3NCMA 2PPDA 3C6LD 4NUGL 4PJAB 3RPIB 5JZ7D 1HC1A 1P7QA 2HUEA 2A6JA 1BA9A 1AZVA 4B27A 5DRWA 4BIKA 2P8PB 3M17A 3FMGL 4IRSA 4Y19A 4WTQA 3VXMA 1XH2A 1JNNL 1U8CA 1T22A 3II3A 1KTRL 3ARGD 3MV8D 1AD9B 1ONQB 4PS7A 4UTCA 1X5GA 1MCFA 1E5ZA 2QSCL 5FA3B 2EEFA 1B88A 3IKCA 4MX7B 3MRGA 3MRFA 2PTTA 5B8CB 4UBDC 2A74C 5HGGS 1EWHA 4JFPA 1AR1D 1OE2A 3BQUB 3DRQB 4QOKE 5HY9B 2P48B 1QSZA 2QHRH 5ABZA 3D39A 4OB5H 4P99A 1IO4C 1I8IB 1MWAL 2HJLA 5SWZA 5ICZB 1CDGA 3US1A 3LH2H 5GSVA 1R24B 1SYVB 4PIRF 5CWSB 2J57A 3MRHB 3NFNA 1IKFH 1VRSA 1JWUB 3RWEB 4F7PA 2BJML 3KPQA 4PAZA 1RIVH 1N4XH 1WBYA 1WA2X 1XF3B 3T2OA 4WTXA 3VE0A 2EXSA 3PL6A 1IQWH 3WY2A 1G7MA 4U2YA 1PG7X 4UT6L 1NSNH 1FV1B 2OMNA 1KPRB 1SEQL 3H3PH 3OZLA 4YDZA 1CBVL 2X87A 2IAMC 2Y7QB 5K9JL 2FIKB 2Y22A 4GAAA 3GXUB 4U6XB 4X5QA 5AAMC 4F80A 1LQSR 1IL1A 1HWWA 1VFBB 2E5EA 2V8LA 4FXKB 4EN3A 4HEPG 3MA9H 3QDAA 1PFCA 2EXYC 3RVVC 4PW9A 5JXAH 3V9EA 4PJEF 4DGWC 4F24A 1DUZB 2CUAA 3WEOA 5CCGE 3MUGA 1PL3A 1RFDL 2K8MA 5IJDC 1FH5L 3ABLB 3LSOB 2V2TB 3PV7A 4Z78A 5GGTH 2RCSH 4OIFA 4Z95H 4HFWA 2FLRT 4BEIA 4D0BA 1XF2B 2DIAA 1RJYA 1EEQA 3A47A 3IM1A 3PV6A 4KKPA 4GRLB 5EZPA 5IVXF 2V2WB 4HUNB 1L7TL 2YO3A 4ZFZA 2F5AL 3ELAT 4FQXA 2DQJH 3SDAA 1A4AA 1FUNA 3QI9A 4X6DA 1KGXA 4ZFOL 5BV7L 4IW4C 5I19L 1MFAL 2YEZA 2VDPL 3R18A 5SWSE 4IBZA 4JN1L 4KI1A 1OAXH 3QCVH 3QUXB 1MRFL 1Q0EA 1BVZA 1XR8A 2IFGA 2R2EB 1I1CA 3WN6A 4CBZA 4NFBA 5JA9A 1X6NA 1KXQE 4JG5A 3U1SH 2MKLC 4O51A 3CE1A 3FFCA 3IDIB 3LMJH 3BP7B 2EE6A 1AE6H 3JWDC 2K4WA 1KCSL 3TP4A 2J8UA 3ZKXC 3QDME 5A7EA 3SBRA 2CIKA 3LIZL 2C1OA 1UH3A 4R3SA 4FJYA 4H8PA 3WD5H 1D3CA 1LK2A 4WW1B 4Y8DC 5FKAB 3SKOB 1T0NA 3HG5A 2GJPA 3GRBA 2KQNA 4HLJA 4MASA 3AVEA 2EYTB 1EXGA 2DEYX 1G7IA 1LP9E 1RULL 4HIXL 4J27A 4OLZH 1ILSA 4HIIA 4Y16A 4YHYB 3UBFA 1FNGA 3B1UA 2CA3A 3GEWB 3PYCA 3NIDE 4U6VH 3U6RB 1DEEB 5F1NB 4KDWA 3ZDXF 3RNKA 1MJ8H 3HS0A 3UL4A 2FECL 3CXDH 3O2WL 4H8UA 4A6YH 4MRBA 5HHVL 5DRXA 2ZOUA 1QFWH 2WIIB 4XX1E 1RU9H 4L3CA 3O6FB 4PLJD 2R0LH 1HXYA 3FAWA 3HNSL 1K4CA 3VQMA 4A39A 3FQUB 3ZYIA 4K3DL 3HFML 3SQBB 1NDMB 5IMMA 5L0QC 4XP1H 3I6SA 2YQBA 2FX9L 1OZTG 1N0LA 1W8OA 3UC2A 15C8L 1NBQA 3BIAX 4YDIH 3FU6A 5E03A 4DVBB 2R9HD 2R1YA 5E1GA 5AALA 3U0WL 1ACYL 3LKQB 1Q94A 2DWSA 3CZUB 3O2DH 3RNQB 1OT2A 3NCEB 3A4AA 4XZUB 1S7SA 2WSDA 4NQEE 3H9YA 1S9XA 2EIBA 3NSCA 3NTCH 1XF4B 4YXKL 2PWFA 2DKMA 3BUTA 3ZDWA 3EBAA 5JW4R 4OD3L 2AQTA 4KUCF 2P80A 4JFSA 4C4UA 3APCA 1J18A 2V2XB 4BWUA 4NZTL 4ALAL 1TJMA 4G8GD 3DOSB 5T1DL 1JV5A 5ESQB 2BNRE 1J10A 5A3ID 3QPXH 4WJ5A 3RBGA 3CFEA 4JFDE 5HYSB 1A1OA 4MCYA 4NQQA 5DGRA 1D6EB 5HHMB 1HS6A 4IJTA 4XBEL 2CK0H 4MMZC 2NRDA 4PCSA 1C12B 2P5WD 4PM1A 4WO4C 1ZS8A 4ANXA 3NZHL 3QP3A 4ZD3L 1Z9NA 2KLTA 2X3CA 3E6FB 1N6UA 1P4IL 2K8QA 2B2XH 5DC4B 5ACLA 4Z7NE 2FLMA 4LQFH 5EOCJ 2BIOA 4IOFC 4KUZH 1SLVA 4HT1H 5E9DE 3RKPA 1KXTB 2OS7A 5GS1B 3VI3F 4OJAA 1BFOA 1IM3A 4PRNB 5IW1A 4M7KL 3IDUA 4J4PA 3UZEC 3GGWB 4AQ8C 2DIEA 3M1BA 3WE1A 1J8SA 2JJVA 2QVIA 3GXPA 1TTCA 3ZR6A 4B5EA 1BCIA 2CGRH 3OXSA 1NJ9A 4IOSD 4C83A 4E36A 1PG7W 2R0KH 4G7VH 4HZ1A 3VFPA 3P3TA 1EDYA 2EIEA 4UINH 3QPQC 1A6WH 3WIHH 2CRMA 4LDEB 3H7BB 5IFJA 2FJSA 5KS9E 4OJFH 1QSED 2XKSA 1BVLB 3VG0H 4WUKH 1E4WL 4NYLB 1AGEB 1FQ9C 2CO6B 2B4CL 2WXFA 1ET5A 4M4RB 4I3RH 3UGXA 1JMXA 3TO4D 1U8LB 2ZONA 3HMWH 4KJYB 1HWGB 4MB1A 3V4VH 4NPYA 1KCKA 3TV3L 4L37A 4CVXB 2UXGA 1RLWA 2H26A 4X7SL 4XGZA 2ICWA 3RWFB 4IQHA 1KJ3H 2WWNA 4D9QD 3FTVA 4TUKL 5JDJA 3GRWA 1YQVH 4GMSH 1VPOL 2YK1H 5AB1A 5JQ6L 2NXYC 1PDKA 1Z5LB 4QKTA 3V9CA 5EUKA 4OJDH 2VKXA 3I9AA 4I87A 3QWOB 3UJTH 1QFUH 4PEEA 4K7PH 1YY8B 4MDJA 1NCWL 2BNUA 1BQLL 3LRMA 2GBTA 2Y69B 3N40P 4WI7A 1S7UB 4GIAA 2DH3A 2X4UB 4R7XA 5ICYB 1HQ4B 4ZW6A 3KLQA 1D9KB 3ZE2F 4FZEH 3WFBH 5DD0H 2XSKA 3PJNA 2WZPA 4OD1H 5FWQA 3AZUA 4A6YB 3MCG1 4PRIE 2HLFD 5F3FA 1NAKL 2MOVA 5TE4H 4G6JL 1WITA 2VXTL 4P5TC 3QQ9D 2XIDA 3LHPH 3QEGL 2J12B 1S3KH 1Q90A 3FOLB 4N0YL 4YSOA 2LLLA 1T2JA 5I66B 2VMDA 1TQCB 5ITBH 3C5ZD 2I7SA 3LKSB 1NIEA 2I9TA 4JJ5B 1CF8H 4TULL 4JZNB 2V5MA 3FCGA 2NLJB 4NRXA 4DP4X 3UCRA 1DTUA 1H8NA 4OCNC 1O7DE 5K39A 4FFYA 5E6ID 4QXWA 3L08A 4PJ7E 3G08B 2TRHA 4E5XA 1AXTL 3CFCH 2Z64C 2EH7H 2XVBA 3MCKA 4IIZA 4JFWA 2A74A 5BS0E 2W59A 3E1ZA 5EPMA 5HHOA 4WFFD 1XGYL 3MLYH 5T1MB 3T9WA 3HZKB 3TNNA 4B0MB 4LOVA 2I25N 2X41A 3RVXD 1F00I 3T8XA 2Z1PA 4UILH 5CF3A 2EZ0D 2YPLA 1ZEAH 2APFA 4M62L 4NWTL 1DQQA 2ZAGA 2Y9RT 1RZJC 4ZYKA 1KSRA 2UXVA 3E2HC 1QKZH 1NGXB 4P57A 4K94H 5AVUB 3PWJB 1QNIA 2BP0A 3VXSE 1QQDA 4PJIF 2WYHA 2XETA 1GXEA 2QGEA 4I2XE 1MVUA 3CHRA 1CD0A 5E2UH 5F3HA 4OQTH 3WHXB 5C0EA 1UM6H 1OGTA 3HG1D 1JZHA 4DKEL 3ABKB 3QUMA 3MACL 4LEOB 1MEXH 4P0DA 2Q86B 2IAMA 4BWWA 4AYFB 5HHQA 2G2NA 1M6UA 1QR4A 3EYQC 2I07A 4HWEL 4DPCX 5IWLC 2EH8H 4NQDD 1N5YH 5SWQB 2Q87A 3CH1B 1J05B 4X9IA 2NY1D 4EPSA 1FIGL 1BZOA 3Q6GL 1PTZA 2YUZA 2E9IA 4XTRC 5E1AA 1QBML 1VACB 3Q3GB 4R6UA 4LOEA 2VMCA 1QRKA 4KO9A 1J0HA 3MLTB 4F7EA 3TC9A 3SY0A 2MCPH 5I75B 4ODTL 4FN0A 4JRYD 1CL7I 1R3JA 3L3KA 4MA7L 1W0WA 1MQKL 2XPGA 5I1LA 1DEDA 3NGBC 1MXGA 1E65A 1MCOL 3HZYB 3BUIA 2P45B 1OSZA 1MFCH 2FBJH 5HJ3A 4L3EA 2A77L 1TETL 2W9DL 2RACA 3QH3B 2AHIA 2YBRB 3DROB 5I0VA 2AQ3A 5J6HB 4F1ZA 1HZHL 2HWZL 3A23A 3O9WC 3QCUL 4GI9A 1UJ3B 2EDDA 1MCCA 5KVDL 4GP8B 4XOEA 3WS3A 3V4VB 5C09A 2J5LB 2XWZA 4LPCA 2F53D 3ARZA 4I0PB 1T6BX 2CJSA 4DP7X 4F7MB 1RJLB 4GS7B 2XWBA 3U9PL 2GHWB 2V17H 4TQEH 3T3PE 1ZANL 4RSVA 1S3RA 1AXSB 2CO1A 2Z93A 3Q1EA 4RX4A 4O4YH 3ML9A 4P9HH 1KJMB 4MDIA 1PFOA 3NQKA 5FHAL 5BZZA 5LVEA 1D7CA 3PWUA 2HMID 1HIML 1RV6X 3QW9A 4YLQT 4FP8L 4PS4L 3VXUD 2P4AB 5GRJL 2DJ4A 4A55A 1GR7A 3BE1H 1G84A 1EA9C 1A7NL 3LEYL 1ZLDA 4WFED 3CHOA 2IH8A 2NZ9D 4GAGH 3BMVA 3GO1H 2XXGA 5JPNB 4OGXL 1LO3H 1MHHA 3HRZB 1YEKL 4J23A 4NQCE 4WK4B 1QLEH 4PRHE 5D1XA 4A37A 3S35H 3HI6L 2HKHH 5DJCB 3ULUH 1KCVL 4MZ2A 2ICEC 2SEBA 4DZBB 3A6BH 1FFNA 3IFLL 3RJDA 2BSDA 4OZ4A 3MN8A 4EJ1C 4H25B 5A2LH 4TVPE 1VF5C 5KVEH 3K6SB 5B3JE 1E6OL 4H5SA 1IT9L 2G60L 2XV2A 3BLKA 1NL0H 4N2GA 1RAMA 3EYSL 1OK8A 2OV0A 4HJJH 4U05A 4JO8A 4MJ6A 3IJYA 3KZ8A 3DSFL 1JAEA 4E41D 4X4MA 3V5HB 4DQAA 5C9JA 1KWKA 4XAWH 3SDXB 4DP0X 4P59L 1TZAA 2B0SL 1Y6NR 3EYVA 4M48L 4OI9A 3QXTA 3TBVA 1Q1JH 5IJVA 4EMZA 3QYNA 3ARFB 2Y1ZA 2GT9B 3ULVL 4QYOB 1IBDA 4A7VA 2E9BA 4G7YH 4B9GA 4F8QA 1KPVA 2VM4A 3BDYH 2X7LB 3MX0B 5FYJH 1ED3A 2XV6B 3BPLB 1SBSL 3MRQA 3FO2A 4GRWH 5A2AA 4DTGL 3C09C 5CR8A 1AD0B 2NY3D 2O5YH 2GUYA 2GHZA 1OKEA 3EOAA 4H0LC 5HSFA 4MMZA 4OZIF 1I9IL 5BXFB 3L4ZA 3CFTA 3SJVB 4ENZA 2WSKA 4XPAH 4WO4A 2NY6D 1BYNA 1CFSA 3DV4A 5TDPA 1T1WA 1T66D 3TNMA 4A63A 5DSCB 2GFBA 1J1OL 5DD5L 3L9EA 5DZNA 1FI8C 2WB7A 1FYTE 4JGJA 1QX1A 3VQ2C 2YGQA 2GIXA 1YVLA 1E2ZA 4BV1A 4FS0A 3CHQA 4MNGA 2XRAL 1M7UA 3C12A 1QYGL 3NFPA 2DM4A 2Y3NA 4IEFB 4C4BA 2VDQH 1KYOK 5FO9A 4JLRB 2VXSH 5DHVB 1IGIL 4LXFA 3ZHDA 1QR1B 5EFIB 3MC0A 3C8DA 4RGND 3UZEA 1QW8A 4AQ8A 1MLBA 5K9QG 1FIEA 2DQCH 2DDQL 2PUQT 1GH7A 3DOHA 4F9LC 5E2VL 1M42A 1A3RL 3KGSA 4E9SA 5KSUB 4AYBA 3WNOA 5I28A 12E8L 3DO4A 2G3XA 2DEXX 4LVHC 1A7OH 5MERB 3MGAA 3WMSA 1EO7A 1IE5A 5HYJB 3NCBB 3HBGA 4K2UL 3W0WD 2DMBA 2DQIH 1EDHA 3GBML 4HWBA 4YPGB 4ZFQA 5F1SA 4YNYA 1ITBB 1JJUA 1KENL 4FHJA 4MNQA 5ETUA 1FDLH 1VCAA 4HS6A 4FDWA 4U6TA 4YDLC 5C08B 1V05A 2F9BT 1YJDC 3JYCA 3MLXH 1BJ1J 2WO4A 1JN6A 3DV6B 4OH2A 4MMYB 3MJ7A 2IH3A 5DMGC 1JRHH 5BRZA 2J1XA 1BZDA 4G42B 2DLHA 4B97A 3GMQB 5L4IA 2OXGA 4IGBB 5ES4B 1O0VA 2VMJA 1JV2B 4HUKB 4JN2B 4N2BA 5EIVA 4L29B 1KT2A 5IFAH 3O0RH 4LSSL 1II4E 4M7JH 4ZXBC 4LHUG 5EU6B 2WBJB 2AGJL 4ADGA 2HVKA 3FRUB 2X9YA 5DJ8A 2RGSA 2HVJA 5F7KC 3EADA 5F1OB 1V27A 3OKEA 3DO3A 1P7HL 1CR9L 2MSPA 2DI7A 3ALXA 1IEBB 4TLUA 1GGYA 4XPBH 3ZJAA 3WUWG 1E9QB 3BQUD 3MNVB 1I9EA 3I85A 2XZAL 4G7SB 4LIQE 3IK2A 3WXVH 5LUMA 1UASA 2UY7A 3KBHE 1NGQH 2UVFA 2XTLA 3KVQA 4UM9A 3VACA 4CSPA 3GSOA 1OSEA 4QCIA 1A66A 5T3XH 1NCCH 1NEUA 4Q9CA 1PX3A 4LCYA 1NBCA 4IBSA 5CP3A 5FCSH 5DFAA 1QLEB 2X6CA 3F12B 4FMKA 1UFUA 1M7DA 3S96B 3WFHA 2YAQA 3DMMD 1MUJB 4YHPA 2C9VA 2FGWH 1TG8A 2A0LD 3MOQA 3PE9A 3ARSA 5DUBA 1NBYA 3ZGHA 1MW3A 2XWEA 2XNAA 5J6GB 1FHNA 3W9EA 2VDRH 3QRBA 1ZE3C 1BECA 2Z4QB 5IHLB 4JY5L 3EGDB 3QG6A 3RVWC 2J8UF 3MOBH 4QO1A 3MYJA 4WDIA 1IGMH 2FJHB 2VRQA 3QQDA 3FBQA 3K4AA 5ALBH 3KLHC 4PIBA 3AGVA 2OP4H 3L5WB 2PPCA 2QADB 4YXHH 5AW7B 1J9SA 2IMNA 1QRNB 2BNQE 2C9QA 3DYPA 2CRZA 5FYKL 4OFIA 5MEND 1B4LA 1TQWA 4M1CD 3VGGA 4OIIL 3KPSB 2IJ0C 1U21A 1EVUA 3OR7A 4ZDHA 3U9UB 4KXAA 4BYHA 3R0NA 4X99A 5FDWB 1QVOA 4JRXA 5J1AA 2R8SH 1KTBA 1U58A 3DUHA 4GRLD 4GQPH 4UDTA 5CUSL 4Q0XH 1UXSB 4C47A 4AYSA 1T7XA 4GRWB 3LNEA 2P46B 3MCLH 4N2KA 3DSNB 5HDWA 3ZOAA 3FTGA 1X5HA 4LCWB 3VXOA 5KANI 4RA0C 1FORL 4NFCA 4OFQA 4YMPA 1H5BA 2NQ3A 4KFMA 2A9ML 2C7UA 1ID5I 4XN5A 5JW4Q 4TM9A 1O6VA 3QUXD 2LLNA 1R1CA 4XP9H 2MTPA 5D2NC 4WTZG 4AYMC 5IWLA 5GHWH 1YUHB 2H7WA 3OZ9L 1UH4A 5IG7B 4B9PA 3G3LA 4Y0GA 2J2ZA 4ZFGL 1UB6A 2DBJA 2QQKL 1X7QA 2WXOA 4ODHH 5B38A 5FXCH 1FO0H 2VAJA 2VDQB 3DUUA 5I76A 2JKIS 2PNDA 3L5HA 1SDDB 4GSUA 2O26U 1EMTL 2LABA 4WFHE 2QV4A 1KCLA 1YEGH 1J8HA 4P2OD 4WV1C 2FWOB 3UO1L 1T21B 4OVVA 3TN0C 3VJ6B 4PN6A 3K6OA 3ZU8A 4JHUA 3LKRA 3CLFL 5F7LB 1KFAL 2R29H 3N0PB 3VSQA 1DBML 1JHTB 4RMQA 5CCHE 2GY7B 4FE9A 4KZCA 3LV3B 2J4WL 1MRCH 5GRWA 3T71A 1Y1UA 4Z7UA 4RQQA 3O6FD 1GPOH 1CC3A 4QGTA 4R7NB 4K3HA 1WZMA 4JAMB 3ULSB 3GKWL 1KGUA 2WTRA 3IMUA 3KYNB 3V0VB 1YMHA 3PXHA 3SCMC 1SOKA 4WNQB 2BXYA 2DWEA 1ZVYA 5G2NA 3WJMB 3OKNA 1RVFH 5BPPA 4Q9QL 1BJMA 5DJ2B 4HC1A 1FZMA 4GAYB 1U8OA 4IBQA 4FQIL 2Z8WC 3Q9QA 1HYSC 3EDFA 4N8VB 2I9LA 2VLKA 2ZD0A 1XB6A 3THML 1T1YA 1B0GB 1D5XA 3BT2H 3APFA 2H2SD 2VL5B 2F54E 2W07A 3C8HA 3OLGA 4NNYB 1F4XL 1IC5H 1L4IA 5L8LB 4FABL 1JOIA 5BO0D 3SB3A 5JOEA 3LKOA 4Z3FA 3ATFA 2NTFB 4WW2B 5L6YH 3BP4A 2WZAA 4MHHG 5B7EA 4XP5L 4GEIA 3VI4E 5EEZA 2QLVB 4PTTA 1WWBX 1RPQA 3N85L 4P05A 1C8QA 3RDTC 5AZEL 4WI6A 3T0WA 1T0MA 4EVNB 3L1GA 5GISL 4R84A 4DP6X 4Y5XC 1H3XA 3LB6D 5CILH 5JMRA 2PO6C 2NOYA 2GG1A 3JTSA 4IRZH 2QSQA 4GFTB 3IU3A 4AC4A 4J6RL 4PP1C 5HHMD 2YXVA 1JDCA 3HNVH 5JHDD 1BQHG 2OA9A 4GSDL 4NO5A 4ODSL 4PLNC 3EJUA 3TM6A 1JNJA 4HD9A 1DBKH 4CMMA 1GHFL 2VDRB 3MJ9L 2YD7A 3MQIA 4Y4HB 2OTUA 5JUEH 2DL9A 4OLWH 5ADPH 4HSCX 3BRDA 2WQWA 3BWAA 3LQAH 5IHUH 5IB3A 3Q1SH 1Z0MA 4XNXL 1XEDA 4ZSOA 5IJKC 3VYPA 3OSKA 3OJMB 4Z77B 3N1PC 4UUJB 3VD7A 4EI0A 5AOIA 1GZPB 4Z18A 2FHFA 3LQZA 3AWGA 2A9AA 2Q2EB 1HHIB 4KH9A 4X6FA 1KYFA 4IOIA 4NQXA 5KBLA 4UNVA 3JBG7 1FGNH 3I84A 1Q8MA 2PW1A 3SYQA 4B9YA 3P0VL 4Y4KC 4AQAA 1N19A 5FGCB 3QAZB 4HCFA 3AU0A 3OKMA 4XN7A 5I73B 3X14A 3SPCA 2IQ9L 5BQ7A 5GXBB 2GC7C 1H8LA 3QFJB 2IANE 2VABB 3B5TA 2X1XR 5BZXA 4BH8B 1ET7A 3PHOB 3BZ4A 5DC9B 4N0CD 5TH2B 3FL7A 2DQGL 4YSDA 4QPEA 4YIQA 2IMMA 1LEIB 1XCTB 1EZLA 3T1WA 1ZSDA 2JLPA 2ZOWA 4P9MH 1T5WA 4QOKA 1T2XA 4QAWA 3CFQA 4X5XB 4AK2A 3U4AA 2K7PA 5I1IH 3I74A 1DQTA 1FO0B 1R3KA 1TEGA 4N9GB 1BEYH 1Z1WA 1GTFA 3I9GL 3P54A 2E7LC 1CURA 4F9LA 2WUCL 3F58L 5BV7C 1GGBL 5KYWB 5DD3H 4H1LG 5IJCC 5GGRY 4NHCH 2CBPA 5F6IC 3HLKA 3EFFB 2AK1L 2AITA 3AITA 5IB4A 1D9KD 1LE5A 1BQUA 4PLKC 4IS6B 4MAYC 5ITFA 3ES6B 2JQZA 3B43A 4KNTA 3TBSA 3A0OA 1NCAL 1PKQE 4YWGL 4ERSH 1PX4A 1NCUA 4X0KB 3DETC 3OJ2C 1LK3H 1TQBC 3B7UX 3R19A 4NRZA 5DEJA 4C54A 4NP4H 1MRDH 1BD2B 3HE6B 4WEMB 3VB8A 4Z8FL 1XDTT 3WCYA 2H0PA 3HE7C 4GKOA 4NQVA 1ZVHA 5IEHB 1Z66A 4ORGB 1R34A 1YNLL 1S9VA 3TURA 2Z1KA 4AY0A 4EI6A 1UADC 3KXFD 1JPGA 2WOYA 4HZAA 4TV3A 1YQVL 1Q0XL 3L6FB 4GG6B 5MEOB 1WD8A 5KVMC 1W15A 2J6EL 1AOZA 1H9VA 3NYKA 4JO4H 2WXHA 5L8JB 2BFVH 1CK0L 2WQXA 4LSPL 1ZK9A 5SWSA 3BPNC 3RL1B 1A6UH 3C2AL 3GLAA 5DJ6A 5KVGH 1P4BL 2IBZY 2Y0SA 4NM4L 1BFVH 4G5AA 4LDOB 2LTQC 3FU9A 2ADJA 1DLFH 3OWRA 1BMWA 3LS5H 3QIUC 4E9LA 1OQXA 4XO8A 3L95B 2D8KA 1MF2L 2R2HA 2OMVA 1INDH 3QDMA 3VSTA 4Z76B 3MRMB 3QR2A 4LOUD 3TX4A 3Q5OA 4HA1A 4IK6A 1C5DB 3KDMA 1M1XA 2HRHA 3K2KA 3P69A 4CILA 5INCB 1NEZG 4NUMA 2UWEE 5JIHA 1M7IB 5EHFA 5T5FH 5GZOD 1N3NB 1I31A 1LP9A 2FX7L 5E6ZA 2EC8A 2JKNA 2G5BB 5EZLA 1ORSA 2ZOLA 3CZEA 4OLXH 5CBEA 3L4YA 4S0TD 1KN2L 4BHUI 1KIRB 3IDXL 4ALAC 4KKAC 5E1QA 4LAQH 3QO0B 4NT6B 3MRLA 4KMQA 3ZYZA 1YEHH 1PAZA 1FE8L 1MOEA 4XC1L 1O5DT 5D96C 4X6BA 3OKOB 1PNDA 3T2PA 3U0TB 4DP2X 3ET9F 4Z3JA 1XH0A 1OY3B 1BGXH 2K3TA 2OR8A 4Y1AB 2YKLL 3IMTA 5C3LD 5IQLA 3AAZB 3WFDH 3OAUH 3GXDA 1RZIB 5I8KH 2F5BL 1I7ZA 3BZFA 5FAAA 2CJ3A 1PYWB 2CKNA 1KV3A 4F8LA 3SGJC 1W72A 4B60A 4N2NA 3V8CA 4I0PD 1CG9A 4KKCC 1KTJA 1VKXB 4PJXB 2Y7MA 1KZQA 1KGCD 3HN5A 1JGIA 1MCJA 1XIWC 3V5KA 3JWOH 3KWUA 1I8MA 4YQXL 2BNRA 4K8RD 3ZTNH 1BLIA 3FH8A 4G6AC 4HOXA 2QGCA 4JFDA 5EH1A 4K5PA 4WV1A 4PGEA 4YHKH 4S0SD 1K5NB 3B9KA 3L1FA 1KUMA 2WXPA 4MJIB 3Q6FB 2PCFA 5I1EL 2ITFA 1CYXA 2B4CC 4N2LA 1IVLA 1OB1A 2BDNH 4XB7A 3S2AA 4ZQKA 4JM2C 1U4FA 2ZE0A 3TIEA 3X13A 1I9RH 1UZ6F 1DQMH 4J3OF 4CN1A 1HK6A 1G7QB 2F74A 5KTEH 3NFSH 5CCKH 4WI0B 4B7LA 1H0DA 4G9FA 4KQ3L 3B3BA 1BVNP 3T0XA 4BQ9A 5E08H 3UTSA 5E9DA 4Z23A 3Q0HA 3X3GL 4UB0H 4XNDA 1U8KB 5HDOA 4Z3TA 4C56A 3UYRH 4ELDA 1JIBA 4G43A 2FT6A 2CDEA 3IT8D 2C3VB 4OVUA 3S3PA 3K80A 3SCMA 2PABA 1D5MA 1RIHL 4YDJB 4MJ2A 3DI2B 3V7AE 1T03H 3VRLE 5KVFH 2VKWA 2WMPA 3LVTA 4G70B 1E2VA 4H8QA 3DIVA 5DDHB 1YQ2A 2HRPH 4M93C 5F96H 1X4ZA 3S8GB 3EBGA 3NEEA 1I9JH 3RB5A 1HXMB 2BVYA 5KS9A 4DP9X 1T1ZA 1MI5B 3K2MC 4OJEH 4MZRA 3GZKA 4DFIA 3VO0A 1BZQK 1NMBH 1EXUB 1R3LB 3ARFD 3VFWB 1HZLA 3CPLB 4MS8C 4O2CB 3RDTA 1UTDA 1QEWA 3P9MB 4QRPB 1NFIA 4GKNB 3C8KB 2DTML 4DSYA 3RIFK 1YAIA 1L6XA 4H40A 4Y5XA 5EU3A 1L5GB 5EN2A 3QZWB 4W9EC 2E0PA 4KGJA 5F9OL 4HIJB 4K71C 2IH1A 2WLLB 1HILA 4FXLA 4YGVB 3QJRB 5I6XB 4JDZA 2H3XC 4LDLB 1TTRA 3SJVD 4M6AA 4PJEB 1JD9A 4YEEA 1HESA 3CCHB 3WNNA 2GTQA 2E9GA 3FYIB 3FPXA 1S7TA 1HCZA 4GSXA 4WUUB 3F05A 2AK4B 3FRPG 4AENB 3IJ8A 1DDHB 1QNZL 1ZCRA 3UMTA 6FABH 4AEIL 5JLZA 5IVXB 1CXFA 4CVUA 4HKXB 5IJKA 1XR9B 4M7LL 1UUSA 5I5IA 1QPKA 4P46B 1MWAA 3J27A 1RXLA 4UCFA 1LM8V 3WI9A 3OHMB 3BWUF 4YSCA 2FECI 1UKQA 1ZA6A 2YGOA 3V6FA 4HPOL 4ODBD 4PJ6A 4TUOB 3S36H 4K9EH 4ZAKC 2W1NA 4FZ8L 1PIGA 1ETZB 3GJFA 4DGYH 3RA7L 2CH8A 3HUJE 5H94A 1JF5A 3PWPA 5I71C 5ILTH 4AE1A 3BN9C 2JKRM 5E24E 4NO0A 4IRJC 4Y4KA 2BS8A 3H42H 4X9GA 3T0ED 3CDZA 3NG5A 4NS0A 5HYJD 1J5DA 1R6VA 4XAKD 4UV4H 4FYQA 1R3IH 2EDHA 4G1EA 4PJ7A 2OMTB 1FJ1B 4HGWA 3TA4D 3D25A 3MRBB 3QDJA 5F21B 1IBGL 2H0EA 3CFJA 2D3JA 4UQ3A 5BS0A 1NUFA 3QDGE 4I3GA 2V0AA 3LRSA 3ZDXB 3H9SA 4FXGC 2F15A 5DJ0A 3DTXA 3VUAA 4G3YH 1XXDC 4IGBD 4MXWL 1R5IA 1A0QL 1KGCE 5HVFB 4KBPA 4W9HC 3MRCA 4LVOB 2E7LA 1FFOA 4K3JL 2VXSL 1LQBC 5LB1A 5EU6D 5E2JA 3VXSA 4GW1B 5DMKA 4ZFOA 4ZFFA 2XZCL 1Q9KB 2AJZA 3ZUCA 4I2XA 1XCXA 5E2TH 5DJXA 4KJWD 4I77L 2J1ZA 5JOFA 3K4ZA 4MAYA 3H0TA 3FT2B 5INDB 1J12A 1USQA 1IAIH 4Q6IC 5HXMA 5JW5A 1CCZA 5LBGA 1UOKA 4XMTA 5AZ2L 2WUBL 3BPCB 1BP3B 3D34A 1ZV9A 3LIZA 1N64L 3OXRB 3HPLB 2HG5B 1E5UI 3K72A 3F7QA 1ZLSH 2H32A 5CGMA 1CUOA 2PTUA 3U4KA 4XCCH 1B3IA 2WQAA 3DO7A 4U3SA 3HE7A 1WAPA 2E7CA 4ZODA 3IDMB 5G4MA 5KG9A 4FQ2H 4EBQH 1JRHL 2H1XA 1Z6JT 3HCVA 3TA3C 1Y0LB 1MH5B 3ZE0E 5F9AC 3VFSB 1A6VH 3TL5A 3FUMA 4G6FB 3RY6A 1E5BA 3DJZA 4LEXH 2Y36H 35C8L 2ZG3A 2GBVA 2OX5A 4UOW1 1FAIH 2QADD 3OHXB 4N1CA 5IF0B 4Z7OF 1QRND 5DD6B 5CGYC 2MOQA 4JREB 5B1KA 4V33A 5E8DH 2VSKB 1QUNB 1J87A 2YAMA 3NN8B 2UYLB 3KPSD 4KO5A 2PLTA 1WA1X 2IGFL 2IQAA 2DPKA 3QIUA 5JHLH 43CAB 1D5ZB 2IWKA 4DW2L 1TJIH 2B1AH 2GJZA 5FYJD 4ZUUA 4Z7UF 3Q8EA 4ZX6A 4UU9B 5A16A 4ONHA 3VA2C 4E9XA 3S34H 4LCWD 2QPUA 1G6RA 2OJEB 3SJVE 5A6IA 1A3QA 1KCUL 1AQDB 5IBUG 3AU1B 1H6TA 1XEUA 2AFNA 2QPDB 1MVYA 2AXHA 2BCMA 3APNA 4ODXB 5B21A 2PMZA 4QT5B 5C3TA 1GSMA 1M9SA 4HOZA 3ZQ9A 1H6UA 4C4KT 1TJXA 2PYEE 3EJSA 3K74B 4OAWA 2G75B 2MPAL 3ULVC 3CBJB 4LCCB 5BNXD 4XPGH 4NJ9H 3UJIL 2CO2A 4F33A 5DZPA 3DURA 2HP4A 4BSVA 5ID1A 2VZ3A 3NIGF 3FOMB 4AH2B 5LWYH 1G1YA 4PRHA 1KGYE 3TV8A 4Z0BH 4W9KC 5I15L 4RZCB 2A6KB 4AJYV 4XXDA 3FHQA 1OP9A 3EFDH 3QUKB 4HPHA 1BVOA 4YPJA 3C60A 2Y6SD 4AWJC 1JZ7A 4KOBA 4NN6B 4QHUB 4DAGH 5HI5C 4YFLI 3K71A 1Z9LA 5E4OA 1G1OA 4QHLA 2R0WH 2QDWA 2LT9A 5LN4A 3RU8L 1A9EB 4TUJA 5I8OH 4JS7A 3RRQA 4HULB 2VYRE 3L3DB 3ZUNC 3RVUC 3GNMH 1D5IH 3T0VA 1X7SA 4HALA 2VC2L 1WTGT 1ZLWK 3HG0A 4D8OA 3UG5A 1JI2A 5C08E 5HI4D 5AB0A 3UGEA 1A7PL 2R23A 1U8NB 2GCYB 5FUZL 4HK0B 3SGJA 2VQUA 5DK2B 4GUPB 2AJUH 2HTLD 2V37A 3ME0A 3F83A 5D1ZB 5T33L 3NVQA 2EABA 4V1DE 1KJ2L 1XIWA 4NKIL 1CZ8L 2ITDB 4APQC 1DJXA 4XNYL 4BFFA 4ODHL 2C1PA 4M03A 1Z5HA 3QNFA 3WTSA 5EC2B 1UOWA 2VLMD 5EU6E 1A4BA 3QNZB 4LGRB 2QTEA 4S2SA 3RWJA 4U6HB 3P02A 1WZ1L 5HVHB 1IGYB 1FVEA 1UM5L 3DGGB 4HKBA 4Y2DB 2JV6A 3S3SA 3MBEB 3LPFA 3IETB 3FQTB 5FUOL 1AQKL 3I50L 4RDQG 3FAXA 4Y5YB 5DTFA 1QO3B 2G0LA 3JWNH 4E42A 2OZ4A 5D7KD 4PVBA 5C07E 1TO4A 5D4HA 5CD5C 1J8KA 3QEHA 3D1MC 3BN3B 4AMXA 3AMKA 2CPUA 4Q7DA 3HHSA 3D0LB 3MPCA 2QQLH 3O6KL 4OGAD 3UJJL 3ULUE 2YD9A 1XGQA 4NX0A 4KI5E 1K72A 4Y4HD 4QMEA 4LSTH 2MNJB 1HDMB 1ERNA 4XCNA 3Q8CA 1ZY9A 5KVEE 1U0QA 3VNZA 1BF2A 3CDFA 1PEWA 1RHHB 3MXWH 4RMWA 4Y7OC 4PJIB 1BQSA 4TNFA 4K3EH 2WANA 1JPEA 4EOWL 4A66A 1R46A 3VXNA 3BSHA 3L81A 3VD4A 1E4JA 1LEGB 3EGXB 1M4KA 2G9KA 2IDCA 4U0RB 3SBWC 3V5DA 3GMPA 5E4EC 2VR7A 3KPSE 2J21A 4N90E 3DC0A 2GTWA 5IMLB 1G7LB 1DVYA 4YJZL 3S37H 4HXAH 1IBYA 4W6XB 1I4FA 3KPMA 4NENA 4ADJA 3PWVA 1S9YB 3REWB 2ESVB 2Z7YA 4GP5B 5B1CA 3L1OH 3WEXA 4ONFL 2BZCA 5FYLH 5GJSH 5ACZA 3WTTA 4WHYH 5D7JC 1AGBB 1IUZA 4GAJH 4WK0B 3QIBB 4OLYH 3QFJD 4PWJA 5I0DA 3MBXL 4GNKB 1U4EA 4I88A 4CC1A 4JHBA 3LAFA 3N04A 5JYLA 4ISVA 1KTCA 1UCTA 2ZG2A 4DQOH 2NY7H 3O6MH 1KMGA 1JSYA 3GSQB 4D9LL 2Y07L 2BINA 1KB5L 5BRPA 4OCRL 3B2DC 5CJQH 2VLLB 5ISZB 4J3VA 2BOBB 3BESR 1HHGA 3P9WB 2G2RA 1TOXA 3QXAB 2IH9A 3LN5A 4WWKB 4ZAKA 5TJWK 2V7NB 1XGTA 4R7VA 4ZUVA 2CD0A 4JPWL 2P7TB 3U79A 1LDSA 2CIIB 1A7RH 1YC8A 1KTDB 5C0FB 2Q6WB 3S5LG 1GZQA 2W9EL 4MBOA 1F42A 1ACXA 2DS4A 2NW2A 1NC2A 3LRHA 5LCVL 4O2FB 5D7SH 5F72S 3FO0L 3ORJA 2F7RA 4PJDA 5B39B 1IV8A 2JI3A 5DS2A 3V55A 1P4UA 1PAMA 1UD8A 1CFVH 2FH8A 2XN0A 4D3CH 3MV7B 2DZEA 1U91B 5J11B 3OQRA 4JFFD 4NCDA 3P4NA 4G8IB 2BNQA 4FFVD 2YPKA 3TIDA 1CI5A 2J55A 1A6AA 4XPHH 3BZEA 2VDOL 2X38A 3K1KC 4KGLA 1L9SA 4A7TA 5DD1L 1BD2D 1DBBH 1LP9F 3HE6D 3BEVA 5M7QA 3QUYD 5LGHH 2F19L 1RUMH 4K9JA 3NIDF 4HS8H 3B9EA 1IFHH 2PWEA 4ZTOL 1UA3A 5GGRB 5H37G 5IHBA 3I3DA 2DQTH 1M05B 4FJ6A 2WO2B 2TAAA 2YC1B 2E3VA 4FQHB 1I7TA 1HX0A 1TCMA 5IB1A 3FUIA 2X89A 4HU8A 2AVFA 3NESA 4F7TB 2O30A 4UAOC 5DZLA 4IJ3B 4Y9FA 3H85A 2X4NB 1NFDA 1RZ7H 1G9MH 2AAAA 2FATH 3D06A 3NRPA 3KLDA 2AF2A 4KJPC 1LXMA 3LH8A 1RPUA 4Q6IA 3FQ4A 3GSUA 2UY6A 1GCYA 3WEMA 1WC7B 4Q56A 1FN4B 3U48A 5EOCH 5BO1H 4GB9A 2O72A 3FB6A 2KZBA 1V54B 4H8HA 3W11C 2YHGA 5T3XE 1HCVA 1QTPA 4X5LA 2ERJB 1A6ZA 1N5AA 3FUEA 1FL5B 1K8IA 2R2CA 1E6JH 2OL3L 2BIIA 4NNPH 5DGQA 4UQAA 1B2WH 1JYVA 3QORA 1MWOA 5I9QB 4TSAL 1OV8A 2W65A 3QARA 5L4FA 3DECA 2PCPA 3HC0A 4EN2A 3SE9H 1UUNA 4OZIB 3U46B 4C58B 3SZ6A 1JK9B 2DQEH 3G7TA 4PGDA 3ESOA 5C0DA 1J0JA 4XC3H 1P7QB 2A6JB 1HU8A 2VXUH 5DRWB 3UEQA 2E59A 2V7HA 5G55A 3M17B 4IRSB 4OKDA 1E5AA 4PCTA 5KYYA 2K9FB 1FL3A 5MI0C 4FI6A 4M5ZH 5J12C 1U8CB 4PJFE 1T22B 2NY5L 4MVBD 4Z7NF 2OZNA 1T7VA 1TZGL 1MCKA 1TJGL 1W6LA 5FGBC 5I74C 2A83A 4Y1AD 2WZ6A 5FGCE 3HB3C 3MTRA 5F89A 3KLKA 1GMEA 3IKCB 3MRGB 3MRFB 2PTTB 1PX8A 1B0RA 1QEXA 2F54A 4JFPB 2Y4SA 1LNUA 5K9QI 3DWTA 3TS8A 1P4LA 3LQMA 4LSRL 5ESAA 1UWFA 4LF3A 3D39B 3WNJA 4I85A 4PSPA 4CC0A 5SWZB 1EAQA 2HJLB 2DQHL 5GSVB 3VI4A 1H3TA 4S1DD 3A6OA 3NFNB 1INQA 3GMMA 1FFQA 2JQAA 2OSYA 3HZMB 4A2LA 3CIQA 1YECL 4ONGH 5B3SB 3E3QE 4G11A 4I13B 4F7PB 2CBTA 3KPQB 1OTUC 1HOCA 5KS9F 1RURH 3CX5J 3UERA 2ZXBA 3W3BA 1WBYB 1YMMD 1U95A 3VE0B 3PL6B 2ZWYA 3KDPB 1G7MB 4AIEA 3OD3A 1NLDL 4XB3A 4QNPE 4ES9A 5D1QC 4QD2E 1UACL 2YAFA 4W70A 3GI9H 4JFZH 1U3ZA 2D31A 2DWDA 3B7SA 4NKOA 3H2PA 4YR6A 1IL1B 3RI5F 3FTSA 1LVEA 4G5ZH 4EN3B 1RMFL 2MQ3A 3DI3B 1GIGL 2FWUA 2JWYA 1IJNA 3PS6A 4UQ2A 1JGVL 4EDWL 3QZBA 3WAJA 4NZUH 3BOVA 3J07A 1DJSA 4M7ZB 2QL1A 3BIBX 2XBTA 4Z78B 4D0BB 4HFWB 3H56A 1RJYB 3B6SA 3KJ4B 4K15A 1BD2E 3PV6B 1PBYA 3FU7A 1HSBA 3DK2A 1T20A 4ZFZB 5DA0B 4APQA 3MLZL 1RUPH 4YZFE 4FQXB 4W1TA 4W6YB 3SDAB 4N8PA 1BG9A 3QI9B 3BKMH 4HFUL 4X6DB 1LMIA 4Q97A 2FDBP 2HTKD 4MJHA 5AVZB 4AK1A 2Q1EA 2YEZB 1KC5L 2YN3A 5E0QA 4DPAX 5SX5K 4UT7H 1MI5D 1DANT 3JT2A 1OP5K 1HAWA 3VFTA 1PIFA 2IG2H 5TF1L 1W16A 3ZTDC 4P2AA 2WYIA 5C0BD 4LLWA 3I6LD 1AHMA 3WKYA 4O51B 3T3PB 3FFCB 1B4JH 4QRPD 4RCAA 1F6AA 1AJ7L 3VG9B 4JBSA 2J8UB 3GRWH 3SQOH 5I0XA 1YNKL 3PAVA 2CPCA 4F93B 2C1OB 1EHXA 4P2QE 4R3SB 2Y5QA 5KOMC 1QZ1A 3L54A 1LK2B 3SYOA 1ZGLM 3K2UL 4RMVA 4K23H 3TH3T 3ZHKA 3KYOA 4W9JC 3NUKA 1T0NB 1OGAE 1TVHA 4KNSA 3IE9A 2FQDA 4JDEB 1F11A 2Z7UA 4PJ7F 5D9SA 5LBSH 2AMGA 5AOJA 1G7IB 5FO2A 2XA8H 5ENWA 4HIIB 1U8IA 4Y16B 4X9YA 1FNGB 1IIKA 4WUUD 2AK4D 5CHNA 4URKA 2D7TH 1Q0YH 2EO9A 5E5MA 3RNKB 4P5KA 3VFNA 3MR9A 3HS0B 2NY0B 5ANME 5JA8B 2HUHA 1MFDL 3LTVA 4KTDH 5DRXB 5E8NA 4L3CB 3V0HA 4P46D 1K4CB 4OZHE 1PKQA 5FB8B 3MODL 4LRNL 1ZT4A 4PRAA 5IMMB 3SBWA 3V8OA 4KHXL 1AFVH 2UZYA 4YDVA 2N7SA 3W2DL 1N0LB 5M95B 4OCMC 1HH6A 2EE2A 1MNNA 1A3LH 3RB7A 4OSUH 1T1XA 1T0PB 4Q4EA 2WBWB 4ZW7A 2R1YB 5F1KC 2DOCA 5FCUL 1SM3H 4FTVE 2GEQA 1G87A 1Q94B 3COOA 3WUZA 1EJOL 2VRKA 3CVCA 1KDIA 3SDCC 2DJMA 1TCRA 4PJ8C 4YK4C 1S7SB 1EZVX 1OO2A 4PWGA 2ODIA 2VQTA 1S9XB 1VGEL 1UM4H 4LHUA 1S5HA 3RWGA 4OI8A 4XI5C 3DYOA 1UWGL 4HLEA 4KTEL 5C2UB 2WN2A 2J1YA 4JPIA 3EJZD 4WJKB 1QPPA 5C0NC 3ABZA 1JV5B 1WIUA 4UQDA 1MNUL 4WJ5B 4LESA 3CFEB 1A1OB 2ARJA 4MCYB 4BD4A 4TVUA 2H1PH 3X1EA 4M6ML 2OM5A 2NTSP 3KPNA 3UDWC 4BUHA 4YSQA 4JDTL 4JY6A 2VRAA 3IPFA 1ZS8B 4NO2A 1C5CH 1S2EA 3QUMH 3MUUA 3TCLA 4MJIE 3D48R 3RTQC 3VD9A 4EZMA 1MAML 2UWEA 1KLUA 3LZRA 3GBNH 5HYIA 1BYPA 2X2UA 4JGNA 2PTVA 2P8LA 2R0ZH 2XFXA 4GSRA 4S11A 3RFZA 3ALWA 4FMVA 1NKRA 5FC9A 3PQYA 4X8JA 1R17A 4HWNA 5IW1B 1BFOB 1IM3B 3T3PF 3VWJC 5J1TC 2O5XL 1F56A 1ES0A 1NIDA 4R5XA 1BQ5A 3M1BB 3WIIH 5TE6L 3FQYA 1R5WA 4XP4L 5L7XL 3OXSB 1NJ9B 4LAJH 2A6IA 4C83B 4KUCD 4L2YA 4YZWA 3VFPB 1MFUA 3AT8A 1BG1A 1HKLH 1URIA 2OCJA 3ZQXA 2F68X 4J3BA 3TASA 2VDKB 2YA2A 4HMEA 5IFJB 2DJUA 3Q2VA 1T04A 1ZHLA 4OLEA 3HC2A 1WE5A 3RWCA 5I30L 4NBYB 3TONA 2VXVH 5AAPA 4XCEA 4XE5B 2WCGA 1BEXA 3W5NA 3QG7H 4NPYB 2RJMA 2ICCA 2MJWA 4GLRI 1BX2A 2QLYA 3HS9A 2WNWA 4L37B 3JWDH 2VUOA 1O9VA 2VSCA 2H26B 4XGZB 3NH7L 2ICWB 5DQ9A 2VDNL 4QRPE 3W39A 2X05A 5KVGE 3VQLA 2FB4H 1DQDH 5B3JF 1PDKB 4UYPA 3EOTL 2AEWA 2VH5L 2NNCA 5EUKB 2J25A 5JORA 3EDJA 3CJJA 3FB8A 4P23C 1CVSC 1MY7A 2R69L 2CE6A 3PCYA 4MDJB 2BNUB 3F7KA 4AYDC 4H0IA 2DWTA 4N20A 1CTOA 5KOVC 3RJOA 1ULVA 3QQXA 3SYPA 4RIRA 4JO2L 2AK4E 1OLLA 5DWPA 2NY4B 3OPZH 2KHAA 3F6JA 3H3BC 5T1JA 4KRNA 1I7RA 3R8BB 4BCXA 4DEPC 5CLYA 4IU2B 3WU1A 1N8ZA 1NDGA 5LXGH 2PF6A 3CQFA 3MV9A 1I1FA 2BP8A 2ILLA 4XNMA 4KZDL 5IHHA 3OM3B 4LL9A 3CFDA 1JHLH 2F7IA 4RFEA 2I9TB 5F8QC 1BJ1H 3UBXI 1IM9B 1MFMA 1MJJA 4KKBD 5AW5B 4B3VA 1BFSA 1UA7A 4NRXB 2WY3B 3MJ9A 4D94A 5FGBA 5IOPA 1M71A 5K39B 2QQNL 2FEEL 3JT0A 5IBLC 1GY1A 3EOBA 4E5XB 3GI8H 1TTUA 2FUQA 1CE1H 3MCKB 3C6LC 1BIHA 2A74B 3QUGA 5JZ7C 3DHPA 5E6RB 5EPMB 5HHOB 5F1IA 2BOLA 4AGLA 4HUXA 2LU3A 5JIIA 2C9XA 3MJWA 3T8XB 2O5ZL 4P2RA 3PUCA 2LV4A 3RHWK 3RE0A 5EO9A 3CPUA 3O8XC 2YPLB 3UABA 1DQQB 1HHHA 4PRBA 4ZYKB 2DQUL 3ARGC 2ZWZA 4P57B 1J5OH 1DBJH 3ISRA 1GYCA 2BP0B 1GS6X 3G6JE 3QCTH 4HJ0D 4G80A 1H8SA 1QQDB 2XN9E 3L5XL 4KTYA 4CKQA 2P1YA 1MVUB 1TIUA 1WGVA 3D6GA 4AQ1B 4JANA 2R39A 5F3HB 5A43C 2PXYA 3UADA 5C0EB 4KKZA 4HXBH 5LWYL 1MELA 1UCBL 4MZIA 3QUMB 1JG9A 5D1QA 4PJGA 3RI5K 4EI5C 2IAMB 2YD1A 2R1XA 5HHQB 2I07B 3NCYP 4OM1L 4BRVA 3KVPA 4N25A 3L4UA 4XCFL 4Y2DD 3MBED 1JPSL 1MFVA 3CU7A 3BAXA 3CBKB 3HMXL 2BSTA 4M1GL 2AJYL 1JMZA 5E1AB 4I18C 2AQPA 4PVLA 3K8KA 3KBPA 4F7EB 1J88A 3A6CH 3HN3A 1N0XH 3SY0B 2FUTA 1W8EA 3NJNA 2V3EA 3GT6A 1B4RA 5CN3A 1JPTH 1R3JB 2BWDA 3HUJA 3L3KB 4L4VE 4TRPL 3PGDA 1T6WA 1W0WB 1IZJA 1TTGA 2XPGB 3OGCA 1FG2A 1FBIH 1LO4L 5DURB 5I1LB 4RGOH 2IFFL 5KVFE 2O6PA 3EO0B 2ID5A 1CF1A 3GJFK 2ZAHA 1OSZB 5HJ3B 2EDLA 2ZF9A 4L3EB 5F7WC 5CSZA 3RX8A 3P4OB 5B3NA 2BVEA 5HTSA 5CLZA 4GH7B 4NN7B 4HZLA 4JFYA 1J8RA 3UBXA 3WS3B 3P9LA 5C09B 1FF5A 5C0IA 3FULA 1Z2KA 2M1KA 4XHJD 1AKJA 3INUL 3ZKXB 4CVZA 3QDGA 4QRAA 2XWBB 2D3VA 3T6XA 4KXZI 4AXWA 4OUUB 4A2HA 1CLYH 2ESVD 1X9RA 4FQLL 4FQ1L 2WWMD 1C16A 2B3IA 4J2XA 1DZBA 4MDIB 2XWJA 1AZUA 2NPLX 3UGUA 1MAJA 5TE7L 2YD4A 2FK9A 4HUUA 3OWEA 2Q8AL 2J6EA 3QIBD 5CKGA 3ZIYA 4GMTH 4DOHE 5F7EL 3QRLA 3IMSA 3RWHA 3LXBA 3EAKA 5CINH 2K45A 4S1RH 1N67A 1MHHB 1PJWA 1UD3A 2R1WA 5CP3H 5D1XB 3V0FA 4AVIA 5A6MA 3KL3A 3ZYJA 5IR1A 2K3HA 3UP6A 3II1A 1TMCB 5L0QB 4WWKD 3O45A 1T4WA 4ZO7A 1MCWW 2SEBB 5DUMH 1L7IH 1S46A 3D4CA 4OU3A 4OZ4B 1ZGLA 3UZVA 1A2YA 4DO6A 2PR4L 4KX9A 2IBBA 4L1HA 4H5SB 4BQ8A 5C8JA 4HV8A 2KZWA 1U8PA 2E7MA 3TJPA 4QRRA 3SDCA 4PLJC 1IBBA 4PJ8A 3IDYC 4MJ6B 3IJYB 1W8NA 4YSUA 2KLRA 5CEZD 4UV7L 5C9JB 4J8RA 3EYVB 4JQIL 3TBVB 1OPGL 3HC3H 3MV7D 5IJVB 1QI4A 1G4MA 1IGCH 4BFNA 5DYOA 2JB5L 1J1PH 4QF1A 1RZJH 2R9HC 3GHEL 1KPVB 2BH0A 4XZ4A 1ED3B 4X8XA 5I1KL 3MRQB 3FO2B 3WAKA 1F8TL 5E95B 5LBVA 3EOAB 3OX8A 4LASH 3ZHFA 1GA2A 4WO4B 5ICXA 1CFSB 1NCBH 3DV4B 1T1WB 3D3VE 5TDPB 3TNMB 4FFTA 2WLNA 3BKYH 3FUKA 1NM9A 5CZRA 2W9LA 2CR0A 4XVSL 3RTQA 1AACA 1GTNA 1A7RL 5D8JH 2P49B 2VGLM 3UEZA 1EEZA 4KHTL 5LQBH 3SD5A 3LKNA 3C6SA 4D9RD 4MNGB 5I1JL 4K0OA 2DEWX 3NFPB 2J72A 4CW1A 5A3IC 2PYEA 2Z92A 1NFAA 3VWJA 5FO9B 2YPVL 4NQSA 3ATBA 2Y1YA 4JKPL 2ZOKA 1KEMH 1MLBB 3B34A 3JUYA 3VVWA 1VHPA 4ANUA 2Z0UA 5DMIH 3QR1A 5KWYC 4GRMA 1BXXA 4KZEL 3VI4F 3K46A 1OSYA 2VW7A 3RZWA 3T1FA 2J44A 3S88H 5TFSL 1BPLB 2YA1A 1G9HA 4PUBL 5IVZA 4YNYB 3ZTCC 1YNTF 4XMKL 5GS2H 2EVJA 4MNQB 4R2GB 3BI9X 1DANU 5ETUB 4HS6B 2Y06H 3D5OF 3JZ7A 5FYJU 1JN6B 1A64A 5ICUA 5C0JA 3DX7B 3D0VA 2IH3B 3MJ7B 1P7QD 5BRZB 3HNTL 2A9DA 1JWSA 3EXJA 4FNLL 4PSRA 4KZ0A 4HC1H 4L5FH 4K8RL 2OXGB 4AMKL 1GGCH 1G9ML 1JGUH 3QEQD 2EUXA 3BCFA 1KT2B 3ZMEA 4WY7H 4V1DA 5C6TH 3TTSA 2V5SA 3CHPA 5I8EA 3D85A 2HVKB 1CT8A 5DJ8B 3TO4C 3T2NH 5FYLD 2HVJB 4F2ME 1EZSA 4ZNEE 1X4XA 4QUOA 2FRGP 1EGJL 1KYUA 3OKEB 1E67A 4OT1H 5CAYB 1MFEL 4HP5A 3WN5C 1EIBA 4GW4A 2VLRE 3U82B 1JL8A 1GOFA 2UY7B 4UM9B 3GSOB 4GUOA 4QCIB 1VIWA 4UOJA 5FDYA 4A2FA 1IC7H 1MHPL 5EBLA 1XGPA 3L4TA 4HISA 4QTFA 5EO0A 4GAFB 4XXWC 5ISZE 2B3RA 4YN3A 1MREL 5L2JA 4NBXB 2BY2A 3FQRA 4YHPB 3VU2A 4G9DA 4BZ2H 3QA3A 1UZGA 3B5HA 4B95C 5DUBB 1YC7A 1NBYB 5C07A 1OL0A 4DUXA 2XNAB 3W9EB 1WEJL 3PL6D 1LDPL 1E7UA 3TU6A 1TTBA 3BAEL 1YEFH 3IPBA 3P3YA 5A40E 3QG6B 1GOGA 3SE4A 4CU7A 1K6QH 5I24A 3MYJB 4WDIB 3MFFA 4ORZC 1H15A 3QQDB 2HLFC 1A4JA 2Q76A 4JPVH 3NOIA 3QQ9C 1N7MH 4UTBL 4TLTA 1I1YA 2FWSA 3GK8L 3G6DL 4YBHA 1OAYH 4WWNA 4NB7A 5FKPA 5TQ2L 3KLLA 1R5VA 1G7JA 3U9WA 1IC4L 3OR7B 4ZDHB 1X44A 2FX8H 5DCCA 3O8XA 4X99B 5J06A 2XY2A 5SX5H 1DCEA 2W80C 1QVOB 3I6GA 4JFHE 1CLOH 4JRXB 4YVNA 3E2HB 5HPOA 5J1AB 2AI0H 1U58B 3KW8A 5FX3A 1BZ9A 2BSEA 4M8UA 4FQXD 3V6OC 4YE4L 3SDAD 3QI9D 3FTGB 3VXOB 1HZKA 1H5BB 2AERT 5J13C 2IV8A 2C7UB 1KTKE 4EI5A 5BMFL 1BIIA 1ROWA 4OFYD 3CLEH 1IEAA 3RVXC 5PCYA 3QE5A 5IHWA 2EZ0C 4OTXL 3OR6A 3GD1C 4YO0B 3FRPA 3R1GH 3FFCD 1UB6B 2XQYA 3MLRH 4X5RA 4NCC2 4HKZA 1X7QB 2J5WA 5A7BA 5B38B 3QJZA 3A67H 3RBSA 4UQ9A 5I76B 3DUUB 1WUZA 1NWOA 4POZD 1CXIA 3MJ6A 4I18A 4AJVA 2E75C 5BQDA 4GINA 2WW8A 1LTXA 1N68A 3GSNL 4Z7OB 2V3DA 5IT2L 1J8HB 4OW6A 3MREB 3VM5A 4FC3E 2AXFA 1GRWA 2ZUSA 4Q6KA 1RZKL 3OBAA 4NGHL 4Y16D 1TMQA 2HJFB 3LKRB 3NJVA 2UZPA 4MA8H 1JERA 1THAA 3NGBB 4GBXC 1MJ7L 4DP8X 5I1DA 2NY1C 2IDTA 3K6IA 2NSQA 2VLJE 5KUKA 2NY0D 1TLKA 1KCRL 4PPTA 4Z7UB 2WM0A 4RQQB 1MW1A 3DOIA 2BLFA 2YD2A 3CDGA 4PCYA 1MHCB 2WTRB 1B6UA 1XXFC 3PP3K 1YMHB 4NAMA 2DWEB 3NJMA 4PGBA 1W2KT 32C2B 3OKNB 2UWEF 3CZFB 4FAAB 1FZMB 1U8OB 3TBTA 1G9NL 4LARL 4Y19E 3TBYA 3NCJL 4PV9B 2XTJD 2I9LB 3VXME 2UXTA 2VLKB 1BAWA 3BSZH 3E9TA 1ADQH 2WZ5A 2XXCB 4U6YA 3KLAA 3BWZA 1D5XB 1YEJL 1QSFE 5KSVA 3NIGB 2W07B 2XZQH 5KAQG 3SGEI 2PP8A 1BYOA 4MAUH 2Y7SA 4QWWD 5AG8A 3SBPA 1ORQA 3LKOB 1JZDC 2EXWC 5F7YC 3D50A 3BP4B 5LBSL 4AG4L 5AW0B 4JQVC 2AEQL 4PTTB 3FBKA 5E99H 3BKJL 2P80D 1T0MB 2YA0A 1YZZA 3D39E 1GGUA 4KVCH 5SWZE 2H2PC 2D7TL 1Q0YL 3TEWA 3CX5K 1HKFA 2BRRH 2C7FA 3HA0A 5F97E 1DVFC 3JTSB 1KN4H 3CK0H 3IU3B 3JV4A 4OGYH 2QFPA 4LDCA 2NY5C 1V5JA 3F7YA 2HMIC 5CGBA 2X4QA 1MKFA 2DQDH 3CSPA 4AL8L 3FO9A 5AVSB 4N1HB 4PJCE 1SDYA 2APXA 1ZE3H 2CM6A 5IQ7H 4CMMB 5DVNA 1ZAGA 2QJDA 5E51A 4A7GA 2OTUB 3FQWA 3LN4A 1PLAA 2IC2A 3BWAB 3GS7A 2YEQA 5IB3B 3MJ8A 4H88L 3L4WA 1O9WA 2WXIA 2EE0A 1Q38A 4AGOA 2ZUTA 3WY3A 4YAQB 4BKLA 1DVZA 3D2TA 4JG1L 3ZYOA 5L9DL 3LQZB 3LRGA 4J4PD 1ZLUK 1BPVA 3PAYA 1FFRA 4X6FB 4IOIB 4NQXB 4FKHA 4HUVA 1OE3A 5T1LA 4Z0XA 2PW1B 3UO8B 1QA9B 3CX2A 4JQXC 4OFVA 4ETYA 4YSPA 1NAMH 4AQAB 3C09B 1ZV2A 2APWA 2IV9A 3KR3L 4PJFA 2DYPA 4DGIH 4E68A 4X6DE 3X14B 4XMLH 2YSTA 1V7NH 4OF7A 5BQ7B 4RMUA 4TPRL 2AJXL 3ZDYE 4NZ8A 1Y1DA 3BZ4B 4KVNH 4IHBA 2WVTA 4YIQB 5I16A 1FSKB 1QZNA 1W72H 4GW5A 1ZSDB 4G8GA 5DS1A 4QOKB 3P2DA 2DYSB 2WLKA 1J9CT 4LSUH 4OGZA 5CZKA 3VRLF 3ZKMD 2HT3D 5EU7C 5I1CL 1R3KB 4BSWA 2R0ZL 5GRXG 2P5WA 4Q89A 1RIUH 1EV2E 3HI5H 3UX9B 2NY6C 3K3QA 2OFQA 3QPKA 3BKCH 3MLVL 1Q9WA 2ZKWA 3BDBA 3H54A 4IMLA 3KPOA 2ZKHH 5HYEA 1YEIH 4LVHB 5C2BH 4AVJA 5IB4B 4RGMB 1LE5B 4QRQA 5ITFB 1FCCA 2NY4D 3TBSB 4NLHA 4PJBA 2WZPD 4D8PA 4LT7A 4Y9EA 4CSSA 4RGNC 4YDLB 3L3OB 1DVSA 1NFKA 4R0LC 4NRZB 4FTDA 3Q48A 1CDCA 2CLZA 3O6LL 3UTPD 1I1AB 3TJHD 3B9AA 1DUYB 3BC9A 1HJCA 2YRPA 4NQVB 3QUHA 1IM9D 1OARL 3OJDA 1U2CA 1QSEA 1S9VB 3PGCA 3QHZH 1TZHB 4EI6B 1JPGB 1ZXQA 3G04A 1FZKA 2WNKA 3QULA 4Y1SA 5E8OA 2DL2A 3BAKA 3FU8A 1RD6A 4EEEA 1NPJA 3TFKD 3IMWA 5DLML 3IVKA 3NP4A 3C08H 1DBAH 4CN4A 4UBDD 5SWSB 3PFUA 5HHOD 2XACC 4NUGH 1L0QA 3WN5A 5DJ6B 4KK8D 3HUJF 4ICXA 3FC8A 2ADJB 1KV7A 3FMGH 2YPLD 4DCQA 4U3XA 3VXRE 3TH2T 3ZT7A 2BO0A 1JNNH 2R2HB 3QZNA 5F93C 1F4WL 2OMVB 2BP5M 3QDMB 3EBIA 1OD7A 3TT3L 3HN8A 4P2QA 2FHBA 1QAWA 4G1MA 3KDMB 4P04A 1XD0A 4X8CA 2QSCH 1M1XB 1OGAA 3LRLA 4FMFA 5B8CC 2YWZA 4TNGA 5FGSA 3ZZLA 5KBNC 3BQUC 4H8WL 1E7VA 3LDBC 1LP9B 1PEZA 2IAMD 3EH3B 5BVPL 1AZRA 5C3IA 5MEQA 4B96A 1R0AL 2KZ1B 3BGFB 3NIDB 1MWAH 1ORSB 5EZLB 5IZ7A 2ZOLB 3B2UC 4ODUA 5CBEB 5J3HD 4X7FC 5ANMA 1KB5A 3DMMC 1PZ5A 3RVVD 1OW0A 1QOKA 3MRLB 2BJMH 5C7ZA 4OI7A 3GJFH 1TPXC 4MMXA 2BXZA 1A21A 2F0CA 3AJ7A 3C6EA 3ENEA 2I32A 4IM8A 4NRYA 4X6BB 1CL7L 3KPLA 5HPMA 4UOW0 3ZMRA 2P42B 2NYYD 4UT6H 1CBVH 1SEQH 4LP4A 4JCLA 5K9JH 3BRFA 4LE8A 3V6OA 4FTVA 5HDQL 1U41A 4I3SL 4HOMA 1WCBA 4L3ED 2HN7A 4I9XA 3T0BA 1CLCA 2BC4A 2OMUA 4M1CC 5EB9A 1I7ZB 5IY5B 3BZFB 3AMLA 5C0GA 1UXWA 5I6NA 1RFDH 3U6XS 1FH5H 3STLA 4B5ZA 1KBGL 1W72B 4KITB 4YVUA 1QMUA 2DM2A 1CG9B 5KW9L 1HNYA 4OF8A 1L7TH 3V5KB 1CDHA 3FCUB 3ZE0F 5FFLA 4JGUA 1I8MB 2F5AH 3QXUA 2BNRB 1HINL 4KVPA 1TQTA 4JFDB 4RX4D 5BV7H 5IB2A 4WV1B 2Q7AA 4PGEB 1JS4A 3B9KB 5DK3A 1XWVA 5I19H 1MFAH 1HOEA 2G5UA 2KS0A 2VDPH 1E5YA 2PCFB 1A14L 2ITCA 1TLMA 3OKKA 2GJRA 4JN1H 3F6LA 1OB1B 1MRFH 3PXLA 5C0AA 3Q8FA 4ZQKB 2ZAIA 4GBXA 3TIEB 2BHUA 2ARJQ 2F74B 3BJ91 5CNHA 3MRJA 1F6LL 1H0DB 4G9FB 2VR4A 4X0NA 4Z7NB 1KCSH 4IBTA 2P47B 3STZA 2CLVA 3TZVB 3EHBB 3L3IA 2KPWA 3UTSB 5E9DB 5H8DA 4LSVL 2XWCA 5D1XD 3BGMA 3OMNB 3TBCA 2ADYA 4C56B 2HLAA 2H32H 4P2OC 3T6VA 4G43B 3ILQC 4N0FA 1CI3M 2CDEB 5D4IA 4EE2A 3SCMB 1D5MB 5C0CE 4NNXA 4YHYC 4HIXH 1RULH 5EUOE 4S0HA 2WMPB 3W9DB 1ZT1A 2I27N 2OL3A 5IB5A 1NGWA 2B8OT 4MYWB 4L1SA 2Y3AA 3K0YA 5CS7A 3DIDA 2BSRA 2FNBA 3LEXA 2Y5TA 3O2WH 3O6FC 3QO1A 1I3UA 1BFTA 2ZUXA 4MXVE 5I2IA 2IPKA 3BVDB 5KS9B 4W93A 1SOQA 1T1ZB 3HNSH 1AP2A 3GMOA 5K93A 3N43F 3FT9A 4P3CL 4K3DH 1EUUA 3HFMH 1HHJA 2F53A 2YXMA 4DUWA 4Q58C 3RDTB 1QEWB 1NFIB 2FX9H 3ZVVA 3DTDA 3IGUA 5A2CA 5EU3B 2Q7NA 4Y5XB 3ZMNA 15C8H 5EN2B 5AVRB 4CADA 3U0WH 1U3JA 4J3OD 1DVFA 2WK2A 3IKKA 1E2WA 1KIPA 4MA1B 5F0PB 3WTVA 2H2SC 3KL5A 2IH1B 2TRYA 4JB9H 1HILB 3MROA 4JDZB 1UA6L 2JCCA 4FXTA 3VXUA 4WO4D 3X1FA 1C1EL 3B9VA 4GXUN 3GXIA 2DQMA 1LWJA 1GAFL 1HE7A 1S7TB 1W6WA 2DYRB 3BUBA 4YXKH 3W81A 1SVCP 1J5CA 4MYPA 2B1OA 4OD3H 2EEAA 5JLZB 1OXYA 3LIUA 1NLBL 1I3VA 4G72B 4BA8A 4NZTH 3LB6C 1MWAB 3UZQA 3PDDA 4ALAH 5T1DH 4TLSA 1ZA6B 3UPRA 3O4LE 3V6FB 5IBTL 3CN2A 5AVWB 2X4RA 2Q8BL 3FSVA 4QXUL 4BXVA 2PN5A 3GJFB 4XBEH 3EJCA 3ZRSA 5H94B 2E86A 4BCZA 4QTIL 3MLWL 3S97C 3PWPB 5CSGA 3JTBA 1F2XK 1T5XA 3VXTA 3NZHH 2X0UA 4JQXA 3DVIA 5ECGA 3L45A 4I0CC 4PRDA 4NO0B 4ZD3H 1J1PL 1P4IH 2EVIA 3QPQD 1MIML 2A9CA 5B1JC 3KLSA 5I6LA 5AVXB 3CDZB 4ENED 3VW3L 2BCKA 3GRGA 3WS6A 2MHAA 2ORBL 1M1SA 4Z3GA 4Q9BA 3WFEL 4NM8L 4WI9A 4AI7A 2IGLA 4TSCL 25C8L 5GS1C 1F1GA 2ZX9A 3JTTA 4L3EE 1K4DA 4LP5A 5I6MA 4F9PC 4G1EB 4MNQD 4PJ7B 4R2GD 4HGWB 4M7KH 3D25B 2CR6A 1JNLL 3QDJB 1MPAL 2CRIA 2CHZA 2GAZA 3F7VA 3CFJB 1NCBL 1ROCA 4UQ3B 4DETA 5BS0B 3BDXA 5EF3A 5HHXL 5C09E 1HFUA 3LRSB 3ULUF 1J1XL 3H9SB 1AVAA 4Y88A 2Y72A 4YC2C 5DJ0B 3DTXB 5GJTL 4FG2A 4KI5F 3MV11 2WSPA 1R5IB 1RPKA 2IOIA 4U3HA 3GMRA 5EIIA 2WQSA 3JV6A 1TTAA 4TXVB 3MRCB 1BDYA 3VU1A 1FFOB 1CYWA 1D2OA 3LZOA 1E4WH 3G6JA 4X4XA 4ZFOB 3VXSB 4EQ2A 2XN9A 1U2YA 4ZFFB 4N0CC 2B4CH 2AJZB 2GPZA 5DMKB 4I2XB 5F6IB 3IGAA 2VDPB 3QGVA 5DJXB 2ZCKL 3RGVC 5KJRL 4K73A 1J9RA 5JOFB 1NUNB 1VZIA 3H0TB 4MAYB 4KU1A 3TV3H 5JOPD 3T0AA 4GKSA 4HIPA 4JFED 1QWHA 1SN2A 4X7SH 1CDYA 5IROD 1TNNA 4UM9D 5JW5B 1RK1A 2WXJA 4TUKH 3P11L 1SVBA 5LGJA 1E27A 1VPOH 4NWUL 5HGAA 4R0LA 5JQ6H 3NCWA 3S36X 2EDBA 1FYHB 4XMWA 2DM3A 3K72B 3ZDZE 3TLRA 2QV2A 3UXFA 1IAKA 2H32B 2RB8A 4K5LA 4NOBA 3DO7B 4U3SB 5F44A 3HE7B 1NCWH 1MW0A 1BQLH 5KG9B 2XX0A 2YEVB 1J9QA 2FEJA 2XWDA 2XWTA 4PWFA 3HCVB 4BFGA 3W0WA 4RAHA 2N0KA 4OKVA 4NAQA 2P9RA 4L4VA 5A2JH 4B0MM 5KYXA 3A21A 2N7AA 2G9HA 2OX5B 2IPTL 1YYLL 1NA