3RLSA

Crystal structure of yeast af-9 homolog protein yaf9
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
152
Chain Sequence
IKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSLERPHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast AF-9 homolog protein yaf9
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Protein AF-9 homolog
total genus 25
structure length 152
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rlsA00
2L7EA 5IQLA 5IOKA 4TMPA 2NDFA 3QRLA 3RLSA 2NDGA 5HJBA 5D7EA 3FK3A 5HJDA
chains in the Genus database with same CATH superfamily
2GHZA 5DF0A 5LCVH 1CXHA 3S8GB 4I77L 4HUWB 3SCMA 1S7UA 4WTZA 1EJOL 1ZWIB 5FGCE 3WU1A 2XPYA 5FHBL 1N7ML 2AGJH 3OAWA 4Y2DB 3I6LD 3KPPA 5FWQA 3SKNA 3LY6A 4QLWA 3F7VA 4YUEL 1J05B 3RURA 4DK6A 1CS6A 2D4FA 4PBVC 5FB8B 4YPGB 3MXVL 5D7KD 1FORH 4PJHE 4XXWA 4BWUA 2VDKL 3OPUA 4Y2DC 4YHLL 3PABB 2G4EA 3B7UX 3CNKA 5F1SA 2R0LL 3VXRB 4ABVA 4AM0B 1ZHKA 4PGBA 4MRBA 1FPTH 3GNMH 5E1GA 1TQCC 2NMSA 3GDBA 4OF0A 3PPEA 3ARFC 4FG6D 4FS0A 1HKFA 4TUKL 3VGFA 3ZE2F 4HKJA 2N0KA 1A3ZA 1QLFA 1X5AA 3BZDA 5KTEH 1GS6X 3SPJA 3I50L 2ZX7A 4GUQA 2VDML 2VDPH 3BIBX 3HHRB 1X9UA 3IKCA 3D52A 2R0ZH 1S7SB 1QRNE 3QUZD 4LLMB 3TFKC 1CL7L 3TP4A 3FQ2A 5GS3A 2WY3B 4M43L 4R5XA 1A14L 5DLMH 5T5FH 4Y4HC 1UB5A 1XV8A 2E74C 4LLUB 1LO4L 1DVUA 3EBGA 5K59F 1QQDB 2P45B 2AXHA 3L7EB 4LBEB 2VZSA 3LAFA 4WKXA 2GJRA 2A9AA 4HJ0C 2GJ6E 1F4YH 3SGEI 5LGJA 1VERA 4YSOA 3N9GH 2R8SH 1W8OA 2H6OA 2YGQA 3CD4A 4OLUL 1WZMA 3QCVL 3PWUB 2VXTH 1G0DA 5HJDA 1NLDH 2GQHA 4M03A 2B15A 3OKMA 4H40A 5T3XL 3KHQA 5BRZE 1BFOA 1KIPB 3H42L 4B96A 3FU6A 4PJAB 4HXBL 5GGUA 3QJFB 3TS8A 1KGWA 4DEUA 1UQSA 2K6YA 4KVNH 5IR1A 4FG2A 1TYRA 1BOYA 4ZW5A 1JGDA 1B4TA 3ILEA 4KZEH 5BVJB 2ENJA 1DL7L 3NZHL 4P2CG 4A2LA 1F4WH 5IHLB 1WZ1H 1MKFA 5K93A 2DLIA 3JWDH 1DBML 1ZD6A 4GAGH 2D7TL 1OGSA 3UZEA 3OR7A 2ZOTA 5J13C 3W0WD 4Q9RH 4JRLA 3ALXA 3CVCA 5D5MB 4F58L 5CWSB 2EDDA 3HE6D 3P4NA 5EUOE 1T0NB 4Z3GA 1R34A 1YUHA 2XN9D 4HZ1A 4F2ME 4OAWB 5L4JA 3VWJB 1NSNH 2KC0A 2EDBA 4RFOL 1MHEB 3MRDB 2BSDA 4XP4L 2YAQA 4KWUA 2DQDL 3LMJL 4H88L 4L2LA 5AVVB 1U8HB 3N3EA 2XNAB 3GKWL 1OW0A 3A4DA 4A68A 4OCXL 1OWRM 1T7XA 3KBPA 4IQHA 4KXCA 1FFPA 5HYIA 5J1SC 3AS0A 1BZ7B 1WE5A 4OD3H 2AEIT 3HC4H 4JM2D 3T0EC 3N0PB 5ITBH 5F8QC 2DM3A 1FO0L 1BWWA 3PHQB 5FX3A 4G5AA 2OSXA 4XCYA 1WWCA 4GIAA 4MXVF 2FYVA 1JD9A 2JTYA 3NRFA 1NMBH 1S7TB 2GY7B 2R9HD 4NZJA 4PY7A 3LEYH 2NUPA 3UTZA 4NUGH 3GM8A 1LO5A 4LIQL 4BA0A 4Q9QL 1BD2B 4UM8B 1UD8A 2YPLA 3JV4A 2NPLX 2QQLH 3NGBB 4FZEH 4JHWH 5IMMB 1NGQL 3JZ7A 4L1HA 3L2LA 3HNVL 3ZYOA 3IGAB 1BLNA 1HTYA 1CT8A 4JHBA 2DWXA 4I1PA 4BCZA 2WUCH 1UCTA 2WQAA 5L0QC 4RAVB 4YAQB 2BSEA 1AG0A 5C08A 2X4RA 4PJEB 3UJIL 5IMKB 1DN2A 3WS3A 2EEXA 3F5WB 2DWEB 2OZNA 3CFUA 4ZUUA 4NJ9H 2A9ML 1D7BA 3MLTB 1KB5A 4AENA 1QWHA 1WTGT 2EDRA 4YSRA 4PV8B 2F7PA 1E3XA 2C3VA 3GHEH 3NRQA 4K5OA 1HILB 5E94A 1GGIL 5C7XH 2BNQB 2GBUA 3RGVC 4XPHL 3CH1A 3NCXA 3HNTH 3VGHA 4PPTA 1JIBA 1P69B 1LD9B 1FO0B 2HFFB 3BGMB 3T09A 1BVKB 1EJOH 3DX9B 3NDYE 4QGTA 3DJ9A 4DH2A 4LASH 3J2PA 4BIKA 5J5EA 1OGAE 1TKWB 1Z5YD 1JHLH 3UPAA 1ZLWH 2LVCA 4XVSL 4Y4FC 2E9BA 5TE6H 4DUVA 3GBNL 3N50A 3NVQA 4QHKI 5JQHC 4OZGB 2A4EA 5TDNB 3SJVA 4AMXA 1UJTA 3FHAA 4D8PA 2EAEA 3IS1X 2WCSA 4Y2NA 2DQ6A 4JANA 3SE3A 1ZGLP 1U8CB 5AVYB 4HCFA 2VLJE 3C6LD 1XQ4A 3RUGF 1SFHA 2FJHB 4YS4A 3HI5L 2DQDH 4HMEA 4DZ8B 5CCJA 3GI9H 4Y2OB 4N8PA 3F62A 3MRFB 4TNWK 3BFQG 3ZDZF 3E6FB 3EZJB 3QJFA 3HCVB 4HUWA 5J12C 1S9KC 4XGZB 5KVGL 3CLFL 4QHUA 3PQYD 2MFNA 5ECJE 2Q86A 3U48A 2VLLB 5F44A 2PO6C 4F3FA 4G70B 1CG9B 4TS6A 3H56A 1TQWA 5D7JD 3VSUA 1SJMA 3GMQB 1KWKA 1PSKH 5HHME 3H9SD 1YEHH 3VXUE 1ZVHA 4QCIA 3WFCL 3IAGC 2QGBA 3NFNB 4JPVL 4PVLA 3ULSA 4NRXB 5LQBH 5GGVY 1EVUA 3I6GB 4YX2L 1KBGH 4FQHB 1KGIA 2EH8H 4OCWH 2NY2D 1EHXA 1IM3B 1KT2A 3UTOA 1BX2B 1CE1L 5E1HB 1T22B 5DCCA 3LKQB 4LL4A 2P8PA 1U4FA 2VERN 3MJWA 3A47A 4YSEA 2MPAH 1A9BA 5L6YL 1W6WA 3QUZC 3UG3A 3NCFB 3UTQA 5LXGL 5KSBF 4FGMA 4S1DD 5FFLA 3MA9H 3OAZK 4O2CA 5LKNA 1M6OA 1JNLL 1VA9A 1RZ7H 3VCLB 3VFPA 3O41B 1XX9C 2AW2A 2JB5L 3V5HB 1RZFL 2X6BA 4YHYB 2D4DA 1U8NB 5DVMA 3T3MB 1SJVA 1NKRA 5KOVC 4XC1L 4Z7UB 1OCRB 2NQDA 1ZSDA 4JVPA 3KYKL 4XVSH 1IO4C 4GQQA 3VTMA 1BQLH 1OT2A 2ORBL 1IC7H 3O3UN 2VSCA 1CGSH 4M5TA 5FKAB 1C8PA 3MU3A 3QBTB 5IW1B 2P5EB 2VDNB 3HE7D 4AYEC 3CXHK 1BLNB 4D2NA 1I9JL 2OR7A 4QUOA 3EJCA 4NO3A 1IEHA 4RZCB 3MUGB 4ANXA 4PJBB 4W4OC 5C09D 3G5ZB 1QSVA 2FJGA 1GOFA 2BVQB 4FQXC 3KWTA 1LWRA 1NAMH 3B9KD 5INDA 4PS4L 3W81A 3WS3B 5C0EA 2PPCA 5HDLA 4E9TA 2DL9A 2ATPB 2WQSA 4Q4IA 2PP8A 3ARDC 3DKHA 4ODXB 2ODHA 3AVEA 4N20A 3ZMRA 4TPRH 4ZPVB 2IDFA 4M93C 3QUZB 4BBWA 2MQGA 1D6EB 4LPTA 4WWPA 4IRSB 2J2ZA 4A7QA 1S7RA 3KPTA 1Q0XL 1WLHA 5AKTA 3RY6A 4CW1B 3HLAB 3IBOA 3UOAB 1CTOA 5HI3C 4QLRA 1LD9A 5D2LF 5SWZE 1C1EH 1T4WA 4MYWB 4O2EA 4PJ5D 5B8CA 4JVUA 4KY1L 3CPUA 4UOW1 5AVUB 2HJLB 3RJDA 3SE9L 3V0DA 4EAEA 4U7KA 4OZIF 2WXJA 1U58B 3OKDA 3VI4F 4UM9B 3VXSD 2QHRL 5EIIA 2R2BA 5SX4I 4AC4A 1CQYA 1BZDA 5E00A 1T1XB 1KEML 4EBQL 4B0MM 1QUNB 4RNRB 4YNYB 1SDDA 4BH8B 3QEUB 4HDIA 3WN6A 3H54A 1ZLSH 1H5BB 2VLKA 2HLFC 1NMAL 4UAOB 4U3CA 3RHWF 5D6DA 4FHJA 4UMGA 3UJIH 2ZYHA 2UZPA 2VB5A 2H1PL 2P80D 3IDGB 1FSKC 3VRJB 1T4KB 1MCDA 2MOVA 5J6HB 2J8UB 2JKWA 2WO4A 4NN7C 5HI4C 3V7AE 4GP8B 1QEXA 4OTXH 1KCSL 4TQEL 5KSAA 4IJ3B 3KNBA 4LPCA 1YAZA 3HLKA 1QBAA 3BVTA 1CGYA 2IPKA 2YSSB 3O11A 3E2HB 1CGSL 1TXKA 3ZOAA 2R1XB 3KPSD 1IC4H 2EC9U 5CEYB 3S37L 4F7EA 3P54A 1KCRH 4X4YB 2EVJA 1A6VL 4ANWA 4PRAA 4OCYH 1LILA 2VDKH 1TJHH 2ZKYA 4FRWA 2JIXD 4PREA 2EXYD 3ABMB 2O1AA 1JZ8A 1U8OB 5C08B 1QBBA 3VFGL 2A83A 3BUTA 1F3RB 4KH9A 3UTQB 1Q90A 1PLCA 1GVIA 1LTXA 2P9RA 5IROC 1GGYA 3LH9A 1G6RB 1HHIB 1NCBH 2EDQA 5FOBA 1WZKA 5KANI 4YHOL 3TBYA 3BD5A 3WTYA 3B1UA 5HD8C 4O9HL 4MB3A 3X1FA 4ACTA 2NY5L 2UX7A 3TEWA 1E40A 3RTLA 1EUTA 2EEFA 1IBDA 2D7TH 4YN3A 4DUXA 1F00I 5C6TH 2H26A 5LDUA 3GSNB 4BXVA 2B4CC 3N04A 4GSQA 1VFUA 1KBPA 2WWMC 1E4XI 4QRRB 4G6JH 1HQ4A 1KEGL 2FBRA 4P2OC 4TUJB 2GEEA 2IO5A 4JHAH 1RURL 1T5XB 1YVLA 3TYGL 4JZNB 4L2YA 3RWEB 2H6PA 3FUIA 1FV1B 1AAJA 4HCIA 1E28B 1QHOA 2XTJB 3RZCB 4C4KO 5JYLA 5DHEA 4AEIH 3HI6L 1JOIA 2ZWKA 3PIQA 4I4WB 3TU6A 1CVSC 4MSWB 3DJSA 4X6FA 5DYFA 5G5DA 4DGVL 4P99A 1EIBA 3D69A 3DSFL 4QKXB 4Y4HB 5IEKB 1SN0A 3QG6A 3HIZA 5EU4B 4BSJA 1A6AB 5HPMB 1H9DA 5IP4A 1MDAA 3GTVA 4IBQA 1DL7H 5HDBB 3ZO9A 1YEGH 1B2WL 2QFPA 4GRLA 2GBVA 5I15H 2I9LA 3IFLH 4IJTA 3ATBA 3BKML 3QP3A 5E9NA 1DO6A 4MJ6A 5F7LB 4UM8A 4M56A 1NFKA 1BZEA 5KWYC 5AD0A 3ULUD 1ZLVK 3LIZL 5IBTH 5MEPA 1PLGH 2EE6A 4L3EA 2ITCB 4JGJA 1A9VA 1PJ9A 4OY9A 4KNSA 3P0YH 4NP4L 2BIPA 4DVBA 3EHBC 4BWWA 2VC2H 1HFUA 3N42B 2DJUA 4HSCX 4LHUG 4LKXA 5EZPA 5DZVA 4WF7A 2E47A 2NY2B 4M62L 5AYUL 3GSWB 4OCSL 3Q1SH 3RL2B 3UZVA 3U79A 1M6OB 3GT6A 4JQVA 3K74B 4X5WA 3IDXL 4OLVH 5EOQH 3WXVL 3EBAA 4U4BA 1NC2A 4K7PX 2BP5M 1BP3B 2BSTA 3FU8A 3KLAA 2HFTA 2ZXAA 5I66A 3O4LB 5IKCA 4LIQH 1UWEH 3FT4A 3KXFB 1YZZA 4DUWA 2P8MA 1MJ8L 5IEHA 4P5MA 4OZFH 4F9LA 1OOWA 3MCLL 3VXMB 1J0IA 3F2LA 3HG5A 1TTUA 3HE6B 4K8RH 3LS5H 2Y7QB 1I3GH 3MACL 4JFFA 1Z9LA 2A83B 5D9SB 2A6IA 2WYZA 3B2VL 3UJTL 2CIKB 4ZTOL 5KBPA 3K5RA 3IMBA 5J56B 1SUHA 4W9HC 4UV4H 4HKZB 4QHLA 1C5BH 5FYLH 3NBNA 3MXWL 1AACA 5K9JL 3O3EA 3TNMA 4CBPA 2D3NA 4FMVA 3L4CA 4G8GE 3FMGH 4MBRA 2DN7A 3PWUA 1INDH 2FQFA 5I0ZA 1F6FB 4JG1L 1GTFA 1XCTA 4JFFE 4NKMB 4XH2B 3AJ7A 3RIAF 3CFKB 1CU4H 5D7IF 1KBGL 4Q74A 4C83B 4DKDC 2CGYA 3P11H 4K3DH 2BVPA 1NGWA 1KG0A 2V37A 3UYRH 4I0PD 3GRGA 5BO1L 2H9GA 4ATWA 2CDEB 2X4OA 1NIEA 2R4SL 5AB9A 3R4DA 4PRDB 1AR1C 5FOJA 3OMNB 4MVBD 5EBMB 1P9MC 1D7FA 3BAJA 4FQXD 4LHUA 1PYWA 4J23A 2AXGA 4N5UA 3VWKB 2BFVL 4ZMOA 1TPXC 4ECNA 3D69B 2R29H 2F54D 3MBED 5BZXA 5AKVA 5TDOB 3U82B 4P3DB 4NIKB 3ZE0F 5GJSH 2IOMA 2F5BL 1I9RH 1GCYA 2X0VA 3EDFA 4PLJC 4WUKH 4XBGA 5BZWB 3DUSB 2R7EB 3L3JB 1SEQL 3GSUA 3RNKA 4E9SA 3FTWA 3MJ9A 3IFLL 4HFWB 4JJHA 3DA0A 4CJ1A 4FTDA 5E8EA 4APQB 4CBZA 1JPSL 4YLQT 3TTSA 1YN7B 4H8HA 1IL1B 2GC4C 1LEGA 2R39A 3FU9A 3WEMA 3MGAA 2DI7A 4XRCB 3VG0L 1XGUB 3IRPX 2Y5QA 1BAFH 2W94A 3VYNA 5CLTA 2A38A 4G72B 4X9HA 4DK5A 3JWDC 5HHOA 1U8QA 3S3PA 4JM2F 1V3MA 4DQOL 5ABZA 5DMJB 3PY9A 2R23A 5C9JB 3PHSA 2A6JA 3MGOB 1X5HA 4OD2B 2ZF8A 1X7QA 2BWQA 3RWHB 4JGNA 1CGXA 3QUYA 2VC2B 4M5ZH 2O5NA 5KSVA 1KBKA 5EU6B 3VGBA 2CLRB 3IDUA 3U4KA 1JWSB 4OCNC 3D39E 1URLA 4YIQB 4IS6B 3QS3A 4MQTB 1I7RB 5E2TH 4JO3L 4X5LA 2ZUSA 5BQ7B 3MJ9H 3VI3A 2EUVA 3K6IA 3N41B 4LMQI 1KTJA 3EO1B 1WFNA 1HAWA 3KPOA 3AXIA 4K5PA 4J27A 3ULVC 2NY0B 1UEYA 5I24A 5KZCD 2E6JA 1L0PA 4AQEB 3FB5B 2K3TA 1AFVL 1F2QA 3W5NA 1BZ8A 1BZ9B 4MXWH 4LDOB 1K5WA 2QPSA 3DYOA 3LNEA 2YGOA 4PJHA 4HS6B 3MRGB 1E43A 5KVFL 1R75A 1NCUA 2Y25A 3CH1B 4UU9A 4N8CH 4FQCL 3K80A 3DV4B 3RX7A 2IH8A 3BVUA 5MERA 4PJEE 3KCPA 2GW5A 3L08A 1IU1A 2X40A 5ILTH 3VD2A 4XBPA 2PR9A 1LK2A 1RZ7L 4AYSA 3KPPB 4EIUA 3EH1A 5FIEA 1OF2A 5DI8B 4ODVH 3BPLC 2Y0SA 1COBA 2DDQL 3T65B 1E50A 2B20A 2B1AH 4HJGA 4BA8A 5C0AA 3CVDA 1N2RA 3H9YA 4KXBA 1M3IA 3KH3A 4OVUA 5IV2B 2G4GA 1TVDA 3FO9B 1OSYA 1UXMA 5LAXB 2WYHA 5T3ZD 1OGTA 2VZVA 5F7WC 4N0RA 5EUKB 3RU8H 2EIJB 3QEHA 2VE6A 3LIZA 4K07A 3WTXA 1BV8A 1AYRA 4A7TA 2KH2B 3KDMB 4IOIA 1P7HL 3QFJB 1GW0A 4P5TD 5D2NB 3CSBA 4A7GF 2EC8A 3IJYA 1XCXA 4FYTA 4MMYA 1FJ1A 4DPAX 1MLCA 4GKZA 4WKZB 3ZE0B 1NAMA 2JI3A 3V0HA 5KYUB 3MLXL 2VNCA 3CHPA 5IGXH 2WCPA 1SHSA 3OBAA 4HFUL 5B22A 4M7JH 4N2CA 1NINA 3MBXL 5C0DA 5AUMB 3CHOA 2PP9A 4O5LL 3TO4C 3CIQA 4MMZA 2J6EA 1J0ZA 1AJ7H 5DD6A 2J6WA 3BESR 1NCGA 2NXYC 1XWVA 3F01A 4MJ4A 1J1OL 5A6LA 4G8IB 3KPLA 1OAKH 3L1OH 2IPTH 5TE7L 1FNEB 3LKNA 4IHBA 4MXQC 3AG3B 5KG9B 1FGNL 4N3TA 4JZJC 5E8DL 3R8QA 1MWAH 3VD0A 1ZT4A 2ZWNA 3QUXA 5FHAL 2EDNA 5CD3B 4LSVL 1BREA 1QFPA 3BH9B 1RZJC 2A74B 3WUWB 5CR8A 4X6BB 2Q20A 1J87A 3E8VA 4MRCA 4YR6A 5GZNC 5IGXL 5FM8A 3ZKXC 3L1GA 4N2FA 5D2NC 3B9KA 1RZ8B 4KPHL 4JUSA 1UATA 2Y6SD 2Y06L 3CQQA 3PYCA 4GRLB 5CILH 3VE0B 1C5DA 3AGWA 3D25A 1UVQA 1F58H 3VU1A 5GGRY 1P7QD 1WC7B 1PZSA 4N9GB 1WA1X 1R4XA 2JJSC 2N01B 2WSKA 4H8WL 3BQVA 3GS0A 4WI0B 3SPGA 3IRZA 5DLLA 1RERA 1WRFA 4UQAA 2XICA 3NYKA 4DAGH 2YPLE 1OAZH 3HMWH 1MFDH 3PL6B 2NY3B 1UOKA 3NCYP 2MH4A 5ACMA 4DO5A 3MRDA 3MRIB 2GG1A 5HYEA 3MLZH 3S97C 4D9RD 3L3OA 4JCMA 1Z3GH 3DX2A 2TRHA 1NANI 4IHOB 5MHSE 2JI1A 1W2KT 3P9MB 3AQXA 4LCYB 3W9DA 1CICB 1MCOH 3ARZA 2WN3A 4OQTL 5I8CA 1E8XA 5A16B 5CHNA 1C5CH 2EZ0D 2YOAA 3EZ8A 5IOPB 2EXYC 1TOXA 2HT2C 5FA4B 4NERA 5F7YC 4U6XB 2A9DA 5F88B 4N0CC 4UIMB 2PF6A 4Z95L 1XGRB 2RFXA 2VR5A 4DQAA 1KZYA 3PXLA 5EBLB 1ED3B 1E4XH 3AS3A 3KW8A 3NCBB 3W0WB 4G9DB 4BV1A 3P4MB 4DWHA 3ZE2E 2XZCL 3BKYH 1OGTB 4NUGL 3PGFL 1X5GA 1EZVX 5DGQA 1KYDA 2XUWA 2ADGB 3ALWA 2P44B 4OZIE 1ONQB 1MUJB 3APMA 1W0YT 1PD0A 3QQDB 4EVNB 3SJVE 1BW8A 4Y2DA 1LO0L 4HZLA 3OXSB 5BUGA 4P4KB 3VG0H 4ZNEA 3EGXB 2A0LC 4KHTH 3UDWC 3QWRD 4HWUA 4ICXA 4K71B 4FNLH 3K2KA 4RCAA 4B5ZA 1A1OA 3TJPA 3LX9A 3FH5A 1TZ8A 1S7VB 1HI6A 4NZ8A 3R19A 4LP4A 3FO0H 5HHPA 2A4CA 1Z7JA 3LN4A 1OTUC 5DJXA 43C9B 1XSOA 4R8WL 5KSBA 1KTLB 4M7JL 4NO0D 1QNZH 1T89C 1S9YB 4PB0L 3GJEA 5F6IC 1G1YA 2ENYA 3LXAA 2JJTC 4HUMB 4XVTL 5K69A 1L5GA 3T71A 1KXTB 5ID0A 4IBVA 2Z4QB 5A2JH 2AJ3B 4GJTB 4WI8A 1OP5H 3VGAC 1RAMA 4ODUA 1QATA 5DC0A 4YX2H 1NCTA 4WI5A 5ICYB 3PWPB 4FFVC 4LGSB 1CN4A 3U2SA 2FQEA 1QRND 1XAUA 1U2CA 2QQNH 4PRBB 5AAWA 4ODWA 3BMVA 4ZTOH 2FH6A 4C4BA 4X9GA 3ZTEA 4E41B 2OW6A 1URIA 2AQTA 3DX1A 1QKZL 2CMRL 3CFBA 4QYOB 4XB7A 5T1KB 4IU2A 2DOCA 2OMWB 1V8HA 4PCSA 2EIEA 1SXZA 1JTPA 3WHXB 4BK5C 4RISL 1MCEA 4FQIH 3QQ4B 1ODAA 2COVD 4QJ5B 3BZEB 4QMEA 4OLXL 4Z7VA 2YO3A 2CBOA 2LV4A 2NY1D 2CM5A 1DJWA 3CSYB 2EIZA 1NBCA 4GQ9L 2RACA 2L7QA 3OJDA 2PO6B 3H85A 3MV8A 3FL7A 5EZLA 4ZSOB 1NEZA 5IJVA 2VN7A 3PU7A 1HSAB 2Q1EA 2PYEA 3SDDA 1ZHNB 4WVRA 3U83A 4F7CA 1CK0L 1CIDA 2QZQA 4PW9A 3B5TA 1UXSB 1W72B 4ZS7H 3TEUA 4KVNL 1BD2D 5D7LD 4K8RL 4DPRA 1P4UA 2FZ3A 3CFEA 4OZFG 4OIFA 5J6GB 5C97A 4OB5L 2Z8SA 3VFPB 4DK3A 3MV9A 3VQ2C 5LN4A 1MFBH 4ZW6A 5FDWA 4EE2A 3FSVA 3GJFA 1WFJA 4LLQB 2CCWA 2D7OA 3H6AA 5F97E 3RVTD 3VXRA 1U0QA 4GYBA 1YUHB 4Z7UA 5DEGB 2Y24A 4NB7A 2CLZA 3F5WA 1EJ8A 1XMEB 2FGZA 1WD9A 3MYJB 4MB5A 4ZAKA 5CKGA 4OJCA 2YS4A 1GJUA 3IB4A 3B8SA 2UVFA 4FLSA 5ID1A 3BWUC 4FLOA 2CHWA 3QZBA 1F58L 3DTUB 3DX4A 1T83C 1RHHB 3VM7A 4GKNA 4ZPTA 4PJ9D 4BKLB 5CSGA 2J3SA 4JFWA 1BFSA 4MCZA 3RBSA 3ZKSD 5D1XD 4E9YA 2GK0B 4BZ1A 2FK9A 4HCGA 4WI9A 2R59A 1LNUA 3VXOB 4ABQA 1TKWA 4HAKA 2A99A 2VR4A 3DX8B 1DTUA 3CVHH 3SDYH 3UZQB 2IAND 2OMXA 2UY7B 4FQXB 5C8JA 4HLZH 3Q5OA 4GKSB 1HL5A 1MWAL 1JV2B 2OJZL 4KQ4L 5JIQA 1RSYA 4JFYB 4JY6A 2O72A 4X80H 2YRBA 3T6VA 3TEXA 5FCSH 2CO7B 3TZVC 2GCYA 2QMJA 1R3KB 4BFIA 3LEVH 1OTTC 1HHKA 4M8QA 4XAWH 2PYFA 2BSRB 4IKNA 1AIFA 3GJEB 2ZOKB 4P2QB 2ZNWA 1HDMA 4KK8C 1N2RB 1GHFH 2PPDA 2H3NB 4U33A 3RGVA 2BHUA 2VUYA 4QHKJ 1NCAL 4R26H 4XMVA 3V0JA 2BVOB 4ETYA 2R4RL 2WVTA 2XFGB 3WGUB 1T0PB 4TVPH 4UTBH 1Z3RA 4KZCA 4EOWH 4QAWA 4HKBB 4LLVB 3OAUL 4TOYH 1MW1A 1BQUA 1JWUA 4JRXD 2PPAA 4MXVE 2RR3A 4QCIB 4AE1A 3O81A 4G7SB 5K1NA 5DJYB 4RDQG 4KGJA 3CPLB 3ARDD 4CKQA 3O9WB 3QDMB 2A0LD 1CFVH 4NQDB 3BP7B 4OCLC 5CGTA 5CLWA 1LYQA 3SJVB 3LSOA 1E4HA 3ELQA 3PABA 3BXNB 5CJOL 4MCYA 3OSKA 3GLAA 5E6ID 1BVLB 3V6FB 3N0AA 3KPRA 5AQ0A 1J8RA 5AALA 1A6PA 2DQEL 3KJ4C 3MODL 1Y07A 1UB6B 4DHLA 1EAJA 4UTBL 3TJEH 3WO3B 4S2SB 4PWIA 3M45A 4UT9L 4OUUB 1IAMA 3JQOB 4WW2C 4CU8A 3RL1B 2HUEA 4NP9A 4OLYH 4RWYH 2Z7YA 1MH5A 5ACZB 1H15A 1R46A 4WTZG 2VMFA 1U3YA 4G6FD 4LAQL 3BEWB 1S7TA 4MA3B 4EIGB 1FZJB 4BSWA 1L0QA 3ISYA 4OSUL 2FZ3B 5CM1A 5T1MB 4Y1AE 1BCIA 1HEJC 3F12A 5D7EA 1Y18A 1I7UA 2ZKHL 3JV0A 4GLRI 4KQ4H 1TVBA 1IAII 4FHBD 5E0QA 3FN0H 5HHQB 4KK5D 3MLYH 4XMZA 4ANVA 3MFFA 1KB3A 1Z9OA 4Q7DA 4XNXL 3T1WA 3KGTA 1YNTB 4ENZA 2OA9A 4Q6IA 4AQOA 1JYNA 4H7VA 4KI1A 3EXLA 4HGKC 3K1KC 3HG2A 5JR1H 2X3AA 3CMOH 1OE3A 4ZPVA 5HYJD 4L18A 4M3HA 5DD0L 4HIJB 2V33A 5FF6B 2XJKA 1GC1L 3HUJE 4XVUC 3VFVA 1MVYA 2DTML 5BVPL 4MS6A 1ZRUA 3F6JA 1B0GA 1I3RB 4WY7L 2HFFA 2IFGA 4GY4A 3ZL1A 1IC4L 3ZKQD 4I4WA 2DYPD 5LBVA 3M1CA 4M61B 3OLEA 1NGQH 1DBKH 2NXZC 4PGEB 4O02L 5LCVA 2AQ3A 4XP1H 4AZUA 4CDHA 4HA1A 2NZ9D 3IYLW 3PWPD 3QFGA 5JORB 3SY6A 1A2YA 3N6YA 5I1LB 2WV3A 1LWHA 3O4OB 2CDGA 4V2BA 1PQZA 2LE9A 1ZXQA 1TU2A 3LZRA 3THML 1SLXA 3ARSA 3ILQD 4V1DB 5DRWA 1USZA 2X3BA 1TCRB 3OF6A 4P9ML 4R83A 3DSNA 4RAUA 1KBWA 3S5LA 4X7FC 2DQHH 2J56A 2DQUH 4IDJH 1HXMA 2JE8A 1D9KB 1WISA 4LCCC 1WWWX 1A6ZB 1EXUB 1NEZB 2BOBA 5TH2B 4ZS6D 4NDMA 3FQYA 4ZBJA 4BHUA 2ZYIA 3CHRA 1YMMB 3VFOA 3JSSA 4N0FA 1MI5E 2YPKB 4IMLB 3FTGA 1P5UA 4GQ9H 3C8KA 4LASL 2YN3A 4NM8H 4PYHA 1DVZA 15C8H 1FNAA 5DFVD 3VI3E 4OV6F 4AYGA 2VDPL 3W0WA 4YXHH 1KPVB 3RTQD 3EJJX 3QCUH 1M7IB 1VESA 4Z77B 2Z31C 3K2MC 3NFNA 1OARH 3H1ZA 4X9YA 4XVJH 2F68X 1BD2A 4MKMA 5EIVA 3OMZA 4JKPL 4BFKA 1WYJA 3S4SG 2YRZA 4HXAH 4P2RB 3OKNA 3INOA 3TPKA 2AXWA 5JHAA 3MLWL 5KAQG 3LH2L 1E4WH 3MBWB 1ZGLA 4U1IB 3SBQA 5LHDA 2YD7A 3IAQA 5CCGE 2RB8A 3Q6FA 4FXGB 2NY1B 1RZFH 4NQSB 2CJTA 4E42B 4OI9A 2IH9A 3MV7A 5CILL 1HINH 3KXFA 4OJEH 3B7TA 4LCWD 1P7QB 3IKKA 3CAFA 4U0RC 1DZBA 2V0AA 5F7DB 1UC6A 2BCMA 1H15B 3Q9PA 4ZTEA 1GGBL 3ARVA 3ULUC 3DHJA 4U1MB 1E7VA 2W9LA 3UADA 3OJMB 1HHGA 4WJG3 3PWLA 3QZWA 4Y5XB 2AQPA 2O5YL 3HPLA 4IBYA 2F53B 1OAZL 2NY6D 3S5ZA 1I8LC 3NJHA 1GYAA 1V7ML 1FLRH 5E95B 3B9AA 2BZCA 3HB3C 3NK3A 3KVQA 4WW1A 3SQBA 4X6DE 1PIFA 4BYHA 1ET7A 2VYRE 5IFHL 2PCFA 1T5XA 3R18A 5LGHH 1ZANL 5BZDB 3L3KA 5D8JL 4YDVB 1IEAA 4HG4J 1JZDC 1HQRA 3RU8L 5CKAA 4DP8X 2OFQA 3J27A 4ADJA 4GG8B 4IBLT 5GJSL 5CSZA 3HB3B 1VFAB 3ECWA 2F19L 4Y4FD 4O02A 1PAMA 2F7QA 3GMMB 5L0QB 2VIRB 4OV5A 4XNYL 3HI6H 4RLDA 1N0LB 5H2BB 2F7IA 4X5PA 5C3TA 4BXSV 3OGOE 3L4UA 3KYOA 4PTUA 2OYMA 2I5YH 1DJGA 4KUZH 4IM8A 4ZO8A 1UYWL 2Y23A 4H13C 4JY5H 3QDGE 3MLPA 4F33B 3VI3F 1T83A 1MRFL 2MCMA 3EO0A 5B3SB 1X44A 5LGHL 1S3RA 1KF9B 2F54B 3LN5A 2BC4B 4HJIA 3ZLQC 2Y07L 3SD5A 2IANB 4LSQH 4L48A 4DN4L 1HCYA 4GRWH 1SEBA 1WFTA 4XP6H 1CC3A 5MP6L 3TA3A 5IB4B 4JZNA 5MEQB 3HS0A 3L3IB 2M8XA 1I9IL 4NC2B 3ZSTA 3WNMA 3VD7A 3U4BH 3N5AA 4LF3B 3RL2A 4F7MA 1J5DA 3BO8A 3ASNB 4I7ZC 3FQTB 4ZX5A 5FEBA 2CIIB 1JGVH 1OIOA 4IGBC 1VSCA 3MRKA 2B9BA 1T4KA 4YC2B 4UYPA 2BS9A 4P2RE 3AAZB 4LK4A 4U7SA 3NA4A 2XV2A 2ZE0A 4JRXB 5GRZA 1TTBA 2X9WA 3CDGA 3VUAA 2IFFH 4PJ7F 4R7NB 4E68A 1XF1A 1IGTB 4BCYA 4UTBA 1XGQB 1F13A 1U8PB 4Y89A 2HJFA 3HUJF 3P9LA 1L9QA 3EH2A 1O5DT 2BPBA 5A7BA 4PRHD 3CFIC 3EFFA 3BZFA 3C8HA 1DBKL 2F1EA 1WDAA 2W8CA 2XIIA 1NBZA 3GRWL 3QZMA 4HEPA 1BZOA 3GMPA 4N24A 4K7PL 2BY1A 5DK3A 1T3FB 5E56A 1QWUA 2R0LH 3GIZL 2Z0UA 1I82A 3RGVB 1Y6MR 2XU9A 3FSWA 1BOGA 1O6SB 5C6TL 3MCKB 4HUXB 2YD1A 3GK8L 4HAFA 1MF2H 1QR1B 2HLAB 3OL2A 4EPSA 3MNMA 3OVUB 2JLPA 1F4AA 3ULVF 2UWEB 3HEIB 4IRJD 3CN2A 1JZ7A 4ORZC 4HIXH 3FF8A 4XVTH 2ZKXA 3D0VB 3RWGA 4WFED 4KKBC 5DQ9A 1JTOA 1YECH 2CJUH 3HS9A 4H8VA 4QRPA 3FRPG 1TENA 2OR9H 4ACPA 3TESA 4K9EC 5C2BH 4FNRA 2DQCH 4K15A 7TAAA 1W8NA 1MI5B 1G1CA 3QDMA 3K6SB 3N43F 3N9GL 1P6FA 3VSQA 2JXMA 1HKLL 1AGDA 3VXMA 4P2OD 1T1XA 2PLTA 1P1ZB 3T3MF 3WKML 1ZT7A 2HVKA 4HXAL 4HK3J 3ZT5A 1AR2A 4M7LH 3IU3A 3VTAA 3D1MC 4AWJC 5C0CA 5C7ZA 3HS8A 3MROA 3QG6B 4AMKL 4J3VA 4WFHE 5GISL 1U2HA 3RB7A 2DM7A 2QVTA 2WSPA 1KCUL 4HLJA 2RCSH 3C09B 1AC6A 1MVUA 2YPKA 3FULA 3POCA 1KTDA 4PR5A 4IBZA 5A2CA 4L37B 4PJGE 1SJHB 2HMIC 1LO3L 1LQBC 1S7WB 3IJ9A 1Q9LB 1AANA 5FO7B 3KAAA 3TIEA 3IDNA 1XZWA 2QTVA 5CEYA 3N2JA 1PKOA 1F2XK 4XNQB 1DSYA 1TQVA 5K9KB 2QPFA 2MNJB 1K4DA 2JWYA 1X5IA 3FB7A 4V1DD 4QRTA 3HN5A 5HY9B 2P5WD 2V7NB 5E9DE 3V6OC 3REVB 1NSNL 1TTRA 4P5RA 4APQD 1FL6B 2Z0BA 5IW6B 4RQQA 1MCWM 3MLXH 1D5XA 1EBPA 3HAEB 3KXFE 3CUPB 2FB4L 3TWCL 2HX9A 3QHZL 1OAYL 2GJ6D 5KSAD 4JFHE 4K94C 2IXQA 1FNEA 3LKNB 4AG4L 3V6ZA 1B0GB 1C7TA 4MAYD 1KTKE 4L4TD 1F4XL 1NM9A 3BH9A 3RVUC 1NQBA 3NEXA 1PZBA 3GSVA 5EN3A 2YPVL 3G04A 1DQDH 1FAIL 4JQVC 4XPFL 1YEFH 5LDSA 1Z0NA 4A6YL 4UNIA 1K6QH 3QZPA 2HVBA 5D2LE 2RTTA 4JFTA 5IHWA 3NSXA 3FCGA 4DZBA 3D50A 4G9FB 3AREC 4JO4H 3DX0A 3OV6A 1E67A 2DIEA 4JQIH 1EXGA 3RBGA 2J8UE 5IMOA 1LNUB 4UV7L 1CYWA 1ZV2A 2D73A 5KYYB 2D7PA 5DRNB 4AYFA 3ZIMA 3SGKC 1XGTA 2Z92B 1CI3M 4Y9GA 5DVOA 4ZUVB 3ULVD 4OU3A 4FYRA 5LO7A 1NWOA 4C55A 1GA2A 3VXMD 1FNSL 4I0CC 1UUSA 3CDFA 4AUJA 1F3DJ 3DTXB 4FI7A 4XMPL 2AJUL 3C60B 4UQ2B 3X3FL 4Y4KB 4GO6B 3IMUA 4S1SH 3HZMB 5AOMA 3LB6C 3QJZA 3MLZL 3FHQA 5GS1B 5IIEB 1VEMA 5HGHA 1QI5A 2I27N 1AD9A 3G5VA 1EDHA 3GDCA 3QIUA 4PW3A 3WDHA 3CC1A 1AHWC 1ZWIA 1ND0B 5EU3B 1SHMA 3TYGH 4H8PA 5AWNL 3BPNB 2LU3A 2W60B 3D48R 3DMMD 5HI3D 3GTNA 4XAKE 1IGJB 5CGMA 5TE4L 4LPVA 1M2OA 2K9FB 3GSOA 1PZDA 5CINL 1NLBH 2N56A 4HH9B 4AQ8A 1G7QA 4U1MA 5DD0H 1BZ7A 5F0JB 1S5IH 3F65A 4AJ0A 4KDTC 1CI5A 3RVXD 3TV8A 3UXFA 5L2KB 1XZ0B 4HS8H 1J9QA 4GSDH 5KJ4A 3STZA 3ARWA 3IDMB 3K72B 3BISA 3D85D 3DGGA 4M1GL 4MCYB 5LJYH 1TFHA 3UGEA 1KXVC 4N2BA 3BAKA 5BRPA 3H9HB 3A6CH 3B43A 4HIXL 4GRMB 4ZZFA 4AGMA 5JXEA 3CLEL 4UQEA 1WJ3A 2E56A 1X7TA 4UWQB 2VITA 4B7LA 2OK0L 3WIFA 1IJNA 3A3YB 4G6JL 5AW6B 1FG2B 1U30A 1TQBC 3TPUB 4ETQA 1XMWA 2Y7QA 4FNLL 1Z5LA 2E9WA 1L7TL 3UJTH 5HYSA 1UB5B 4OZHF 4G2AA 1IKOP 2BIQA 2ZONA 2VLJD 1Q0YL 3T0DA 3QUGA 1FH5L 4A66A 4DPCX 1NCCL 1FCCA 4WZ9A 1V7NH 1D9KD 3FONA 3SGEH 4AEIL 2BHZA 1CG9A 4PRPA 5I6PA 3LYRA 1MAJA 2OP4H 3II2A 1ZVSB 2D9QB 4I0KA 1XVSA 5KYUA 2D0HA 1WC7A 1BM7A 4A63A 4ZW8A 4J3OD 1J5OL 3WNIA 1DP0A 1HNFA 4OFPA 5T3XD 4IRJA 3OKYA 1A7OL 4KOCA 3GSRA 1AXIB 3GS4A 3WSQL 4XTRC 4JRYE 3KPLB 5JZ7D 3AWGA 1VKXA 3MNZB 1GYCA 1QSFE 4NRYA 4P2RD 2GTZB 2JKSA 4MZ2A 4R90H 3P2BA 4G43B 1K8DA 4O2CB 3F7QA 4LHUB 4HS3A 4JL2A 3WFBH 1T03L 4AXWB 4J3BA 4WUUB 4Y5XC 1WCBB 5BUPA 1BIIB 3KCWA 1PZAA 1UM4H 5FYJH 2VW6A 5D7LB 2AABH 3IBEA 2V2TA 4HAGA 5C0AD 1Q0XH 5K9OA 5GHWH 4NBYB 4Y16D 5HJBA 1V54B 3T1FB 2AXFB 1HCZA 3WEXA 3DTXA 4QT5A 1AXSA 3HRPA 4MJ2A 2WQRA 2GFBB 3OKLA 1MCPL 3AB0B 2EDFA 4HJJL 4JBSA 4E36A 1V7MH 3DBXB 5IBUB 1LK3L 5DS8A 1NL0L 5IIEA 3A22A 1AVAA 5C0JA 2ENQA 2NDGA 4YPJA 1UADC 4JNXA 2JLLA 4KHXH 4MS8C 2G75A 4HLEA 4XCYB 2YD6A 3D9AL 4FLHA 2Z91B 3AWEA 1MFDL 3NZUA 3WDIA 3UTZB 2WNXA 1KIUB 1A1OB 1H8NA 4PV8A 4JPIA 4BE6A 4YHPB 4UTAL 3JUZA 3V5HA 3DO7A 3KPMA 5CJ8A 3RWJB 1EH9A 3EJTA 2XZZA 3MV7D 3U4EA 5IJKA 1PFOA 1A0QH 3H3PH 4M6OL 1J5OH 1UYWH 4PJEA 2K8QA 3BP6B 1TEYA 4FABH 4ZMWA 3QCTH 5C2BL 3ESOA 4B27A 1OAYH 3C9NB 5K59E 5CFHA 3EUUA 1SDYA 3L95B 2PWFA 2J5LB 4ODHH 4ONHB 3KHOA 3WE6B 3I6SA 4XWOD 4LVOB 2VR6A 1FRGH 4HK3N 2GI0A 2VABB 3GINA 1GYWA 2AZUA 3TYFA 2R8SL 2YXWA 5D72H 2HYMA 4FNSA 5D8JH 5F9WC 2J72A 1TZOA 2H1LM 1MPAH 4FULA 2VCOA 4RRPA 3QORA 4WFGD 5JO5B 3U0PA 1X6LA 3KH4A 1XGZA 4FI6A 2IGFL 3B2PA 1A5FH 2Q86B 1FUNA 1TQUA 3WDJA 4P05A 2DJMA 3D18A 4NENB 3KNBB 2OTUA 1M2VA 3MLSL 3K81A 3OAYH 1XB8A 2Y5EA 4YZFE 4AQZA 3RWIA 1J11A 3O3DB 4LOUC 3TN0A 1RZGB 1AR1B 4OLZH 3UEZA 2ICWI 5D7SH 3NJGA 2C5DC 3PUUA 2PPFA 4NNYB 4DCQB 1ZS8B 4NI6A 1BFOB 3HJEA 1OB1B 3MOBH 1EO8L 3CWGA 4FXTA 4HD5A 3MV9E 1X5JA 5L2KE 2P48B 1KCBA 3FZUC 3KZ8A 1VFBA 1EA9C 5DWUH 2I60H 5JHMA 2APVA 1AQHA 3B2MA 3O4LD 5ICZB 2L8AA 1OSEA 4TL4A 3AS2A 4OVVA 2YQBA 3IN2A 2QHRH 3AREA 4YSTA 2VL5A 3MRHA 4BWTA 1D3CA 4O2FB 2Y1YA 1CXFA 4FNPA 1MFBL 1UASA 2W0KA 3KBEA 4UANA 4GI8A 1TJIL 4GT7A 1OGAD 1XF4B 4ADIA 2E9GA 5A3ID 1NOFA 2BWDA 3TT3H 3PNRB 4U6TA 2VZ1A 2X2HA 3SKJH 1BFVH 3KR3L 4PJFB 3K4AA 1MFMA 4QRRA 2Y22A 2D3VA 3FH8A 2BP0A 1IE5A 2EYSB 5A2AA 1RSFA 2FUTA 5DD6B 2CO6B 5KBKA 4QDGA 3VCLA 3OZ9H 2H3KA 1JSYA 3LRGA 3LOWA 3MACH 3NEOA 2HPTA 4F2FA 2J88H 2VZTA 2H1XA 1ZK9A 4NGHH 4C54A 4YDKH 4LL1A 1M7DA 5CBAA 1MELA 3ZSSA 5DTFA 2EIBA 2BK8A 4X98A 4EXKA 5DRNA 1CF8H 1OAXL 3ZYJA 3PWNA 2AJVL 2ZCLL 1I7ZB 4KDTA 3IJHB 1MCCA 3S8WA 2ZSWA 3E38A 3RRQA 1O6TA 3UFIA 2XXMB 2J2ZB 4NPKA 5IQNA 3TURA 5EC1B 3LVTA 2NYZA 1G87A 2VDLH 3ZDYF 2XPGA 2ADFL 1KB9K 4NJ9L 3UO8B 4KV5E 1IBGH 2YGNA 1J1XH 3FRPB 4XC1H 2ZOKA 2X4SB 2PR4H 1RIHH 1UZ8A 3HZVA 5IB5A 1QFHA 2FEEI 1OXYA 2J55A 1ADQL 4TM9A 1SVBA 2EDXA 2Y6SC 2AK1L 2R69L 4Q6YA 3L3DA 3QUZA 4YHNA 4XPBL 5I0XA 3IDJA 4P0DA 2W1NA 3OGCA 4F57L 1RUMH 4QO1B 1PNDA 1T1YA 2WKLA 4DVBB 4ELKB 5DQDL 2Y36H 2H0FA 1H8LA 3QT2A 1JD7A 2BFVH 4LQFL 1MZYA 1NPUA 2KL6A 2X9YA 3ARGC 1IILE 4U1KB 4W9ZA 4LB8A 2W92A 1N12A 2X12A 1A4KB 1G9ML 1X6NA 3MV11 2PR4L 2P5WE 4J3UA 5ALCH 4Q52A 3BP4B 4V1DE 4JRFA 4UOJA 3UTSD 5J9PB 2FEDD 2OJZH 1DLHB 4MAYB 5GRUH 3GGWA 1P1ZA 5MEOB 4FC3E 5C92A 2UVEA 2VXVL 3FQXA 4JRYD 3ROLB 2GC7C 4DFHA 3PREA 3AFLA 2AKRA 4YLBA 3UC2A 1PG7H 3FKUS 3RL1A 3S3JA 4P23B 4RX4A 1DQML 4WV1A 4YXHL 3SY0B 1RULH 1MFAH 1E9OA 5KBLA 1GOHA 4NWTL 4PIBA 5SX5K 3X13A 4Q58C 5D7HA 2UXVA 1UGNA 1U3HD 4HJJH 1XH1A 1FF5A 2LLNA 1PU0A 3QXVA 4R97B 1GS7A 2J4WH 1JRHH 4JS7A 5H8DA 5FO9B 1NMAH 2IPTL 5TE7H 3BRGC 2JKJA 1X9RA 4AC2A 3SBRA 1X4XA 1L3NA 3KPSB 4N85A 5F96L 4B9FA 4LMQE 2AJSH 2IDUA 2VC2L 4PWJA 4YHPA 5FUCC 2XWZA 1I1FB 3I84A 1MZZA 1U92A 4R97C 4YLCA 4LRIC 5DHYA 4N1CA 3NAAL 5EO0A 5HDOA 5EEZA 5DK0B 1I8KB 4XMWA 4DEWA 1O7DC 1CQKA 3QDGA 3DXAB 4N2NA 1T21A 5DMGC 4F8LA 5IHUH 4KTEH 3RILA 3QYMA 4XPBH 1G6RA 5FOBB 2CO6A 3HR6A 2YBRA 4AL8C 3BPNC 2VDQH 3AXLA 3PQYE 3ULVE 1A0QL 4M6OH 2QMKA 5T3ZE 3BIKB 3V4VL 1FL5A 1IGIH 4YHKL 3N1GC 4KDWA 2VLRA 3QJOA 3NFSH 5LNDA 1MFUA 3P73B 4OBRA 1OM3H 1WK0A 1GRWA 2F5AH 5BO1H 2AK4B 4CMMA 1UWXK 2AEPH 2CRMA 4FJ6A 3K2IA 4FXKC 5KSAC 2IALB 4WU7B 3FCTA 4NZRH 4QOKB 2AQ2A 2V6HA 5FYJE 1G7MB 4NSKA 3U46B 3TCLA 4MBOA 1WBYB 4JO4L 2C7UB 1HEZB 1FNHA 4JDEB 2ZYRA 5IQ7L 5HGDA 3NSYA 2YAEA 2O93L 1M42A 1PLBA 1DJIA 2GVYA 4PJCB 1E6OL 2B1HH 4L9LA 5DVPA 3OZKA 3QI9B 4XNUL 1KIRB 3WUWG 3ZL4H 4HV8B 5JDJA 2BVOA 1EFXD 5FYKD 2AQ1A 4L3CA 4O4YH 4R84A 5HYQA 3VQLA 5DR5H 1BVNT 1PL3A 1LO4H 4XVOA 5DT1H 5LBSH 1A7RL 1D7CA 3ESMA 3LXUX 1KPVA 4P59L 4UMSA 1LP9A 4L4JA 5KVFE 1UH2A 2PTTA 3JYBA 3AQDA 1ZLVH 4JREB 1BBDH 1J8HA 3L81A 3BWUF 3DVGA 5EU5A 3ZRCC 1JGEB 2V2XB 2C4FU 2DQEH 4YSUA 1J8SA 1W9XA 1E5BA 5I28A 3DYPA 4GG6E 4Q0XH 5I1CH 3MBWA 2HT4D 1A2YB 5E9AA 1R3JB 3QDJB 3S34H 1AXTH 2XWBB 4R5TA 2IADB 4X6CE 3RVVC 4JFOB 1RUPH 3BUBA 4H8WH 4JRYB 4Y19D 2CO1A 5CINH 1U3HC 1A25A 3VACA 3QFDA 4QHNB 2EVGA 3KPOB 1P5UC 1G4MA 3S7GA 5FXCH 3BE1H 4PP1C 2CG9X 3HG4A 5TPWH 1H6FA 3SDCD 3ROOA 1WFOA 3MYZA 1UEMA 4OT1L 4BJLA 2NY7L 4XN7A 3D12B 1QP1A 4ELMF 1JG9A 3DMMC 3IDGA 5I19L 3D85A 5D70H 1U3HB 1NEPA 1TIUA 4PGZA 4NNXA 1LEIB 1BBDL 4MTMA 3B9EA 1DCLA 2AV7B 4QAMB 1CZ8L 2J71A 2WINB 4DEPB 2IC2A 1A3LL 4E5XB 5E8PB 5E24E 5DGRA 4NM8L 5J06A 3HUJA 1VZGA 4QHLB 2X6VA 1IGCL 2AQQA 2DEWX 2J88L 1H6UA 2WXIA 2OMUB 2X4UB 1WITA 5BRZD 4WJ5A 1AGCA 3KXFD 4X4YA 4XTRD 1UH4A 2YKLH 3PQYA 4UT6A 3HE6A 4D0BB 5GIRB 5HYJA 4NFDA 1HE7A 5IUCA 4H88H 5AOIA 1XIWA 2K7QA 3S3BB 3CV5A 3QQ9C 5H4ZA 2NDFA 4XPTH 3RPIA 4H44C 4NXKA 4AGOA 1EGJL 1VRSA 3JV5A 4DKAA 5FFOA 1P2CA 2XSKA 4QD2E 1IT9L 3SCMB 1RXLA 1DQLH 4TUKH 4XCNA 4M8UA 2ITEA 3ARTA 4MB4A 3EO0B 2E76C 4NYLB 4OCWL 5DUML 3TWYA 2AK4A 1NCOA 3BUIA 2ZSVB 1W0WA 5HVWA 3KL0A 3CXHJ 3VWKA 4FG4A 3H7BA 2VH5L 4Z7QE 1QW8A 2F7OA 4X7DC 4Z7WE 3LEXA 5KYNA 3PWVB 2WUCL 5TDOA 2EDJA 5AYQA 1KDJA 4JDEA 1HWWA 4G11A 1U21A 4MA1C 4KTDL 3ZQWA 3MUZ1 1CGWA 4X6CF 4D9LH 7PAZA 1LQSR 2ATAA 4P46D 4GG8A 1INDL 4GQRA 2AI0H 5AUMA 1BVLA 3IXTA 3FT0A 1BD2E 3ZZSA 2GTWA 5B7EA 15C8L 3ZMEA 3NSCA 3B34A 4BQ8A 5JZ7C 5ALBH 1MFNA 4DF9A 3NDZE 1L9PA 2PXYA 5DEFA 1CO1A 2B2XH 1MH5B 3QR0A 4OQTA 3ZDXE 4J5VA 5F9OL 2M1KA 4QXGL 1TYEB 1PD6A 2K0RA 5DYOB 1ORSA 2ZWYA 3WO4B 1OD7A 3O6FA 4UUJA 2HT4C 2IQ9H 3ARXA 5EZOL 2Z35A 3BGAA 3FOLB 4MD0B 2WWMD 1UG9A 3TCTA 1A64A 1D5XB 4H8UA 4XMLL 2DB8A 1M4KA 2DM4A 3OB0H 2QGCA 4QXTB 5EU6A 5IESL 2JQAA 3LDBB 3ZE1E 5HHQA 5L6YH 4MMZC 3T0EE 25C8H 4J3SA 4NZTL 3EFDH 3GMPB 1RZIA 5JDSB 3ETTA 4KKAC 4ANUA 1N6VA 1N8OE 2VN4A 1U3NA 1OSZA 4P04A 5I8KH 4J1UB 5CJOH 3AS1A 5DK0A 4K3JL 3BDYL 1TETH 4YHYC 1UQSB 1KPRA 4NKOB 1ZE3H 3BE1L 3L5WA 1WGVA 3RDTB 3S0PA 5C0NC 1TVHA 5B3NA 1WAPA 4TNWF 2WLIA 4I85A 4P57A 4NPYB 3C5ZB 4JPQA 1JV5A 3HHMA 1IIKA 1PSKL 4JFDD 4K3DL 4PJCE 3MGTA 3X12B 3VXME 5C3IA 2I9TA 1YUKB 1G0XA 5F1NA 2BSBA 3QUMA 2IBGA 4GSXA 1AQDB 4XVJL 3PV7A 1AZNA 1AC0A 2OBGA 1UACL 2CCLA 3ZE2B 25C8L 3B2DC 4YDIL 1AHKA 32C2B 4WU7A 3POHA 3ATDA 5A43C 1AI1H 4D8PB 5JORA 4FP8L 4Z3FA 2GT9A 5IUSA 2K3HA 4M48L 4BEIA 4I18C 4JJ5A 4F8QA 4FFVD 3WI9A 5T1JA 1XIWB 2ZP8A 5C6WH 4PJCA 3PDDA 3U0TB 3FB8B 1KSRA 1GZPB 3VFRA 1V10A 3GXMA 3OAZH 3TVMD 1AZZC 3WY1A 2VMJA 4PW4A 2X4TA 1J5HA 1G6VK 3SYOA 3WNPA 5JA8B 3C08H 4FTVB 2BNRE 3EOBA 1JGDB 2BIHA 2G2RA 1MAMH 1OAJA 3S48A 4RMQA 2BOCA 1L7IH 4PY8J 1L0YA 3II3A 1HZLA 5C07B 2G3ZA 1XCQA 3MX0A 3FB6A 2AAVA 4PJ8A 1XF3B 3UH8A 5E99H 3RWGB 2BP8A 5F6HJ 4KX9A 3WIIH 5JW3H 4KK8D 1REIA 2XG4A 4QHMB 5H94B 4L9LC 5A16A 5FS5A 5C0IB 3ILPB 1A8ZA 3NJJA 4ZRGA 3V4LA 2B39A 1JGVL 2Z8VC 5D72L 5J8OA 1Q94A 3O4OC 5FPIA 1TQSA 5C0GB 4UM9D 4CILA 1PX3A 4ZFZA 4BH7B 1EFXB 4W9GC 3QDJD 3FFCB 1EEYB 4AKQA 1SBBA 1N6QL 4ZFFA 1KN4H 4NZDA 1EV2E 2CDFA 1S7SA 4LLMA 3CFNA 2ZUYA 5T3ZL 3TPUA 4A6YB 2OI9B 4ETQB 5I76B 1LEIA 1JGUH 4H1LA 2F9BT 4OIIL 2VLME 3KDPB 3VXRE 5BZWA 3KLHC 3NIGB 1BQHB 3IVKB 2LTQC 1X5XA 3PWJB 3EG9A 1JZIA 4WSGA 2FD6H 2WD0A 1IGMH 3ZDZB 2BCKB 2Y2WA 4M1DH 2ZX9A 2IBBA 4Z7VB 5IZ7A 4U1GC 3G5ZA 1LO0H 4Y9FA 1A6WL 4U3SB 2W65B 6FABH 4OZHA 4L9LB 3MRJA 4UDTB 5HGAB 3LXBA 5HHOB 5D7IA 1VFAA 4X8GA 1GGIH 4CUCA 1Z6JT 2A74A 1EZSA 2WQWA 4KKQA 3BJ91 3IFNL 1IGYA 1JPEA 4J3WA 4L1LA 1IV8A 2BW5A 4LCIH 2NXZB 5I17A 2KQMA 5I1GL 3BUYB 3QWRA 2UWEA 3KPSE 4HP5A 1VKXB 3BYYA 3NFSL 4BHUI 4RGOH 7CGTA 3WD5H 2FHBA 3KYMA 4TNFA 4U6HB 2Z31B 3OD3A 1SHWA 1CDHA 3LNIA 4AX3A 2X4SA 4CJ0A 3CFCL 3H3KA 2ITFA 1YPZE 3DOSA 3HNVH 4NQCA 4B97A 1B90A 3NJXA 4PCTA 3MJGX 5F3HA 2Z8WC 2G60L 1KIQA 2G5UA 2HJKA 4GI6A 4KI5C 1D9KC 5JIIA 1YEEL 4OR1A 2JCCA 4Y4FA 1OSPH 2CUIA 2E27L 1IAOA 4XT1C 4JGMA 1KNOB 3FQWB 4YGVA 1NFIB 4HIPA 3FB8A 3SOBL 2ROXA 4D3CL 4DFIA 3BH4A 4WLCA 1P1VA 3HE6C 5ISZB 1H3PL 4G3YL 4Z0BH 2AHIA 3SQOL 5MERB 1QASA 3D33A 4GKNB 3V10A 3BO8B 1AZVA 5FM5M 1CICA 1TZGL 4WHTB 5ANMB 4ZO9A 5SWSE 4J39A 1BYNA 4PP1D 1PCXA 4FXKB 4S0TD 3UO1L 4ONFL 3WL9B 1YNLL 4X6DB 3VXOA 3HMXH 3MUJA 4U1HA 1BG9A 3OAUH 4TOYL 4YFLI 3ALPA 4DPBX 3HZYB 5I16A 1HE8A 3L48A 2OMTB 3KEHA 1G6RH 3P77A 3KJ6H 1QZNA 3TV3L 2RFXB 3M1BB 5T1DH 3FFCE 2KHAA 2JB6B 5IWLA 3C60A 3K0YA 3NCJH 5KVEH 3QAZC 4U6VH 2BXYA 3EHBB 4KI5E 1WPCA 5TD4A 1T04B 3X3FH 3QI9C 3TH2T 3GI9L 4XCEA 3OSVA 1O6VA 2NNCA 1FFOA 4OFKA 4XXCA 3BVWA 5SWSA 1K2DA 1T2QH 2L4OA 1F4YL 1T7YA 1ZANH 3MRNA 4C56A 4ZZKA 4HZLB 4J3OG 2XBTA 4AQ1B 1DJYA 1CTNA 1U8KA 4IRSA 2G3XA 2NR6D 3HAEA 1DDTA 4P49A 3W0WE 1V05A 3EDJA 3LMJH 4HEMA 3PHOA 3V5DA 4LLWA 3C6SA 5B1JA 3GSXB 2ARJB 4ODUB 2R51A 4Z78B 1FLTX 3BSGA 3LRKA 3U2JA 1EHLL 3GMRA 4B6ZA 1EEZA 3GZOA 4XPHH 4AQ1C 4QXUL 4P5KB 2W5PA 3FT3B 4HS8L 1NOLA 3ZHDA 3TZVA 3G04B 4FX5A 1JFQH 3BQUD 1HH9A 1PCSA 4HUUA 3U0PB 3FT2B 5K9QI 5IW1A 3ARFD 4FG6C 3UPRB 2W80C 3FQUA 5K39A 2OTWA 1UZ6E 3WSQH 5I1HH 5AG8A 3QAZB 3UAJA 2GT9B 2GJ6B 3WTWA 1QSFD 2CO7A 1JI1A 3U7WL 5A3IC 3RZCA 1XH0A 3NP3A 4R5VA 5E9DD 3IXTB 3S34L 3S36H 1VAHA 3BAEL 1X5ZA 3WFDH 2X7LA 1CL7H 3QFJE 4L29B 4YC2C 2NXZD 1AS7A 1F8TH 1NFDB 2QHLA 2XV6B 2QT6A 2OMWA 1HAUA 3M8OH 5GSRA 1GOGA 5B39B 1KFAH 4JFDB 2ATKB 3D09A 4MQSB 1NCCH 1AQKL 1WF5A 4WTQA 1XFPA 4HHAB 5AW2B 3K6OA 4AV0A 2EIKB 1FAIH 5T1MA 1H3XA 4F5CE 1KB9J 3LZQA 1F56A 3V0EA 5E23A 4ZT1A 1X5KA 1SYVA 2D7MA 3LRHA 2E7LC 2DWDB 1OQXA 2XKNB 4YFDB 5IVXE 4K94L 4BFNA 1SQMA 4LLDA 4NUQA 1RK0A 5KYWA 3K46A 4I0PA 2DQCL 1Q72L 2WZ5A 3MNVB 4BRJA 2NZIA 1L3WA 2NY0C 3B56A 4UV7H 3VH8B 3F83A 2CBQA 2UV3A 4JG5A 2YSTA 2ZG2A 5KUKA 3M8OL 1J5IA 3TA4D 2WZ6A 3KPRB 1BM3L 3GC3A 4D9QD 4PJDB 3LN9A 4RQQB 1QABA 3MRQB 4U1SB 4JPIB 4M7LL 1A4JB 5EDSA 3W82A 2DMCA 1QRNA 5EEWA 1JE6A 2OJEB 3O8XB 3V0GA 4Z7WB 1M7DB 5CBAB 2WO3B 4DKEH 1KJVB 2Q3ZA 3ZQXA 3VMOA 2XWBA 1XR8A 1BXVA 3SDCA 2SEBB 4K8RD 5DZOA 5C07D 4PRNB 3P11L 3QIWC 3T8XB 3WEXB 4JO1L 32C2A 4Y1AA 4HX1B 3E3QE 4DW2H 3VD1A 1OARL 2A73A 4LCWA 4HOMA 3PGDA 1YEJL 5DD3L 2AJVH 1INQA 1FN4B 2ZX5A 2XOTA 3EFOA 3DGDA 4N0YH 4ZJ9A 3GQFA 3VU2A 1YEKH 1NCJA 3VXPB 4JY4B 3G6JB 1FVCB 4DGUA 5DDHA 4UV4L 1IARB 5E6SB 3H8NA 3VDBA 1C7SA 3C09C 5IQ9A 4PJIE 4G3YH 3QJHA 5CZKA 3S2AA 3MLUH 1KUMA 1RQ5A 1NC4D 5ALBL 1BFVL 1SVZA 3KR3H 3PQYB 1KENH 4P06A 1ERNA 2QSCH 3O2DH 3Q7JA 5DJYA 2BP8B 2BNQE 1DBJL 4C83A 4A37A 1HDMB 1DE4B 1JMXA 1MNUH 3QW9A 2OX5A 2IQAB 5SWZA 3W1ZA 4JFVA 4X2UA 1ACYL 4H2CA 2PW2B 2CUHA 3BX7C 2J1ZA 2FR4B 1FE8H 1G5GA 2WOYA 2XZQL 4QOKE 4JG0L 3IWVA 4A6YH 2NZ1A 3L6FB 3VFMB 4KROD 2FWOA 4TSBL 1ACZA 2FYYA 3OZLA 2A9MH 1QKZH 1W0VB 2CMRH 3LD8B 2X4NA 3ES6B 1YEDB 2QFRA 3CZFA 4JPVH 1WT5A 1DSWA 4MNHB 4WEBH 4ZS6C 4HDIB 1PYWB 4CC1A 4YHLH 4TTGA 4MQ7A 3U30C 5E70A 4ZTPL 4WSKA 2PCPB 3QJVB 5CO1A 3OWRA 4JB9H 4CA4A 2XWCA 1HVXA 3TN0C 3IKCB 5EDXA 2WBKA 1DN0A 4KBPA 3BPLB 4Z7VF 4HXBH 2A74C 1XF4A 3RVWC 4J3XA 4MJHA 4XBGB 3TH4T 4TQEH 1GMEA 5CSBA 1HHJB 5IJCC 4TNVK 5MENE 4FQJH 3BXNA 2DQTH 1PLGL 4M7LT 1QNZL 1MREH 1PMYA 1NGPL 4NUMA 2RQEA 1F86A 1RJZA 2H0PA 1ZEAH 1C1EL 1BFTA 1KYOJ 3PJSA 1UB6A 4KK9C 5E2UL 5B1BB 4AT6B 3O4LA 4GRLC 5IKCB 3QYCA 4N68A 1XD0A 5DMYA 2NTFB 4P2YA 4LHUD 3TN0D 5F9JB 1HZKA 1GIGL 3LRMA 1T6VN 4TUOB 2VRQA 1JNHB 5E1AA 4JAMA 1J9RA 3OHXA 2XQ0A 2NT0A 3LRSA 3C5JA 2E4FA 1IC1A 4FQCH 4U1IA 2C9VA 5AVWB 2G0KA 4WI6A 4DGIL 1QNIA 3DSFH 3B5GA 4N2LA 4FDWA 2NY3C 3LVEA 1QLEH 2Y7SA 3ECQA 3ZY7A 1E2ZA 3WNJA 3U30B 4OGYL 3GRWA 3TNMB 4JJOA 4XBEH 5CJQH 4AIOA 1R24A 4X4KA 1HL8A 4EKJA 1KJVA 3ARGB 4L0YA 3C08L 1Z9PA 1HINL 1YNTA 5LG1A 1BIHA 1CICC 3N40F 2VW7A 4JDVA 5E2TL 3EO1A 4NC1C 2WNWA 4HT1L 3TVMC 1OGAA 3U9PH 4XH2A 1G7MA 4NSKB 5D93C 3L3HA 3U46A 1NOAA 4HJSA 3ZTJG 1MRFH 2C1PA 4W4NA 4JZJB 3NA9H 4F93B 1DCEA 2JIXA 2Y72A 3IXAB 1YJDH 2H32A 3VFVB 1INQB 1GJWA 1AQMA 4ZUWA 5FDYA 3VXSB 1PX4A 4V1DA 2XWTB 3BQUB 4MNGB 3ARFA 5DRWB 3VA2C 3IMSA 2FWLB 3QI9A 2VUOA 1BVOA 4AYMC 2Y6TE 1BZQK 3E8UL 3T2QA 3A24A 3EYQD 5EO1A 1AQDA 1UA3A 5F7AA 1JI2A 5D5ME 5MP6H 4EN3D 2FL5A 3X11B 5EC2A 4EZMA 4AGQA 3DX8A 5DZAA 4XOCA 5JHBA 4W9IC 5EUOB 2NY4D 5GRJL 1CLZL 4KY2A 4PI2A 4HULB 1O7VA 1ZTXL 3H3PL 4OFYA 5E9DB 5D7KE 3F85A 4LLUA 2F08A 1KMGA 1HH6B 1HIML 4NQUA 1N5AA 3RUGA 1NBVL 4DP2X 1TU2B 1WQVT 3BYTA 3CZLA 3WV0A 3QUYD 3MR9B 2ADFH 3ML8A 3Q2LA 1J8HB 2DD8H 4U1GB 3ORJA 2BC4A 4PLKC 4W68A 3RKDC 3KLSA 4KUZL 5JQ6L 3QEGL 4KX8A 3JV6B 2NYYC 1AQKH 5CIPA 3W9EB 2O5XH 4HBCL 1V3KA 2YMTA 2HRHA 3HFML 3VNZA 1IMHC 1RULL 1VFBB 2CXKA 3L4YA 2X38A 1S7UB 5DSCB 3EH5B 4XO4A 1UA6L 1F42A 2Z64C 2XG5A 4KJYA 5IF0B 5C0BA 2MTAA 4RGMB 1A7NH 4M6NL 2WZPD 3G08B 5BXFA 3EYUL 2JVUA 3HR5B 4I9WE 2E59A 2EDHA 4X6EA 3OKEA 1CFVL 5KSVB 3DETD 1GKOA 3FCSA 4TMPA 4YPGA 1P9MA 3PHOB 3RZCC 4DOHE 1UM5H 1X7QB 1KLGA 5EBGA 2CZNA 4YZWA 2XWJA 4AVHA 5AVSB 2R56L 1FQ9C 1XO8A 3TJHD 2X1PA 4U2ZA 1F4XH 4GRLD 4BZ1H 4IOFD 2TSBA 2Q6WA 3JUYA 1C12B 3FQNA 1LVEA 3QRLA 4IIZA 4Z0XA 3ZTDC 3OKOB 4HPYH 1IGTA 4LIQE 5D71H 3OC8A 1MI5A 4CDGC 1IL1A 1DVFA 1DJXA 5I1KL 4S2SA 3ABKB 3HMWL 4P23A 3SO3C 3EFFB 2YUZA 3Q0HA 3F6LA 3S9DB 5BPPA 3ZL2A 3QXUA 4IOFC 3WY2A 2HKFL 4LARL 2WO2B 4FQLH 4KXZH 1K5NA 2X0WA 6TAAA 3RVUD 5HPOA 3ISRA 4LHQB 4MD5B 2IALA 2B0SL 3ZKND 3X1GA 3UCQA 3WN5B 2QPEB 3RWHA 5DMKB 4ZQTA 4PJXA 3E0GA 2F5BH 4X4XA 3EOAB 4NO2B 1H3WM 2N0MA 2QVKA 2X87A 1XHHA 4Y2LA 2F58H 4W6WB 3RFRA 3VGDA 3ESUF 1M05B 3CVHB 2BM3A 5FYKH 2ITDB 1DLFH 4XWGL 1H0DB 3QQXA 3RB5A 5J1AA 2VQ1A 1ID2A 1G7JB 3QWNA 2BXZA 1OL0A 5JYMA 2HLEB 4GMSH 1KY7A 3RAJL 1RMFH 1MCBA 4HYTB 4LAQH 2Q10A 3VX0A 5EU6E 3DNKA 2VLRB 4TNVF 2EC9T 1W15A 2X4NB 3ES6A 3WBDA 4QNPE 4CVZA 2NNAA 5EBWB 5LAPA 4MA1B 3MA7B 3GPEA 3DUHA 3IDIA 5TF1H 5E5RB 2XACC 3QIBC 3IU3B 5T5NF 5I8CB 4G9FE 5CWSA 4GRWB 2XYCA 3IJYB 2JMRA 4U05A 1NGXB 1P4BH 4WGKA 4LSRH 4K5NA 4PGCA 4NUPA 1YMME 5E1QA 2W9DH 5F88A 2F8XC 3TXAA 2DQGL 2WPGA 2BJMH 3Q44A 4PJFF 5LCVL 3SDCB 5MEQA 3OQRA 1XGQA 2WZPA 4CN6A 1DQIA 5FO8B 3DSNB 4RAUB 3IS0X 4Z76A 5KEZA 1LM8V 3ARBC 5AVRB 4F7MB 5DQJB 1A6VH 4YVUA 2N1TE 3ETSA 2F1BA 2OK0H 5TTRA 1KLFA 1EO8H 1YEKL 2JQMA 2NNFA 3ATFA 4TXVB 2DQFA 2EO7A 2X4RB 5DA4A 4LT7A 5SWQB 2OXGA 5BRZB 1NDMB 5F1OB 3B3IA 1Q9OB 4Y16B 4ZFOB 3DDGA 4OW6A 3GMNA 1RVFH 1DVYA 1RJLA 3F8UB 5EV7A 5IG7B 1V7NL 4KI5D 4XX5A 4N28A 4J7RA 2JF1A 1CL7I 2YPLB 5FV1L 1OK8A 1GHFL 1TPXB 3DHPA 5SX5H 2R0WH 4B3VA 4DJMA 1A9EB 1FO0H 1BAWA 1C12A 1WZAA 2IXQB 3KEDA 1TTGA 2WXNA 4M4PA 4PUBH 3BFOA 4AYDC 1QPXA 3H3BC 5L2JA 1S7XB 5TK4A 4L3FA 2DQHL 5TQ0H 1I75A 1LJMA 3ULSB 3NCYS 4C56B 5DJCA 1YG9A 5J89A 1F6LL 3SKJL 5ETUB 4RMUA 4GSRA 2AJ3A 2V5YA 4MD4B 1QLFB 1S2EA 5J0BA 4G1MA 5EEUA 5I1JH 3MV7E 4NQVB 3RZWA 4QEGA 1DEEA 4GW1B 4PJ9A 1RLBA 4PRPD 2W59A 1HHGB 3MZTA 2KLRA 3HAEG 1GZPA 3VFRB 2XZAL 3G5YA 4XNZB 5I6LA 4GW5B 5F96H 4X6BA 3ECBB 3CCHB 2DICA 4BRVA 5CHNB 1IGFL 3DV4A 5EWIH 1TF4A 2ZAHA 2WC7A 1EMTL 2GSIA 2HLFD 3BT2L 2QPUA 3B9KB 2CAKA 4X5XB 4XB8A 4GBXB 1YYLH 3NESA 4CN4A 4KNQA 4Z7OF 1J12A 1ETB1 4Z9KB 1E5CA 4OI8A 3O8XD 2LABA 5DMGD 4ZQKB 2RAMA 1BBJA 3MRPB 2YR3A 1G7JA 4LEXH 4XI5C 5DHVA 5KVMC 2WM0A 1ES0B 1PG7L 4OJDH 4E2OA 5IHBA 3HG1D 3GHBL 1CE6B 3AG4B 2EDLA 5A2BA 4G9DA 2FGWL 5E2WL 2WJ7A 3ZZLA 3R0MA 5ESQA 1DJHA 2AEPL 1BX2A 4BKTC 5HYSB 3FN9A 4RAHA 2ATPA 4KNUA 1BQKA 4K94H 5EPMB 4CVZB 2RD0A 4LSPH 3V7AG 4UB0L 2OZ4L 5IBLD 5E08L 2V5MA 4KJQC 5JPMC 1GL4B 2WTRB 3D3VE 3EGSB 2HKFH 3FS9A 3VO0A 1IAIL 2NY4B 5IK3B 4FEMA 4FMKA 4PLNC 5I73B 4AJYV 3T08A 3VFUB 1Y6NR 3V6ZB 3NIFE 4YDLC 4EI5D 3RIFK 4G5ZH 1IM3A 1KT2B 2OMZB 1OSZB 5FECB 4R2GD 3ZRFC 4BFGA 5L2KA 2KI6A 2IDQA 2D3JA 2MEJB 5PAZA 5L8JB 1X4ZA 3IJSA 3HS0B 1NKOA 5I19H 3BVVA 5DJ8B 4QRBA 4AVJA 2DW5A 3DWTA 4OZFB 1ZTXE 4N25A 2O5ZH 1FPTL 1E30A 3GNML 5I8EB 5C0FB 3PLYA 4NBXB 3SJVD 1NFAA 4BZ1L 1ED3A 2HWZH 5GJTL 1X5FA 2X1QA 3JWNH 3RYMA 5H37H 2A6DA 3V4VB 1T89A 4DT2A 4POYA 1AGBB 1N8ZB 3ZN6A 4RMWA 3ZKXB 2ADGA 1NANH 3PHAA 2DKUA 5KJRL 6CGTA 3DX9A 3CJJA 1K5NB 2JCCE 4M29A 3W2DH 2BSCA 4DP0X 1NGZB 3VRJA 2CGZA 5IEKA 2OMUA 5JPMB 4HX1A 4OJYA 2FLBT 4FN0A 3Q2NA 4Z7QF 3MMEA 5AAMA 1GS8A 1XXFC 2BZDA 1RZJL 3AC0A 4OLUH 2AJSL 3VDCA 3ZT6A 3PGCA 3J07A 3PL6C 2W38A 3JYCA 3LZOA 4X50A 5TQ0L 3OZ9L 1Y0LA 3EJZC 1RZQA 1YY9C 4P23C 5IREA 4K9EH 3GI8L 3O6KL 1BF5A 3DX6B 1XGTB 2HJLA 3I2CH 3O45B 4NM4H 5HGHB 1AJ7L 2ROYA 4HUVB 2G75B 1TZHB 2HH0L 5F2FA 4TUUA 1YECL 2CJUL 1DO5A 1QUPA 3G08A 5BXFB 5C70A 4KOBA 3E8UH 1DR9A 4M02A 4Y5YB 4F7KA 4M7KH 4FOMA 1CLOL 1WAAF 3TBYB 3H55A 4LOEA 4HG4K 5AAWC 3TASA 1BHGA 2ZOWA 4FTVD 2Q3XA 1ZHBB 3QO1B 4Q2ZB 3FOMB 4AQAA 2YD0A 4JKNA 2HRGA 1WG3A 2HFGL 2XTJD 5M95B 4ZTPH 1L9TA 4DN3H 3V6FA 2ZKWA 3ZYIA 1SMAA 4MZ3A 3A67L 1Q9KA 4WWOA 4KKRA 4Y4HD 2GTWB 4FA6A 1TITA 1ES0A 2V3FA 4R4ND 4BE5A 4GXVH 1DVFB 4CU6A 3OC5A 3RHWK 2ESVE 2XX1A 3MREB 3O41A 1E90A 5KBMA 4ZAKC 3SE9H 6PAZA 2CUMA 5ACZA 4Y88A 1N6QH 1ZVNA 4ZPTB 1E4KA 2KLTA 4UTCA 2W95A 5L88L 4J2XA 1E3FA 2YC1A 3G3LA 1F4HA 1T7WA 2BMKA 3ARRA 3ZTNH 4HJEA 3QCVH 4LNVA 4XZUA 3UTSB 4EDWL 4G6KL 1VZIA 5I1AA 4YOKA 5FWRA 1MWOA 5ILTL 3GJFH 2GI7A 3WHE1 1BEYL 3B2UD 1OP3K 1GKEA 4KKLC 4A2FA 2J21A 2WBXA 3FUEA 2DKMA 1MCQA 2R2HB 2VDRB 1EGJA 1NAKL 1RK1A 2CNYA 5E4IA 5JW4N 5I8EA 1TT6A 3RPIB 5D96B 5C86A 1SPDA 1N64L 2H3NA 2NRDA 1A6TA 3Q2WA 1JL8A 3GSQB 5IB3B 3FBKA 1D2PA 1RZPA 3FFCA 3FH7A 1OCZB 5E8OA 5MENA 4QRQA 1G7HA 3QEGH 4FE9A 4LSQL 3DOHA 5C3LD 2CD0A 4NJAH 4J4PC 3RNQA 3IU4L 1V3JA 4NRYB 2YPVH 3DJZA 4W9LC 3GLEA 2AS5M 2BNUB 1FC1A 5HBBA 5I1HL 4NNPH 1P7KB 2OMXB 2HTLD 3PDOA 2EDEA 3EYUH 5I0YA 1ZIBA 1OQOA 5B39A 5IHZA 4LPWA 5C0BE 2NXYD 3MJ8A 5D7LA 4XI5D 2YUXA 4D7PA 1A02N 2GB2A 4A2HA 4G7RB 3QNYA 3GIVA 1AXSB 2H4EA 2XQBH 3P3YA 3QJTB 3SO3B 3VXNA 3LKOA 1ADQH 1RZKH 3LXCA 3I2CL 4PJXF 3RVXC 1IM9D 1MFEL 1HNYA 3G5XA 3CE1A 3DPDA 2C1OA 3QVAA 5I17B 4CADA 5F7FA 4FJYA 3H4HA 4CW1A 2A7BA 1T7VA 3CHQA 5I1GH 5CBEA 3F7VB 1I9EA 4CSZA 4MA3A 3PFUA 2BSED 4EDWH 4YSCA 3EIFA 5KVFH 2R1YB 3BSZH 2AXJA 2ZAGA 3RY4A 1MSPA 4F91B 5EN2A 2BOLA 4JDTH 1RUAH 1WAAE 4DP1X 1HC1A 2OYKA 3MODH 3SPCA 3KM2A 2FNBA 4F20A 1L9NA 4JR9H 4V11A 1UD5A 4QRAA 2YIHA 3S3SA 2JCCB 4Y4FB 3WIAA 3EO9L 2OULB 3TL5A 2JKIS 1NLBL 4LOVA 2CLZB 4S1QL 3BW9B 5JIKA 2WSDA 4CGTA 3HR5A 1PS3A 4LLAA 3I9GL 3KBFA 5HHMB 2P8MB 4KZEL 1H3PH 4NQVA 4QXWA 1NCNA 2PWGA 4DNLA 1JXJA 4K2UH 3I3BA 2DJ4A 3SE4C 3K6DA 3D4GA 2IJ0C 1WAEA 4K5LA 2E75C 2PETA 5FHBH 3HBPA 1UTDA 4NZUL 4M61A 4S1SL 4Y19B 4KAQH 1F0LA 1E8YA 3O11B 1CFQA 2EDWA 5IQ9B 3M1BA 1BAFL 2IG2L 3IJHA 3QDAA 4YDVA 4PRHA 1CD1A 1ZS2A 3DPBB 3DUSA 3U7YL 4PVBA 2FT7A 1OF0A 3WJJC 4OF8A 3SCMC 2EKJA 4YXLH 3VYOA 1SM3L 5BV7L 1SXCA 1XH2A 3QC6X 3AW5A 2HFGH 2XY1A 3PIQB 1R3HA 2CIKA 3MTXA 5DHXB 4OD1L 2HKHH 4GG6B 4DCQA 7FABL 4HVBA 3B9VA 3FJTA 4L8BB 3EYSH 4BQ6A 3BZ4B 5G2NA 5IHHA 2MTPA 5LGYA 1E7UA 2WVUA 1YDPA 5DRZB 3UBXG 4KROB 1UD3A 3BUYA 4LQ1A 3V5DB 2ZOOA 1PIGA 3T0XA 1L7IL 4RWHA 4L4VD 1NC4A 3C5ZC 3BSZL 2KS0A 4X83A 1P4LB 2VM3A 5FHAH 4KC3B 3D39A 5FGBC 4IKJA 2YXMA 4RRPM 1XF2B 1EMTH 2WKOF 2DQUL 1AGEA 4IS6A 3Q2VA 1Z0MA 3KBHE 1TDQA 3E1F1 1VCAA 1WIOA 2JKTM 3DROB 4M1CD 3QNYB 5AW0B 4MCNA 1WFIA 4Y7MA 3ETBJ 3ULUE 2OYPA 2CGRL 4OCRH 2DPKA 1BM3H 5DMIH 4XC3L 2PUQT 5D6CB 1U9KA 2AXGB 2UXFA 3FPYA 2E9JA 2NQCA 3LHPH 4KKBD 4DGYL 4DP7X 2JSFA 1WCBA 2C1OB 5DXWA 2ZCHL 5D1QA 3NQIA 4TULH 2P47B 2ZJSL 3CQFA 5DR5L 1KBBA 5C09A 2B3IA 4PMEA 3WUWA 4OSUH 4UB0H 4H1LB 5E08H 5JOPE 4PJFA 1G1KA 4XZUB 3MLWH 2OSWA 1R5WB 1A7OH 4KHTL 3UTSA 5I75C 1AHMA 4NZFA 4NWUL 5HVHB 4FKKA 1EAQA 5BJTA 3ARGD 5IB1A 3SODB 4W70A 1ZT1B 1S7QA 3QPXL 4ZW7A 1E42A 4JR9L 4RAVA 4HIHA 1DQVA 4G80B 4GBXD 4BSVB 4YEFA 1G5AA 2OMVA 2R1WB 5LWYL 4P9HH 4NQSA 4M6ML 2XQYG 4ONGL 3VI3B 1BMGA 5DHDA 1S46A 1V55B 4M9OA 4KK5C 4WCYL 1M7UA 4WFFD 3G6AA 3KJ4B 5CLXA 3D3VB 5F7DA 5DUPL 4XXCC 3VDAA 3V0IA 4ZUWB 4H4NA 5EC1A 4HIIB 4ZFGH 1G7HB 3KS0J 2NY4C 5PCYA 3SKNB 4OIBA 4YFEA 5ITFB 4DIXA 1OPOA 2XI9A 1EUUA 3OLDA 3MBEA 1DE4A 2QSTA 4QTFA 3TFKD 5JIHA 1DDHB 1RP8A 4U1KA 4M8RA 4WW1B 3SQBB 4KAQL 2VR3A 1Q0EA 2LTQB 2OMYA 4LSTH 5BMFL 1XTMA 4XNDA 3RFZB 3V95A 2HUHA 4KFZC 5EB9A 5FGSA 2H41A 2ZCZA 4UOQA 4YXKL 3DTDA 3HS0C 3TCLB 3WLWC 2BRRH 3EH4B 2AF2A 5FGCB 5HVHC 2YD4A 4NRZA 1FNGB 4MWFB 5GPRA 1JBJA 1M1SA 1S5IL 1FVDB 1YRKA 4JX0A 4NO0B 1C5BL 1CMOA 2DS4A 4MQ7B 1H9VA 5D1XC 3T65A 5CMAA 5ESVA 4A39A 4WK4B 5EBLA 1OM9A 3NZHH 3IJEB 1G7PA 1EERB 4UOZA 3KGRA 2DIBA 4WO4B 3SY0A 3FAWA 2BOBB 1IFHL 5GXBB 4P3DA 3U2IA 3EGDB 3MVSA 3AAZA 1TMCB 4UINL 2AV7A 1NIBA 3RY5A 2VE6B 4LFHD 3QA3A 5I82A 2BDNH 4MAYA 1PDKB 2YJQA 3RDTD 3O2VH 1G6RL 1MIEL 2NCMA 4LNRB 4F8NA 5D2NA 4LRNH 5DFWH 1UJ3A 2X3CA 3NSJA 5EU5B 1T1WA 1JERA 3NFPB 2H3XC 5CJXC 4PV9A 2NY2C 3D25B 3TCXA 5CF3A 5IV2A 1OP5K 4AJWA 1FFOB 1U6AH 1H6TA 3UG5A 1KB5B 3U7YH 5C9JA 3TH3T 2DWEA 2HMID 1D5MB 1X5MA 2KT6A 3LNFA 1H3UA 4NAJA 1LE5A 1Z9MA 2A4ZA 2W81C 2ZXQA 5FV2A 1JAEA 2R0ZL 4U1JB 3ARGA 3O2VL 4PB0H 5H4YA 4NYLA 2J6EH 3BKCL 2N1KA 2Q8BL 1A47A 3L3OB 4MNQB 5FCUL 4ZMAT 1E9QB 5KG9A 2EADA 1HHHA 1ZSDB 3SSGA 1A3RL 3QO0A 4Q9RL 3SE3C 4KVPA 5T5NG 2PCYA 2Y07H 1MY7A 1AE6L 4ALAL 1G0YR 1WO2A 4OZGA 1ESOA 1FC2D 2TSAA 5GGRB 4PJXB 4QHPA 4ZMTA 1AGDB 1A7BA 2BS8A 5E1IA 3WGVB 1MHHB 3OR6A 1JGLH 1R5IA 4U6XA 3WXWH 3ZTCC 1QFUH 2XA3A 3SYPA 2EEAA 4WV1C 2GJ6A 2VDRH 1P5VA 1QBML 1VADB 3RVVD 4L8SC 2PO6A 4O9HH 2E27H 1OSPL 2APXA 3H9SE 4XO5A 4GG6A 5MI0C 4QOKA 1MJ7L 1TQTA 3ARPA 3ARUA 3IFPA 2DDQH 2QSCL 4OCRL 4RSYA 3TA3D 2HLAA 4EMZA 2VXQH 2JJSA 1MG3C 1BJ1J 1E9PB 2ZPKH 3QEQB 3UTTE