3RLSA

Crystal structure of yeast af-9 homolog protein yaf9
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
152
Chain Sequence
IKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSLERPHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast AF-9 homolog protein yaf9
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Protein AF-9 homolog
total genus 25
structure length 152
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rlsA00
3FK3A 2NDFA 5HJBA 5D7EA 3QRLA 5HJDA 3RLSA 5IOKA 2NDGA 2L7EA 4TMPA 5IQLA
chains in the Genus database with same CATH superfamily
4KJWC 1KYFA 4L3EA 4UMGA 2OX5A 5G5DB 3FUHA 4H8HA 1T83C 1GKOA 5D93B 4YQXH 3MLTB 3JUYA 5HHMB 2Y2TA 3QPKA 2EC9T 2IAMA 5LQBH 3X13A 5LDSA 4HWBH 2B2XH 4B9JA 4HG4K 2F8OA 2X0VA 3X11A 1YEEH 4YHYC 4AH2A 2DM7A 3N9GL 1IZKA 5F7MC 1QFUL 5T5FH 2DBLL 3SD5A 4Y4FB 5D1XB 4LOEA 4S2SA 4A6YL 5GS0D 1PX3A 3SPCA 4KKNA 4Y19E 3QZPA 4BQ9A 4OF0A 1J0IA 1NCAH 3V7AE 4ADJA 1GMEA 4Y16B 1HE8A 1NAMA 5D96B 3SKNB 3V55A 5KBNC 4MJ5B 1UB5B 3VFVB 2I9TB 2K1MA 1N59B 1ZDSA 2VXTL 3WFCL 4KK9D 2V2XB 3W9DA 2XLLA 3AWEA 2EDWA 3DO7B 2JSFA 1BJ8A 2OL3L 1T2QL 3T04D 5AALA 4WV1B 2NY3D 2O6EA 3WMSA 3RAJL 4TOYH 1ZK9A 2VDQH 4PRIA 5EF2A 3T6WA 2QQKL 4K94H 1I1RA 4PCKA 3WSQL 2VXUL 4BFBD 3D39E 4LO9A 1S7WA 3KHQA 3HHRB 1BM3L 5IOKA 4OM1H 4HWZA 1YECL 5HYQA 1SBSL 2QGDA 2NY0D 4TSAL 4QEGA 1WC7B 4NM8L 4LP8A 5I71B 4FS0A 3MNWB 4YE0A 5K33A 3C8KA 4PRPB 4X7DC 1WAAF 2Y22A 1BJ1H 4PI2A 3TNNA 1H6FA 4Y16D 4JHWL 4JM2F 3UAJA 3L5WA 3BFOA 3WJMB 2B9AA 3E2HB 4WO4D 3MLVH 5B8CC 2OJZL 4PD4K 4HX1A 3NQKA 5JNYA 1Q0YL 5EC2A 1E4KA 3BPCB 4L8SA 2GK0A 3AS1A 5KYXA 3UPCA 1NCTA 2JKTM 2YD8A 1FAIL 4PB0L 3APNA 3WFBL 5JZ7C 1MW2A 5DDHB 4MAUL 3HJ0A 1SVCP 1UH4A 3WNJA 5CSZA 3LXAA 4NKQB 3S7GA 4P9HC 4Z8FH 3FO1A 2EZ0D 3P73A 4M5ZL 3WHE0 2DIBA 3QS2A 3BO8A 4X6EB 3RX8A 4NJAL 3VA6A 1DLHB 3ULSA 2AEOA 5EF0A 4LGPB 3TT3L 1CZ8H 3LZFH 1A6PA 5C6TH 3I3EA 2BC4A 1KJ2A 1M6OB 4XO4A 4MHHI 2Q6WB 1G1KA 5ICUA 5I8OL 1JHTA 4JR9L 5ISZD 4F1SA 1BQRA 2WYZA 3AC0A 3V5DB 4F33A 4L29A 3W2DL 3T1FA 4MA3A 4XWGL 4YHOL 5BUAA 4DKFL 5GZOA 4AMWA 3BRFA 5JPMA 2BVQA 5ALBL 4U1NA 4QWWD 5B22A 4KRMB 2J1WA 1HINH 1QKZH 2CK0H 1H0DA 5L8KB 2VL4A 4HJ1A 2YQGA 2Z35A 3BFWA 2WCGA 1ANUA 4FLHA 3TBYA 1FZOA 4MZRA 1U36A 4BBWA 2N1TE 5HD8C 4X7EC 1T0MB 4CU8A 3EFDL 1CS6A 1E50A 1NMCC 2AXFB 2Q20A 3K2UH 3POCA 4J3TA 4NFBA 2EDXA 1DDHA 4E42A 2V5RA 4XOBA 2XPGB 1XR8A 1T5WB 1SY6L 5IR1B 1ZLEA 4JFFB 3RGVA 3ZYJA 3BFQG 4RMVA 2VDPB 1R3KA 2RCSH 2R0WH 4OI7A 3RPBA 5DU7A 1D5XA 1N5AA 1HKFA 4OTXH 2PR4H 3PE9A 4YLCA 5LKNA 5FLUA 5F8RC 1KYOK 2H1PH 5MP6H 1FQ9C 5IUCA 2ZKHH 2WAQA 3KR3H 2WSKA 1HDMB 3KYNA 5E03A 1TT6A 3L4WA 3D50A 1IM9B 1GOFA 2DM3A 5JDSB 3T6QC 1B6UA 2NNCA 4P4RA 4YUEL 2H47C 2OI9B 4JKPH 5TH2A 4RBPH 3VFMA 4YZFE 1YQ2A 4OCRH 2FT7A 4X5WB 3KEHA 2WWKT 1GC1L 2V8LA 2WIIA 4N2LA 4JFQA 2V8MA 1G7JA 5EPMA 3GS4A 5IW1A 1MJ7L 15C8H 2WXFA 4I3RH 3UBXB 3ZTJH 3WIIH 4BYHA 2R0LH 3ARRA 3KCWA 5DT1H 3UCRA 3TURA 1T22B 4TQ8A 5FCUL 3BZFB 4J3BA 4E9LA 3EJUA 1B3IA 1BMZA 3QDGB 4HJEA 3NSXA 3I84A 1IBGL 4UINL 3CHOA 3RKDC 4ZMYA 3MV01 1CLZH 4ZQKB 1L5GB 4EIUA 3VYPA 5KVDE 3E3QE 3RY5A 3UBHA 2J72A 3VXQB 1B2WL 5KG9A 4CN6A 5JOPE 1HAUA 1RFDL 4NM4L 4BFIA 1OAUH 1CZ8L 4BZ2H 5GGRB 2EIZB 1MOEA 3KYOB 3RUGB 3IVKA 1IMHC 5LGYA 5D9SA 5DRWB 1SOQA 1A64A 2B08A 1M7DB 3J8F7 4N8VA 2G60L 4ODHH 1TEYA 2BNRD 1XGQB 5K9QI 3MKKA 4HLZH 2C3XA 5EOTA 4FQCL 2DMGA 4PJ8B 3Q5OA 3FO0L 3QCUL 3L4CA 1KDIA 4IOFD 3BISA 3PNWB 3S96B 1VPOL 2GUYA 4KROB 4MMXB 2CKBH 3BAWA 1IE4A 3SOBL 1IV8A 3VWJB 1JK9B 5F9OL 4WI5A 5J1TC 1FL6A 1S7XB 2CH8A 5BZDB 1NC2B 5E9NA 2YAHA 2J5LC 1SXBA 3BVNB 4A2LA 5D1ZB 4H20H 1PSKL 1RUML 2QBWA 4E9WA 1UA6L 4UIKL 3OMIB 2OYPA 4CNIB 5F72S 2E3VA 4NAQA 4NM8H 3G5YA 4IIQC 2C7FA 3RDTA 2YPVL 1J10A 1ERNA 4CAGA 3AT9A 4BZYA 3CDGA 3FT2B 1GZQA 1D9KB 1S3RA 3O2DA 3WTVA 2AV7B 4RMQA 4YC2B 4Q6IC 3RL1B 1KPRB 5EEXA 3QEGH 2JKRM 5FOBA 1H3VA 1I9IL 2MCPL 3FO9B 2EEFA 2OXGB 4FZEL 3DHJA 4X6FB 4R9HA 3KCPA 3ZKSD 3INUH 4WWKC 5F9JA 4Z3FA 5BZZA 4Z8FL 1TJMA 1TPXC 2QKIA 2A6IB 2EXWC 4C83A 2HRLA 4J4PD 5D2NB 4GRWH 3C60B 4KDVA 4D0CA 1KGXA 3FQRA 4ZTPL 3HNTL 4EI5D 1FVDB 3C2SA 1AXTL 1T66C 3ZKQD 1ZT1B 2R8SH 2SODB 3K6NA 2O5YL 5HVGB 3FSVA 4XPFH 3X11B 4MQ7B 3SKJH 1NGXB 2DL9A 5E2WH 5DSCB 1A4AA 2BIMA 5D1QE 4YL4A 4ZAKC 3RTQB 4Q6IB 1R19A 4D8OA 1S7RA 3I50L 3U6XA 4X9GA 3SN6N 2VJ8A 3VTTA 3VFUB 3QR1A 4XMPL 1SVBA 2W65A 2X12A 3DX3A 4L9DA 5F8QC 3GSUA 5IB3B 1TCRB 2C7UB 3SJVD 5BVJB 4G6JH 4YHZH 3C5ZC 4W9IC 4TSAH 1S78D 3LPOA 3HFMH 1PFCA 5FC9A 5GRUH 1T5XB 2H7WA 1YNKL 4OLUH 1U3HC 3ZDXE 1SEBA 4M3JA 2AJYH 4EOWH 5KUKA 4IBSA 1DTUA 4QHKI 3FUDA 1Z66A 4G42B 5I6XC 3BDYH 4ANUA 4JX0A 4KNUA 1OT2A 5T33L 1JF1A 3ABMB 5FM8A 1G43A 5C0CD 4IS6B 1X5KA 1U4EA 4BFNA 3DJRA 4TVPD 5TPWH 4ENED 2EDQA 3BLBA 1KJ3L 4ICWA 4MNGA 4F8OA 2ATAA 4OLUL 3LZOA 2HX7A 2WTRB 1OAQH 4KZEL 5FKPA 5PAZA 1MKFA 3LCYA 4K94C 1BFVH 1RJCA 1OOWA 4FAAB 5AW4B 2X4OA 5EU3B 1VACB 1L6PA 4JMNA 1F6LL 1DFXA 3DMMB 3D2UA 4APQD 2JIXD 2HFEA 3CZUB 3P11H 3IJHB 4LVNC 3RTQD 4R4FH 1TZGL 3FFOA 4J8RB 5F9WB 4M62H 4YXKH 3G5WA 2ZCHL 2EVFA 4BQBA 3OKKA 3CLFH 2ZWKA 3P30L 2F54E 1J8SA 2P5WD 4Z6AT 3S5LG 1P7KA 3OLDA 1HI6A 2DWXA 1UOVA 1SYSA 4TSBH 4IKIA 3ZTCC 5L9DL 1OGTB 5K9JH 1A9BB 3EH3B 3E8VA 5CINL 1WFTA 3WV0A 4U1IB 2HKAA 4MLIA 1J1PH 1KJ2B 1M6OA 1YEFH 3DBSA 3MGOA 4UUJB 4UQ3B 3B9EA 4FFTA 3RP1A 1TETL 4PJGA 3AJ7A 1W16A 2VB5A 1W72A 2AJSL 1Q9KB 2WHVA 2P44B 1L9NA 4LL9A 2X10A 4DZ8A 5I2IB 2BVQB 2DAVA 4B97A 4HPOL 3B9AA 3BP5B 4OGAC 1BJ1J 4GXUM 1PD1A 3S98A 4DEPB 2Z35B 2UYLB 4GS7C 3W57A 4H8WH 1KYOJ 5DMKA 4XC3H 3TU6A 4UTAL 3SE3A 1ILSA 4N2HA 4PRID 4EMZA 5AVXB 3RQ3A 2C1OA 2JIXA 2F53D 1MZZA 3D2UD 4IDLA 3FAXA 4APQA 1D7FA 3RRQA 3GBML 2CHDA 4N8VB 2BZCA 5DHXB 1CLZL 1G9MH 3REVB 4HLEA 3F7QA 4P06A 1DFBL 5CEZD 3D0VB 3CN1A 4L3ED 1YA5A 2APBA 5I1LA 4ZS7L 2R0ZL 3ARBC 3L3OA 3L95A 5KVDL 2GSGA 2KZWA 4JQXC 2M1KA 5F93C 3MOAH 3O0RL 5GS3A 3U9PL 1NEZB 3IFOA 3HG1A 1WGOA 4KJWD 4KKZA 5DHDA 5B3JF 1AIFB 4HWEL 5GS1B 3WIAA 4LRNL 1KT2B 2A0LC 3H3PH 2WMPB 3DO4A 4RQQA 2CIIA 2JELL 3APMA 5JMOC 4P9HH 3VXSA 3FU7A 2JXMB 1QR1B 1IL1A 5FYKU 4WFGE 2P4AB 1QO3B 4XMLL 1S5HB 3ZX1A 4B96A 2Z64C 3OB0K 4NO3B 3U7AA 1S8DA 3NMEA 4Y2NA 5CEYA 2I7OA 3O8XA 5KJRL 2LU7A 4XVSH 1NCWH 5DMIL 3SJVA 5A3ID 4MX7B 4X9HA 4Y2OB 4ZFOA 1UM4H 2DB8A 2XQYA 4AITA 3CFMA 3DVIA 3BZFA 4ALAH 1TZIA 2FJUB 3QEQD 4QKTA 4JANA 2XYCA 2NY2D 4L2LA 3H6JA 1L7IL 1FFPA 4L4TE 3TZVD 3GSOA 2HVJB 2GK2A 2Z7WA 3MFFB 3MLZL 4P8QA 3N1MC 4ZXBA 2QSTA 1U8CA 4EEEA 1CFQA 5D1QD 5K39B 2ZSVA 5LGJA 4NXSA 3D3VE 4RGNB 1WEJH 1P1VA 2W9EH 4LVEA 4GLRI 3LKQB 2Y2WA 1K5NA 1CL7I 3H54A 3AXIA 4KFZC 1ASOA 2COQA 4A7GA 1Y6MR 3MV9D 1VDGA 1RXLA 5D5MF 3MRDA 3UG5A 2VXVL 4PRBB 3LNFA 3QEQA 4POUB 3RPIB 5IMMA 4NQDA 5CSGA 4R4BB 5FECB 2B59A 2VXSH 1BZOA 4FQIL 2LTQC 4X83A 4YS4A 1LO2L 1S3KL 3GO1L 3I6LE 1AQMA 4LSDA 4WTZA 5JIKA 3TJEH 3VGBA 2DQCL 4LLQA 1KY7A 3A3YB 3KL0A 4BKTC 2C3GA 3S4SB 4FFVD 4UT9A 1AGCA 5DI8B 5GRZA 1SBBA 2X5PA 4XHJC 3V4UL 2IGTA 4IRZA 1C16B 4PV8A 4OD1L 4XNZB 5T1KA 3LQAH 2Z31C 3DSFL 4UQEA 1JZIA 2ZXAA 1JD9A 1MCNA 1DQLL 5IK3A 1OPGH 3MCLL 4Z7QE 1L4IA 5FDYA 1DJWA 5CN1A 2V17L 4P2QA 3P77A 2X4PA 2QDVA 2R9HD 5CJOL 3SGEH 5LWYH 1CR9H 3EHBC 3GNML 3V7AG 3QQ4B 1IGFH 3H7LA 3WJLC 3TVMD 1S7TB 4HKJA 2IQ9H 2BLFA 3GHBH 3II3A 4CJ0A 1G0XA 2RJMA 3O8XC 4ZPVA 4IBVA 4QO1A 4KTEH 5LHDA 1NIEA 4ONOA 4U05A 1X5YA 1KCKA 2YEZB 2IDTA 4XWGH 1ZAGA 3EBAA 1LK3H 2YBRA 3RDJA 35C8H 2XUWA 2VXQH 1OP5K 4NZUL 1QLRA 2LLLA 5LNEA 3BP6A 5F88A 2E5EA 4JFUA 2OBGA 4PB9L 1GJWA 4LSPL 2GEQA 2R59A 2F54D 5D6CB 2HFEB 2OYLA 3GM0A 1OLLA 2EDFA 3QUZA 3UBGA 4XPGH 1ACCA 2WQ8A 3DROB 2APSA 5C86A 2BVUA 3U7YL 4EI6B 3RX9A 1FVDA 3O3DA 3GSNA 3GLEA 3UJJL 2ATPA 3GSVA 4EUPG 3IT8D 4OZHF 1B0RA 4JNXA 2DQGL 2BIQA 2GAZA 5E00B 2QHLA 1XB8A 4BFGA 4APXB 1RJLB 2AJVL 5C09B 3ML9A 1ZGLA 4HJ0C 2Y5TA 1C5DA 3Q5YA 3BKJL 2J88L 5DS8B 5IBTH 3SPJA 1GS7A 1OZUA 4L8DA 3E38A 1HXYB 4F7CB 3F84A 4JDZB 1MQ8A 1G7HA 1HWWA 1W0WA 1WFOA 4OLWH 1H9VA 2D03L 3DIDA 4FNUA 5KSBE 2DL2A 3GT6A 4ILDA 3BWSA 5BZWB 3OLEA 1BVZA 3IWUA 3WTXA 2NXZC 4WWOA 3FHQA 4PU2A 3L9RA 2D9CA 3ZE1E 3SDXA 2A0LD 3NCYP 4UI2A 3WN5C 4NRZB 5K1NA 5B4MC 5FEBA 5T1LA 4KVNH 3IDJB 3S37H 3LZQA 2FEEL 4DP7X 5I1JH 2B14A 5DK2B 5BRZA 2VLRD 3HS0B 2B8OT 4IU3A 3QQNA 4JPIB 4TNWK 1KBBA 1OXYA 2ZKYA 3FFCB 4HUUA 1AXSA 1QNZL 2LV4A 3KPRB 5E9AA 1F56A 4WU5A 4NI3A 1W0VA 4JZJC 3BT2L 1SMOA 2BY3A 2EIEA 2WVSA 1KLUA 3HAEG 1CTOA 2F18A 1QAWA 3X12B 1JWSA 4HJSA 4BD4A 4EDXA 5D7IE 4KH2A 1AC0A 1NL0L 4M5YL 2APVA 3WN5B 2YD0A 2XXGA 4K9EC 2AI0L 2ARJA 4WDIA 1B0WA 3CBJB 3IMBA 1RK0A 4LEXH 1P69B 5FFLA 4ETQB 1A6ZA 3CDYA 1G6RL 2J8OA 2X1PA 1IAIL 3MBWB 4HD9A 2BSSA 3L4VA 3L4YA 5A2KH 1YEGH 4Z1PA 3GSWA 1KEML 3GXUB 4HPOH 1I8KA 4OJAA 3LN4A 3OPZH 5DD5H 2RQ8A 2WOYA 4KKCC 4NO3A 3QFDB 2Q6WA 3MV8D 3UBFA 3PREA 2EE0A 3PHOA 2VIRB 4QHPA 3VXRB 1L6XA 1MCWW 5DVLA 2DICA 1CGTA 1NFDA 4UQ3A 4K3DH 3UO1L 2YC1A 5FHAH 2QR0B 4F3FB 1RSYA 3FT4A 4KXZH 1F6AA 4HUWB 3TBBA 3FZUC 3P30H 5AB9A 4WENB 2KKQA 3FUMA 5IM7A 5A2CA 3MJ9H 3WELA 1IC7H 3WUZA 4H2AA 1W72B 4U1NB 1VFMA 2WOBA 5AAMA 5JIDA 4FXGB 5T3ZL 1IEBB 1C7SA 4MJ4A 4TSBL 5IHBA 3GJFH 4PBDA 4EUPB 1TJIL 2CMRL 2Z7UA 4RFEA 3RGBA 4FI6A 5HGDA 2DQTH 1R5IA 3ELQA 4PFEA 2NTFA 1YPZA 1BZ9A 4AYSA 1XF2B 4XMXA 4U6TA 1T20B 3HLKA 1S7VB 1P2CA 4BUHA 4KOBA 1JFQH 4LIQL 1E5YA 3RIKA 1AQDB 1M1SA 1A66A 2WWOA 1ODAA 1YN7B 2FWUA 2W60A 1SJMA 1VA9A 1R24A 4ZW5A 5I6LA 2QT6A 1J0YA 3TN0B 4PGJA 1HILA 1KTDA 1J1OL 1DVXA 3IMRA 1WEJL 1DVFC 3A4AA 3VFSA 2XV0A 2XWBB 5C6WH 3QRGH 2FLMA 1A7NL 1C1EL 4A2GA 1OF0A 4LCWB 1RZGB 2RH0A 2ZJSL 3VU2A 3ZHFA 4AG4L 2NY1C 2XICA 2YGNA 3SKOA 3CSYA 4WO0A 3D18A 4R26L 2X70A 2A1WH 4I88A 4NNYB 3MUHL 4ODWA 2X6AA 4GQ9H 3G6DH 3QO1A 4H1LG 4WIQA 2A6JB 3HI6H 1F90H 5ANMA 5CN3A 4MJIE 1WWCA 3UBXA 2WXGA 4FFZL 1X9RA 2BC4B 3HN5A 4NNPL 3LZLA 4QOKD 1CGYA 4YDKL 2JVUA 4ZFOB 3V5DA 4F33B 4YHZL 1RIHL 5I1EL 3H7BA 1O6TA 3HZYA 4POYA 2J5WA 5JPMB 2AQSA 3QJFA 2FYYA 5KAQG 4FYSA 4ANXA 4B60A 1LTXA 1OAZH 3PRZA 1FN4B 1PYWB 2WBJC 5DLLA 4U1MB 5TE6L 3UJJH 2E46A 1KJMA 2F5BH 4DSYA 2NY1B 1LO2H 3FFCE 1P7QD 1I4FB 1DQML 3GRWA 4QRBA 3TNMB 4PJDF 5I6MA 2EACA 4CSTA 1MF2L 2ZSVB 4AJVA 1I85C 1YEWA 4K7FA 2XJLA 3JWOL 4YFLF 2P24B 3ARGC 3P2DA 3RB7A 3ZQWA 1AI1L 3T0DA 1ROCA 3CC5B 1PZCA 1CICD 3EDEA 5IROD 3H2WA 4RDQG 5ID1B 3SPHA 1EBPA 2D7OA 3FTUA 3VH8A 2BP0B 1U8PA 4APXA 1JE6A 3JTTA 4KTYA 3MYZA 3WUWA 3ZE1B 1GW6A 1N5AB 1I8LA 2DI7A 2PP9A 2WXJA 3D85D 4QRRE 4GRWB 1H9DA 5I6KA 1V3KA 3DURB 1KIUB 1XF5B 1JUFB 3LPPA 2O6DA 4E9VA 1MLBA 1N0XL 4WKZB 1FVEB 2H0FA 5KBPA 2YWZA 1PPIA 2WXOA 5CF3A 5GSVB 5CHNA 25C8L 3BVNA 5JXED 2ED6A 3OMNB 43C9A 4NO2A 4ZXBD 2BOCB 2GJJA 2UV3A 4GNKB 2EKSB 4P3DB 5FO2A 4WJ5A 3QK0A 3QIWB 3SGJA 5D1ZD 3CHQA 2J12B 2N59A 4NQTA 1AR1B 4P2QB 1MWAH 3P77B 4N3UA 5DGQA 5LUMA 1LEIA 4HKBB 1S9WB 1KWKA 4OW6A 4GEJA 4JEGB 4PJAA 3A67L 1S7TA 3UROR 1GW0A 3AFLA 4HZLB 2K3TA 3LY6A 3NJNA 5E1QA 1TKWA 3MRGB 2E7DA 3DHUA 5LB1A 1YLBB 3EFFB 3E0GA 3IDGA 1YMMB 1ZTXL 2XQYG 3OBAA 1LK2B 4BSWA 2NYZA 4UQ2B 6CGTA 5E23A 2QKIB 2VMCA 5BMFL 2D2CC 2E47A 2ICCA 5DHYA 2FX7H 1RUPL 1PIFA 1AS8A 1FG9C 4N5EC 3UZEC 4PJ7B 1HIML 1JAEA 2K8QA 3D2TA 1KYUA 3QT2A 4LHUB 5D9SB 4WI3A 5DRWA 1F3JA 1BQLL 2ZYRA 4GIOA 4MQXC 3SQBA 4XWOD 1ID2A 3C75A 2WZAA 3P4NB 3QDGD 3AS3A 3QJZA 1D5MB 4HIJA 4IKLA 4NKMA 1WICA 3KWWA 4HJGB 3C08L 1AY1H 5FYLE 1UM4L 1CXLA 4KI5F 1Q4NX 4XBPA 5F9DC 3CHRA 2W81C 2IO5A 4HUWA 1JOIA 3HUJB 4FQCH 4EI5B 5E1IA 2ZG2A 4H40A 5GISL 3C9NA 4UILH 1I1AC 3WTUA 1J5CA 1E9PA 3BH4A 4PAZA 3ZU8A 4Q0XL 3G5YB 3O2DH 3RDTB 2K45A 1IIKA 5GGRY 4BRVA 1OWWA 3QJUB 4YC2C 2X88A 4J3UA 4JGMA 3VXNA 1ZVHA 1MCCA 2FLBT 2AEQL 2ZWYA 2PCPB 5DJDB 2AGJL 2UXFA 4I9XA 3D25A 4JQVA 4Z7VE 3B34A 3NT0A 4XB3A 2CJ3A 2X53A 1JK8B 3DX8A 4NRYA 3DTXB 2N0MA 4CUCA 4DPAX 3KR3L 2OTUB 2IG2L 2NUPA 5AW2B 4CC1A 1CU4H 1N3NB 4H26B 4QLRA 2E7LA 1Z9PA 4YHMH 3HUJE 4PWIA 1JVLA 4YVUA 1BX2A 1P5VA 1XXDC 3KNBB 3T2NL 2YZ1A 1IQWL 1TJGL 4TQEL 4HOMA 3GJFB 4EUPH 5FGBC 2Z65C 4DW2H 4HFUH 1FDLH 4U3XA 5CCKL 2NMSA 4JFXA 3ZYOA 1R24B 5DEZA 1KLUB 2PP7A 2DQTL 4ABUA 4KROC 4ISVA 4X5LA 3ZTNH 5CD5C 5DO2C 5KW9L 3CFKB 4FCHA 1EZVY 1QVOA 5GRJL 4GBXD 5IB2B 1JF6A 3VXOA 3LXCA 4KNTA 5E08L 4XCYA 1VFBB 3CDCA 3MAWA 5CJ5A 3QIUC 3GJEA 2F54B 4QHUB 3CQFA 2PW2B 3A67H 4R6UA 3JTBA 3HNSH 2VNCA 3E3QC 2OMWA 1F4YH 3EOTL 2E0PA 1FVCA 5LXVA 4QXUH 2A6KB 3VAEA 5BQ7B 1JYWA 5EUOF 1K3IA 3U30C 3PQYE 5EUKB 1FWXA 3KPSA 4K23L 3OKEA 2C7UA 1R3LB 5BVJA 2KQNA 1P4BL 4KC3B 5HGBB 2YJLA 3U36A 5I1CH 4YDNA 2X3AA 2OMBA 3SE3C 3F01A 4N0YH 1KACB 1SXCA 2YR3A 5TFSL 4O2EA 4TVPE 2QFPA 1EAOA 4PY7A 1IGML 4X6BB 3BSGA 3EO0B 3KXFA 5ISZE 1I4FA 2IALA 2IOOA 5D2LE 1JNJA 2VDRH 3MCG1 3K1DA 5DFWH 4Y0GA 5B3NA 3EJSA 2K4WA 4J4PA 1LP9F 1OP4A 2Y7SA 4UMSA 3FH7A 1WHOA 2P24A 3A24A 4JY4B 4MJIB 1LXMA 1P84J 4FL4B 1YC7A 3PWVB 4JRWA 4PS7A 2A9MH 1PVHA 3H3KA 3E2HC 3IETA 4N8CL 4FD0A 2BP0A 3D0VA 4KKAC 2ZCLL 3D30A 3D85A 1Q0XH 2NDGA 3MV9A 5GHWH 8CGTA 1DCEA 2F5AH 2YPVA 4C47A 1SQMA 3ZE0E 4YIQA 5E2TL 4MD5A 5ICXA 5JIHA 4ZDHA 5AWNL 3NIFF 4V11A 1FO0L 3CUPB 4HAFA 3O2DL 5B3JE 2BCKA 1Z2KA 1W15A 1VEOA 4K94L 1UT9A 4C4KT 3W56A 2JMRA 4GMTL 4DKEH 4J8RA 3UCQA 4XNQB 1MCPL 5IW6A 3V4PA 1CFNB 4N86A 4OM1L 2BVPA 4NO2B 1QR1A 1F13A 3CFCH 3I75A 5DRXA 3RVUC 3DXAE 4UT6A 3F00A 4BE5A 2OXHB 1PY4A 2WLJA 4ODWB 4G6KH 1X9LA 5T3XD 3LVEA 1OGTA 2D0GA 4PRHE 1JCKA 5IBTL 1GH7A 1O5PA 3KL3A 4Y2OA 3DMMD 1YO4A 3MGOB 4UUJA 1NPJA 2MTAA 4I4WB 4Z0XA 1A1NB 1X5IA 3MROB 2P48B 4XX1G 2ZYHA 1TZOA 3MRFB 3N9GH 5KBMA 2RBLA 3M8OH 4B53A 3SGKC 4PJDB 5FGBA 3EO9L 2I32A 3OWRA 4GRLD 3RX7A 4NQSB 3U30B 5DK0A 2ZXDA 3VFTA 3UAFA 3T4YA 1KBWA 4CVUA 5C0NC 1KJ2H 2YPKB 3AM8A 1MHEA 3EGXB 3O6FC 4PLJC 4BINA 2WSPA 4N2IA 2HVKB 4UQCA 4RNRB 4HUCA 4WHTA 2AI0H 4NQCE 1NDGB 3HG1D 1QEWB 1SFHA 2E9JA 2P26A 2XZAH 4Q58C 4WW2B 1UD5A 5I74B 3AB0B 1JZ7A 2OMXB 5C0DA 2WVUA 1UCBL 3IKCB 4XAWL 3UJIL 2OQJB 4MCYA 3GK8L 4BKLA 3LEVH 3GUTA 4BFEA 4DQOL 1NBYA 2XZQH 4WW1B 1OE1A 3ARBB 2CPCA 1UZ8B 1KTRL 1XTMA 1A7QH 2VQ1A 3O2VL 4D9QD 2X4NB 4CN1A 3P4MB 3H8NA 1DBJH 4Q4IA 2HT3D 1XO8A 2AQTA 2LVCA 4N6RA 4ZUSA 1QSEA 3QRBA 2HUHA 4AMKL 1J1XH 1VKXA 2WUBH 5HD8D 1RZIA 3GXFA 4XCNA 2KPNA 1KTCA 2XOTA 4NZJA 4OJFH 1C08A 1EO8H 1Q9OA 1HHKA 1K4CA 3OMZA 1QNIA 3WENA 5C0AD 3WO4C 1K4DA 2ZP8A 4XMTA 3P3YA 1DZBA 4LZKA 4ZW7A 2EE2A 2IDQA 1ZLVK 2HPOA 2WP3O 3PGDA 1TLKA 1BYOA 3N1QC 3L3IB 3P3TA 3OPZL 1KN4L 2QLYA 3C8DA 4FFZH 1EZVX 4NKIL 5DD5L 5DQDH 3HR6A 2HH0H 3LIUA 3PJSB 3T4AA 5JW3H 4HUXA 1WE5A 3TV3L 4MWFB 2IBGA 2IIJA 3GZQA 4MX7A 4XVOA 5IQMA 4HIHA 4Y8DC 2YMOA 4YFDB 1IGJB 1OWRM 4PYGA 4G9DA 2HTLD 2XA3A 4L1LA 3DI2B 5JUEL 5JHAA 2ZKXA 3QPQD 5J89A 1G6RA 1NMBH 2P5ED 1TYRA 5F7BA 3FTSA 2X09A 3BPLB 5F88B 3SBRA 3QXWA 4NQVB 5DD3H 2GK0B 1NAMH 1MAML 1UD2A 4ODBD 5DHYB 3QUZB 5F0LB 1NSNH 2XY2A 1RUAL 1CFQB 1XL4A 2DKMA 2FD6L 2DQUL 4K71C 4PWKA 5B1CA 2YAEA 2CALA 2ZAHA 3QNXA 4R5XA 3X13B 3M1BB 3NIDE 1N7ML 3PWPD 2IH8A 4ZOAA 1CXFA 1K5NB 3A23A 3D5OF 3RE0A 2G9HA 3LPFA 5E8OA 3RWFB 4YNYB 3DLQR 4P57A 2PYEA 4AYMC 5B7FA 5DD3L 5AB1A 5C3IA 1GGUA 2A6DA 2A4EA 2CO2A 3MV8A 4X6CA 2WXLA 3LOWA 1QQDB 1ZVSA 2A83B 3I6SA 4W9HC 3D06A 4AYDC 5H35A 2PPEA 3DX1A 4D94A 5AENA 3MO1A 5F7YC 1RZ8A 4OM0H 3Q1SH 4HHAB 4EAEA 3WN6A 5DJCB 3UO8B 3QEQE 4MNQE 4PW9A 4AKQA 1CD8A 5BS0E 4J39A 3Q7JA 2CHZA 2FVNA 1EV2E 1UZGA 2ZPKL 2ITDB 2WYTA 1KJ3H 2KDYA 4K2UL 4E9QA 2O26U 2YSTA 3AROA 1U8QA 5D1XC 3IAPA 4KUZL 3RZWA 3RVWD 2JI2A 3WE6B 3U4KA 4M03A 3P9LB 4A7VA 1L9MA 1E9QB 2HWZH 3K0WA 3VI3F 2ICEA 1I1YB 1MFBH 1NEZG 1ZE3C 1T4KB 4WF7A 2QZ5A 2XWJB 1QSFE 4RA3A 4NPKA 4Z7UF 1PLBA 5E1AA 4L8BA 1B9ZA 4GUPA 2KPWA 1NDTA 3IDIA 4TNEA 4FA8A 1XDTT 2NUTB 1LD9B 3CG8A 2FJGA 3H3BC 3PFQA 4A68A 5F7KC 2DLFL 2J55A 2ZTBA 4DN4H 2GY7B 2VRQA 2X6UA 4Q0XH 5T3XH 3MV9B 3C12A 5C07E 3S35L 5F97E 2QADC 1X3DA 3VD0A 4JO4H 4DZBB 5CBAB 1NUDA 1XSIA 1SLXA 4MBOA 4L2YA 4PJXF 3G3LA 4NYLA 1MCBA 2AGJH 2BNUA 3ZE2F 2XKNA 1I3RB 1WBZA 5GRWA 4KK8C 4PJEE 3L7EA 2D0FA 4KDWA 4RISL 4HDIB 1PBYA 4PGEB 4BSVA 1X6NA 4QJ3B 5DD1H 4J6RL 4NKIH 5J56B 2YK1H 4CC4A 2H1XA 1UG9A 4PJCA 2AKRB 1INEL 2YAFA 1A6VL 4NN5C 2CPUA 3BDYL 2HFGH 5ITFA 2J56A 1QASA 2IF7A 1V7MH 1DN0A 4WO4A 2EECA 3PV6B 4UM8B 3QYMA 1UENA 3BWUC 3KBFA 2XV3A 5JORB 2HKHH 5JOFA 4Z0XB 4P2CG 3TVMA 3VI4A 4XVSL 5DMIH 1NIFA 3HBPA 4LQ1A 2OCCB 1EDQA 1YN6B 3BKJH 3IDYB 3JWNH 4JKLA 5BS0D 1T6WA 2ZCZA 5HYJA 3AT8A 2R69A 3D7PA 2DQ6A 4LNRB 2GTWA 2GFBA 3JV4A 4AGQA 2VN5A 5CCGE 3ZT7A 5E5RB 1UCBH 3UJIH 3ROOB 3ULAB 5EN2B 1NDGA 1I31A 4OZIB 3IU3B 3PHQB 3P40A 3OKYA 4LCYB 3TFBA 1RULH 3IGAB 1ILUA 1N19A 3KYOA 5CIPH 5CILH 4ZUUA 1VEMA 1U91A 3IKCA 4LOUD 5KYUB 3MUUA 1NCGA 3PWVA 4P5TA 2YD4A 2P8MB 1R5VB 4L1HA 1WITA 3X1FA 1UASA 4KHTL 4UF7C 5GJSH 4HKXA 4L37A 3S37L 3N5AA 3MBED 4NHUA 3ARBA 1T7XA 3L3OC 1ADQL 1YN7A 2BXZA 2PUQT 1JHKL 4GW1A 1T2JA 2FJFA 4MYWB 3PWJA 4NENB 1D5IL 3BKYL 4RIRB 3LNDA 5B3SB 3JV0A 3WY3A 3CSBA 2FH8A 2OSLA 5CBEB 4ZW6A 5MENE 3AT0A 4U1KB 2VLLA 5I82A 3FU9A 3C60C 5I28A 4PVBA 4Q9QH 4LSSH 4HGMA 3NPZB 4NN6B 1J7VR 4LKXB 1HH9B 3VRIB 4HCIA 3NA9H 4YHIA 1XGZA 3MRIA 4QRUA 2UXGA 2FHCA 4RA0C 4DESA 3DJTA 5FYLL 2EEDA 3EYUH 4F7KA 3BMVA 1GRWA 2IPTL 5DWUL 4HGKC 1MPAH 1U92A 2QV4A 4NUQA 4QCIB 5IG7B 3NESA 2YAMA 2QTVA 1MIEH 2DJSA 2VIRA 1FH5L 5HDQL 3HI5L 2ITCB 3ZUNC 1A6WL 3QAZC 3WXWL 4Z76B 4ZTPH 4GMTH 3ZYIA 3N0PB 4CW1A 3UMNA 2JJUA 1EJOL 1UZ6F 2YC1B 3IDMA 1B90A 4MA7L 2H26A 3KLHC 4EN3B 4JFHD 4ZUWA 5CR8A 1GS8A 2F5AL 2EILB 3EO1A 1PTZA 3MOAL 3O0RH 3TS8A 2FGZA 4J3OC 3V7MA 3ZTNL 1QP1A 3MNMA 3F12B 5CP7A 3IMUA 1M71B 4P4KB 1M05A 2M2DA 4DO5A 2CLRA 1P6AB 4HH8A 2MNWA 3G04B 3QNXB 5AL8A 4WHTB 5BRQA 5TE7L 4BFRA 4Z78B 1BZ9B 1XF2A 4XCCH 2HRPL 4KQ3L 2FO4B 5FDWB 2YXFA 2EIZA 3F7RA 5BOZG 2DEYX 3RWFA 1H8SA 2OMXA 5C0DB 1UATA 5G4MA 2EH8H 1QRKA 2PW1B 2BX5A 3N42B 4GSQA 1G5AA 4I1PA 5IJBC 4ENEC 1EEZA 1M53A 4QF1B 4TNVK 3GSNL 3U46B 1LO4L 3DXAD 4ZMPA 5I1HL 5E6IC 3GRWH 3AITA 4HAGA 4PP2B 1UXWA 3ARGD 2A74B 3W1ZA 3ARDD 4JREB 3VXSD 2F53A 4WKXA 4TULH 3DA0A 5CZVH 1E6JH 4IM8A 1A2YA 32C2B 5CLXA 1QI3A 4N2KA 4ANVA 1RUMH 1DSWA 2QSCH 2WINB 2PYEE 4OCLC 1XB6A 2ADIA 4LFHG 5I30L 1SQ2N 3IDYC 2EUXA 3QIWA 3QUXA 2D3LA 2X70B 3HNSL 4GYBA 4X6CE 5ALCH 1JCVA 1J1PL 35C8L 1A9EB 4ZMTA 1L9OA 2IFFL 2QPUA 1BG9A 3VWKB 2E8YA 3Q06A 3W9EB 4IOIB 4OIBA 1K2DB 3CZEA 5CZXD 5I19L 3L1FA 4R7XA 3KW7A 1S9YA 1LWHA 1II4E 4L23A 4FADA 1IGYB 2XIIA 4P23D 3EJYD 4P5TC 5AUMB 3ULVL 4QD2E 1XF1A 4JY6B 4M48L 3M86A 4PVLA 2W9DL 2OCJA 3MDJA 5EU6B 1VGEL 4DGIL 4LRNH 2D0HA 5AB2A 4X6CF 3P4LA 2F74B 3KH3A 4B9FA 3K5RA 5KYYA 4JM2C 4NYLB 1MCSA 3QAZB 3HFFA 5IB1A 1KJMB 4U6VL 1MCQA 5GGQH 4Z7VB 2G4GA 1U21A 1VRSA 3UERA 2DWEB 4YZWA 1E7VA 3ZGIA 2ODIA 3NSDA 4LEOA 3U4BL 3K91A 4PBWD 4CVXA 3UZVA 4AE1A 2F9BT 1SF5A 1TVDA 1WAEA 3EOAB 1FO0A 4N87A 3VU1A 2XU9A 5F1SA 3CX5J 3V9FA 1OGPA 2ICWJ 3EFOB 2VDLL 2ENSA 3HZKA 4DKTA 2YGPA 5LDUA 1U8LB 2C5DC 2OV0A 3N04A 4YSOA 4GKOA 1U3JA 4LF3A 2OYKA 2AEQH 2WNGA 5LCVA 2FYVA 5JOFB 2XWEA 1GZHC 3FRPG 4HHAA 1MLBB 2JCCE 4NBXB 4P9HL 3MR9A 3C6EA 3TIEB 3M8OL 4YBLB 1K6QH 2NZIA 3I9AA 4WZ9A 3UYRL 4DZ8B 5I2IA 4Y2DA 5KTEH 1U0QA 4BQ6A 4WTWA 4AI7A 4L1BA 4AM0Q 4WJ5B 2CCLA 4KK9C 5ANME 4K3GA 4Y4FC 3DETC 3JV6B 1KBGL 3S5LB 3A21A 3B9DA 2A5UA 2YD9A 2IAMD 1SF3A 4U6XA 1QSVA 2CDEB 1A14H 5HHPB 1ZLWK 2D7QA 1LO4H 2KMWA 3UTQA 1A4KA 1I3VA 3FUJA 4ACPA 5IJKC 1NCOA 3F3HA 1BD2D 4Y88A 4PGBB 4GLRH 1WD8A 1N3NA 4H26A 5FYJH 1HK6A 4N0FA 4AL8L 1XD0A 4X0KA 1UHVA 2NY4D 1S7SB 2AQ3A 1BECA 5EOQH 4WNSA 1OCOB 4WNQB 3EH2A 5ESVB 4NGHH 2XZQL 1P7HL 3KM2A 4HKXB 2BNRB 2ILLA 3VSTA 5LGJB 3EFFA 4O58H 2GG1A 1X6LA 3BMWA 4XMLH 1UCTA 2X4OB 4L8SB 5EU3A 4QNPE 3LNEA 1DL7H 3BGMA 3D39A 4JHUA 4Y4FD 5EA0L 2EP6A 3P11L 2LLGA 2EH7H 4NHCH 1FGVH 1TNNA 1QPKA 2XWZA 4EIGB 1W8EA 4JGJA 5FM4A 5JHBA 5SX5K 2FSEB 4AW4A 1YHPA 3VG9C 4ORGB 4V2BA 3ARVA 1CDGA 2J6EL 5HHMD 1GAFL 1I1AA 3QZNA 3CBRA 3P9WB 2EXYC 3K2MC 3VGAC 4AH2B 3ULVE 3N41B 1I7RA 2NW3B 4WFFE 3QA3B 1RUKL 4N2AA 3NG5A 2BNQA 1ORSA 2WBWB 4JCWA 4A2EA 3HNVL 3ZZ1A 4QCIA 1BZ8A 1PIGA 2ZICA 4NFCA 5DJ8B 3UTPE 5CS7A 3O81A 3CFIC 3ZKMC 5IVOA 2AQPA 2PCXA 4Y9GA 3UGUA 1KB9J 1XGPA 1XMWA 1QWNA 4U1IA 5E99H 4NCC1 3U1QA 1N59A 1S9VA 1SGKA 4GKZB 4GQ9L 4Z76A 3ATBA 4I7ZC 5HJ3B 2EDBA 2A9NH 3S0PA 3WO3B 5FM5M 1NUGA 3SY0B 4WI6A 3JZ7A 4FG0A 4EI5A 2AV1B 2VLKA 1KTKE 4AQEB 4OAWA 1G9HA 5TE7H 2HTKC 2FNWA 3ARXA 3RDTD 4J3VA 1IBHA 3NJFA 4XN4A 1ECYA 1ZLDA 4JAMB 5IVZA 3GXDA 3V52L 5D7LD 4MXVF 4LLAA 1BFTA 2V5TA 2X41A 4B9IA 3FQTB 4KZDL 5PCYA 5IBUG 2WSDA 2FT6A 1WG3A 4BZ1L 3F58H 1N0LB 1IIIA 1L9PA 4BCXA 4E9TA 4TNWF 2AC0A 1U6AL 3WJMA 3L54A 5CZXC 3TBCA 1WIPA 2FL5A 2VR9A 3RIAF 4EZLA 3QZBA 3VI4F 3K8LA 4UDUA 5BV7C 2ZWNA 3WAJA 3Q8CA 4OKVB 1OW0A 3ZHLA 1DUZB 2Z34A 4FNPA 4G6ML 2WXNA 1KUMA 3S2AA 4P46D 1KNOA 3WTSA 1QLEL 4G8GA 4LVOC 1Q0EA 3NIGE 4TQEH 3ILQC 4G8AC 4DOHB 4PJFE 4QRPB 1IC7L 5F0JB 1BQSA 4W9GC 3BRGC 4R83A 3KPRE 1XEDA 4HUVA 4GI8A 2XBTA 3ULUH 1WUZA 2CM5A 4W4OC 2P3YA 4BWWA 4JFQB 1JPSL 3FPYA 4NX0A 5BO1L 1KTLA 2R4SH 2QEJA 4PMEA 3OZKA 3E6FB 1U92B 3BKYH 5BQ7A 2P28B 2N01B 1QYGH 1JN6A 2WCSA 5ECGA 4BZ1A 3VD1A 2X6BA 3ZT5A 5EU7C 1KF9B 5CEYB 2B39A 2FIKA 2PYFA 3KPPB 3D48R 3BUTA 5DC2A 6PCYA 5C0RH 1ZLSL 4C4BA 4JM2B 2W1NA 3BWUF 2BHFA 4LSTL 5ELIA 5IVXE 3QI9D 1ONQA 4K5LA 1CT8B 1U8OA 4CRPA 3RYMA 3ASWA 3O4OB 5KVDH 1X7QA 2XQYK 1GGCH 5KYYB 2DJ4A 2P8PA 3ARFA 1W2KT 3OF6D 5D6CA 3WEAA 1HQRB 5I1HH 2A73B 2HTKD 1FZOB 3V8CA 4CDHA 1RIUH 1MZYA 4Z7VA 2E4FA 5GS2H 4XP1L 2CIKA 4ZFQA 3IFLL 1TJHL 5J6HA 3CFEB 3S5YA 4EI6A 1J86A 5E6YA 1UWFA 2X0UA 5FDWA 3N2JA 3E80A 3HG5A 1ZLUK 2L7EA 1OARH 3LVTA 5F71A 3TA3C 3ZZSA 2NXYC 2VR8A 1HIMH 3FTVA 3RGVB 1OF2A 4D8PB 2XT1B 4PJAE 3MU3A 1NOLA 1HEZA 4L05A 2BSED 3S36L 1VFAA 4LT7A 5B21A 4GRLC 1UWYA 1LO3L 3B5HA 2PCFB 3ARGB 1DLFL 3HE7C 2MRYA 1BZEA 2JKIS 1NGPL 4ODSH 3RBSA 3QISA 1B9KA 1TQBC 1NBCA 4IU2B 2YMXL 2WLLA 4EZMA 3K4DA 1G7HB 4W1TA 4NKOA 4C57C 2G30A 1RLWA 4DNLA 3CHPA 3BEWB 3MR9B 5JXAL 5IW6B 3QC5X 2A4ZA 3A22A 3QUMB 4Y1TA 3A47A 2PCYA 3S36H 1K4DB 2JTDA 1QFOA 3LH2H 5IK3B 5D5MA 5C3LD 3S4SG 4ZNEE 1MI5B 3QDJD 5DJ6A 5EDXA 3RI5K 1IRAY 4PG2A 3GMRB 2NYKA 4XB7A 4B9YA 3FT2A 2V5YA 3EKCA 3ESOA 5DHVA 2HT4C 3WFCH 2QKIC 3WKYA 4JPIA 4XNZC 1X5XA 3RZCD 1E9OA 3F85A 3NK3A 4FE9A 3V5KA 4L0YA 1KPUA 5L2KE 3QIUB 1XF3B 3VDCA 3LH9A 4GKNA 5AAWC 2EDLA 2CR0A 3JXAA 4WEUD 3UTOA 1QTPA 3Q9PA 3F7KA 2MSPA 4ZFOL 3EBGA 5KYWB 4DGYL 3AQZA 2RQEA 1T7YA 4MB5A 3MRBB 4R7NB 5EU7E 1D7DA 5HJBA 3U7YH 4MXQC 3FPXA 1MJUH 1CL7L 2F7RA 4A2MA 4TUOB 4OZ4A 5JOPD 3N40P 1T7WA 4ONGH 3WGVB 1IAKB 1XT5A 3KHOA 2XTJB 4U3SB 1ORSB 4LCCA 4CGUB 1KFAL 3Q48A 4FGMA 1GGBL 4J6IA 4UNUA 1OSPH 5FWQA 4TN9A 2JQMA 4OB5L 4WHYG 1GC1H 4LF3B 1EERB 1SYVA 1VB9A 1OAZL 4WNJA 5HHME 3V0GA 4BZ2L 3MBEB 1AHWB 1JK9A 5GZNC 2BIHA 1ZD6A 5F7NC 2BS9A 2R0KH 4L4VA 4O02B 4OGYH 4OLZL 4PV9A 1E6OH 3RURA 3T3MF 3MLXH 4G7RB 2NW2A 1BD2B 7PAZA 4OGAD 1ES0A 3GTTA 2Z8RA 3LDBC 5DUPH 3W0WA 1R34A 3TONA 2Y36H 4W6YB 3TOPA 3SY6A 1JWMB 2NY5C 5EUOA 4TNVF 4YVNA 3T2NH 3VMPA 1HHJA 4OUUB 4GI9A 2O5ZH 1B3JA 3DOHA 3NUKA 1LO5A 5H94B 4X8XA 4P2RA 4JS7A 4OIIH 1EAPB 2B9BA 4YAQA 2VDOL 2GCYA 4HIIA 4K3EH 4KKLC 3QYNA 3APFA 4FHJA 1NDMA 5FA3A 3HVDA 4WI9A 3U0PA 1EANA 2DBLH 4P2AA 4PR5B 3AY4C 2DQHL 5KOVC 2APWA 3WNPA 3WNOA 5FKPB 3T0WA 3DSNA 4PUBH 2UVEA 2ZUQB 1Y18B 5C92A 1FL5A 1VERA 4N90D 1HZHH 4KKBC 1KTJA 2YS4A 1VACA 3DRQB 3OX8B 1N68A 2YAQA 1JGUL 5HSFA 1RZPA 1JWSB 1AZBA 4G5AA 1YY8B 1U8JB 1UH2A 4FNQA 4HIEB 1F3DH 3WIHH 3KDPB 1P7QB 1BQ5A 3C5JB 4WU7B 3R8QA 1ZT1A 3M1CA 4AM0B 5FGCB 4XBEH 3PP4L 2QQKH 1UKTA 1HI6B 1OQOA 3B5GA 5EULV 4H8VA 4D9QE 3FMGL 1V55B 4I0PD 4AGMA 3VACA 4BM7A 3LN4B 1Q8MA 3F8UB 5JORA 3UIYA 4WFEE 2EDKA 1QSEE 1AR1C 2PR9A 1GIGH 2IOMA 4OCYL 4OFKA 2IWKA 5C0JB 3FCSA 3WJJC 1F42A 1HXMA 1T0NB 1XF4A 4NPJA 4KJQC 2A1WL 4L5FE 5D2LB 3MXWL 5DZLA 4B5ZA 1OY3B 1OB1B 1IKNA 5I1DA 4U1MA 2H3XC 4MNQA 2WAHA 1W91A 2ENPA 4NZRL 3IXTA 1A9VA 4L1DA 4AC2A 4YFLI 1I7ZA 3ECWA 4ELME 1KFAH 3RJOA 2JB5H 3IGAA 3T0EC 3H9SA 4JKPL 5INDB 3WY1A 4MS8D 3L13A 3UC0H 1JERA 5E4EC 5EOQL 2YGVA 3JWNE 1XMEB 4FXGC 3S34L 1U2HA 3ECVA 3BQUD 3IRPX 3TH3T 3TT3H 3S88H 1KXTB 3KW8A 2CBMA 2PO6C 3D39D 3S5ZA 1LEGB 1WBXB 2MCG1 4NT6B 5I66B 3AXLA 3PAZA 3WO4B 4DZBA 4M61B 2D31A 3I85A 3MA9H 4PJAF 3DV6B 3G6JF 4X5QA 3VXRE 4G6KL 1G7IA 5D7IA 5FO8A 2K78A 5KS9A 1BZDA 5HHOE 4I0PA 2HN7A 3FOMA 2JNZA 5E2VL 1YJDL 5A2JH 4ZUTA 1GA2A 1IEAA 4U1LB 4AT6A 3M7FB 2WB1A 5KYNA 2X1XR 3FSOA 1UURA 3MRIB 3OSKA 4QRUB 3TYGL 3V0VA 4JRFA 5ABAA 2IWGA 4Z7WF 4KKPA 4C56A 3MN8A 3ZDZF 4XNXH 5JDJA 5FYKL 2H9GB 1WFUA 3O0LA 1XAKA 3VQ1C 2H5UA 2G60H 4BSJA 1MI5E 1R5WB 5ITFB 1KIPB 5D7JA 3BAXA 2E7CA 3MNDA 4OZGF 1CE1H 1YAIA 5ANMB 2E7MA 3O8XB 5CEXA 1G1CA 1P5UC 3HC0B 4NDMB 5ALBH 1D5BA 5T3XE 3D4CA 4KNQA 1VEPA 2Q0ZX 4ODHL 1Q90A 1CLYL 3CLFL 3QORA 1F4WL 3U79A 2OJEA 5FLVA 2D4FA 4FQ1H 1BQHG 2VSDA 5GJTL 4JKNA 1JZ8A 1OCCB 4OQ1A 4WUUD 2XG5B 3GIZH 4G3YH 3C6LA 1LLAA 3QIUA 1H6UA 5HDLA 5JO5B 5MEOA 4LNRA 4M9PA 2IGFL 3O9WC 1DVZA 1QBML 4BSWB 5A7EA 1W6WA 1EHLL 7TAAA 1M05B 1OTSD 5CLWA 4P2RD 3MLTA 4JVUA 3O2VH 3WEXB 3BVDB 1ED3A 3FMGH 4KHXH 4UOW0 4M43L 2I5YH 3VO0A 3CFEA 4FCAA 4LCYA 3MLUH 1IBBA 5FR3A 2DEXX 1HSAA 5BOJA 4CADA 5D1XE 3G6DL 5IEKB 1JPEA 2HLAB 3OHXB 4YGVA 4S1DD 4P5MA 1PCXA 3QULA 3G5VB 4XOCA 3VJ6A 4CC0A 2NY6B 4L48A 4BGLA 5IGXL 1F00I 3MXWH 2ED9A 1O5DT 3KJ6H 4F2MA 1JRHI 1NEZA 3N42F 2JTYA 2EDOA 3CTTA 2WLLB 1NCBH 1QSFB 2VLLB 2YKLH 3EJQA 1RU9L 3L6FB 5JW3L 3T0VA 5HDBB 2WMPA 2LW3A 5LGKA 3GDCA 2UXVA 2DW5A 3BD5A 4XN2A 2Y2YA 4AEFA 4BFKA 4XE0A 1IARB 3GGWB 5IOPB 3DWTA 3B9KD 3QXDA 3QORC 4KVCH 4C4UA 2R1XB 3OG4B 5DRZA 4MA1B 3MMEB 1NGZB 4N28A 2V17H 3QQ3B 4ZRGA 4YAQB 5DYFA 4WFHE 4Y4KD 1CPUA 5A2LH 3TA3D 3WNIA 1C5CH 3SGKA 4P99A 2ZNWA 4MD0B 4I3SL 1JSYA 3K80A 5M7QA 3WHE1 2FO8A 4NSKB 5ID0A 1DJXA 3OM3B 4JBSA 2ARWA 3UC2A 4JY6A 2ZUSA 2DKSA 3OB8A 3RBGA 3K72A 1EZLA 2XRAH 5HGHB 2B1AH 4F2FA 1TKWB 2CK0L 3KDMA 1J12A 4G72B 1G1OA 2F74A 5I26A 3TT1H 5JNYB 3BW9A 3OGCA 2FJHA 4H0IA 4XCFH 1NJ9B 1BFVL 1LK2A 3VYNA 2CM6A 3BH9B 4G6MH 4C55A 2F5BL 1XIWD 1M71A 2XWDA 5I5MA 3G08A 4O51B 3FXIC 4YSCA 3D8MA 4ONFH 4MXWL 3V6ZA 1UA3A 4QY8A 1IKOP 2L4OA 4LP4A 3V5HB 4GW4A 3JYBA 1WFJA 3ZDXB 3F58L 5DO8A 4ODXB 4HIPA 1T21B 3OWEA 2Z31B 2I07B 4FQQA 1GIGL 1HNGA 4OCYH 4S0TD 4UQ9A 5I15L 2DTMH 4JE4B 1QYGL 5EZPA 5E9DA 4LBEB 4L3AA 4F5CE 3K71A 5JQIB 2K70A 4QYOB 3C6SA 1OSYA 3GI8L 3KPSB 1NCDH 4JFDD 2VO8A 4PEEA 2WZ5A 4JDZA 4XC1H 3WIHL 3P3UA 2WANA 1FORH 2F53B 3O6ML 3M6DA 3US1A 2Q3AA 3U36B 1QSZA 2FD6H 2KLSA 4PWJA 1LYQA 3PP4H 4M4PA 2ZCHH 1SUHA 4KJYA 3NK4A 4PGZA 5CMAB 1DQQB 1EUUA 4DPCX 4PGDA 2WZPD 2X1WL 4A7SA 1DJIA 1TTAA 3SGDH 4JFOA 1IVTA 2WLKA 1X5LA 4Q4EA 1T4WA 1RVFL 4JW3A 2SEBA 3E1ZA 3OB0H 1U3NA 3S6CA 2WN2A 1UA7A 1T3FA 2OZ4A 2WQAA 4PJ9B 3HS0A 3DTXA 4ZPVB 3O6KL 5FW6A 3QFJD 1S7SA 4JFFA 3Q1EA 1RY7B 4PHZA 3CFQA 4J7RA 5L7XH 2G5RA 1A0QH 1FPTH 5I8KL 1Q9WB 3MLWH 2R23B 3B7UX 5CILL 1D5XB 3AB0C 4HX1B 1RFDH 1FE8L 1PJWA 1E4WL 3L9YA 3BSHA 1BEYH 1XCTA 3SCMA 2IDCA 5L4JA 4YX2L 3MRPA 3EYSH 5K93A 1KCSH 4GG6B 2Z92B 1ZT4A 2HLFC 2HT2C 4NO0B 4JQVC 4XRCB 1UVQA 1QX1A 1YSOA 3O6FD 4P2OB 3WKNA 2C1PA 2M26A 2EDRA 4QHKJ 4URTB 4Q6KA 4C56B 5FHBH 4EQ3A 4Q9QL 4OD1H 1E4WH 5GRVL 4Y5VA 3UGXA 2OZNA 2X3BA 4TV3A 4GXVH 4GMSH 2C26A 2GT9A 2ZXCA 1P4BH 5DCCA 4TTDC 1VCAA 1J8HA 3MOBH 3HE6D 4E9YA 2NXZB 3FQXB 1EWHA 1FYTB 4MS6A 4HXAH 1IILE 1RHHA 2F8XC 3PWNB 1WTGT 3D08A 2BMKA 4XT1C 4PWGA 3N85L 5C09D 3T77A 4M7LL 1BFOB 1XZ0A 3FB6B 5JQ6L 2FWOA 3K4AA 1TOXA 3UC0L 5I17B 2YPLE 3BZ4A 4Z3HA 2V4LA 4IOSA 3RWIA 1FF5A 2IBZX 4NQSA 3VFTB 3ESVF 2X4TB 5J8OA 4PREB 3IYLW 5CJBA 3WS3B 2Z3FA 4F7EB 2DWDB 1UJ3B 3WTTA 4KVPA 3MRNA 4PIBA 5GJSL 2ESVA 5CJ8A 5KVGL 3CLWA 4PRDA 3CZGA 3ZY7A 2IBZY 2GJ6E 3MC0A 4OKDA 5L9DH 3TF7C 3N1FC 1UC6A 3GC3A 2CDEA 4E42B 1KEGL 4ZYKB 4G6FB 1U95A 3MHZA 1S7VA 1P2CB 3Q6GL 2EE3A 1HSAB 3RVWC 3SD2A 3NJLA 2JJWA 1IB5A 1QPXA 4X0KB 3NCEB 2VO5A 3ZDWA 5IR1A 2EIDA 4D3CL 2FX8L 2VISA 4WU5B 5E4EB 2XX1A 3QRFM 1TJGH 1T03L 2WXRA 1J9TA 3FFCD 5F1IB 4N2OA 4S10A 1UXSA 3RWHA 3RWEB 1ZHLB 1OGAD 4K3JL 3BGFC 3I74A 5A6IA 1AG0A 4XCNB 5D2NC 2I27N 1VFOA 4F8QA 4WSKA 1KCVH 5L0QB 4Z7OE 5GGTL 4ZXBC 4S1RL 5DFVC 1IM9A 3H0TB 3QXUA 1A7NH 1C1EH 1HHKB 1K4CB 1CUOA 4LPYA 1C5BH 2VYRE 4OLWL 4BDVA 2R9HC 2DYPD 2AJUL 1KWGA 2NZ1A 5FUCE 2ZYIA 1HYSD 2VZOA 4GRMA 4WVRA 4AXWA 4FJZA 1BYNA 3NJXA 3QIBD 2QQQA 1I8KB 3RUGE 4JZOA 4CBZA 4DVBA 4RZCB 2WQXA 1CK0H 4ZX3A 2J8UA 5D8JH 4QJ4B 2XN9B 4UT7L 1DP0A 1L9QA 3GXPA 3ZDYE 3RGVD 4OZIE 1GS6X 3MX0B 4XGZB 3LIZA 4NBZB 3TBVB 4I77H 5DJXA 2GSIB 5DD0H 5F89B 4YN3A 2AK4A 1IE5A 5AVVB 4IRSA 4ZG1A 1P6FA 1QG3A 1T7VA 3DGCR 3GDBA 1HHIA 5E5MA 2XWXA 1OARL 1U58B 3ECBB 1TTFA 4FABL 2R56L 5DFTA 4AQEA 5IB5A 4CMMB 1FN4A 1PYWA 5D7KE 1QNZH 2EH8L 3QR2A 3GMOA 3IRZA 4C54A 3EJTA 5DZ9A 2ZXBA 1I8AA 2FK9A 2UWEF 2C4FT 1R4XA 2O5ZL 3EGXA 5HGDB 1WPCA 3ALPA 3QIBA 3ZDYF 1RPQA 1Q94A 4ANWA 4KY1H 1MFDH 3Q13A 1E40A 2AITA 2I60L 2MHAA 2V2TB 2JCCB 1QUNB 5TF1H 3U82B 4S0HA 2DMBA 1MRCH 1NLBH 2Y1YA 1CLYH 4XXDB 1ECZA 5KSAC 2C3VB 3QXAA 1CD1B 4HP5A 2F7OA 1AKJA 1E3ZA 3OLIA 5FKAA 4HXAL 3SIKA 1ZHBA 3PXLA 3IB4A 1IFGA 5E4OA 2VQUA 5SWSA 1T04A 3LH2L 3FCTA 4IGBD 3WLBB 1I8MA 1MJJA 3D69B 2VXQL 4KO5A 1A3LL 4I89A 3LMJH 1U8NB 3GXIA 2DDQH 1WQVT 2IQAB 3C6SB 1XCQB 2P5EA 4QHMB 4IU2A 4B9ZA 5F0PB 3ZSTA 1FFNA 3QI9A 1WBYB 3GSXA 5AOZA 2BDNH 1CGSH 1RZIB 1KOAA 4P5SA 3QBTB 4GO9A 4FP8H 2KZBA 3IDXL 4GEIA 4QRPD 3DVNA 3KYKL 4N3TA 3PQYA 4WW2F 1TEGA 4PJDE 1Q9OB 2BM3A 4LOUC 4U4BA 4BH8A 1PL3A 4P0DA 4UM9B 5H37A 5CFAA 4JFVA 2NZ9C 1B4RA 4NC1C 1VGEH 4DGIH 3QO1B 4N1CA 1F8TH 1BIIA 4XR8C 5B1BB 3SZKC 1K3ZA 4PJFA 2O6CA 4JQXA 4A6YB 2WLHA 3P4OB 2VXSL 4WWKD 1AZVA 1XIWC 3QJHB 1F4XL 1OTUD 1LD9A 1BGXH 2FJGB 3D9AL 3QE5A 5L88H 5E95B 5I1JL 1CT8A 1U8OB 3NEEA 2CE6A 4J3OD 5D7HA 5HI3C 3PJNA 2OL3B 2AW2A 4P2YA 3ARSA 4JO3H 4ERSL 3D2UB 4HJUA 5F9JB 1PNDA 1I3RA 1WBZB 3ZSSA 1RULL 3HNTH 3A6CH 3UGEA 4HGWB 2OTWA 4NC2B 4LBAA 4AY0A 3FQRB 3MZTA 4OCSH 1KLFA 2R51A 3GNMH 3L5XH 4XN9A 1VSCA 5ES4B 5I75B 4KHTH 1NM4A 1PKQB 2FE0A 3NJGA 4GMSL 4EF3A 5ACLA 4IIQB 2H45A 1OPGL 2NX5A 3MCLH 4JZJB 3OAYK 3SBQA 3QNZA 3IF1B 4RMUA 3TO4B 3TZVB 2YRZA 5FF6B 2AQ1A 4AWJC 3HC3L 4RX4A 2H0EA 2DQJL 2V3FA 2VZUA 4PS3A 2B0SL 4YHNB 3PV6A 1E2VA 1Q38A 2FGWH 2CO7B 5EWIH 3SCMD 3BIBX 5H35B 2G5UA 2GT9B 3JWDH 2PO6D 2F8IA 5IB3A 3J07A 4OJEH 3LKNB 2GUOB 3DX9A 2MOGA 1FYTD 1WFNA 3JZYA 5GS0C 1PG7X 2DH3A 3RFRA 4OGXH 4L18A 3LRSA 1CE6B 3NACL 2ROXA 1EAJA 4MAUH 5EU6E 2HFGL 1JI2A 1E5AA 3K6SB 1D7CA 2YLKA 4LSUH 3VX0A 4NGHL 4L3EE 2CLZB 1HYRC 3WDHA 2LFGA 2DQGH 4U3HA 3ZZQA 5DYOB 1KZQA 1AE6L 1UYWL 1FLRH 5HYQB 4RFNC 4Y4HB 5IHZB 4MA7H 5EF3A 4NRYB 4LQFL 3BJ91 1U95B 1IGIH 3FSZA 4K07A 5F70A 3U0PB 1H3XA 2BWQA 2J21A 2AVGA 4G1EA 4XNYH 5LBVA 1P1ZA 2VDNL 1UB6A 1U91B 3Q8FA 5KYUA 1CFMA 3RTQC 4GSDH 2K4AA 2XRAL 2CDGB 1MCRA 5DZAA 2P45B 1KPUB 3L4TA 4GT7A 4D9LH 3RFZB 4KOCA 3EJZC 1XH1A 1ZOXA 4PJXA 3WNKA 1YMMA 4HFUL 2YD7A 4W81A 1WZLA 3WGUB 5I8EA 3HRPA 2IH9A 1EGJH 2W92A 2ADFH 4LEBA 3J2PA 4PY8I 2ID5A 2IPKA 2Z6FA 1CQYA 3DECA 4NO5A 1C7TA 1Z0MA 3R06A 2DF3A 1MFAL 2DIAA 2MMXA 4WUUE 1A7OH 1LWJA 1V8HA 3MTRA 1A1OB 1HWHB 4OCMC 5AW8B 4OD3H 1YNLH 3G6JE 4YSTA 2JXMA 4YGAB 2VR7A 3RWGB 2QZQA 3SOTA 2X4QA 3VGHA 2WQWA 3KXFD 2A9BA 1BREA 4GRMB 4Y5VB 1MEXH 5I15H 3LS4H 4AVKA 2YOAA 1XX9C 2AANA 4OH2A 4QI3A 2Q7YB 5DR5H 3WLWD 1SYVB 4BH7A 3GLAA 3W9DB 1GSKA 4J27A 1N8OE 4UCFA 3ABZA 3HZMB 1JXGA 4M7KH 1KGUA 2XKUA 5IP4A 3C09C 2ZP0T 1NAKL 5I6OA 5IHUL 3U1SL 3KPSD 3R7RA 4Z3GA 3BZEB 2DMHA 2I60H 4ONHA 3L3JA 4FN0A 3W81A 1BP3B 4CMMA 1FNFA 2QADD 3ETBF 1G6RH 3L08A 4CVZB 1B4TA 3KPQB 2O5NA 2X7LB 1EXUA 2XZZA 3CFJA 4G7YH 1NKGA 3K8KA 1JRHH 3WY4A 5HDBE 2YFOA 1NC2D 1DJZA 3FQWA 3ZW3A 1R3HA 5IQOA 1PEZA 3G04A 4Z78A 4P9ML 3K46A 5CO1A 1JK8A 3BUDA 2JCCA 4GAYB 4R96B 5INDA 4ZYKA 4YDKH 5ABDE 4APQB 2Q7AA 4FFZA 1LMKA 2XFGB 1LHZA 4V1DB 3HI6L 4PRBA 1Y18A 2EUZA 3FTGB 4W9CC 3STLB 5E6ZA 3LB6C 1LILA 4JFXB 1ETZB 2VR3A 4GAJH 2G75A 4ZUVA 1CE1L 1FHGA 3P3SA 4MTMA 4DJMA 1BEXA 2ZOTA 4ZW8A 4KXAA 1KN2H 1U8KB 4GJTB 5F9OH 3MRQB 2DQDH 2VQTA 3LRGA 5TE4L 4U1HA 3H9HA 4IQHA 4NLHA 4F7TB 5IMKB 3MI6A 2BVPB 3S36X 3QS3A 5FX3A 3QQXA 3H0TA 3VXSB 1XFPA 1S7QB 4FKEA 1OZTG 1HHHB 2Y06H 1YYMH 1GTNA 2H32B 3LTVA 3RY4A 2YPLD 4F8TA 5CKAA 1NFKA 3FT3A 2BY2A 2NOYA 3FUEA 2QELA 4H4NA 2YRPA 4BELD 3E6HA 4UQDA 3HZVB 2QPSA 4HW6A 3SJVB 1T22A 3BD3A 4H88L 2W80C 4DCQB 1TTGA 3PAVA 2WWMD 1TU2B 3B9VA 2V7HB 2V3DA 2VZSA 4W6XB 3V6FA 1QW8A 2G2PA 4CVWA 5C2BH 4IBWA 1MHPL 3RVTD 8FABB 3ARDA 4XTRC 4G82A 4KKCD 1TJIH 1SY6H 2CMRH 3PGCB 4MJ6A 3THMH 5MENB 1JNNL 3BP6B 5EUOE 4PJEF 3MV7A 5C09E 4FXTA 1CJYA 4YSRA 4UBDD 4Q9CA 4X6BA 3WEXA 2DDQL 3IJSB 4X7CC 2CRIA 3IXTB 4LK4A 4EBQL 5JHLH 2I25N 4ZSOE 1E4XL 4CN4A 3FHAA 2D7NA 4K3DL 4WW2A 1THAA 2GJPA 1FCGA 3B3IB 1MQKL 1TVHB 3LKQA 4LCWD 2XTSA 4AIOA 5CKGA 3DUUA 4ZMOA 4GG6F 3SDCC 4PJBA 2WN3A 3OR7B 5HVHB 2BSRB 2J71A 2YFNA 3KVPA 1RZKH 4XVJH 1K8IA 1I7UA 1IAOB 1RV6X 1TG8A 3NSJA 3R8BB 1UT1A 3SKUD 2AEIT 1AD9B 3KS0H 5AB0A 4ZZKA 1G7PA 5KVFL 5J11B 4G6JL 3KLSA 2JLLA 2W0PA 1FLTX 1HTYA 1WBYA 1W0WB 1NC2A 4KFMA 4W4OA 4ZMQA 5KN5B 2R56H 32C2A 4OJFL 4S1DC 3S3DB 4AKOA 3MA9L 1YNKH 3L3HB 3OKMB 1BOGB 4FFWD 4M29A 4YSEA 4PJCF 4ODTL 3TH2T 3ULVD 2DYPA 5TGBA 1PEWA 4AX3A 2XQBH 3I02B 2D7TH 2OXHA 3CSFA 3LKOA 4GB9A 1JYNA 4JRYD 2O6FA 4GUCA 2RFXA 5IW1B 5MEPB 4RGNC 1RQ5A 5KVFH 4N9GA 2J6WA 4QNPF 4YHKH 4B9GA 2YUVA 4MNQD 3SDDB 4EI0A 4HIXL 4JM2D 4R8WH 4MD0A 4U6YA 2EYTA 2WWKO 2GBTA 3MREB 4H1LB 4PGBA 3EFDH 5AW9B 4DN3L 1E3XA 1KENH 1NEPA 2AF2A 3AY2A 3MROA 3RWCB 3K72B 4KZEH 1TF4A 5HGHA 1HEHC 3FFCA 1AJ7H 3QORB 4HUUB 1I53A 5IQLA 3WFHB 4QRTA 2VWEC 1GJUA 2FJHB 4OUOA 3ZQ9A 4Q56A 1QLRB 1YY9C 5AKRA 3BGMB 3D39B 2XFXB 1MHEB 2LU3A 4Z0BH 5IV2A 4GSUA 1MEXL 1JI1A 4YPGA 3FQ2A 2OSYA 2ESVD 2NZ9D 3PPSA 4QY8B 1VZIA 3DMMC 1ID5I 2NR6A 3KBPA 4IJ3B 5C0AA 3UP6A 1I9IH 1MHHB 1HNFA 4MMYA 4PJHA 4YK4C 3GBEA 4DPBX 2X4QB 1R3IH 3NDZE 5B39A 4HYTB 4JRXA 4B27A 1T6BX 5DJ8A 3FSAA 3OSVA 4NQEA 3L8QA 2VQ1B 1QA9A 3VXPA 5I71C 5EZOH 5BW7A 3PHOB 3VXRA 3ME0B 3GSUB 5HYJD 3T9WA 4GKZA 3BPOC 5DJCA 2HCZX 1T0OA 2VL5B 2R7EA 2XWTA 1NBVL 3KYMA 3VFPB 2UVFA 3L6FA 1FAIH 1SDYA 4A7UA 4PJ5A 3ARDC 4JO8A 3R0NA 3TIEA 3NJMA 3UYRH 4JG1H 4XPAL 4KY2A 3PIQB 5KSVB 2CBPA 1JNLL 3ZKXB 1W9XA 3HMXA 3TBTA 1Y0LA 3HS0C 2AXGA 2ZKHL 5HHNB 3ZRFC 3DARA 5E6SB 3AQDA 3FRPB 4EZJA 1OP9A 2DWSA 2JI1A 5ESAA 3OKLA 2QSVA 4IRSC 1H3GA 3EDDA 1J1OH 1BWMA 4CKVX 2P8LA 2L0DA 3ESNA 3PPEA 3QQDA 4M7KL 4Y4HA 1JTOA 4NXKA 3QZMA 1CDJA 4LMQI 4JHBA 4WTZG 1D7BA 3X3GH 5ENWA 3J27A 4XP9H 2PN5A 5GGTA 1QEXA 3N43B 5FYLD 2R2EB 5LCVL 3HC4L 3IU4L 2MIZA 2WC7A 2YHGA 1K85A 5LGHL 1EFQA 5FXCH 5FOBB 2B1OA 4PW3A 4YE4L 2VXUH 5TE6H 4F9PC 3O3EB 3DPBA 2ZUYA 4Z7OB 1M7UA 4LPVA 5D1XD 1UEYA 4UAHA 1PAZA 4JFFD 3DMMA 4CDGC 3ZKNC 3KL5A 5GS0L 5E6UB 1D2OA 1NFAA 4AUYA 1RHFA 1QRND 4JKKA 1A7QL 4U6HB 3V9CA 3C60A 3NH7L 4XB8A 4C58B 1ZA6A 5D7LA 1VFUA 5IKCB 2MJWA 2Y24A 4Z7UA 2X6MA 3BN3B 5D7JC 5HGAB 3ZO0A 3OVUB 4PWEA 4HUVB 2X3CA 1AGFB 1XGUA 4PPTA 1HHHA 4LARH 3RWGA 2OCFD 1DVTA 2VWEE 4NNYA 3W39B 2E74C 1V05A 2BFVH 5JR1H 1UD6A 4FEMA 1AHKA 1MFCL 1QQDA 1PX8A 1ZVSB 3QUKA 2XPYA 3H9YA 2BVOA 6PAZA 5JIQA 3HRZB 2B5IC 1JWUA 3T8VA 2BS71 4MQTB 1JGUH 2WVTA 4FOMA 1MFVA 2H1LM 3MBEC 2WBJA 1FNEA 2MWCA 2R2BA 3CPLA 1PD0A 4MLSA 4M6NL 5JW5B 3QG7H 1FFOA 1IJ9A 3SGJC 4K73A 3PL6B 3HBGA 3TCTA 4QYAA 1FV1A 3ULUF 5LBSA 3KPNA 3NJIA 2VM4A 2IWEA 2WY3B 4X99B 4H1LH 3LZFL 1TZAA 2P8PB 3KS0J 1UJTA 2OMYA 5CJXA 3C5SB 3JT0A 2ESVB 3DTDA 4CVZA 4JFOB 2MOVA 1AY1L 5JPNA 1S4IA 1JF1B 2FATH 4F24A 5EN2A 5DMGD 2IGFH 3VRJB 4DP5X 1IC4L 2EEBA 2J4WH 2ORBH 3ASNB 3D4ZA 1T3FB 3DX0A 3G9AB 3IDUA 4QXGH 4R5VA 5EORH 2HJLB 4ZBJA 3MLVL 3BUIA 3OXSB 2ZOUA 4MAYA 4EQ2A 3IDIB 1NAKH 1MWAA 5IHUH 2XN2A 4A66A 5ID1A 4Y1AE 5A3IC 3DXAB 3G9VA 1N8ZB 3KAAA 1ZSDA 3BE1L 3HC3H 4OGZA 3FQNA 3U2JA 1I7UB 1IAOA 3L81A 2Q8AL 3RWDA 4B50A 4JFDE 5DJ0B 5B38G 5GGVH 2BHUA 4OKVA 5IBUB 4MAYD 5JHDA 1HOEA 3AVEA 1G7PB 2PNDA 2VRKA 3ZL2A 3Q2VA 1AIFA 4M1GH 3ORJA 5JLZB 4R7DB 5MEQA 3BEWA 2JF1A 2VSCA 1ZXKA 4Z3EA 3GZOA 4HBCL 3GIVA 4FZEH 4KMTH 4HSQA 1A6UH 1ZY9A 4YDJA 5ACMA 2XKSA 5KN5A 3NCWA 4WFGD 4F7TA 4NO0A 4XRCA 5EOCH 4PJIA 3D05A 3FU7B 3ULUL 1BBJB 4GQZA 4Y5XA 5C0BA 1IQDA 4OI8A 5TGBB 3QUXC 1S7QA 4I2XA 4OFQA 1UKSA 1IM9D 3NP3A 2QGEA 4OLXH 3CU7A 5IUSA 4X4YA 4PJIF 3MRKB 1DN0B 2Z7YA 4X7SL 1KPVA 1A7RL 4N2BA 4N9GB 3ZVVA 4MQXD 3WFBH 1A6AB 4FA7B 3GTVA 2HA1A 1F4AA 3HVNA 4V2CB 5L6YH 4PGCB 1S2EA 1TJHH 3UTSE 4G5ZH 3F7YB 4Y4KA 5TD4A 1FNAA 3UTTA 1E4JA 3VGDA 1P53A 8FABA 2BHZA 2EIBA 3BZ4B 1I1CA 2E59A 1X7QB 1F1DA 3GPSA 1QWHA 3IRCA 2CKBL 2UZIH 4OZFH 1TTCA 3HS9A 4UM9D 4YHKL 2B4CC 4FMFA 3V52H 5HYJE 2A73A 3WIFA 5JR1L 1JV5A 2NNRA 2IFGA 3ESPA 2CWRA 3MV9E 2DJMA 2YGOA 3FCBA 4EOWL 1OM9A 1CFBA 1CTMA 5G4NA 3WNLA 3LD8C 2H2PD 4IOSD 4N0UB 4XXWC 6FABL 1T1ZA 4HKZA 4WJKB 4LCCB 4CBPA 3OKOB 3SZ6A 5IFHH 1YPZF 2X4UB 3KE0A 2F6AA 1OAXL 4GKLA 4FJYA 1ZV5A 1T2QH 4ZMZA 4WEBL 4FTVB 4D9RE 5IEHB 4E9SA 1NGPH 4ODSL 3KJ4B 3VSVA 3ARGA 1A8ZA 4IKKA 5C9JB 3QCVH 1OP3H 5IVXB 2DTML 3WSQH 3MV7E 4LL4A 1N67A 3QEHA 3VQ2C 2J20A 1ZE3H 4MZ2A 4YSUA 2FQFA 1R6VA 3LQAL 2ADIB 2V33A 4PY8J 4PRIB 2ZX5A 1VADB 3QSKB 3EYFB 3OZLA 1E67A 3TXAA 5J5EA 1U3HD 3NFSL 3WL9A 1NSNL 1RUAH 2IH3B 5JHLL 1SDDA 1K72A 1OOAA 5DURB 2DQCH 4RSYA 2RFXB 4ZFGH 3VXTB 1YMHA 4TMPA 3TBSA 4BGDA 5C3TA 4RISH 1HKLL 3EDJA 5ENWB 4CW1B 1F41A 4HXBL 1V10A 2AK4B 3RPKA 1NMCB 5E9DE 4FQPA 1JNLH 3DSNB 3GEWB 3DI3B 2WXKA 3L5WB 3WXVH 3AG1B 2X2YA 2HX9A 4A1RA 3B37A 4POZD 3GJFA 5IFAH 1KCLA 3NSCA 3DRQA 1J0KA 3BPCA 2DLFH 2F0CA 5TDNA 3MJ9A 4LSQL 4HBQA 1U8CB 3KGTA 2YA2A 2QGCA 4HC1H 4UIMB 2J2ZB 3MJ7B 4JO4L 5FYKD 4E2OA 3H53A 3EJCA 3IGFA 3ILEA 3OC8A 2Y6SD 4NCC2 3FO2B 2BSCA 1IFHH 3GEFA 3NCJH 1ITBB 2NX5B 4JZJA 4OIFA 5FYJE 5DA0B 3ZL1A 4HK3N 3FYEB 1KY6A 3EUDA 4OZFG 3PL6D 2TAAA 2OI9C 2BZ7A 2Y36L 2YMTA 5JYMA 4YHNA 1MJJB 3D69A 3SOBH 2VR4A 4FQ2H 4HCRL 2HG5B 3IE4A 3L2NA 4GH7B 4LVNB 4Z0BL 3ZN6A 1UB5A 3ATAA 3QI9B 1HINL 5AKTA 5DI8A 1RD6A 3MBEA 4HPHA 3RB5A 4MA3B 3LPWA 1O6SA 4WFFD 4Z3IA 1YAZA 3DO7A 1JTPA 3MJ9L 2R0ZH 5T1KB 2ZOKA 4M7ZC 1C8QA 1NGYA 4XHQA 3VQMA 1VLXA 1E8WA 3WFDL 3MUZ1 5SWQB 1LE9A 1ZTMA 3TBTB 2CLZA 5GHWL 2GJRA 3A4DA 4W4NA 3VW3L 4OLYL 1NMAH 2CCWA 4O5LL 3GI9H 5ESAB 5IHZA 3MLZH 4A6YA 2X4RB 3TO2B 4AYGA 4X6DE 1B88A 5C0BE 2BPBA 2GCYB 4HIIB 4EXKA 4JG0H 4QXVA 1NKRA 1ZDQA 1P1ZB 2EO7A 3BH8A 3QJHA 4OFYD 4B0MM 2NUPB 1JXFA 1MCOL 3IBOA 5BS0B 4WNQA 5L4FA 5ESVA 5D4IA 3KZ8A 3Q05A 1GGIL 1E5CA 1A4BA 2QQNL 5FUCC 1BYPA 4KRLB 5DZJA 3VD7A 2IPUG 2W0FB 4TVPH 4JRYB 4GKSA 3COOA 4FQJH 3TYFB 5EC2B 3GBDA 1PCSA 5JIIA 4QHLA 5DHMC 4F27A 3O6FB 4P2OD 5T1MA 1QR4A 1GOHA 2P43B 4WWID 2VDPL 4OLXL 5FO7A 2VKWA 3TH4T 1F4HA 1KLFB 1IC0A 3HCVA 4P4KD 5D93C 3LDBB 3APDA 3UEZA 5I1AA 1GTFA 4AQAB 3EJRA 1AD0A 1BBJA 5AW3B 5BXFA 1WIOA 4M02A 5D96C 5DRXB 4WTXA 5GGTH 4XAKE 2BSSB 4M7LH 4H0HB 3NZUA 2Y07L 2WQVA 1S5IH 4OM0L 2WIIB 4HT1L 1L9SA 3GBLA 4OF3A 1WZAA 2A6KA 3N1PC 3BAKA 3QXVA 1JPFA 3BZDA 5L2JB 1YEKH 1B2YA 1IGTB 3ZDZE 5A2BA 4F8NA 4X42A 1O7DC 3T0EA 1P9MA 1NFDB 3O3BB 2I5YL 4WWKB 4FQLL 1KYDA 4UOZA 2BW4A 1WO2A 2BIIA 1P4IL 1RURH 1VAHA 2EE9A 1L5GA 5GSRB 1ZWIB 4Y9BA 5JPNC 5EU5B 1KXVA 3CK0L 5AW5B 3S5LA 1XB3A 3FQWB 3O6LH 2HVKA 5D4HA 2NTFB 2N3JA 1YPZB 3ZBMA 1Z3GL 3NBNA 3Q44A 4N2CA 3U0WL 1A4KB 2XPGA 4I5BB 3MCKB 4G1EB 3GI8H 1INEH 1MAKA 4MJIA 3U2SB 2BVEA 5L2KB 2BW5A 2J8UE 2XVKA 3LKRB 3O9WB 5ETUA 4DFHA 2RAMA 2YN3A 3UTSB 1HC1A 5I30H 3VXUA 2WWNA 3G5VA 3RNKA 4IIZA 1N10A 3M07A 2OMNA 5SV3A 5CZRA 4N0CC 5DTFB 4PJCE 4R7LA 3LNIA 3U4EB 4XN7A 2Y23A 5KS9B 3VWJA 2VDML 1YJDH 2CRZA 5CEZH 4UT9H 5GGSY 4CU6A 4R7DA 4PJ6A 1Z3RA 3FB7B 2ARJB 3HB3B 3I9IA 4WDIB 3UXFA 4Z7QF 4U1LA 2PYED 3QDJE 3OAZK 1EGJL 1U8IA 4LPXA 4P4RB 4NWTL 4F37K 5CINH 3CSYB 3D18B 3MBWA 4UNVA 4LPWA 5J4MA 3BP4A 1KTLB 1R3IL 1NH6A 4RMSA 5F1KC 3P2TA 3SGDI 2APFA 5E7BA 4Q9BA 3OQRA 5K1VA 3V0FA 2MCMA 1TUPA 5FA4A 3EZJB 2DS4A 3WXVL 1LVEA 3F5WA 4OCXH 1B0GA 4OJDH 4MDJA 1B4JH 1UD3A 2WV3A 3FHEA 2PKDA 4MCMA 1SOSA 3HS8A 4FZ8H 1RZQA 5FYKE 4OCWL 4PJBF 3CN0A 3DIFA 3KLAA 1MCWM 3KVQA 4HK0B 5IIEB 4GG6E 2QSQA 2RB8A 2E6QA 2ZP9A 2X9ZA 4M6ML 1CFTA 5DRNB 2BY1A 2VM9A 3SDCB 4Y4KB 2G3MA 3ARDB 2BSEA 2BS8A 2IH1B 1L7TL 4FQIH 4PJHE 3EGSA 2J8UF 3C6LB 1A02N 3WFZA 3MV7B 3NPSC 3ULUC 4NQVA 1BM7A 4MQSB 4AGOA 3B2VH 4PD4J 4JAMA 5IVZB 4C83B 1YNTB 5AVUB 4PCTA 3UJTH 2JCCF 1DL7L 4TRPH 1YNTF 5HJGA 3GKWH 1DQJA 1BQHB 2VLME 3LX9A 1O7DE 4FNRA 4TTDD 1F2QA 4UNIA 1Z9SB 5E8PB 2WZ6A 3IMWA 3HI5H 4LDEB 2W9LA 3WXWH 5DLML 1Y1UA 7FABH 3I6KA 1HCZA 4BA8A 2LAGB 3N55A 4JJ5B 3UTZA 1O9ZA 1UD4A 1MPAL 1T1ZB 1NBQA 3U1PA 2A6DB 3MV8B 3STLA 3U6XS 4XBGA 4F57H 5J57B 5E9DB 4LRIA 2GIYA 4FTVA 4DQAA 5IEHA 1RZ8B 1PZSA 1QATA 5D1ZI 1JUFA 3CIQA 1EEUA 5E7FA 5KVEH 4JDEB 4N1EA 1JTTA 5KJ4A 1AANA 4U1HB 3TTSA 3BVVA 1KCRH 1SY6A 3S8GB 2YGQA 5IT2H 4LLMA 4YSAA 3GI9L 4LXFA 2YRLA 3WOVA 3BKCL 2R2HB 4QT5A 1U8QB 1QBMH 2WUCH 1JVOA 3QG6B 1QRNA 3ARFD 2C9RA 4N0RA 1JHKH 2DEWX 3ZRSA 4XCEB 1LWRA 43CAA 3MV8E 3WL9B 5MEPA 3OJMB 5KSBA 2D3VA 5BUGA 5DQDL 3KPTA 3NAAL 1CBVL 1VPOH 1JBJA 1SZNA 1PG7L 2D3NA 4LEXL 5EEZA 5I73B 3ROLA 4HWEH 1QSED 4TVPL 1TENA