3RLSA

Crystal structure of yeast af-9 homolog protein yaf9
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
152
Chain Sequence
IKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSLERPHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9 homolog
publication title Crystal structure of yeast AF-9 homolog protein yaf9
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 152
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rlsA00
5HJDA 5D7EA 5HJBA 2L7EA 5IOKA 2NDGA 3QRLA 4TMPA 3FK3A 5IQLA 3RLSA 2NDFA
chains in the Genus database with same CATH superfamily
5F9JB 5IVXE 3DRTB 3O3EB 1DQDH 1A6WL 4HH9A 4BJLA 2ICEA 1UZ6F 1N8OE 1O5DT 4UAOB 4ZSOB 1SRDA 1J5CA 3R0NA 1QSZA 2CE6A 3HPJB 3UGXA 2OP4L 3WS3B 1BLNA 4R4ND 1TJIH 3R0MA 1FPTH 1G4RA 5LDUA 3PFUA 3I6SA 3QCVH 2V2TB 2BMKB 1ZT7A 3D39B 4R84A 2EYRB 3HMWH 4C83B 2AABH 1EHNA 4TPRL 5FFOA 1JGEB 3QJSB 3NJGA 3L6FB 4Z7VB 2WYZA 5T33H 2AZAA 3FQUB 3RGVC 1D3CA 5GXBB 3FULA 4ZUWB 1GPOH 4LRIC 4LLYA 2K9UA 2YQ3A 3G5ZA 4WUKH 1W0VB 5IR1B 1RULH 1UEMA 3QUHA 5IESH 3KPLA 4GB9A 4XAWH 2AQ2A 5LKNA 4ZT1A 3UDWA 4ONOA 2B5IB 1LO5B 1YEEL 2ZWNA 3T77A 2CM5A 4MWFB 1S78D 3WKQA 3B9VA 4XN8A 1W91A 1KCKA 4CVXB 2MCPH 2XN9E 3T4YA 1LDSA 3BPLB 3QR2A 3RDJA 1MWAH 3QEUB 4KGLA 3IWUA 1A4CA 1AXTH 3DROB 1FNGA 1UZ8A 1IC5L 1SHWA 1J5OL 3HC0B 2AJYH 4LEBA 4NJ9H 4M93C 1ITCA 3V8OA 4LNRA 5KSAA 1IUZA 4PR5B 4HP5A 3G6AA 2H3NB 1I1CA 1WQVT 1BOYA 3L5WB 1TQCC 1XHHA 5LHDA 5FYJL 3MAWA 1LP9F 2A6KB 4R5VA 3PJLA 2W92A 1D7FA 1OE1A 3MLVL 1Q94B 1DLHB 2NY3C 1MHCB 5J5EA 2VJ8A 3E2HC 4KUCF 3BFOA 4UF7C 2ZSVB 3EH5B 3MFGB 3QZPA 3GSUB 4WJG3 5A7BA 2ICES 2AMGA 2XPYA 4B9PA 1BMWA 4YGVB 4HW6A 1NIAA 4LSQL 5DUBA 1S7RA 2CAKA 4AGQA 1AP2B 4P46B 1TXKA 2ADFL 2QSVA 1DE4A 3UMTA 4OF3A 2YLKA 2MEJB 2O61B 1WBXB 3P73B 5DZ9A 4IOIB 1SFDA 4FJYA 5SWQB 1EHLH 4RRPM 2VDLB 3QYCA 4GO8A 1JV5A 5EO0A 3BYTA 1LO3H 1DQTA 4L9LB 3HB3D 4AGNA 3BQUB 3T5WA 4XPFH 2H1PH 1N0LA 4YK4B 3THML 3TURA 2BP5M 3RVWD 4HF5H 1HWWA 2CO2A 2VQ1B 4JFHD 1MHPH 3MCG1 5GS2H 1ZDSA 1U8LB 5JYMA 3FZUC 4GT0A 2NY4C 4MQXD 3X3FL 3GJFB 1AI1H 2OA9A 4ODTL 5BRZE 3MRGA 3J2PA 5TH2B 4EUPH 2R29H 5EZIL 4F57L 2BP3A 1YDPB 1GJIA 2EVJA 3B2UD 4YZWA 3FAXA 2NY0B 3MGAA 2HX9A 4NKDA 2HKAA 4K71B 4OIIH 2YAHA 5A2CA 1NCUA 3F58L 3O2DA 3NIFE 4F15B 4UMSA 3HR6A 3I75A 2V3DA 2V8LA 2WXRA 3AU0A 1PD1A 2R4RL 3MLZH 4JY5L 1QYGL 4CMMA 2GJZA 3MBWA 4MDIA 1HHJA 3QHZL 2I5YH 5D1XE 3CZFB 1UYWH 4MXQC 5D7LA 3KPQB 3NJMA 2NDFA 4HCRH 3CHOA 5AUMB 1SLVA 1UEYA 1XR9B 4WW1A 3VXTB 3WKML 2H2SD 2ZUYA 3QNZA 4LDLB 1ZTXE 3RDTD 4R0LA 1X4XA 4BZ2H 4AQAA 1VENA 3QQNA 3BIAX 3QG7H 3V95A 4K5LA 3T0BA 1EX0A 2ZE0A 5B7EA 1HHHA 3TBTB 1SHSA 3P0VL 1OSZB 4XBPA 4FMVA 1GTFA 4PJHA 3DUHA 1WDAA 5SX5K 1EHXA 3FO0L 5DD1L 3JV6B 4CKQA 1A6WH 1K2DA 2FHCA 4WWNA 3UROR 3IE9A 4ZXBD 5TPWL 3VDCA 1AQ8A 2WQSA 4LKCB 3GXDA 2F61A 5DSCA 5KG9A 2OP4H 3N91A 5GJSL 3W57A 3FQXB 1VSCA 4LSRL 3REVA 3WO4C 2O93L 5FUOL 4H7VA 2RB8A 4KI1A 5SWZD 3O4OC 1U58A 3JV5A 5TDOB 2H6UA 4TPRH 1JPSL 4JBSA 3KPTA 4N24A 1F58L 4G8GE 1R19A 2YPKA 4XCFL 2E7DA 3VQ1C 1H3UA 2HXAA 1MI5A 3A23A 3G5YB 1JUFB 1FHNA 3P30L 5JDSB 3ARGC 3MKGA 2WVVA 4X0KA 1K8DA 1N3NB 5I71B 4I89A 1X5LA 1UCTA 2EQDA 4AVKA 3TH4T 1YEEH 4F8LA 4NZRL 1DHKA 1FZJA 1HCYA 4XE5B 3KGRA 1GA2A 1SGKA 1IQDB 4QJ3B 3APFA 2OQJB 4IRJA 2AMUA 1ZT4B 1G9ML 5BVJA 4A66A 3VXUA 1PW3A 1L0XA 4KJQC 5I1DB 3QUXD 1IC5H 3VXRB 1J5OH 4QKTA 3OR6B 4OJAA 3GB7A 3GZKA 2WV3A 5DEJA 4NENB 5T3ZL 3WBDA 1AG0A 1NFDA 3OKOB 3P4LA 4QXTB 2BOCA 4DP0X 3DIDA 1B4RA 3O6FB 1UXLA 3OKLA 4B60A 1CDUA 2A6DA 4IDJL 2H32A 2FHFA 3MHZA 1CICA 2XVBA 4X6BB 1YN7A 4P2RE 3V79C 5DZOA 1PZ5A 2FJHA 1FHGA 1N64L 5KVFE 3QA3A 5FYJH 1DN0A 2V9TA 1T3FB 1MUJA 4Q52A 4QRSB 2QPEB 3ZKSD 2I9TA 3MLVH 4Z5RA 4JG5A 2WSKA 5IB4A 4G9DA 5FYLL 5LXVA 1C12A 4LCYA 2VLKE 3BO8B 4LSQH 3V4UL 4XX5A 2OXGA 2D9QB 2H3XC 2EECA 1WA2X 1XDTT 2ADFH 1ZD6A 4NO3B 4PRIE 3ZE1B 4AENA 3MSPA 4FQHB 5L2KD 4JR9L 2J12B 5C0DB 1AD9A 2E7HA 4AEIL 5K1NA 5IHZA 2VR4A 3AT0A 4B3EA 5KZCD 2F08A 4Z6AT 1HH9A 2BNUA 2ZOWA 2FHBA 3VXMA 3M8OL 3THMH 4YSEA 4ANWA 3FQ1A 5I16B 3T2LA 2CLZB 4OJDH 5LGHL 3ARDD 1YN6A 3TV3L 3TIEA 4IKJA 5HVFB 2YQBA 3N50A 3NQIA 3TNMA 3QDMA 3X3FH 1SF5A 1KDJA 3G3LA 1FYHB 3JWDL 4ODTH 3ARGA 4Y4KA 1U92B 2R1WA 4NUQA 3TYGL 5ANME 4X4ME 5EZIH 1LLAA 3SZ6A 4IMLB 4F57H 5IJVB 2ZP8A 2Z35A 2DIJA 3QWNA 1LEIA 3GEFA 4LOUD 5GSRB 5EU4A 4M02A 1ZHKA 1R3IL 3LPOA 5DQ9B 4KDTC 2N56A 3RX8A 1KGCD 1SOSA 2AVGA 3NJHA 3F58H 4PJCF 4KNSA 1IARB 5IUCA 5AD0B 3AG2B 3O45A 4Z3HA 4XMWA 5HY9B 4AJVA 5IQMA 4YSSA 4FG6D 3B7SA 4WI6A 1IM3D 2FE0A 2W07A 2DQFB 4NRYA 2R4RH 4JY5H 4OGAD 43CAB 4Q9RL 1QYGH 3QHZH 3D69A 3II1A 1SOKA 3WY4A 1MCDA 4PJIB 3DK2A 5I6PA 3IFPB 4B5ZA 2R23B 2YA2A 4QHKI 2WSDA 4YPJA 3WKMH 1C08B 4X7DC 2HG0A 4KMTL 1A02N 2CDEB 2YMTA 3CFNA 3KPMA 2R29A 4MNQE 4RGND 4AUUA 1RZPA 4UOQA 1AGDB 4JKWA 3QFDA 3WY1A 4KBPA 2GC7C 2VN4A 5L2JA 1U8NA 4CDGC 1HE8A 1FL3A 1F6AB 2JCWA 3P0VH 1IIKA 3UABA 4PJ5D 4UT7L 2IBZY 3FO0H 5DD1H 4BFGA 4LPUA 2CZNA 1LILA 3E1ZA 5TPWH 5AKTA 4AVHA 3DHPA 4EDWL 4ZRGA 4XRCB 5GJSH 4N8PA 1WFNA 1BBJA 3EKCA 2XVLA 3ECQA 4KX7A 1A6AB 4LSRH 4Z18A 1D7DA 3TFKD 3FO2B 1SJXA 5FUOH 4PJDB 5CFAA 5J06A 3B2VL 2JKJA 3LH2L 4E36A 3KPSA 3QW9A 4L3AA 1JPSH 2FJFA 5TGBA 4BGLA 3GJEA 1ETZA 1F58H 1N67A 2FQGA 1SJHA 3FTXA 4HUCA 4BZ2A 5GGUB 1WIPA 4XCFH 1KENL 4JO1L 5F9DC 2J4WL 2LU5A 3GZQA 3IMSA 4N8UA 3VSTA 3KMDA 2XG4A 3B2DC 3P30H 5E8EA 3CPUA 5E8PB 1FO0L 1W6LA 2BIQA 3LXAA 1IX2A 4L5FE 4R2GC 2NPLX 2NXZB 5HHOD 4NZRH 3AABA 1S7VA 4FXKC 4UDUA 5D1ZC 1E65A 5DK2B 1HYSD 1I3RB 3FQRA 4YPGB 5LCVL 1SQ2N 2EDXA 3VGBA 4EQ3A 5KSUB 1U2HA 1VFAB 2VC2B 5B38A 1G9MH 3VE0A 1GL4B 3U83A 2DMKA 2ATKB 1WG3A 5B1JA 3CQPA 3MRJA 5BS0D 5F8RC 2QGBA 4JCMA 4HS6B 3K8LA 2YLHA 1HZKA 3L48A 4DKEL 4U1KB 3S3DB 5T3ZH 3Q2CA 3MNDA 2D7MA 4KZEL 1KACB 2MOGA 2FH8A 4YHZL 1PLBA 4H1LB 2VCOA 4IDJH 4WI2A 1QBLL 4Z1PA 4J3VA 2Q3XA 1A1MA 1N64H 2WIIB 4EBQL 3SDDB 5JNYB 4C4UA 3LOWA 3MV9B 3NSYA 1FIEA 2HRLA 7PAZA 4AK2A 3F05A 4BSVB 3UBXB 5FYLH 3UEQA 1KCVL 3DMMD 3LHAA 3V4UH 2CBTA 4KI5D 2CMRL 5D96C 1OP3K 5AEAA 5KYUB 1NFIB 2NY6C 3C6LB 4XNYL 1XTMA 4OCXL 3EG9B 3L9RA 4JR9H 4AEIH 1P7QD 1ZVYA 1MCPL 2C26A 2GSMB 1T1WA 1MLBB 4R3SB 2Q0ZX 5AVXB 4X7EC 1SVZA 5IJKC 1Q72L 5GRVL 4AIZA 2EDNA 3M8OH 5EU3B 2WLMA 5B8CC 3NA9L 2BDNL 5LGHH 1JPGA 1E3XA 3TV3H 5ACZA 1QRKA 3VSQA 5SWSE 2WLLB 3JWDH 3KPOA 5KSBE 1T83C 3MNZA 4HMEA 3BESR 4LEXL 3TYGH 1J88A 5I75C 3GSVB 2XPGB 3FRPA 5JA8B 5EC1B 4F33B 3Q2VA 5CSZA 5D1ZA 1ZLWK 2VSDA 1CG9B 1X7QA 4P3CL 3CTTA 1R3IH 2JWYA 1KIQA 2XUWA 3ZK0A 2W0LA 2OMXB 3D85B 4X4YA 5JOEA 3N1GC 3ES6A 5AB0A 2V5SA 4PS8A 5IFAL 3GBEA 1L5GA 4X6EB 3UTSD 1FC2D 1X9UA 1I1FB 2KZKA 2VM9A 4WTZA 2ZP0T 1HH6B 1DQJA 1EXUB 5FGCB 4Q9RH 5L7XL 4XMXA 3CVIL 1XL4A 1HHIA 2KZ1B 3V5DA 3POCA 4ZW8A 3FTSA 4OF0A 3V0WL 2VW7A 4QNPE 2X6BA 1NCWL 3C8KA 3FF8A 2DD8L 4HJ0C 3QJVB 5DK0B 2VMJA 4KMTH 4APQB 4DPAX 4E9RA 5L8KB 4PCYA 4R7NA 4RDQG 3OXRA 3HE6D 2P42B 3NOIA 4AEFA 1TQSA 4OLXL 2HN7A 5BV7L 2GAZB 3RFZC 3QJHB 2G2RB 3RJDA 4ZG1A 2YSTA 4MJHA 5HP5A 1PLCA 1TO5A 3PP3H 4X7CC 2QLVB 2V7NB 5E1GA 1PZUB 5DEFB 4UT7H 4NOFA 2QQLL 1G9MC 3RIFF 4H44C 2IH1A 2IWEA 3MXVL 4HX1A 4UINL 4EDWH 4G6ML 5F7KC 2VB5A 5LNEA 2IV8A 3PNRB 3GM0A 2UWEB 4DGUA 3EBAA 1U8KA 4NT6A 5T1MB 4BK5A 4UTAL 2SODB 1ZS8A 4N8VB 3LH8A 3R7RA 4QIRA 5JXED 1ZS2A 1YQ2A 3B2VH 3LH2H 2VDMB 4M3JA 4XPGL 4FD0A 5FF6A 3BZDA 1LVEA 1R24A 2WN3A 4ODXB 5C2BL 1DLFL 2ITCA 4DQAA 2OSLA 3MBEB 3AW5A 4ZUTA 4ZFOB 3D07A 4QT5A 4HWZA 3CFEA 1KENH 3GXIA 4JO1H 4A2GA 3ULVL 5MEQB 5DRWA 2J4WH 2VE6B 1SBSL 4ISVB 2XV2A 4XPHL 5DZJA 3MX0B 4DETA 1T83A 3B56A 4ODHL 2CALA 2OXHB 1FO0H 4MJ5A 4WV1C 3ULSA 1XXDC 2BFVL 2PTVA 2YJLA 3R4RA 4K94L 1D6VL 4ZZKA 4QDGA 1HEZA 1U30A 1JZ4A 1U8OB 3HRZC 4I5BB 1CL7L 1TZGL 5E95B 3AXLB 2F8OA 2CIIB 5LCVH 4JHWL 2F54D 3VD0A 5GGRY 4LZKA 4PJFE 1HT6A 2H8PB 3EDDA 3VFVB 4OM1L 3PHOA 5C0JA 2GUYA 2IAMC 1NMBL 1GVIA 2C1PB 3L4WA 5AAMC 4U4BA 5JOPD 1QR1A 4DKEH 4HWBA 4JO3L 5KN5A 2LT9A 3NSDA 4B0MB 3QC6X 3OZLA 4XMKL 4AQEA 4KZEH 3L4XA 1S7QA 5DJAA 3EHBD 3U6RB 3QIBB 4OFKA 1I7ZB 4YHZH 3GMLA 2PXYA 1J5DA 2WK2A 3DV4B 1QBLH 3DSFL 3JWDC 2AFNA 4B6ZA 1NLDL 5IKCB 4EBQH 4N0CC 4GAYB 4J4PA 4NUPA 1IB5A 2A5UA 2KPWA 3GBLA 3BZFB 2YAPA 3WGVB 2UY7A 1B2YA 3GSWB 4P5MB 4HIXL 3V0VB 1AZVA 4ELME 1RK0B 4U6HB 1UKTA 4O51B 1KCVH 1UB6B 5DEGA 2DJMA 2B20A 2Y5EA 4HJJL 3SIKA 2Y07L 4QRFA 4JRXD 3V7MA 2CMRH 1KEML 3WKNA 1KGWA 1SDAB 2ZUWA 1XGRB 3HNSL 2W65A 3PWPD 2GHWB 5EIQA 4XNYH 4OCXH 1YNLL 3RVWC 3KR3L 1JV2A 3LRSA 1FGNL 5ABAA 3PYCA 4PGJA 1MCPH 4LFHD 2LV4A 4IQHA 4A6YL 2BC4A 3JTSA 4PRHE 2E6QA 3KLLA 4JFXA 1M2OA 4KKLC 1G7QB 1Q72H 4MQSB 4OZGE 5C0FB 2A9ML 2X2JA 3VD7A 3WEXB 3T6QC 4WW2C 3NA9H 3DX8B 2V33A 2BDNH 1AKJD 2EZ0C 2VLJD 3DX2A 3OWEA 4PGDA 4G83A 2NY1C 3Q6FB 4K7FA 3KM2A 1Y18A 4XCYA 1UJTA 4MRBA 2CRZA 4LLDB 3OMNB 4S2SA 4GI8A 4LEXH 2H1XA 4FA7B 3BP4B 1EEYA 5ICXB 3S3JA 3IMWA 2HKHL 1LXMA 2OBGA 3SDXB 1TSHA 5JW4N 1MHHA 2VAAB 4P3CH 1E3ZA 5DJ6B 2IOOA 1UB5A 3H0TA 3HUJA 2GSIB 1N0XL 1ZV9A 2YAMA 2PO6C 3H55A 5IFAH 1EJ8A 1QLEL 1UCBL 4FXGB 3BWAA 1MCRA 3RX7A 3GK8L 2H2SC 3MV8E 4RMBA 3LQZB 3RDTC 2XXCB 1ZXKA 5L7XH 3EOAA 5JO5B 3CVIH 1Z2KA 4PTUB 3UERA 4FABL 4GG6B 4KY1L 3V0WH 5JHAA 5IB3A 4ZS6C 3GTTA 4OFDA 1M71B 1NCWH 5AZ2L 3L17A 1F00I 2DD8H 3DOSA 1CLZL 3OB0K 2L7JA 2YUXA 3V6ZA 4OAWB 4NQDA 4P5RA 1U9KA 3IFLL 2AK4A 3FONB 1YLBB 2ED7A 2HT3D 3BKJL 2EKSB 4N2OA 4OLXH 4LNVA 4AKPA 2TSBA 4OKVB 2ITDA 3T04D 3VI4E 5BV7H 4YR6A 1BLIA 5CHNB 3KVDD 5IK3B 4L0YA 1CI3M 1NOAA 3FPYA 5AW8B 3QFJE 4CC0A 5IJDC 2JVUA 2VXTL 4FLRA 3LV3A 3STBA 3I6LE 2W9LA 1KJ2B 1S7UB 1TQWA 2YZ1A 3EFFB 3F00A 5IQLA 3TEUA 2QQLH 3I9AA 2M83A 1I8KA 4UINH 2R39A 3L4TA 1BJ8A 3MXVH 5E8NA 3GRGA 4G6MH 3RGBA 3SJVD 4CILA 5HYQB 1T0NA 1Y1DA 5FC9A 2P5WB 2PWEA 3MRQB 3ZKXC 4WCYL 2QR0B 5I1LB 4JGMA 2QJDA 4MXWL 3RYMA 3C5SA 1RPUA 1IJNA 5DU7A 2GUOB 4GAJL 25C8L 3MV7B 4MJ6B 5F6HI 4YHML 4XPGH 1DO6A 1KB5B 4KO6A 5HVHC 1WSST 4WW2A 4F7EA 5C2BH 1DLFH 2JTDA 4R4BB 4EN2A 2P5ED 4FNPA 4LSSL 2P8LB 5KBPA 1HDMA 5DUML 4GSUA 1XGUB 5DHVA 3ULVH 4NYLB 1BVKB 4XP6L 4D0BB 2FBRA 4OLZL 3KBEA 1HINL 5DZPA 5T3XE 1SBSH 1T66D 3T4AA 5CD5D 1CTOA 4QTHA 4XPHH 2VISA 4ODHH 1UUSA 3BUIA 3LNEA 1AC6A 3T0EC 3PRZA 4KH2A 5JR1L 4RGMB 3BGAA 2FX8L 4UTBL 3H4FA 3EO1B 2BFVH 3QZLA 4GQPH 4K94H 4UV7L 1D6VH 4IJTA 5IOPA 1KBGL 1CL7H 1TZGH 2AJ3B 3MRDA 4J3OD 1P5UC 1NC4B 1NAMB 4W9GC 1NBZA 4BEIA 5ISZD 4JHWH 2GJ6D 2PO6A 4CU8A 3CZNA 4KK5C 3L4CA 3UZVA 4H13C 1RJZA 3R18A 4OM1H 2IH8A 4HIHA 4KK8D 3UTQA 1NMBH 4CC4A 3RDTA 2EVHA 3I02A 4BQBA 1NCNA 4JO3H 2G30A 2E46A 3E0GA 1JGUH 1XXFC 4XMKH 5A6MA 3TESA 4FFVC 1OP5H 5IB1B 3KLDA 4M7JL 3DSFH 1FDLL 1FFRA 3O9WC 1NLDH 3IBOA 3GHBL 4EKXA 2F5BL 2BHUA 2CLVB 2Y25A 1JWSB 5JHBA 4NZUL 1FGVL 2X1QA 1Q9OB 2DMGA 2ZCLL 4HIXH 1SXSA 4ODWA 5MERA 4D7BA 1TEFA 4DJMA 2Q86B 3WJLA 1RJCA 3B83A 3MZGB 3ZE2E 4EKJA 4HJJH 1G7IA 2Y07H 5EUOF 5E9AA 1Q1PA 1KEMH 1Z7JA 5CP7B 5SWZA 1MIEL 3HNSH 4EE2A 3O11A 3KWWA 3BIKA 1YNLH 1AQKL 2ZKWA 3HG1B 3KR3H 3MCYA 5F9OL 1H3WM 3SPIA 2YBRA 3L4VA 1FGNH 1KIPB 1IBYA 4WIQA 4JM2C 5I0XA 4BFKA 4A6YH 3AG3B 4HXBL 1KNOB 1BHGA 2VLLB 1PSKL 1I8AA 3O3DA 2A9MH 3DPBA 4G6FB 2HG5B 4PD4J 5J1AB 2Z31B 5GSVB 1OB1A 3T3PB 3SBWA 1O6TA 3WFZA 3QJTB 5IQ9A 2ZUQC 1MVUA 5BV7C 4N68A 2NUTA 2GSGB 4WW2F 5EBWB 2Q7AA 3S4SA 4RQQB 5GGTA 3VMNA 4C4KO 3NCBB 1NUDA 1ZHBB 2V5MA 4PWJA 2KYIA 4KMQA 2WOYA 5MI0B 5CUSL 4A39A 4K5NA 3REWB 5C0CD 2HKHH 1MW3A 1D9KD 3GPEA 3DTUB 3ZY7A 4G7YL 3QUXA 4AQOA 4ENED 3GIVB 1B0RA 5JLZA 1JF6A 2FWSA 3QP3A 3W37A 1MNNA 1N0XH 2XTJD 1JRHI 3QZWB 2MCG1 3VQLA 2ZXCA 4AV0A 2XVGA 4ZTOL 1QLEH 1UCBH 1EV2E 5HGDA 2PW2B 3CBRA 1MCBA 4B5EA 3QAZC 3ARFC 4OZFH 3GK8H 1EA9C 4HDIA 4UBDC 1CBJA 1SYVB 5IJCC 4FABH 4YC2C 4KY1H 1A0QL 5JOFB 5EHFA 3ULVC 1IGTA 4WK2B 3U6XA 5AZ2H 2JCCE 4PLOB 1CLZH 3SE9L 4WWKC 3B7RL 4BSWA 4HUVA 1J5IA 3S5ZA 4JFED 3A67L 1AS6A 1WGVA 3E80A 4JY6B 3WJLC 3IFLH 4FLHA 3BKJH 1UTDA 3V5HA 4ETYA 4K94C 1KB9J 5E9DB 4K2UL 5J0BA 4EVNB 5L2KA 1F1DA 2VXTH 3NJJA 4KFMA 1RZ8B 5MENB 2CUMA 3GMOB 4IHBA 2GTWB 2JB5L 4TVPE 4J27A 2XFXA 1UWFA 2VN6A 4LKXA 4Z7QB 2OW6A 3MLUL 3A4EA 1OF2B 2OTWB 2PYFA 2CDFB 1A7PL 4YSRA 3SO5A 4IOFC 3W81A 4JM2A 4E5XG 4WCYH 3U7WL 4MLSA 4MXWH 3ZRSA 5DZVA 1VFBA 4NC0B 4U3HA 3QDGE 4V1DB 3NP3A 1U3YA 4RWYL 2FO1A 4GAJH 25C8H 2APSA 4YHMH 5C0IA 3BGFC 2GBUA 3OXSA 3ZHDA 4I1NB 3QJFB 2VDPB 4LSSH 2KKQA 5DUMH 2BP8A 1ZSHA 2BW4A 5K9JL 1LD9B 3BXNA 4XP6H 4ETQA 4OLZH 4MA3A 1HINH 2IOIA 4DK6A 2EDYA 1DSYA 5JPNC 5ICZA 4OZ4B 1U3ZA 3MUUA 4GRLD 4FRWA 4OIFA 4XMUA 3D39D 2IANB 5JR1H 2ZSWA 5H94B 2FX8H 4UTBH 1ASQA 1IAMA 3FTGB 4UV7H 4PGEB 1IM3A 5I5RA 1KBGH 2FWOA 5FDWA 2FO8A 1T4KB 4ILDA 4U6VL 3FO9B 1R9FA 5GZNC 5C08B 2EE0A 3KYOA 3D25B 4YOKA 4UTAA 5D72L 4X4KA 3O4LB 3RWHB 1EGJL 3DX4A 1M7IA 2HFEB 2AGJL 3RIFK 5I6LA 4IU2A 3EYQD 3VD9A 2PWFA 2RD0A 4I18C 1NKGA 3ESPA 1IGJA 5D7JB 5F1IB 3SCMC 4MXVF 1Z3RA 3A4AA 4M7JH 1FDLH 4I3RL 4MB1A 2AAAA 2BHYA 2ZPKL 3V55A 2R2HA 3MLYL 4XP9L 1XCQA 4P4KB 4PJ5A 5AVVB 3U2SB 4Y5XC 3H1ZA 4N22A 3SGKC 2F5BH 3A3YB 5B38G 4U1GC 2QPDB 5ADOL 5FYKD 1F56A 1UXWB 5EOCJ 3BAXA 1CGWA 2IDTA 3W11C 3DV6A 1FNHA 1HQ4A 4BCXA 3V0GA 4NZUH 1ES0B 1FGVH 2ZCLH 4R90L 3QQ4B 2R1YA 3D4YA 1XGTA 4YO0B 3RY6A 3QXDB 5E6SB 3WYRA 3LEVL 1NEPA 5EU5B 1MIEH 1ZXQA 3FQ2A 5IM7B 1FFNB 3GMRA 3MREA 5AVQB 3BFQG 1AQKH 3QQDB 5F9OH 1FVEA 1M6UA 1NJ9B 3FFCE 2VXVL 4NO5B 4AH2A 4DKTA 2KT6A 1B4LA 3JQOB 1UOVA 1QD0A 1RJYA 4HXBH 2G3XA 3DIFA 3TASA 1PSKH 4OY9A 1DUZA 3H6JA 4YDLB 5IHLB 1EK3A 1WT5A 2GBTA 2VL4A 4P46D 2GB2A 4JM2F 4WFFD 5F93C 3ZVVA 5E7FA 3RVTD 4LCCA 4F7KA 1XWVA 3BVNB 3U2IA 5HHOA 1W72L 1TYJA 3L95A 1R3JA 1FNLA 5KOMC 2FSEA 4CNIA 3P3TA 4HKJA 4URTB 2EC9T 3BQUD 5FWRA 5CUSH 1MJJB 4NQEB 1F11B 5EB9A 1VCAA 3AT8A 3PE9A 2K78A 3BW9B 3KLQA 4G7YH 4X6CB 5CXPA 5BS0A 3BEWA 3BKML 5I8CA 2V7HB 2PPEA 3CFDA 5C0RL 5GZNA 2GABA 2R7EA 1RP8A 3CSYB 5IVXB 1OQOA 4JFDB 3GSOB 4A6YA 4ZTOH 4MB5A 2BIIA 5DHYB 5ETUA 3QEQA 3RX5A 1DYZA 1TQBB 5AW5B 5HYJD 1BXXA 4JAMB 1FZOB 1U33A 2NY0D 3BWZA 3P2BA 4WEMB 3EBIA 7FABL 4POZD 3A6OA 1A0QH 4YDKL 1MKFA 1W9XA 3V8CA 3SE9H 1S7TB 3A67H 3DMMA 1KXTA 4PRNA 5AOZA 4K8RL 4LSUL 1JG9A 3ULVF 3GGWB 4JKKA 2MKLC 4B9JA 4G6JL 2C9QA 2QHLA 4K2UH 3AY4A 4ZODA 4QRPE 1WZAA 2KBGA 1P7QA 1DR9A 3K1DA 1BIIB 3KXFB 5IVZB 1CFMA 2JB5H 1MDTA 2V17L 8CGTA 5F44A 1A7RL 4PY7A 2N59A 4YFLI 4W6XB 5I9QB 2K9FB 3L3IB 2A6IB 3MLUH 4HULB 3IJHA 4HJUA 5CGYC 2OMTB 3WE6A 3VFNA 1UOKA 2XN9B 1A7PH 1F4YL 1LEGB 3WTXA 3U7WH 2H2PD 3H7BB 2ADGB 2IQAB 1XF3A 4RWYH 5C07E 3AITA 3VXSE 4D9QD 3B34A 3MRRB 4PIBA 3IDYB 4IKLA 3FC8A 2D7TL 2V2WA 2XWZA 2ADJA 2IWKA 1XH0A 4FQXC 4X5WB 5DDHB 1DANU 3KDPB 1T80A 2VZTA 4GY4A 5K9JH 5D7IE 4LCIL 3RZCC 4Z3TA 4S1RL 1SJMA 3ZTDC 1IBBA 2OMVA 4Y2OB 3RPKA 2E86A 2F1BA 1FZMA 2VXQL 3WENA 4ZNEA 1CXHA 1N26A 4J3TA 4P8QA 2XX1A 5E2VL 4KRPC 1MH5A 3UTSA 1DVFC 1IAKA 1JN6B 5E8OA 5T5FA 3VI3E 2RAMA 1TETL 1CPUA 2ARJA 4U6VH 3UCQA 1U91A 4NKIL 3L7FB 3NESA 5J6SA 4EIGB 3BMVA 3L3JA 4KFZC 5D72H 3LKRB 3UIZA 4CSPA 3M1BB 1W2KT 3N42F 2BINA 4IBTA 1EGJH 2APVA 2ED8A 3MQIA 2VM4A 3PAVA 2AGJH 4DHLA 3LEXA 3WFCL 4YEFA 4XR8C 3BZ4A 2OM5A 3D2UB 3KJ4C 2NQDA 4CC1A 2PR4L 3NCCB 4WJ5B 3Q9PA 1KLGB 3ZYJA 1U4EA 3L3DA 1XO8A 4GLRI 4DGWC 4N2BA 1T5WB 5LBVA 4I3RH 2ZPKH 1CD1B 3MLYH 2EDWA 4MSWA 4GW4B 1AQDA 1A4JA 1S7SB 1BOGA 3OZKA 4UTBA 3W9EA 5ADOH 3VXRD 3K1KC 4UQ2B 1JHTA 4M7LL 3KYMB 3P3SA 4L1LA 2UZPA 3HCVB 4CVWA 5BRZB 4R90H 1S9KC 2BO0A 1KJVB 3VWJB 3MR9B 4F2MB 3O6FD 5CD3A 1ZEAL 5CJOL 1WBZB 3LEVH 2WXLA 5CNHA 5JXEA 2Y69B 1XBRA 2C7FA 4GAAA 2DQDL 1OCWL 3TF4A 4LLVA 1MAKA 1NEZA 3CMOL 2VXVH 2I7OA 3HS0A 3NIFB 1E30A 3GXNA 3LDBB 3L08A 5DMGC 2IV9A 4M5TA 1AIZA 2H41A 5F0PB 1Q1JL 4FQ1H 1H6EA 4XBGA 4ATWA 5CU5A 3RWDA 3TBSA 4PEEA 1H6FA 3MNWA 5D1XB 3ESOA 1WUNT 1UM4L 1RZGB 2JQZA 4OCWL 4RESB 3RZCA 2JKLA 3ECVA 2VQUA 2DI9A 4HUXB 1W72H 4HS3A 4M5ZL 4N28A 2NSQA 3V4LA 4MAYB 3TJHC 3E6HB 2F54A 5BUAA 3QR1A 3LPFA 2BSRB 2ZKMX 4QLWA 3EADA 1UJ3C 4RMRA 4WGKA 4XNZC 4GLRH 3HZVB 3BKMH 3ENEA 4WGWB 4FYSA 4KHXL 3LNFA 2MRYA 2OMYA 5C0RH 1AOZA 1CI5A 2Y2WA 4IEFA 1YMHB 2DI7A 5B39A 3K4ZA 4JRYE 3TF7C 4PRPB 1GGTA 2BH0A 1FORL 4NQCE 3RWCB 3BE1L 5LNGA 1WF5A 2BSTA 3OX8A 2Y7QA 2X88A 2X38A 2VNCA 2YIHA 3DXAA 2GT9A 4W81A 1EEUA 2VO8A 4WNQA 7FABH 3QIUB 1ORSA 3AS3A 4YDKH 2K4AA 4XNMA 3CXDL 2XXGA 4Q9CA 1OALA 3CHSA 1QSFE 3HZ3A 2WIMA 4H8VA 1ET8A 3NFNB 3QIWC 2VDOB 2ORBL 1MSPA 4NZ8A 1IAOB 2CO1A 3F7PC 4JRXA 4K8RH 5AVRB 4LSUH 1RCYA 1CIDA 1KXHA 4G6JH 1ODAA 5DF0A 3AC0A 4L1BA 4AYEC 3FFOA 1ZV5A 3DBXA 3VU2A 2GCYA 2N0MA 4JFTA 2F18A 3U36B 32C2A 3SY0A 4NHCL 1JZ3A 2V17H 4LP8A 4PTTA 1A7RH 2IALA 3UAJD 4AI7A 5EO1A 1F3JB 4J5VA 1HXYA 2QVFB 4PJ7A 2YPVL 4JRFA 1LO4L 2DQIL 1MFUA 5I17B 4KNQA 3WD5L 5F7NC 2VLJA 1AKJA 1F4YH 2FJSA 2JJSA 3PIQA 5EC2B 1B0GB 1J9CT 3PP3K 2NUPA 4MNHA 3RUGF 2ENQA 2HAZA 4WO0A 4QHUA 4X5PA 3VYOA 1XMWA 5G2NA 3S98A 5E6UB 1WTGT 1N12A 2D7TH 4MA1C 3S7GA 3ALPA 1ZHLA 2D7PA 1XR8B 4BCZA 5I1AA 2O26U 3KPPA 5I6KA 4LCIH 3MJ9L 5GGRB 4OCRL 3H85A 4TLSA 2EDRA 1BQRA 1KPUB 2VXQH 3I6KB 4P2RB 1II4E 4N2AA 1Z9OA 1WS7A 2HT4D 4MVBC 1WZMA 1G7MB 3CZGA 4X9HA 5E2VH 2B15A 4CSZA 3ARTA 3VCLB 2M2DA 3JYCA 3L3GB 4HJEA 1FV1A 3PWLB 3C9NB 2C9XA 4AJ0A 4F3FA 1U8PB 1TETH 4LCWB 4XVUC 1DQVA 2AK1L 2NX5D 2VLKB 4NKIH 2OMZA 3IU3B 2E76C 1CFTB 3P77A 4PRIB 3DRQA 3EO0A 2W38A 1QPKA 5FB8A 1FFPA 3WFCH 3LCYA 2NXZD 5ESAB 5CF3A 4X99B 1KGUA 2PR4H 5BO0D 2I26N 5C86A 4L8DA 1CXKA 4NM8L 1RJLA 1MW0A 5CWSB 4JG9A 4M6NL 1TMQA 1MN4A 2CNZA 1KTDB 1P2CB 2NYZA 4M7LH 4MDJB 3RWJB 3DC0A 2FQDA 4LO9A 2PWGA 3Q7JA 4X8XA 2TAAA 5BMFL 5ANMB 1WWWX 1PAZA 5KVEE 1CXIA 1ZEAH 3DUUA 3JV0A 5CJOH 3U4BL 4QRBA 2KDYA 2DQDH 3SDDD 1OCWH 5G5DA 4S1DD 1EGJA 3N44F 3CMOH 3MV9D 3MZTA 4HWUA 2H5UA 1X5HA 4J6IA 2P5EA 4QRUA 2JKNA 1FVCA 1ZK5A 1VRSA 3NN8B 5JIPA 3FQNB 1TNNA 3GZPA 2YKLL 4OFIA 4JPWL 1QLFB 5F7DA 1Q1JH 1OZUA 5C7XL 2WBKA 2P24B 4QKXB 4Z78A 4Y7OC 1PFCA 2BVEA 1WLHA 3WEOA 2YEZA 1UM4H 1CDGA 4OCWH 1N2RB 3C6LD 4K8RC 1HL9A 3HE7B 5I0YA 1D9KC 2C7UA 2ZOKB 3NJXA 4M5ZH 5JW5A 3Q01A 3SBQA 2JE8A 1J0IA 4MMXC 5D6DA 3FT1A 3C60C 3Q2WA 4DO4A 5IGXL 3DVGB 1CXFA 2GJ6A 2HX8A 4GMTL 3RKDD 3WN5C 4MNQB 5GRVK 4AQ8A 1XF4B 4XN4A 4F58L 4MD4A 4L1HA 1QEXA 2XTJC 4GRWH 5LG6A 3TBYB 3MUZ1 3WUWB 2ZYIA 5F3BB 5GS1B 1P4LA 4ECNA 5JMOC 4KXCA 1KLUB 3NGBB 2UY6A 4FP8L 3JZYA 3D08A 2I69A 4KHXH 5BO1L 3ZQ9A 4KROC 1ZWIB 3RTQD 3MOAL 1K8IA 4MFHA 3T3MF 3CC5B 3OBAA 3FT4A 1FORH 4GT7A 3BPNC 5MEOB 3BE1H 2UZYB 3QUYB 5IMMB 1B9KA 2X53A 3S4SG 5HGHA 3M07A 5EDSA 5FM8A 3ECUA 3P2TA 5F8QC 3WTSA 5EV7A 3P3YA 4MRCA 1A8ZA 4OT1L 3VFOA 4OBSA 1JF5A 3CXDH 3D85D 4PWEA 3VXNA 4LHUA 3QUMB 1HAUA 1KPRA 4XHJD 1QLRA 2QDVA 3K46A 2ORBH 5ITFA 5ID1A 3FO1B 2E74C 3FYIB 3UO8B 5EN2A 4A38A 3EFDL 4QJ4B 4HIEA 3U48A 4W9KC 2WXOA 4JX0A 4F7TB 1MVFA 4KOCA 4RDBA 4NHCH 4N0RA 1CO1A 3UC2A 5FM5O 5CEXA 4GNKB 1WCBA 4PREB 1UATA 4GUOA 3TO4B 1DVYA 2AXHA 1L9RA 2YPVH 1LO4H 2DQIH 4FMFA 3W5NA 4MJIB 5E56A 1RZKL 1NIFA 2OPCA 3MRFB 4RFNC 1JNHA 3TO2B 3WD5H 4O02L 5IMKA 4ZFZA 5I5IA 1FFOA 3C6SB 4GS7B 5FO9B 2EEDA 2HSIA 3FUIA 2XQYA 3I2CL 3CBKB 4NN6B 4OZHA 4GRLC 4YUEL 2ZCKL 1NA8A 1NC2A 5C0CA 5LJYH 4RAVB 1D9KA 2Q9OA 3MJ9H 5CJ8A 4OCRH 3G04A 4YFLF 1BG1A 3KH3A 3MROB 4V2CB 4I77L 5BPPA 4KKCC 5A2BA 3RL1B 2YFNA 3NCFB 1OCOB 1T1XA 3RL2B 1VADB 3Q8AA 1C16B 2JLLA 3PV6B 4HZAA 5B22A 1ASOA 3CZLA 3UTZB 3GO1L 3MBED 2CGRL 4MZIA 3OMZA 2BY0A 2OX5A 1SUJA 4R7VA 1FN4A 2AK1H 2K7QA 3PHQA 4YHNB 2C8NA 4L0PB 3Q3GB 8FABA 1OP4A 5LN8A 4C58B 3MOQA 3STZB 1JBJA 4AYGA 5T1LB 4JFEA 3ETTA 2JKRM 2VH5L 1SDYA 3C8HA 2AQQA 3ILQD 4Q7DA 3NZHL 1FG2A 5A6IA 4MAZA 3EOBB 3K3QA 2Y5TB 1N9PA 4NM8H 2VXQA 3ZR6A 1J9RA 4N9GB 2QV2A 3D4ZA 2WP3O 4M6NH 4X9IA 4CJ1A 5SWSB 3KYNA 1FZKA 2WC7A 2YXFA 3WHE1 1PY9A 4JDTL 5A2LH 5KSBB 5DRNB 1PLAA 4JJ5A 3G6JF 4I2XA 5E5MB 2ZAGA 5AG8A 1OP5K 5BMFH 2B3IA 3QIBD 1PZ2A 3U4BH 2PTUA 2IXQA 4PRDA 4TSAL 4LVHC 5F9JA 1BQHA 3PDDA 1XGQA 4MJ2A 1KG0A 4U6XB 4W6YB 1OHZA 5E8DL 1UENA 4ONHB 2BSBA 4TUOB 1A7BA 3RVTC 1NCOA 3HPJA 4XWOD 4JPWH 3WS3A 2KLRA 2MNUA 2COQA 4PJGE 5HDRA 5C7XH 2A38A 3FH5A 1P6FA 3IPEA 2V2TA 4GRLA 5DJ0B 5EIVA 3ISYA 4BFOA 1F3RB 3D39A 2EYRA 2HVJB 4C83A 4FI8A 2DLIA 1ORQB 3WOVA 4B9YA 3L3OB 1JGEA 5HSFA 2WYTA 3L6FA 3O8XC 1QHQA 2BZ7A 1DDHA 2F2HA 3FQUA 4NI6A 4C54A 5IGXH 4OZHF 3DA0A 5D4JA 4GMTH 4F58H 3ZR5A 5LVEA 4ZUWA 5DC2A 4YHLL 1NCBL 4FJ6A 1L4IA 1W0VA 4Q6IB 5IR1A 2F7RA 3MDJA 1MF2L 1DJIA 1XT5A 4G2AA 4FP8H 3EOYG 2G75B 3OWRA 1LO5A 3OZ9L 5BO1H 3EJCA 2AEOA 3MXWL 3A0OA 3MOAH 4MWFA 3NK3A 1PZBA 2Q76B 2X3BA 1J8KA 3AG1B 3A5VA 2HLFD 4CVXA 3U25A 4FG2A 4ZMNA 3DK0A 4M00A 3QEUA 4EIBA 3KL3A 2JB6B 3DROA 3FQ4A 5AW6B 5INCB 2OS7A 4OT1H 4DTGL 4N1CA 3NYKA 4LESA 5HJ3B 3WIAA 2RMNA 1HEJC 4JFWA 3T8VA 2YGOA 2ZWKA 5E4EC 1U95B 3AQYA 1R5WA 4WRLA 2H3NA 3L5WA 3ZX1A 1WZ1L 2TRYA 5IF0B 2A6KA 3EFDH 2GK2A 2Q2EB 4G6AC 3POHA 2FECL 1DLHA 3V6OE 1MHCA 4U1LB 2A74B 3QNFA 3VRJB 3GSUA 4X80L 1JWUB 3HW7A 4U0QB 4YBLC 4A2DA 1PX3A 2KDGA 4W6WB 3ZQXA 4YGVA 1IFGA 3CN1A 4LAJH 1JPST 1T6WA 4JREB 5HHMB 1AP2A 4AE1A 3HTLX 3SOBL 1RZKH 4PJFB 1YRKA 2DQTL 4O02H 4APXB 2VL5A 4Z76A 3W5MA 2O61A 1WBXA 2EIZA 2WXQA 4JVPA 4IOIA 4X8CA 3RVXD 3I2CH 3B9KC 2BVPB 2DEYX 4YUEH 1R5IB 2ZCKH 3FKUS 4FZEL 4FG4A 3BQUA 4U7KA 3QE5A 1U42A 1O6VA 2W91A 1Y0LA 2VQ1A 1E90A 2BOBB 2X0VA 4NOBA 2P5WD 4I77H 1XL6A 2G9KA 1AXIB 4X7TB 1U8LA 3WL9A 2R9HD 1NKOA 4TRPL 3EYSL 1HCZA 2J25A 3MV7D 4XXCC 3GJFA 1KTKE 1MJ7L 4WFEE 5TH2A 4TNVF 4ELMB 1NCGA 3GO1H 4U05A 1F5WA 2CGRH 1IVTA 4IGBB 2IGFL 2PP7A 5AB9A 5HYJA 4NCC1 4JFYB 4JM0A 4P0DA 3BVDB 4FNSA 4HISA 4J2QA 1AQMA 3WUZA 3ASOB 1TVBB 1JK8A 3O6ML 1T89C 1VESA 2VH5H 4ZPTB 2DOCA 5F7UA 5EF1A 4C55A 2ISDA 1YPZA 1M2VB 3NZHH 3BPCB 1N5YL 2DDQL 5HGAB 1NC4D 4PRHB 3MJ9A 4JJHA 2H0PA 3CZFA 4YE0A 4OZGB 3SE6A 1NGYB 4ZMWA 2QVMA 1F02I 2ZX5A 2BVTA 2OI9C 5AUMA 3KPNB 4O00A 3VXTA 4FI6A 4OLVL 1P6AB 3EDJA 3GI8L 5DI8B 2E4FA 2NOYA 4N2IA 4JDTH 4PS7A 1X4ZA 4G5ZL 3D51A 4PJ6A 1C7SA 4GRWF 3VFTB 1E9QA 4LASL 3TBTA 4TSAH 1DQIA 3HVDA 1OSZA 1YMMA 3HN8A 4UB0L 2HCZX 3JV6A 2BRRL 5E8DH 2AAVA 2Y2TA 3UZEC 2PMZA 4LKCA 4PS4L 1K4CB 3FQXA 4P5TC 1ZA6A 3MUGA 4XBEL 3ISWA 4N0FB 4A2EA 3MV8B 3WNOA 1INEL 2CLRB 2ZIDA 5FGSA 1G6RH 4DVBB 2JELL 1MFDL 1I7TB 4R26L 5EU7E 2LFGA 4LEOB 4MS6A 5TDOA 1HTYA 3RA7L 3HG1D 2DLHA 2WLNA 5J6HB 5CKAA 1NEZG 4AQ1C 2FNWA 5CN2A 2CA4A 2WQXA 1C8QA 1KF9B 3EGDB 4MB4A 4YHLH 1NCBH 5C9JB 4I4WA 3G5YA 3VI4B 3QRGH 1MF2H 2HLEB 4YSAA 1N3NA 4G6FD 1U2CA 3QFJB 5BZZA 3OZ9H 1GZQB 5FA3B 1MY7A 3MXWH 3SQOL 3TOPA 1RZKC 3U82B 2XBZA 1KV7A 3FBKA 1IQDA 4Y2DC 5ACLA 3HNVL 1ZE3H 2DTSA 3KJ6L 2OQJA 4M7KL 3CPLB 3GS4A 1DO5A 1ZT4A 3NACL 1OM9A 3QT2A 4MHHG 2UX6A 2WQ8A 3VGHA 5I1DA 3UTPD 1ZGLB 2LOEA 3VXRA 5EF2A 3IFOB 4WHYH 3OR6A 4DTGH 3N41F 4FL4B 4KRNA 3OKOA 3QQ3B 4QXTA 1SLXA 4XOEA 3NZ8B 2NSMA 2X2IA 3O6FA 4Q4IA 1HQRB 1QVOB 5B39G 1H15A 1YPZF 4X6BA 5CGBA 1PG7W 4UM9A 1WZ1H 3QORC 1BQKA 1T3FA 4JDZB 3LZNA 4X80H 4L4TB 3UPAA 1ZA3B 4GH7B 4X6DF 3M1OA 4HPOL 4NO0B 4B97A 4WDIB 2A9AA 3C5JB 3SOBH 4NO3A 5FHAL 1IRAY 3UZEA 5C0BB 4ANXA 2DQTH 4LL1A 4MMZC 5C0DA 4Z7UB 1NWPA 5EEYA 1IFHL 5MEND 4FKKA 1QQDA 5K9QG 2JKWA 3NRQA 5DRZB 3NJLA 1FNFA 3QNXA 4KXDA 4FZEH 4LFHG 1HSBB 4ESKA 1A3ZA 4XT1C 3CN4A 3OKEB 1FWXA 4POUB 4A7VA 1YYML 3DO4A 5I16A 1MFMA 4XI5D 1FF5A 4P4RB 2DAVA 1I9IL 4YDVB 4GKLA 4TL4A 4V1DD 2WPGA 2HTKD 1RHHB 4NZTL 2NW3B 3EYSH 4HK3N 1INDL 4TRPH 4CJ0A 4F5CE 1ZGLP 1BD2A 1A2YB 1MJ7H 2YC1B 4GXVH 4CSSA 1TCMA 3ETBF 4V2BA 5HXMA 3PL6C 3WHXB 3WLWD 1QACA 1SNRA 4E5XB 1L9PA 2IGFH 4CN1A 5IJVA 3KG5A 4ODUB 3ZE2B 1I1YB 3HAEH 5DQ9A 1DBML 1KJ2L 3I6GA 4I0PC 2IAND 5E4OA 5HY9A 1ZVNA 3O6MH 3M86A 1CF1A 2Z7ZA 2WSPA 2LTQB 5LAXB 2DQFA 4OCLC 3LX9A 1N5YH 43CAA 2DDQH 3NPSB 1QO3B 4NM4L 5A2IH 5CEZL 3RPIB 3C8DA 5C08D 4AGMA 1T1ZB 5D2LF 4E0RA 1BCIA 4PJIA 3SE4A 2WXJA 4PJCE 4J39A 3O4LD 3IFPA 4FE9A 4PMFA 4OLVH 3NP4A 5D5MF 1H3VA 3DX1A 3UAJA 3GI8H 2CDEA 3AM8A 1WFIA 3D06A 4HIJB 4TVPL 3W39A 4CU6A 4FHKA 3VD1A 4HBQA 3NPZB 4K55A 4LRNL 1AGDA 1UXSB 4G5ZH 5HYIA 5D7JD 2EYSA 3MYJB 4JANA 3VXUE 4DEPC 1GOHA 2GTZB 4OKDA 3RVVD 4DN3L 1ZE3C 4P4KD 3VWKC 1HIML 1ZKAA 4CMHC 5DURB 2BRRH 3B37A 5E1AB 4HLEA 5DJXB 1X44A 4E41E 2VDKL 1QUPA 4MMZA 1I8MB 4XRCA 3EYFB 4PS4H 4XBEH 4I87A 1A6AA 3RB5A 2MWCA 4UOW1 1INEH 3FO2A 3FQYA 4PJDA 2JELH 1MFDH 4JJOA 3K71B 4R26H 5AZEH 1VB9A 2NZ9D 3T1WA 3DGGB 3RA7H 2FWUA 1DJZA 1QBAA 2NX5A 3L2NA 3QUKB 3RTQC 1TR7A 4LXFA 2MH4A 2XZAL 1G6VK 4QGTA 4AG4L 1XAUA 3SDCB 3TN0B 3O3BB 3OAYK 2XWBA 3PWVA 3IETB 3T8MA 2YD3A 1T20B 1K5NA 5I24A 5C97A 3ARPA 3SQOH 1DJSA 5FO7B 1QWUA 5KSUA 1NUGA 3HNVH 4M7KH 3KJ6H 5H37G 5CBEB 1I3UA 1VFAA 2OMWB 3KH4A 1XF1A 3ATBA 3RWIB 3ESMA 4XN5A 4J3OG 3NACH 3HHRB 1DZ0A 2ENYA 2QV4A 4FFTA 4NQED 4MZ2A 3VGAC 1WBYA 1BFTA 5HI4D 1HZHL 2ATKA 3OLEA 1RQ5A 3ASNB 4HS6A 1S9WB 3VG9C 1AOHA 4DEWA 1YEKL 3QDME 4U1KA 5J6GA 1AGEB 2BHZA 4JFDD 5K59F 1G7LB 1XSKA 2AJZB 1D5IL 4H1LA 4KQ3L 4FEMA 2WIIA 4BXSV 2NW2B 5E08L 1HS6A 4G8AC 3MV9A 5EBMA 5FYKU 1RY7B 3PUCA 1L6ZA 2BS9A 2XQYK 3HN5A 1E9PB 1UH3A 1WWBX 2EIBA 5GZOC 1EDQA 5CR8A 4NO2B 5EWIH 2C9UA 2X42A 2Y3AA 3MRIA 4BSVA 3LS4L 3UBXA 2HFTA 4HPOH 3MLRL 3VWKA 1BM3H 3R4DA 3KLKA 4ZDHA 3K8MA 4HD9A 1JWMB 4OV6F 2P8PB 3EF4A 5FHAH 3CJJA 5KYUA 5E1HB 3KBPA 3C6LA 4WTQA 5HJBA 3KXFD 1IFHH 5FUCC 2I07B 6PAZA 1MLBA 2IADB 4R3SA 2NQ3A 3FT3B 3PJSB 2BNQB 1J1OL 3FOMB 3L2LA 3CDZA 4GO6B 4KVPA 5E6ZA 3APNA 4O58L 2KQMA 1YYMH 5EU3A 2EXSA 2XN9D 4ZPVB 5JHDE 2COVD 2WB7A 2XKNB 2OLDA 3KWXA 1I9IH 2HT2D 2ZXQA 3RTQA 3LXCA 3C5ZB 4DT2A 1D2OA 4KTYA 2NYKA 4NZTH 4YE4L 1INDH 2WLLA 5DVNA 2DL2A 1XVSA 3PAYA 2X6CA 4FCHA 2YAFA 1CLYL 3GSVA 3ETBJ 4Q2ZB 5EC1A 4GKSB 1TQVA 3AU1B 2MNWA 2WY3B 2X2UA 4HC1L 3NG5A 5DJ8A 4K9JA 3B3BA 3ILQC 5D6CB 4IRSC 2IG2L 1DBMH 3ARUA 3D85A 2XWJB 3Q1SL 2NRDA 1BJMA 5J12C 2HH0L 4A2HA 5C0ND 3OM3B 4X6EA 3FFCB 1FCCA 1NH6A 2UVFA 3V4VB 4B27A 1P7HL 4LLQA 1I1FA 1LNUA 2YN3A 2Q20A 1TFPA 4JFVA 4NSKA 4XCEB 3ARYA 3IDMB 1BZ8A 1EXUA 4P23B 3QQXA 4OB5L 1OANA 5CEZH 4NM4H 4BHUA 1OT4A 3P0GB 4YSTA 3VNZA 1JZ8A 4PLKD 2ZICA 3L4UA 2G0LA 2DEWX 2R0LL 4G6KL 3CHRA 3GD1C 5BZXA 2IWGA 3HBZA 3P1VA 4HSCX 3D2UD 1EPFA 3QEHA 1OP9A 4TVPH 4H5SB 3AB0C 4LRNH 2ROYA 3CH1B 2P1YA 2FX9L 2GAZA 4XXWC 5E4IA 2K8QA 5M95B 2G2RA 3ZT6A 5AW0B 3ILEA 2R2BB 2QZ5A 2I24N 4CAGA 3NA4A 1GXEA 1LJMA 4ZUSB 2X70A 1GOGA 4GQZA 4XOBA 2V7NA 4DN3H 3F85A 3ARZA 1G4MA 4OBRA 1HIMH 5DEFA 1ZV2A 4TNVK 3BP6B 3KS0H 3WMSA 2XTLA 3S6CA 3IMBA 3MRMA 1N8ZA 4KK9C 4LOEA 1PCXA 3BLBA 3LQMA 2VDKH 4KUZL 2E9IA 5EF3A 4XCNA 2UWEA 4NN5C 3OAUH 5FFLA 5T1MA 4N8VA 1HSAB 4HEME 1AZRA 2ERJB 2Z4QB 3B8YA 5GS0L 4L8CB 4O2CA 5L4JA 4MDRA 1KN2L 2AKRB 4FQPA 3N2JA 1XCTB 4KJWC 1NSNL 3MBEA 2CGZA 2O1AA 3MRPB 3GSQB 1ROCA 1P1ZB 2C3VB 4KKPA 1I9EA 5I26A 4H8WL 1OIOA 1P84J 3B1TA 2WINA 1Z9LA 2XZAH 4ISVA 3WLBB 2X4QA 3SBPA 4AG4H 3MX0A 2OXHA 3FNKA 3RBGA 3UJIL 2HLFC 4HMCA 4L8SC 5D1XD 2IVFC 1YEHL 3OKMB 4QRPB 1SVCP 2WXKA 1PD6A 2EIKB 4PLJC 4KVCL 1HCVA 4F2EA 1U8OA 1OY3B 4XO4A 1HX0A 2Y7OA 5E70A 4JO8A 1UD6A 1OW0C 4MAYD 3LPGA 1T0MB 1NINA 2H8PA 3QI9D 2F0CA 5FYJE 3VFVA 1CDCA 5K9OB 3EJZC 4IK6A 1HZHH 4IK7A 4QRQB 3NJKA 2O6FA 1YEKH 3F7YB 4W9DC 4KDVA 5DQJB 3VXSB 3JSSA 1LQBC 2OJ1A 4PRPD 1B0WA 4G8IB 2IDQA 5I6XC 3U6RA 4GSXA 4Z7IA 3QIBA 1I7ZA 1D5IH 1IE4A 2P43B 4KQ3H 3PDOB 2QPFA 3DV4A 4LSDA 1YJDL 4XVSL 5D7IB 1EO7A 4G7SB 5EUKA 1SVBA 5E08H 4GAYA 2I9LB 1XD1A 1OSYA 4YIQB 3HNTL 3IJYB 4L1SA 3MCKB 3ARBB 3QIUD 5KSVB 3BZFA 2BVUA 4MCZA 2DBLL 3TVMB 4P04A 3FSVA 4B7LA 5J13C 2AW2A 3V0VA 1H9VA 5HI5D 1RK0A 4U6HA 3LS4H 4W1TA 4O51A 3ZDXB 4HUUA 1GS7A 2WCSA 1UB6A 2HPTA 3MLRH 5DHDA 3TEXA 2ZXWB 1YNTB 5ACMA 1CR9L 3GHEL 1DUYB 4GP5B 4HKXB 3VI3B 3IPBA 3VFRA 5DD0L 1X4YA 4GUCA 1XGRA 1DJHA 5C0AD 5KBLA 1AGBB 3D5OF 3OAZH 1H5BC 4PB0L 3DHMA 3AAZB 1J1OH 1X5GA 4NZFA 3FCBA 5C0FA 1LGVA 3WEXA 4O58H 3P9MB 3TA3C 2PP9A 2A9BA 1I4FB 3H42L 4FQQB 1WRFA 5F9WC 1WFTA 3Q6FA 2MQ0A 3U0PA 4YE4H 4QCIB 4Z7NF 5DTFB 3OKNB 4QD2E 1CLYH 2NSXA 1W80A 4JKNA 5ICXA 3GXFA 3SDXA 4HC1H 4ES8A 2FCBA 4WEUD 4LLUB 4FEIA 1OW0A 1T1YB 2WTRB 5DJ6A 5DVPA 2IG2H 1MXGA 3H9SB 3FU5A 3HOGA 3Q1SH 4DK3A 2EUWA 2HH0H 1NGQL 2L3BA 3G9AB 1S9VB 2X7LB 1BFOB 2VUKA 4M7ZB 4PSRA 4X4ZA 2A6JB 2YGNA 5KVGL 4FXGA 1AHMA 5ADPL 5B1CA 4WENB 5DJCB 1ET7A 2Z8RA 4C57C 3TL5A 2F6AA 4HD5A 5E2TL 4Z3JA 4LCWD 3FSWA 4OB5H 4LT7A 3CSBA 1BECA 2VLKD 3WJMA 5FKAB 1S9XB 5JO5A 3ZT5A 4PTUA 5C9KA 4GG6A 2FTAA 2IBZX 3GZOA 4QGYA 1VDGA 1T4WA 2DIAA 3UH8A 3NJNA 4PRID 3IJSA 1E2VA 1M71A 5GISL 3WHE0 2R0LH 4G6KH 1F8TL 1SOQA 4OVVA 5C71A 4OAWA 5LUMA 4KKRA 3CDFA 1M56B 3CFKB 3FONA 4TSCL 2EKSA 5F1SA 4TNGA 2FX9H 4NGHL 5CHNA 5IK3A 2UUDH 1DQLL 4PW9A 2OMUB 1OSEA 5LGKA 3F7VA 1KJ2A 1S7UA 3EFFA 1RP9A 3VFSB 1J86A 4EOWL 1IMHC 4JRYB 3F04A 2L0DA 3TTSA 5LDSA 5HYQA 4KUZH 5HDLA 1TYEB 2J5LC 1N6UA 2APTA 3CVHB 3LNIA 2FD6L 2P5WA 4NQCB 2IDFA 3MTRA 4R5TA 5I1LA 2QR0A 3LQAL 2J6WA 2V4LA 1V8HA 4FGMA 4KQ4L 3V4PL 2B08A 3BEVB 3MV7A 4FTVE 3IBEA 1SHMA 3D4CA 1KB5A 2OZNA 3FU7B 5K1JA 35C8L 5GS0H 1KN2H 1JXGA 4L1DA 3K6SA 1A25A 3F64A 2NTFA 1NSNH 4K9EL 2P8LA 1JCKA 1VZHA 3OHXB 1KTLB 1QSFB 2WN2A 4H8WH 4NYLA 1BVKA 2DYSB 4D0BA 2HLAB 4TLTA 3G5XA 3OJMB 2E7LC 1A7NL 1WP6A 1KFAL 3VYPA 4GRMB 3UJIH 1AANA 4YSCA 1BQUA 1YEHH 4QY8B 3TYFB 1J0KA 3WNMA 4PJBB 3HE7D 4KVCH 5ALBL 3X2QB 3CFBB 1ZLEA 5T3ZE 1D5BA 2QADC 4Y8DC 2AJ3A 3ROLB 1AR2A 1NC4A 1NAMA 2J44A 3LXBA 3QZMA 4MNQD 3DTXB 4AOFA 3CIAA 3JWOL 3DETD 3F3HA 2R0ZL 4PJ9B 4RIRA 1N5AB 4FQCL 1KBBA 3BDXA 4X4XB 4DVRL 5HHPB 4FA8A 3JZ7A 1QATA 1ASPA 5FYLE 5TDPB 3U4EB 4E42B 3X14A 3I85A 2AQSA 4XVSH 5IB1A 3D18B 4XH2B 4MX7B 1YJDH 3QUYD 3FCTA 5C09B 1F2XK 4IU3B 4LPCA 3PGDB 4WEEA 3HNTH 3BN9D 3FT2B 2KL6A 1I7RB 4OUUB 2DBLH 5HDQL 3VGFA 1P84K 3OMAB 1Q9OA 3NCYS 4XHQA 3WG7B 2FEDD 3ULAB 5KUMA 2Q86A 1IKNC 1T22B 5E0QA 1CR9H 3GHEH 4NPYB 5C0EB 4N6RB 5CILL 4QYOB 1SDDA 2XN2A 5CP7A 5DD0H 5LXGL 4L3CB 3ZU8A 3NVQA 3JXAA 1TKWB 1OCZB 1AZUA 1ZT1B 3WFDL 3HG1A 3PQYB 4L18A 4X6FB 2G4EA 4XP5L 1NBCA 4M1CC 5FOJA 2Q3AA 4NQDE 4AVIA 4PB0H 2JCCF 1KNOA 2AK4E 2E6PA 5D9SB 3GHPA 2VLLA 3NEXA 3TO4D 3AREC 5FIEA 2HG5A 4MJID 5J1AA 5T5NG 3PHAA 4EN3B 3H42H 4HETA 3QCUL 5F3FA 2OTPA 4MCYB 1QNZL 1S8DB 3V6BR 3W0WE 1RLWA 1WEJL 3W56A 2GSGA 2F68X 2YA0A 2VIRA 3FCSB 4P3DB 5EBWA 1QBBA 4Y9CA 3V0EA 1I31A 4HPHA 1ZHBA 1CGVA 1CE1L 4TTGA 1Z0MA 3SODB 1BVZA 1HAWA 2VLRB 4IJ3B 1AHWB 4XMPL 2CO4A 3SGDH 3GIVA 1AO7B 3MU3A 3JVFC 4XNXL 2FJGA 1MFVA 3ZSTA 1NGQH 3QZWA 3SPVB 3DYOA 5KS9B 1IC0A 5KVGH 2PW2A 4JFUA 2ZXEB 5ADPH 1JXFA 2QTVA 3JWNG 5GS0C 1KDIA 2J3SA 4PI2A 5E2TH 3BPOC 3LKNB 3IPFA 4Y9BA 3ZSSA 5BXFB 3QPKA 3GRWL 5JOFA 5KUKA 1RPKA 4H8WC 2AANA 2Z92B 5GISH 2CSPA 2HJLB 5I1GL 1JNNL 1F8TH 1RK1B 4L2YA 5T1LD 5BQ7A 4CKVX 4JY6A 4F27A 2X4RB 2WUBL 4OLEA 4U3SA 2E75C 3T65B 5M7QA 4BH8B 2E9BA 4NGHH 4HC1A 3RB7A 1P5VB 2B77A 3MRHB 5HI3D 1DQLH 1E4HA 2NLJB 3OG4B 2MQGA 2Y2YA 5MENA 3IGKA 2WYIA 4UILL 3KPRD 4HUWB 3GMOA 1IBZA 2F1AA 3WXVL 4GSRA 3TBCA 4W9CC 5DFTA 4EOWH 5SWSD 5J7CC 5LN4A 4JZJB 2ZOTA 1OF2A 1HXMB 4YHPB 1QEWB 4LPVA 2OTWA 5JHLA 3ZZ1A 5EU6D 5ABDE 1X9QA 2CDFA 2FD6H 1ZY9A 1RZJL 3LQAH 3S3BB 4KQ4H 1BWWA 2VDQB 3V4PH 3ZZQA 4V1DA 1KCBA 1QWHA 3LVTA 4H4NA 2ED6A 1NDTA 3AREA 35C8H 2Z6FA 1YJDC 4AEEA 1ESOA 3F8UB 3JUZA 3FK3A 3ZO9A 4K9EH 1A6VL 3RZWA 1JP5A 3B8SA 1I8LA 2WJ5A 1E42A 2EDDA 1A7NH 1KFAH 4OZ4A 5SWZE 2WZPD 1EQWA 4GBXC 1EEZB 3DLQR 2IANA 2YR3A 4OF6A 5H94A 3VXPB 3QDHA 3FTGA 4PGEA 1QA9B 5ALBH 2FK9A 2QDWA 1VFUA 1TEYA 5HTSA 1T4KA 3DJZA 3GS0A 4Y16B 5HPOA 4KO5A 1KELL 5EO9B 3H9YA 5IHBA 3D25A 3JWOH 1HZLA 1XEUA 3EJSA 4HSAC 5AWNL 2R0ZH 1NEUA 1LEKB 2P3YA 3O4LA 1MRDL 3L1FA 1JZJA 4A55A 4FQCH 1ZLDA 4MGXA 4HJSA 5AVWB 1XZ0A 4GKZB 1S9YA 3AS2A 3OG6B 3NIGF 4DVRH 4ZUVB 2JKTM 2VR3A 3AWEA 4U6TA 4F7PB 1OGTB 3ULUL 4D8PB 1GCYA 2XTSA 3BSGA 2P52A 4LPTA 1EDHA 5F1IA 4PJ8C 1LE5A 1X5AA 4OCMC 1JYVA 2VRKA 4AYID 4UDTB 5JIMA 1RUQL 3U2SA 4GSQA 4P4KA 5DO2C 2AQRA 3MFFB 4H8PA 3IDIB 1UXWA 5E6IB 2GKIA 5HDQH 4PFEA 3ZDWA 1ES0A 1Z5LB 3II3A 4YHKL 3U0WL 4OFQA 3QQ4A 4MAUL 2JF1A 2WBXA 4I48A 4YO0A 4BA8A 3QXDA 2YD6A 4OD2B 4KKAC 4MXVE 5ESVB 4ABQA 4A7QA 2O6DA 4JZOB 3BRDA 3PG2A 4XP4L 3GUTB 4ZFQA 4XAKD 5CILH 5LXGH 3X1BA 4D0CB 4JQVC 1NKRA 4QHMB 5FM5M 1YQVL 1FFNA 4H1LG 5IM7A 5F70A 3WFDH 4LPXA 1O6SA 4NFBA 4MKTA 4NO5A 1JDDA 4XP5H 2BXYA 4OGZA 1VZGA 4JVUA 1SM3L 3SPGA 1YHPA 4YL4A 2DN7A 2W1NA 1OKEA 4Z7OF 3QUZB 1JL8A 2NYYC 2WTOA 5F3HB 5HHMD 3T9WA 4HOWA 3WIHL 5L2KE 2EILB 1XB3A 2JJUA 3UTTA 3Q8FA 3LB6D 3WY3A 4P2OC 3N43F 3QCUH 2Q6WB 1MCSA 5B4MD 1KZQA 1QNZH 1EH9A 1YEDB 1WEJH 2AI0L 1QI4A 2UXTA 4LHQB 1RZ7L 4DERA 3T6VA 5JIKA 4A37A 5JTWA 1CE1H 3U0TB 5C0NC 4NQEA 3WTVA 3MTXA 2X40A 2WO3B 3BHBB 4XMPH 2V7HA 1OCRB 4LVNB 1DJGA 1QP1A 5HBBA 2C4FT 4K4KA 1TLMA 4XNXH 3CSYA 1KIRB 4NHUB 4JFDA 3GSOA 3PXHA 3LQAC 4PJXB 5DHYA 4U0RB 3KS0J 3GKWL 1JPFB 3BZEA 5DJ2A 3O0LA 4IGBD 1YY9C 4M7LT 4PJGB 1T0OA 5DZAA 1LHZA 1MIML 3VRIB 1J0JA 3KW7A 4GEIA 1TTRA 4K9EC 2VMCA 1KGCE 2WAQA 3C75A 3GRWH 3GTNA 1C1EL 4M03A 5I1GH 4MJ4A 1JNNH 5D2NB 5EZPA 2BIOA 2IQ9L 4TMPA 2EEFA 1TQTA 1RUPL 2WUBH 4UOZA 1MAML 3GGWA 5FGRA 5JIDA 2BSSA 4PRHD 4F8QA 3CG8A 4J3SA 5CSBA 1T6BX 4XXDA 2AP2A 3KXFA 4WTXA 1V54B 2ZWYA 1BIIA 4NN7B 3DO7A 4ADIA 4UILH 3WXVH 5IVZA 3JWOC 3LY6A 4H25B 4Z9KB 5CCHE 5ENWB 4PG9B 4IBUA 3FB6B 2X6VA 2A6IA 4HV8B 4UOW0 1FA4A 2HMID 5DMKB 1FI8C 2XN9A 4D0DB 2D03L 3BWUC 1LEGA 4XVJL 4ELKB 1RZJH 5DUPL 1AGCB 2QMJA 1GY1A 3H7BA 2ADGA 2IQAA 4ZI8A 1BF5A 4PJAF 3MRRA 5CCJA 1XIWC 2G5BB 3FTVA 2WGNB 4P57B 4NNPL 2Z1PA 3E3QC 1A6VH 1E43A 1CDYA 3FOLB 5I5MA 4FNRA 2OULB 5I18L 4ZX6A 4PI0A 1E9OB 4Y2OA 4Y4HC 1MY5A 1TZHB 3GSNL 3MV8D 4MAYC 3TZVC 3NEOA 5CAYB 2XY2A 5I19L 4ZAKC 2LFEA 4PGBB 1DL7L 4UT9A 1E50A 3QI9C 2EIMB 3FSOA 4N8VG 3FAWA 1JN6A 4Q6YA 4QAWA 1HHGB 4XMTA 4MS8D 5C92A 3L7FA 1KELH 2BIHA 4UU9B 3KZ8A 4A63A 2X4NB 5AWNH 3CFMA 4WUUB 4QPEA 3M1BA 4ZX3A 1LP9B 1MRDH 5I15L 3MLTA 2DRUA 4DOHE 1IAIM 3QFJD 4HGWB 1HFUA 2H3KA 1M3JA 4RWHA 2NXYB 3PFQA 1UA7A 2Z64C 3I3EA 3D2UA 2YPLA 1S5HB 1TTGA 2W81C 3HA0A 1EERB 4M48L 3NIDF 5DYOA 5C8JB 3ULUH 4WJ5A 2H1LM 3NJFA 1KLGA 1WZKA 2J88L 1T5WA 1F6FB 4U49A 1CD1A 1RUQH 2ZJSL 3SPCA 5I66A 1G94A 1S7SA 4UNUA 2NDGA 2AQ1A 2UXVA 2RR3A 1TZIB 4UQ2A 2J1KA 4AYFB 3KYMA 2I27N 3HCVA 4NDMB 4YHKH 3U0WH 5DJZA 4MAUH 1KJVA 4F2MA 3QEQE 2VXUL 4FS0A 4AK1A 3NAAL 4PYHA 4XP4H 1WBZA 1UD3A 1ETA1 3K80A 1F45A 1XFPA 2Q8AL 5T3XD 2IBGA 4ZUUA 1YQVH 5DFVD 5GRZA 4BA0A 5JYLA 4J3BA 2J72A 1NIEA 2WQRA 1SJVA 5F96L 1Q0EA 3P0YL 2ZXBA 2UZIL 1M53A 1KTJA 1SM3H 2QTEA 4L4TD 3M17B 5DS2A 1IILE 2O72A 5E2UL 2VXSL 4KO9A 4NO0D 1XIWA 2A2QT 4WVRA 2GY7B 2M26A 1BP3B 3UYPB 1X9RA 3WIHH 3VRLF 5C0BD 1RZGA 2Q2LA 3KBHE 2Y1YA 3ABLB 4H40A 4HMDA 3SGJA 2XNAB 3ZO0A 5FLVA 3FTWA 4TTDC 5CJXC 4MAYA 2XIBA 1RZ7H 2B9AA 3E6HA 3T77B 1N68A 2BSRA 4X8GA 5C3IA 3QI9A 4QHNB 3LD8B 3T4YB 1JPEA 1JZIA 2ATPB 3HZVA 3IKKA 1FNGB 5I28A 1WFOA 1YMHA 4PRPA 4QO1B 3SYPA 3N55A 3IRCA 4JHUA 1RZJC 4G3YL 9PCYA 5FECB 5KAQG 2ZXDA 2CHNA 1OAKL 1PAMA 4M3KB 5HDBE 3GKWH 4Z3EA 3IJ7A 1I1AC 2OL3B 1OE2A 3EJYD 2WBJC 2HYMA 1MIMH 2WWMC 4A7GF 3QIUA 1YAZA 4D9LL 1D5XB 4F80A 1C1EH 4ABUA 4EI5B 3T09A 3UTSE 1Y1UA 1YAIA 2QQKL 3O2DL 3NFNA 3TPUB 1J7VR 1JMZA 2IQ9H 3G9VA 3NBNA 1RUPH 1IAOA 2QT6A 3WNJA 1MAMH 2JFCA 5DUBB 5C0AA 1S7RB 2R59A 4HS8L 1MJUL 1XGPA 1PS3A 1QFWM 4X5RA 2FWLB 1ND0B 3U36A 3QCTL 1ID2A 5JPMC 4DKAA 3EZ8A 4I0CC 1OTTD 4JFQA 1JV5B 1F3JA 2YGQA 4X83A 3AFLA 4F8TA 2A4CA 4G8FB 4N5EC 1R46A 3EDFA 1X5XA 5I17A 4NI3A 1N0LB 3PY9A 2D03H 4XVJH 1HOEA 4AKQA 4I9XA 5EC2A 4I1PA 5DUPH 1B0GA 2H0FA 2A9NL 1CLVA 2HX7A 3ULUC 3GRWA 2C3WA 3RGVB 3VUAA 2DLGA 3IS0X 3HI5L 2HTLD 1YA5A 1I8UA 2XJKA 3CFUA 3QEGL 2BWDA 5DURD 3BWUF 3RU8H 1NDMA 1XR8A 4NNPH 3MRGB 1A9VA 3MRNB 1VIWA 3CQQA 5I18H 2AEIT 5GGRA 4DKFL 2VKXA 3FUJA 5LBGA 2NR6D 2AC0A 1KPUA 2MIZA 4ZTEA 3GSNH 1I1RA 3OV6A 5I19H 4XX1G 2KMWA 1DL7H 2BSCA 4TXVB 2OSWA 2PKDA 1E27B 4ENZA 3DETC 2W9EL 3VCLA 4GUPB 4YHIA 2HJKA 2EXYC 3PWLA 5DS8B 3C9NA 1NBYA 3I75B 3N1PC 4LCWA 3WELA 2VLKA 3ASWA 1CFBA 1I9RL 5DMIL 2EYTB 1GRWA 4NC1C 2JLPA 4MDIB 3IU3A 4M93B 1CFTA 4KGJA 4XC1L 3TN0D 4BKLB 2DEXX 4R97C 3NCWA 4URKA 5I15H 1XD0A 3FUHA 5TK2A 4AT6B 12E8L 1L9OA 2WBJA 4WW1B 4KK6D 5A40E 5ESAA 1TQCB 4X99A 1OM3L 5L4IA 3F01A 4M48H 3VB9A 4AQAB 5AB2A 1G5GA 3GSRA 4ZMOA 2J88H 4LBAA 5AENA 3GLZA 2NY3B 3RWFB 2NT0A 4XPAL 3E2HB 1AGFB 2H0JA 1YY8B 3BX7C 3LKSB 2WP3T 3FYEB 2ZJSH 5CWSA 5DEZA 3S2CA 1HHHB 3ZE0F 2D3LA 2BFGA 3O0RL 1MLCB 3CZKA 1P2CA 4G43A 4JQXC 4MDJA 2QKIC 5F0LB 3RWJA 4O5LL 5SV3A 2H4EA 2PABA 1T7VA 5ANMA 4N6QA 2H9GA 2CPCA 4U1SB 2VXUH 5KG9B 1EUUA 2V2XA 4JM4L 3NAAH 4DUWA 2CWRA 1DQQB 4ATTA 2CR6A 2PF6A 3DXAE 3MO1B 2Q8AH 2FATL 4X7SL 3ILDA 2APFA 1JPTL 5M94B 1PCSA 1U58B 3M46A 4PCTA 4MD0B 5F96H 3BT2L 1QW9A 3P0YH 4IBZA 2UZIH 4BGDA 5MP6L 3D09A 4Q58C 5E2UH 2VXSH 2ALAA 2MTAA 3V9FA 3WFEL 4B0MM 2NY4B 2J43A 4X5LA 1EAJA 1C5BL 4LCVA 1WD8A 5F7EL 2GY5A 3HE7A 4Q89A 4LLWB 2MPAL 2N3JA 4PJCB 3OAZK 4LK4A 3HI1A 1ZCRA 3DVGA 4G72B 4MNQA 3IGAB 1XF4A 2BNQD 2AQNA 3IFNL 5F3BA 4A67A 5GS1A 2VLJE 3LJ3A 4K3JL 3HC4L 3HFFA 5D1QC 3FU6A 3LZPA 5A3IC 5FCUL 1YC8A 4TQIA 5D71L 2QVIA 1ZWIA 4BUQA 1ZHNA 2OR9L 3C5ZD 2VJ0A 3CC5A 2CO6B 4NP4L 1JZGA 4G3YH 1WFUA 1E67A 3HC2A 4HHWA 1OAKH 5TTRA 4E41B 2FSDA 4WEBL 2UZYA 4HYTB 1NANI 3QUYA 2CCVA 3JVGC 2CBPA 4XOAA 5K33A 5IMMA 5BUPA 4AYDC 2GFBB 4AM0B 3WIHA 2ICEC 1Q8MA 3LXUX 3PREA 4JFPA 3T3ME 1T21A 1H0DB 4Z5RB 3SB3A 5IB4B 4G9DB 2QQKH 3O2DH 3FFCD 4M62L 2FZ3B 3UP6A 5DVOA 3QH3B 4LCYB 3QZWG 3VSUA 3K72A 1KJ3H 2WQAA 4I9WE 5EZLA 3L2MA 4P23D 2OXGB 4HS8H 1MWAB 1MJUH 5LGJA 1TOXA 4IBLT 2D31B 1ADWA 1X5YA 1S3KL 4FNLL 3SDYL 3QZOA 1FSKB 1TF4A 4FQIL 5AVUB 4F7TA 3QCTH 3ABKB 3QZBA 2PCFB 4KKBD 5D70L 3U9UA 5AVSB 1BSIA 3WO4B 2X28A 5IHZB 1TUPA 4PREA 5E4AA 1HH9B 3O4OB 2UUDK 4YDJB 4MJIA 3CU1A 1I7UB 4HKBB 3TO2A 1JHLL 3UDWC 3WFHB 5BNXD 2WNXA 2A9NH 3C6SA 5FO9A 3ZKNC 1KC5L 2TSAA 1Z66A 3DOIA 3HI5H 3TIEB 1M05B 3QEGH 5ID0A 3TNMB 3CX5J 1KY7A 5GS3A 3IMVA 3ULUF 4RAVA 3FU0A 2JKSA 1N6VA 1Z0NA 2DJ4A 4DKFH 3MROA 3RL1A 3JTTA 5CO1A 2WKLA 3IXTA 4RZCB 4DPCX 2A4ZA 1C16A 5DT1L 5KSAC 2A0LD 2CRIA 3TPKA 3M45A 2W9EH 4ANKA 5GGSY 3UTZA 1BZEA 2ZUSA 1ETJA 3BSZL 4UQDA 3BAIA 1DDTA 4YHNA 1OSPL 1I9RH 4FYTA 5DMIH 1W8NA 2JI2A 1ZPUA 1D2PA 4I85A 4XC1H 2BNRA 3Q3GA 2VTFA 3QXUA 1J12A 3ECBA 5HJDA 4KHTL 1FAIL 5T1LA 1O9VA 12E8H 4QRPD 3UGUA 3CFJB 2CK2A 5H4ZA 2JJWA 2FEJA 4UYPA 4F7MB 4G70B 1OM3H 4EUPB 2GJ6E 3TS8A 1UD2A 5FA4B 3MGOA 3EOBA 4MA7L 3CWGA 4U1MB 2Y5TA 5TFSL 4XPAH 5JQIB 3GSNA 3QHTC 4N9GA 1E5CA 5JHDB 3B7YA 2SEBA 5L2JB 3KPRA 5LNDA 3MODL 3O0RH 1FL3B 4J1UB 1H8NA 3D7PA 1JZFA 3HG2A 1IEBA 1PY0A 4Y88A 5LAPA 3WDHA 1PZ3A 2F19L 1RKRA 4FJZA 5SWSA 4NQVA 3VXSD 3KLHC 1SJEB 4O5LH 5KSBA 1OVZA 1SXZA 5DRNA 5EU6A 3T2OA 2YOCA 4JM4H 3WNNA 2ED9A 3WJJC 1TEGA 3DGCR 1CFVL 4B7IA 2H32H 1AXSB 2FATH 4X7SH 5IHWA 1HI6B 5J3HD 1JPTH 3AROA 3I3BA 3ARBD 5E2JA 2CD0A 3PUUA 4Y5YC 2YBGA 4ONHA 2Y7MA 3TVMD 3BT2H 5TGBB 3LB6C 4TUOA 3GJEB 1ETZB 2V6HA 3G6JE 3OR7B 5MP6H 1BZ7B 1SJHB 3OAWA 3O41B 4FFWD 3WFEH 2WZPA 2J21A 5DJ0A 5IFHL 4WKZB 1D5ZB 1I8IB 2MMXA 1IM9B 4JGUA 1C5BH 5HHVL 3EJUA 1ORQA 5PAZA 3GMQA 5F7EH 5HYEA 3L3OA 3Q5OA 3W1ZA 2MPAH 1OGSA 1B90A 2EICA 3KDMB 4DP6X 1PJ9A 3BOVA 3H2WA 4JRLA 2BCKA 2LLLA 4WI4A 1L0PA 3IFNH 4Q6IA 2VZUA 4TULL 2BZCA 2JSFA 3HC4H 4K3JH 3F7LA 3OJVC 2G75A 4Y1AD 5FCUH 1IEAA 3DVIA 4R0LC 2B16A 5D71H 2FLBT 3MRJB 4G82A 2OR9H 3GBNL 3L4YA 2F53B 1WTLA 4V11A 2Q76A 4OZHE 3BD5A 4NP4H 2X0WA 5C0CE 4WEBH 2APBA 5JXAL 4P2QA 1CU4L 4KZCA 3AT9A 1DVSA 4QXUL 3FTZA 5DWPA 3EH4B 5INCA 1HOCA 3DIVA 3HVNA 1C9SA 2NNAB 2MOQA 2XTJE 5HJ3A 2CKBL 3H9SD 3CCHA 3D30A 4JCWA 4B3VA 4C4BA 4M62H 2IDCA 2F74B 4G1MB 4OGYL 5DD3L 3OMIB 2KH2B 2LABA 5FAAA 3ABGA 2YD4A 3RZCD 3ZOAA 4EXPX 4FNLH 1S3KH 3L54A 4TNFA 5F7YC 3SDYH 4FQIH 4NC2B 1IGIL 5IEHB 1X7TA 3ZLQC 4U1LA 4XTRC 5CZKA 4NZJA 3VRJA 3WJJA 4JFEE 3MRCA 2WD0A 1JWUA 4K3HA 1BF2A 1A5FL 1ANUA 5D70H 1GGBL 4ZOCA 4NEHB 4OH2A 2V3FA 2HJFB 4KRLB 4TKWA 3HPLB 4D3CL 1RIHL 4Y5YA 1A65A 4PJFA 1JHLH 3S96B 4XNQB 1G9NL 4APXA 4UAHA 2UZXB 1ZVSB 1B4TA 2J71A 2OMBA 1JPGB 1KC5H 2WM0A 5ACZB 3ILPA 2BVPA 1VEPA 2FDBP 3V4VL 2JXMA 5FM4A 4JMNA 4IRJC 5K69A 1R5IA 5LQBL 3KPOB 4JRYD 3OQ3B 4Y2LA 2FT7A 2AXFA 1UA3A 4I2XE 3UZQB 4L8BB 3VB8A 3BRFA 3QO0B 3FRPB 5HGBB 4R2GB 2BOBA 1WPCA 4H0HB 4TN9A 1TPXC 2F8XC 3N1QC 1SBBA 3FDWA 4FXKB 5D1ZB 4CSTA 3VD4A 5BOPA 4QJ5B 2LGNA 4MLIA 5L88L 1OTSD 2PYEE 5DT1H 3BJ91 5DMJB 4X4YB 2XWXA 5F9AC 4OIAA 5F2FA 4J8RB 1CICC 5H2BB 3AUVA 4BK8A 4ZMXA 4IGBA 2ZG1A 3BSZH 1E4KC 1QSFD 1KTCA 1LL1A 3QS3A 5AOIA 1OSPH 2WLZA 1DQJB 4OM0L 4JFYA 4LCUB 3L5JA 2AJVL 2VABB 2K6ZA 3S37L 4NERA 5DD6B 3LN4A 5FLUA 4KHTH 1FAIH 4MBRA 3KGSA 1WZLA 1LE9B 2E6JA 1QRNE 1AQHA 1I85C 3D0VA 4G7VL 3SD2A 3P3UA 3U1QA 1S5IL 5D55A 5IHUL 1M2VA 4U4IA 3N6YA 1SEBB 1T6VN 5HGAA 4PRHA 1PKQB 4L1TA 3F84A 4HIIB 4MNGE 3WXWL 1R3HB 3K6NA 3TCXA 4MA7H 3ZKMC 4OZGA 1NGYA 1URLA 5TFSH 4Z7WA 4KITB 1ECYA 4PJ9D 3CX5K 4NKOA 2E8ZA 5BRQA 3MODH 3FSZA 1KT2B 4GIAA 2F19H 1URZA 3CXFA 5DI8A 1R34A 1THCA 5BQDA 4EEEA 5D96B 1SEQL 3VMPA 4HWBL 4R8WL 2JK5B 2NY6B 3S37X 1UM6L 4YL9A 3VFTA 4W9HC 5AVZB 2AQTA 3KLAB 5D1ZI 1ZK9A 1CFVH 5C09D 2ARWA 4NT6B 4MA8L 3BKCL 4Y4KC 5KJ4A 1A6UL 2CUAA 3ZHNA 4YAQA 4Y5VB 5B8CB 4D9LH 1B88A 1L9SA 4QT5B 5KBMA 5I73C 1K4CA 3QB7C 4GRWE 2YFOA 4N0FA 3MV8A 6FABL 5B3JF 3ME0B<