3Q48A

Crystal structure of pseudomonas aeruginosa cupb2 chaperone
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
217
structure length
194
Chain Sequence
IAQGTRVVFPASEREVTLRVSNTSGTPVLAQAWIDDGRQDVPPEELQVPFSVTPAVTRVEPNGGAVLRIAYLKAPLPTDRESLFWLNILEVPPRFSFRSRFKLFFRPSQLKSVDSAAGKLQWKFLEVVQVNNPTPYYVSFASVELIVDGRVMSVGKGMVAPFSTKEFDWMEAASVRYEVINDYGGRNTHDRALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone CupB2
publication title Structural and functional characterization of Pseudomonas aeruginosa CupB chaperones
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 33
structure length 194
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q48A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q48A02
3T3ME 4UINL 3VXPA 3EOAB 5D1ZC 3QNYB 1T03H 3O2DL 4JFEB 3QPQD 1A1OB 3WHXB 2I9TA 4JY4A 5HHNA 3T2QA 3U2SA 1I8KB 3MRDB 3F8UB 2XIDA 5HGDB 1UACH 2MMXA 2QTEA 4G9FB 1H8SA 1QBLH 4EBQL 1LE5B 1UT9A 1T4KA 3ULUD 3L5WB 1ORSA 5FV2A 4MQXD 4G7VH 1DLFL 4X7EC 5CKGA 1KULA 1JP5A 1I75A 3MYJA 2SEBB 5T33H 4GAJL 4X4XA 1NEZA 1S7TB 3ALWA 4YZFE 2C26A 5FDYA 3U9UA 1H0DB 3KYMB 4DN3H 2XTLA 4XCCH 8FABA 1PKQA 1TLKA 5BV7L 4ODVL 4ZSOA 1A7RL 3QUMH 4R3SA 3CSYA 2HN7A 4YBLB 1YEFL 4OT1L 4S11A 3KPNA 1FZJB 2X4TA 5DRZB 1JNJA 2NW3B 1JL8A 1N8ZB 1WSST 3SDDC 2V2XB 5J6GA 1RI8A 2D03L 4EOWL 3IDYB 1U6AH 3QI9B 3NGBC 5E8DH 1JE6A 2O61A 1JBJA 4X80L 4X6CF 2DIAA 4FQQA 4M7ZC 1FNSH 1UJ3A 5FO8A 5I9QC 4UIKL 4LQ1A 1XR9B 4U6XA 2YSSB 1K2DA 2EXYC 5GGQL 3HLAA 1ZA6A 4E5XB 1WV7T 4K7FB 2R29L 4NN6C 1A9BA 2E6QA 2ADIB 1EO8H 1LP9E 4UUJA 2ZSVB 5JXAH 5DJXA 3L3DA 1A3LL 4Z7QF 3LKQB 1VEPA 4NQSB 1ZGLB 1HXMB 4PRPA 1LE9A 3OKNB 4ZQKA 2FZ3B 2N1KA 2P8MA 4PJAE 1YECH 4P48A 2CDFB 3ZKSD 4JANB 4Z7VA 5C9JA 2IANB 1AXTL 3S5LB 4HS8H 1XGRB 5C9KA 3G5YB 1YN6A 1A7OL 3OAZH 3RTQD 4JFDA 4OBRA 1R24B 1S8DB 3HN3A 1DE4B 3U4AA 6FABH 2ZSWB 3VFTB 4BYHA 5KSAC 4WFHE 1V3LA 5TGBB 3TJHD 1I1AD 3C8KB 1JIBA 2APBA 4BQ8A 4KAQL 3MTRA 3QEQB 2EDYA 2VLLA 1OAZL 3IS1X 3LN5B 3SDAD 1VDGA 3D6GA 3I3DA 3MXVH 3TFKD 5E2WH 4L3AA 1FLRL 3GI9L 3TO4A 5E08H 5IFJA 2GY7B 1CYGA 4HJ0D 4ONHA 5B39G 1AIFA 3GK8L 3S35L 2XN9A 4PFEA 4U33A 5D71L 3L6FA 1YEDB 1T5XB 1SYSB 2CLZA 1JTPA 4GG6F 43C9B 4H20L 3B5HA 2CD0A 3RKDC 2DQJL 3V4PH 3BKJH 4NP4H 4CDGC 5GQBA 1OD9A 1YEKH 1N64H 4KTDH 1HXYA 1TXKA 1J5OL 1M6OB 2D3VA 1H3TA 4GRLB 1P1ZA 3WNKA 15C8H 2HVJA 3NCYS 5DI8A 3RZCC 4OI7A 1FNGA 4PG9A 1EEZA 2R2HB 1D6EA 4XNXL 1A6ZA 2JCCE 1QG3A 4E41A 1XF4A 5BO1L 4UT9L 3K4AA 4LVNB 5FIEA 4N8VA 25C8H 2Q7YA 2DQTH 3GIZL 4LLWB 4ETYA 4OF6A 5DGRA 5E4EC 3WJLA 1BOGA 4CMMB 2C3HA 4TSBL 4UBDC 1UZ6F 2EKSA 1CIUA 3U0PA 1G7QA 3GSUA 3A6BH 5T1KA 4U1IB 5F8RC 2NXYC 4OZGE 4UTAH 3CU1A 3VMOA 5FOBA 1QSED 3TGXA 1T1WA 2XFXA 4P3CL 1AO7B 4QRRE 3VXMA 5E8PB 5IFHL 4WO4D 4XCFH 3QJHA 3QYCA 1P4IL 1OB1B 5BRZE 5C3TA 1RFDL 5H2BA 2YBRA 2EE3A 4RFOH 4OUUB 3WFHB 4JRXE 4J3SA 3ZE2F 4TSAH 3LEVH 2RJMA 4K94H 2IH1B 5JPNB 5C0ND 4UQ2B 3CSBA 4PREA 4F7TA 3WS6C 1NEZG 4P2RD 5AG9A 3G6JE 1JNHB 2BZDA 5L2KE 4KFZC 3MV7B 1OTSD 1CLYH 3OR7A 1TVBB 1LD9B 1RZJC 3QDMA 5DTFA 3MRQA 3FQWA 5DJYB 2Y4SA 1BVZA 3QSKB 3JWDH 4K9EL 3QNZA 4RQQA 3HA0A 1J8HA 1VFMA 2CPCA 3RVUC 1ZGLP 4XP9L 4M6NL 1DCLA 1T1ZB 3FFCE 1SM3H 4OLUL 5D72H 4K3DH 4OZFH 1WBXA 4NQCB 5IEHA 3EFFB 1Q72L 2BX5A 2FGWH 5GRYA 1JYWA 3NIFF 3H9HA 2P5EE 5AZEL 4HKZB 1I4FA 3SKMA 3W39A 4RMQA 3RHWK 5F96H 4QXGH 3VXSB 3O6LL 3VGFA 4XCNB 3B9KB 4KV5E 5HJ3B 5C0EA 5F93C 5DHVB 1ORQA 1CVRA 1F4XH 1ONQB 1XCTA 3BW9B 3IT8D 4YX2H 4HUUB 1QSFE 1NMAL 4ODUA 4R96A 1ZVHA 1KNOB 4AM0B 3IFOB 5KVFH 3QCTL 5E4IA 4JO1L 3NFSH 3O11B 2Q87A 3QR2A 3UP1A 4PP1D 4JQXC 3DGGA 1HEZA 2FJFB 1IAKA 2ZKHL 1F02I 1T5WB 3KJ4B 4GSDH 3ZSSA 2YC1B 3QUZA 5I1HH 2GJJA 3S4SA 2YRZA 3QO1A 3C87A 4FG6C 4M1CC 4DFIA 4QF1A 2UYLB 3FMGH 4ZXBB 1A4KB 4ZUVA 1RD6A 4NC1C 5TDNB 4E42B 2E7LC 1VB9A 1T0NA 4BM7A 1A8JH 2XKUA 3KXFE 4R90H 4PJCB 5I1KL 4L3EE 1QFWH 1CD1B 2YR3A 4N5EC 1A0QL 4XMKH 3RNQB 1MRFL 4CL7A 1ZKAA 2YHGA 4KJQC 5KJRH 1ZEAL 1J7VR 5I18H 1R0AH 1G7HB 5IHZA 2LU3A 1CFTA 3OR6A 1JFQH 4WUUD 3U7YH 3VRLF 3FO1A 3TNNB 3NABH 2B39A 3UXFA 5ETUA 4LSSL 4X83A 4HKJA 3SGKA 2VDRL 5D4QA 3ULUE 2QKIB 2IBZY 1ZHLB 2BVPB 1IC7L 2XZCH 3OKOA 2R2BB 2UZIL 1G7PB 1U8IB 2YMXL 5ISZA 2Q8BL 5A3IC 4XXCA 4O2CB 4DK6A 4UAOB 4JG0H 1IGCL 5E00B 4ZOAA 3MJ9A 4Y16D 2IPKB 3BPCB 1EHLH 3IKKA 2H2SC 4XH2B 4Z8FL 1S7WB 4G8GA 5I1EH 3IJYB 4OIIH 3LKNA 4OZIA 4CVWA 4PLOB 2H45A 4LAQH 4MXVF 4UT7L 4HC1A 2ICES 2ZCKH 4N8VG 1BEYH 1KIQA 3N9GL 3GMLA 1E4KA 3OKLB 4HLZG 4M4PA 5EU7C 2R2CA 2DMKA 3LKOB 2HFFB 3BH8B 4HIEB 3FRPA 3PHQA 4G7YH 1YEHL 1C1EL 4P23C 5I1CH 3V5HB 3RPIB 2HLFC 1XF3B 3PGFH 4MNQE 5DJ0A 5A2IH 4WW2A 4KMTL 3UTTA 5F7HA 2FIKB 3QDGA 3LIZL 1JHKH 4YHYC 3TPUB 1KTDB 5IWLA 2BSRB 4LDOB 3QIUC 4MXQC 3ARFB 4L9LB 4FMFA 1QFPA 2BVQB 1QNZL 3GBLA 5D2LB 3O9WB 5IBUG 1OPGH 3BP4A 3WJJA 3O6ML 2X4SA 1LEIA 4NGHL 5D7JC 3AAZA 4DGIL 3M1BB 3LY6A 1OAYH 4I4WB 1EO5A 1XF5A 2VL5A 1MELA 2NY2D 4IRJA 1PDKA 2ED9A 4L8SA 1AR1D 4OZHB 1SQ2N 3NIGE 3QUYD 2D7PA 2BNQB 4XAKD 4PS4L 4TRPL 1ETZA 1QSVA 5FYLD 2AJUL 1KIPA 2PW2B 4JFED 1XF2B 2AK4A 4HGWB 4TVPD 2JJSA 4WU7B 43CAA 2EYTB 3MRBA 3ZKNC 3OX8A 5KANG 2VZSA 3ARBB 2GSGB 3VWKA 1C7SA 2R2EB 5FYJH 4L4JA 4YXKH 2NZ9D 3MXWL 3LZFH 3U30C 2QQLH 3LV3B 1UCBL 3CVHB 4LQFH 4OQTL 3TV3L 3SJVB 1DQQB 5GS1A 3WN5B 5BS0A 1RJZA 4WEMB 3UYRH 4K8RC 3ULVL 2QADC 2GTWA 1OT1A 3IDGB 5CEXA 1RZFH 5EFIB 4LVHC 4FP8L 5KSBA 4S10A 1O7SA 5ILTL 5JOPE 3JV5A 4WI3A 4XPHH 1KFAH 5I74B 2P7TA 5KAQF 2YZ1A 4M48L 3VW3H 1YNKH 4PJHE 3TBVB 4P5MA 5DVOA 4BJLA 3OAYH 2YA2A 1CGYA 4D9LH 4YNYA 2N4IA 4BSWA 3QI9D 3K4DA 4E0RA 2CJUL 5MP6L 1IM9B 4XT1C 5FYKL 3W5MA 4JVWA 4P3DA 4APQD 4KU1A 1KCUH 3S4SG 1CTNA 4DEPB 3B4NA 5DUMH 1ZA3A 3ARTA 4H25A 4Y4HB 3DETD 2APTA 4BSVB 1AGBA 4XVTH 1ADQH 4AH2B 3TNMB 3CPLB 3EHBC 1N0LA 3S98A 1EEYB 1I7TB 4U1NB 2W65B 3DBXB 4RISH 3RQ3A 4OKVA 4Z76A 1XH3A 2VLJB 1P9MA 3JXAA 3HC3L 4PG2A 5J0BA 3GSOB 1KEGL 3CXDL 2H8PB 3V79C 4P2OC 3OGOE 5E2UL 1JNNL 1N0XH 2VE6B 3SKOB 3MMEA 1IZJA 2X1QA 4M1DH 4NM8L 3VFUA 2IAND 2PTTA 2PYEA 3HMXH 2HRLA 3ESUF 3P4OB 3KHOA 1BF8A 5DJ8B 1KB5L 2HP4A 4ZD3L 4PUBL 5D1QC 4LLAA 3U7WL 2JK5B 4HIIB 3SKJL 3DSFH 5D9SB 2R4SL 4YHMH 2B1HL 3VXUB 1SVZA 4G43B 2FDBP 4MZ3A 3ECBA 5ICYA 4KRLB 1CFNA 4H5SA 3G04B 5D7SH 4ZTOH 4DJMA 4NSKA 2X4UA 1XGQA 2HTLC 4AZ8A 4M62L 3REVA 3RP1A 5E5UB 3QDHA 3LRSB 1OLLA 4LPVA 3MRKB 5F7YC 1WWAX 3O4LB 1Q0YH 1JGVL 4Y2OA 3U4EB 5EBLB 5CCKL 2Z31B 3BGMB 3HI6L 1PG7X 1LHZA 4WUKH 1NUFA 5DSCB 5KVGL 3TH3T 3FRPG 4OLYL 4QRQB 4QRUB 4RRPA 3CC5B 3G5XA 1EJOH 1S9WA 3R0MA 2ARJQ 4K2UL 1RHHA 3FQNA 1JF1B 4XMLH 4BA8A 3QDJB 4GRLD 1JRHH 1F3DH 3JUYA 2F5AL 1T89A 1C5DB 5DMIL 4ZS7H 1GOFA 5H37H 4NZDA 3MNVB 1N6QH 2EYRB 4LLVA 3VD9A 4K7PL 4PJAA 1QOKA 5EU6B 3D87B 1ZSDB 1RJCA 1PAMA 5GISH 4DOHE 5DR5L 1S7XA 3BT2H 5AWNL 3GMMB 3IGAA 3MOBL 1RZKC 4LPTA 3AY4C 4HW6A 4I3RL 4TULH 4WW1A 1F4YL 5F7KC 3V4VL 5MENA 3DX7A 3QG7H 1NKOA 2HG5B 1NEUA 4ALAH 1M7DB 3ZL4H 4HFUH 4JG1H 2H32B 3CMOL 4AYFA 3T0VA 2QBWA 1GPOL 1S5HA 5EA0H 5JO5A 4HD9A 3QIWC 3ILQC 4TVSa 5J1AA 3U79A 2CLRA 3IXTA 1W0WA 5LGHH 4LFHD 4LU5L 3L3JA 1KXTB 1KTRL 2OJZL 1VADA 4KK9C 5CBAB 3PDOA 5I8CA 1Z9SA 4I3SL 3CVHL 3T1FA 3NGBB 2YPKA 2LQRA 2DKMA 5FF6B 3MV7D 5I71C 2A1WH 4NHUB 4PJGF 4MQ7B 4WUUE 2R0ZL 4H0HB 1G1CA 5L8JB 1SMAA 3EKCA 3ARRA 4M7ZB 1A7QL 5I9QB 1MCNA 3EFDH 1E4XL 4OCYL 5GGVH 3D69A 1A7PL 2DQEH 2VDPH 1I9JL 1R3IL 4NUJA 3ARUA 4KRMB 2XZZA 3FB7B 3GZKA 3UTSB 2JCCA 3MRIA 3PJSA 1DBJH 3UX9B 1IAMA 3BIKA 3UPRB 4DN4H 3VFMA 4NN6B 5F1KC 5KVDH 4PJFB 3GSNB 2GITB 5F1NB 5EBWB 4NOFA 4NQCD 5JZ7C 4MXWL 2O93L 5INDA 1FSKC 4JCMA 4QNPF 3KPLB 2KQMA 1AC0A 5EPMB 5MI0C 1IGYB 4OZGA 1DN0B 1W0VA 2VLMD 1MUJA 3VXSD 1I3UA 2GHWB 3B9KD 1HZHH 1J0IA 1CXKA 5K9QI 4QRRA 5MEQA 5DD1H 5FEBA 1G7IA 3FT2A 3T0XA 5EIIA 3I6LD 4JHAL 3KGRA 5BRZA 1C16B 2CH8A 1M05A 4NRYA 3K8KA 1LEKA 4GG8A 2YPVH 2R0KH 2FR4B 1UA6H 4JRXA 1TJGL 4HKXB 3GJFH 5FYKD 3X17A 3RWGA 5KSAB 3NPSC 3RAJL 5C2BH 3VXQB 4TPRL 2X4RB 1KPUA 1QEWA 3K2UL 4FNLH 3OMZA 5EBMB 1FL5A 2QSTA 1FGVH 5JW4N 1MIEL 1H3XA 2ERJC 3G6JA 1F6AA 1AP2A 4OJFL 1NAMA 1WISA 2X1XR 4I0PB 1TETH 3GRWA 4XMPL 5LJYH 2QSQA 4HFWA 3DYMA 3NN8B 4ZXBD 2IQAA 4QRTA 4K23H 2DDQL 2Y06L 5EH1A 1NCWH 3D18A 1QR1B 1VKXB 3CSPA 2Q86B 3QEGL 4BFGA 5E5MA 1IGIL 4LSDA 4LSUH 5CD3A 3FFCA 4XAKE 3O81A 3UJTH 1D6VH 3LN4A 4Y5VB 4JFEE 1XIWA 5K9JL 1DLHA 1SEQH 4DTGH 4TVPE 5FECB 1A21A 4EDWL 3VMPA 2RCSL 4KKCD 1CF8L 2P5EA 3J8F7 3IETB 3R06B 4FXKA 5C0CB 4DVRH 4N0UE 5C0FB 4Y2DA 4NO2B 3O0RH 4LOUD 4Y0GA 5ID0A 5DK3A 4H1LH 3RUGE 5BVPH 4IIQC 4RRPG 3N1FC 4Z6AT 1AE6L 1HI6A 4YC2C 5GRVL 1AD9A 1MWAH 1QSFA 4R9HA 1J1XH 1JK8A 1YC7A 2ITCA 5JDSA 5HYJA 3CMGA 2DLEA 4XP4H 1CBVH 1SMOA 1N5AB 3MRLA 2HMID 4PJXB 1P4LB 4YDKH 4PGBB 4Q9BA 2VXTL 4ONFH 3T0EE 3RHWF 4CBPA 3UBXI 4LKXA 1FJ1B 2WW8A 4HS6A 1X5YA 5B8CC 4JFYB 4G8IA 5SWSB 2YXMA 1K8IA 4OGXH 3X13B 3UBXB 1U8QA 1P6FA 1U91B 5EG6C 1BFVH 3KXFA 3HAEA 4LCYA 2NLJA 4GBXC 4L3EA 3AM8A 4X6CB 1R5IA 1U58A 4LHQB 4XPFL 2C4XA 5J06A 1I7UA 4KC3B 3O8XA 5FYLH 2VISA 2R9HC 1BWMA 4J23A 1UEYA 3ARFD 3LQAL 4C56B 3AGVA 3ARPA 3DX9A 4HWZA 4TVPH 3O9WD 4U49A 5I1AB 5D2NA 1K5NB 3CVIH 5DJ6A 4CVZB 2IFGA 2EDEA 1V5JA 4L4TB 4FQCH 2NY3C 2PKDA 2AK1L 3SDYH 2BNQD 5IV2B 4MCYB 5D7KD 4QKXB 3UTQA 1HHGA 3ARBD 1MFEH 4RX4D 4U6HB 1NFKA 4GMSH 4XNMA 2XV6B 1R5WB 1XCQB 1AY1H 3C8DA 4N0YL 2GAZB 5JMOC 3V95A 3GHBH 3M07A 2Y7QB 2UY6A 1FFPA 4XPTH 3SJVD 4X9FA 5HDOA 4U1LA 1UZ8A 1S9KC 1UKQA 1S9YB 2BDNL 3O45B 4PY8I 3FQTB 5CHNB 1F8TL 5EZJA 1UJ3C 4WEBH 4MNQA 4MVBD 1VGEH 3KYKH 1VACA 1JNLL 2XI9A 5EU5B 2F54B 5JIKA 3RWFB 3MNZB 3SKUD 3KDMA 1CFQB 1MCWW 3B83A 2W60A 1PZ5B 1W72L 3H3PL 2DN7A 3VGGA 4QHKI 2BFVL 4MQTB 5C0RL 4TOYL 1Q0XL 4L8BA 1QO3B 3Q6GH 3CFCH 3QEUA 1WFNA 2ZNXA 3HE6D 1MHHA 3BQUA 5FXCH 4YO0B 1HILB 2R1XA 4IM8A 4X4YB 5LBSL 2D7MA 4Y4HD 2XRAL 3RVTC 4NFCA 3PP3K 4U6VH 4L9DA 2ADJA 4FS0A 4EI6A 1MJUL 4NZTH 3MBXH 5EZIH 2VLJD 5CJOH 3DUUA 4QHMA 1NC4A 2VJXA 4M7LL 4QGTA 4BH7A 5EIQA 1NCCH 1H15A 2GUOA 2ATPB 3RVVC 5K9KA 5LXGL 1I1AA 4W4OA 1IC5L 1U8LA 2UWEF 3VCLA 4QXTA 1G9NH 4M61B 1MRDH 2OR8A 4GKSA 4PP2B 3TO4C 1PLGH 3TYGH 5I1IH 1CGTA 1MCOH 3P73B 1IEAA 4F3FB 5DC9B 1ZVSB 1OSPL 4HF5L 4YBQD 1YNLH 3D2UA 3ZE0F 3VXUD 3CUPA 3H42H 4PJHA 3MYZA 5DLML 2YMXH 4PTTB 3FB5B 5TF1H 3MROB 1X5GA 3MRFA 1F3DJ 4RBPH 4WHCA 3BP5A 1FG9C 4BH8B 3V9FA 1B2WH 2YD8A 3MV7E 3MNWA 1AQKL 1ITBB 5EUKB 5E1HB 5EOCH 2UVEA 2PNDA 4QEGA 2DWEA 4YHYB 3QNXA 4NJAH 2D31A 3O4LD 1UWEH 3IFPB 4QWWD 4JHZA 5C71A 4QRPB 4KI5F 2NY1C 2Y23A 4QRSA 5DMYA 2Z31D 1CD0A 5JLZB 1FL6A 3U46A 2ADFL 3ULVE 3WO4B 1IVLA 3VMNA 3E6HA 1XGPA 3HAEG 2JIXA 4PRBA 1GZPA 2NTFA 2NNAA 3MV9A 4WENB 2XQBL 3NA9L 3QDJD 1NCBL 4PJEA 5GPRA 1HCFX 5IJVA 2CDEA 3PWUB 3B5GA 3HB3D 5ALBH 3WFZA 2IAMA 5EU6D 3I6KA 5F6IB 1V7ML 4Q58C 1VPOH 2ZG2A 4U6YA 4I48B 4AENA 1BLNA 4QY8B 3DMMA 3QQ9D 4MHHI 4WO4A 4HUVA 1KENH 5GGSA 4OZIF 4NO3B 5DVNA 4PJ5B 1L9NA 1HINL 4FQIL 4HMCA 5GGTA 3U30B 5FYKE 1IKFL 5F7FA 5DQDL 4JFZL 1UFUA 2NY4C 4NQXA 2AJYL 4KJWC 1WIOA 5D6CA 3MJ7B 5F3BA 4P0DA 3V8CA 3MLRH 3O2DA 1RIVH 1AGFB 4YE4L 5J11B 1CFVL 5IJKC 2H6PA 2QADB 1P4BL 2V9RA 3FCTA 2GI7A 3TYFA 4LVHB 1UH2A 4R7DB 3AREA 1BIHA 1CDJA 4Z7NF 1FZKB 3B3IA 5BMFH 3V0VA 4WW2F 3NCEB 5F7DA 3GSVB 4YXLH 1IM3A 4PJCE 5ERWB 4S1DC 4ISVA 1NDGB 2W07A 2BNRB 3FOLA 3UTZB 1Q38A 5I1LB 1KPVB 5INCB 1BZ7A 2BY3A 4X99A 3EYVA 1K6QL 3HZMA 5E8OA 4ENED 3OXSB 4NNYB 1HSAA 1RK0B 3B9VA 1A02N 1T0MA 5AAWA 2DQFB 3N85L 4HWEH 1F6FB 4R4FH 4LASL 3UTSD 3BKCL 3NTCL 3SGJC 5D1XC 2EICA 3WFEL 2W0FB 1JPGB 2GTZA 3OBAA 9CGTA 4PGEA 5D96C 4YHOL 3PWVA 5DHVH 1T7YA 5ANMA 1KYOJ 4FABL 1A7NL 1DUZB 1I9RH 1JGUL 3ZMRA 3IFLL 1ZHNB 3BPNC 4YPGA 1Q9KA 2AEQL 3NOIA 4MD0B 4XX1E 5MEOA 1V7NH 2AEIT 4P2OB 2C1OA 2XWJB 1DBKL 3MA7A 3L9RA 4G42A 3CFDA 2NTSP 2GJZB 3HHRB 3QUZC 1WK0A 4X5WB 5C7XL 2DMBA 1JYVA 4C59B 3ZYZA 5DUPL 3LSOB 5KSBF 3CDCA 3BZ4A 5D1QB 4ZFZB 3MLSH 2AJZB 4OFPA 5MEPA 1EHXA 4OB5H 4PRDB 3D39A 4U1SB 5BOPA 3OPZH 2OBGA 4PGZA 4JPVL 1QP1A 4OGYH 3QPXH 1DVFA 1QSZA 1QUNA 4HKBA 4KPHL 4N0FB 3P30H 1A4JB 4H8WC 5HYQB 3CFIC 3STBA 4PV9B 1GRWA 4R26L 4MA3B 3JVGA 3AFLA 4ONGH 1OGAB 3TC9A 4LSQL 4I0PD 5TFSL 4LGRB 1HHIB 4PJIB 2B5IC 1TJHH 4UNTA 3SGKC 4UTBH 4WI9A 4X98B 1ZT7A 1ITCA 1MOEA 3IXAA 3MLTB 3RKPA 1S78D 4D0BA 4HPYH 4OZHE 1RUML 2OZ4H 4PPTA 1PG7H 2I07B 1C5BH 2P8LB 3G6AB 3CXHK 3VRJB 2BNQE 2GK0A 1A6TB 4OCWL 3THMH 1TZHB 4L3CB 3ZKXC 1T0PB 5C0GA 1NAKH 3TO2B 4GRMA 4EQ3A 5C0CD 4S1RL 3QT2A 1T1XA 2BC4A 4NNPH 3UJJH 4FQJL 1E4KC 2BOBB 3SJVE 2AJXL 2XG5A 1FCCA 5FUOL 1X44A 1X4YA 3H7BA 3PHSA 4TNWK 4UBDD 5A2LH 4PGDA 2L7UA 5C0BB 3ARSA 5I1DB 5CSZB 5CP7B 2D0GA 5FKPA 4ODSL 2OI9B 5C07B 4GW1A 2D9CA 4KQ3H 5IWLC 2XY2A 2YWYA 1RJYA 5EB9A 3RVWD 1U8JA 2VXUL 1IT9L 4G8FA 3WJJC 2Z92B 2ZUUA 3QIWB 3QO0A 1FBIH 3BP7B 4B0MM 5SWSD 5LAXB 4X6DE 3S7GA 3H8NA 4YEEA 3L3IB 1C08B 4JY6A 3WDJA 2X9YA 4GAFB 3K8MA 4L8SC 4LPWA 3DTXB 3GBNL 4LCUB 2RFXB 3O2WH 4O2FB 1NLBH 4NC2B 4HIHB 5LWYH 2WIIB 5CZVH 2JJSC 3ME0A 1JGLH 1RY7B 5EO0B 4QTIL 5HHXL 3RA7H 5MERA 2H9GB 2ARWA 3D85B 3MCLL 4C56D 4BZ1H 1I8KA 3VWKC 1S7QA 5D5ME 4Y4FC 1MQKL 1BECA 4XVUC 1FFOB 1QLFA 1UXWB 4I1NB 3QCVH 2VLJE 4DWHA 4N0UA 4YEFA 2EIEA 3LEYL 4NKOB 3RVUD 3EDDA 4L4TD 2HJLB 3OJVC 2EDQA 1BQSA 5GS1C 5EUOF 1AFVL 3RUGA 5FHBL 2DWDB 3UPCA 1GCFA 4NC0B 2OR7A 2A77H 1BX2A 2N7AA 4KHXL 1QQDA 4KROC 1S7TA 2VSCA 2EDRA 1XGUA 1XAUA 4WCYL 3IF1B 3V7MA 2A83A 3S36X 3PL6A 4N1HB 1EEUA 1XR8A 1EH9A 1NFIB 3MLWH 4FXGA 4OFKA 3T0EA 2JJTC 3HC4H 4AEHL 1NFDA 1GIGH 4QTHA 4RMWA 2BCKB 3C2AH 2V5RA 4GXUN 4LRIA 1N8ZA 2LVEA 1EBPA 1JZ4A 5CS7A 4MJ6A 2A6DB 3T4AA 4JFFB 3QI9A 1CZ8H 3SQBA 1HK6A 5ITFB 5IW6B 4YXHH 4S1QL 5I16A 2E9JA 4APQA 2WLYA 2ERJB 2F74A 3KPOB 1U0QA 4FG6D 3S9DB 4J3WA 2YSSA 3I02A 4YR6A 2BNUA 1NGQH 3JV6B 2ZWLT 4C58B 2P49B 1D9KA 5GGVY 2LU7A 1EO7A 3MLYH 3DRTA 4KRPC 1P9MC 3U4BL 3WDHA 4B7IA 1LK2B 3B2UC 4KJYA 4PD4J 4PG2C 5IW1A 4OV5A 2GCYB 3GBML 3LH2H 3IJHB 5CJQL 4N5ED 5SWZB 2D4FA 3LKQA 5JOFB 3QDJE 5F9JA 5C0JA 4NRZA 1KJ2B 5L0QB 4KJQD 1QHOA 2H1PH 5E56A 4M6MH 2O5YL 2C3GA 2CDFA 5EU6E 4DKFH 4TYUA 4XRCB 5J13B 2V6HA 3RWIB 3O3EA 5DJAB 2IEPA 3GMQB 1XGYH 1N26A 3ZTJG 5E8NA 4EIZC 1QLEL 3SPVA 3TIEA 5E0QA 5B39B 5F7WC 4MA8L 3CH1B 3ARZA 4IBLT 2VAAA 3S34L 4IIQB 3SGEI 4YC2B 5A3ID 5EORL 5F7EL 2J2ZA 5EOCJ 2OL3B 3VFGL 2MJWA 5KTEL 3MREA 1XZ0B 5ADOH 2UVFA 4WY7H 1X5IA 5CGYD 3J7HA 5E6ZA 2ICEB 4GKZB 4GOSA 2Y07L 3OAUL 4NYLB 2A38A 2IG2H 4X6FA 5FYJU 3QXDB 4ZNEE 4PV8A 5DJZA 5E6IB 4LEXL 1TJIL 5B8CB 2ICWI 4KQ4L 3C6LA 4L4VB 4XP5H 3WEXA 3JV4B 5H35B 2D7TH 2BSTA 3H9SB 1KEMH 4FQXA 3ISWA 4BSJA 4PJGB 3MRNA 4GBXB 2ICWB 5HGHB 4NOBA 1K4DB 4M6OH 1RURH 1T89C 2C4FU 3VXPB 2FHCA 2VUOA 2J8UE 2I9TB 4JY4B 5HHNB 1U36A 2BRQA 1I3GL 1EHNA 1TVHA 4HXAH 1MVUA 3MJ8A 3QCUH 4QRPD 4Y1AE 4OLVH 1MAML 4UT6L 1MHCA 1JHLH 4PJFE 1T4KB 2JB6B 5EU4A 1ORSB 2CXGA 1NCDH 3E8UL 4OD1H 1FNFA 1KOAA 4CMMA 5B21A 1IQWH 3VGHA 5HVFB 3BPOB 3MYJB 4ZPTA 3TVMA 1FH5L 4DQOL 4X4XB 5ENWA 1NEZB 2EIBA 4K3EH 2Z8WC 1MFDL 3U9UB 2FL5A 3RWEB 8FABB 1GC1C 1PKQB 2H32H 4ZSOB 1DFBH 2CKBL 4R3SB 2X9WA 3CSYB 1LK3L 2HN7B 1OB1A 1EGJH 3KPNB 1B0GA 4PJ5D 2X4TB 1PSKL 1CR9H 4K94C 5I30L 5DT1L 3VGDA 5J6GB 4YHKH 4YHIA 4LSTL 2WINA 4K8RD 3WFDH 1J0JA 2QADD 1RIHH 2FECL 5JW4R 1T7XA 2E7HA 2NX5E 4MD5A 4FQQB 3JWDC 4U6XB 4BQCA 1K2DB 1NGYA 3ARXA 4WI4A 4F57L 3MV01 3HLAB 2VDOH 4B50A 3V6ZA 1Y18A 4OQTA 5SWQA 4U05A 1A9BB 5DMGC 1F90H 2BNRD 1BBDH 3V7AE 3U9PL 5TF0A 5DJXB 3L3DB 3A67L 3HNSH 2WIMA 3GSNH 4PLJD 1LE9B 4CJ0A 5IM7A 5JW3H 5D7IA 4NKDA 2UY7A 2P8MB 2VDKL 1HH9A 3PF2A 2QSCH 4Z7VB 4KKAC 4I13B 1YN6B 1WWCA 5FCSH 3HPJA 2GSIB 1MREL 1P6AB 2ZCLL 4JFDB 4GRWF 3FTGA 2OQJA 3BW9A 2V9QA 4WJ5A 3DLQR 1DBBL 4HUKB 2PETA 3EYUH 4ZPVA 3H0TA 3LEXA 1KNOA 4P2OD 2YA1A 4G6KL 2FD6H 3IFOA 5D7LE 3FB8A 4JM4L 4PY7A 3N1PC 4XNUL 1IARB 2VLLB 5CIPA 3DIFA 4ZUTA 4JPIA 3WLWC 3TJEH 3L7FB 5ESQA 3TO4B 4G8EA 3PXHA 5IFJB 4EI5A 4XWOC 3A6OA 1UEMA 2NY5L 4ONHB 2Y6SC 1AIFB 3PV6A 2XN9B 3EUUA 4FZEL 5SWSE 1QBMH 2L7JA 4LPUA 4X5XA 5D1QD 4JHWH 4QOKE 3L6FB 5TDNA 2CLZB 4GMTL 1LO4H 2P46B 4NZUL 1NL0H 2EE6A 4X6CE 3T04D 3RIFK 5JHLL 4P9MH 1Q1JL 4LARH 1JGEA 1HXYB 1XIWC 1J1PL 1G7JA 2HTLD 1VEMA 4G5ZL 1P1ZB 4XVJH 5EWIL 2HVJB 1OGAD 5JQHC 1FNGB 4PG9B 1EEZB 1KB5A 1D6EB 2R23A 4LVEA 4NQTA 1A6ZB 4RMVA 3TN0A 1YN7A 4E41B 1XF4B 4Z7QE 2X1WL 4Y2DC 2J88L 3QRFM 2NY1B 3LDBC 4N0RA 4Q0XL 4N8VB 3DUHA 1NCNA 1HYSC 1MFCL 2Q7YB 4AQ1B 4PJ9A 1BOGB 5GRJH 3KYNA 4MAUL 3ES6A 2EKSB 3JWOH 3B9DA 1YEGH 5GS3A 1BZQK 3U0PB 1MHPL 1G7QB 1AGEA 3GSUB 5T1KB 1EMTH 5CJ8A 4WHYG 5ICXA 5FOBB 4PBWD 1T1WB 3LS5H 5E94A 3CLEL 1I7RA 2XFXB 3MCKA 1JZ3A 2QHRL 4PRIE 3VXMB 3QHTC 4H0GA 3O2VH 3QJHB 5H2BB 5HHMB 2YBRB 1LO5A 5IBUB 1GOHA 5I19L 4M5ZL 3MRJA 4NJ9H 2QEJA 3ZT5A 3ZLQC 2DQCL 1JMXA 4LP4A 5C0BD 5F88A 4MDIA 2NY4B 4WEUD 2DTMH 4PREB 4F7TB 2FX9H 1IC4H 5KANI 5C07D 1IGML 1IFHL 3O8XC 3QPQC 4MMZC 5HPOA 3QDMB 4QT5A 5DTFB 3MRQB 2MQ3A 3MA9L 4GG6E 3PWPE 2YWZA 3BJ91 5GHWL 3QIWD 3ILQD 4U0RC 3QNZB 1RZJH 2VC2H 2B2XH 4RQQB 1J8HB 3P11H 3DV4A 3ULUC 2B0SH 4MQXC 3V6BR 2R15A 1BVKA 2DBLH 3P0YL 2XKNB 5DFWH 4KK9D 3PIQA 5IEHB 5DGQA 4OZHA 5HHOA 3AMLA 2DM4A 3QQ3B 2R4RH 3HNVH 3OJ2C 4ESKA 5CMAA 1AJ7L 3ZYIA 5ITBH 1T66C 4JM2A 3H9HB 1EVTC 4AEFA 3I9GH 1I4FB 4PJEF 3SKMB 3W39B 1YJDC 5DFTA 1BD2D 3LD8C 1UZ6E 3KR3L 5JHDA 1L7IH 2APXA 5C0EB 3ARQA 5C09A 7FABH 5EBGA 5D70L 1ORQB 2FO1A 1XCTB 3DUSA 2MTPA 1MFAH 2EDOA 5DDHA 4GT7A 3W0WE 4ODUB 4R96B 3MX0A 1NUNB 3BPNB 4HK0A 4P9HH 1LDPL 1FC2D 3DGGB 1A6VL 1HEZB 4IMLA 1NBVH 3OHXA 4KVNH 1VCAA 4HX1A 1MRCL 3BRGC 3QUZB 1UKTA 3S4SB 5CWSA 4MA7H 3QO1B 5JDJA 3ZE2E 3SDXA 4QF1B 1T3FA 5DFVD 4KZEL 2IADA 4JFXB 4ZUVB 2YD7A 1T0NB 3PQYE 2OXHA 4I2XE 4PTUA 4QXUL 4X6DA 3G5VA 2EXWC 3BD3A 1ACZA 3NCJL 3PG2A 2Q6WA 1DZBA 4QXWA 4NO5A 4JFFD 2E6JA 2YA0A 1RZ8A 3MLUL 2DL9A 3N1GC 5E99H 3BQUC 2EH7H 3HE6A 4G3YL 5DYOA 5IK3A 3A6CL 5IHZB 1ACYH 1CFTB 4JO4H 3OR6B 4X0KA 5CINH 5C6TH 1OY3B 3FO1B 4QRPE 2YD6A 1SJXA 1BGXL 4Y4HA 2B5IB 5JOEA 2O5ZL 5ETUB 5ICZB 2HJKA 1A6UH 4XC1H 4XAWH 5D5MA 4I77H 3OKOB 1OW0C 1MH5A 5L8LB 1HYRC 1A14L 5SWZD 1YDPA 2XOTA 3IS0X 4IRZH 5ISZB 4RIRA 1YYMH 1F58L 1U9KA 3GDBA 3MLVL 1ZOXA 1I1AC 4W4OC 4EKXA 5IVZA 2H3NA 1BPVA 4OCRL 2VWEE 5I0DA 2CGRH 5JR1L 3ZKXB 4DUXA 3T4YA 1BFOA 3QH3A 1YA5A 2EH8H 3TFKC 2VR9A 2VZVA 4G8GB 4AJ0A 4OZIB 3LKNB 3S88L 4XP1L 4F58H 1PW3A 1BAFL 5EZOH 1P7QA 1GHFL 1S7VA 3KHQA 5C2UB 1KIQB 3GMLB 3MOAH 5IF0A 3PHQB 2WMPA 4XI5C 1ZHBA 1FZOA 5D93B 4XP6H 4BK4A 1MIML 4TUKH 1X6NA 4KJPC 4JFOA 5DJ0B 3IDJA 4WW2B 1H3PL 3UTTB 5IB3A 4LSVL 2NY7H 3QDGB 2DLTA 2Z8SA 5FUZL 5BJTA 4XC3H 3RL2A 3EYQD 5I2IA 5E6ID 4EXPX 3BP4B 1LEIB 2X4SB 2EZ0C 3BAEH 2R0WH 3BWUC 4FFZH 3T3PF 3AAZB 4XNYL 1T20A 5KW9L 4L4VD 2UV3A 4XPAL 2IPUK 2VL5B 3H9SD 3TBSA 4IRJB 1FFNA 4NKQB 3IDNA 5F7UA 5F3HA 4GBXD 4L8SB 3B2VH 3VRLE 3LHPL 4O02L 3CU7A 1PY9A 2EE2A 1ETZB 2WV3A 1KIPB 3WD5H 4JPKL 3K7UA 2AK4B 3D5OF 3MRBB 2EYRA 2LABA 3OX8B 5T3XH 2R9HD 2QHLA 3DMMC 4N1EA 5DA0B 2Z35A 3BWAA 3BP6A 2FEDC 4WO4C 3VWKB 3DI3B 4JGJA 2HH0H 1DQDL 2G60L 4O58L 4FMKA 4W6WB 3SDCA 1WAAF 5GRZA 1FDLL 3Q6FB 5L9DH 1BF2A 3LKRA 5GS1B 1UM5L 3PHOA 1NC2A 5BS0B 3BUYA 1RJZB 3MLXL 2MQ0A 4MXVE 4JFQA 2GTWB 4UIMB 1OAQL 1M7DA 5CEXB 2JLLA 1ZT1A 2FEEL 4KROB 4K8RH 3JTTA 4NQVA 5KSBB 4ZFOL 5CEZD 1CGWA 5LGJA 2IPUG 2P7TB 4TUJA 1YPZF 4P5MB 4ZNEA 3A0OA 5E7BA 1NCTA 2EDFA 3P4MA 4YNYB 2BRRH 4FQPA 3T2PA 1DDHA 1K8DA 4Y8DC 4JDZA 4BSWB 1YQ2A 4E0RB 5DWUH 2DLFL 2RGSA 3UC0L 4LCWE 3C60A 1FPTH 1OGAE 3FAWA 4P3DB 5IT2L 4X5LA 5HGGS 1K85A 3VFOA 1G7MA 1ZLVH 1ZA3B 3QDAA 2J8UA 3MR9A 4H25B 1QBBA 1AGBB 4AG4H 1KCLA 1PQZA 2D0FA 1K4CA 3AC0A 4Y1AA 1RULL 4XNQA 4OKVB 4Z76B 3VG0L 5C70A 1IEBA 1XH3B 4KRPB 3ULSA 4NWTH 2GITA 4OFIA 3CX5K 2YPLA 2MCPH 1JPSH 3KPLA 1YEEH 2QQQA 3MMEB 4Q6YA 4G6FB 5F7LB 1L4IA 1B0RA 4PP1C 2EE9A 4UV4L 3VFUB 2PTTB 2PYEB 3LMJL 4AEEA 1N4XH 5DUBA 1W72A 1DQMH 4ZTPL 5IG7A 3RVTD 1EXUA 1ODAA 2XA8L 4ODHL 1S5IH 3G5ZA 1IC1A 4JDTL 4JFDD 2VLRD 1ZLUH 4J6RL 2FWOA 5J6HA 1OAKH 5HY9A 1DVFC 5C0BE 2A9NL 5GRVK 1NFDF 3ECBB 5ICYB 1CFNB 4H5SB 4WFEE 3UZQA 2R1WA 3GSRA 4NSKB 1U92A 1XGQB 4M8QA 3NIDF 1E6JH 2MKLC 3REVB 3TO4D 1MCLA 2NX5A 4ONOA 1CG9A 2ID5A 5HHVL 3CH8A 2VQTA 1QR1A 2YUXA 1OARH 2WUBH 4TSCL 3G5XB 1S9WB 1LO3H 1RHHB 3FQNB 5IKCA 1MCQA 3HFMH 1D3CA 4JN1L 5IBTH 1P5UA 3W11D 4Y16C 1OLZA 1QFOA 3QWRA 1CVSC 4PJAB 4XBEH 4WTWA 4R8WH 4JREB 1CLOH 1BD2E 1RAMA 4E41D 4UNUA 3IETA 1S7XB 4ZO7A 1YYLH 2CMRH 5EUOB 3IGAB 2X05A 3WFCH 2WUCH 4OLZH 4CADA 3MRMA 2X70A 3TH2T 4UV7L 4WW1B 1KC5H 1RZKH 4YDIL 4HG4J 5MENB 3DX7B 1FVDA 5T1KD 4HT1L 1CK0L 1E4WH 4XVSL 4G6JH 5D7LA 1N5AA 1QYGL 3V0WH 3X3FL 2VO5A 4CMHC 4D3CH 3QJFA 1OAXH 3KLHD 2ZJSH 1S5HB 5J1AB 1DL7L 5HHMD 1MFBH 2CLRB 3NH7H 3NVQA 3IXTB 1W0WB 1IGFL 1KJ3L 5SWSA 2VDQH 1A5FL 1IZKA 3GHEL 4FHBD 3L3JB 3Q5YA 5FHAH 4QOKA 1D5IL 5KS9F 3IKCA 1VADB 3VD4A 5GJTL 4JFFE 3PDOB 1AR1C 2DQDL 3KPRE 5AYUH 3QUYC 4MNHB 4X6CA 1UWGH 3D9AL 3T1FB 2YPKB 1MJ8H 2YKLL 3QDMD 3GI8L 2IC2A 4ELKA 2QQKH 4HQQL 3D69B 4KHTH 4NUJB 2JCCB 3PJSB 1J8HD 1JPFA 1KJVA 3BIKB 2E7CA 4Z95H 2NZ9C 3C6SA 3VFMB 3WV0A 3FB6A 3P40A 4RDQG 5SWZE 4HGKC 5INDB 4PJ7F 1AH1A 1VFBA 5F9OH 3TT3H 4ZDHA 3WIHL 5AEAA 1L0QA 4JQVA 4P57B 4K9EC 1T22A 4OZGB 3PL6C 4PY8J 1W0VB 5F89B 5E2VL 4ZMAT 2EO1A 4J4PD 2CRIA 3VFPB 4XBPA 2ZCHL 3OV6A 4PRIA 4MS8C 4YBLC 4QRRB 3T0EC 5MEQB 5E8EA 1G7IB 3T09A 4IHOA 4HS3A 5IVXF 4LRIC 4JFHD 5BRZB 5CLWA 1M05B 4NRYB 1LEKB 1WTGT 2N56A 4GG8B 2Y7QA 1GZQA 4JRXB 3IDYC 3RWGB 5I1JH 1NGPH 4QHKJ 1RU9L 3QI9C 3BISA 3GNMH 5F7NC 1QEWB 4I9WD 3B9EA 1FL5B 2OR9L 2HYMA 4APQC 3G6JB 1F6AB 1AP2B 2XKSA 3QUZD 5FCUL 4HJJL 5T5FH 1NAMB 1WBYA 4K3JH 2VERN 3U6RA 4HFWB 2FSEA 4GG6A 2IQAB 1D9KC 1CFQA 3VFSA 4QRTB 3RX7A 3UZEA 2E9BA 3PWPA 3BUTA 4ELMF 1D5BA 4WVRA 3D18B 4PJGE 4X7SH 4A6YL 4M9PA 2JKXA 1PVHA 5CD3B 3FFCB 2D4DA 1PEZA 4ZODA 3LN4B 1DLHB 2J6EH 1B4JH 1RZ7H 4RCAA 1KJ2H 3OF6A 1INEL 4P5TA 3LPGA 3BKYL 4DGVH 4YO0A 2P48B 2YUVA 1G6VK 1WVZA 4ORGB 4DZ8A 5D7IF 4YGVA 3SOBL 1BM3L 2P5EB 3BN3B 2ZG3A 4FXKB 3O6KL 4LPYA 5L88L 4QNPE 1EA9C 3LDBB 2FO4A 5ID0B 2D9QB 3T2OA 1MPAL 5H94B 1FFQA 5TPWH 1SEBA 5ISZD 2DQGH 1HI6B 1HIMH 1AD9B 1QSFB 1WZ1L 2XZAH 5AUMB 2XWTA 1JK8B 3W0WA 2ITCB 5HYJB 5JDSB 2NZIA 3GGWA 1ERNA 2HT4C 4KUCF 3X3GH 2FB4H 3MRLB 5J56B 2OL3H 4M61A 3OGCA 4D9QD 3GKWH 4G8GD 2VDLH 4ZSOE 3SGEH 5CEZE 3V4UH 1GGBH 2J4WL 4WWKA 3PDGA 1AGDA 3BKMH 4LKXB 5LVEA 4HS6B 1JV5A 4G8IB 3C6LC 3CFJA 1K8IB 1U8QB 5HYSA 1GVIA 5BVJA 3KXFB 3PQYA 4FQXC 2KH2B 3HAEB 4I2XA 2B8OT 2F58H 4L3EB 1YQVH 2EIDA 3S96A 4LSPL 1R5IB 1U58B 1YEIL 3UTTD 1I7UB 3QDGD 2E7MA 1T2QL 3O8XB 3FONA 1W8NA 1NANI 5DQ9A 2VISB 2I9LB 3LS4L 3GEWB 4KUZH 3ZTNL 3DX9B 4HWZB 1Z3GL 5ACLA 1JPST 5CILL 1KTLA 1KB9K 2CR6A 1MQ8A 5D2NB 4RGNE 4YHZH 2VDMH 1LEGA 2YK1L 4YQXL 5IGXH 3LQZA 4IRJD 2PN5A 3NA4A 4HZLA 5TQ0H 1P53A 2VN4A 3QIBB 3TVMC 2IMNA 4XPBL 3BFOA 3X11A 2AK4D 4NQUA 4YWGL 2OK0H 1QA9A 3UTQB 2B1AH 2ENYA 3DVNA 3VWKD 4L5FL 4XNMB 5A43C 4JFDE 4OCSL 3RJDA 2VLRE 4XVUD 2DLIA 5CEZH 3DO7A 1WEJH 4OI9A 4NO3A 2ED7A 1FFPB 5B38A 4CDHA 1DQLH 4JRWA 3FAXA 4U1LB 1UZ8B 5BS0D 2FH8A 4NNXA 1R3KA 1CE1H 3HZYA 1KCRL 4BUHA 1AGFA 1LP9F 2AI0L 3MRRA 3H9YA 4I3GA 4KROD 1MEXH 1DANU 4JO2H 1I9IH 4MNQB 5ALCL 1VACB 2VZTA 2PCPA 4JGMA 4TTDC 2YRLA 3S36L 3CDGA 4CVXA 3KDMB 1EVUA 2W60B 1S3KH 3SE9L 4Z7UF 1NCAL 3PGDA 3WCYA 4Q7DA 2P45B 3BZFA 1NDGA 4LCIH 3ULVC 4DKEL 2MPAH 2ZOLA 2D2OA 4PRHA 4L8BB 5HI3D 4P59H 1KPVA 4RFEA 4D9RE 2D7OA 1OP3K 3QEUB 1J1OL 1UKSA 4KDTA 3TESA 3L1OL 3OKEA 3WKML 4OF3A 1MHHB 2G9HA 3BQUB 5E2TL 4U1JB 1RUQL 2R1XB 4E41E 2PUQT 4KTYA 1FN4B 4JM2F 1GGCL 3Q5TA 3B9KC 2VZ1A 3EO9H 5KVEH 2VDNH 2ADJB 3FO2A 4EI6B 3UO1H 4HJGA 3DUUB 4QHMB 3VRIA 1NC4B 2W38A 3B2UD 3UJIL 4FQ2L 1IAIL 4BH7B 3GKZA 2DQHH 1D7FA 1H15B 2GUOB 3KJ6L 5K9KB 1I1AB 2FX8H 4GXVH 4LRNL 2Y36L 1U8LB 3VCLB 1RUPH 2PYED 4NM4H 4QXTB 1OSZA 1UM4H 2F19L 2JELL 1INDH 4GKSB 2BOCA 4EI5C 2IF7A 4HPOH 1IEAB 4X6EA 4ZXBC 3ARDA 3D2UB 2LU4A 5DD0L 1QD0A 3SDXF 3CUPB 3UTOA 2FH6A 4PJHB 3WXWH 5IFAL 2QQNL 1FE8L 1MJ7L 2HKFH 1OWRM 5HYIA 3Q0HA 3GB7A 3RU8H 3MRFB 4YHLH 3RL1A 4PRNA 3OSKA 3BP5B 1QFUH 4JY5L 3ZHLA 1CGUA 3MNWB 2X1PA 4AIZA 3QDME 4J7RA 4D0CA 3INUL 4LCWA 5AZ2L 1BFTA 4RGOH 3QNXB 4FFYL 2BJML 1BQLL 3TN0C 2B4CL 1QRNA 2OSLA 2KBGA 4E9LA 1J8HE 3CLFH 3BESR 4QRSB 3O3UN 4KK6D 1Q9WA 4LOUC 5HYSG 1FL6B 4R4ND 5GS0L 3WSQH 5T1DL 1KIRA 2IWGA 3E6HB 1XGPB 3WLBA 2JIXB 4PRBB 3V52H 1GZPB 1H5BA 2NTFB 5ACMA 1VGKB 3MV9B 4HLZH 4N8PA 4PJEB 1GYAA 5IROC 3OZ9H 5IJVB 3QHFL 2CDEB 4C57C 2IAMB 2HMIC 4XCYA 4U6YB 4AENB 4JGUA 1BLNB 3DMMB 4P4KA 4C4KO 4WO4B 4HUVB 2VH5H 5EZLA 1HN1A 3UZVB 6CGTA 4JFHE 5GGSB 2A6JA 1IQDA 1WWWX 4X7FC 4OM1H 2MHAA 2UWEE 1HKLL 4DZBA 4NQXB 5D6CB 5F3BB 4CU8A 5MEND 4I9WE 4F8QA 4WFHD 5CSZA 1LO2H 3QXAA 3IDXL 3L5HA 2H6PB 4O4YH 5F9WB 2ZPKL 2VABA 4UDTA 1B88A 3TYFB 4KZDL 2A6KA 3ZE0E 2KZ1B 1FORH 5DZNA 3AREB 4JPWH 2W9DL 3B3IB 2IPTH 1VENA 2VITA 5F7DB 1UM6H 1DUYA 4O51A 1IM3B 1H3VA 1L7TH 5LAXA 3RIAF 4OTXH 4ISVB 5B38G 4YGAB 3FOLB 4JKPH 1QBAA 1BZ7B 4RSVA 1T83A 4NT6A 4X99B 2RBLA 2AGJL 3EYVB 3HZMB 5E8OB 4TNVF 4HHAA 1HSAB 3WFBH 1T0MB 5BV7B 5F8QC 1K3IA 2CKBA 3EDKA 3ARBC 5HGBA 4PB0L 2OTPA 1BJ1H 4AEIL 3I85A 3W2DL 1BD2A 5DQJA 3O6FB 4O2EA 2GTZB 3L3HA 4CGTA 5JW5A 4PGEB 5ISZE 4OSUL 1SBSL 3PWVB 5ANMB 1EJ6A 3WN5C 1E6OH 4YPGB 1M71A 1Q9KB 2AV7A 4HEPG 2HT3C 5CGMA 5GXBB 5MEOB 4W6YB 2C1OB 1HHKA 1I85C 3QFDB 3MGAA 3L9RB 3GMNA 4M7KH 4D9QE 4G42B 2QR0B 3CFDB 2DQUH 4KKAD 4OZIE 3PP4H 4MVBC 1HQRA 3C8HA 2IBBA 1MCEA 4QRRD 5I74C 3EOTH 4JO3H 1NFIA 4LLYA 1KCSH 3BZ4B 5BRZD 5LQBL 1H9VA 3RGVA 5MEPB 4F9PA 5GZOD 3D39B 1IRAY 3I50L 1Q9LA 2E8YA 2HFEB 4IDLA 4HKBB 1DVFB 1OP5K 3OQ3B 2AXGA 1RUKH 4Z7NE 4GH7B 3QQ4A 4R97C 4HXBL 4RWYH 2ORBH 3UTTE 3KPRA 3QDGE 3G6DL 3HE6C 3VFWA 1BJMA 5TE4H 4H8WH 5FA3A 1E0OB 1QKZH 3WLWD 3VDBA 4U2ZA 3TIDA 3FT3B 4MSWA 4Y4HC 4DFHA 1WQVT 3STZA 1ZT7B 2GEEA 2HTKD 1DSFL 2W91A 3IXAB 4NHCL 4DAGH 3O3BA 4YIQA 4D0BB 1A6PA 4J3TA 4Z77A 2J5LC 4LVOC 5IVOA 2GK0B 1GGIH 2AK4E 2B7DT 2BK8A 2V5MA 5C0GB 1OF2A 3MJ9H 4PB9H 4GRMB 2P5ED 4CN1A 3ARYA 1AHWA 1TZGH 3GMQA 4Q9QL 3C5JA 3D3VA 5LCVH 4KMLB 1T1XB 2BC4B 5L6YH 1GJIA 2DQIL 4LIQL 4FQ1H 2IFFL 3E2HB 3AU1A 4BZ2H 1Z9MA 4HC1H 1CL7L 1HYSD 1F4WH 1DBAL 3H7BB 4EDXA 4JB9L 1QSFD 3M8OL 1OP9A 1Q9OA 4PGDB 2ILLA 1CXEA 2ICWJ 2ZOKA 4NZRH 3H9ZA 5HYJD 5FKPB 3TT1H 5KSBE 1MCCA 2EIZA 1UXSA 4ZYKA 4DGYL 1DR9A 4OCXL 3TCXA 4GW1B 1KELH 1LVEA 2JB5H 2F15A 4DW2H 1RJYB 2WWMC 1CE6A 1A3RL 1U8JB 3QXDA 1DJSA 4G8FB 4MLSA 2OP4L 3BD4A 3QO0B 3EJZC 5E6IA 4Q9RL 3R1GH 1ZLSL 2L4OA 3JTSA 2H2PD 2ARJA 2J7LA 4MWFA 5F1OB 3IJSB 5JW4M 1LO0L 3VH8A 3VJ6A 5HD8C 3TWCL 5JQ6L 2VXQH 5DEZA 4IDJH 4LNRA 4P99A 4NUGL 3O8XD 5KAQG 1FO0L 1CU4L 3HB3C 5MERB 3EOBA 1HDMA 1WICA 1F3JB 1NUDA 32C2A 1R5VA 4ZAKB 1N7ML 2YZ8A 4KTEH 3F7VA 1S7QB 3QQ9C 4ODTL 1FG2A 2PTUA 3GSXA 5DEGA 5BQ7A 1QLFB 4RMUA 5TE6L 1NLDH 4N0UB 2JB6A 3P0VH 3SDCC 1GGTA 4OD2A 2KUTA 5GRUL 4ZFGL 3T2NL 3RUGB 3QIBD 4RGMC 5IQ7L 5CKAA 4FQLH 4LL9A 3EIFA 4JZNA 1BX2B 1T66D 2PYEE 1QQDB 1BZ9A 1ROWA 3LQAC 5IHUH 1XGUB 3RI5F 4U3XA 2A83B 1BWWA 4HQQH 3PL6B 3RWEA 4KK5D 12E8H 4JLRB 3Q3GA 1XR8B 3TCLA 5BW7A 4FXGB 3T0EB 1NFDB 1S7UA 3BE1L 4QTHB 1OT2A 3WKNA 2F8OA 4U1KA 3TBYA 4I5BA 4MJ6B 3C08L 2GKIA 4JZOA 5AG8A 4CU7A 3MQIA 4F33A 3T4AB 3MRHA 3DECA 4WV1A 1F97A 3C60C 1N5YL 1Z6JT 2JTDA 4IRSA 4ENEC 4FTVA 2CK0L 5DD3H 5GJSL 4YJZL 4MNQD 2YD9A 3O3AA 1QPXA 5CJ5A 5I16B 4F7MA 4APQB 1S9VA 2APVA 2F74B 3PGCA 4GS7B 4M1GL 2VXVL 4OF0A 1UB6A 3I02B 4YR6B 2BNUB 5JNYB 1D9KB 3QRGH 4HV8A 4AK1A 3DRTB 4HLJA 4URTB 2V7HA 4KJYB 5IW1B 2EXWD 4OV5B 5D8JL 3NACH 1BREA 2Y25A 1CCZA 4IS6A 1ZWIA 5C0JB 5F9JB 5A40E 5C3LD 4KY1H 1B90A 4NRZB 4P5KA 3BQUD 3L3GA 3UPAA 1YEJL 2DMCA 2AEPL 3O3EB 3L3KA 1C5CH 4L29A 5DD5L 4JR9L 5EUOE 2HKHL 5L7XH 5E8NB 3SPVB 3TIEB 2GSIA 3BDYL 1NC4D 3KPSD 2VLRA 2FATH 2VAAB 1MLCA 1VFUA 3H3KA 5T3ZL 5MENE 3SCMA 1ULVA 3GMRA 1HCVA 3KPMA 3SKNA 4MDJA 3MREB 4XWGH 4O9HH 1RJLA 2DLGA 3F58H 4HBCL 4NN7C 2VQ1A 5FUCE 4WHTA 1NGXB 1CXFA 4I0PC 1KCVL 3L7FA 4D94A 4X6FB 1A6WH 5JOPD 4PV8B 2ADGA 3ARVA 5DJZB 2O5XH 4QYOA 3SQOH 2GT9A 5DMJB 3D2UD 5JUEL 3SBWA 2XZQH 2FYYA 3C6LB 1S78C 3WEXB 1G7LA 3CIQA 1AKJA 2BSTB 1FRGH 1KPRA 5EOTA 3Q1SL 4FQXB 4XI5D 3MRNB 4PBXA 3ZDZF 3QXVA 3QZWA 4MYWB 4X4ME 5IBLD 4Y5VC 1VSCA 4M43L 3NAAH 1T6WA 4KJPD 5JIHA 5B3JF 2X7LA 3C2SA 4XGZA 3QWQB 4ZUUA 1DBMH 2JJVA 5GSRA 1TVHB 2VXSH 1MVUB 3MJ8B 3SE8H 2XTJE 2EZ0D 2F53A 1MHCB 5EU4B 1LNUA 1ZANL 4KVCH 3HUJF 2P1YA 4OD3H 3JWOC 3SO5A 2HWZH 2AJSL 2JIXD 3VH8G 3CDYA 5EO9A 3MV9D 3EYSL 3BRDA 1RUAL 3X14A 2X09A 4ZPTB 3TVMB 1QLRA 1UVQA 1HWGB 3HR6A 5ENWB 4KDWA 2IAMD 5FV1L 2EKJA 3KYAA 1SY6L 3MODH 3E0GA 2JF1A 2FL5B 2I26N 5GGUA 3T08A 5K9OA 1I9EA 3DMMD 1GAFH 4ERSL 3UDWA 3BHBA 1J0ZA 3HMWL 4NKIL 2FEDD 2WLZA 3MFGB 5IMMA 3RVWC 4HDIA 1XGTA 2OM5A 3UYOD 2DD8L 1B0GB 1QACA 1AXSA 1GC1H 1MF2L 1RVFH 4AL8L 1B0WA 1IBGH 1KBGL 3L5XL 4QHLA 5JMRA 4N8CH 4GFTB 2MOVA 5HDQL 4YHIB 1KN4H 1U8PB 2WINB 5HI5D 2A73A 4ZO9A 4LLDA 4Z7WF 4PGJA 5D1ZA 4MD5B 1BJ1J 4H26A 5HDLA 3ARED 4ELMB 1DN2A 1EK3A 4HCRH 1NGYB 3I2CH 3IDIA 5D6DC 3V6ZB 5ADPH 1Y18B 5HHPA 5SWQB 3HRZA 2AABH 2W9EH 5BXFA 2Q3ZA 4AMKH 4JQIL 5C0AB 3CK0H 2XKNA 1TIUA 3IU4L 2MKWA 5FGSA 5IM7B 3QQ3A 2PW1A 5D7IB 5EOQH 4NKDB 1DTUA 1OQOA 1HH9B 4ZFOA 1AQDA 2FBJL 4M5YL 3QUMB 4UILH 3S37H 2Q1EA 3S97C 2D7QA 3V2AR 5CGTA 3WIIH 3CFKA 5FFLA 3BXNA 2Y5TA 3L95A 3K74B 4HWBH 3U36A 4J4PA 3WXVH 3HPJB 3O6FD 4K07A 5CUSL 3U0WH 4UB0L 3FTGB 4N1CA 4XTRD 4EJ1C 3GMPB 2OQJB 4MNGE 4WJ5B 4EIGB 4P9HC 2DYPA 2R0LH 2HFGL 5HYJE 2UWEA 3IFNH 3VWJA 4ZPVB 3H0TB 3LEXB 3FB8B 4PY7B 3EJJX 2P8PA 4NWUL 5CIPB 3DIFB 3NZHH 1XT5A 4ZUTB 4XPGL 2VQUA 1V3KA 1OCWL 1WCQA 4JPIB 1IGJA 5BZWA 5ESQB 1U42A 4G8EB 4EI5B 3V5DA 35C8L 4U0QB 3QUKA 4GQ9H 1NAMH 3PV6B 3FN0H 1FAIL 1FGNL 3GRWH 4HH9A 4X5XB 3BMVA 4JFXA 1KXQE 3D39D 5TQ2L 1DVFD 1UC6A 3VA6A 5FOJA 4LPXA 4YUEH 2R8SH 5FM5M 5IW3A 3E3QE 2I5YL 2CXKA 1JGEB 1AI1L 1G7JB 1QVOA 4PJBA 2W59A 5IESH 1MCPL 2FLRT 3LQMA 5KZCB 5T1MA 5C08E 5J9PA 1G9MH 1KB5B 1E4JA 2R23B 4YK4B 1I1YA 2CR3A 3TN0B 3MACL 1YN7B 5D2NE 4LNVA 1I1FA 1ZXQA 4I0CC 5T3ZD 5ICZA 2FX7H 4YDLB 3Q48A 4HIXH 5C6PB 4PJ9B 1JMZA 3KYNB 1U3ZA 4MAYA 3ES6B 3QZWG 1EDQA 3RY5A 1C7TA 1J05A 1FIGH 1AGEB 1KN2H 2G2RA 1Y6MR 2WAHA 5ICXB 1N3NA 3L5IA 1CDHA 5CGYC 5DJCA 5E94B 4GRWE 1I7RB 3MCKB 3MV8B 4WWKC 1SHMA 4O5LL 3TLRA 3PP3H 4U7SA 1LO5B 3RPKA 3F7RA 3MRJB 4BQBA 5E1AA 5I15H 2FHBA 4G6MH 2A9ML 1HSBA 2PR4H 3LAFA 5F88B 4MDIB 4OM0H 1ZTXH 4H88L 5HVHB 3HAEH 3U1SL 1NSNL 4OF5A 1NMBL 2PYFA 2VRAA 1UYWH 3RZCA 5DS8B 4QT5B 1JPTL 5K59F 2F5BL 1UGNA 1P7KA 4GAGL 3GM0A 2R69L 3DV4B 4KDVA 3WO4C 1J87A 1NANH 1I3RA 4MMXC 1BVKB 4S1SH 1HKLH 3N06B 4MX7A 3PIQB 5TE7H 5L2JA 3MLZL 3ULUH 5I8KH 3B9AA 1MCRA 5HHOB 1G6RL 2E27H 2HRPL 5CMAB 4Z0BH 3VXRA 1UWXK 5FB8A 1T03L 3IAQA 2WBJA 4JM2B 4UQ3B 2VWEC 4M7JH 2IQ9H 5F6IC 5FKAA 4MB4A 2D0HA 4ZAKD 1TZIA 2I27N 4K3HA 4X4ZA 5DD6A 4YFLI 2CK2A 4KKNA 5JHDB 3CZJA 3FRUA 1UACL 5SV4A 1QBLL 5C09B 1YMME 1YJDH 3KPSE 4RNRA 5HBBA 1KXVC 3MUHL 4G7VL 5SX5K 5IMOA 3DUSB 5DDHB 1TTUA 4AT6A 3Q6FA 1E4XI 4HK0B 3L7EA 3RBSA 3O3DA 3WS6A 5T33L 5J11C 5GGRA 1JZ8A 4UIMA 1CGVA 1YUHA 4IMLB 3OHXB 2EDNA 4HX1B 4DN3L 1RSFA 4OI8A 3FO0H 4XCCL 3QULA 3PL6D 4Y19A 5CWSB 3VU2A 3SDXB 3QUML 4R7NA 1T3FB 4MS8D 3T0ED 4ODXA 5DJDA 2IADB 4JVUA 5F70A 2Z8VC 4PTUB 2MWCA 4X6DB 3G5VB 3BO8A 4JKLA 5KOMC 3SE4A 2Q6WB 3KNBA 3WIHA 4NO5B 1U6AL 1I1CA 3IYLW 1RZ8B 4PLJC 5E8DL 3LRHA 2IBGA 3DURA 4R97B 4XNZB 3HE6B 5DYOB 5IK3B 1CLZH 4LIQE 1FNSL 3K0WA 3BSZH 4X0KB 2G5RA 5HGAA 1D9KD 2HJKB 1REIA 4W70A 5D5MB 4NQED 1RMFH 1EO8L 3MC0A 1MH5B 2CO7B 5JXAL 1YDPB 2AJVH 3MV9E 5DMKA 2V2WA 1X4XA 1CIDA 4RIRB 2J5LB 2I60H 4LVOB 4PJEE 5C0DA 2EDDA 5IVZB 1P84K 2H3NB 2X4PA 3G6DH 1YECL 4NCC2 2IGFH 4JQXA 4FZ8H 2AQ3A 3T4YB 1BFOB 3QH3B 2GFBA 1CI5A 1EFXA 2YOCA 3HNTH 4HS8L 4UMGA 5EU3A 2M26A 5CJXC 1UG9A 4Z78A 1MNUH 1P7QB 1S7VB 2OTUA 5JXEA 5I17A 4A6YA 2ED8A 6FABL 1BQUA 2V17H 5IF0B 3HI5H 2W1NA 2DICA 2P42B 4OF8A 1R3LA 1B9ZA 1U41A 1CGSH 3BGFC 1ZHBB 1FZOB 1NBYA 1CDIA 1U3YA 2R56H 4JFOB 2HT4D 3F6LA 3IDJB 5IB3B 1CFSB 2VN7A 3LPWA 4POUB 3MXVL 1G0XA 5E2WL 5BJTB 3MBEA 4OLWH 5E08L 4ODWA 3RL2B 4GXUM 5I2IB 2X9XA 4GKOA 4F7PA 3IDMA 1T20B 3C6LD 1SVCP 1OAUH 3V4PL 4MJ2A 3MGTA 3TBSB 1FFNB 3NFNA 3IDNB 3BKJL 3L3OB 4FQXD 4NP4L 1H5BC 5F3HB 1YEKL 3MOQA 1N64L 4WFFE 2WNGA 4KTDL 3UAJC 3P4NA 2Q8AH 2GJ6E 15C8L 3F12A 3OB0K 3P4LA 2WSKA 1OM3H 2Z35B 3BWAB 4P4KC 3BP6B 2MCG1 1RIUH 1MHEA 4P49A 1I7ZA 5EUOA 4TQEH 25C8L 5ANME 3DARA 3NZ8A 3GO1H 2DQTL 3SDCB 1FVCA 3LKRB 5GGTH 2EYSB 3PHOB 1NC2B 4RGMB 3BUYB 4MCZA 2A0LD 3TVMD 1JI1A 3A6BL 4R2GB 4JFQB 3K8LA 4UINH 4UTAL 2OI9C 1OHQA 4M8VA 1I1RA 3FHQA 3O2DH 1ZT1B 3KLAA 4YAQA 3AMKA 3JTTB 4NQVB 1Q8MA 5J7CC 4XCFL 1LDSA 5LGJB 1NKRA 1U8OA 4TUJB 5D7JA 2A74A 4EBQH 4RFOL 3D39E 1VERA 2J3SA 3AROA 3P4MB 1DLFH 4TSAL 3C5ZD 1BMGA 3LEVL 1DDHB 1K8DB 5FO7A 3NCFB 4JDZB 4RMSA 1FNHA 2YS4A 1T83C 4MNHA 1IAOA 1NBZA 4GAJH 3WNNA 3C60B 3V0AC 1JJUA 4X4MA 1CLYL 2HVKA 1NBQA 1A47A 5E9DB 3T3PE 1WJ3A 4MJIE 2RHEA 3QUXB 3VFOB 2Y5EA 1G7MB 4TTDD 5BV7H 4ODVH 2J8UB 1A7RH 3MR9B 3JWDL 4LHUA 4PLKD 5T3ZE 5DK2A 1S9XA 1YEFH 3FO9A 1PQZB 4OT1H 1K4CB 4Y1AB 3S3SA 2V5YA 4XNQB 2CIIA 1IEBB 1SM3L 5C0AD 3ULSB 3ULVD 5D72L 4K3DL 1F4AA 2D03H 4EOWH 4Q2ZA 2FGWL 2YPLB 5AD0A 2ITDA 2GIYA 2BVTA 1B0RB 3RVXC 4X80H 1CD8A 4LLMA 4JRYE 2R1YA 4P57A 4UIKH 2VLKA 5DUBB 1W72B 3EAKA 5F89A 5F96L 1H3GA 1PG7W 1WAAE 1D5ZA 4QXGL 5GGQH 5IG7B 3VFPA 1EXUB 3G5ZB 5DFVC 3RGVC 2R29H 4F9PC 1F4XL 5D2LF 4YX2L 2VKWA 2FWOB 5J6HB 5HY9B 3R4DA 4KUCD 5HPMA 1A3LH 3ELAT 4POZD 1HH6A 1JTTA 2R1WB 5FA4A 3GSRB 5KVFL 3NFSL 3HZKA 1U92B 4M8QB 4RAUA 1NGWA 1L9MA 4GSDL 1YPZE 4NN7B 4OFYD 4YDJA 5I1HL 4Q97A 1AXTH 4EI5D 2NX5B 1A6AA 4CRPA 1CG9B 3PWJA 1WBZA 2DM3A 1T04A 3FMGL 1A7OH 4X7CC 3KVQA 3SHSA 3W9DA 5AYQA 4R90L 3FN3A 4X7TA 2AV1A 1QFWL 3JWNC 4OCNC 4XMKL 2CUIA 2M8XA 3B8YA 5IKCB 4D0DA 5L0QC 4N9OB 4KAQH 5KJRL 4LSRL 5I18L 3HG1E 1OAZH 2IH3A 5KZCD 1R0AL 3ZE1F 5J13C 1UQSA 2NY5C 2PTVA 1JFQL 1AHWC 3U7YL 1FLRH 3GI9H 4ORGA 3IRPX 1KUMA 4Y5XB 3TN0D 3NABL 4YBHA 5ID1A 1VESA 3GK8H 1A2YB 3S35H 4Z9KB 4N0CD 5D71H 1TITA 2XZCL 4FQHA 1T7VA 4UI2A 4CADB 3MRMB 4PJ9D 1U8NA 4H20H 4X6BB 2DQJH 5H94A 2P5WE 3WNPA 4P2CG 2X70B 3GIVA 2DI7A 1J8KA 4MNGA 1FC1A 4KK8C 4LKCA 4W4NA 3GM8A 4JG0L 1GXEA 5AUMA 1JF5A 4Z5RA 1FVDB 1J5OH 1FIEA 3P9LA 1EHLL 1JWMA 2FRGP 4WGWB 2OMBA 1U3HB 5D7LB 3MV8D 4MJ4A 3F65A 3P9MA 5I1EL 3CCHA 4OIIL 5E2JA 4XNXH 2GY5A 3QJFB 4LAQL 1J0HA 3RNKA 4D8PA 4WRLA 1NFDE 3EYQC 5BO1H 5E6IC 1SJHA 3DX8A 2ZCKL 3VFRB 4UT9H 1BEYL 3WHE0 1BVLA 1A64A 3HR5A 5BOZG 4WI2A 3GIZH 4QOKB 1FV1A 3NIDE 2C1PA 5F1IB 4G7YL 4TSBH 3IKCB 1M7IA 3N0PB 5I1CL 3N50A 3WNMA 4NQDD 2NPLX 3PGFL 1JHKL 4J3XA 3VXOA 4ELKB 4DCQA 5F97E 2MFNA 4P3CH 5C08A 2I9LA 3ROLA 5IFHH 1PZUB 1P4IH 1OPGL 1WF5A 1RFDH 4LCCA 1KT2A 4NQEE 1JPFB 1KJVB 2Y9RT 2UZXB 3QAZC 3C6SB 1OAYL 3AY4A 3FB6B 4L8DA 4F80A 5F9DC 2VIRA 4IJ3B 5HHOD 2MQCA 4EN3A 3BPOC 3QIBA 4BUGA 1VFBB 3BN9D 4JM2D 4ZDHB 3MZGB 1BQHG 1Z0NA 3RJQB 5JORA 1T22B 4LHUG 2BXYA 4OF7A 4XBPB 4F7EA 5JHDD 3QEHA 4PRIB 4K9EH 4WGVB 5E8EB 5C09D 4IHOB 4HS3B 5FYJL 4YXKL 3LZFL 4NN5B 5ESAA 2IJ0C 2QQLL 4XP9H 4M6NH 1GZQB 1NJ9A 2EECA 4LQFL 4OLUH 3ZZ1A 3PE9A 5KOVC 4WV1C 3UYRL 1OOAA 2HT3D 3UEZA 1Q72H 4IRSC 1RZFL 3BD5A 3TZVA 5AZEH 5CSBA 1QTYT 1WBYB 1CGXA 2EDHA 4XPHL 4BQ6A 3ZKQD 5KS9E 3U6RB 1KFAL 4M6AA 3O6LH 1I8IA 2FSEB 4GG6B 3VFSB 3VW3L 1YNKL 2K1MA 2X5PA 3M45A 3PWPB 2WBWB 5FM8A 1D5BB 3D25A 7CGTA 4RGNC 3VGEA 1FNEA 4D9LL 1NMAH 3EJYC 3FQXA 1X7QA 2G75A 4QGYA 3QCTH 2DJSA 1FYHB 4JO1H 2AJ3A 4P2QA 5F44A 1WCBA 3WIFA 1KCUL 2ZKHH 4P5TB 4J3OC 4U1JA 2XACC 4HUXA 4CW1A 4DZ8B 4YGVB 3GMOA 2GQHA 4U2YA 5DUML 1P7HL 1EZVX 1FN4A 4XVTL 1ADQL 2EO9A 4PJ7E 5MHSD 4KGJA 4RISL 2FO4B 1PYWA 4NDMA 5I1KH 1YMMA 2V5TA 4X9HA 1VFOA 3KPSA 1SEBB 4FOMA 5CP3A 3SCMC 3CFBA 1A0QH 2OMNA 4KH2A 1MRFH 1MFNA 4KKLC 2XWTB 3W0WB 1N0XL 1WITA 1ZEAH 1Q94A 3GGWB 4M1DL 5E6YA 3HMXL 5FDWA 3OGCB 5IVXE 1KTKE 4NFDA 5E95B 1X3DA 4WWKB 5CBEA 1P5VA 1P7QD 1AGDB 3B5TA 3WUWA 4LSSH 1JV5B 2VDRH 3SBWC 2CLVB 5E70A 3DSFL 2E9WA 2I24N 4WHDA 3CFJB 1IC7H 2HA1A 4YHML 2UZIH 1IMHC 3AS2A 4Q9CA 5HYSB 3V8OA 5F6HI 4F7CA 5BVJB 3PQYB 2Q8BH 4I2XB 1EUTA 3R8BB 3S96B 5D7SL 4ZTOL 1IGCH 1Y6KR 3EZJB 3VXNA 3W11C 3HTLX 4ELME 2CIKA 3FONB 5DQ9B 4Z8FH 4PJBF 3HE7A 2IALA 4ZS6C 2WWMD 4IOIA 4WHYH 1Q0YL 4UT7H 1G84A 3DVGB 3OJDA 1KTLB 5HI4D 3EJZD 2WZPD 4WUKL 1CICA 3N9GH 3CXHJ 1LEGB 5C0AE 3LQZB 1I8MA 1RK1A 3WJLC 1JZ5A 1EJOL 1YEHH 1C1EH 4HZLB 4YHPA 5D7IE 1K9TA 4XMLL 5HD8D 1VGKA 3WDIA 1WUNT 3X11B 4CNIA 1JRHL 3NMEA 2NR6C 4ZS7L 1B4RA 4KMTH 1OL0A 1N6QL 4ZO8A 2OLDA 3LIZH 1QA9B 3MRPA 5IOPB 4C54A 4LAJH 3DVNB 5GISL 1YY8A 2J8HA 3KLHC 1QNZH 1W2KT 3MFFA 3BT2L 3MUJA 5B22A 3O6MH 4PRAA 1ND0A 1S7SB 4NGHH 1MY5A 1QZ1A 3DO7B 4DGIH 1X5AA 3SDCD 1X5KA 5B38B 4CJ1A 2CDGA 4TULL 5I73C 1NC2D 4NNXB 4JJHA 1R3KB 2RAMA 3QG7L 3HZYB 1FO0A 4R2GD 4PS4H 4TRPH 4ALAL 2AJUH 3MRRB 3ZL4L 4HFUL 4JG1L 2PCPB 2XY1A 3ZDYF 5EA0L 3CDGB 3VFNA 3SE3A 4CVXB 3STLA 4C55A 1EHAA 5IB4A 1PX3A 1HQ4A 5LGHL 4QHNA 3MXWH 3PGDB 3SN6N 3MUZ1 4I18A 3BZFB 1HHJA 1AD0A 1UCBH 4KXZI 4OQTH 3TV3H 5A2JH 4WIQA 3MJ6A 3UCRA 2ZOLB 5J3HC 4PRHB 4RFEB 1AGCA 3ULVH 3C60D 3OKEB 3MGOA 2AERT 3S6CA 2A1WL 2G9HB 5E9DD 2PXYA 3QUXD 2GJ6A 4FP8H 1IL1A 5FYJD 3EFDL 3BEWA 2EC8A 5GGVL 5ILTH 2DQEL 2FHFA 2VDPL 4J4PC 4PJXF 1L6ZA 2EC9T 1MCSA 2F9BT 4Y1AD 4M48H 4ZOBA 1DBJL 2UZYB 5CZXD 3FO2B 3O6FA 4DN4L 2FJGA 4HJGB 5KVDL 3EO0A 3VRIB 5IR1A 1A1NA 1H3WM 3B6SA 3VWJC 2CJUH 2YPLD 1D5MA 5MP6H 4OGAD 5FYKH 4KRNA 3QFDA 3MV8E 5IIEA 1OSZB 3BIBX 2QR0A 2XQYK 2BOCB 5IB5A 2MSPA 5CIPH 4N9GA 5HSFA 5ESVA 1HZHL 3EDFA 2G5BA 5DD1L 4X6EB 3ARDB 1U8HA 3BH9A 2YPVL 2R0KL 3HC3H 1UA6L 2HFEA 2NY0B 3GB7B 1KEGH 5C2BL 3CXDH 4NQDE 3RL1B 4PRNB 5L8KB 4FNLL 5E2UH 3BGFB 1JNNH 2E8ZA 1F3RB 1FGVL 4AIZB 4NM8H 4D0CB 4LCWB 4XZUA 4KI5C 2BVOA 4Z7UE 2NX5D 1NCUA 1TETL 1MCWM 3WUWG 4MJIA 3FT3A 1QRNB 2DI9A 2OSLB 3UTPD 1KLUA 1KB5H 1U95A 4K23L 4ZD3H 1MI5E 3I75B 4PUBH 1C8PA 3U7WH 2FGZA 3SKJH 1Q9WB 1FCGA 1NCWL 2R4SH 2B1HH 3RWDA 1KIRB 1XEDA 1Z0MA 3WLBB 4MAYC 5HHOE 4LSUL 4XXCC 1H5BB 4OAWA 1FZMA 1BIIA 2XQYG 3UJTL 1MLBA 1D6VL 1SEQL 4DTGL 3QWRD 4M62H 2NW2A 2RQ8A 3OWEA 4XCYB 3WNOA 4OCLC 1WC7A 4QCIA 5JHDE 4JRYA 3TA3A 4DVRL 4RAVA 4P4KB 5C09E 3ROOA 1JGVH 5EZLB 5CCKH 1WAAA 3O0RL 2A6JB 1IQDB 3HI6H 5BVPL 3AXLA 5KVGH 3G08A 4OLYH 2MHAB 3WE6A 5DZOA 3WL9A 4Y5YA 4DZBB 4LBEA 1MWAL 1J1XL 4K2UH 2QV2A 5D93C 3QXAB 2F5AH 2VABB 4WW2C 4XP4L 1U3HD 1F11A 5D7LD 4UDTB 5DMIH 1CBVL 3FJTA 2A6KB 5DHXB 4YDKL 4K7PH 3BOVA 3SDXE 2Q76A 1NMCC 4ONFL 1YPZA 4ZG1A 1ZS8A 2VITB 5DR5H 2AQ1A 1ZV5A 3GSQA 1DUYB 4O51B 5AWNH 1HKFA 3MOBH 4OGXL 4JVPA 4QOKD 3WS3A 3U82B 4P46A 3EO1A 4IRJC 1BFVL 3F7PC 1U3JA 2X4OA 4I3RH 1F4YH 3OKMA 1JZ6A 3IJSA 5DRNA 3V4VH 1IE5A 4NT6B 5C8JA 1SY6A 2WBJC 4HHAB 2NQCA 3CMOH 3C9NA 3HG1A 2CKBB 5FYLL 1F3JA 1C12A 5J8OA 4TVPL 5HGBB 1GPOH 3VGAC 3MLPA 4ZAKA 3K81A 3BMWA 1FYTA 2RIKA 2JJUA 1BD2B 5MHSE 5DQJB 4R4BA 5CJBA 2FECI 3CVIL 4O2EB 3L3HB 4LMQE 5JW5B 4LU5H 5CFHA 4FQCL 2PF6A 3QFJE 2OJZH 4UU9A 3SDYL 2V2TA 1M71B 1U93A 2AV7B 2P5WA 4I3SH 3CVHH 3H3BC 5GGSY 5IJKA 1INQA 1HHKB 3IRZA 3GMNB 1EBAA 2R0ZH 1HQRB 1A7QH 1SJEA 3JUZA 5A16B 1E4XH 4OCYH 1MFEL 1A7PH 3LB6D 4GMSL 4PRID 1LGVA 1I9JH 1R3IH 4JLRA 4YHNB 1AY1L 2Z4QA 4LLYB 1FAKT 3GHBL 4WFGD 3RGVB 3O4OC 3NPZB 4XPTL 3SE4C 3WMSA 1Q9LB 5J57B 4MXWH 2AXGB 5HI3C 2QSVA 3QQ4B 2CUMA 3KPRB 3BEVA 4GLRI 3VFWB 4WEBL 1VGEL 5FA3B 3KYKL 2YUZA 2YD4A 3TIDB 1TNNA 4MSWB 1UADC 2OJEA 3BJLA 3SGJA 4HMDA 3STZB 3PWPD 5D1XA 4A2LA 5JNYA 4JHAH 2BVEA 3O3BB 4NQEA 4YIQB 4ZUSB 3NCYP 5ELIA 3WBDA 4Z77B 1TJGH 3D0VA 5KG9A 3IAGC 2XWBA 2NY6C 3Q6GL 3RAJH 4TPRH 3CFCL 3K2UH 5HYEA 3ILPA 2ZUQB 1T7WA 2C7UA 3OF6D 4P5TD 1OF2B 1MIEH 3MO1A 2ESVE 4OJFH 1OTTD 1AHWB 4IOFD 5I8OL 4PJ8A 4XMPH 3C5JB 3D3VB 4OIBA 1A9EB 4U6VL 5HHQA 4UDUA 2X2YA 4C83A 5JXEC 5BZDA 2C9AA 1B3JA 2DDQH 2VR5A 2Y06H 3AU1B 3MBXL 4NZTL 5EZIL 2AS5M 5CJOL 1FVEA 1ZVYA 3QEGH 2Z93B 1VHPA 4EDXB 1IGIH 3RRQA 2Y72A 1NCCL 1PEWA 1Q9OB 3W0WD 2ZOKB 4LSRH 3VG9B 1HHHA 5K9JH 2EIZB 4ZYKB 1UXSB 1G9NL 4EDWH 1BJ8A 1MRDL 1O0VA 2RCSH 3MBEC 1PLGL 1NGXA 3TYGL 3I3BA 5I1IL 1CF8H 1MCOL 4WWKD 5ECJE 1CE6B 3VI4F 5KS9A 1YNLL 2FBOJ 4KK6C 3H42L 2FLBT 4R4NC 3JTSB 3OKDA 3DOSA 1AE6H 2ARJB 4FA8A 3PQYD 4MWFB 1WT5A 5TF1L 3T65A 2BHUA 4O00A 3VH8B 3VJ6B 3V5KA 1CWVA 1B2WL 4GO6B 2HJFA 5E9DE 4LNRB 4L1HA 3P9WB 3GFUA 5EOCL 5FYJE 3EOBB 1HDMB 1N2RA 4NJAL 4JREC 2VXTH 1UWEL 32C2B 1TVDA 1R5VB 1MCFA 3ARGA 3F7VB 4JAMA 4YFDB 2V7NA 4FFWC 1FG2B 3GSXB 5DEGB 5BQ7B 5T1LA 4HGMA 5KSVA 3QAZB 3ORJA 3GUTA 4OD2B 4PJ7A 4PJDA 2YPLE 4F37K 1FQ9C 1J18A 3RWHA 3DVIA 2WQ8A 4UOW0 3LKPA 4JZNB 4XPFH 1BZ9B 5ALBL 4KKBC 5ACZA 4EUPA 4Y4KD 1VPOL 4YFEA 5FUCC 3LQAH 1CQKA 5IVXA 3Q3GB 4GW4A 3TCLB 4CN4A 4M93B 1KENL 1ES0A 4PJIF 1S7UB 1JUFA 2AXHA 5IMKA 3MRGA 4OCMC 3IU3A 4U1KB 3TBYB 4I5BB 4BK5A 1Y0LA 1G6RA 2AK1H 3C5ZA 4JZOB 2UUDK 5JA9A 4F33B 1JI2A 3MLRL 1RIVL 3MRHB 4WV1B 2DAVA 1U8PA 5ABDE 4EZMA 3RDTB 4IRSB 4FTVB 5JIIA 3O3AB 1BBJA 4F7MB 1S9VB 3PGCB 5BMFL 4ELMA 3UTPE 1TQCC 1UB6B 4P4RA 4G9FD 3TF7C 4Y4FA 4YXLL 4N0YH 4CKVX 2XTJC 1DQJA 4HV8B 5IQ9A 5GIRA 3QG6B 4L8CA 4RGNB 2V7HB 4PRHD 5C0AA 4IS6B 1ZWIB 2BDNH 4P5KB 3L3GB 1F8TH 4NCC1 4OFDA 3QUMA 4HWEL 3L3KB 4L29B 1JNLH 4R4FL 2BERA 1T2JA 4NO0A 2AP2A 1W72H 3H3PH 2JJTA 4DVBA 4L1DA 4BZYA 4OZ4A 5I1GL 3DXAA 4G9DA 2BFVH 2V5SA