3Q48A

Crystal structure of pseudomonas aeruginosa cupb2 chaperone
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
217
structure length
194
Chain Sequence
IAQGTRVVFPASEREVTLRVSNTSGTPVLAQAWIDDGRQDVPPEELQVPFSVTPAVTRVEPNGGAVLRIAYLKAPLPTDRESLFWLNILEVPPRFSFRSRFKLFFRPSQLKSVDSAAGKLQWKFLEVVQVNNPTPYYVSFASVELIVDGRVMSVGKGMVAPFSTKEFDWMEAASVRYEVINDYGGRNTHDRALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Chaperone CupB2
publication title Structural and functional characterization of Pseudomonas aeruginosa CupB chaperones
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 33
structure length 194
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q48A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q48A02
3MRHA 3GM8A 4P0DA 4RRPG 3BKCL 2R2CA 1EFQA 4HBCL 4LNVA 4WHTB 5FF6B 5IVZA 5IQ7L 3U2SA 4JQXC 4R2GD 4NN6B 1FZOA 4MJ6A 2QSCL 1D6VH 2E7LC 4FQLL 1MF2L 3H9SA 2PYEE 2XZCH 3VXME 5J4MA 1YQ2A 3AC0A 1GPOH 3H9YA 2Y25A 2NTFA 3L6FB 4IIQC 4CRPA 2GYSA 3V7AG 3HNVL 5A43C 1W72H 4ODUB 4OF6A 4W70A 1WUNT 2D31B 3JV0A 3HUJA 4MXWL 1IAII 5INCB 3WUWA 3I02B 3O6FB 5FYJL 5D93C 1C16A 3P9LB 1Q8MA 1R0AL 1RV6X 4JFQB 2D4FA 4NO0B 1RURH 4OB5H 2B8OT 3TN0A 5ESQA 4DKFH 1ES0B 1MFDH 1QO3B 3UBXB 4EI5B 5HGHB 1GOGA 1KYOJ 4P2RA 4ODTL 3RA7H 3B8YA 1OTTD 3GMQA 2YHGA 1JBJA 3UTQA 1BFVL 4N9OB 5JORA 1TQBC 4XVUC 2HKHL 3ROOB 5FYJD 4H5SB 2C1PA 2XOTA 1DEEA 2JELH 3BYTA 4M93B 5E2WL 1KLGB 4N8CH 4KHTL 2B2XH 5J13B 3WS3B 2LU4A 2VH5H 4K2UL 4PFEA 5ANME 4M3JA 1I8LC 3VE0A 4XXCC 1RJLB 1DLFL 1X5ZA 3NAAH 4TUJA 5IWLC 3VXUA 4S10A 4XBGB 3D1MC 1HN1A 2AJ3A 1TJIL 1MY5A 1HILB 4EQ2A 1H0DA 4KKLC 4PJ9D 1FRGH 1NC2D 2HLFC 3LKNA 3SQOH 1P4IH 5JTWA 3T4AB 5E4EB 1Y0LB 5SWSE 3HMWH 5ICZA 1NFDF 2QADC 3RVVD 2XTLA 1FFOB 2OX5A 4I3RH 5JA9A 1GAFH 4KH2A 3IETB 3QO1B 5D5ME 3RU8H 4OGYL 1REIA 3OGOE 4PY8J 5JHDA 5IB3B 3ULUH 4WEUD 1FLTX 2GAZA 5JOFB 3KYOA 2BNQA 3CVIL 4MMZC 3ZYIA 2E27L 3VFRA 1DVFB 2JIXA 1WWCA 2VLLA 5C0FB 1CFTB 2V2TB 4UMGA 4CAGA 5C0CA 2NNAA 3WHE1 1S7QB 4I0KA 3QPXH 4XP9L 1VGEH 4RMTA 1V3MA 4Y2DB 2Q6WA 3WIFB 3O3BA 1ZA6B 2RCSH 4IRJC 3QUZA 5F72S 3EGSB 2MKLC 2CIKB 4UOW1 4I3GA 5HGDA 2R2HB 5IK3B 5D1ZA 4J4PD 2QQNL 1FCCA 3SDAC 5H94B 5J56B 4YXKL 3VGAB 3MCG1 2ITDB 4ODXA 1RPQA 2KUTA 3KJ6H 5GGUA 1JPFB 3RZCA 4LKXB 3P4NA 1N8ZB 3N9GH 1NLDL 3UPRA 3GRWL 5C0IA 1KTDB 1M7IB 1MJUH 1P4LB 4KGLA 4PB9H 5E4IA 1PBYA 2BP3A 3DUUB 5FM5O 5LBSL 1KT2A 1C08A 1INQB 3VH8B 4Z0XB 1QBAA 4PV8B 3F7VB 5BCAA 1QRNE 4WGWB 3BPOC 4AIZB 1XR9B 2HMIC 5MEPA 4X7TB 4UTAH 4L3CA 3QR2A 5EA0H 4XX1E 4P2OD 2D9CA 1H3VA 1EFXB 1DQDL 3QDMB 2ICES 4CW1B 1G1CA 3QI9A 3U7AA 4CN4A 2YBRA 4Z7NF 3X3FH 4P9HL 3GMNB 4QT5B 2A6JB 4FRWA 5I74C 5TE6L 4LSTL 3WJJA 3MLYH 4OZFB 3QJFA 3PWUB 3BAEL 3UMTA 2OK0H 4QGYA 1GJIA 2XNAB 2ICEB 1ZWIB 2QEJA 2NY5C 1IQWL 1SYVB 1KG0A 4BQCA 4TOYL 2C7UB 1UZ8A 3MCKA 1AJ7H 3ESUF 4ZMAT 4HWBL 4YDIH 5E1HB 3HS0A 1TZIA 4L9LC 3RTQD 2BJMH 5DS8B 1PKQB 4A2LA 5HYSG 3K8KA 2XA8H 3V7MA 4KK8C 1DANU 5DVMA 1YNLH 3RWGA 2UWEB 4JFFA 1F8TH 4Q9RH 3QXDA 4Z77A 5IESL 4PGDA 4JE4B 4FQXA 5TDOA 3S36H 1HCVA 5HHXL 5DJYB 3WKMH 1UWGL 4OFPA 1T66D 3AXLA 5TE4H 1OSZA 3PDOB 1ZHLB 4WUKL 2OXHA 1A7PL 3N06B 3SJVB 2HJFB 3HZMA 3MJ9A 2ARWA 5D7IE 3B9KC 1BFOB 3MRQA 5FKAA 3NH7L 2LV4A 1T1WB 1R3IH 4ZFGL 4E9LA 5IVOA 2X7LA 1D5ZB 4OCRL 5D70L 1CF8H 3NFPB 4KC3B 1IGML 4HS6A 1CLYL 5E8EA 1BBJA 1AE6H 4LSDA 3MNWA 4Y4FB 4JN1L 1FHGA 5IKCB 5ICXB 5SWZD 4L8SC 4JQVA 3FB8A 4NO0D 3DMMC 3VD4A 5IIEB 1I7TB 3D25A 4TQEH 1K4DA 3SE8H 3RVUD 1CDJA 4EI5D 3KPQB 1A6ZB 2KDGA 4PP1C 1WBXB 1NBVH 2LU3A 4JN2B 3LEYL 3GIZH 2VUYA 1I1YB 4M62L 1BEYH 5D7SL 1ACYH 2B0SL 2GI7A 3ROLB 3EYFA 43C9A 5IFAL 3TN0C 2HJLA 4WEMB 4IBLT 3RWDB 3UX9B 1MHEB 5BMFL 4ZYKA 3T0DA 4TSBH 1CWVA 1FAIH 4OJFL 4QGTA 4X4YA 4WW1A 1F13A 2QHRH 4MS8D 5I9QC 1CDGA 3LKQA 2ZJSH 4OF3A 1XF3A 3WE6A 2P5WE 2VE6B 5BQ7A 3OTTA 2YPVH 4HPYH 5I17A 1OT1A 2QQKH 2VXUL 2WBJA 3DRQA 3VCLA 2FSEA 1CE6B 2QLVB 4QCIA 1XEDA 2OTUB 5BRZD 4LIQL 2GW5A 1TCRA 2W60A 4LIQE 3ZKMD 1XZ0A 4H1LA 4TUOB 1MCDA 2EEDA 3X13A 4FG6C 3Q48A 4KRMB 1OP5H 5E08H 1S7TB 4JB9L 1IGFH 5HHME 5C9JA 4OF0A 5FDYA 2FYYA 3EOBA 4LCYB 5SV4A 2QSTA 3TPUB 1ZT1A 3UYRL 3MRCA 1UJ3C 2GUOA 4OBSA 4R6UA 5JXAH 3ZYOA 1G6RL 4OZGF 2C4XA 4POZC 4X9GA 2BOBB 1DVFD 3QXWA 5C0CE 4S1RH 2V5SA 1U8LB 3TJHC 2G5BA 3BP5A 4RMUA 1WEJL 12E8H 4NQSA 1IEHA 1U8HA 2DD8L 2ESVA 3ZE0E 4EBQH 1LO3L 4O4YH 1MWAA 2QQLL 2EEBA 3VFVA 5DQJB 1MCLA 5M95B 2DQFB 3C2AL 4XP5H 3L5JA 2OXGA 3H3BC 2DTSA 4LGRB 4L5FL 4QHNA 1I9JH 3WEXB 4G6AC 1Z5LB 2D03H 2HT2C 1H15B 3UZQA 4YBLB 1C5BH 1FL5A 4M6OH 2WUBL 3GHBH 1X5HA 4XNXH 1WCBB 4HUNB 3UBXG 1VPOL 4BA8A 3U48A 1BVLA 5CEZE 5F7MC 4Y7MA 5DD6B 2I25N 4MAUL 3TV3L 1SJVA 3EBAA 2NW2A 3O6LL 3GK8L 4LHJB 5TQ0L 5A2KH 3UPAA 1QG3A 3VGHA 4W4OA 3OL2A 3IDGB 1DSFH 3LKRB 4PY8I 3RL1A 1PG7W 5IBUB 3EHBC 1EGJL 3QHFH 3VXOB 4YBQD 1OVZA 1KIQA 2W92A 3O9WD 4L9DA 3NCMA 3CD4A 4PJHB 5CSZB 5DK2A 3KPLB 3LPGA 1UWEH 3LV3B 3EKCA 4PJDF 3QDMD 3SKUD 1BJ1J 4M5YH 5HI3D 2R9HD 1ZAGA 5JZ7C 2XTJD 1D5BA 3QSKB 3VJ6A 3PL6C 1MFBH 1MJ7L 3MV01 1RU9H 4JFEA 1D5MA 1VHPA 4JLRA 3BGFB 4K9EL 1GGCL 3I9GH 4JY5H 3NIGE 1AXTH 1WZLA 3BWAA 4WU7A 3WXWL 1S9WB 5E8PB 3I85A 5IB1A 3C09B 2HVKB 5KSUA 1XF5B 5DFVD 3NIDF 4NN5C 2ATPA 3BH8B 3DV4A 5C0RH 3EFDL 4LAQH 5DA4A 2UV3A 4YHLH 1MCKA 4KQ4L 5C08E 1VFOA 4G6JL 5L7XL 1A7OL 5K93A 1XGRB 1CICB 3PP3H 2BY1A 4M7KL 3TO4B 4KKAC 4GH7B 1M05B 4JAMA 5DDHB 3D85B 4XCFH 2G2RA 4JFXB 1Q0YL 2PYFB 4MX7A 4UB0L 2SEBB 5HGBB 2VDMH 3PWNB 3S34L 3BPCA 1D3CA 5IMOA 2VDNH 2PO6D 4DN3H 2P8PA 3VXPB 2JE8A 4KUZH 4O02L 1LE5A 2VDKL 4Y4KD 5CGYC 4ZFOA 1EZVX 4PRHA 1LO4H 2ADJA 5CKAA 3ABZA 4URTB 4OLUL 5CHNA 4XCNB 4UILL 3IB4A 4NFCA 3EO9L 3G5XA 3FO0H 2H3NA 4YHIA 3R4DA 4A6YH 1MQKL 1GZQB 4Y4FD 4HIEB 1KIUA 1OLLA 3BKJL 4G9DA 4PRPA 4PS4L 2NY4B 5H2BB 5CILL 1KEGH 5IM7A 1T0NA 3DO7A 4RMSA 2J6EA 2Q76A 2EDFA 3IT8D 3T8XB 3CSGA 1L0QA 1AXSB 4KI1A 1RZ7H 5E99L 3VH8G 1BOGB 2WBWB 4HULB 4S1SH 3G6JE 3QUYC 3QJHA 5FGBA 5I30L 1V3LA 5JXEA 2FX9H 1NCAL 1YEJL 8CGTA 2EO9A 1U8PA 4JRYB 5DHYB 4IHOB 4U1LA 1A9EA 1VFBA 4LPYA 4GUPB 4TUKH 3WFCL 1UADC 3K0WA 2GHWB 1QSVA 1U3YA 4ODSL 2R2BA 1YY9C 4LARL 5I1AA 1BM3L 3RHWF 3GSUB 1F5WA 2Q8AL 3EOTL 1BREA 1QFWI 5EC1B 1IMHC 1A0QL 1OAUL 3DTXB 2IF7A 5F3BA 4RGNB 3MRMB 4EQ3A 5F9AC 3HNTL 4GO6B 2RB8A 4P23B 3CFBA 3ILQC 5I0DA 4ONFH 4X5LA 2Q86B 4V1DB 5F89B 4PJIF 7FABL 3P73B 3PUCA 3F62A 4XCCH 3JV4B 1DDHB 4HIJB 3TBSA 1BAFL 4J3XA 2IG2H 4ISVB 3NGBB 1WBZB 3IGAB 3ARQA 3DXAB 4CUCA 2WBJC 3BIKA 3IFNL 4G80A 4I4WB 5I6XC 5I8OL 1RUML 5TH2B 1KXTB 2GQHA 5HSFA 4OD2A 1N2RA 4NWUL 3IFLL 4D3CH 2ZG1A 5I76B 1JWMB 5DT1H 4LDLB 1I3UA 5E8NB 4FQPA 2W9DH 3HR6A 2ESVE 3O4LB 4S1DC 5C2BL 4G7VL 1MCQA 2CKBA 2WM0A 3MUY1 1LD9A 2VLKD 3F7RA 3ZTNL 4KVNL 4JFOB 5IFHL 5IV2A 4JPWH 4GRLA 1I1AB 5C0AB 2ATKA 3IDYB 1G9NL 4EVNA 3RGVD 5EU5A 2DLEA 5I66A 2M8XA 4QOKA 3NACL 1JHTA 4U1MA 1T0MB 1TTGA 5EULV 1IAKB 2E6PA 3IDJA 4HGWB 3ZYZA 5IHBA 5ADOH 2FH8A 4HWEL 3BMWA 3UZEA 1B4JL 2K7PA 4L8BA 3MLZH 3G9AB 3WFEH 1JPGB 1LO2H 4L1HA 5KVMC 3QG7H 2NXYC 5FO7A 4MQSB 4NBXB 2FJHB 4LLYB 1UVQB 5GJTL 1CGTA 1P7HL 1GIGH 5EC2B 3QB7C 1KELH 2A77L 4KRPC 2YRZA 2NPLX 4U6TA 1Q72H 3PV6B 2XIDA 2GSIA 1ZGLP 1J1OL 4U7MA 1SJHA 4W4OC 1CIUA 4YXLL 3RNQB 2AKRB 4PJXF 3VXQB 3M1BB 1AGBB 3QFJA 4NFDA 2PR4H 4BELD 3ET9F 4XCEA 4IRSB 2W9EH 5TQ2H 5ERWB 4WHDA 2NY2C 1WWBX 3O3EA 3LH2H 5D1QA 1Z3GH 3G6AA 2HTLD 1L6ZA 1INEL 4JDTH 3T3PF 5GZND 3KR3L 4NBZB 1QFUH 1K6QL 1KB5A 3BIAX 4RRPA 1Y6NR 3GHEH 4U6YA 2R23A 3EDEA 3TC9A 5KJRH 4ZOEA 4G43A 1JMZA 4K8RL 4Y5YA 5DUML 4Y0GA 3ZKSD 2HFGH 1RIVL 1JNLL 1I9IH 2GJ6B 3TO4D 1WBYB 3IJSA 4FTVE 2YC1A 3CNKA 5E2VL 3UROR 3GBLA 3O0RL 4NWTH 4P2QA 4NQEA 4LSUL 3I6LD 5ITBL 5DEGA 4Y88A 2FRGP 3IDMA 4JM2A 3MLVH 4DZ8B 3LPWA 5EBWB 2IALA 2R29H 4WFEE 5FYKH 3HRZA 2EO1A 3ALXA 3UAJC 3BPLB 5IF0A 1A1OA 3N1MC 3BOVA 3QUMA 4WNQB 1YYLH 2W0FB 1LK2A 1E28A 2E3VA 3FAXA 4XAWL 5GRVL 3FRPG 1CFBA 3HN3A 3BKMH 1LE9B 4JFYB 4ONHA 4F9LC 3LN5B 3H7LA 1XF4B 1LP9A 4FHBD 5T3ZL 1C7TA 5C0EB 2CGRH 5T3ZE 2NY4D 3FN9A 3E6HB 3ZSSA 2WK2A 3JZ7A 5FKPA 4IMLB 1JNHA 2AVGA 4WU5A 4DK3A 4I0PA 2XN9D 1BD2A 5IBUG 2KL6A 3IVKB 4J7RA 3WFHA 4AH2B 3WFDL 4XNZC 4CVZB 2NLJA 5E1AA 2YUXA 4WFHD 2H6PB 3Q3GA 5KOMC 3U0PA 3QQ9C 3MRBB 1ZS8B 5BOZG 3MO1A 5DR5L 4XNUH 5GS0C 3U0TA 3V4UH 3IRPX 4O2EA 4YNYA 1R3HB 1P7QB 4YHZL 3A0OA 43CAB 1MRFH 5J57B 4OLEA 4ZFZB 4G9FD 4WDIA 3L5XH 1DUYB 3M07A 4WWKC 1MFCH 1N64L 2W65A 1GGIH 4QRRE 4TSCL 4Y5XA 4GG6F 1YYMH 4RWYH 3PWPA 4HT1H 4LLWB 4X83A 3ZDZF 6CGTA 4YFLI 5CMAA 4N1CA 2DQEH 5MI0B 3WNKA 3L3DA 1AKJA 3ARWA 4TPRH 5FA3B 2OP4L 5KVGL 1T4KA 1EEQA 2YKLH 5BJTB 4B50A 4XPHL 4V1DD 1KCSH 1CL7L 5CBAB 2F19L 4EUPH 3FT2B 5EWIH 5B39B 3EYUL 4GG8A 5I8EB 3HHRB 2EC8A 2H1PL 2DQTL 1RHHA 2NW3B 1RVFL 3SKJH 3QDHA 4OIBA 4L29B 4KJPD 4UDUA 2DLIA 1YEGH 5I1IH 2ICCA 4HH8A 5FUOL 3VXSA 4F7TB 3AAZB 2ENYA 2E5EA 3SDXB 3VFSB 5KVEH 2P5EB 1I8IB 2H2PC 1VEMA 5EO1B 5IW6B 4FA8A 3K8LA 2BNRB 5M94B 3LS4L 2AGJH 4X80L 2FL5B 4YIQB 1BGXH 4PJ8A 1JF5A 3LB6D 4DZBB 4Z0BL 5D6CB 3GI9L 4HEPG 1KPRB 3UDWA 1X4YA 2CKBL 5AD0A 3X11A 4ETQA 5KSAC 5KVDL 4Y5VA 1YMME 3JTSA 3SDDD 1S9KC 2AP2A 3MTRA 5K9JL 4XPAL 4CVWA 3MGOB 2R1XA 3OJVC 3AVEA 1HE7A 4DJMA 5C0AD 1UQSB 3AY4A 4D8PA 4WENB 2KZ1B 4KVCL 1MLBA 3L7FA 3AMKA 3CVHL 4UV7H 3Q5TA 1HCFX 4I18A 1LDPH 4HBQA 1X6LA 3FL7A 2GJZB 2R39A 5CP7A 1T6VN 1NMAL 1LEIB 4RIRB 3GMPA 2ZSVA 3H3PH 5GRVK 3TBVA 4M03A 3BP6B 5E03A 4FFYH 2EC9T 4PY7B 1WC7A 5KSBF 4JREC 3EO1B 3C5ZB 2CD0A 3FQUA 1E4KA 3GSRA 5DSCA 4HKBB 4M1GL 1NC2A 3TT3L 5IB4B 1NGQH 2H8PB 2P8MA 4D0DA 4HV8B 1UB5A 1J10A 3TJEL 4B53A 2WP3O 3IXTB 3CAFA 4WRLA 5GISH 4OFYD 4PTUA 3BRFA 1ZGLM 1EVUA 4NT6B 1PKOA 4U05A 1KCRH 1KJMB 4KKNA 3T0BA 3OJMB 3BO8A 3QFJE 1AO7A 5BZDA 4J1UB 1BX2A 1J8HD 3NPSB 4MB5A 4R4FH 2YD3A 4HW6A 1IRAY 2F58L 1KJ2H 2DQHH 1JWUB 3DNKA 4LBEA 1HSAB 2DKSA 3P77A 4B41A 2V2WA 1H3UA 1LEGA 2C3VA 4DN4H 4J23A 3VWJC 2P46B 5T1LB 4TULL 5CIPA 1JPTL 4U3XA 3CX2A 2ORBL 3RVXC 3EAKA 2YSSB 3RWFA 3KPPA 4JZJB 3A6CH 1BIIB 3ARGD 2F74B 3NPZB 3FOLA 3V7AE 5FGCE 1JHKL 5I8KL 5D1QC 4J4PA 3PWVA 4NQEE 4RZCA 4NO5B 4L3EB 3A6BL 4KJYA 1K5NA 4NC2B 5EIIB 5HVHC 4XP4H 4R0LB 2KKQA 4OZ4A 3A6OA 4BH8A 4YHML 5BV7B 1CG9B 5JPMB 1NCCL 2WUCH 4AEIH 3CFJB 5IT2H 2Q3ZA 1BQHB 1AQDA 2AABL 3OGCA 4QHMA 3LQAC 3D5OF 2FECI 2F54A 1C7SA 4G8GB 1INDH 1K2DA 1VB9A 3R0NA 4N5UA 1DN0B 3OMZA 4P59L 1M4KA 1QLRA 1J1PH 4NZUL 1LP9E 4JM2C 3VFPA 2EDHA 5F1NB 2CXKA 4WY7L 5D9SA 4HWZA 3FQRB 1AR1C 4P2OA 3KLAB 3MA9L 4OIAA 4HHAA 4JKMA 4DCQA 1BD2E 4OCXH 2PXYB 4F7EB 1Q1JH 2R0KH 3BP4B 5L2KA 2L4OA 5L2JB 1N6UA 2Z93A 3S5LB 2ARJA 1P1ZA 1L6XA 4GOSA 2Z91B 3VXRB 1IFHL 1OSPH 1T1YB 4P9ML 4KY1L 2KZWA 1Z9LA 2V5MA 1YY8A 1V7NH 1YZZA 4TVSa 4XMLH 3FB6A 1AFVL 4I0PC 3RIAK 1K3ZA 2DOCA 1FL6A 3RTQA 4YDLC 4FFVC 1A6VH 3TNNA 3PWPE 5TFSL 5DUBB 1BZ7A 1DQML 1ROWA 1QA9B 1QFWM 4PB0L 1PGRB 3L9RA 5DMGC 3SKMB 4HXAH 4KUCF 2NX5D 1BJ8A 1ITBB 1EHNA 5A16A 3CU1A 1NFIB 2N7BA 3PGFH 1W8NA 4PRID 3TVMB 4ZXBD 5GHWH 4PG9B 5EU7C 4Y5XC 3QEGH 2HA1A 3ULVH 2PNDA 2VLJE 1V3JA 5IUSA 1T89A 3G9VA 3L6FA 4KK9D 1A9BA 3VXSE 4Y16C 4WV1C 3FN3A 3T2PA 3MBEB 1S5IH 4EJ1C 5EOCL 1KV3A 2QQQA 5JO5B 3RKDD 4ERSH 4NKOB 4WO4C 3DRTB 5INCA 1OAKH 1T3FA 2BNRD 3PABB 4R2GC 3I02A 5DVLA 5C86A 4EN3D 2OZ4L 4LGSB 3U7WL 1A3LH 4JPVH 3B8SA 2UZXB 4JPIA 1KEML 3P9LA 4JFQA 4NO0A 1YPZB 2FGZA 4JDZB 1ES0A 1U8NB 1QO3A 2I07B 4EI5A 1MVUB 3DPBA 4MA1B 3GFUA 2ADFL 4Z76B 5J8OA 3HC4H 1YEIL 5EUOF 3BHBA 1DUZB 1RULL 1HHIB 5I73B 5DF0A 1M7DA 4GRWB 4LCWD 1WF5A 1G7IA 2ZCHL 3ROOA 4H5SA 2APFA 1BLNB 1KLGA 4OT1L 2WLYA 3UTSB 1KGCD 1RZ8A 5B8CB 4K94H 1MHPL 1OTTC 5E95B 1CQKA 5GSVA 3BP7B 3HR5A 2YZ8A 5JW5B 2DM7A 1RJLA 4QXWA 1KNOB 4WW2F 3S7GA 4JZNB 5ISZE 4P3CL 1KC5L 1QBLL 4OZIF 2DQDL 5MERB 4MAYB 1C5DA 3CU7A 5CJOL 4ZO8A 2HFFB 3QZWB 3HCVB 2Y9RT 2X1XR 1Y0LA 5ILTL 1S3KL 2VB5A 1CFVH 4DGIH 1AY1L 1FFOA 3UO1L 4NM8L 1GGYA 3KYKH 1AO7E 5F1IB 4PJ9C 4QY8B 3TH4T 4U1NA 3CLEH 5D1XB 3P9MB 3KXFB 4P3DB 5DLMH 1MHHB 1FYHB 4KI5E 4K71C 4K7PL 1EMTH 2GSGA 4Q9QL 1QTYT 5JOFA 1JRHH 1KENL 1GOFA 3RVVC 3L5IA 4BFIB 1CDIA 1DVFA 5B39G 1VFMA 2VDRH 2V2TA 4PRNA 3BGMA 4WCYH 3DVNB 1DQJB 1ZTXL 2XQBH 4QHKJ 3QAZB 5CAYB 1S7QA 3OXRB 1LNUB 4HPOL 3FN0L 3UTTD 2CMRH 1ZA6A 2G75A 1LGVA 2R15A 4W68A 4DKAA 2CIKA 3TH3T 4X99B 2IMNA 2XWTB 3F58L 4M48L 2R2HA 1YEKH 1RZIA 1UM6L 1A2YB 2AJVL 2OL3L 4YZFE 3V5DA 4L3ED 4ZNEA 2OMNA 3P0VH 1JPFA 1Z9MA 1MHCB 4JG0H 5SX5K 4OIIL 3TA3C 4PJBF 1E0OB 4LKXA 5CD5C 1IGIL 1N8ZA 2YMXL 5F7NC 4MXVE 2Z31B 1UWXH 2CO6B 3C8DA 1B6UA 4WI4A 1QPPA 2EICA 1KTDA 4J4PC 3RWHB 5E8DH 1P4LA 2BX5A 1DTUA 2F54E 1WWWX 4D9QE 3DUUA 5E00B 1T7XA 1U2HA 3CFKA 4YPGB 3VRJA 1INQA 3CXDL 3WD5H 4O5LL 4Z0XA 4ELMB 4G8GD 3O9WA 3F7VA 3VG0H 1TZGL 3UTZA 1ETZB 4FXLA 3DIFB 4AIZA 3VFWB 4ZO7A 1X5LA 2Z8RA 1YN6B 4N90D 4PJEB 4YHKH 4X7TA 4KHXL 5CUSH 4ENEC 1UCTA 3B2VL 3MUHL 3C08L 2XRAL 4UNTA 4MDJB 3HNSH 3QDMA 4GAGH 3TZVD 3CK0L 4K3EL 2XKSA 4CW1A 5L2KE 3KYNB 4NRYA 4F2MB 1JVKA 1NL0L 1A64A 3OPZH 3KLHD 4U6HA 3SGKA 1H3PH 4N8PA 4QT5A 3GMNA 2A6JA 1NAMH 32C2A 4MVBD 4OZFA 1ZV5A 5ESAB 1P2CA 3PWUA 4XNQB 5EORL 4HIIB 5E94B 4O58H 2ZUYA 2XNAA 2ICEA 4P2OC 4U1IB 5DHVA 3TYGL 2HYMA 1SYVA 4QWWC 1P7KB 3PXHA 5EZIH 1JWSB 5DK0B 4RMVA 1MFAL 4R4NC 5CZVL 2C7UA 3MRGB 4P4KB 5CJXA 1DR9A 4N8VB 5T5NG 4OQTL 3PHOB 4RAUB 5IW1B 4M6NL 4XHQA 1EJ6A 5F9OH 4NKDB 1FDLH 1U3ZA 1DFBL 1RJYB 1GHFH 2FO4B 3P4OB 3QUXD 1LO0L 1JRHI 4GXVL 2UWEA 5GRJH 1LO5B 5TE7L 4R7DB 3V4VL 1SEBA 4F15C 5DJYA 1F4WH 2DL2A 5E70A 1BPVA 4UT7H 1ZHLA 4P9HC 3FONA 2BVUA 4QNPF 4FMKA 2EIDA 1KCUH 5EIVA 4ZPTB 1JGUL 3AB0B 4NN7C 3SJVA 2HJFA 3MJ9H 5FHAH 3TIEB 2R0WH 2XPGB 4ODHH 5JLZB 1T1WA 1HZHL 4HXBH 1A4KA 3MBED 1D5ZA 1T66C 1ZA3B 3NFPA 2X4SB 3S9DB 1FZMB 2QR0B 2VLRD 5IW3A 5B38B 5JQ6H 4HFUL 4Y4FA 2P42B 4CNIA 5CBEB 3U7YH 5IJKA 3HPLB 4XVJH 1L7IH 1S7VB 5IKCA 5ICXA 4XWOC 2EIEA 5DD1H 2WW8A 4HWNA 2O5XH 4QRSB 3BUTA 4NRZB 5KS9B 1B4RA 5C0DB 1I7TA 4Q58C 3Q1SL 4MNQB 4ZAKB 1X7QB 3KPQA 1RZFL 2C4FT 2VLME 3CFDB 3VMPA 4KPHH 5C07B 4JN2A 5GGSA 5GIRB 4P49A 4NGHL 3IU3A 2ERJC 1UB6A 2HT4C 5CJQL 4R90L 2OLDA 2LQRA 3ROLA 3DJ9A 3MRIA 4HUVB 3UJJL 3ESVF 1MIEH 2VDQH 1BIHA 2VXVL 3RVUC 4L1DA 3RWDA 1N6QL 2XZAH 3O2DA 3S5LG 5K59F 1IGTB 1JI1A 5I15L 3EZ8A 4MDIA 4N0YL 1U58A 2YD5A 4GXUM 4U6XA 2EEAA 3DSNA 4WTXA 1UA6L 3RUGF 2AJSL 4S11A 4XAKD 1CE6A 3C6LB 4NUGL 2OTUA 1B9ZA 3VFGH 1OCWH 5ETUB 3E3QE 5DWUL 1YJDL 3JBG7 4TUOA 4H1LH 5A2IH 3T0AA 3OX8B 1MJJB 3BD4A 3OR6B 3ZDYF 4TTDD 4MQXD 3SO3C 1S7TA 3NIDE 2JB5L 4UOJA 1R6VA 2B4CL 3O8XD 1VKXB 2LAAA 5EG6C 1ZLVH 2FBJL 4D9RD 3FRUB 1R3JB 3QQ3B 1VA9A 1WAAA 2P24B 1IC5L 3N1GC 4HUUB 2IMMA 1QSFB 3BT2L 3T3MF 3OAYH 1HXYB 4LASL 4MQTB 4OFVA 3MV8D 2VXTL 3ZKXC 2BOBA 1IGJB 4P46C 2HLAA 3I2CL 5IVXA 1E4WL 3KLDA 3IXAB 3SE9L 3HZKB 3IJHB 3BKYL 1A6TB 3V0VA 5T5FH 4IIQB 3REVA 1JYWA 3I6GB 1IC7L 2VLKA 1W0WB 4Q0XL 4TVPL 4MA7L 4TVPE 1EA9C 2I27N 4YHYC 5FK9B 4QHUB 4ZTPL 4EUPB 1H15A 4ZNEE 3V4PH 4JKWA 5D93B 2J88H 4BUHA 1JGLL 1A6UH 4XPTH 3RGVA 3X12B 3FRPA 1L7TH 1MIML 5MEOA 2XXMB 4QHLB 2DICA 1BVKA 2NY3D 3EJJX 4DVBB 5JHLH 2Y5TB 3JWOL 1KACB 2EDQA 5T1MB 3FO2B 3IDGA 1HHGB 3LKRA 3MACH 5I18L 4F8QA 5KSVB 1IT9L 1S9VA 4YGVA 1TQBB 4UQ2B 4XNYH 1IAMA 4YPJA 3HAEB 4XTRC 4L4TB 1MOEA 1CFSA 5FO8A 4JM4L 4PJHA 5GRUL 4FZ8H 5CSZA 3INUH 4U1JB 1I9RL 3KPLA 5IMLB 5GGRA 3LV3A 2ED8A 4HS8H 2AEPH 3GJEB 1JTTA 5K9OB 4YBQC 4LRIC 3O9WC 2FEDC 3TBWB 1FZKB 3QZWG 5FDWB 3MUJA 1BQLL 3G08B 4MNHB 3VI3F 3CFCL 5ESVB 4KMQA 2VDOH 4YC2C 3D2UB 4GMTH 3T0EE 5ACZB 1S9WA 2UVFA 5E8PA 1JZ5A 2HVKA 4WUUB 5DK3A 4E5XB 2BMKB 1XF5A 2ED7A 2R9HC 4PJIE 3RVWD 2QADB 4XBEL 1P4BH 3TWCH 4NO3B 1PKQE 4M43L 4I9WD 4XRCB 4EXKA 1H8OA 4FQJL 1LK3L 4LKCA 3TO4A 2UWEE 2FX8H 5HHNB 1IEAB 1M05A 3LY6A 5LG1A 1ZLUK 1WIOA 3WFBL 4UINH 5IB2B 1FGNH 3PWNA 3P9WB 4RGMC 2D7OA 3FO1B 4JO4L 3K1KC 1ZSDB 1DEDA 1AC6A 2F5AL 3KYMB 3SJVE 5DD0L 3SGJA 1CK0L 5KANI 1CGYA 3C2SA 4IRJB 3VFOA 4ZNCD 3TBTB 1OAQH 5FV2A 1Q0XH 2DLHA 1J0IA 2UUDH 4XCNA 3MUGB 1E27A 1MELA 5BOPA 5FA4A 5L88H 2PO6C 3OJ2C 2CRYA 1GZQA 4X6CB 4HIEA 5J1AB 2CDEB 4HZLB 4Y4KC 1FG9C 2CLZB 1U8IB 1QSEB 1SYSB 4Y19D 4ZDHB 3OKLB 3QDJB 2J6EH 4HDIA 2XN9A 2R8SL 3G6DH 4KZEH 1YNTA 1AXSA 4PJFB 4BH7B 2Y6SC 1BOGA 3QWRD 4NQDD 1JHLL 5DMIH 3U1SH 5IJKC 2AJZA 4X6DA 3GMOB 4OLYH 2FB4L 1R5WB 3W9DA 1ORSB 3BPOB 1NDGA 5DHYA 3QWQB 5HHOD 1FYTD 1F3JB 2FD6L 3LIZL 3WS6A 2FR4A 4GMSL 2J5LC 2YK1H 4G9FA 4Y1AB 3GSUA 4OCYH 3RFZC 1SHMA 5GJSH 4BZ2L 3VWKD 5EC1A 1HKLH 5I74B 2BVTA 2FX7L 5EU6D 3BRDA 4G6ML 4PJXE 4PV9B 5I1EL 1U8OB 2AV7B 1QKZL 1V5JA 1AHWC 5TF1L 4NC1E 4JHAL 2HVJB 1NJ9B 4N8VG 2Q86A 5L8KB 4V1DA 5LXGL 1QR1A 1QBMH 3P73A 2Y23A 1A7QL 3B5HA 3JV4A 1DDHA 1KIPB 2HKFL 2UZYB 4HIJA 3FQWB 2ZUTA 4AT6B 3T3PE 2OM5A 4KMTL 4R26L 2NY7L 4ISVA 5ELIA 4L9LB 1WBZA 3IGAA 3DXAA 3JUYA 4ODVL 2BY2A 5DJ6B 3GM0A 4I4WA 4FQCH 3OB0H 5TH2A 2YZ1A 1UH3A 4FQ2H 1OPGL 2MKWA 1HDMB 1MRDH 4CMHC 5I76A 1JWMA 4N0CD 3FCTB 5HJ3B 1FN4A 1IGCH 4WEBL 3O4OC 4PPTA 4Z95L 5BZWB 4YUEH 4IJ3C 4UV4H 5E8NA 2AK4B 4KDTC 1NKRA 2V9TA 4BK5A 3SKOA 5K9QI 1A5FL 2FLBT 4P57A 3B9DA 4Z78B 1Z2KA 4HIXL 4G5ZH 4NP4H 4IDJH 3OWEA 5F9JB 4U1KA 2CR3A 5EOTB 5B38G 2CJUL 4JFOA 5IMMB 1IBGH 4LSPL 5C0AA 1MQ8A 1XGQB 3VFUA 1CD8A 2APTA 2BFVH 5D7LB 5FYKU 1OAYL 4Z7VF 4PJGB 4NM4H 4F57H 3DECA 5EFIA 2L0DA 3H9SB 4L8SB 4PJAB 4XWGH 1T0MA 4LSRL 3QH3A 1IAKA 3L7EB 3DMMB 2NTFB 4HGWA 5E6IC 1NMBL 3T77B 2OTWA 4FZEL 5FYLL 3LQMA 3E8UL 3MJ6A 3HUJB 2WWMD 2VISB 4L4VE 5EZOH 4PIRF 1Q38A 4OD1H 1QLEH 5T3XE 2CSPA 3RGVC 1NUDA 1CR9L 4XVUD 5EC2A 1RUAL 2IADB 2VDPH 4FNLH 4L4TD 3TN0B 5ESQB 2G60L 1OAXH 1AGDA 4G6KL 3S3JA 1I8KB 4OFYA 3PV6A 5FYLD 4YHOH 5F1SA 3LS5L 5I9QB 2AKRA 3FT4A 4F58L 1G9NC 1V05A 5JIKA 3VXQA 1T1ZB 3M1BA 1AGBA 4GG6E 1A7BA 5CLTA 2DQJL 1E4JA 2LAGB 2CPCA 3L1OL 5ERWA 2NY6D 1ZLSH 3EYQC 3S97C 4KKLD 4BUGA 5I1HH 4L8DA 2J8UF 3OB8A 3QCVL 4MJID 1Y6MR 1BFTA 3D2UD 1UCBL 1TXKA 2ICWA 4Q6IC 1T04A 3VE0B 3JVGC 2QADD 1KB5H 1CZ8L 3VXUB 1WFTA 1HINL 4C56E 2RJMA 4AG4L 2I60H 3RDTC 1N5YL 1UJ3B 3MLPA 3BDYL 1N7MH 2GJ6A 3GJFB 3L5HA 4MHHI 5DD5H 1WBYA 2HTLC 5DJXB 4HF5H 4CDHA 1F4YH 2EH8H 5GZNC 3D39B 4LPVA 4U0RC 1GOHA 1T1XA 4U3HA 4PUBL 5AWNH 3G5ZB 5KTEH 5EBWA 1I1CA 3MXVL 4LU5L 1G0DA 5JHDB 1HHHB 1QACA 3AM8A 4WNQA 4DW2L 3QUMH 3KYOB 1UM4H 2BNQB 2W0FA 4EUPG 2JIXB 3HE6C 1E6JL 2VLLB 3O2WL 4PD4K 3MCLH 2DMCA 3SDAD 4JFYA 2CXGA 3LN5A 1C1EL 1XF4A 3JWDL 1XGPA 4XPBL 5C0EA 3NZHH 3ARTA 2Y06H 3SGJC 1NGPL 3UYPA 5J11C 3O3BB 4K8RC 3E6HA 3QUZB 1QSED 5AEAA 2MHAB 4OM0L 5HGDB 3JV6B 1IAIL 4GQ9L 5KW9L 4GS7C 1G7JB 4AH2A 4CVZA 3WO4C 5JMOC 3HAEG 2BY3A 3MV7D 5KSBE 3QIWD 1ZS8A 4JRYE 3U36B 4Z8FH 3GSVA 2C3XA 1IQDB 4HUMB 4HH9B 2DM2A 5GGUB 3FB5A 3GNML 3I3DA 5IBTL 1CS6A 3MBXH 1WFNA 43CAA 2VC2L 2MOVA 3SHSA 3CZFB 5D6DA 5I16B 1R3KB 4RGNE 2DIAA 1EHLH 1KT2B 5IEKB 5C1MB 5HYIA 3PL6B 3CMOH 1PSKH 4NKIL 4LLWA 2CRIA 3P4LA 4R7NA 1ZHNB 1RZJC 4DAGL 5IP4A 2NX5A 1KTRL 1Q94B 2IBGA 5FA3A 3NIFE 4PRIA 3ARFC 4ZXBA 2DQUL 1HK6A 1QRKA 5CBAA 1NFDA 2XKUA 4NN5B 1NGZB 3FT2A 3HTLX 5B21A 4OCWH 3THMH 5B39A 3SE4C 5I8EA 1NAMB 4W6YB 3DXAE 1TETH 1ZK9A 3IKKA 1FO0B 2F53B 2NW3A 1RIUL 3BSZH 3QJFB 4X7SL 4L29A 3DO3A 4OF7A 4WI3A 4F7TA 1KCKA 3SDXA 3VFSA 2P5EA 4HC1H 4HGKC 4XMKH 5EO1A 3T1FA 5IW6A 3FMGL 2ZCLL 2BNRA 2FL5A 2BZDA 4YIQA 2D0GA 5GGTA 3GSWA 3FFCB 1GZPA 4XCYA 3HS0B 5D5MF 5D6CA 3GSNL 3S88H 3O4LE 1KPRA 3GBNH 5DFTA 4KJPC 5DRZA 1ZT4A 2R4SH 1ADQH 1U6AL 1TIUA 1PZ5A 4N68A 3B9KD 4JFFB 2FCBA 5ID0A 2BOCB 4Z77B 7CGTA 3MGOA 3MR9B 3LB6C 4JKPH 4X8XA 4MXWH 5E2TL 1D6VL 2F9BT 5FYJH 2A2QT 1J88A 1OSZB 2Z0BA 2XZCL 4KTDH 1R0AH 2DLTA 1GPOL 3SBWA 3EFFB 1D5XB 1W72L 1VENA 3HZMB 2DRUA 1I3GH 3SDDC 2GJZA 4ZFFB 3MRQB 1JGDB 2R1WA 3K80A 5HYJD 1JV5B 3L3KA 2X7LB 4RIRA 3BP6A 4PP1D 1JZ3A 3IYLW 1MUJA 4PY7A 4HS6B 3C5ZA 4PJCB 4HMDA 1VFUA 4U3CA 3QUYB 1FFRA 1RURL 4OB5L 4OGZA 5IEHB 3LVEA 4HKBA 1RUKL 4DKFL 4ETYA 5IB4A 2H8PA 3QO0A 1ULVA 1MFDL 3FB8B 3D0LB 4UZGA 4P3WA 3D25B 5D7KD 1K4DB 3IXTA 3OAZK 2JJTC 5C09B 2WWKO 4NT6A 5CINH 4P4RB 3S96B 1A14H 3CSPA 2JELL 5I1GH 4JRXD 3GUTA 4J1UA 5EH1A 3RAJH 3EYFB 3IDXH 43C9B 5IHUH 3QUKB 2B2XL 5E9DD 1JWUA 2DWDB 1ZGLA 1HSAA 2VH5L 4BM7A 4YEEA 3O81A 3NAAL 4Z6AT 4S0TD 4F9PA 4X4YB 5T1LA 3OKEB 2P45B 4FG6D 5SV3A 5HXMA 3V5KA 1XF3B 2V7NA 3WE6B 5E24E 1FRGL 1A4JB 4TYUA 2WBJB 3SQOL 1P4IL 4JZJA 5I6XB 4QCIB 2F74A 2GJ6E 3OR7A 5DRXB 3HMWL 3ZE2F 1QYGH 1T80A 1XZ0B 3CVIH 3HFMH 2V17H 4H1LB 4YFDB 3LDBC 2E27H 4I3RL 1RIHH 3X13B 4NO5A 1U9KA 4NJAH 4POZD 4L3EA 1GAFL 2Y36H 3D39D 4OZHB 4YK4C 5C9JB 3RU8L 5EIIA 3EOBB 4JHWH 4OF8A 4R0LA 3V0AC 3TJHD 1RZGB 3ARGC 3ULUL 3ULUE 1XT5A 5L6YL 1BQHA 2BVOA 2QJDA 4G8GA 2X44D 3ULVF 2QQNH 1DN0A 2HJKA 3QPXL 4G6AD 2VNCA 2FGWH 2GITB 2QBWA 5F1NA 3BP5B 3OJDB 1IKFH 2RCSL 3ILPB 3MV9D 4NQSB 4CDGC 3ARDD 3KLAA 2B39A 2IAND 1JGVH 1NLDH 5D2NC 3VFVB 1WICA 4HKZB 3GRWH 4F7EA 3WUWG 4MCYB 3BP4A 5AAMA 5FUCE 4QHNB 5L2JA 1QBBA 4QXTB 3S5LA 1MI5D 4E41D 3KJ6L 2NXYB 3EHBD 3VXRA 3N9GL 1T1YA 3FT3B 4KRPB 4NDMB 2Q1EA 1A6WH 2X41A 2EDJA 2EDOA 1CGXA 1NBZB 5E5UB 1MJUL 2NW2B 4PB9L 3T2NH 3U79A 1XCTB 5DRNB 3T0XA 3Q5OA 3QT2A 4P9HH 3E6FB 3ARBC 3MRJB 3PL6D 4UTAL 1F2XK 1OWWA 5EA0L 2HRPH 2YPLD 5F7YC 3R1GH 1ZT7B 1Z9SA 1DANT 2NY2B 1NFIA 5DK2B 4WI2A 4UDTA 5DVNA 4E42B 3X3FL 3OAUH 1AH1A 1UZ6E 4PG9A 1ZMYA 3MLYL 1S7UB 1J86A 3VJ6B 2XWBA 5ENWA 2OK0L 1UACL 3VFNB 4JFEB 3W0WE 3BW9B 2VZSA 2EDNA 1QVOB 5E8OA 2HFTA 3S37X 1CIDA 2P5EE 3L3JB 3MRNB 3MBEA 1CDHA 4KKAD 1GVIA 1AJ7L 3IAPA 5KAQG 1NSNH 2VLRA 2OS7A 3REWA 1Q9WA 4OZGA 4YDIL 3PABA 3ZDXE 4LRNH 4EKXA 1I1FB 4TNWF 4YEFA 2ATPB 3ORJA 1FL3A 2BJML 5E7FA 2AI0H 4NQVB 3TCLB 3K4DA 3FFCD 4WUKH 1YPZA 1D6EB 4Y4HD 2XA8L 4KK9C 5DMYA 1YNLL 2PETA 1MVUA 4Y8AA 5C0BB 1F8TL 3O45B 3RKDC 3NH7H 4Z76A 1JFQH 3JV5A 3S36L 3WKML 2AXGB 4QRQB 3NBNA 2O26U 4MGXA 3CDGB 4WFFE 1L0XA 1HHIA 5T33L 4EN3C 5CGTA 5TE4L 1EIBA 3P0YH 4PLNC 3BPCB 4HLZG 4AJ0A 2P8PB 1CFNA 1P9MA 1F4AA 1WTLA 1IE5A 3QIUC 1R3IL 5B8CA 1CF8L 2OQJA 1F42A 3BP7A 5CHNB 1AE6L 2XWJB 2OCFD 4XNZB 2KH2B 2H3NB 1KNOA 4JZNA 4GBXD 5B22A 1UM5H 1DQQA 4MAYA 4G9DB 4PRPB 2CUHA 4TQEL 2A6KA 2HFFA 3SE8L 5GGQL 2X5PA 3DO7B 5BS0E 3HCVA 1S7RA 1CU4H 2Q76B 5BMFH 2JCCB 2ZPKH 1NBVL 2CK0H 3GIZL 4MD4B 4ZOCA 1BEYL 4PJDA 2VXQL 4OJFH 2Q20A 5C09D 1ACYL 4WWKB 1HQRB 3O8XA 1T83A 4ZSOB 4MNGA 5F1IA 2EE9A 3HZYB 4ALAH 4BFEA 4QY8A 5CWSB 2JK5B 3DX8B 4U1LB 1A9EB 1VFBB 1EAPB 1MCPL 3DGGB 4RMWA 4TSBL 3ZE1E 4F8TA 1FAIL 5JW3H 2R2BB 1TPXC 4BFIA 2QHRL 4DOHB 3HG1D 2ZJSL 2GTZA 3DVNA 2W59A 2YPVL 1HHJB 3RX8A 4HPYL 5F3BB 2QQKL 3BJLA 3QDGB 1IARB 4KRNA 4YFEA 5CZKA 4S0SD 1RK0B 3CFBB 3SY0A 3NIGF 5A40E 1IKNA 8FABA 1B0WA 1P53A 3P3YA 4X99A 2XWTA 4Z7QE 2JJSA 5E08L 1NBYB 3CPLA 5FXCH 2Q7YB 1IGFL 4KMLB 2Y07H 5F44A 1A2YA 3TBSB 3EJYC 3GSOA 2RBLA 3CX5K 4K23H 2BRRH 4AK1A 1MHCA 2EKSB 1FVEA 4WHCA 5JXAL 4G80B 1LO3H 4PJ5D 5KSAB 3NZ8B 2B5IC 4JZOB 2FIKB 5TDNA 3O6MH 2NMSA 3C5JA 1N2RB 3RWHA 3KPNA 5DUPH 4G8GE 3B5GA 4S1RL 4C4KT 1S9YA 4L5FH 2DDQH 4C59B 4GW4B 1PG7H 4YPGA 3GMRB 4LVOC 5I71C 12E8L 3TT1H 3DIFA 1W0YT 1YN6A 2WUBH 3PWLA 4LSQL 4AEHH 4EBQL 4O4YL 3OKNB 2IH3B 6FABL 4WJ5B 2V5YA 3ARPA 1MCBA 4MDJA 4XP5L 4Q6YA 1I9JL 3HC3H 4WFGD 4F2MA 2D03L 1U3HC 1C5BL 5K59E 2VABA 3BPNC 4GRLB 4M1CC 4JREB 4M6OL 4Z7WA 2ATKB 3GHBL 5C6WH 2H45A 1EGJH 4XNXL 5ESAA 4OZFH 2EECA 3VXRE 3V6BR 4XNQA 3WKNA 4HIIA 5E94A 5EU5B 4X9BA 3KPSD 4QOKB 2EDKA 4U1IA 5DHVH 3TZVC 2J12B 3IJYB 4I2XB 5DK0A 1E6OH 1TENA 3SOBH 1DSFL 1U2CA 4N8VA 4L8BB 5D72H 2HWZL 4MVBC 3ZDYE 3QHFL 5IW1A 3H0TB 5FV1L 3BE1H 3BDBA 3MRPB 1XAUA 4NKDA 5FO7B 1RJYA 2VO5A 1EO8H 2FO4A 1CGSL 3SPVB 3R8BB 4M8VA 4Y89A 1GGCH 1UWEL 5EU3B 1AD9A 1LO5A 4M4PA 1SVCP 3FQXA 3T3ME 4M5YL 1ZE3C 4OLVH 1MFBL 1HI6A 1RU9L 4AM0A 2N4IA 4ZPTA 2BSRB 3I9GL 3QUXC 3BUYB 2ZUUA 4JY5L 4P2YA 2YUZA 1AXTL 4JO3H 1A7OH 3BD5A 4H1LG 2XPGA 2E9IA 5JLZA 1KN2H 1X4ZA 3IS1X 2X89A 3J8F7 3OKDB 5I1CH 4KKCD 5D1QB 2X4SA 1FZMA 5C0RL 1Q0YH 2QR0A 2MFNA 4LAQL 4U2YA 5B38A 4YHLL 1KB5B 3WXVH 3STLA 1S7VA 3MOBH 1U3JA 3VDAA 1F4XL 4QRSA 1ZHBB 5KS9A 4G43B 4NRZA 4Y19A 1PY9A 1RZKH 3BEWA 5GGSY 4MNQA 4ZAKA 1OP5K 1X7QA 5C0BD 1R24B 3GMLB 4XCFL 2AJUH 3CFDA 5C07A 2VDML 2E6JA 3QWRA 4NQDA 1BMGA 4OGAC 5GIRA 2VDNL 2EE3A 4P2QB 2IH1A 5DEGB 3IDMB 3VGFA 4HUVA 4KUZL 4MD0A 3NCYP 3UTSE 4JM2B 3C60C 5HHOA 2IALB 1GXEA 2X1WL 3BX7C 1LO4L 4FP8H 3HRZB 2ZUXA 4XNMB 5IF0B 3QUMB 4G6FB 4OI8A 2IAMC 3VWKA 1T5XA 3O2DH 1IGTA 3FO0L 4A6YL 4Z7UB 1OM3H 2WMPA 5EU6A 4K7FA 2XY1A 3QQ9D 1KEGL 2PUQT 5GS0D 3WIIH 4H8WH 1KBGH 5J89A 1RZ7L 4ZO6A 1T5WB 1MJJA 2BNUB 3OR6A 4I0PB 2XKNA 1NEUA 4S1SL 4X4XB 2Q8AH 3KPRB 4YDLB 2NLJB 2FX9L 4M1DH 4WWKD 1VKXA 2HAZA 2X4QA 3Q3GB 3U0PB 3QCUL 4K7PX 3FRUA 1R3JA 3QQ3A 3KXFE 3LEVH 4TUKL 3TPKA 3MXWH 3UC0H 4DQOH 2ZCKH 4HUUA 2DJUA 3V6OE 1CFQB 1AI1H 4IOSD 5F6HI 1HXYA 4RNRB 4LLQB 5HHQA 4TTDC 4I77H 4KROC 3K2UH 3QHZL 2DQIL 4AEEA 1CXHA 3OV6A 3O8XC 3EIFA 1P84K 3LRSB 2W65B 1NUFA 3OKKB 1OGAD 4Y5XB 2NCMA 2BVPB 3H9ZA 3IXAA 4C58B 3HZKA 3QDGD 1A6TA 3WNOA 4ONFL 4IIQA 3I6GA 4PLJC 4Y16B 1AKJB 5FM4A 4WV1B 4AL8H 1T4KB 1YJDC 4XCCL 5DEFB 4F37K 4NWUH 1P6FA 2H2PD 2YD1A 5FK9A 4QHUA 4WO4B 5AYUH 1D7FA 4R2GB 4EUPA 3BIBX 2CUMA 3DX7B 3QQ4A 3HMXA 2B4CC 1FNGB 3MLXH 4CL7A 4G8FA 4M02A 1RHHB 5CP3H 4HUKB 1FFNB 1U93B 4QHLA 5HD8C 1EUUA 1I7RB 5I1KH 1KOAA 4UDUB 1I3RB 1I7ZB 4D3CL 2Y5TA 2K3TA 4LQ1A 3GSXB 5T1MA 3GO1L 1BBDH 3FO2A 4QRPB 3HI5L 4FABH 1J11A 2WQRA 3MSPA 4KVNH 4ELME 3PQYD 2GKIA 1X5FA 2W9DL 5KSVA 2QTEA 4UQ2A 5K9QG 4PJEE 3HAEA 3LPFA 4L4TA 1BF2A 1CLCA 4C57C 5GGRY 3VXMB 5AD0B 1FV1A 3X11B 2NY3C 4LMQI 5EO9B 5IMLA 4OKVB 4HWEH 4GKNB 1QQDA 1G0XA 4M9OA 1I8LA 1WISA 2R1XB 2ZP0T 3GJEA 4XXCA 5K9OA 4ZTOH 3T2OA 4A2MA 2YR3A 3TBWA 2DF3A 1FZKA 5FDWA 4JVWA 1CD1B 1MLBB 3L7FB 1S8DA 2NXZD 3G08A 4X7EC 1A3QA 4QTIH 4I18B 2A77H 2E8YA 1WITA 2OR7A 3RJDA 1SBSL 3D2UA 4JQIH 5ADOL 4OAWA 5ACZA 1C12B 3V5HA 4E5XA 3MLZL 5FGRA 1WLHA 2BMKA 3FOMB 3JWOC 3WFEL 3Q6GL 2J7LA 4EIGB 3N0PB 3MJ8A 3SEPA 1LO2L 3TBVB 4U1HB 2ZSVB 4CVXB 3QG7L 4NO3A 3OSKA 3FQNB 2X2YA 2A9NH 2I5YH 3FQUB 3LN9A 4HUWB 1GIGL 4I1NB 1KELL 4XRCA 3GSRB 4PJ9B 2FWOB 3LSOB 4K71B 1IEAA 1Q72L 2O5YH 2OJEA 2UYLB 3D87B 5ANMB 4PTUB 4O2CB 3VWJD 2YUVA 3FO1A 1K6QH 2B20A 3TFKD 2PR4L 4N0UE 4PGEA 1B2WL 3KYMA 2W9EL 5TQ2L 3RVXD 3CXHJ 4DGYH 1ZANH 4LBEB 3LH2L 3TBTA 1Z3GL 3T0EC 5D7JD 1RIVH 4CU6A 4JDTL 1LEGB 4FXGA 1QFUL 4J3VA 2AEIT 5E2VH 3QNYA 3GHEL 3SDAA 1NLBH 4X6CA 4NSKB 5J1AA 4RMQA 4GKOA 3MA7A 5KS9E 2JJUA 3RWFB 1MCWM 3IKCA 1U8IA 4UIMA 3TA3B 4MHHG 1QSEA 1SYSA 1I9IL 4MNQE 3OKLA 1JZ8A 3FOLB 2BSSB 4QTHB 5C07E 4PJFA 4X7FC 4BH7A 4HK0A 3BEVB 4NWTL 4YXHL 4HGMA 3K4AA 2AXFB 4RZCB 5TPWH 3QIWA 2D7TL 4IMKC 3MLVL 2XT1B 1R5WA 2R29L 3NCYS 1ORSA 5FYKL 5FYKE 4BH8B 1RZJH 4XPGL 5GRYA 2Y1VA 1F3JA 1YYLL 3LD8C 4P5TD 3F8UB 4Y1AA 4FN0A 3B6SA 2K9UA 3OGCB 3OQ3B 3E2HC 5GSRB 4QHMB 5F97E 2X1PA 5MHSE 3UTOA 2APWA 3BKML 3DBXA 1K2DB 3BJ91 2LTQC 4PLKC 3SCMD 2X1QA 2LVEA 4PV9A 3K81A 1HHKA 1P5UA 2CGRL 1A7NH 4GAJH 3VFPB 1U8OA 5CEYB 2AV7A 4HWZB 5D9SB 2A38A 4NOFA 4P2OB 3P40A 5IR1B 2DJSA 5EZJA 5HPOA 2HVJA 4X98A 1OB1B 4DCQB 3C5SA 1T6WA 3VWKC 3D3VE 3CLFH 3DWTA 1EBPA 4DKEH 3KPRD 4L9LA 2Z93B 4FFVD 2ARJB 3V8CA 3V4UL 1PEZA 4GW5A 1KJ3H 2MCPH 3VXNB 1QSFE 1MRFL 3KYAA 5DMGD 2BC4A 1EO5A 3L5XL 1YY8B 5HDOA 5HJ3A 5BZWA 4I48A 1FL6B 1YYML 2AQ2A 3RTQB 2MQ3A 4K3JH 3EOAA 4RWYL 4U1GC 4HT1L 3TNNB 3IF1A 1T03L 4Z78A 4NN7B 2DQEL 1RVFH 4TPRL 4CADB 1AGFA 3L9RB 1NCBH 2YKLL 3B9KA 4KAQH 5A16B 3FFDB 1G9MH 4N0CC 4NQCD 4Y16D 5F9JA 5EOTA 5L8JB 4JFDB 1XGQA 5EWIL 3QEQD 3S37H 5D7LA 5F93C 3V95A 1ZVSA 4WO4D 4EZMA 4PJGA 3SKJL 4WTZA 3DVGA 3ZHKA 4L8SA 4LCCC 4PJAA 1YEGL 5I1IL 2P44B 3L7EA 3DMMA 4UU9A 5KVEL 1A9BB 1B0RB 1CE1H 1RMFH 5KVDH 3T77A 1BGXL 1A21A 5K9JH 5H37H 2VISA 4QRPD 1T3FB 2ERJB 3VFMA 4LLUA 3HPJB 3SDCD 2FO1A 4JPIB 5IGXH 1I3VA 5SWZB 2IFFH 3GSQB 4LHUB 2IADA 2PYED 3UTPE 1RUQL 3VXMD 4OM1H 2XACC 3K1DA 4N5EC 1I8KA 1A7RH 3QIBD 3DYPA 4ZPVB 1AIFB 2WWMC 1KB9J 3L3IB 2X4NB 3BHBB 3IFPB 5GRXG 3S35H 1M7DB 2IQ9H 1G7IB 1T1ZA 2IJ0C 5EOCJ 1LP9F 4UV7L 4M1GH 4OD3H 4PRAB 1GCFA 2LABA 3PGCB 1RZ8B 1RQ5A 4WUUE 1TZHB 4OUOA 1LMKA 3H3PL 4FFYL 5GSVB 3HR5B 2GY7B 3SO3B 4EDXB 2K7QA 4XMPL 4P5MA 1NGQL 1EDQA 1M6OB 1XR8A 2NY6C 5E0QA 3Q6FB 5BRZB 1TJHH 1UJ3A 1C5DB 2PTVA 4HZAA 4RFOH 3GJFA 5DJXA 3ZKXB 2AAVA 4DVRH 3D39A 4BSWA 3MLUH 1KCRL 4P46B 3QXAA 3C87A 3ECBB 2IPTL 2YOCA 1DBMH 2E6QA 3G5ZA 1JPTH 4DGVH 4R4FL 1QEWB 2P5WB 4UT6H 1KJ2L 2DQHL 3ES6B 2CLVB 4U1NB 1HHHA 3PV7A 2PCPA 2GSGB 4DN4L 3KPOA 3J7HA 5I8KH 2Q8BL 4LLDB 5SWSD 4YHYB 4KK6C 1XIWD 5HHMB 4PRNB 4X6CE 3BGMB 4RQQA 1VACA 3MV9A 3A6CL 2NZ9C 4LFHD 4V2BA 3QDJE 1NQBA 3B9EA 1OF2A 2G75B 2NR6D 4JHBA 3TA3D 5CD5D 4PJFE 2EXYC 5FYJU 1HWHB 1YEFH 2MHAA 3JV6A 2EKJA 4O2FA 1LHZA 1G7JA 2ADGB 4TRPL 1CD9B 4E41A 5A3IC 1RZIB 4XP6L 1MCWW 4XP4L 1HNFA 3V5DB 3U36A 4OLWH 4P59H 1IQDA 1DBBH 4NZJA 4HH9A 2WUCL 4NNPH 4WY7H 4AEIL 5IT2L 4AMKH 4ENED 3MA9H 4Y1AE 1FVDA 2BSTB 3CZFA 4X6BA 3T1WA 5I16A 3UJTH 3RY4A 1INDL 4APQC 1R3KA 1RAMA 4UIKH 3QIWC 5IEKA 4GFTB 1NH6A 3CFKB 3VRJB 3PL6A 1J1PL 5DMJB 3O9WB 5MENE 3MLSH 4WW2A 1TVBA 3UTZB 5F7EH 1AGCB 1ZHNA 3K3QA 2F8VA 1I85C 1Q94A 2X4RB 4UAOC 3PNWB 1WZ1H 4XP1H 1WT5A 4YC2B 5DJCB 4OCXL 5DJAA 2IPUK 1Q1JL 2R0KL 1ERNA 4QWWD 1IZJA 2ICWI 5F9WC 2WQ8A 4NRYB 4R4ND 5FB8A 5HTSA 2XTJB 1NGZA 4U6HB 1NAMA 2X9WA 32C2B 2VIRB 1D9KC 1FO0A 2F53A 2IGFH 5CSGA 1P2CB 5JOEA 1QRND 1UKTA 1B90A 1PLGH 2D9QB 5E6YA 4HIHA 1V7NL 5DHVB 2N56A 1FNLA 2HG5A 3DURB 1NANH 3MODH 2APXA 3ZE2E 1A6VL 1GC1L 4RGMB 1CCZA 2AK4E 5GGTH 3FFCA 3MRFB 5HVGB 4Y4HA 1CVSC 4P23C 4GAFB 3RGHA 2GTWB 4HXAL 4KI5F 1MFEL 5F7UA 4C83B 4PGZA 3V79C 3PGFL 4ZUVB 2BOCA 5AG8A 3U4BH 1SEBB 3MR9A 2I9TA 5GHWL 5D7LE 5AZ2H 1Z6JT 4JFDD 2EDXA 5C8JB 3QEGL 4PJGE 3ULVL 2PO6B 3ULVE 2AV1B 4MA8L 3H9SE 4CN6A 3FONB 5HY9B 1S78C 4PJAE 4Y4KB 2D7NA 4YBHA 4XWOD 5C08B 3EFFA 1D5XA 4WTWA 3MRRB 3B3IA 4PJBA 1S5IL 4RX4D 4ZFFA 4GKSA 1RY7B 4ERSL 1JGDA 1G7HB 1JV5A 3RPIA 3G04B 1A4KB 4D9LH 3HUJE 4OTXH 5DMKB 4MXQC 4LPCA 1OTUC 4YZFF 2XYCA 4GBXA 4PJCA 3QUYA 2ZCHH 4CNIB 5IEHA 2HT4D 1YA5A 4H25B 4ZOAA 3OHXB 1DBJH 3SO5A 3D0LA 4LHUD 4MXVF 4GKZB 3HC4L 4P2RE 4RDQG 4RDQF 4NRXB 4G42B 2J5LB 3O2VH 5FCSH 5C09A 2ITCB 4ORGB 1FNEB 5GGSB 5ICYB 1U8JA 4P4RA 3IU3B 5IBLC 3S96A 1UB6B 4TTGA 4P3CH 3MRIB 5DC0A 3QUKA 2VRAA 2W91A 2DWDA 1AHWB 4K94L 2APBA 2OMBA 1AGEA 1NCWH 1P6AB 3HG1A 4H0HB 4PGJA 1ND0A 5HPMB 1S3KH 2DLGA 3OKEA 3BH9B 3VXUE 1MCHA 4MDIB 1U58B 3G6JB 2G5RA 4U6XB 1Q9OB 2ZWLT 4AIOA 1A4JA 4JY6B 4X4MA 2CDGA 4N1HB 4TSAH 4XX1G 3ZHLA 5DRXA 3NTCH 1NANI 5C71A 1CFVL 4CMHB 4RFNC 4DGIL 2J8OA 4RWHA 5J1SC 3KYKL 3MJ7A 4OZHA 4P46D 1IM3B 4IJ3B 4NZRH 3CLEL 1RZGA 5DLML 2P5WD 5BV7H 2CIIA 3QBTB 5JHDE 1EMTL 4PJ5A 2BNQE 3EJZD 4HS3A 3CDCA 1NDMA 2VDRL 3BZDA 3M8OH 4ZUSB 5LGJA 4WCYL 2XQBL 4WGVB 2HLAB 1UM6H 1CDBA 4XZUB 5HHMD 5IVXB 2GITA 3CSBA 2CMRL 3OJDA 3ILPA 3FZUD 5EPMB 1IGIH 2YMXH 3V0VB 3REVB 3FJTA 5E6IB 1XFPA 2VLKB 3F7PC 4HKZA 4MLSA 5FOBB 1YEKL 4MCYA 1MFNA 4XI5C 1YQVH 2X40A 5ALBH 1I7UA 4QXTA 5J9PB 4PLOB 4LHUG 5KG9B 5C0CD 5D2LB 3RGVB 2R56H 4JG0L 3ARDC 3KPSA 1UFUA 2FZ3B 5F3HA 4XTRD 5CEZL 3FT3A 5MEOB 5CD3B 4NDMA 3B2VH 2Z8VC 2VITB 1BECA 1NBZA 1BVKB 5E8DL 1X44A 3BGAA 3S4SB 4G7YH 1XCTA 5DRNA 3E1F1 3VG0L 1CGUA 3E6FA 1S9VB 2WV3A 4YGVB 5DTFA 4YHKL 3MRJA 2D7PA 5CUSL 1CFSB 2FEDD 1ZT7A 3RZCD 5FO8B 3FHQA 3HNSL 4GAGL 5CEZD 1UYWH 5GGRB 3OPZL 4E42A 3FB7B 1W2KT 4HJ0D 4U1SB 5CZVH 3NVQA 4Q6IB 4JFHE 5GS2D 3QCTL 4PJ7B 4DEPB 5HDLA 1QFWH 5C7XH 2DBJA 1S7UA 2F53E 2XG5A 3SGEH 3ZMRA 2BHZA 3HE7C 4WW2C 4O58L 3VFNA 2J4WH 1ORQB 3BW9A 1ZKAA 3AU1A 4I5BA 1QVOA 4RISH 3RDTB 1RFDH 5EBLA 1YDPA 1WT5C 5EZIL 3L3JA 5C6TL 3MRNA 3PE9A 2CR6A 5IHLB 3ARYA 1WZKA 1G9EA 1I1FA 3FFCE 3QI9D 5F9OL 4X8JB 4U0RB 1FDLL 4NQVA 3TCLA 2YPKB 1GHFL 1D6EA 3CUPB 4XBPB 2BXYA 5C0BA 3S3PA 3CSYB 5GRJL 4LKCB 1LQSR 1YEDB 2GFBB 3O45A 1KPUB 4JFFE 4IS6A 1HZHH 2AXGA 4QRQA 1F4WL 3CDGA 5GQBA 5J12C 4TNWK 1UEYA 4UT7L 1X5XA 1VGKB 4GRWH 3HE6B 2DTMH 1KCUL 3EYVB 4NOBA 4LSVH 3C9NA 4OSUL 4Y4HC 3TM6A 4F9LA 1JUFB 3MJ9L 5FHAL 2R69H 4ODHL 5C08D 4HMEA 3I75A 5J11B 3EW3B 3VFOB 2QV2A 2XZQH 4YWGH 5DJ2B 4FTVB 5CLWA 4YDVA 2XWJA 1MCJA 5JQ6L 4GS7B 1E27B 5FA4B 1XH3B 2Y6SD 3IU4H 3U7YL 3WO4B 1L7IL 2PW2B 2R1YB 2HP4A 1DLHA 5DD1L 3AREC 2O5XL 3RBSA 4LVHC 5EZLB 4PP2A 2CLRB 3MLTA 5ADPH 1ZVHA 1X5JA 2E7BA 2VL5B 2DQCH 2DWEA 2JCCA 3WJLC 4HDIB 4KPHL 2XN9B 5HDQH 1YNTB 2FBOJ 4MD4A 5JUEH 1HWGB 4WWKA 1HQRA 3P11H 4GBXC 3ZKNC 4MQ7A 4N0YH 4ZSOA 4LSSH 3HZYA 5JOPE 1MIEL 2UVEA 2AJZB 4X6DB 2DJ4A 3ZLQC 2VDQL 1AD0B 5BO1H 5CWSA 3W9DB 1LWRA 2JK5A 1NDGB 1UWXK 3DX8A 3WIHA 3SE3C 4O00A 1EAPA 4OCMC 3DGGA 2XZAL 1AQKH 3RY6C 2FR4B 2MPAH 4KK5C 1WVZA 3ARFB 4G9FB 1RHFA 1OARL 1MPAH 1OGAA 4OZFG 2H2SD 1HHJA 3SGEI 1MJ8H 1F3RB 1MCEA 3QDGA 3H3KA 4LK4A 4DWHA 4X4ME 1NC4D 1A22B 3VFGL 1RK0A 1MEXH 1OCWL 2YXMA 15C8H 5DHXB 4YO0B 4OCSH 4QXGH 3UP1A 3N1PC 3BT2H 5DYOB 1R5IB 1NBYA 1J05A 1QR1B 2Q7YA 4GAYB 3IS0X 4OZHE 3LCYA 5CZXC 2GK0B 1XGYH 4QRRB 2DYPD 3NPSC 4IEFB 2FJGB 5LWYH 2EKSA 4PGBB 3SN6N 5J1TC 2UWEF 2UZIH 3WHXB 2C3GA 2Z8WC 2BVQB 3WNPA 5KSAA 3NZ8A 4JZOA 2FIKA 3VG9C 4N1EA 2OR9H 4ELKA 4GW4A 2VZTA 1FN4B 3GMRA 4J3WA 4YE4L 4NUJA 2V9RA 3TNMB 2EDDA 4WVRA 3RWIA 3W11C 3SKOB 3OKNA 2IH3A 1MWAL 4P57B 5T5FL 3CFIC 4WJ5A 1BJ1H 3Q2CA 3S3SA 1X5IA 1BQUA 3SDDB 5E6ID 5ALCL 1SM3H 4U1KB 4MSWB 1J1XH 2WNGA 3V4PL 2J88L 3VFUB 4XPTL 1CGWA 4KJQC 4YHPA 3GKWH 1IT9H 5L0QC 1L7TL 1X3DA 5EFIB 2AEQH 5IROC 2ESVD 4JM4H 3QH3B 5GRUH 3NCEB 4DUXA 3HB3C 3IJYA 4Q9BA 4I2XA 1I9RH 4PD4J 1TQCC 1YMMB 4G8EB 2OTWB 3W2DH 4AZ8A 3EOYG 3MACL 3DLQR 1KSRA 1U8QB 3H0TA 4NBYB 4XNYL 2GCYB 3MRPA 1RI8A 4MMXC 1OP3H 4LEXH 1YUHB 4FZ8L 1KN4L 4J3OC 3SPVA 4BZYA 3CVHB 1MRCH 5EU3A 4PRDA 1WQVT 1FNSL 4CMMB 3BN9C 1AGDB 2PXYC 3EYQD 4PREB 4GW1A 4HS8L 1D5IH 2AEPL 4FS0A 4QF1B 3VWJA 4PG2C 2A9MH 4XBEH 1CI5A 4S2SB 3PXJA 4K3GA 3FT4B 4XC3L 1J8HB 4JFEE 2BSRA 3TIDB 3BUYA 1S9XA 2VDOL 2E7CA 4GMTL 1EHAA 3RDTD 4DUVA 5D7JA 3WN5C 1AXIB 4L8DB 1SY6A 3OKDA 3MC0A 3MREB 3LDBB 1P4BL 3LN4A 2D0FA 3P0GB 3TWCL 4BQ6A 4UT9H 2ICWB 1T04B 3GGWB 3WDHA 3QPQC 4YK4B 2ZKHH 3VFTB 2FDBP 4U6VH 1ZHBA 2FX8L 3S36X 3ARGB 3D9AH 2CKNA 1QOKA 1PAMA 1U91B 2AS5M 1R24A 3GMLA 4KKCC 1HEZB 4UINL 2VKWA 1FGNL 5HDBE 4PRBA 3RVTD 1ZLVK 3MQIA 1YC8A 1T1XB 3HE6D 3KNBB 4Z7VA 4PBWD 5C0ND 3LKOB 4ZFOL 3OAYK 4LVNC 4UUJA 3CFEB 4PRHE 4XNMA 5B4MD 5E2JA 1Q0XL 4K8RD 5D2NB 1O0VA 1CLZH 2R4RH 2C5DC 2VSDA 5L88L 2CUIA 5MP6H 4FTVD 2Q7NA 4JO2L 4Z7UA 2P47B 3W9EB 1KTLB 4Z7OE 2COQA 4PRPE 1G7PA 4LDEB 2OI9C 1XGPB 1FGVL 2KQNA 2J6EL 4WFED 1SBBA 4L4JA 4KZEL 4KZDH 3LIZH 1J0YA 1T5WA 5E5MB 3O6KH 1BQSA 2BNUA 5D8JH 5HHPA 2Z92B 2O61B 4X4XA 3KPRA 3IFOB 5DMIL 3U1SL 2NY1D 4ZSOE 3V2AR 4HJJL 4OLYL 4C55A 3SGDH 5K33A 4PJHF 3GSVB 3C8HA 2WZPD 2Z4QB 3FB5B 1UGNA 2BRQA 2YK1L 5T3ZD 4AQOA 5CEXA 1CFQA 3RPKA 2J8UA 4LLQA 4RNRA 4M5ZH 2BHUA 5GJSL 4NHUA 3ARFD 3VU2A 1A7QH 1HKLL 2DKMA 5B3JE 4LP4A 4XT1C 3LRSA 2JJVA 3OKKA 2BVPA 1S5HB 3V6ZB 4R7NB 1V8HA 2NX5B 3N50A 4Y16A 4WV1A 1QBML 2D7MA 1X5KA 4JCMA 5DEFA 1OPGH 4PRIB 4TNVK 3QEQA 4ZXBB 4WO4A 1CLOH 1MY7A 2NQCA 5J06A 1KFAH 1EH9A 1NFDB 3DX7A 1FNGA 1ONQB 3HMXH 4HLJA 3IDIB 4QRRD 4FQCL 4J3TA 1U42A 3GIVB 1FFNA 1U93A 2F5BH 3AROA 1I7RA 1I3RA 1I7ZA 3V6OC 1MRDL 2W07A 4HC1A 4ODBD 1AC0A 2E9JA 4P99A 3GSXA 3MUZ1 5FHBH 5HHVH 3T1FB 1IGCL 1DJSA 4QRPA 4JFZH 2CJUH 5FO9B 4EN3B 4UV4L 3SDCA 4HKXB 1HNGA 3TBYA 3GSWB 3SDYH 1GZPB 5E56A 4XCYB 3HAEH 2PYEA 2OTPA 2VL4A 2OJZH 3VXMA 4G5ZL 5DRZB 3BISA 4NP4L 1ZT4B 1ADQA 4X5WB 3QIBA 4IDJL 2AJXH 3NN8B 5EO9A 1PZ5B 1IBGL 4OKVA 3DYOA 4R8WH 4GKNA 5BVPH 1DZBA 5ID0B 4NHCH 2BFVL 1QFPA 4LCWB 3BZFB 4LLVA 5AUMA 4NM4L 4F57L 5I19L 2HTKD 1P5VA 3AS1A 1CD1A 1CDUA 3H7BB 4XWGL 4QOKE 3V0WH 4LCIH 4M7JH 2OBGA 2UUDK 4NZTL 2V7HB 1C12A 3BESR 3FOMA 2R1WB 3L3KB 5EZOL 3MRDB 1YMMD 1JGEA 4KKBD 4U1HA 4NJ9H 4CVXA 5DEZA 4OD1L 1QLEL 1MUJB 3FQNA 3SGDI 2WBKA 1GSMA 4HUWA 1K4CB 2NXZC 4PJ9A 2VDPL 4FNLL 2FWOA 1OAXL 3LSOA 3HLAA 3QO0B 3V52H 3H9HB 3LQZB 3U30C 2UYLA 3QXTA 1TPXB 1YNKH 5ANMA 1PX3A 4YHOL 1LEKB 4O2CA 4XXDB 1ODAA 2BK8A 1RUPL 1CTNA 1VADB 1QNZH 3I50H 1GGUA 3B9VA 2DMKA 1CQYA 5ISZB 4RA3A 3GUTB 1CDYA 1HINH 3CDYA 1VFAA 1ZLSL 5I1HL 1T7WA 1N5YH 4RGOH 1ZGLB 3F7QA 3NIFF 2D2OA 1VCAA 5SWSA 1PJ9A 2DQGH 4Q74A 1KULA 4JPKH 1KB5L 3EYOA 2AQ1A 3TFKC 2VN4A 1OHQA 3RY5A 4NSKA 3V5KB 2I60L 2V7NB 3UTTB 5D5MA 3QFJD 1F6AB 2PTTB 3U9UA 1XMWA 3TA3A 4RBPH 1N7ML 5DZOA 5DD5L 5D7JC 4HF5L 2BSSA 3OR7B 2B5IB 4QTHA 1JTOA 2EH8L 2RFXB 3BEVA 2A1WH 4P2QE 2AXFA 3G5YA 1R3LB 5KTEL 3OB0K 1JIBA 1J0HA 4LVOB 5I71B 1NPUA 4Q97A 2R0ZH 3AUVA 3BQUD 4ZQKB 2IBZX 2AK1L 3R06B 3WYRA 3QUML 3MNVB 3L95A 1JCKA 4MD5A 5GSRA 4Z7UE 3HZVA 2BVOB 3MCLL 4H88H 3BPNB 4NQED 4J3UA 2OL3B 4UTBH 1FQ9C 2HJKB 4U31A 3NZHL 1BFSA 2Y06L 4BQ9A 1CN4A 5CEYA 1BZ9B 5IR1A 3EYSH 4P2CG 5IBTH 4ZODA 4P5TC 2NY5H 3TZVB 3U0WH 5E7BA 1MAMH 1OB1A 5H37G 3GRWA 2I26N 4W81A 1BP3B 2XICA 3SCMC 5DQDH 4Z8FL 2DMBA 5JIPA 4CVUA 1EJOL 5JW4R 3ARBD 3VXNA 3NABH 3X3GH 1JZ6A 3LRHA 3BFOA 1BD2D 4NQXA 4BQBA 1EHLL 1EUTA 1F58H 3CMOL 4WWID 1PSKL 2EDWA 1JN6B 3IRZA 4FQQB 2G9HB 1VERA 2CRMA 1RIUH 3QUXB 4X7SH 4CADA 3KGRA 5DURB 3CJJA 2VZ3A 3FFDA 4WI6A 4JFDA 3DSFH 3FMGH 4UDTB 4OLXH 4OCWL 3THML 5GRZA 3O41B 1TETL 4HWBA 1K85A 1UXSB 3BSZL 2XWBB 4HJGB 5ENWB 3GSNH 3PWPD 3OZ9H 1N4XL 2EZ0D 2LU7A 4XMKL 1B0RA 5E8OB 5CKGA 2VZUA 4XHJD 5DGQA 1W0VA 2VLRB 3REWB 1Q9WB 4OZGB 2VQTA 5DRWB 5E2TH 4KGJA 1FL3B 3HPJA 4K3DH 3S88L 3GBNL 5SWZA 4RAVA 2NY0C 3GSQA 4LHUA 2VLJD 3C60B 2R4SL 1ADQL 3ULUF 3TGXA 5JDSB 5D7IA 1EZVY 5KZCD 1G7MA 1B0GB 3VXSD 3QIUD 4JKPL 4R96B 4ZPVA 1AIFA 3CX5J 2X05A 1NAKH 2FHFA 2IAMB 3L3IA 1O7SA 4FQ1H 2X4NA 3IFPA 5FYJE 3SDCC 4PJ8D 5BW7C 4KTDL 4X5XB 4JCLA 4WHYH 2QL1A 5IHZB 2ZNXA 3WNLA 1RUKH 4BFBD 2EH7H 4PRAA 1CFNB 1I3GL 3PGCA 5D96B 1I9EA 3DV6A 3QIBC 1TZHA 3RWEB 4M6MH 1DN2A 1FAKT 2OQJB 3VI4E 2MQ0A 4HK3J 4EDXA 4ACPA 5HVWA 1FG2A 2DM4A 1N0XH 1M6OA 5BRZA 3Q6FA 1DQQB 2A6KB 4XC1L 3V8OA 2DS4A 3GJFH 1S7RB 5DA0B 1Y6KR 5CINL 5F1OB 4KROB 4P46A 5DD3L 4PJDB 1A14L 1J5OH 3ECBA 1OGTB 5I1GL 3O8XB 5C0JB 4F3FB 3RAJL 3IDXL 5IHUL 1QEWA 2P5WA 4MNGB 3MYJB 3ES6A 5ISZD 2CLVA 1T20B 3NCCB 2BERA 3Q5YA 3MV8B 1FH5H 4RCAA 1YEEH 4LLDA 1CXEA 5GZOD 5IQ9B 1UZ6F 3CGTA 2GTZB 4KJWD 2C26A 1JPSH 1X5AA 3EJYD 1AO7D 1JL8A 1NGXB 3STZB 2BVYA 4HLZH 3SDXF 3MLWH 3SY0B 2IBBA 1FJ1B 1A6AB 1QYGL 3MMEB 1T2QH 8FABB 5L6YH 4FQIH 2PKDA 3HFML 2V17L 4KI5D 4X9FA 5I75C 1G6RA 5LGKA 1F6FB 3ZDXF 1RIHL 3BZEB 4NJAL 2ADGA 2Y36L 1XIWC 3CPLB 3U83A 2CQVA 4H26B 4JHWL 3O3DA 2RQ8A 3GSOB 5C6PB 1JZ4A 1BJMA 2ZOLB 2NR6C 1FVEB 3RKPA 4GLRH 2NY3B 4NQTA 4U49A 1FE8L 5TDNB 2BSTA 2FJFB 3C5JB 2VR5A 3KPNB 1S9YB 1U3HD 2X4OA 4LRIA 1DCLA 2FGWL 4M1CD 1I1RA 1KXVC 4JFPB 1IKFL 1DBAH 2V5TA 4HUXB 1AGCA 3PWLB 2X4RA 3PHSA 5JR1H 1N0LA 3PNWA 3AGVA 1JGVL 1HXMA 4YX2H 5DJCA 4GJTB 1OTSD 3WSQH 1ZEAH 1WFUA 1EPFA 4MZ2A 2VABB 2F54D 4X0KB 4H20H 4D9QD 4Z7WB 3AS3A 2VIRA 5CJ8A 1EGJA 1FO0H 1TLKA 1FLRH 3IAQA 3B5TA 1A6WL 4ZUUB 3DURA 4S1QH 3T2NL 1JPST 35C8H 1H5BC 4LQFH 4AENA 1OW0C 3F12B 2E8ZA 5T5NF 2ZG2A 5L2KD 5KVFL 3MRFA 2UY7A 1XGTB 3WNMA 2HRPL 1UACH 2GTWA 3R1GL 4JVPA 4C83A 5CJBA 3ZE1F 5DURD 1WZMA 3T0EB 1AD9B 2AJYH 4JFDE 4ZUVA 3FQXB 3OAUL 4XB7A 4JR9H 4PJIB 1YN7B 1MREH 5T1KB 1GYAA 5C8JA 2X09A 1NCTA 2MNUA 2PO6A 3EO0A 3LHPH 3WFZA 1MCCA 2AV1A 1HI6B 4AM0B 5HY9A 4RSVA 1YEHH 3RBGA 5IJVB 4Y4KA 5L9DH 5C08A 2BCKB 4JVUA 3MRRA 1IC1A 4HEME 4YDKL 2EDEA 5DZLA 1YMHB 4Z7QF 1G7HA 1NSNL 1P84J 1FNHA 3G04A 2KBGA 4LRNL 5DMKA 4F33A 5T33H 2AI0L 1GC1C 2DB8A 5I8CB 5HGAA 3N1QC 4OGAD 5SWZE 1G7LB 4KQ3H 4H25A 3STLB 3NCJH 3OHXA 1I4FB 3F6IA 2WAHA 1WV7T 1S7XA 4Y19B 2UY6A 1BQHG 3C60D 4GLRI 4GKZA 1JFQL 3BEWB 5T1DH 4NRXA 3Q0HA 4G42A 4OF5A 2PN5A 2QSQA 1E4XH 3LD8B 2ITCA 1HOCA 2YEZA 3EDJA 1FNEA 4ORGA 3E2HB 4NQDB 3P0YL 2IAMD 5ICYA 3O6FD 1C5CH 3ULVC 2IH1B 2LTQB 4MD0B 2BY0A 3QULB 5HHOB 4ONOA 1FYTB 3TYFA 1U8KA 25C8H 4J3SA 2JTDA 2YWZA 3TP4A 1AHWA 5GGQH 4CKVX 3W81A 3RNKA 5HPMA 3EDFA 2VLMD 3VWKB 1IGYB 2X70B 1T5XB 1Z9OA 2BSED 2VXQH 1F97A 3BH9A 5FIEA 5EU6B 4K7FB 3G6JA 1Q9OA 1UM5L 5EBMB 1NC4A 1GL4B 4EDWH 5BRZE 4JY6A 4E0RB 1UENA 5IB5B 1WIUA 1CU4L 4NKQB 1MCPH 2ZPKL 3QNZB 4BJLA 2CK0L 1IC4H 4I3SH 4ZS6D 2XKNB 4KROD 2DYPA 2Y5EA 4HG4K 1IM3A 4M7LH 4NKMB 5I1JL 4ALAL 4KDTA 2B1HH 5JDJA 4U1GB 2X4QB 5L8LB 4W4NA 1EK3A 4PJXB 4ZG1A 3JWNC 5JNYA 5AG9A 3RP1A 3MOAH 5JW3L 2YA2A 4CJ1A 4K94C 4YQXH 2J1KA 4PLJD 1ZLWH 5HHQB 1L9MA 4ZUSA 1U36A 1EXUB 4F37F 1T22A 2QHLA 5I1DA 4XZUA 1WCQA 5HYQA 3L3OA 1RD6A 2R2EA 1KIRB 4XVTH 4LCCB 4X6EB 4YAQB 2VZVA 5LKNA 1DL7L 5EPMA 3EJZC 5CS7A 5HD8D 5E6IA 1PDKA 2W38A 5FOBA 1OOAA 4R4BB 2Y07L 5BXFA 5J9PA 3FTGA 4LDOB 3ZT5A 4K23L 1HIMH 3AS2A 1DQLH 1YPZF 2BRRL 5KG9A 3QQ4B 1WSST 2V9QA 5D2LA 4FFWD 1PX4A 1FPTH 2FZ3A 4Y2DD 3T0VA 4LSQH 4G8FB 3FZUC 5CP3A 3PGDB 3PP4H 5MEQB 3VW3H 2HFEA 5CD3A 6FABH 2C9AA 4QYOA 2VITA 3O6ML 1E4XI 2P4AB 5DUPL 3S4SA 3WLBA 4GRWF 4ODWB 2DDQL 1Q9LA 1PG7L 2C1OB 4JANB 2HN7A 4TVPD 3TT1L 1N5AB 1NCDH 3MROA 4LF3A 4AEHL 1YECH 2FNBA 3MLRH 2RHEA 3QUZC 3VXTB 1FV1B 4POYA 1SJEB 3QDME 2ZUQC 4M7LT 4EOWH 3HC3L 1XF2A 4QHKI 1F90H 1MCRA 3FB7A 4U1SA 2XTJE 1OAZH 2HH0H 5D1ZC 1QQDB 5CCKH 4Q6IA 3HC0B 4PJ7A 4L4VB 2HWZH 3JVGA 3MFFA 4JJ5A 4FFZL 3QEHB 4PYGA 5SWQA 1ORQA 3RZCC 4ONGH 3RDTA 2NY6B 1S8DB 1CGSH 2X4TA 3GDBA 4MJIB 1E6OL 5EUKA 3SOBL 5C9KA 4OAWB 1EX0A 1EFXD 5A2JH 3V5HB 4HJ0C 3M45A 3HKFA 5D72L 1UJTA 1GH7A 5AZEL 3BE1L 3MJ8B 1QUNA 1ZHKB 4X8JA 2IWGA 2YPKA 1EO8L 4GG6B 3CUPA