3TCXA

Structure of engineered single domain icam-1 d1 with high-affinity al integrin i domain of native c-terminal helix conformation
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'MVSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLTVYWT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion molecule 1
publication title Structure of Engineered Single Domain ICAM-1 D1 with High-Affinity L Integrin I Domain of Native C-Terminal Helix Conformation
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 85
sequence length 85
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W, Y, a
ec nomenclature
pdb deposition date 2011-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tcxA00
4IMLA 4RFEB 4UV4H 4R2GC 2LVEA 4OGAD 5ALBH 2OSLA 2YRLA 4HS8H 4Z95L 5SX5H 2V6HA 2GTZB 1INEH 4I0PD 5TPWH 1FZMA 3QNXA 3QXWA 1EAPA 1ZOXA 4HIXH 1S7RB 4RGNC 4ZPVB 1NLDL 1LD9B 1C5CH 1RSFA 3WFZA 3FT3B 3HTLX 1ZLUH 3BDXA 4GAYB 3BGMB 4HEPG 3LKSA 4JFQA 2QQLH 2DI8A 4PJCF 4X7SL 3CCHB 3SDCB 3ZE1E 1MRDL 1OAUH 3CK0L 1WC7B 5J9PA 1JMXA 1WZMA 2YMXH 4HUKB 1GGIH 3GMPA 3VXMA 3ES6A 5EN2A 3FHQA 3FONB 2AGJH 2P8MB 4UU9B 2MQ0A 3DRTA 2FWOB 2V2TA 3EYFB 2J88H 1WEJL 1I3RA 2G60L 4OUOA 5I1AA 4O5LH 4AEHH 5EO9B 5E9DE 3PWVA 1NANH 1CE1L 5JW4Q 2I5YH 3CFCH 2ZSWB 1K9TA 1RUMH 2VXTL 1TQCC 3ARGB 4XNYH 4J2XA 2NY0B 4NQED 3BJLA 5ESAA 43C9A 1KXQE 3C6LB 5EUOF 1B90A 4LNRA 3T1FA 3C8KA 4CW1A 2GJJA 5DJZA 5IBTL 5E9DD 4KKBC 1WWBX 1XT5A 2H26B 4NN5B 5I8OH 2DJ4A 5DA0B 3GI9H 3MRCB 4PJFB 3DUHA 2QHRH 2IEPA 4ZNEE 5DQ9A 4LQFH 1X7QB 1TJGH 1MEXL 5EIVA 1OL0A 3CVHB 1AO7A 1NC2D 2AJXH 3FB5A 3MJ6A 3QUKA 4WTZG 1C08A 5F6IB 5KTEL 4NQCA 5EC2A 3KXFA 4MNGA 5C0BE 5IB1A 2X4SA 1U8LB 1ZGLP 1ZA3A 4YXKL 1UACL 2QADD 2H41A 3I9GH 4PJ5B 1MLCB 4DGIL 1QEWA 4PJBE 3LSOB 4ZUTB 2X10A 3SE3A 1UA6L 4JN1H 1JUFB 1AR2A 1J8HE 4G7YL 2XRAH 3GSVB 1S9VA 4U7MA 5TQ0L 3OKNA 4QYOB 4WFFD 1GPOL 5AEAA 2H32B 1NGZA 1LP9E 4KJYB 4EUPB 2H2SD 1EFXD 5C0BD 1K8DB 1LO4H 2GIYA 3UDWA 2XACC 2WBJB 4E41E 1T7ZA 4NRYA 3QCVL 3B6SA 4GQ9L 3S97C 5D7JB 5EULV 4HUWA 3O9WA 2A6IA 4ETQA 4WEBH 3TNNB 2AI0L 3O6LH 2Y23A 1SBBA 4OIIL 2BY0A 1J8HD 5GJSH 3QHZH 3SE3C 4JZNA 1G84A 5F7EH 3QXVA 3MJ8A 3MXVL 4OGXH 5FFLA 3ULVL 2QKIB 1P7QB 3QNYA 4MJ4A 3MACL 3EOTH 5HHPA 2R1YB 3QHFL 1MVUA 2IPKB 4XNZB 4PJDE 2VISA 3BPLC 3UDWC 2D0FA 2P5WD 3I75A 1CCZA 1KPUB 4K3EH 5F6HJ 2EYSB 1CDCA 3O9WC 2XYCA 4TQEL 1UB5B 4EN3D 3WIHL 2DQCH 4LCIL 4Z7UA 1QUNA 5FYKH 3BH8B 3MBXL 4YK4C 5BCAA 1XZ0B 4F3FB 5KSBB 4X9IA 4HIEB 2VUOA 2P44B 4MCYB 5FYKE 5EIQA 2FIRT 3IGAA 3RU8H 4FQ1L 3VGHA 2E9WA 3T4AA 4MDJA 2VZTA 3IAPA 4P48A 2AEWA 4EI5D 3VCLB 1KNOA 2D7PA 5IVXA 3N50A 4ZUUB 4HJJL 3V6FB 3EYQD 4XP6L 3ZDYF 1W0YT 1JNNH 4J12A 3BZDA 3TH3T 2DQIL 2E7LC 2X89D 4G3YL 5F1IB 2YD8A 1IGTB 3MODL 4ETYA 1SVCP 1RJLB 5F9WC 1UZ6F 4LDEB 1CQKA 1H15B 3RL1B 2CIKA 1HYRC 1ZHKA 1TVBB 5MEND 3UROR 2AEPH 2E8YA 1BQLL 2X7LA 3SKNB 2Q7NA 4JFFE 3Q6GL 4TUJA 4HIIB 4KHXH 2AJSL 4ODUA 2VITB 2QQKH 2BNRE 2IGFL 3PWUA 1G9MC 5L8JB 2R4RL 1J0ZA 4UINH 5IQ7H 4JPWH 2A6JA 3VWKA 1K6QH 4QHNA 2IF7A 4JO3L 5IW3A 3V5DB 4LSVL 5SX5K 3CH1A 4XZUB 2V2WA 1QFUL 1XGUB 4JFZH 1AKJA 1IILE 4HS6A 1V8HA 2C3XA 3MRIA 4HUNB 4E9LA 3BEWA 3JVGA 3WLBB 1GZPB 3NABL 3AU1B 4UTBH 5HI4C 3MZTA 2X4PA 1WSST 4G9FE 4TUKH 1ZLUK 2EEBA 1CFSB 1PEZA 5DJYB 5DHYA 2FIKB 2BRRL 3LS5H 1G6VK 4YXLL 1DN2A 1L7IL 1DUZB 3VDCA 3ARPA 2IANE 4PJIB 1WF5A 5A3IC 5TDOA 1G0XA 1A6UH 2FL5A 3VWKC 4TOYH 1U91A 1ZT4B 3MNWA 4W81A 5T5FH 4X6CB 1RHHB 3Q3GB 3K8MA 4HGWB 2VLJA 4GBXB 2SEBB 3T08A 5IMLB 3R06A 2BSSA 5BO1H 1W8NA 3NN8B 3RDTD 3KYMB 2ZUUA 4WWKA 4YGAB 4NOBA 1PX4A 2AEQL 3UC0L 4DZBB 3JVGC 1V05A 1J5OH 4UMGA 3OKEA 4M61A 1ED3A 1P69B 1SJEB 3SKOA 3PHQA 4ZQKA 1U8PA 3DIFB 2HRLA 4DN3H 3HAEA 3HC3L 1INDL 4K9EH 3U9UB 3ETBF 5C9JB 5AWNH 4J3XA 4LPXA 2BVQB 3QEUB 4PGBA 2PO6D 4YGVA 5EO0A 4L8SA 3VFRA 4WWKC 3BP7A 4OF6A 1HSAA 4V2BA 1CXFA 4L3EE 3R1GL 5K9JL 4AM0A 5JXAL 2FDBP 1RUKH 1CDGA 5MEPB 3V79C 4NWTH 1DBAH 1MCDA 2D2OA 3KYOB 3P40A 2NQCA 3X17A 4QY8B 5A2LH 4MJIA 3VFWB 4DKEL 2W38A 4UILL 5C0CB 4P4KA 1PFCA 8FABA 5C0AE 1VFOA 2D7TH 2X2YA 4Q2ZB 1BVZA 2HJKA 1KF9B 4I3RH 4L3ED 4L8SC 5H2BB 15C8L 3EYOA 1YYMH 3EKCA 2DL2A 1PZ5A 3SCMA 2GT9A 2LV4A 2JK5A 4NM8L 1XF5B 3I6LD 2HG5B 5GS2H 3B2VH 1QLRB 2LAGB 1JMZA 3C60D 4ODXA 4XVJH 1TTGA 4G5ZH 4R96B 5IB3A 2QSQA 1UKQA 1ERNA 3MOQA 1OGAB 2C5DC 5KVFL 5C0AD 3PXHA 3L7EA 2AV7A 3SKJH 3U7WL 2HKHL 2FB4L 4P4KC 1C16B 4PS4H 3T0WA 4OSUH 2VLRB 1QFWM 3FB6A 4TNVK 4HIXL 4WDIB 4LLMB 1U8HA 3UBXB 3OAUH 4IJ3B 3SCMC 4HK0B 5I1LA 2ADGA 4KV5E 2X1QA 3GSWB 4L8CB 5GS2D 1MH5A 4XP5H 3I6KA 4ZXBD 3ARFD 1T04B 4LCUA 2BFVH 3WE6B 3V8OA 2JCCB 4GFTB 2YPKA 1MREL 3S36X 1B6UA 5JZ7D 3KLHC 4YFLI 4QOKB 2RR3A 5CGYC 3SJVA 1PG7H 2FECL 3X3GH 4NZJA 4XPGL 4KMTL 2P49B 3D0LA 4C4KO 1FNGA 1FLRH 4UTAH 4RA3A 3QG7H 4U7SA 5E6ID 2R0KL 2EDRA 1YEHL 4BQCA 3EFFB 4KK8C 1KEMH 1N6QL 3NTCL 2BNQE 3ME0A 2IFFH 2RCSH 4HUXA 4P3WA 2GJZB 3UJIL 1J1PH 2HRPH 1I9EA 2FH8A 2VYRE 3QDMB 3GK8L 4NC1C 3UZQA 2YD3A 1KIPB 4HZLB 3IETA 5DEGA 3U82B 2VUYA 4ELMA 2X4TB 7FABL 1CICB 4GSDH 3QZWB 2IH3A 9CGTA 1IAKB 3VW3L 1MI5E 1N0LA 4FQCL 2ESVE 4LSRL 2EIZB 4Q9BA 4KI1A 4LPCA 2BNQD 4HLZH 4XGZB 4Y4KD 4LVOB 2WMPA 4XMLH 4WUUA 4U1JA 4J7RA 1MRCL 1GOGA 1P4LB 2WANA 3IDXL 4ZPTB 1HHIA 3Q0HA 2JB5L 3GMRB 4JFOB 1FV1B 1TJGL 4AENB 3S9DB 2YC1A 2FGZA 3Q5YA 4OLVH 3O4LE 5GHWL 4RFEA 2OR7A 5DJ2B 1KELH 3TWCH 4K71B 4Z9KB 2OM5A 3PGDA 2BSED 2NW2B 2DQJH 2GTZA 1CT8B 2YD2A 5J1AA 1MI5D 2ESVD 4L4TB 4MQXD 2WIIB 2G5RA 3I9GL 1QFWL 2HLFD 1EJ6A 2GHWB 1YQVH 2W0PA 1K4CB 4ZFOB 1PKQB 1LD9A 3HRPA 5JR1H 1KCRL 3KPRB 3F7YA 3PHSA 3W81A 4GW4A 3FT3A 1MCPH 3FOMA 2I9LB 5AYUL 3BGMA 3KYKH 1RVFH 3FN0H 2X44D 3EYVA 3C8HA 1YEDB 5DMGD 3TT3L 3CCHA 3SDCA 3LKNA 2CUHA 1ZXQA 1WC7A 4M1CD 1I7TA 3BKCH 4P59H 4I77H 2NX5A 2DQDH 3L6FB 1N7MH 3S6CA 4PB9H 3UO1H 1BFVH 2P8MA 2Y1VA 3MJ9A 3P4NB 2R29H 4XAWL 5M95B 4WNQA 3QHZL 3UPAA 3U0WH 4MAUL 5ICYA 2K7PA 1SM3L 4E42B 5EZOL 2DLFL 1KENH 3F6LA 2J12B 2ZSWA 1TCRB 2X9WA 5T1DH 4LKXB 4UNUA 3JV5A 5DZOA 1YYLH 3MO1B 5JDSB 3KPNA 3SDCC 3TBVB 3TBSA 3DXAD 4UBDD 2NZ9C 2HT2C 3FKUS 1MCHA 1X9QA 4I0PB 2X40A 1NSNH 4UQ3B 3WIIL 4F7TB 2HLAA 2BVYA 1A6ZB 5GQBA 3EDKA 2H26A 4RSVA 5FUOH 5GRXG 1F4WH 3CLFH 1H5BB 1GAFH 3QEGH 4LCYB 2AXJA 4L4VE 1KB9K 3NCBB 4C56D 1FVCB 1X7QA 3OPZL 2NY0C 5KSUB 4CN4A 1WIOA 1DE4A 4A6YB 1I9JH 4Y89A 1CGWA 4JRXE 4FG6C 3L1OL 5DD5L 3UYPA 2UZIH 4J4PD 2YBRA 3QA3B 3LPFA 4RMRA 5TQ2L 1BBJA 4PJ5A 3ZDYE 1NBQA 5I1CL 3LEYH 1IGJB 2VDPL 3LPWA 1JUFA 2IC2A 4GRWH 1QR1B 2APVA 4S1DD 4L4VD 4QYOA 2XZQH 1TETL 2C3WA 2ZUXA 2AXFB 4XP9H 4LFHD 5CKGA 1F6AA 2I9TB 4AQOA 1LK2B 4GRWE 1MJ7H 5C0NC 5HDLA 2H6PA 4KJYA 4EUPA 1KYOK 3QJFB 2DQFB 5IB5B 1EEUA 2R4SL 1K8DA 5J13B 2P8PB 3THMH 4RQQB 3L3HB 5LJYH 2HKFL 1EGJA 1HQRB 3WLWD 1LO5B 5D7JA 5B4MD 2BOCA 2AP2A 1AE6L 5I0DA 2EO1A 4MYWB 2QSTA 4M7JL 2D7OA 2KQMA 4YJZL 3ZTNL 5E9DB 5E00A 3ZHKA 3TN0D 4I4WB 2NR6D 4NO5B 1P7QA 3RZCA 4NZRL 3RP1A 4AG4L 2PUQT 2R1YA 2IPKA 5C6WH 4Q0XL 3LS5L 5ANME 3G5VB 3JSSA 3ZE0E 3VMPA 1FBIH 1QZ1A 1KPUA 4LBEB 2VDLL 2XNAB 5D7JC 4IS6B 1RZ7H 3I84A 4QRPE 1RV6X 5FA3B 1YMHA 3T3PE 3TBTB 3MA7A 2BSRB 3BH8A 4OM0L 4RAVB 4HPYL 4WGWB 1XZ0A 5KSBA 4U6HA 3DX8B 1LO2L 3B83A 1LDPH 3HG1E 4HIEA 1IGCH 1CIDA 4XNXH 2X4OB 3RZCC 4MA1B 2Q7YB 2H1PH 1I8IA 1U8JB 1CR9H 5A40E 2DI7A 5ELIA 1JGEA 5JMRA 4GAJL 1EFXB 2VSCA 3VCLA 5C0BB 3WUWG 1UB6A 1BPVA 2W65B 3DJ9A 3V6FA 4DN3L 1T1YB 3TYGH 5FCUH 4MQTB 4MJ5A 4QRPD 5L0QB 2P7TB 4PJBB 2XTJE 1BQUA 1IGTA 3BKYH 1WBXB 4BZYA 4JFDE 4YWGL 4ONOA 3RL1A 1J8HB 1A4JB 2EDDA 3AS3A 4XWGL 5GGUA 1KOAA 2M2DA 3HG1D 1HE7A 5DC4B 1FG2A 4PP2B 3SKNA 4XCYB 1LP9B 4HK3N 1NJ9A 4HIIA 1DVFB 4J1UA 4Y4HD 1JYWA 1V3KA 5KVGH 1WAAE 1HXMA 4MXVE 5K9KA 1CU4L 2AEIT 4E41B 3NFSH 5BS0E 3JWOH 3ZE2F 3W2DL 4P3CL 1M7DA 1ZS8A 2XTJD 3LDBC 3UJJH 1RK0B 4JFDD 5E4IA 1NAKH 1S3KH 4A2LA 4EN3B 5D93C 1XGUA 3BUYB 4YFLF 3GFUA 2Q8AH 1YEIH 4F58H 3O6KH 2KBGA 1REIA 2UZXB 1CL7H 1GZPA 4GUPB 5GGTH 2VDML 4PJDB 4FXGB 4HFUH 1BZ7B 4R97B 5DJYA 5BS0D 3VXQA 2FIKA 5IR1B 1T0MB 4NJAL 4EI5B 4CVXA 1AP2B 3TYFA 4YHKH 1DUZA 3O3BB 5DHVH 5C8JA 5I75B 4OLUL 2A9NH 1VADB 1O7SA 1ZT4A 4X6CA 3O2WL 3Q3GA 5EDXA 4GBXA 5IMLA 5JXEA 5FM5O 3RVVD 3LH2H 3NN8A 3KYMA 3JTTB 2DM4A 5DD3H 4ZNCD 1T5XB 4G42B 1DL7L 5MENB 1YEFH 4UDUA 3F7VB 3S34H 2EEDA 4UQ2A 3HI1B 4DZBA 4RIRB 3ROOA 5T1KA 5H35B 4NO0D 2R69L 4KTEH 2X42A 4JFED 1NC4A 5EBLB 5K33A 5TE7L 5K9OB 4P5MB 2JJWA 1I1CA 1TQBB 1QSVA 4F7MB 3U9UA 1UM6H 3SE9H 4W6XB 5C9JA 5DK0B 5JTWA 1B9ZA 1M05B 2BVQA 4GBXC 3QEUA 1J0JA 3X3GL 5JXEC 3MV8E 1A6VH 3P2TA 4CNIA 1CDBA 4HWEH 2V5RA 4YR6A 1OP3H 1CG9A 1FNEB 1S9WA 4UNVA 3LQAL 4W6WB 2R9HD 2BNRB 4AQ1B 5MEPA 2ZKHH 2RCSL 3PGCB 4LCWA 2FGWH 4OV5A 3KYOA 3VFMB 2I07A 5DEFA 3VFWA 4XVUC 1RZJC 3S3PA 5C0CA 4P9HL 1R5VB 1KCLA 1SY6H 3MV8D 5C3TA 1DBBL 2J8UE 5L2JB 5LCVH 2CO6B 1P4IL 3KPSA 5KS9F 4NZTH 3PP4L 3T0BA 1IC4L 4KAQH 4OF0A 2CIIB 1XF5A 3L5WB 5CWSB 4GG8A 4MZ2A 3QIBB 2B1AL 3RWCB 4M00A 3QWRD 2IANB 4R96A 4MA3B 2CDFB 4MHHI 1OGAA 3V0WH 4K94C 4JB9H 1E4KA 3MOBH 1J0YA 3MLVH 1MCQA 1S7SB 4PJAB 3A6BL 3OV6A 1KB5A 1MCLA 2VH5H 1BEYL 5DVMA 4EZMA 2PO6B 1U8NA 2HH0H 2V9RA 3HLAB 5JOPD 3OXRB 4HZAA 5D7IA 1CXLA 1JGLH 4EDWH 1IMHC 1G7IB 4NFBA 1HI6B 1T89A 5FKPB 5I71B 5LBSL 4A2MA 3FL7A 1MCCA 4HK0A 5F3BA 2P5EA 4P23D 4L8CA 3BQUA 1DBMH 3FN0L 2F54E 3QFJA 3DRQB 5E1HB 1T04A 1A0QH 5EUKB 1EK3A 1IAII 1E4KC 2AABH 5EU5B 4I77L 1QO3B 4J3TA 1RU9L 4QOKA 5IGXH 1A5FH 4CRPA 5ADOH 5HVWA 2R2EA 4P2YA 4L3EB 4HW6A 5CZXC 3MCG1 2NNAB 1T89C 4NRZB 1KENL 2F54D 4YHLH 4AY0A 2WK2A 4OJFL 4DTGH 5INDB 5EU7E 2DKMA 3BQUC 3U4EB 4WV1B 2GJZA 3C60B 2E3VA 3QEQA 2ZP0T 2VE6B 4J8RB 2F19H 1YEJL 1N0XL 1N64L 1YYLL 3T0XA 3K1DA 2VXVH 4U49A 1Q0YL 3QDMA 1XF1A 3RA7H 5C0AB 1JZ6A 4OCRL 5HYSB 1KIPA 4UT7L 2VLKE 4CL7A 4KZEH 1MAMH 2XQYG 4XP4H 1G1CA 3FN9A 2X4TA 2NY3C 5K9QG 1CICA 1PEWA 5DRZA 3BYTA 3QZWA 3NCYP 2CGRH 2ICWB 1CFNB 2DLHA 1NCAL 1X5YA 2D9CA 1G9NC 5D5ME 3FB8B 5FUOL 2ADJA 3PWPA 4OLWH 1WBYA 3QUYA 1FL3A 3H9SE 3OGOE 5BRZE 1T66C 5JOEA 3N06B 4ZPTA 4FNLL 3GMRA 4PJGE 4LNVA 4JFOA 1IAOB 2FJFB 4YZFF 1TXKA 3T4YA 3MNZB 1YA5A 3BKJL 4AENA 1Q94B 4HKZB 3AMKA 4ZXBB 3ARFB 1ETZB 1D6VH 4TSCH 1YEEL 3CU1A 5I74B 4KJPD 4OZGE 1JPSL 2BHZA 4OZHF 4Q6IB 3IU4H 1DR9A 3BSZH 4L4TA 5D1XD 2WIIA 1CICC 2EDFA 4NUJA 2Y06H 3MR9B 3ECBA 4ZFOA 1CD1B 4XPHL 3RWHB 1QR4A 1ZHLB 2WQ8A 1B2WL 1Q8MA 3LN4B 3H9SD 5E6IB 1E0OB 5BRZD 4PY8I 4LVOC 1H3UA 3QUYC 4TVSa 1X6LA 2I9LA 1I1FB 3FFCE 1I4FB 3CDCA 1YEDA 3E2HB 2XXMB 4R3SB 1B6DA 3BDYL 4WJ5A 4I0CC 5AYQA 4Y88A 1F00I 3KPPB 5E7BA 1E4JA 4B0MM 1JK8B 4WI7A 1QSFE 4TSAH 1U9KA 2J8HA 5FUZL 4LVNB 3MRJA 4JG0L 1WICA 4J3VA 1NGQH 4Z7QE 1E28B 3C9NB 5ESQB 4Y1AE 3MYZA 5DJDB 2BNQB 4Y4KB 2VZUA 4E42A 1QFHA 1FNSL 3AS0A 4YBQD 3VI4F 4ZFZB 4LKXA 3GMNA 4MAYD 4BH7B 1DQMH 3V2AR 5DRNA 5JDSA 3BXNB 3TBVA 3IKKA 5C6TL 1QSFD 3OAYH 4TN9A 5I1GL 5I0ZA 1L9NA 2DLGA 2W0FA 4UIKH 1FCGA 2IG2L 1MI5B 3QWQB 4OV6F 2ESVB 1P2CB 2R56L 3TIDB 4JM2D 2PF6A 3FOLA 2IAMB 1JRHI 4HV8B 4UQ3A 1IC7L 4JKPL 4UDTA 4Y1AD 3VE0A 3ALPA 2N7BA 1A6ZA 3P30L 3MLUL 1KLFA 3SEPA 1H5BA 3BAEL 3Q5OA 1UXSA 2R0WL 1LE5B 5HHVH 1KEGL 5MI0B 1M7IB 3O4LB 2J6EA 1MWAL 4W4OA 2WWMD 4YC2C 4E0RB 4POZD 4A6YA 4NP4H 4OGAC 1EHLL 2F5BH 1JHTB 5IFHH 3A0OA 4F7PA 5DI8B 3QA3A 4LOUD 3RUGF 4Q97A 4U6TA 2CMRH 5T1MA 3H3PH 1NGWB 3MX0A 4XC1H 1WZ1H 4H0HB 1IGJA 5DF0A 4PGEA 1QR1A 1P1ZA 5GS0H 5IG7B 4ZS6D 1FLTX 1H5BC 2AXFA 4LGRB 3WFEH 5EIIA 4K7PH 1XAUA 2I9TA 1LK2A 4LSDA 3QJFA 2DQFA 5IB5A 5CP3H 4W4OC 3KS0H 3ARDD 4KGJA 4RQQA 5E08L 5DJXA 4WI8A 1A9BA 1HQRA 5KJRH 4XMPL 3DX7B 1IE5A 1DQJB 1WFNA 3MCLL 4OD1H 4GRMB 1U8KB 1K8IA 3T1WA 3QPXL 5FIEA 1IL1B 3I50L 4P5TD 5E9DA 1ACYH 3I3DA 3W0WE 4EI6B 4I4WA 1CFVL 5JORA 4NO5A 3EYSL 2XWBB 5BZWA 2XZZA 1JZ3A 4WY7H 1FAKT 1ORQB 2HT4D 4R7NB 5FDYA 3EOBB 1ZV5A 3N1MC 3SBWA 2AJYH 5J13C 3MLTA 1T0PB 1JWSA 3V4PL 4APQD 2GTWB 5GZND 3D18A 4AH2B 4LBEA 5ERWA 3JV4B 3OG4B 4XRCB 3FQNB 4IS6A 3S88L 2RQ8A 1KULA 3O4OC 2HMIC 2A6KB 2B5IC 2Y07L 2IPTH 5FHBH 3BYYA 5EFIB 1YEKL 3M07A 1J8KA 5IFAH 3S34L 4ZNEA 2OCFD 4L4VB 4MCZB 1A7OH 1KPVA 2X4OA 1KGCE 1VKXA 2Q7YA 4BH8B 1OGTB 3RNQA 4U1HA 1OAZL 4WTXA 4OUUB 1U8JA 1OY3B 4FZ8H 4KZDH 3D9AL 3IDMA 3Q1SL 1U8MA 2ED9A 3SBWC 5E8OB 2F5AL 4N8VG 2W65A 2DQTH 4JRXB 2DWDB 5F70A 3MRNA 1KG0A 3D3VE 1KJ2H 2P7TA 5DD1L 1WBXA 5EOTB 2KZ1B 3CFEB 5GJTL 1ZSDB 4KI5C 1A4JA 1IM3B 3ZKMC 2H8PB 2MJWA 3L5XL 5LGHL 2WLYA 4PP2A 4U6XB 1A1NA 3MRPA 3W82A 4H1LA 3BE1H 4GRWB 2O5YL 4MVBD 4XCYA 1LP9A 5IOPA 5FDWB 3NIFE 1DVFA 3HFML 1BWWA 5J6GA 1XF3B 4X6DE 3BJ91 2EE6A 4MD4B 5EOQH 4E41A 5HGAB 4FQLL 3NPSB 1BM3L 5KVDL 4NOFA 4LLDB 2OL3L 4JEGB 1RK0A 3LV3B 1BBDL 5L0QC 4OCYL 1KLGA 3CDGB 3LZFL 3VI3E 2YWYA 3QP3A 3BUYA 2I24N 5C0GB 2NXZD 1F4AA 1O0VA 4DK3A 1IFHL 3VXSE 1J0IA 1RJZB 2M8XA 4YBHA 2UY7A 4FABH 4YX2L 5ACLA 4PJDA 5HD8C 1DVFC 1P6FA 5ANMB 4M48H 4FXGA 1BZ7A 4EQ3A 1S9YB 4OFKA 1T0MA 3LCYA 1AP2A 3V0WL 3T3ME 5C71A 4QXTA 2ADIB 1XFPA 5CBAA 4WU5B 1OTSC 5GGRY 1VADA 3CNKA 4N5ED 4QRPB 5FHAH 2YEZA 4XBEH 3HI5H 4U0RB 2Q86B 4Q9RH 4TSBL 1OLLA 5IK3B 2JELL 4ONGH 5I19H 4HC1A 3VXSD 4G42A 4FQIH 3HG1B 2P45B 1HHJB 3F7VA 3VG0H 1LWRA 3MV01 4FFYL 2E5EA 3AGVA 1RZKL 3GBML 1T7WA 5J89A 1FFOB 5H35A 3UTZB 1NUGA 3V52L 4DWHA 4R97C 2NY5L 4JGUA 2FH6A 5K9OA 4P5MA 4ISVB 1DN0B 4PB0L 2NXYC 2J4WL 5SX4I 4D9LH 5LXGL 5DMJB 5ID0B 4DVRL 2XTJB 3MV7A 3NIDF 5CD5C 3RAJH 3OAYK 4JFDB 5E8EA 5DK0A 1UJ3B 1JYNA 5ADOL 4U6YB 1S7VB 4BSVA 1NMCC 4JFFA 3BGFB 2ARJB 4OKVB 3UTPE 3MLYL 1OHQA 1I7ZA 3GKWH 4R0LB 4YHLL 4DTGL 2BNRA 2W0KA 3VFMA 5BS0B 4QTIL 3X12A 2YD4A 2J8OA 2Z8WC 3QIUD 4PJ9D 4S1SH 1EZVY 2X1WL 2FHFA 3Q5TA 4JG1H 5EH1A 1R5VA 3IDNB 1HH6B 4YUEL 2CSPA 5DDHB 4HHAB 4IDJL 4R4ND 1J1OH 4M8QA 2CIIA 4NKOB 2YUWA 2O26U 4G9FA 1IEAB 5DTFA 3L5WA 4KRLB 5CWSA 3C2AL 2Y5TA 4JPKL 3QIBA 4NO0B 3MOAH 3RWCA 3ULUF 1NDGB 3SDAD 2IANA 5DUMH 4MA3A 4TVPD 4X7TA 4QXGL 3BMWA 4Y8AA 1D6VL 1A7NL 2PTTB 3HE6A 5FA4B 5J3HC 3VH8B 5IVXF 4OLXH 5DHVB 3KPLB 3IU4L 1S7SA 1X5AA 4Y19E 4LDOB 4LLWA 1INQB 3PIQB 1DBJH 4MQ7B 4XPFL 1RJCA 5EU4B 5K93A 3HR5B 1I3UA 1QNZH 2NYYD 3GMLB 4JRYE 3RIFK 2EC8A 3OXRA 1MJUL 5C1MB 1SBSL 1HI6A 5FKPA 3CSBA 4X98B 1AD9B 5CSGA 1A3LL 4N0YL 3GHBL 1F4XH 6CGTA 4JY6B 4X5WB 1Q38A 5E2UL 5BXFB 5JPNB 3IAQA 3QIBC 3SY0B 1FVDB 3HZVB 3U46A 1KACB 3RVWD 3GDBA 4YNYB 1JYXA 3ZDZE 3HE6C 5EU5A 3ET9F 4Z7VF 4GKSB 1J05B 1QO3A 4JDTH 2VDKL 3VFSB 2YPLE 1UEMA 3MV8B 2AK4A 4I48B 5J57B 3IJYB 4YDVB 2B4CC 5A16B 1L6ZA 3H9ZA 4KVNL 1F58H 5B3JE 3W11C 5DFVC 2NNAA 3DVNB 2OP4L 4PJXE 1Q9KB 5ACMA 2J2ZA 5INDA 4TPRL 4XWOC 4HAFA 2Z8VC 1DQDL 3GMQB 4XBGA 3RWIB 2VE6A 3OR7B 4PJ8A 3JWDC 4WUKL 3REWB 4XI5D 5C0AA 5HYSA 2YPLD 1X5FA 4RZCA 2J8UB 3DROB 1BIIB 4UIKL 3SDXA 3OKKB 3S4SG 1FN4B 3MFFA 2PKDA 2BVPB 3GHEL 3P9MB 2ZOLA 5ETUB 3U4BH 2BVOB 4B41A 3QUML 1BZ9A 4KROD 1CFNA 4HWBL 5IIEA 4OT1H 3EJYD 4V1DE 1Q0XL 2V2XB 3DSNA 5T33H 4P9ML 5JPMB 4G6FD 4M5YH 4BFBD 3MLSL 3OF6D 4UOW1 2ZCHL 3MNZA 3QCTL 1Q94A 4MX7B 4HKZA 3B3IB 4IEFB 4PJ8C 3ARFA 4DGVL 1CDYA 4I2XE 1BREA 1ETZA 3K46A 1A1OA 3CIQA 4NKMB 3EFDH 4X4YB 1DJSA 2ITDA 1K85A 2WNGA 4OZIA 4JPVH 2YHGA 4BQ8A 2FJGB 5H94B 3MR9A 4V1DD 1CD1A 3VGAB 3U1SH 3RWHA 5EA0H 5E6IA 2IBZY 1Z3GH 2J5LB 3TJEL 4CKVX 4RMSA 1Z9LA 3EDDA 1HH9A 1BECA 1I1FA 2F54B 5FK9B 5I1DB 4MHHG 1I4FA 4JFXB 2EH7L 5E1AA 4DCQA 4R3SA 3RWEB 4XCNB 5SWSE 3ARFC 3SPVB 2CLVA 3KPPA 5BZDB 4XMKL 2ZCLL 1JK8A 1MFDL 1RPQA 2PXYA 5I30H 1NCNA 3RRQA 4L9LA 2FBJL 3EO0B 3DLQR 5DWUL 4XCEB 1VERA 5KAQG 1ACYL 2NMSA 2X4QB 1E28A 3C9NA 1NFDA 5E6IC 4GMSH 5DJDA 5EU6E 5AG9A 4OQ1A 2EKJA 1L0YA 3SE8L 5F7NC 5SWSD 4GG6E 3B5TA 2ZSVB 3QXTA 3E2HC 2LAAA 3LOWA 4UZGA 2N1KA 4YFDB 2VLKB 3ARBD 3UTSE 1ES0A 4MB3A 2CK0L 3HZMB 1Q1JL 3C6SB 3BGAA 3T8XA 1WZKA 4OFYA 5LWYL 2PXYC 4G6MH 4R2GD 2ESVA 5D1XB 4L9LC 4FQHB 3V7AE 4YHNA 3ELAT 3HPLB 3TIDA 2IAMA 2VL5A 4HV8A 4LVNC 5D5MB 5F21B 1PAMA 5EU6D 2IPUK 5E99L 5D2NE 3A6CH 3H9SB 4MXWL 5BRZB 3RIAK 4PJGB 4RMQA 3N9GL 1LE5A 4AIZA 4GRLD 1M7IA 4R4FH 2GCYB 3O4LA 1G7JB 5FGCE 2BJML 4RCAA 3T09A 5BW7A 3MV9A 4OZGB 4E0RA 3GSNA 2DQTL 3VGDA 1JZ5A 3W39A 5ISZA 4DOHE 4R4BA 5HGDB 5DJCB 5DURD 1JHTA 1J87A 2MCPH 2L4OA 5DI8A 1KJ3L 3U36B 1MIMH 3MQIA 1MCRA 3AXLB 2YR3A 2IAMC 1NGWA 5I8KL 1L7TL 1IM9A 3FFCB 5IG7A 3P0VH 3NCJH 4OQTL 5GGSA 4K2UL 4JQIH 4O2CB 4CUCA 5MI0C 4Y4FD 4XPBH 2R0ZL 4XPTL 4BQBA 4Y5VB 4K3GA 1EX0A 1MCNA 5BW7C 1J1XL 4MAYB 4XCFH 3LD8C 1QSFB 5HXMA 5DVKA 1G0YR 1DQJA 3TCLB 4P3DB 3U6RB 4GXVH 4GRMA 2FO4B 5CFHA 1U8KA 1YNLH 4JM2B 1I9IH 4ELMF 1IL1A 1TPXC 4Y1AB 3E8UL 4BZ1L 1AGDB 1BJMA 4ZAKA 1EUTA 2OZ4H 1V7ML 1T5WB 4S0TD 1G6RH 3AFLA 4EI6A 4JDVA 2ORBH 3KJ6H 4HG4J 4OF3A 4KKBD 2PW1A 2XWBA 1UWGH 5CEYB 5C0JB 4JANB 2E6PA 2EYTB 1G7LA 3ZL4H 1MFAH 3OKOA 1OAKH 2Y72A 4NCDA 4PD4K 1U58B 5DA4A 1N2RB 1OT1A 5HHXL 5DS8B 1P9MA 2LQRA 2IFGA 4AH2A 4OCWH 2WUCL 1AXTL 1CLOH 4XVSL 1RIHH 4OFIA 1DBKL 2BCKB 4NQCE 4MNGE 4JGJA 5TE6L 4LLQB 4Y2DB 4ZAKC 3LAFA 1OAXH 4OD3H 5ITBH 1JJUA 2VDQL 1DQLH 1IGFL 1P5VA 4N8CL 1RK1B 5C0FA 4M3JA 2HVKB 5JHLH 3NFNB 4BH8A 1OGTA 1YNKH 4HXAL 4UT6H 1VSCA 4OUUA 1N6UA 1FGVH 2Y7QB 3HUJE 1I8MB 5JDJA 4BJLA 4H8WL 2APXA 4WHYG 1GHFH 4OCNC 1TZGH 4JRXA 4K8RL 3ARXA 4X9HA 4NQVA 1P9MC 3B9DA 2DYPD 1OQXA 1AO7D 5HI5D 1Q72L 4NQCD 2ZG1A 3S36L 5CJBA 5IHBA 1FORL 5EOTA 5DD0H 4O00A 5JUEL 7CGTA 4LLUA 3EW3B 1ZSDA 4P5TB 5F8QC 1OB1B 2H8PA 1H3GA 1BFOB 3NCMA 3M17A 4S1DC 1G7QA 4U6XA 3GKWL 2UY6A 4NT6A 3KLAB 2LTQB 3MLRL 5FDWA 4HUUB 2VB5A 3QR2A 3EDFA 3P0YL 4TVPL 4ZFFA 1MJ8H 4MD4A 3OG6B 5F9JB 5HYJE 5I16B 3CPLA 5HGAA 3ZKNC 4S1SL 1MELA 3S5LB 3CAFA 3PWLB 4APQB 4F37F 5L7XL 4EBQL 3C5JB 1JNLH 1YUHB 4KVCL 3OB8A 4IOIB 4JLRB 2B39A 4LSPH 2VDRL 1EJOL 1TIUA 1CF8H 2CKNA 4FMFA 3W0WB 3KPTA 3O9WD 3O2DL 4HSQA 5D70L 5DHXB 5E24E 5A1AA 4HKXB 1ZTXL 1RJZA 3O45B 2Z91B 4U3HA 1HXYA 4Z7UE 2EDOA 3KAAA 1X5KA 3VXOB 5ANMA 3AC0A 4O02L 3BO8A 4PJFF 2EE2A 4D9RE 4L5FH 4HT1H 4LP4A 1FRGH 5HYQB 2MKLC 5E8PA 4WW2A 4JO2H 4WU5A 2NLJB 3L9RB 3C5ZB 2JE8A 4D0CB 3RHWK 5FO9B 5FXCH 3DV6A 5IK3A 2R1WB 1UCBL 1YECL 5DFWH 4NGHH 4UOW0 2CRIA 4F33B 5F72S 5JW4M 1HHJA 2C1OB 3JV0A 1YN6B 5DJ6B 1W72H 3QUZA 3BZ4B 5ICZA 2JLLA 3E6HB 2ITCB 4XPAH 4X7EC 1J10A 3D3VB 3ARSA 5HDQH 4ISVA 4NNPH 4FXLA 4WW2C 4EXKA 3DX9B 1FO0L 1KC5H 1UJ3A 2ZUYA 1TJHL 4G6AD 1KJ2B 5FYJH 1KXTB 2OYPA 5KSAD 4BQ6A 2VC2L 4JY4A 4LF3B 1S7VA 2Z92B 2NXZB 3QJHB 4ZUWB 1T1XB 3RWJB 4OKVA 4MDIB 5FYJE 2KPNA 2AKRB 1CFTB 4R0LA 3TV3L 1S78C 4X6DB 1WAAA 4M93C 3QUZC 5GGVY 5CMAA 3DTXB 2FATH 1Y0LB 2B1HH 5HI4D 1HINL 4WU7B 1JGVL 3FO2A 2XTJC 1RUAL 2CRYA 3GMOA 3IDNA 4AMKL 5A3ID 5J56B 1UJ3C 3VWKD 3U4BL 5CJOL 1T03L 1I8KB 1A21A 5CZKA 2CUIA 2I26N 5LVEA 3BWUC 5D6CA 5DUBB 5FYJD 3VXSB 3ZSTA 4NKOA 2ZZUT 1C7TA 1AKJD 2VLJE 4CVWA 2XA8H 4R0LC 4DK6A 5KSBF 4RWYH 4YHIA 4WFED 3GSRB 3NZHL 4YHOH 1BAFH 4NO0A 4RRPA 1NDGA 5LAXB 3QEHB 1XGTB 1CD8A 1XH3B 1VPOL 4ODHH 5FA4A 4WI2A 4XNMB 3VH8A 4HLJA 2ID5A 4DKFH 2OK0H 3W9DB 1SMAA 1MHEB 3JWOC 4F15B 5GIRB 5F1NB 3MRMB 4FRWA 1INQA 4MQ7A 4O4YL 5EU4A 4D8PB 3HR5A 1T4KA 3IDJA 2VLJD 4FXKB 3OJDA 2RB8A 4J3UA 4X98A 4WWKD 4EEEA 1F8TH 2DBJA 5EO1B 3FQXB 2BY1A 3MRQB 1BZQK 2X9YA 3P4LA 1NCDL 4HD9A 4JY6A 5BXFA 5JPNA 3GNML 3SY0A 3CUPB 5IT2H 5E2JA 1D5ZA 4YNYA 3JBG7 4GKSA 1NBVL 4YEFA 1J05A 2F53E 1IAIM 1E4XI 2V5TA 5GRUH 3VFSA 3G6JE 5I30L 1F2XK 3MV8A 5SWQB 4HS3B 4OFVA 5KSVB 4MJIE 5A16A 2GQHA 1T1WB 3WD5L 3D0VA 1C5DB 1CDIA 3DVNA 2FYYB 1GGCL 3IXAB 4KXZI 4XNUL 4PTUB 2P8LA 2R9HC 2ARJQ 1IC5H 5D7KE 5CBEA 1TZIA 3RWIA 4JO4H 3OR7A 3SDAB 3QWRA 4NC0B 1ACZA 3REWA 4YE4H 2IQ9L 3IYLW 3NA9H 2P43B 1GJIA 2FLBT 4M6ML 3GMMB 3BEVB 4HKJA 3U0TB 2J8UA 1BIIA 1P6AB 3CFKA 3WIHA 4MJID 3KWWA 3OKKA 2BVPA 1LMKA 4ONHB 2Q76B 2BVOA 4M1DH 3G9VA 4P4KD 1SY6A 1I1AA 4X6CF 4B53A 1E27A 2ADFL 3NGBB 5J06A 3A6CL 4X4ZA 2DM2A 2YRZA 1ZLVH 5JPMA 1BFSA 1PD6A 5D7KD 1IT9H 4GAFB 1A7RH 2WWKO 3N1PC 4YO0B 3SCMD 4G6JH 1FZKA 5I2IA 4U31A 1V3MA 2E7HA 4GMTH 4XAKE 1GSMA 2HTLD 5E2WL 3T0EA 3IJHA 3DX6A 3KPQB 4NKMA 3PE9A 4M7KL 4Y19B 3PGFL 3I2CL 4OLYL 3NACH 3SDYH 2APTA 3KPOB 4JRYB 4GW5B 3DMMA 3KLHD 5B3NA 4LLVB 1I1AC 2KQNA 5E2TL 4I0KA 4LAQH 4NZUL 5CGYD 5E6ZA 1DLFH 4CADA 3WO4C 2BK8A 3DECA 2YD6A 4LCCB 5FYKU 3CD4A 3I3BA 4JAMB 4QF1B 3TNMA 3SJVE 5KN5B 1KFAL 1G7MA 3IB4A 3QWOB 4ERSH 5HYIA 2EDEA 5FK9A 4JKMA 2HFEB 1NANI 5C0RH 2R1XB 4KK8D 4JFXA 4C59B 1J12A 2ZPKH 1KN4L 5JQHC 1R5WB 1ZE3C 4XCNA 3SPVA 1KT2B 4LSQH 3N1FC 1T3FB 3T0EC 1BLNB 1BQSA 4PP1C 2HFFA 2YPLB 3T0DA 4AL8H 4GKOA 3PV6B 4LSUL 1IAIL 3EO0A 1OM3H 1FVEB 5HHQB 3DMMC 1WQVT 1B3JA 1MHCB 4M8VA 4XCEA 2B2XL 1JHKH 2UUDH 5D7SL 3SJVD 2X4QA 4PJXB 3KG5A 5TF1L 3IXTA 4N68A 3H8NA 2FX7H 1LEGA 4J6RL 4OAWB 5HDBF 3FRUA 4G6FB 1BP3B 1J0HA 4OIAA 3H2WA 4BKLB 2V17L 3OXSA 3B2UC 1A9EB 2ZSVA 2UVFA 1Y6NR 4L8DB 4ZYKB 2VLKA 3ZHLA 3HZMA 2VXSL 3VFNB 3C6SA 5E5UB 3WSQH 4HXBL 5D1XA 3QBTB 5KZCD 2XG4A 5D1ZA 1EA9C 3ORJA 4V1DB 2HVJB 4KUZH 2VLMD 3P77B 3H9SA 1FPTL 4H88H 3MZGB 4JHAH 2Q3ZA 4PJGA 1YC8A 5DGRA 2A9ML 5F7DB 2DLEA 3U2SB 4UT6L 1KIRA 1U95B 3O0RH 3VD7A 4I2XB 4WUUD 1PYWB 5IHUH 4LSSH 2DQHL 4LASL 4KDWA 3WKML 1FSKB 2HFGL 2DDQL 1DFBL 3TO4B 5DJCA 3U36A 4YHYB 3GJFA 5D1XC 1E4WL 3AXLA 5D1ZC 2CJUH 3L5JA 3MJ9H 2Q20A 4RFOL 1IBGH 2F58H 3ILQD 2NX5E 1S7QB 3FFCA 4EUPG 12E8H 5HHNB 4S10A 1U3ZA 4M6OL 4NWUL 4O2CA 4F80A 1BWMA 1F11A 5SWSB 5IWLA 3OKMB 3MA9H 4ZUVB 1IGML 3M8OH 43CAA 3I6GB 3ARBB 1QSFA 1U93B 4ONFH 5HVGB 1O5DT 3SDCD 4P3DA 4YDJA 3U6RA 5CEZH 2C4FT 1GOHA 3UCRA 4QCIB 2NZ9D 2FO4A 1BF8A 3VG9C 2HT2D 4B5EA 2NX5D 1GIGH 4Y1AA 1C5BL 5EU6B 1AGDA 2BMKB 2UWEE 4M4RA 5CEZE 2E27H 1QFPA 4DAGH 1EO8H 1FNHA 4KWUA 4GG6B 1UQSB 5CEYA 4JANA 5E95B 1A6AB 1BQHB 3ULUL 4GRLB 1WLHA 4OCXL 2PW2B 5EWIH 5IWLC 4YBQC 5I18L 1FIGH 3QT2A 1G9ML 1U58A 3UTSB 1FRGL 1W8OA 1HHHB 2EIDA 5IB4B 1VHPA 5DS8A 5DURB 4M4PA 5ACZA 2OSLB 4FG6D 1EHXA 4KQ4H 5D2NB 4K3DH 4LLQA 4Y2DA 1JRHL 3QNXB 4L9DA 2E6JA 2W9EL 2VRAA 3N85L 1RK1A 4BM7A 3ROLB 1C8PA 5FGCB 2P1YA 2DLIA 5JHDE 5E8DL 4Y4FB 2WWKT 6FABL 1HKFA 4DEPC 5KVEL 3F58H 1QBLH 4XPAL 2IMMA 3MRGB 4DOHB 2WWMC 1CFQB 1P4BL 2CRMA 3K8KA 4JFQB 4PRAA 4YFEA 3A6OA 3LMJH 2OXGA 1OCWH 3JZ7A 2LU3A 5TJWK 4D0DB 1PG7X 1WITA 3EJJX 2Q3AA 5MEQB 3AS1A 5CUSL 2NY6D 1S7XB 3ES6B 5EN2B 1OB1A 4Y2DC 4PJ5D 5KBNC 1R3HB 4HQQH 4PJEE 1X4ZA 1HHKA 4HF5H 5FM8A 2V2TB 4S1RH 1JZ7A 4ZS6C 1I3RB 5I8CB 4O9HH 4KFZC 3KLAA 3OJ2C 1ZLVK 5I1AB 4HUUA 3VXUA 1S5IH 2A77L 2E7BA 1E6JL 2FATL 1J11A 2VQ1A 1CXEA 2GY7B 3BN3B 4JFPA 5CP3A 4WFGE 4APQA 1FAIH 4UOJA 2NY2C 3C5JA 1YUHA 1F90L 5ESAB 43C9B 4G9DA 4I9WE 4P2OD 1LO0L 1A4KB 5IJVB 2VIRA 4U1LB 3W0WA 4HULB 3C8KB 1VA9A 2X4UB 4CW1B 4HKXA 1T83A 5DJZB 3U79A 5F9AC 4LRNL 1GC1C 2Z91A 2C3VA 1G6RB 3HNVL 3O45A 4JKWA 3TBYA 5IMOA 5GS0C 2WINB 3VXOA 2VXUL 4DGYL 3RZCD 4IRZH 4WFGD 5HYQA 1JF1A 2R2CA 4APQC 2DYPB 4I9WD 4EOWL 3FB5B 4MJ6A 3WFDH 2NLJA 5IESL 3C5ZA 1BHGA 4NQCB 3IRPX 5FO9A 3HKFA 5EC2B 5IM7B 4MNGB 1H3PH 2UYLB 4OB5L 3H7BA 2CRZA 2KDGA 2ZJSH 1L0XA 1CIUA 1NDMB 2UUDK 2C1OA 4BFEA 1T83C 5FO8A 4M43L 4TNWK 3HUJB 1AR1C 4NKIL 3OJMB 3BZ4A 3ZT6A 3OKNB 3E6HA 2ITCA 2OR9H 1ZGLB 1KSRA 3D3VA 4NO2A 4YPGA 3ZE1F 1MQKL 1XF4B 1NGZB 1X44A 2X1XR 4YQXL 3R0NA 1X5JA 3ESUF 3C5ZC 3J7HA 1KJ2A 1MRFH 4X9FA 4NRYB 4S11A 3B6SB 1I1RA 1AGBB 4ODSH 4HUWB 4ETQB 1MFBH 1GGUA 2A6IB 5CCKL 4ZUWA 1T1XA 1VESA 2HN7B 2AERT 2XQBH 4WHCA 1RMFH 1CFTA 1F4YL 4YK4B 4JZNB 1GGYA 1IC5L 5HYJB 3DTXA 1Y0LA 3QNYB 4H20L 3NA9L 5HHPB 4ZDHA 4NQSA 5FGRA 3LHPL 4WTZA 1MVUB 1JTOA 1KCVL 3F8UB 1S9XB 1Y6MR 3TT1H 3I75B 1I8KA 1KCUL 5C92A 1B0WA 2DQGL 3WXWH 1G7PB 5AAWA 4L4JA 2NXZC 5CJQL 3DO7B 4GKNB 4ZFGL 3BT2L 2GUOB 3BN9C 4Z7UB 5CZVH 3MRBA 4HFWA 3FB7A 5DJ8A 4GMTL 1EMTH 3QEHA 1XGTA 1CGXA 4PRHE 4N9OB 1RZJH 2A1WH 3HMWL 4YDIL 1QKZH 4PUBH 1PGRB 3W9DA 1KNOB 1MHEA 3UBXG 5GIRA 5A43C 2FEDC 1MHPL 2B0SH 5F1NA 4F57L 4YAQA 2DBLH 5C7XH 1AH1A 1OD7A 4PJBF 5KSAB 4DW2H 2QLVB 2DLTA 4GBXD 5T3ZL 1MIEH 5IVZA 5JXED 4S1QH 3BMVA 3RTQA 5IVNA 2CIKB 4OBRA 1ND0A 3FQXA 1DSFL 5IQ9A 1NBYB 2NTSP 3MRQA 2MTPA 2R39A 1QG3A 1JGUL 1W72B 1MAJA 1LP9F 3VXRA 4K23L 2E8ZA 1JFQL 5T1KD 4TUJB 4LU5L 2F74B 4K94H 1NC4D 3PWUB 5SV3A 2XWJB 2FZ3A 4LCWE 3TZVD 4F15C 5SWQA 1CLZH 3CVIH 1U6AH 5KSVA 3VWKB 1KTKE 4QHNB 1R3JB 3FCTA 1YJDH 5E94B 4TNVF 4AEFA 2YPVH 35C8H 4MMXC 1A6PA 5CJXC 1C5DA 1CGSH 1KJVB 1U3YA 2FYYA 3RTQC 1AKJB 3KPSE 4FFVC 2F8OA 2P48B 4IRSB 4PTUA 4ZS7L 3VGGA 1MCOH 3NH7H 1XGPA 2Q8BL 4GXUN 1FH5L 3SDAA 4PJDF 5IW1B 4KRMB 4LCWD 3QZWG 1OPGL 3GMMA 3BEVA 4X0KA 3ZT7A 3U0TA 4AT6A 3QAZB 1NMBL 2VZOA 4ONHA 4NM4H 5C0CD 2FL5B 1KB5H 1RULL 3PDDA 1U91B 3MNWB 1AD0B 3KPSD 2VLJB 1A22B 3D85A 2BC4B 3R06B 1A1MB 1FNFA 2XZAH 2LABA 5DR5L 4YO0A 1OTUC 5D7IE 1I3GH 2VOTA 5IHUL 5JOFB 4XC3L 3SDAC 1TNNA 2CKBH 4XCCH 5HI3D 1HOCA 3C8DA 3OKEB 3V4UH 1ED3B 3PHQB 2AXGA 4Y19A 4HJGA 5L8LB 1MHHB 1JI2A 3QFJE 3CLEH 1HKLL 4JRYA 4FQQB 3DYOA 1XCTB 4GW5A 4PJ7E 1CK0H 1WFOA 4NQDE 3EOAB 3TLRA 4RGOL 3NGBC 5E56A 5L9DL 4XX1E 4JAMA 4PGBB 4LEXH 4QF1A 1WIPA 4YGVB 3KR3L 3GI8L 5KN5A 4R90L 4L8SB 5CZXD 5EO0B 3BP7B 1BJ1J 4DN4H 3V6BR 2HFEA 1NCCH 1HSAB 4G6KL 3ISWA 3UEZA 1U8QA 2W60B 2P5ED 3MA9L 1L6XA 3BQUD 1KT2A 4ZOEA 4M9PA 2G9HA 4XHQA 2QQNH 2F53B 3QFJD 3G6JB 3FO0L 3PV6A 4JO1L 1WWAX 4MJIB 4NQDD 5F71A 4ENEC 5HHQA 1ZANH 1YQ2A 3EJZD 1MHCA 5EOCH 8FABB 3CFJB 2NY3D 4AIOA 4OFDA 4FFZH 4QOKD 1F97A 4PJXA 4NJ9L 1UYWH 5L6YH 2HJKB 3ARRA 3VMNA 1EO8L 4BKLA 1U8OA 2QV2A 1G9EA 1A9EA 2DQUH 3CX2A 3SCMB 4WCYL 5LQBH 1T66D 3PWPE 5CINH 4ZYKA 2PR4L 3OZ9H 2XKNB 3P11H 4H5SB 1YEGL 4N0UA 4ODXB 4XI5C 3QEQD 3VFNA 3ZTJG 5IB3B 1DCLA 5ESVB 1LEIB 1OF2B 1VFMA 3QDMD 3KHOA 3G08B 3L7EB 2AV7B 1UWEH 5DFTA 4AEIH 5I1EH 1CICD 3FB6B 2YRPA 25C8H 1U3HB 4PJCA 5BQ7B 3Q48A 4XVTH 1PLGH 2WIMA 5CHNA 4HCRA 4ZO6A 4WFHD 3PWPD 3OGCB 3QUYD 3WFCH 2HWZH 4I2XA 1VDGA 5I1LB 4WO4B 1K3IA 1F3DJ 5DJAB 3TO4A 3I6KB 1XGQA 1EGJL 1HIML 5L88H 4LCUB 4LGPB 1BVKA 2YPKB 5FKAB 2C7UA 5EBMA 3CXHK 1K4DB 2A38A 4L4TD 3RY4A 3SJVB 4FQXD 1BF2A 2QJDA 4M6NH 3MGTB 3EYUL 1S7QA 4HBCL 5BJTB 3D0LB 5HHNA 1FDLL 1FNGB 1TZHB 3VGBA 5AZEL 1S5IL 5DZNA 5SWSA 4N0FA 5EUOA 3H3BC 3OKMA 1PG7W 2XFXB 2DS4A 4CDGC 1UM4L 1FSKC 5FYLH 4PRPA 4XB8A 4Y8DC 3FMGH 3I6GA 5EU3B 3ARBA 3OKLB 3TO4C 1TJIL 5DLML 5FYLE 4QT5B 4YHYC 5KZCB 4Y5YB 3IETB 2EO9A 5DEGB 5F7LB 4ELMB 1M4KA 2R23B 2BMKA 5DUPH 4U1SA 3VFOB 2IH3B 3BISA 3SGDH 3MNVB 4MWFB 2PYFA 1MF2L 2EH8H 4GG6A 1UQSA 5F96H 1A6AA 1BQHA 4GRLA 4TUOB 4KXZH 2PW2A 5I1IL 3TFKC 3IVKB 4QTHB 3T2OA 4U1JB 3ULSA 4CMHB 4P9HC 4GW1A 3UTSA 1HHIB 3D69A 5IB4A 5T3XL 3ARBC 2YC1B 5FYLD 3MGOA 3VRJB 3K4ZA 4OCSL 5DK2B 4G7VH 1GGBL 2DTSA 1IKFL 3PGDB 5D2NA 5C2BL 5J11B 1NAMH 4Z8FL 5J1AB 4PGJA 3LIZL 1PSKL 3ROLA 1QBMH 2OJZH 4KV5F 2YD9A 1ZAGA 4GRLC 5TF0A 4ALAH 1JPGA 3F7YB 4Y4FA 4GW4B 4ZO8A 3O3UN 3TGXA 3FOMB 3MRGA 3D2UB 4POUB 3RI5K 2CR3A 1CFQA 5HY9A 4U2YA 1N3NA 2DM7A 1NCUA 1HDMB 1TVDA 2LE9A 3EYVB 3QO0A 4JR9L 1T7VA 4YHPB 4NBZB 3A67H 3LKNB 2QEJA 4G8GE 4D0DA 1I7TB 5MEQA 2NX5B 4NHUB 5D2NC 5A2JH 1S7XA 5IMKA 4D3CL 5JW3H 4M1GL 3HNTH 1R3HA 1ORSB 3VFGL 1EBPA 1RMFL 4WNQB 5I8CA 2VKWA 1CL7I 5H8DA 5ICYB 4Y4FC 4I18A 5B39G 3BP4B 3W5MA 3F65A 4O2EB 3HMXL 3CFDB 5I1HL 5B21A 3KPNB 3TBSB 4JKKA 4IOSD 4JM4H 1A4KA 5IJVA 2UWEB 1CDUA 4JVUA 4U1LA 4YDKL 3B8SA 1AGCA 5I1JL 2H2PC 5JNYA 1DUYB 2X4UA 3FTGB 2HMID 2ARWA 2YD7A 4KJQC 5DRWA 2OZ4A 2HLAB 1G6RA 5EORH 3RBSA 4KI5E 2VWEC 2WINA 5I8EB 3SGEH 1D6EA 3DPBA 4K3JH 1QYGL 1MNUL 5IEKB 3CZFA 1KCKA 1NCBH 4I18C 5DQDH 4HIHB 2V7NA 1OSPH 2DYPA 5ILTL 3M1BA 2ERJB 4E5XB 4Q74A 1DE4B 2B0SL 5IM7A 4PYHA 3STLB 5EBWB 3CMOL 1NQBA 3LS4H 2UYLA 3TJHC 4DW2L 4HPOL 2NY6B 3W9EB 1WFTA 2YBRB 2R8SH 1H3WM 1BBJB 5D1QB 1NDMA 3HA0A 5I73B 4M62H 4KI5D 4MA8L 5JHDB 3ZKMD 3HUJA 3NAAL 1ODAA 4H1LH 4PIRF 1MCEA 3RZWA 3WL9A 2DTMH 1TNMA 3AY4A 5GISH 2WP3O 1ZGLA 4TRPL 1F6AB 1XF4A 2OQJA 3TIEA 2H6PB 5C0DA 5M7QA 4OLZH 5HI5C 3HNSL 4P2OB 1IAMA 3QDGE 1AGBA 2CLZA 2BOCB 2YPVL 4NUGH 5GS3A 3UYOD 2HN7A 4QNPE 2AJVH 4Z0BL 1AFVL 3K2UL 4UT9L 5E00B 4JHWL 5I66A 3PL6D 5HYJA 4R26L 4GAGL 4OGYL 3RZCB 3AY4C 1T20A 5HD8D 1DVFD 4BUGA 4PGCB 4L3CB 5IBUB 3D5OF 2ATKB 2AK1H 1OAYH 2CPCA 1S9XA 4E41D 5TE4L 3V8CA 3QDGD 1AQKH 1MFEH 1OTSD 4QRRA 2VDNL 3VRLE 5EZJA 3P3YA 1G7PA 3RQ3A 4HC1H 2YN5A 3DO7A 4GKNA 4UV7H 4FP8H 2GUOA 3DUUA 3UAJD 1I7RB 1YMHB 2X1PA 3G9AB 2DD8L 3GRWA 4CU7A 3MA7B 5F7YC 1KV3A 3WMSA 5DMKB 1FGNH 4U6HB 2AJUL 3QG6B 4KK9D 1WCBB 1CLYH 1I8IB 1FYTE 2YA1A 1UM5L 2YKLL 3W5NA 1JGEB 4O58H 1UB6B 1JYVA 2NXYD 4OI7A 1AJ7H 1JHLL 3FO1B 5ICXA 4IBLT 1VGEH 2QQQA 3LDBB 3D25A 5CD5D 4Z77A 2X6MA 4P4RA 5KSAA 2X05A 4MJ5B 3UJTL 5HHOA 3MV7E 5EZLA 3NZ8A 1OW0A 4MA7H 1G9NL 5D93B 1CVSC 1LVEA 4LHJB 4MMZC 5GGUB 2Z4QB 1NBYA 5I1KL 4K7PX 1FG2B 5FYKD 1W72A 4GRWF 2MPAL 1FL5B 1B4JH 4M5ZH 2FSEA 1NJ9B 4J1UB 3FQRB 1V7NH 4YEEA 5IFJB 2F74A 5K9KB 1HXMB 2XWJA 5E4EC 5EZIH 3E3QE 3S37H 3T2NH 2Z35B 1M7DB 1T21A 1ZS8B 4G6AC 3MV7D 5CILH 1RUPH 4QEGA 1R3JA 4U6VL 5KSAC 1R3LB 5E94A 5C07E 2OI9B 1OW0C 1KJVA 2VQUA 4ODBD 1NCWL 3WJLA 5L2KE 3PV7A 3MLZL 4IRSA 4JFFD 5JMOC 3HC4H 5DT1H 5HYSG 3U9PH 1N4XH 1AI1H 5I15L 4RDQF 3C08L 2BHYA 4YXHH 4WI6A 2BNRD 3V7MA 1GZQA 3RGVD 5IW1A 1FC1A 3JV6A 1WIUA 2OTWB 3WUWA 1TCMA 3ZE0F 3VXQB 1A7QL 3U7YH 1U8IB 4CVXB 3L3KB 3TYFB 3RWFB 5C8JB 1LK3L 5J3HD 1A14H 4TYUA 1UWEL 2B4CH 5TGBA 4HWUA 4RISL 4ZFOL 2G75B 1AD0A 1ULVA 3T3PF 5AZ2H 3DYPA 1QLEH 2BC4A 5L2KD 1A1MA 5F9OL 3BWAB 3DVIA 4JQVA 2F8VA 3CFIC 5F1KC 3SDDB 3WJLC 4FN0A 3QCUL 2RFXB 4IRSC 3EO9L 4UDUB 4OZFH 5TFSL 4UQ2B 1EVUA 4G9FD 4J3OC 5JOFA 3ROOB 2R2BA 3P73A 5T1KB 3G5XB 3JWDH 2Y4SA 3QIBD 3U7AA 4DQOH 2YK1L 2IAND 1NC4B 4KQ3H 2O5XL 1MHHA 4U4BA 5GRJH 3QAZC 2EXYC 4RAHA 3TZVB 3HE6D 5DEZA 4AJ0A 5HDOA 5GRYA 4FQQA 1XCTA 1ADQL 4OZ4A 4RMUA 3OBAA 3EOAA 1D5XA 2BVEA 4LPUA 5J0BA 3HI6H 4NNYB 3TP4A 1MFCL 1SHMA 2VZ3A 4KK5D 4CNIB 2AK4E 3W11D 5DFVD 4JQVC 2DQEH 5D72L 3WDIA 4YR6B 3L7FB 1CG9B 1XGRB 1S9WB 4NSKB 4ZTPH 4FQJH 3OAZH 2HP4A 2UZYB 2W60A 1WAAF 4MXVF 1FFNB 2OL3A 4XWOD 2G2RA 4ZD3L 1D5IL 2F53A 2WP3T 4LCWB 1ZT7A 4X80H 4OV5B 3EBAA 3G6JA 3GSXB 3ZKQD 1KN2L 1I9RH 4PJHE 2I07B 5DEFB 4NHCL 1XGYL 3L95A 3S35H 5B22A 1RURL 2Z8SA 1E4XL 5H37H 4GKZB 3GO1L 3OX8B 3QRGL 3CFJA 3MLWL 2D7NA 5T1LA 3T65B 1Q9WA 1EEQA 2NY7H 2AK4D 3SDXE 3KPSB 3B4NA 1A7BA 2GITB 3SOBL 4OIBA 4DFIA 1DLHB 1FE8H 2D03H 1RZFH 1OVZA 5JIKA 2J6EL 3RL2B 1FQ9C 4L3AA 4GG8B 4P5KB 1YY9C 2C1PA 2XKNA 4H5SA 4NO3B 3S98A 1IQDB 4A6YL 4PJ8D 2O61B 4KPHH 5D71H 1NMAH 5ESVA 1LEIA 1OF2A 4UV4L 3V4VH 3G08A 4LGSB 4MB5A 5ALBL 4HS8L 1A7PH 3GM8A 1INEL 2O5ZH 5TPWL 3U30C 4JFHE 4OZIE 1KB5B 1KBGH 1U3HA 1C1EH 1U8NB 5BQ7A 2H45A 5D7IB 2YUVA 1C5CL 1MCSA 3BPOB 5F7WC 3OGCA 1QRKA 5IMMB 5F3BB 4WO4A 2P5EB 2HTLC 1UEYA 4OI9A 4BYHA 3BQUB 4CU8A 1ZHNA 2ICES 4ODWB 5DJAA 3QFJB 2CKBB 2QQLL 3SN6N 4PJ7B 1D3CA 1OAUL 3WNOA 4NQDB 5SWZE 5FKAA 2YMXL 5BV7H 1GGIL 2YZ1A 4I1NB 5B8CB 3CH8A 1K4DA 1YY8B 3FT4B 1HILB 2NY3B 2AGJL 2E9BA 2W07A 3MGTA 4FTVE 1PVHA 4HX1B 1U3HC 5BJTA 2R2EB 4XXCA 2J88L 1A6WH 1CLCA 1TZHA 5CJ8A 4QXUH 3QQ3B 4U1GB 3H42H 4O5LL 4AEHL 1BD2E 5IV2B 1P7HL 5C0IA 1KIQB 2M1KA 1NFDE 1EHNA 4WO4C 2XFXA 4MS8D 2I5YL 2Y36H 3CFCL 3MRKB 1RUML 2ATPA 2QTEA 3QIWA 4XNYL 5EU3A 3OKLA 3QEQB 5SWZD 4Z76B 1J7VR 1X3DA 2BDNH 3VDBA 1R0AH 1J18A 4M7LH 5GGVH 4QT5A 4KY1H 4Y5YA 2J8UF 4X5XB 4RMVA 2YA0A 2PXYD 2R23A 3DV4B 3VFOA 3HB3D 4X6FB 1KJMB 1NL0H 5DRZB 1DZBA 4H26A 3MNVA 4WI3A 2YZ8A 4MWFA 4ELKB 4XXCC 3BDBA 1ZMYA 4TUOA 3VXNB 2ADJB 3PWPB 5I8OL 1WBYB 3IVKA 3QUYB 3GI9L 4QTHA 1FL3B 2K1MA 2D31B 2QHRL 5DC9B 5ALCH 4LQFL 3O3AB 4R9HA 3GSNH 3T4YB 3QIWC 2RJMA 1Y6KR 2W92A 3VRJA 2AJXL 5DK2A 3IT8D 1PQZA 1Z0NA 3EOYG 3P4MB 3MV9E 4Y5YC 2ZUQB 4OM1H 4Z7NE 3UP1A 2PETA 4OFYD 3LEVH 5ISZE 5F8RC 4HEME 3V6ZA 1O7VA 4LFHG 1YN7A 4FQXB 4NUJB 1XIWD 3ECBB 2IAMD 2MCG1 5CIPA 4EIZC 4XP1H 4RBPH 3HR6A 4JN1L 3IS0X 5GGRB 2DJUA 3FQUA 2VXQH 2XRAL 1ZLWH 1KLUA 3WBDA 4U0QB 5SV4A 4CMHC 3NBNA 3D2UA 5D2LE 3O4LD 3BIBX 1RZGA 2AJ3B 1HDMA 1NLBH 4HIJA 3MV9D 1LO4L 4OLZL 4WJ5B 4YHPA 2YA2A 1VFAA 2FX9H 5F9DC 1CWVA 2YD1A 2XZCH 2JF1A 5ISZD 5MERA 4OTXH 3UPCA 2JB6A 3WS3A 1KTRL 1BOYA 4RFNC 2ZUTA 4NHUA 1CZ8H 5J11C 4WEBL 3O6LL 2X09A 3ILQC 5E2VH 5FECA 1B0RA 1ORSA 4RX4A 3CVHH 3MRJB 3MLXH 3SO3B 1BGXH 5GJSL 5F7EL 5DSCB 3WJJA 1IM9D 4OGXL 1RIVH 3GIZH 3REVA 3EOTL 1EPFA 1VFBB 2EDKA 3BP4A 4PLJD 3WFBH 4Z6AT 3UMTA 3QQ4B 4NYLB 1CDHA 4O2EA 4JPIA 3CFDA 3QUMA 4YC2B 3GMNB 1E6OH 2A0LC 3KYAA 5DRNB 1KTDA 1Z9SA 2UWEA 1A3RH 1RUQH 3VRIA 2W0FB 4K3EL 4UAOB 1NH6A 2YUZA 4HC1L 5FM4A 1DUYA 1SJHB 3FTGA 5D5MF 1IGIH 3FOLB 2DQCL 2BHUA 4UDTB 3VE0B 1PX3A 3KDMA 4MXQC 4ZAKD 5FYKL 2CUMA 3I02B 3WJJC 4PJGF 5I8EA 4YHZH 3L3GA 1R6VA 4ZTOH 5IEKA 1UXSB 3LRGA 4HIHA 3RU8L 5ADPH 2V5MA 3BX7C 4OZGF 4P57B 4E5XA 1NKOA 4KHTH 4N0RA 2C4FU 3STLA 5EBWA 1ZLSH 1R3IH 1JNNL 3G5YA 4F7PB 3W9EA 5KW9H 1S7TB 5D1QA 1RIUH 3LKRA 2HYMA 2XIDA 1GXEA 5L8KB 1NAMB 5T1MB 2R2HA 5FM5M 5JHDA 4LAJH 3E6FB 1QSZA 4PGEB 2AEPL 5BVJB 1P1ZB 4PGDA 5EIIB 1HZHH 3UYRH 4KHXL 2QQKL 2OBGA 3PP3H 4G8GB 4MNHA 4UINL 4DVBB 3ZKND 5EZIL 2ERJC 5IQ7L 4JPWL 4JRXD 4PLKC 3WEXA 2R0LH 1F4HA 4TULH 5DJXB 1DANT 1A9BB 4PREB 4P2OA 1K6QL 5CILL 4PJEA 2NY6C 4Z7QF 4JM2F 5ITFA 5D1QC 2WLZA 3CX5K 3O4OB 1K8IB 5I73C 1KCSH 2B5IB 4JFZL 2FD6H 5D8JH 4C4KT 5JORB 2EDTA 5BZWB 4UTBL 1QLFB 2BY3A 4PGCA 4TUKL 4L3CA 1PY4A 2ATKA 3U7YL 1K5NB 3MLTB 1JWSB 1NLDH 1A6UL 2I25N 4P2OC 2NY1B 3D18B 4TOYL 3ZLQC 5ERWB 3R4DA 4GT7A 5T5FL 3RFZC 2ZUSA 4NQUA 3FRPA 5AZ2L 1OTTC 5BO1L 2D4FA 3KHQA 1I7RA 4LHQB 2KKQA 1PDKA 2AW2A 5DMKA 4X7SH 3QG6A 1YMMA 1MRDH 3CK0H 4N9GB 1J5OL 1L4IA 1KPVB 1VKXB 1U36A 3RNQB 1WCBA 4U1HB 4PBVC 1H8NA 2HJLA 4PRBA 4JHZA 2ICWJ 1Q9LB 3X11B 2VR5A 3IDMB 4CVZA 1U8MB 4XH2A 3FO1A 2H9GB 3FQTA 4X4ME 3MRNB 1DDHB 1KG0B 5CJ5A 3SQOH 3WN5B 2G60H 1X5ZA 4K9EL 1P5UA 1B0GA 2AXHA 5AWNL 4KK6C 1CE1H 4W70A 4CMMB 3KYNA 1M7XA 1IEHA 3OHXB 5DMYA 5ABDE 2VXTH 1KYOJ 2JTDA 2Z4QA 3IJSB 4URTB 1BVLB 3PL6B 4QHUB 2GK2A 1A1NB 3MRPB 1S78D 3C09B 4H1LB 1RUKL 1FL5A 3BH9A 5IOPB 3QUZD 3ZYIA 2XWTA 4PJIE 4NWTL 1DBAL 3FQRA 5IFJA 3RNKA 5J6GB 2Q6WA 1R3KB 2IMNA 2B8OT 4LDLB 2EKSB 2I60H 3QDGB 5IBTH 2Y6SC 2Z35A 3UZEA 3QQNA 4MGXA 2Z93B 4KMQA 4QKXB 2D7TL 1R3LA 3X14A 3BIAX 1KLGB 4IMKA 5C08E 3RIFF 5K59E 4I3RL 2QR0A 1F42A 1MEXH 1YYML 2A2QT 4CJ0A 1RZFL 4RBPK 1EEYB 4QHKI 4HUMB 1ZLWK 3B2VL 4YXKH 3DI2B 1OOAA 2OTWA 1UACH 4XVJL 4ESKA 4G5ZL 1CN4A 2PTUA 1U8IA 4DGIH 3L3KA 3LEXB 3RWFA 2PN5A 2NXYB 2P46B 4QXTB 3SKJL 5CBAB 3H7LA 1UA6H 4MSWB 5FUCE 1QHOA 4YDLC 4G7YH 4PS4L 2G75A 4F8QA 1MY5A 2YEZB 4OSUL 5E5RB 3GIVB 2OI9C 4GLRH 1HSBA 4IMKC 1GPOH 3BWAA 1G7HB 3SDDA 3K3QA 3B9KB 2RFXA 2B20A 1NMCB 3OAUL 3AREA 3OKDA 3RKDD 4PRHA 3MCKA 3CC5A 2WZPD 1OP5H 1FYTB 5C0EB 3IFOA 3G5XA 3QCVH 4GQ9H 1W0VA 3VWJB 3V0VB 3DURA 3MMEA 2J1KA 2AI0H 4XP5L 2NPLX 2X4RB 2DICA 1QP1A 2BFVL 3TZVA 4BZ2H 2WW8A 5BOPA 3MLPA 1VEMA 1R5IB 3MV7B 3V6OE 3MXVH 5E8EB 5EPMB 3WCYA 3ULVH 4NNYA 1PG7L 2L7UA 3MACH 3SKUD 3UTTE 1FLRL 4N1EA 4QXUL 3SDDC 3QHFH 3QG7L 4BSVB 4UTAL 3L7FA 1XGRA 4H8WC 4NSKA 4JFFB 3ULVE 2I27N 3K74B 3NIFF 3AREC 2WSKA 3F12B 1KEML 1I7ZB 2A83A 4X6DF 2BRQA 1FFNA 1FL6B 2IFFL 3HE7D 4WEMB 3RGVB 5E6YA 3ZZ1A 3GSXA 1J1PL 3BESR 2HRPL 3X12B 4TQEH 5HHME 3V9FA 3TZVC 3WIHH 2VLRE 4LCIH 4KY1L 3MBXH 4GKZA 3VI3F 2Z31A 3OX8A 4L8BA 5C07B 3T65A 3CZJA 3EAKA 4GSDL 3O6FD 2D9QB 1T6VN 5L2KB 3VGFA 1U2CA 2GITA 4FQ1H 1DLHA 5TDPA 5HYEA 4C58B 4M8QB 1VGKA 1NUFA 3MBEB 4XMLL 2FEEI 4HJJH 4G9FB 3RL2A 2EYRB 5DTFB 3CSYB 2EE3A 4XP6H 5ALCL 4P5KA 5EC1A 2JCCE 1CXHA 2DQIH 2Y5TB 4NO3A 5HHMD 3T3MF 1IQDA 3VFUA 1P84K 5INCA 8CGTA 4G3YH 4OLVL 3HCVA 4X7TB 4H0GA 3PP3K 1KELL 3HE6B 3TWCL 5GRWA 3T0EE 3ARWA 2Z31C 2DQJL 1BQLH 3K4DA 4LLWB 3Q6GH 1YQVL 1I1AD 3DUSB 1YJDC 1MAKA 5TDNA 2IGFH 4Z78A 3FFDB 5JR1L 2R4RH 5DD6A 3QDJE 3GJEA 5IMMA 1MCPL 5GSVB 4OZFB 3MPCA 4C83B 1CBVH 4X7DC 4Y5XB 5HI3C 3KYKL 4JO3H 1RVFL 4ODWA 5B38G 3Q6FA 2CKBA 4LSVH 3ZDXE 4PJ7A 3T0ED 3U46B 4UNTA 4IM8A 1QFUH 4ORZC 3O41B 4PP1D 4NQDA 3WXVH 1Z5LB 3BKCL 4P59L 5B8CA 1YY8A 3FT4A 3VJ6B 1HILA 2DQDL 1N7ML 5C70A 3LN5A 2VERN 4PB9L 3UO1L 3U0PA 1BFVL 1JZ8A 2AK4B 3DMMD 2R29L 4HMCA 3NABH 1CD0A 3K8LA 4HX1A 1JP5A 1X5XA 3QQ3A 3U0WL 2BRRH 5IV2A 3BPOC 4YXLH 1RZ8A 1KIQA 3RIAF 1L7IH 1EFQA 3B2UD 3MRKA 1CGUA 1NGPH 3BIKB 4PJHB 4XBGB 4OKDA 4Z76A 3FJTA 4PJ8B 2W9LA 5T1DL 3QXDB 5F88A 5DVOA 1S7UB 1JF6A 4WVRA 4PY7B 4X5XA 3TC9A 5B8CC 4RZCB 5FYJU 3EJZC 3SDXB 2AEQH 3BVNA 3UC0H 3DV4A 3MFFB 4X6FA 4X8JB 1KJMA 4JZOA 2ZOLB 1NSNL 4EQ2A 1BZ9B 1X6NA 5IIEB 4ELKA 1RJYA 4U1GC 1TVHA 3VXNA 1F4WL 3CLFL 1URLA 1RZIA 2D31A 1GAFL 3QEGL 1INDH 3O3AA 3BRGC 4QHMA 1WFUA 5JIHA 1A1OB 2VLKD 3VD9A 2KH2B 3P4MA 1I9JL 1JI1A 1ROWA 3MFGB 2ITDB 3GJFH 1NEZG 5DQJB 4OZIB 1IJ9A 3R1GH 2IJ0C 2UZIL 5JXAH 5D1ZD 4GQPH 4YBLC 4FQXA 3LEYL 5LKNA 1N5AB 5GGRA 3WFHA 2G5BB 2IALB 4DKEH 5I9QB 1NGYA 4UILH 2XZQL 1HH9B 4NKQB 4XP9L 4PV9A 3S3JA 1MJ7L 2AJ3A 3VXTB 5E1AB 3UZVB 3ZDZF 4DCQB 5SWZB 3ZYJA 4ZMAT 2JJUA 3THML 4CU6A 2CLVB 1G0DA 15C8H 2KL6A 3IKCB 4M7ZB 2ZUQC 3S4SA 2BNUA 3UPRA 4NM8H 2PXYB 4L9LB 5A2KH 5B3JF 5BV7B 4PG9A 4FQXC 4QLRA 1BD2B 4PJXF 4HKBB 1UVQB 4NPYA 2FD6L 5DSCA 1NFDB 3S5LG 5E70A 4I5BB 4RNRA 3FFCD 3DGGA 5IF0A 5IBLC 5KVFH 1H0DA 4U1KB 3U7WH 2HKHH 2FB4H 1VFBA 1OP5K 1EEZA 4OGZA 3AB0B 2MQCA 3QQ4A 4NYLA 3O2VH 2XTLA 1T6WA 3BP6B 2DAVA 1FBIL 1ES0B 1NPUA 3KVQA 3T8XB 1RZ7L 3PNWA 4YHNB 1FG9C 1SJHA 3K81A 1XIWB 2VL5B 3SO3C 4Z5RA 2X5PA 3I02A 1H8OA 2D3VA 3MGAA 1OP3K 4Q6YA 1LDPL 4NQEE 1IGCL 1MREH 4XNXL 2AAVA 4AIZB 2H1PL 1QRNA 1CR9L 3D87B 4OF7A 4P57A 3MV9B 3GSNB 4XPGH 4KMTH 4F8TA 3LD8B 3W39B 5ISZB 3SQOL 1WTLA 2R0KH 4R4BB 5FCUL 1YEHH 3TYGL 4UAOC 2N7AA 1JZ4A 5IB2B 1N6QH 1S7TA 2NZIA 3BKYL 1LEKB 1T2JA 3DETC 3NTCH 1S8DA 1NAMA 1TPXB 4Y2DD 1NGXB 1GL4B 3E6FA 5GRVK 1GC1H 3UJIH 1UH2A 5BVJA 1IM9B 4MD5B 1X5HA 5D2LB 3GK8H 5GGSB 1F3JB 1FFRA 4BSJA 4J23A 5DK3A 5KVGL 7FABH 3GSOA 3VXUE 3KNBB 4HJ0C 3MJ7A 4G8GA 4DVBA 2CDGB 4P2RA 2I60L 3NFSL 4FQCH 4LSRH 2FR4B 3VW3H 3JWOL 4M7LT 4PREA 4NFDA 2PYEE 4IOFC 3UJJL 2NY2D 1CI5A 4PFEA 3BRFA 5DVLA 3RHWF 3NFPA 1MRCH 1NAKL 3QFDB 3IDXH 1S3KL 2JB5H 5JLZB 2Q8AL 3ILPA 4ZAKB 1YEIL 4F58L 2OXHA 4WFFE 3D6GA 3O6KL 4JDVB 5JQ6H 5GHWH 3LKQB 4GG6F 4Y7MA 5D9SB 3RKPA 2PW1B 1CL7L 5GGTL 4U3CA 3VXUD 5GS0D 1QLFA 1G7LB 3BP5A 4HFUL 4YH6A 3OKOB 3TVMA 1QFWH 1L9MA 3VA2C 1K5NA 2PYED 2Q1EA 4YHKL 3WIFA 3RVXC 3H0TB 3HS0A 2A9NL 2W1NA 4HGMA 3PWNB 1KCRH 4X99B 1WBZB 2MKWA 3RY6A 5AYUH 3LH2L 3W0WD 4MZ3A 5DD3L 4PRNA 3TT3H 1YEFL 4GH7B 3RPIB 3WNNA 5C0FB 4N9GA 1JF5A 1AR1D 1NBZB 4DKDC 1WWWX 2P5WE 4KTEL 3X11A 1Q9LA 3TVMC 4BZ2L 4CN6A 2H9GA 4XAWH 1FNLA 1DDHA 4RGMC 2ZCKH 3WN5A 4NQVB 2NY1C 4MAUH 1UM6L 3SE9L 1T2XA 3C5ZD 2Y5EA 3S3SA 2FRGP 1SM3H 3RY6C 5EZOH 4CMMA 2DLFH 3OHXA 1A6VL 4LLUB 4HWEL 1ZHBA 3IJSA 1WGOA 3SQBA 1KGCD 3VXPB 1BVLA 3PL6A 3M17B 4QHUA 1G7QB 3MTRA 4NT6B 4IIQB 5CS7A 1QPXA 3QI9A 2W9DH 2ZKHL 2EIEA 2FGWL 4ZFFB 4MNQA 2E7LA 1R3KA 5E03A 1FFPA 5ENWB 3D3VD 3SKMB 3CPLB 2EKSA 2IPUG 3QDGA 3WIIH 4Z7OE 2O93L 5DMIH 3WN5C 2Z93A 3IF1B 5C09A 1F6FB 2FJHA 1SY6L 1LNUB 3GJFK 5MENE 3R0MA 5LCVL 5GRVL 3QUXD 4NZTL 4LPYA 4XXDB 3KJ4B 3OPZH 4KAQL 2IWGA 2IBGA 3BN9D 1EEYA 3PL6C 2GYSA 3C09C 3ZKXB 1HXYB 4R7DB 3QI9C 3PQYA 3L1OH 2F8XC 1N6VA 5DD5H 3BO8B 3QH3B 3LQZB 1UGNA 4U7KA 5TQ2H 5J4MA 1CXIA 3SHSA 4H25B 3LEXA 5I1CH 4JB9L 5E8PB 5I6XB 4WW2B 2XN9E 2VDPH 4MSWA 3MOBL 5AUMA 3KGRA 4P2QA 3IDGB 2FEDD 3MLVL 2OLDA 1TITA 4KKLC 3GIVA 1TETH 3DV6B 2VH5L 3ULUC 3T0AA 4AZ8A 2HH0L 1G7HA 3UAJC 5D4QA 3B9KA 1HQ4B 3F5WA 1JGLL 4EDWL 2R4SH 4Z7VA 3MREB 2IQAA 1UZ8B 3OR6A 1FYTA 1YPZE 3HUJF 5C0EA 2HKFH 3FZUC 1CBVL 3L5HA 4M93B 3QUZB 4KK9C 3T77A 3H9HB 5IROA 5ICZB 3VWJA 1DBML 3V0VA 4Z7WA 4QRUB 2X4NA 1AE6H 5KANI 4U1IA 3AUVA 3LKPB 2X4RA 2XN9D 2CD0A 4M7JH 1A0QL 3VXRE 3ZTNH 3GSUA 3WXVL 2AABL 1R5IA 1S7WB 4F2MA 4U1NA 5IGXL 3JUZA 5EPMA 1WUNT 1A5FL 4ZUSA 4NZRH 5F1OB 1OQOA 4AG4H 4G80B 4JY4B 3RVUC 3B9KC 1FP5A 4TTDD 4Q0XH 4KDVA 3RTQD 3F12A 4FFVD 4JZJB 1FL6A 3RGVA 2VDLH 4N0CC 1NGPL 5CMAB 5IROC 3VWJC 3VXRD 2F19L 3DNKA 4PJAE 2VXVL 3RA7L 3FO2B 5DJ0A 5C9KA 4OM0H 4HPYH 5C07A 2ICEB 4KZEL 3DO3A 1MAML 4XP4L 2EE9A 3GMOB 5C08B 1LO2H 5BVPH 2CGRL 5L2KA 3CU7A 1QQDB 3UTPD 1RQ5A 4IHOB 5D6CB 4GAJH 4S2SB 4OLWL 4Z7UF 1AHWB 3MBEA 5CD3B 2EYRA 1XMWA 3CSYA 3TA3B 1OTUD 2C9AA 4YHIB 3RGVC 3EGSB 2CH8A 4HWZA 3E3QC 2DKSA 4YWGH 4TSCL 5K9QI 4FFWC 4XWGH 4M03A 1UWXH 4X6BB 3BSZL 2X9XA 4HWNA 5HGBB 4AK1A 2K3TA 2Y06L 3DUSA 1DEEB 1T4KB 3I6LE 5KG9A 2E9JA 3IDJB 4HH8A 3FFDA 3D85D 3GB7A 3OJDB 1CU4H 1JTTA 4WW1A 5JO5A 1IEBB 1HWHB 3G6DH 5CAYB 3NPZB 5CLWA 3MBEC 4X7FC 3W2DH 4P3CH 4BFGA 5GSVA 4OZFA 1S5HA 2J3SA 4C83A 3R8BB 4M02A 4Y5XA 3HE7B 1T22B 3OSKA 2VTFA 3L3DB 4Z0XB 1D9KD 1XF2B 5FF6A 2OTUB 1GOFA 1D5ZB 4F7CA 2DIJA 4Q58C 3O41A 5M94B 3TM6A 1Z5LA 2H3NA 4Y19D 3BZFB 4K07A 3VJ6A 2PNDA 4GO6B 4ENED 4JCMA 2AV1B 2ZG3A 4JRYD 4TSAL 3O6FB 3NCCB 4D9QE 3UTTB 4KK5C 2VDMH 4QRTB 1NGQL 3BZEB 3I85A 5GPRA 3D0VB 4X8XA 2QBWA 4NJAH 4OLUH 1SEBB 1XCQB 2P8LB 1DTUA 1A6TB 2P24B 4LVHC 4Y5XC 3BIKA 4GS7C 4PJHA 5HHMB 5CBEB 2VO5A 3O2WH 1TZIB 3O2VL 3FT2A 1C12B 2V7HB 3QXDA 1DQML 2ZUWA 2OTPA 1S7UA 4NBXB 4HKJB 4PY7A 1DL7H 5FCSH 2CK2A 4D9QD 3CFKB 4N0UE 5JA9A 3KWWB 4X8JA 1BQHG 2XY2A 2Y25A 2QSVA 1I1AB 3LB6C 4Y16B 1E27B 3WO4B 2R69H 1Z6JT 4KKCC 1ITBB 1FCCA 3C5SA 3OTTA 4HCRH 4FZEH 2PCPB 5DGQA 5TE7H 3QPQD 3KS0J 3V7AG 3B9AA 1QTYT 1SMOA 5T5NF 5HHVL 4PJCE 3GM0A 4P2CG 5CKAA 1FZKB 5I2IB 3WNLA 2YWZA 4KGLA 3T0EB 3IJHB 3NA4A 3DX6B 3MUZ1 3IS1X 4NP4L 3UXFA 2F5BL 3VD5A 5DQJA 4HK3J 3LQAH 4DZ8A 5IFHL 1EERB 4POYA 1KIUA 3HPJA 3DMMB 1W2KT 2CMRL 3H3PL 3QB7C 4XC1L 1WZ1L 5HBBA 4PRIA 4CADB 1N5AA 3QDJB 1GC1L 3FAXA