3TCXA

Structure of engineered single domain icam-1 d1 with high-affinity al integrin i domain of native c-terminal helix conformation
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MVSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLTVYWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion molecule 1
publication title Structure of Engineered Single Domain ICAM-1 D1 with High-Affinity L Integrin I Domain of Native C-Terminal Helix Conformation
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 85
sequence length 85
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W, Y, a
ec nomenclature
pdb deposition date 2011-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tcxA00
3EGSA 3VXUD 4OI8A 4MAYA 3SJVB 2GJ6E 2H2PC 3P11L 4K8RD 2A74A 2XFXA 1XGUA 1OSPL 4ELMA 2V6HA 1K2DB 5I8EA 4WGWB 4LHJB 5IEKA 1RUML 4OQTH 5KANG 1INDH 1C5CH 1MFBH 3WNNA 5D1QA 3NZ8B 5I15H 4PRHE 2JELH 4HCRL 1U8QB 2R4SH 1A6TB 3IDYB 3V5HB 4M6NH 2EE2A 3OPZL 3UTSE 3LN5A 3MA9H 5ALBL 1J8HD 4BQ9A 2CRYA 1DL7H 1A1MB 4OCWH 1N5AA 2CIIB 1FIGH 2AP2A 1RK0B 2VUYA 3QFJB 1RU9H 3V5DA 4FQPA 4PS4H 4G6MH 3HUJB 2ZOLA 3ESVF 1EVUA 1AXSB 2C1OA 4ZUUA 5J1SC 1ERNA 1S78D 4PRNB 1A6UH 2BSSB 2BY0A 3HI1B 2YKLL 4P4RB 5HI3D 4LSPH 4PY7A 1KJ2B 4ZOAA 3GBLA 4FQIL 1DBJL 4B50A 5K9QI 4AT6B 4Z7WF 4U6TA 4NUJB 4XC3H 3I6KB 4H0HB 3FN3A 2FBOJ 4RFEB 5B8CC 3C8DA 4F7MA 4IBLT 2BHZA 2X9WA 5KSUB 1PX3A 2W0FB 5EZIH 4EI6A 4M6ML 3MV9D 5LXGH 3MXVH 4TSBH 1F97A 2FECI 3TVMA 4PGBB 5BZDB 2BRRH 1NSNH 4JVPA 5IVOA 3F6IA 1K4DA 3UJTH 3MLRH 4P46B 4QHKJ 1HCVA 4WGVB 5J3HC 3EYVA 1UYWH 2BK8A 4M7JL 5HYFA 2VE6A 4NQDD 5C0ND 3F7YB 5TGBB 1A7NH 4UV4L 1A7BA 3BKML 4FTVA 4U6VL 4POUB 4JVWA 1U6AL 1FDLH 3T0EA 1Q9KB 5HHVH 4YDLC 3VFRA 5E5MA 4ZAKB 5KOVC 5ILTH 4XVTL 1JIBA 3I6LE 5SWZD 5IB4B 2CUMA 1W2KT 3S4SB 5JOFA 1I9JL 3CSYB 3VMOA 3ZKND 2VN4A 2XPGA 1X44A 4NFCA 3D39A 5E2UL 1N3NB 32C2A 4CAGA 1CLYH 1TDQA 2VZ3A 4ZDHA 4LVNC 1DCLA 4F15C 2Y9RT 5F89A 4OFYA 5D96C 2HTKD 2W65A 1NCDH 4KKLD 3KLAA 2Y23A 2YMXL 1FNAA 4QWWD 1PD6A 4DEPC 2O5ZH 4GRWH 4G7VL 1CFNB 2Q7YA 4YPGA 3QUYB 1PSKL 3F65A 5F97E 3NFSH 4JFPB 1JI2A 5DJ6B 5I17B 2Y06H 3HRZA 1OCWH 5E8NB 2FCBA 4BQCA 5DD3L 4JM2A 1RZ7H 1HZHH 5IIEB 2DB8A 3EYUH 4PG9B 2EO1A 3SPVB 1MNUL 3TLRA 3PWVA 3NCJH 3A67H 4FQLL 1PYWB 1JTTA 1IFHH 3K80A 3MLTB 3PHQB 3ROOA 5ACZB 4UQ3B 1C5BL 4DK3A 3ALPA 1BBJA 4OZGB 2J6EL 1ZHLA 4OGAC 3BUYB 4U6HB 3OXRB 3WFHB 1KN4H 2AGJH 1JGDB 3QQ3B 2AI0H 1ORQB 4HKXA 1FV1A 4I3RL 3RWFB 1LE9A 2CMRL 3SDXB 5IGXL 1IEBB 4F7EA 3EJZC 4PJCB 2C3VB 5J1AA 2IFGA 2H2PD 4R0LB 1RI8A 4PRIB 2YXFA 2A9MH 4YHIA 1QBLL 2VJXA 1G84A 3OG6B 5EBGA 5GS3A 1HHKA 3RTQD 5AUMB 3I85A 4HUMB 3K4ZA 1IM9D 4M4RA 3HPJB 1EGJH 4PY8J 5ALCH 5C8JB 1BIHA 3RPIB 2YWYA 4JDTH 1UWEL 5KN5B 2X4NA 4MA3A 3VXNA 3U1SL 4RGNE 3KPLB 2BVUA 3PWJB 3HR5B 5J0BA 3NPSC 4QHLA 5CEZL 1XT5A 4TSCL 4G9FD 3ARBA 2UYLA 5B3JF 1VCAA 2WUCL 3FB6A 2OTWA 1DE4B 1KNOA 1KTDB 2HVKB 4YXHL 2PNDA 1P7QA 1MIMH 5FYKL 2JJUA 4K94L 5BV7C 1GCFA 4I5BB 4RGOH 4GOSA 1YPZF 2A9NL 1SVCP 1A7PH 2LAGB 3X11A 2CO6B 1JZ7A 3SBWC 3VFVA 1J1OL 3VRJB 1Z9MA 1JPST 1R0AL 1A3RH 3SY0B 1WJ3A 1G7JB 1YDPB 1ZXQA 1T0MB 2O5XL 1AY1L 5E2VH 3GSWA 5E1AB 3ZTNL 4MA1C 3O6FA 5SV4A 3WBDA 3NN8B 4WJ5B 2CRMA 2A6KA 4WV1B 3WFDH 4DQOL 4LF3A 4JR9L 4NJ9L 3WLWC 2IC2A 3BO8A 3H3PH 3CVHA 3CVHH 1H3GA 4X6DB 1LO0H 4QRSB 2PO6A 2E8ZA 4RGMB 1MREH 3LKNA 2APWA 2BSRB 3Q5OA 5I8CA 4JO4H 2OSLB 4HWZB 1KCRL 2MWCA 3N1QC 3QG6A 1CD1A 1T80A 2FZ3A 2BNUB 1CIUA 3SOBH 1UKQA 3VXQB 1HKLL 3ULUH 3G6JA 1P9MC 4UIMB 5FCUL 2P7TB 5I1GH 4XAWL 1D5BB 2VXQH 5FKPB 1MPAH 2C3GA 3ARDD 4TUOB 5MEND 3KPOB 3CSGA 1T5XB 3UPRA 2RR3A 3QQ4B 3V6FA 1HCFX 3B2UC 4GRWE 1A22B 4HMDA 5T1KB 2I07A 1UADC 3IDUA 4L8SB 4I0PC 1F6AB 1EBAA 3AREA 2YC1B 3NA9L 5E6YA 3V5KA 1SYSB 1EAPB 5EZLA 4LLUB 1OVZA 1YMHB 2X44D 5DLMH 3B6SA 4OFIA 5T3ZD 1QFWL 5HJ3A 1OW0A 3D6GA 4N0UA 4C83A 1DLHA 3LB6D 4JE4B 4L9LC 1F6FB 5F9WC 3CD4A 1C7SA 1EJ6A 4I13B 4NNXB 4JAMB 1FNSH 4HX1B 4KK5D 1A4JB 5C0GA 1QRND 5ACLA 5JW4Q 5KS9F 5TFSH 3MRCA 1PLGL 2P5EA 2NTFA 1MJJB 3UBXA 3DUUB 5AYQA 2ZSVA 2ADGA 1NLBL 5FDWB 4BH8B 4PRBA 4IJ3C 3OWEA 3WDJA 4JFFB 5EWIL 43CAB 3BRDA 1IAIH 1K8IA 4B7IA 4DZ8B 3D3VA 3MOAL 4P49A 1NMAL 2F58H 4JPVL 2JB5L 1EMTH 3BEVB 3CCHA 4NN5C 3L95B 3VFMA 5IR1A 3V8CA 1S9KC 2UUDH 4YDVB 1A4KB 2R2BB 2CLZA 3EO1A 3LKPB 1OQOA 3G5VA 3EJZD 4ZD3L 3O3UN 2AK1L 4LLWA 1HHGB 3GI8L 3TBTB 3UDWC 2BVYA 4KI5D 1MJ7L 3K8MA 2BP3A 4PV8A 2NY4B 1I8MA 5HY9B 3QEGH 4OD2A 4J8RA 5CSZA 3LSOA 5I1KH 1MCLA 3Q3GB 1HHHB 3LKSA 2Z8VC 3DV4B 2QSCH 5C2BL 1EJOH 3QT2A 5ETUB 1B0GA 3S36H 3WIHL 2Y07H 3MV8A 2LU3A 3ZKXC 3WJJC 5EC1B 3DTXB 3GI9L 3BQUB 4MQ7A 4UNVA 1FNGA 1HQRA 3DURA 1DSFL 1K8DB 2FGWH 1E6JH 4XPTH 3P0GB 5EN2A 3GRWA 4IOIA 5D7LD 3LEVH 4YWGH 3MODH 4WEUD 5IF0B 3JXAA 1WICA 3FO9A 4GH7B 1L6XA 2VABB 1NC2B 2L0DA 4NN7B 4NHCH 4DFHA 5DK0B 3EO9L 3ORJA 4M43H 1MEXL 4C56D 2VLRD 3GKWH 2JK5B 3IB4A 2B2XL 2OL3A 2OL3H 2QHLA 3DVGB 5HDLA 1ZT1A 5DMYA 4K3GA 5TQ2L 4PJFE 4N8CH 4QLRA 4MNQD 3QXDB 5KJRL 2DWEB 4GBXA 5FHBL 1FYTB 3NCYS 5CSBA 4ZOCA 3RGVB 1FZOB 2NYYC 4RZCB 4U05A 1RVFH 3IDXL 4Y8AA 1LHZA 3ULUE 4HKJA 3SDCC 2GEEA 1J18A 3WLWD 4EDWH 3INUL 4V2CB 1MAMH 3G08B 4UB0H 3SDYL 1H0DA 2Y5TB 4JN1L 2CKBL 1U3ZA 1CICA 1OAZH 1NMCB 5FF6A 4XNYL 3O3EA 3QA3B 4HUXA 2YD7A 3JTTB 2CDFB 2NXZC 4NQEA 4EQ3A 2LQRA 4OF0A 5EG6C 3BGMB 3LH2L 4RDQG 4FQHB 5HPMA 3AM8A 4GUPB 3STZB 4UU9A 1KCSL 5JOPE 4WNQA 5GS2D 3EAKA 5E08H 4MJIE 3HUJF 5DWUH 1NDMA 4YIQA 4JANB 5GGTA 5CD5C 4N0UE 2HYMA 2AJVL 1S9VA 2GK0B 5CIPB 4YBQC 1Y18B 2NLJB 4N68A 3RDTB 1FFPB 1B4JL 3GHEL 1TZGL 4ZODA 4EZMA 3B2UD 4XP4H 1K9TA 3OJDB 5IHBA 1RFDH 3BD3A 1ZHNA 3HC3L 1QFWM 3RWHA 5FOBA 2PCPA 5D1ZC 2IQAB 1BEYL 1HNFA 5F44A 5CILH 4I0PD 1YYLH 2EXWC 4Z7QF 2G60H 2P5EE 1R3KA 2C5DC 1JPTL 3HG1B 5F70A 3BPLC 3RY6A 4TUJA 3UTTD 5H35B 1JYVA 2EDBA 5ITFA 1FG9C 2P4AB 5JPMA 5BXFB 4XPBH 4PLKC 5HGDB 4ZPVB 3D3VE 1NAKH 1RZJC 3QPQD 1S3KL 1FQ9C 1AO7D 1Z3GH 1UM6H 3DI2B 3SKNB 3QI9D 1G9NH 3UBXG 1F2QA 3REVA 3EO0B 4FNLL 2P44B 2D31A 2XYCA 3BZFA 3GJFK 1E4XL 3ZHKA 1CD9B 5DK2A 2AQ2A 4IRJA 2HKFH 2IPTL 1U8LB 4P5TB 4HH9A 4MA8L 2V2TA 1A14H 3BHBA 5D7SL 1B9ZA 5E7FA 1TIUA 2V9RA 5I6XB 4JFOB 4Q6IA 3WKMH 3GSVB 2X10A 4IMKC 1C7TA 3VWJA 1S8DA 2VDOH 4DOHB 1INQA 4CL7A 1BMGA 3OAYH 1LK2A 1NPUA 5EU3A 4OM1L 4P2YA 3FFCB 1AD0B 4QO1A 3PDOB 3DUSB 5DJ2B 1FCGA 1EO7A 1S7QB 3THMH 2VB5A 2C4FU 1IJ9A 4KDVA 4W4NA 4KROC 4UNTA 4OLXL 2Q8AL 1FPTH 2V7HB 2Z4QB 4OZHA 2AEPL 1OTUD 1DBBL 1NFKA 2JTDA 1JP5A 4PREB 3GJEA 4L4TD 3SDAD 2BC4B 1D6EB 3IFLL 1NC4B 3C60B 2ZCLL 4FFZL 4R2GC 2QQNL 5BVJA 3WL9A 3RA7H 4XMLL 4J12A 4NZTH 1LWRA 1VPOH 3IVKA 4GO6B 3QEHB 4ZFZA 5E95B 3ILQC 3RVXC 2XKUA 4DN4H 4C4KO 1E4JA 3RNKB 3X12B 1YNLH 3GIZH 4LSVL 1FH5H 5ICXB 3VFWA 3JV4B 4KKAC 1E4KA 5I9QB 5IHUH 3WIIL 4GQ9H 4GG6A 1MLBA 1XMWA 2MNUA 1AGBB 2OR7A 3LEYH 3L3IA 1J1XL 5HYQB 4Z18A 3I75B 1Z9LA 4OZGF 1YN7B 3BH8A 3LZFL 1UKSA 5IW6A 3AC0A 5D7JA 1OPGH 4J6RL 4JHWH 4QRPE 1KG0B 2F53D 3HI5L 5L2KE 1U91B 3FQUB 1MUJB 3FQRA 4YXKL 4M8VA 5DMGC 2OMBA 3Q5YA 5MERB 2ZJSH 2NW3A 2AKRB 3OV6A 4M48H 2NXYD 3KPSE 2CRZA 3K2UL 2NX5D 3T04D 4KDTA 4Y4FB 3O8XA 2BOBB 1IQWH 3V0WL 1BFVL 3PWPE 1KEML 43C9B 4NQEE 1HNGA 3MGOB 3BSZH 4N90E 4I4WA 5EC2A 5L0QC 3LRHA 3X3FH 2UZYB 5CJQL 2ZUQC 3SDCD 1FL5B 1BX2A 3WHXA 2DYPA 2JIXD 3QIWB 2WBJD 5KG9B 1CGSH 5JPNB 4LHUA 3MRKA 4S0TD 4A6YA 2DQJH 3OBAA 1G6RB 3MR9A 4DGVH 4XNXL 4HZAA 2D7OA 4OCRH 1IGIL 5I30L 2YD9A 4HAFA 3RWGA 5DRZA 3CDYA 3CXDL 2VITB 2YHGA 5DUBA 1CXLA 1NGYB 3IFOB 4FQXC 5GGRB 5GGSB 4Y1AA 1SBSL 4MDJB 4F57L 4LRIC 5JW3H 3MTRA 3SN6N 3V95A 3CFEA 4LSSH 3MO1A 1E27A 5BJTB 4KRNA 4QOKA 2Q1EA 4U1LA 3U79A 2DWDA 1MVFA 2H6PA 1NGWA 4YQXL 2FNBA 3CFKB 3BVNB 3VA6A 3K74B 1XIWB 2HT2C 1TZHA 3AGVA 2YUWA 3VWKC 3MUZ1 1UA6L 4HBCL 2WQRA 1R5WA 4LCWA 4XAKE 2EXWD 5INDA 4FOMA 4JHBA 3W11C 2QQLL 2Y5EA 5D70H 5EO0B 3VCLA 4GKOA 3QH3A 5D9SA 4N0YL 3WDIA 1N5YL 3UJIH 5L8JB 3LD8C 4G5ZL 4KUZH 4X6DF 2FD6L 3VXUA 4UT6H 4MS8C 2A6JA 1IKFH 3ALXA 3GB7B 1MRDH 3N0PB 4JO2L 4PLKD 4Z0XB 3V4VH 4EN3C 1FO0A 4PGDA 1FO0H 4CMHB 3QIUA 2YPVL 4R7NB 3E6FB 4UILH 1KGCE 4KZDH 5KZCD 1YEFH 4LPYA 1G7IA 4HIXH 4YGVA 4P2RD 2VIRB 4JY4B 4LLQB 4QXGH 1MJ8L 3I2CH 3FJTA 5F7MC 1HYSC 3BDBA 3FN0H 2H1PL 3HMXH 4JFHD 4MD0A 4NC1E 1FZKA 4M3KB 5HHMD 1MHCB 1QBML 4R97B 2VWEE 2P45B 5F6HJ 4CVZB 3L7FB 5C0CD 4OZHE 5DD5L 3B8SA 4ORGA 4HIEA 4WDIB 3VXSD 2XTJE 4BQBA 5HD8C 2BDNL 1BD2B 3G6DL 4EUPH 2HH0H 2YOCA 1KENH 4X9HA 1S7VA 1ZHKA 2NW2A 4PJIE 4ZSOB 4O2CB 5HGBB 4YHPB 3BGAA 5DVLA 4OLVH 5DEGB 1H5BC 4RBPH 4JFXA 3LS5H 2X89D 3D25B 4M7LT 4UOJA 3IAGC 4WRLA 4KROD 2VDML 2XI9A 4X8JA 1MSPA 5E6IC 4ELKA 4GKZA 3N9GH 5CJOH 3QUMA 3VRLF 1RJLA 5C86A 3V6ZB 4FMKA 1M7XA 4X6CA 4DUVA 1NFDB 4YNYB 2IH3A 4R2GD 2EEAA 1FIEA 4N5ED 1I9RH 5DJZA 4K3DH 9CGTA 1F13A 1LDSA 2EYSA 1M6OA 4OFKA 4MMZC 2ZUVA 4LVOC 4ZPTB 1NCNA 5E24E 5DJXA 3BMWA 3I02A 4ZFOL 5C0AD 1MCJA 1RUAH 1AC0A 2W0LA 5FGCE 4YHYB 5DD1H 4L4VB 3TJEH 1NAMA 3IXAB 4HDIA 4W81A 5JNYA 5BQ7A 7CGTA 5ADPH 4XPHL 4YZFE 4FQ1H 2YPKB 2YD3A 1S9YB 2FJGA 3CFDB 4LASL 4G43A 1C12B 2X5PA 4NQDA 3H9SD 1QLFB 3TO2A 1SQ2N 1HHIB 5HGGS 1EV2E 3V4UL 4BFEA 4OT1L 1RV6X 4M7KH 3VXPA 5H2BA 1JK8B 1QLEL 4QGTA 4U1HB 1BM3L 5EOCL 1I8KB 4MAUH 5EU6D 4IRSC 1BQHA 4XP6L 4PRAB 4G8IA 1QR1B 4NBYB 1C08A 4BZ1H 5FAAA 2P8MA 3PQYD 3H3KA 3QXWA 4HUUA 4JQIL 5SWZA 1N2RB 4G3YL 3TBYB 4TPRH 1KJ3H 4NIKB 1F45A 4APQD 15C8L 5JZ7D 2E7LA 3MBEC 1FORH 3MCLL 5FYJD 5KVDL 4K7FA 2W60B 1UB6B 4Z77B 3B8YA 5JA8B 2IANE 1II4E 1BBDL 5MEQB 4H8WL 3D5OF 1XF5B 3BZDA 4JDZA 2VSDA 2OYPA 4QOKE 5M94B 2APTA 4HGKC 2JJSC 4GXVH 5ID1A 3PL6B 2D9CA 4QYOB 4U1JB 1T6WA 5CZXD 2WBKA 1EPFA 1MIEH 3U46B 3B3IB 3G9AB 1MH5B 3O3BB 1RMFH 4LCWE 1D3CA 3ZT7A 2HFEA 4GW4B 2XQBL 4R26L 2GQHA 1EHNA 4KJQD 4FABL 2VH5H 4WI7A 1LO3L 2FIKB 5T33H 1IQDB 4DUXA 1G7PA 3DECA 1DEDA 3E0GA 2VDLL 2N4IA 1G7HA 4WO4C 5FYLD 3U0WH 1I9IL 2VDPL 4P9HH 1VFBA 1Q9LB 2C7UA 2IMNA 2J8UA 3BDYH 3MRHA 3CFIC 3LRSB 3GMPB 2ERJB 1EFQA 2DQGL 1TTGA 4U3CA 3C2AL 3W11D 1SM3H 2I27N 2DQUL 3GFUA 1P1ZB 2FHCA 4CBPA 1J0YA 4M7ZB 3FOLA 5J6HB 1DQJB 1TJGH 5JR1H 1UZ8A 4RWYL 1F90H 2CKNA 1FL3A 5AZ2H 3TA3B 4ZXBB 5TH2A 1J8HE 25C8H 3QUXD 2HFFA 1AP2B 3TNMA 3LKRA 2A0LC 3VW3H 4PRDA 1FN4A 4Y2DC 2CJUH 4MZ3A 1UACH 2OXGA 1HYSD 3IFPB 2MTPA 5CGMA 3LQAH 4Q7DA 3PDGA 5ANME 1RULH 1UB5B 3WSQL 5L2JA 3QZWB 4X83A 2YBRA 5HD8D 3CZFA 4F37K 5D72L 3TGXA 1IGYB 3L3KA 2MMXA 5EU7C 3WXVH 4XHJC 5FA3B 3DSFH 2D4FA 5KSBB 4LKCB 1I3UA 1PEWA 5EORH 3GUTA 4MSWA 2UV3A 2BJMH 1BF2A 1DQQB 4TVSa 1F4WH 3UTOA 4HLZG 1SY6L 2XT1B 3FQNA 3MV9E 5JHDB 5EZJB 2J4WH 4YUEL 2R1WA 1I7RA 3U30C 5GS0H 4JO3L 4NPYB 1S7WA 1ZT7A 1X5KA 4LSRH 4OIBA 3L7EA 1MVUB 1T04A 1TCRA 4XCFH 1U8PB 5GGQH 1YQVL 4OF6A 4NRYB 4U33A 3ARGC 5C6PB 4K2UL 1GVIA 3MRRB 4NQDE 2VKWA 4KRPD 4R6UA 5IBUB 2RB8A 4FQQA 5B8CA 4JM4H 1JPGB 5F7KC 1IC5H 2EKSA 2ATKA 3IDJB 2D0FA 4CN1A 5TDPB 4HGWB 3R8BB 3S3SA 5HYEA 1MI5D 3PG2A 1VENA 5JMRA 3HE7D 3EOYG 4D0DB 4NKIH 5E2WL 4XHQA 4RMRA 4KPHL 4XT1C 4ODHL 2UVEA 1BQSA 3EGSB 4HMCA 5I1DA 1L7IL 4MAYB 5L7XL 1TVBB 4JRXE 4PJXB 2BNQE 2A74B 3JWOH 2XFXB 3L5HA 4NKDA 5DEZA 3PWNA 4K3HA 4ELMB 1UWGH 1P4IL 5EPMA 5I8EB 5C0RL 1ND0A 4WHTA 5DHYB 2MQCA 1BQHG 5IEKB 4JRWA 2DJ4A 4A2LA 5MENA 2AXHA 4NO0D 3T77A 3C5ZD 1T1ZB 1OF2A 1A6VL 5F96H 4NZUL 2Z31D 3NTCL 3GMOA 1AGDB 4MLIA 5GJSH 2GUOB 1QPPA 8CGTA 2DQCH 4BSJA 5C9JA 3ULVH 5ISZE 4WEBH 2GJZA 1J1PH 1INDL 1C5CL 1MFBL 1N5AB 3JTSA 3IS1X 4JHAH 3MV11 5CINL 2JELL 5T3ZH 5D71L 3ARQA 5DI8B 3WFZA 4QY8B 1S7UB 5ECJE 5KW9H 3MJ9H 4ZUUB 4X9GA 5DJDA 4R4FL 1MHHA 3AUVA 3JVGA 3MA9L 2EYTB 4MJ2A 1UJ3C 2WINB 4Z8FH 3K7UA 2IQ9H 2ILLA 1DL7L 2ORBH 1P6AB 3CFJB 1EFXD 4E41D 4OIAA 3OB0H 1FIGL 4PY7B 2KPNA 2ICES 3CC5A 1KPRA 4G6ML 1QRNA 1JL8A 3VFTA 5J7CC 3S88H 5DRWA 1MAKA 4F7MB 4Z78A 4M6OL 3BJ91 3QEQD 1A6UL 4PUBH 3HI6H 2O5YH 3E8UH 4F7CB 3QXAB 4EI6B 1XF4A 3G04A 1JWMA 1YEDA 1U3JA 4XMKH 3S37L 3QAZC 5DJAB 3KXFE 5FO7B 1AKJD 5IG7A 2D4DA 3GM0A 2FBJL 4PLJD 2X4TA 7FABL 2H8PA 1E6OH 2EDJA 4GAJH 1T7WA 4HUWA 2WWKT 3EYVB 4JG1H 3UYRH 1T2QL 2VLKD 4NSKA 2VE6B 2VC2H 3MXVL 2B39A 2X1OA 3EJYC 4TSBL 1C8PA 4FTVB 3MQIA 1S5HA 4OBRA 4MHHI 3ARFD 4G9FE 2GTZB 4S0SD 2B1AL 4XCYA 3T0EB 4XBPA 3MRQA 4LDOB 2V7NB 5E5MB 2QEJA 3MV7D 4V1DD 1YEIH 4EIGB 3QXUA 1N59A 1A7NL 1YECH 4WI3A 1Q9OA 1QEWA 4Y2DD 4B5EA 1CDUA 5JOFB 5I2IB 4AJ0A 2XPGB 4JFQA 5IVXE 5HHVL 3D39B 2NPLX 5A16B 32C2B 4NNPL 2E27L 5C0EA 3T2QA 3P77A 4KGLA 2AJZA 3MXWH 4XHJD 4JKMA 3MLSH 2W65B 1EZVX 1QO3A 5DQJB 3KLAB 5DF0A 5I66A 2Q7YB 1JGUH 4FFWC 3ROLA 2YUZA 1Z0NA 1OSZA 4LARH 4LCIH 2H45A 1PG7L 1CQYA 1CLOH 3DX9A 4XBEH 4PJBF 3ZTJG 4JQXC 1NCDL 4JM2B 3BKCH 4EVNA 1OLLA 3ARGD 4MNQA 2O5ZL 5C0BB 1N26A 3PWVB 4LIQH 3QPXH 5E9DB 2GI7A 3NFSL 4DZBA 4PGCB 3ROOB 1GGCL 1WK0A 1UZ6E 3VH8A 2AS5M 3IDIA 1BBJB 1HZHL 3RI5F 1ZHLB 3EYUL 4JHZA 4Y4KC 4M93B 3NCJL 5EZOH 4HKXB 3A67L 5JA9A 4HUVA 4XMPH 2Y7QA 1FV1B 1RJYB 1YN6B 1LE9B 2VL5A 1IFHL 4JKKA 1EIBA 3DBXA 2YZ8A 3ZYJA 2XNAA 5ESVB 5DZOA 3UO1H 5J1AB 5JORB 1S7TA 5AAMA 3VE0A 5FUZH 3V6OC 1KN4L 2AGJL 1VGEL 2AI0L 5GS2H 4J3VA 1XR9A 1HHKB 5T3ZE 1F4XL 5SWSD 2FRGP 2GSGA 3CXHJ 5FM5O 2LVEA 3WIFA 3KPRD 1JPSH 1KACB 2RFXB 3VGEA 1JJUA 3OKMA 3H42H 1U8KA 1IC7H 2D7TH 2PF6A 2A9ML 1FE8H 2X4NB 4MA3B 3TIEA 3VXNB 5J9PB 1ZSDA 2OXHA 3TJHC 3ARBB 4LCUB 1N6VA 1NFDF 2UYLB 4X4ZA 4I0PA 1QRNE 2IPUK 3NZHL 2OTWB 4JJHA 3OSKA 1ZA3A 3NABL 1P7QB 4G6JH 4JDTL 1U36A 2AV7B 2DM7A 4MXWH 3UTTA 1QSFA 3CU7A 1KTLA 4N1HB 4L9LA 1E0OB 1IAKB 3UTQA 1XAUA 3X11B 3FFDA 1P84K 4IIQC 4LDLB 3VFVB 4BFIA 3SGEI 5M95B 2PXYC 3VFSA 4H5SA 1AO7A 1MIML 3MJ6A 1JPFA 4ONFL 1M7DA 3QI9A 3TESA 4RGOL 4H26A 2I9LA 5ADOH 3O6FB 1NGQH 2IG2H 2JE8A 3FO0L 1LP9A 3SDDC 1I3RA 4YXLH 4OJFH 2A6KB 4CMMA 3SCMD 1A3RL 4KI5E 4LF3B 2NY6B 1OP5H 3V2AR 5EIIA 1G0YR 1AGCA 1TCMA 2VO5A 1JN6A 5E2VL 1FNHA 4O02H 4PJEB 2PO6B 2VZUA 4X4YA 1NMBH 4G8EA 4X99B 2ZUTA 3TBWA 5I8CB 2DIJA 4DVBB 3WFDL 5DS8A 1CD1B 3H3PL 5JIIA 3CVHL 3FO2A 4X6EA 1LE5B 1HINH 3UDWA 3G6JB 1LO5B 5FUCE 1IGMH 1KELH 2G2RA 4JO4L 5D7LE 4H88L 4OCXH 4PD4K 1PY9A 3V9FA 3UPRB 3MX0A 4L4TA 2EH7L 3V6FB 3EYSH 4EI5C 4X6BA 3SOBL 4MJ6B 2BXZA 3ULUL 2UZIH 3WJJA 2AJXH 4C56E 2VLRE 2E9IA 4QRRD 4OZFH 5CP3A 5I1GL 4OZFB 5F7EH 2VXQL 3H8NA 3AREB 3P0YH 4UQ2A 3OZ9L 4TRPH 3SKJH 3V5KB 1A0QH 3SE8L 1WIUA 2YRPA 3QCTH 4I18C 4HC1A 5HJ3B 2Y72A 4C83B 4MNQE 5IFJA 1DLHB 4HV8A 3W9EB 4LIQE 3BW9A 2J5LC 2DM4A 1GJIA 4BA8A 1VADB 2N1KA 4RMTA 4KKBC 3RX8A 3HTLX 3RL1A 4GW1A 5JQ6H 1Q72H 3REWA 1TJIH 4NCC1 5DLML 4XB7A 5C0GB 1R24A 2H9GA 2F53A 2BVOA 1QSED 1X5YA 4AM0B 1UEMA 2NZ9C 4X80H 1MWAH 3X17A 4PGEA 1OT1A 1A6AA 4Q97A 4CKVX 2NTFB 4YAQB 4IMLA 2NX5A 3VRIA 1T2JA 5IB5A 1FNSL 4K7PX 4IOFC 2ZSVB 1O7VA 4P23D 1G7LB 4PRBB 2AJYL 4IRZL 4OD3H 3D48R 3D0LA 3VH8G 2ICWA 4Y16D 1K8IB 1PZUB 2DMKA 3SDCA 1GIGH 1GGBH 1H3PL 2JIXA 1DTUA 3TYFA 4HBQA 5FGSA 3VFMB 5IR1B 1IE5A 3P73A 1QYGH 5CS7A 2CLZB 3EO1B 1V8HA 2EZ0C 4ZUTA 3P30H 3IRPX 2ADFH 3EFDH 1K3ZA 3G5VB 3NPZB 4MCYB 4LLWB 3ELAT 4L9DA 1UM4H 4PV8B 2F58L 5GIRA 1EMTL 1UXWA 4U6XA 5J4MA 2WP3O 3LSOB 5C08D 1FFRA 3LQZA 3LKSB 1NCUA 2OX5A 5DJCB 3QXTA 2EIZA 3WFCL 5D1XC 3UTTE 1B0GB 5GZOC 4XTRC 1OL0A 3MV8B 1DQDH 2HT3D 3KPTA 4NCDA 3PGDB 5DO2C 5F7HA 5ICYA 1CG9A 1NCAH 2YPLB 5IB3A 4JPWH 4QF1B 4U0RB 2IALA 5GGVH 3FT2A 3D18A 5I1KL 3HCVB 3NOIA 4LCYA 3TJHD 1WCBA 1D5XA 2QSCL 1HQRB 1I7ZA 2DQDH 3KS0H 3S36L 1U8NA 2Y07L 2VDRH 5MP6L 5DVOA 3MYJA 3GIVB 1AQKL 3MGAA 2IAMC 1CQKA 1OGTA 3KLHD 3OJVC 3VXRA 3FO9B 2FX9H 1PKOA 4L4JA 2R1YA 3L3JA 2R0KH 2IBZX 2X4SA 4L29B 1I85C 3BESR 4CADB 5DJ0B 5GRWA 2P8LA 3JWDH 3BEWA 4JZNB 1MCQA 1U93B 2R1XA 3P3YA 4Y5VA 3IYLW 5F1IA 4GBXB 4P2RA 4E5XA 3SDDD 4M43L 4ELMF 1JRHI 1F00I 2X42A 1EH9A 4H8WC 2OL3L 1MAJA 2B8OT 5K93A 5C0CA 2VQUA 1U2CA 3MCKA 2BVQB 1SMAA 4N8CL 3SO5A 4WHYH 4IMKA 3VFNA 4RFOL 4PRPA 4LLYA 1UENA 4KJWD 3ETBF 4JN2A 3BRFA 5DURD 1RVFL 3O3EB 4XPFH 3IDGA 1TQBB 1W72H 1PVHA 4EDWL 2NNAA 2XZCL 1RK1A 35C8H 4LLMA 5IROA 3QDJD 4UB0L 2X89A 3MGTA 1RZKL 4UU9B 4WNQB 5EU5B 1JF1A 1LD9A 1OAZL 1P7KA 1NDMB 1QOKA 4YIQB 2NY0D 2W9EH 5C07D 3LMJL 4HK3J 4OKDA 4Y4HC 5TQ0L 4N1CA 2VERN 2AV1A 2WLYA 3B2VH 2UY7A 4EI5D 2BCKB 3QDAA 4M5ZL 3VA2C 5TE7L 1ZHNB 4FZ8H 5FOBB 4HJ0C 3BP6A 2PCPB 2F53E 4XCNA 4NDMA 1C5DA 5C0AA 2HMID 4ODBD 1ZLWH 1CDBA 2CXKA 5MI0B 4HLJA 1HWHB 3IDNA 5H8DA 2Z93B 4M1CC 3QNZB 3GMQA 3B9KB 4OB5H 2GY7B 4Z7VE 2X1PA 1B6DA 3L5JA 4MQSB 5BZWA 4XP4L 3ECBA 4TUJB 2VOTA 1TENA 4PJAA 1X4XA 5ITFB 1U9KA 4HEPG 1QVOA 3ZDXF 3WE6A 5LCVH 3WJLC 3EFFB 2JCCB 3GSNH 3H9SA 4HPOH 1MFNA 3EHBC 4KKBD 4OF8A 3D0VB 1CL7L 3QRGH 5AWNH 4O4YH 5IVNA 5B38A 4NQSA 2ESVE 4ZQKB 4M61B 4AENA 3NIFF 1MCSA 4MQXD 4HCRA 5EU6A 5C09E 3ZO0A 3LAFA 4R4NC 4XPBL 2D31B 3V4PL 2NY5L 3BZFB 2IFFH 3G9VA 1ADQA 3PQYA 2I60L 2DL2A 3Q1SL 5DK2B 1NAKL 2GSIB 2FSEB 3DX8A 4Z7NE 3KPNB 2Z35A 4HH9B 2V2TB 2ADJB 1Z3GL 2D2OA 3BHBB 1UM6L 2P5WD 1Q38A 2M2DA 3U36A 5FYJH 1G9NL 2FEDC 5T1LD 3IJHB 3VWJB 3MRLA 1ZTXH 5DC9B 5MEPA 1B88A 1INQB 4NYLA 1UG9A 4N1EA 1LK2B 5BS0E 2FO1A 5EU3B 2HKFL 1GOHA 2QADB 1CFTA 4J2XA 4J3SA 3WYRA 3WKML 1BIIA 4JFEE 3QXVA 5KSAD 4G8GA 3QDGD 5BW7C 3DXAD 5ESQA 3OX8A 5I73C 1A9EA 1CFBA 4LK4A 2DOCA 1G9EA 4FQXA 5DDHA 3BPNB 3GJEB 4LRIA 4ZS7H 1Y6NR 5JOEA 5D1XD 2Q76A 5SX5H 2P49B 5BVJB 3WL9B 2IF7A 5LGKA 4J4PC 2GK2A 4GFTB 3WO4C 4OD1H 1OTTC 3IVKB 2IMMA 4QRTA 1FGNL 5FYLH 3MACH 3IGAA 1DN2A 4JM2F 1INEH 1NLDH 1YEHL 3GNMH 4KZEH 2DQHH 1J5OL 1Z5LA 3VI3F 3VWKA 3VFWB 4NT6A 1KXTB 5TPWL 3RA7L 5IJVA 5BRZE 4GG6B 1MLBB 1XFPA 3H7BB 3PE9A 1VPOL 5J89A 1D7FA 1WC7A 4JFHE 4G6KH 1JWUA 3BH8B 3MRGB 3I84A 3KPQB 4WUUD 5C0CE 1YNLL 3GIZL 3X14B 1D5IH 5D7JB 3VXSE 1FVCB 4EN3A 3FQRB 5IHUL 4OBSA 4GQ9L 3R0MA 4P2OC 2ADIA 4GS7C 1NANI 4J3TA 1L9MA 4OZIB 3QUXA 3DI3B 2GJJA 3GJFA 3O8XB 3U7YL 3Q6GL 1AIFA 4WTWA 3MLPA 1QQDA 2PYEE 2AXFB 2GAZB 3ARVA 1CIDA 4LKXA 5DQ9A 3QDMD 1OPGL 4UINL 5EC2B 5D1QC 2ZJSL 1T66C 4M48L 3WHXB 3MLZL 3VJ6A 2Z92B 4M1DL 4UDUB 5C7XL 1UH4A 2GJ6D 3I3DA 5HDBE 4A6YB 3MR9B 1MJUH 3X3FL 1GXEA 5IBLC 1H5BA 5HYJD 4D0CA 1CGSL 4RNRB 5DUBB 5IBTH 3BP5A 2CPCA 4PRHD 4A6YL 4Y1AB 1YY8B 5E6IA 4DGVL 3QRFM 4BKLA 1E27B 4RGNC 4UDTB 4U1LB 5ITBH 1GC1H 2DWDB 2H6PB 4JREC 1NGWB 4NM4L 3UTSD 4U49A 3H9SE 1FSKB 4O9HH 4OV5A 2OI9B 1VDGA 2NY1B 2FR4A 4J3OC 5DD6A 1C16B 1XCTB 1TZHB 1YEEL 3D85D 3KPPA 5TDOA 5JW3L 2OM5A 1GAFL 2FHBA 4LSSL 4P3DA 3LN4B 3AB0C 3L3DB 3TVMC 3VCLB 4D9LH 3QH3B 5ACMA 1E4WH 3PQYE 4PJDE 1ZGLA 4YC2B 3VXUB 2KDGA 4M8QA 3VI4E 1YMMD 2A6JB 5FYJE 3ZT6A 4XXDB 1KXVC 4PGDB 5B38G 3QIUB 2BRQA 5J11C 1YEJH 2Q6WA 1U58A 4NCC2 2V17L 3ARPA 5I0DA 2ARJB 3FHQA 1OARH 4PR5B 3UJIL 4M7LH 4YGVB 5EUOE 5GGUA 4IRSA 4KUZL 3TT3L 4KY1H 4UT6L 2OTUB 4AEFA 4NO0A 4ESKA 4RDQF 1IKFL 3G6JF 3V4VL 4MD0B 5I1LA 1A6ZA 4K8RL 5IVZA 1FO0L 1FZKB 1KYOK 3KJ6H 1L7TL 5GGVY 4E0RA 2Z31A 4QXUH 4KZDL 1TJHH 1YEFL 4ORGB 4HIEB 1DQMH 3MJ7A 5D6CA 3QIBB 3EDFA 3DOSA 2BHUA 4QXGL 3I2CL 1IGFL 1Q0XH 5F3HA 5CWSA 3HMXL 1S7VB 2NW2B 3N85H 6FABL 5HVGB 5E99H 1KIRA 2HAZA 2YD4A 2OR9L 2AEWA 1WFNA 4HIIA 5EFIA 1T21A 2V2WA 5FYLE 3EYFA 5AEAA 2NQCA 4L3ED 3SGJA 3GBML 5C0DB 3OR7B 4X7TB 4E41A 1EFXA 4NN6B 3VGHA 2HH0L 1LILA 3I6LD 2C1PB 3MROA 4Z7OE 1IGTB 1RJLB 4OLVL 4ODUA 1MRCL 5F1OB 3LS5L 5DJZB 1RUPH 2EDXA 3VXMD 3PV7A 2A1WL 2HT4C 1M6OB 3TO4B 3HNSH 3JSSA 4WO4A 4OCYL 5DJXB 3L6FA 1XGTA 3I02B 3QUML 1WZKA 1JNNH 4U6YA 1HOCA 4UT9L 3H0TA 1UWXH 1AKJA 1GPOH 5JNYB 2EIBA 3WLBB 4K3DL 5ERWA 4LPUA 2FJGB 1KV3A 4G43B 1P4BH 3BKYH 3B43A 4OZ4B 4HWBA 2XACC 5DD1L 3VXPB 3TJEL 2ID5A 5H2BB 5DMKA 5CJBA 1NAML 3S6CA 2UUDK 2Z91A 3SJVD 2PTUA 3TPKA 2XTLA 2ZUWA 4FQ1L 5IV2A 1JZ3A 1OB1A 4X5WA 4G8IB 4BK5A 1C08B 3MV7A 4V1DA 4DCQA 2X1QA 5SWZB 4BQ6A 4Y2DA 1LO4H 3VFGH 2KQMA 4RMVA 2MHAA 3DMMC 3OKDA 3KJ4C 2GITA 3CFBA 4NKQB 4K7FB 4D0BA 4MAUL 1QFOA 3SGEH 1FC1A 2AABH 5F7WC 5DJYA 5L6YL 1WAAA 3TIDB 4I77H 4PJHB 2BY1A 1KJ3L 3KYOA 5DRNA 5IW1A 4XC1H 4KDWA 4G9DA 5IBLD 4K9EL 3QFJD 4Q74A 2DL9A 1JHLH 3SE3A 2GTWA 2UWEA 2ED9A 1MI5E 1T7YA 4PJGE 2HFEB 5I16B 4GXVL 4ETQB 4YFLF 3HZMA 2QL1A 3T3ME 1DP0A 1LEKA 3GSOA 1NCCL 4LPWA 5JDSA 1MIEL 2UY6A 3VGAC 1X3DA 4JKPH 5JUEH 3ARGA 4RISL 1J05A 2VXVH 1D9KC 1G7PB 1RHHB 3STBA 3RRQA 1G7HB 3GSRA 5D8JH 1RMFL 4U7MA 1NGXA 1Q9WA 4R8WH 4XWOD 3TT1L 4L3AA 1VFBB 2J8UB 4OCSH 4WV1C 1MFCH 2VH5L 4GW5A 4PBWD 2HJLB 1PZ5A 5T33L 5HYSA 3HAEH 2ZWLT 1I4FA 3K81A 3OKLA 3U0WL 3PNWA 3FOLB 1CR9H 2LFGA 5HGHA 2BNRA 4JO1H 4P9HL 4R7DA 4X7SH 4RMSA 1DUYA 4YBHA 1UZ8B 5DEFA 2XA8H 5LGHH 4HAGA 3MLWH 5GRJH 3CDGB 2ITCA 4CVUA 1K4CA 3ULUC 5A2IH 3TNMB 5I1CH 1LEIA 3O41B 4PRDB 1FN4B 3IT8D 3PWLA 3KPRA 1TJGL 1VEMA 3IJYA 4R96A 4QHMA 3RWEB 4HFUH 3M8OL 2JJVA 5AZ2L 5IFAH 2CIKA 3JV6A 4ZAKD 5FHAL 3UJJH 3A6CH 5L2JB 5DA0B 5KSVA 2YBRB 3C6SA 4WFFD 1HI6A 3CZFB 4UTBL 2DBLL 3VW3L 2GFBB 2H32H 2H32B 3FQXA 1FBIH 4JG0H 1K6QL 1UACL 4TUKH 3ESUF 1A2YA 5F6IC 3GUTB 2VXTH 3QEQE 2CR6A 1GHFL 4BSVA 4AH2A 3FQNB 1JZ2A 4LBEA 4KJPC 4NOBA 5DQDH 1UJ3A 1ED3A 3L1OH 4O2EA 4Y19B 3WXVL 3B4NA 1N8ZA 3STLB 3DO7B 3CMOH 3L7EB 1JGEB 1T04B 1TCRB 2OJZL 1I7UB 2NY7L 4QNPF 1EX0A 2IGFH 3WUWA 1F4WL 2JCCF 2A73B 2VLKE 5I75C 1IC4L 3D69B 3ZE0E 4CVXB 4JVUA 2J8OA 4F33A 2J4WL 5BOZG 1AGEA 5B8CB 3QR2A 4FXLA 1UT9A 1NKRA 2R0WH 2CUIA 2EKSB 3P2TA 4MVBC 5CBEA 4LSRL 3F7VA 3MLVL 4XCFL 1U3HC 4YDIH 5GGQL 5F1NA 2R2HA 3OXSA 3MV7E 4V1DE 1TNNA 1CXKA 2DD8H 4JM4L 1AXTH 2FLBT 4KV5E 1FYHB 2HLAA 4G80A 1I75A 3ARWA 1EEZB 3IFNL 1QHPA 1AQDB 4NKDB 1FNFA 5F71A 1J9CT 3OAYK 1CFQA 1ND0B 4WHTB 1BVZA 2F5BH 4NKOB 1ZVHA 1BAFH 3QUZC 5MENB 4PRID 4QHUA 5AD0B 4Z76A 3P4OA 3T77B 2VISB 4FQ2H 1R5IB 4OZHF 4KHTH 3BAEH 1UWGL 1RZIA 3DMMD 4QRRA 1SEQL 5B21A 2C3XA 3AY4C 3ZKMC 5C9JB 1S7SA 1DBKL 3JTSB 3DVNB 4MD5B 4LVNB 3T0WA 2DKUA 5F96L 4ZFFB 3QO0B 4F15B 1JGLH 2CK0L 5D96B 5FIEA 2DQCL 1JRHH 3D9AH 5FB8B 3DYOA 3PUCA 4DEPB 1MRFL 3ARSA 4ZOEA 2R0ZH 3QBTB 1J1PL 1NL0L 1CFVH 1CE1L 4GG6F 4Y7MA 4ODXA 3H9YA 5EA0H 3CC5B 1KPRB 5T3ZL 3FQTB 3O4LA 4XWGH 3E1F1 2X09A 4PJ7B 4FFVC 5KW9L 1LK3H 5DRWB 1T1XA 3T4AA 4QHKI 5DRXA 2HFTA 4Z8FL 4TSAH 2IQ9L 3AMLA 1WF5A 3MBXH 4P23A 1W0WB 4X4XA 1XF4B 3G04B 1A7RL 4XVSH 5GXBB 3NFNA 4GAYA 2J1KA 4Y16A 3UXFA 4F9LC 2PKDA 3QEUB 4LSTL 3S88L 3PXJA 3CMGA 5SWSE 2XXCB 1AR1D 4RSVA 3BIBX 5HYSG 4PUBL 4FQJH 1PAMA 5JW4N 1MCNA 3HI6L 5E5UB 1OP3H 3KPRE 3E8UL 4NSKB 3FCTB 4XMKL 2VMFA 1CICC 2FX8H 3FT4B 1I7TA 5DSCB 1E6OL 4GAJL 4XBPB 3V6OA 3Q6FA 2W07A 3MRQB 5C08A 3UAJC 5D7IE 3OKOA 1S9XA 3WFEL 2VC2L 4JCMA 4BSWB 1R3LB 3GMLA 3ULUD 1CT8A 3NACH 1Q9OB 2Q7NA 4OFDA 1A7OH 4YH6A 1J88A 4R4BB 2VDQH 3BDXA 3EOAA 4QXTB 4C59B 4OIIH 3NPSB 3HNVH 5T1KD 1JBJA 4JY5L 1YECL 5IK3A 3P77B 3HB3D 3TFKD 2AJZB 2V5MA 1JNHA 2DKMA 3I3EA 2YEZB 2LE9A 3KG5A 3RY6C 4KJPD 3ROLB 2G5BA 3BYTA 3SKOA 4Z7WB 3MXWL 4NQVB 3K0WA 5D2NA 2VXSH 4HFWA 3WUWG 3W2DL 5JW5A 5BV7L 1QNZH 4MA1B 2YD8A 4S1RL 3AAZA 2H2SD 1JGUL 4LLVA 1G9NC 3SDDA 1YJDH 4Y5XC 4LARL 1DUZB 4DZBB 4E42A 4S11A 4PP2A 2R8SH 1CLOL 4MVBD 2P48B 3VH8B 3PV6A 1CXIA 4XBEL 1ACZA 3IDIB 3BKCL 4IRJC 1PQZB 2V2XA 4RX4D 5ESAB 4YDKH 4XCCH 4JFFD 2HVJA 3TM6A 3X3GH 3ARUA 3BT2H 4LIQL 4Q6IC 5BMFL 4HUVB 2Y7QB 3QPXL 3DBXB 2XNAB 3RVUD 1IM3A 1MELA 2B5IC 4PY8I 3TN0C 5FK9A 2NR6D 4M03A 3FL7A 4QRRE 1IBGL 2OZ4H 1S7TB 5F88A 5GRZA 4CRPA 3FO1A 3VE0B 4D8PB 3VMPA 3MFGB 1FFNA 2E7HA 2K1MA 2CDGA 1KB9K 5EZOL 4NWTH 4XMPL 4NC1C 2P8PA 1LMKA 4C4KT 5C07A 4QTHA 2NY4D 4C57C 2VWEC 3TNNA 2Y36L 4EQ2A 3QUZD 4RBPK 2EYRB 3U4BH 1WBYA 3UO1L 1F11B 2XTJC 4PTUB 3GBNL 3OKMB 5FUZL 4EI5A 2QLVB 1NBYA 5EOTB 2RAMA 3OJ2C 1ZSDB 4PV9A 5GSVA 4X6CF 1S9WA 1QSEE 4YDJA 3ZKMD 4P5KA 1P5UA 5TE4L 3RJDA 1AHWC 1EHLH 1JPSL 1ZE3C 1NANH 1ZA3B 3MFFA 5HPOA 4KK8C 4NRXB 3WN5A 3H42L 4CDHA 1IC7L 2DLFL 3FN9A 2VAAA 3MRJA 1QSFB 1FE8L 4L5FH 1AJ7H 4F8TA 4PJ5A 4L9LB 5F9WB 5D5ME 3UTQB 3OAZH 3FFDB 4Q2ZA 1QFWI 2A6IA 4BFIB 2AJ3A 3VFSB 4G6JL 5JW4M 1AO7B 1NC2D 1JPFB 1H8OA 3DRTB 1MCCA 4MXWL 2I9LB 4F7PA 3QHTC 4YEEA 1KJMB 1LP9B 1I3RB 1BQLH 5F1SA 3QSKB 4CMMB 4GSDH 1CYGA 1A3QA 4KDTC 1ZVYA 1ZWIB 4AEHH 3DX7B 5EIIB 4PLNC 3HC0A 1FYTD 3KPMB 1AGCB 2P5WA 1JN6B 4MNGB 5C08E 3RGVD 2AEIT 1NGQL 2IG2L 4FFYH 3EZ8A 4XX1E 1O5DT 4OAWB 4OJFL 4NN5B 1AC6A 3KLSA 3OF6D 4QRPD 2CDEB 4TNVK 5DS8B 5JXAH 4HXAL 1P2CA 5FDYA 1KBGH 1NFIA 3NAAH 3ARTA 3QISA 1JZ4A 4JPIA 3T3PF 3JV5A 4KK6C 4X6EB 1CBVH 3FB5A 5DJ8B 1IEAA 1NMBL 1U8OA 3DXAA 2G2RB 1AI1L 1QKZH 1U2HA 4XCEA 4XZUA 4MXQC 3MREA 1G7MA 2Q86A 1QA9A 4L4TB 3PIQA 1IAII 5D1XA 4X6BB 2W0PA 3IDMA 3L3OB 1EEQA 1FVDA 1I3GL 3ZKXB 4HZLA 3KDMA 3RDTD 4NFDA 5DA4A 1IGML 5TF1L 1L9NA 4UQ2B 3EUUA 1DDHA 5D2NE 2ICWJ 5E00A 1XGPA 5IMLA 1UEYA 3DHMA 5HHOB 1R3IH 3C5SB 4XNUL 1CF8H 1OGAB 4CNIA 1U92A 2UZIL 1WFTA 3LQMA 5FUOL 5AG9A 1V7NH 2D0GA 3BJLA 2FIRT 4RMQA 2IAMA 3P0YL 2J8UF 3QO1B 5DMIL 4TRPL 4O5LH 3ILPA 1A0QL 3HG1D 4BYHA 2B4CL 4WUUA 3RL1B 5ID0A 3REWB 3QCTL 1R24B 2H9GB 4HC1L 2BVOB 4HH8A 4PGEB 2AXGA 1A6AB 1NH6A 4WHDA 1JMZA 3O2WH 2NX5B 4IMLB 3VRIB 3P0VH 4K3EH 5I1EH 2VQ1B 1D6VH 5IB5B 5JQ6L 1TJIL 3OKKB 1TPXC 3QDMA 4WEMB 3QDJE 1Q0YL 3D0LB 4NZRH 4PB0H 2ICWB 4K71C 4B7LA 1MWAL 4MX7A 4MDIA 1BF8A 2YD2A 1RUQH 4FXKA 4TTGA 3SDCB 2JJTC 4P5TD 5C07E 5EH1A 3JZ7A 4WU7A 1O0VA 1A1OA 2HWZH 1LEGA 3P73B 5EUKA 3WNPA 2GJ6A 2B20A 3CX5K 3LHPL 4JFDE 2P24A 1A3LH 1IL1A 1L0QA 4ZUTB 3WFBH 1HXMA 1BZ7A 2HKHH 4JFYB 1GIGL 3FFCD 1GGBL 2P1YA 2NXZB 3RZCC 4D3CH 1UXWB 4HQQH 4U6XB 3MRNA 4OQ1A 3G5YA 3NMEA 3MA7A 5HYJA 3LQZB 1S78C 5I8OL 4PRHA 4KVCH 1R6VA 2NY2C 3P30L 4N8VA 3EFDL 3MOBH 1IILE 5HI3C 5K9JL 4Y4HA 1GL4B 4AQ1B 3S35H 1UM4L 1K5NA 4NP4H 1CZ8H 3UTSA 1CG9B 5FECA 5IB3B 2BVEA 1NC4D 5CZVH 1H15A 3C60D 2IALB 3FT2B 1N64H 3ULSA 1WCBB 1D5XB 3PGFH 5D1ZB 4U1MA 1I7ZB 2J88H 1KC5L 4EIZC 1U8NB 2WMPA 1BPVA 1DQDL 1HXYA 4OLUH 4UT7L 2MPAL 4LLDA 4JPWL 3BPLB 5GGVL 3MLXH 1NEZA 4NFBA 1ZVSB 3VXRB 5DUML 2MCPH 3CLFH 5DHVA 4JJ5B 3W0WB 2DQDL 2R1YB 1YMMA 2P5WE 2X4SB 3QFDB 4JB9L 2VDRL 5C0NC 4UIKH 1ES0B 2YXMA 2YUXA 1I8IA 3BEWB 1IAMA 4DUWA 3C6LC 2QR0A 4S1DC 3U0PA 3HZVA 2R1XB 2FX9L 3K3QA 3NGBC 5F1IB 1I8LA 4P2RB 1BWWA 3S7GA 4E5XB 3QULA 1KN2H 4TYUA 1KT2A 3H2WA 4U1IA 1QLRA 5CJ8A 1TTFA 2V5YA 4Y4FD 1ETZA 5HHMB 4X7EC 4ZUWA 5KVGH 1U8HB 3QDGE 4U7SA 1HHJB 3MCKB 3DXAE 4U31A 4WY7H 3GGWA 1VFOA 3VFNB 1YQ2A 3EOBA 4PB9H 3ZKNC 2Y6SD 4PRPB 4LLYB 4NQXA 4K9EC 3EZJB 5F3BA 3CAFA 3LS4H 1SY6A 2EECA 1T5WA 2DLGA 1MCRA 5IOPA 2K9UA 2W9LA 3LPWA 1RK1B 5B3JE 4L3EA 3MGTB 3AS2A 1KIPA 5IESH 2HTKC 1J0HA 2DI8A 1JF1B 5LJYH 4ALAH 5K59E 5BW7A 5HHOE 4QWWC 3BWUC 4KKCC 5IMMA 3DUHA 3L5WA 1AFVH 3BD4A 5CFHA 1W72L 1YPZE 2CUHA 35C8L 4R2GB 4PTTA 3I50H 4D9RD 3OB0K 4QHNB 4WUUE 4ISVB 4JFZH 5DUPL 5GRUH 3BP6B 1VACB 3FKUS 4XCNB 4DGIH 2W9EL 4NDMB 1C5DB 3OGOE 5C0AB 3E6HA 1ORSA 1TTUA 1SHMA 3JV0A 1XIWD 3GMRA 3GMQB 5E8PA 2WM0A 4XGZA 3B2VL 1QZ1A 5BZWB 3ECBB 4P9HC 1KB5A 4P99A 1M71A 3SE9H 4PJAB 2SEBA 4FZ8L 4I2XB 2LTQC 1WZ1H 1A9BB 1OSPH 3QDME 1QVOB 4QT5A 3NCEB 3TV3H 1YNTB 4NC2B 5C71A 3T4YA 2YSSA 4OB5L 4M02A 1F3JB 3BD5A 4RAVB 1PKQB 4AENB 3QWQB 4QCIB 1CLCA 4P2OA 5EU6B 2C4XA 2FX7L 3BGFC 4HPOL 5AWNL 1O7SA 3RTQC 3DX8B 3OPZH 2BSED 2Z35B 4OQTA 5T1MA 1EO5A 1IRAY 3U36B 5HYJE 5L0QB 3EYOA 2ZUQB 3MRLB 3F5WA 4G42A 1U8QA 2AK4B 4YHKH 3W39A 1A6TA 2IH1B 2IFFL 1ADQL 1VFAA 2PW1B 1KOAA 3QWRD 4M6AA 2H26A 2NY3C 1BD2D 1KLGA 1RURH 3HNTL 3JUZA 1BIIB 5FYJL 3QNXB 4FQIH 1DBJH 3QFJA 3VDAA 3WS3B 3RZCD 4G8GB 4XP9L 1MHEA 2XKNB 4JZJC 1NCWL 2OQJB 3IU3A 5ESQB 4KUCF 3OX8B 3PHOB 4K7PL 3Q0HA 2G5RA 4FQXB 4N9OB 4PRNA 5DDHB 1EK3A 4N8VG 4F8QA 4KQ4L 1VFUA 1F3DJ 5GS0C 2Q76B 4YHNA 2NY2D 4LPTA 5IFHH 3EW3B 1KJ2A 1KJ2H 3P9LB 3HZYB 3C5JA 3E3QE 5E94A 1YMME 5F9AC 3PP3H 3IGAB 5F9DC 1OAUH 2OLDA 5KS9E 3CZJA 4N5UA 3VWKB 4M7JH 4NT6B 4P2CG 1T0NA 3QHFH 1MOEA 5IJVB 3MLUH 4OUUA 1XGRA 4ZUSA 4PGBA 1KPUA 1NEZG 2IJ0C 3QJHA 5FYLL 3MACL 2PN5A 3UX9B 1INEL 1U6AH 2R69H 3LD8B 1BHGA 1GZPA 4LFHG 4UMGA 2DQHL 4KZEL 3KYNA 3MUJA 3RHWK 4EN3B 1S7XB 4F2MA 5D6DC 2ADIB 4XVTH 3JWOC 5FFLA 1UVQA 1CGYA 2XN9E 3CSBA 3ISWA 3F7QA 3C6LD 3GJFB 4G6KL 1ODAA 3WNMA 2EDEA 4S1DD 3C09C 1AIFB 1QQDB 2A2QT 2AQ3A 1MLCB 5DQ9B 2RIKA 2W0KA 3G5ZB 4RCAA 1CCZA 4L3EE 3ARDC 4CU6A 3HC4L 4P2QB 5EB9A 1T22B 3W5NA 3BP4B 4TNWF 3IXTA 4OM0L 3S4SA 1DEEA 4TNWK 3LIZL 1XR8B 3CSYA 3W9DA 4JRXD 3KWWA 2BMKB 3LV3A 2BNQD 3ULVC 4NQCB 5SX4I 3LPFA 1N3NA 2E6JA 4NKMA 5HI4D 3VXME 1B0RB 5FA4A 1PSKH 5F7NC 1NJ9A 2YA2A 4DW2L 1H5BB 2R29L 1XH3A 1KLUA 3LB6C 5DD3H 4D0CB 4U1NA 1RJZB 5E6ZA 3JVGC 1JFQH 5E6IB 1HYRC 1CFNA 3PXHA 4KK5C 4KKCD 4BKLB 4FQLH 3OKEB 5MEOA 4KQ3L 5HGAA 4K3JL 2PYFA 5ISZD 4OV5B 1JWSB 3A6BL 5C92A 5A3ID 5IBTL 2J6EH 4HT1L 5DD6B 5IIEA 4LVOB 1VA9A 4PG9A 3KPPB 5I1IL 3SPVA 5TDOB 3SJVE 1T03L 3J7HA 3BPOC 1LP9F 1PYWA 3GKZA 3F58H 2RJMA 1YA5A 3JBG7 4KAQL 3RBSA 5ITBL 5HVFB 3PHQA 4UOW0 5ACZA 4ZFGL 5AZEH 2E9WA 3WD5H 4V2BA 4U6HA 1IGCH 1MFDH 4YHZL 4M8QB 1J87A 4ZNCD 2KUTA 4KU1A 1A47A 1RIHL 2I24N 2ITDB 3O6KH 4NHUB 3SDXA 2Q6WB 3RWCA 1U58B 2YK1H 5F6HI 3S36X 4PJCA 5GRXG 2C3VA 5CZKA 3V52L 2F54B 4KI5C 3G5XA 5GGUB 4IRSB 4TULH 4ZXBD 2DM2A 4PRIA 3IF1A 3KXFD 4OTXH 3WHE1 3LKOB 3K46A 5AUMA 3QFJE 2F19H 1YEJL 3HUJE 3PGCB 3DV6A 1EGJA 4GRLB 3DIFA 3DMMA 3MBEB 4YXHH 1G0DA 3MJ7B 1OARL 3UTPD 1Z2KA 4M7LL 5FYKH 5KN5A 4G6AD 4K94H 3CFCL 2E9BA 5F3HB 4HIHA 3PWJA 5CWSB 3HR5A 3BZEA 3T2NH 4Y5YC 2WV3A 2NY3D 4ODVL 1C1EH 5FUCC 1UM5H 4HIIB 5EFIB 1T21B 1EHAA 1KTDA 2DLTA 2V2WB 3O45A 2HVKA 1DQML 1T4KA 3EYFB 4Z7QE 3ZYOA 5IEHB 2O5XH 4GLRH 5KANI 1JVKA 4E41B 4I5BA 2JF1A 3ZTNH 1BOGB 3MROB 1YC8A 3N85L 3SGKC 5JHDD 1PEZA 4S2SB 1VGKA 4K23L 3VRJA 5GS0D 4GKNB 3SY0A 3LEXA 5J13C 1FLRL 2YRZA 1RUKL 1D9KA 2QSVA 4JPKL 4AIZA 5I18H 4IDLA 4WO4B 3L6FB 5DGRA 1PY4A 4OGXL 2EICA 3NN8A 3BPCB 1W0YT 2WANA 3BWAB 2FHFA 3N1MC 2OTPA 4WV1A 1RUPL 3WKNA 4OLYL 1SJHA 3L5XL 4POYA 2IPKB 5ERWB 4KMTH 4H25A 2EIDA 1CGWA 3HNSL 1BECA 1HK6A 1HKLH 5CD3A 3M1BA 2K3TA 4O2FA 5IHLB 5FCUH 3K1DA 2BSRA 1GPOL 2OSLA 4PJFA 3KLDA 4WFFE 4OI7A 1JYNA 2ZUSA 4ZYKB 5FO9A 1TMCB 2QHRH 5IV2B 2BNUA 1OB1B 4X5WB 4PBXA 3DSNA 4WI9A 3BKYL 4Z7NF 4DCQB 2O93L 3R06B 4UIMA 4Q0XL 1H3WM 2P7TA 2ZP0T 2L4OA 4HWBL 2NTSP 4TUOA 2MHAB 1WCQA 2VXUH 3DYMA 2DICA 2GITB 3CFBB 3QQ4A 3D2UA 3FAWA 4HMEA 4LVEA 4N0FA 1QFWH 4L1HA 3HMWH 5HDQH 3S34H 2DAVA 2DIBA 3MRIA 5T1KA 4L8SA 5D2LB 4ZO6A 1F6AA 4RFNC 3ULVD 3KYOB 3VFGL 1SYSA 3C8KA 5A1AA 2XZQH 4LLUA 5J1TC 4MJIA 1OP9A 3BFOA 4AK1A 2AABL 5BOPA 5L88H 2UWEB 4M62L 1PLGH 1MCWW 3U30B 4I77L 2OS7A 3HZMB 4NWUL 4PPTA 1LEKB 4EDXA 5JDSB 1D5MB 1NLBH 4OZGE 4P9ML 3QPQC 3ARGB 3FQWA 1J05B 1RIVL 4Q9QL 3H6JA 3TYGH 3MMEA 5DT1L 3QI9C 3B9VA 3GSRB 3VD7A 3ZSTA 3C2SA 1LNUA 1T1WB 2N7AA 4JPVH 2G9HB 3SDXE 2BVPA 4P4KB 1BJ1J 4PJCE 3P4MA 1U3HA 5MHSE 4GW5B 4BH8A 4JKPL 5JUEL 1PZ5B 4GRMA 4RX4A 4EKXA 2CLVA 2VXVL 2RHEA 43CAA 2APXA 4JFFA 4PRIE 5HYSB 4DZ8A 5IB2A 3GI8H 1I4FB 2D3VA 3RVVD 1K3IA 3OKLB 1GGTA 3BEVA 4UI2A 5HGHB 5C0FA 2BNRB 3VGBA 1RIUH 3L95A 4R7DB 1DUYB 2ATPB 2Q8BL 4OCSL 1ZGLM 4DGYH 1MFCL 4YDVA 5DEFB 3T65A 2R23A 3WIHH 4L8CB 3FAXA 4FTVD 1TLKA 3QB7C 3TBTA 1K4CB 3MCG1 1RZ8A 1DVFC 1LEIB 1CR9L 3GI9H 3QUZA 4OV6F 2C9AA 1A5FH 3IJYB 1UCTA 1OTUC 4QHMB 5E8DH 4UAOC 3O9WC 2VDKH 4MZ2A 2CIKB 2DMCA 3JV6B 4N8PA 3SDAC 4UTAH 3MLWL 4WWID 5GRJL 4UUJA 1BREA 1WTLA 2OCFD 4D9QD 1HI6B 5HDBF 3VXTA 3AY4A 2BVTA 1YYMH 5E4EC 1LO2H 5EC1A 3DTXA 5HHNA 4YO0B 3D39D 1A2YB 5I1HL 2B4CC 4M1GH 3AXLA 1A6WL 3EO9H 3VG9C 4NGHL 1K8DA 4BSVB 4ODTL 4AH2B 1B4RA 2YR3A 2B2XH 1ZLWK 1CE6A 1VKXB 3U4AA 5CEXB 1HILA 1UJ3B 4X98A 1ED3B 4LCCC 4O2EB 5TQ2H 4CVWA 2HFGH 1FBIL 1N8ZB 4Z7UB 4PJAF 5KJRH 2B1HH 4P57A 1DLFH 3PP4L 2VXTL 4X5XB 4LOUD 3TCLA 3H7LA 4X6DE 3MNVB 3IDXH 5DQDL 1EEYA 3T0DA 1NCBH 2BERA 2NXYC 4F7TB 1IAOA 3KYAA 5LKNA 3R8QA 3SDYH 2R4RH 5C0BD 5CBEB 3CMOL 3F7VB 2CKBH 2CKBB 3QAZB 3O2DA 3O2DH 1UKTA 5E9DD 4F9LA 2R0LH 2VZTA 3GSXB 5C1MB 5I1JL 2ZOKA 3CJJA 3ZYZA 2WP3T 1U3YA 4WI5A 2E9JA 2WBJC 3OF6A 4QRPA 5L2KA 2NZIA 2HLAB 1IZKA 3JUYA 2ZUXA 3IU4H 3KPSA 4H20H 1AH1A 5SWQB 4AQOA 1CFQB 4MB3A 4J3XA 3SEPA 4HS8H 1AXTL 3PWPA 1B4JH 2QV2A 5DZNA 1EA9C 1A6PA 1X5ZA 5F7LB 4Z76B 3P4OB 4WCYH 3V0VA 2APFA 4QGYA 2GK0A 1X5FA 2EDFA 1X5AA 1RZIB 4JZOB 5CIPH 3VRLE 3BE1H 1FFPA 3BN3B 4RIRB 4NM8H 4OSUH 1FRGL 1S7SB 1BAFL 2CLRA 2F5AH 3WMSA 2VKXA 1S5IL 1H3TA 4OCLC 4FQ2L 2Z9TA 4HUKB 2QQKH 3TH2T 3BAEL 5JTWA 1T20A 4MGXA 2HJKB 4JDVA 1P7QD 3J8F7 1OAQH 4Z7OF 1W8OA 5H35A 1OT2A 4QRUA 5J57B 3O4LB 4FNLH 4JFFE 2I25N 4ZPVA 2DLIA 1FGVH 2IPTH 4ZS6C 3T4AB 1JRHL 4MA8H 3D9AL 4W70A 5D7SH 3JWDC 4Z9KB 3GO1H 2R0ZL 1SJEA 1CFVL 4L8BB 4B41A 3O6FD 1OD9A 4Y5VC 3NFNB 4Y5XA 4XWGL 3EO0A 4WENB 3BRGC 4YJZL 1WFUA 5HHPA 1EEUA 1NDGB 5FGRA 1V05A 4P5TA 2NY6D 4ZNEA 4TSAL 4Y4KB 3LY6A 1QFUL 3KHQA 5C6WH 3R1GH 4HKBA 2DTMH 2PO6D 3RU8H 5GRVL 5H94A 4CDGC 2Q8AH 4RAUB 3O6LL 3RUGB 3TN0A 1DBBH 3FFCA 1OM3L 1FVEB 3IFLH 4FQJL 4FFZH 1S7QA 4B0MM 2QQNH 1V3MA 4K07A 3OKOB 5IROC 4XMLH 1CU4H 3NFPA 4OLWL 5GSRA 3KYMA 12E8H 1DVFD 2Z4QA 2FX8L 4WUKH 3IAQA 3LKQA 3O9WD 3EOAB 1UJTA 2BC4A 1D6EA 2P47B 1NC4A 4LQFL 4ZMAT 2YRLA 2CXGA 1I1AC 3PABA 1NBQA 5A43C 4ONOA 1GZQA 4N5EC 4PJIA 4EBQH 4HG4K 3C9NA 3NACL 1AHWA 3QEHA 4XBGA 1MCPH 1JNHB 1QRKA 2BHYA 4Z5RA 3T08A 4HGMA 5CAYB 3FZUD 2VDQL 3RNKA 5HHQA 3B9KC 4BQ8A 5K9KB 3G6AB 4J6RH 2Y1VA 1U42A 3HNVL 1CD8A 1FYTE 2G5BB 4IIQB 4U1KB 3K2UH 5HYQA 1X4ZA 3MUGA 3I75A 4OFPA 2VR9A 4DAGL 5DGQA 2PXYB 1QFPA 4OF5A 3V0WH 4KVNH 2FATH 1J86A 4KXZI 4DN3H 1U91A 5DFWH 4XNQA 1P6FA 3L3GA 4LLVB 4DJMA 3UTZA 1YUHA 5IW3A 4E42B 4HPYH 4Y4FA 3RWDB 3DRQA 2BOBA 4YX2H 4YHOL 2HJFB 1OHQA 1WT5C 5KVMC 3MGOA 5EBWA 3RFZC 2ZG2A 1FNLA 1HDMA 2HVJB 3RY4A 4APQC 5JZ7C 1IGIH 2B7DT 5JDJA 4G6FD 1FL5A 2OJEA 3MRDA 4TQEH 5FKAA 4MCZA 1IM3B 2R8SL 2ESVD 5FK9B 3EJJX 3FONA 3WHE0 4GAFB 5F88B 1QG3A 3Q2CA 1G6RH 4XCCL 5C09D 2CDGB 3X3GL 2F8OA 5CZXC 3BISA 4BJLA 5A2FA 2P8PB 4YHML 3V8OA 1S7RA 1V7MH 4YQXH 3TNNB 3A6OA 2VLLA 1WBYB 2OZ4L 2WIIB 1ZHBB 1NGYA 5GGSA 4EI5B 1MCHA 4KTEH 1MQ8A 1NBYB 3S3PA 2MKWA 4XRCB 2IANA 3HG1E 3TZVC 1CGXA 2R9HD 1UA6H 4PV9B 5LAXB 4KJQC 5BJTA 3VDBA 2GKIA 5BS0D 2HRPH 5CBAA 3M17B 2HTLC 4U7KA 1NGPH 4P5KB 1AE6H 4GAGL 2YPLD 4HULB 4MJ5B 3U4BL 3BVNA 4JRYB 1DFBH 2FJHA 2VLJB 1I1YA 3MFFB 4JFED 4I18B 4G5ZH 2VAAB 2GIYA 3HS0A 4Y0GA 5CGTA 3P9MA 1MY7A 4PJ5B 2YPVH 1FJ1B 2D0HA 1UWXK 3CVIH 1EHLL 4GKSB 1CD0A 3NCFB 4PJ9B 4PJBB 4ZNEE 4NBXB 3FMGL 3UZQA 4LRNH 1MJ8H 4L5FL 3MV01 3GB7A 1AJ7L 2L7UA 4F7PB 2QKIA 5GRYA 4DOHE 1QBMH 4ZS6D 5SX4H 1B6UA 1TVDA 1U8IB 3IKCA 1CFSA 3QUXC 2BDNH 3FFCE 1MFEH 4GBXD 3G6DH 5BRZD 4JY4A 4LLQA 4RQQA 3QWOA 4NQTA 3HMXA 4HWEL 1T2XA 5I76A 3UMTA 2JJTA 4J1UA 4XXCA 4CVZA 3RY5A 1BQLL 4GSDL 4WDIA 4FP8L 1KFAH 1WLHA 4AEHL 1P2CB 1UC6A 5H37H 2R56L 4H1LH 5KVFL 4H1LB 5CCKL 1J8HA 2VDMH 3EDEA 1TFHA 4EUPA 1KLFA 4L3CA 4JPIB 1P84J 5E2TH 3UBXI 4FFYL 1MCEA 3FB5B 1WAAF 1QP1A 4U3XA 5D2LF 4O2CA 5J12C 1DQTA 3RZCA 4YBLC 3WNOA 3DX6A 1CTNA 4LQ1A 2PYED 4UZGA 5EOCJ 4XCEB 4XZUB 3IKKA 3MREB 3DJ9A 4MD4A 1QA9B 2OBGA 5HVHC 1KBGL 3NAAL 5ANMA 4XPGH 5HHXH 5EO1A 3IDMB 5DXWA 3VFPA 2UWEF 5T5FH 1FVDB 4ZFOB 4I0CC 1JNLH 3SO3C 1NFDA 1I1AD 1QKZL 4KRPC 5INCB 4XPHH 2PW2B 5E00B 1VESA 1XGPB 4Y89A 5IMLB 3MV9A 4CNIB 2DLEA 1YEKH 2CD0A 3V4UH 1TITA 1N7MH 3ABZA 4OT1H 5E2JA 2IAMB 3B9KD 4CN4A 3HE7C 4M3JA 3V7AE 2KBGA 3ILPB 4GMTL 1QLEH 5ID0B 1GSMA 4HF5L 5IMOA 1S9YA 4XP6H 4AIOA 1C12A 3PJSB 1R3IL 2DDQH 1UXSA 2AXGB 4X5LA 5LBSH 3CX2A 4JQIH 3BH9A 4G3YH 1I1FA 3R0NA 3HFML 1RZGB 3T1FB 4N9GA 3C6LA 1WZMA 4U1HA 4KWUA 1KPVA 3SQOL 4MLSA 4PRAA 2ARWA 4MDIB 1GYAA 4FXKB 1MFAH 3C5ZC 4YFLI 1N2RA 3TBYA 3O2WL 3P0VL 3X13B 2JB6A 4WU7B 1A1OB 2Z31C 5EUKB 2GJ6B 4JRXA 1MCBA 2BNQA 3QIBC 1UB6A 3CDCA 2M1KA 2P24B 3QQ9D 3BIKA 4D9RE 1IL1B 5CUSH 5K9QG 4NZRL 5MEQA 1HXMB 1XF5A 1MQKH 4LHUG 4FN0A 1RUQL 4LNRB 5KTEH 4DTGH 2XQBH 4R26H 3T0AA 4WI6A 4Q9RL 2QADD 4QYOA 2HWZL 2Y4SA 4TOYH 3G5YB 3MA7B 2J2ZA 4MQTB 4WU5A 3HPLB 3U46A 4L1DA 4PRHB 4ZG1A 3B3IA 4GMSL 3SGJC 1MH5A 1A3LL 3O3BA 4G7YL 4N8VB 2VDLH 4KHXH 4PJ8B 3WFBL 4Y4HB 2HKHL 4GW4A 1MF2L 3UTSB 1SBBA 5FECB 4D3CL 1I9IH 4Z7UF 5ISZA 1H15B 5TJWK 3TZVD 1SJXA 3ULSB 3L3HA 5A2LH 2ZCHH 2FIKA 2DQGH 4U1MB 3C2AH 3TO4C 2HTLD 3S98A 1BVLA 2DQUH 3MOBL 3ZDZF 3VG0L 1CZ8L 4S1QL 1Q9LA 2I9TA 1N64L 2R2EB 4PLJC 3QJFA 3LRSA 3LDBC 3PGFL 5DHVB 2EEDA 2J88L 3ZL4H 4LPVA 2X1WL 3OR6B 1WTGT 5J6HA 1DQJA 1I8IB 1QACA 1CGVA 3MLXL 3U0PB 3HZVB 3U4EA 2W9DH 3ARFC 4NRZA 2MCPL 2WQ8A 1BD2E 1CL7I 5F7FA 1ACYL 3KXFA 4U1IB 1RQ5A 4OFVA 1IC1A 3GMMA 1GGIH 4ZSOE 1ETZB 4WW2C 3RTQA 4ZUWB 5K9OA 2ENYA 4DWHA 1IM9A 3GK8H 1BLNA 3T0BA 4XH2A 2EDQA 5EU4A 4U4BA 3AU1A 4KH2A 3EOBB 1MCOH 2WWMD 2FWOA 2ICEA 5F3BB 3QZWA 3RJQB 4OCNC 4F37F 4YUEH 4G9FA 2X9YA 4HD9A 4EUPG 5IOPB 1Q1JH 1NFDE 3RWJB 5FA3A 5KSBA 5GISL 4TVPH 1DQQA 1CDJA 2A83B 2HRLA 1VERA 3FB8A 4JZJA 3LS4L 3PWUB 5IMMB 5I73B 1F4HA 5EZJA 5CGYD 3SE3C 5GZND 2CO7B 3RWIB 2N7BA 4WTZA 3VU2A 4L4VE 5IVXA 4XPAL 4PTTB 3TC9A 5IESL 1MVUA 3WO4B 2E5EA 2X4PA 4NRYA 4UNUA 1V3LA 3MRRA 4F3FA 2RGSA 4X8XA 3E6HB 1AFVL 4ODHH 1JPGA 3GMRB 2NY1D 5E8PB 2O61A 2WUBH 4MMXC 1L7IH 1ZT4A 4NO3B 3I50L 4MB5A 5L7XH 3TWCH 1M71B 5TDPA 4HGWA 2SEBB 4JFZL 5GRVK 4WFED 1JHTB 4QT5B 1A7QH 5CP7A 5JQHC 4D0DA 3WEXB 1P4IH 3T4YB 2YSSB 1OP3K 3MJGX 3SE9L 1KB5L 1TVBA 5C2UB 2VZVA 5D6DA 5EBLA 4PJXA 4P2OB 4GS7B 3QIUD 1WZ1L 4YFDB 2EKJA 1A6VH 1XGUB 2BX5A 4NZUH 3RUGF 5BO1L 3NTCH 3TV3L 5GGRY 5GGSY 1TVHA 5DHYA 1U0QA 2LV4A 3ARDA 5T1MB 4IS6A 1HWGB 1KUMA 3EYOB 5CINH 5D1QB 1KSRA 1T1ZA 5D71H 3F5WB 4G42B 2ARJQ 3W39B 3UCRA 3CK0H 1P7HL 1AGDA 2GUOA 1VFAB 4R4FH 3OAUH 2H26B 3QIBD 3LN5B 2DM3A 4OQTL 1MCKA 1KLGB 4AEEA 1Y0LA 2FO4A 5I15L 4YHKL 5DI8A 3V5DB 2VRAA 5CMAA 2R4SL 4QY8A 1S7UA 3MNZA 1MHEB 1GGUA 2ZOLB 3IU3B 2C1OB 3WNLA 3MJ9A 4M6NL 5DFVC 1J0IA 2KZ1B 4H0GA 2EYTA 4M6OH 2WINA 1U95A 2X4RA 1YY9D 3CFJA 4YHNB 4KRMB 5HBBA 1RURL 4OCWL 4RGNB 3S37H 3C5JB 4JREB 1RU9L 5E94B 4PS4L 4FG6C 2BFVH 3BOVA 1OTSD 2FBJH 3ZDYF 1BVKA 7FABH 3HE6C 3O3DA 3H9HA 4M9OA 2DMBA 3TO4D 2E6QA 3SCMC 3MPCA 4F7CA 3QXAA 1T2QH 1T0NB 1WISA 4AG4H 5IFHL 4LAQH 4LSPL 1KJ2L 4EOWH 4OUUB 1XGRB 4ZUSB 3VFOA 1KPUB 3AB0B 4PP1D 5DJAA 5F21B 3TVMB 4YHLH 5FO7A 4OUOA 4WI2A 4WHCA 1K4DB 3QJHB 4XC3L 1FG2A 3BXNA 1OAUL 2B1AH 4MWFA 2B0SH 1GZPB 3KYNB 5EZIL 4F2MB 3UTPE 3QHFL 5LXGL 5J11B 1WBZA 3MLUL 3F12A 2BRRL 1NSNL 1UVQB 3DROA 3CH8A 3UJTL 3MLRL 2GTZA 2R69L 3P9WB 3SKMA 4LMQI 2FJFA 1F6LL 5KSBE 2V7NA 4LGPB 1UYWL 4NNPH 4TVPE 3VFRB 2E27H 5J8OA 2PTTA 3IXTB 1CDCA 1DEEB 5JHDE 3W9DB 5I2IA 3QZWG 1FDLL 3KWWB 4R90H 3LV3B 3L5IA 1YEGH 5A16A 4NKMB 3GHBH 5FA4B 1HIMH 3M45A 4Y5YA 5ILTL 1NJ9B 5IJKC 4ZDHB 5ELIA 4PBVC 2GYSA 1PG7H 1XH3B 5D7LA 1X7QA 5FYKU 3ARZA 1KLUB 5F89B 5DQJA 4U1NB 5K33A 5HYIA 2BSTA 4GRWB 4W4OC 3F62A 3SGKA 4LSDA 4WTZG 1CLYL 5MEOB 4YPGB 4C56A 2VLRA 3OAZK 5HGAB 2E8YA 1GGCH 2PYFB 3HRZB 1U8MA 1GH7A 5GS1C 1BFSA 1ZOXA 4JCLA 5TF0A 5IBUG 1JFQL 5C0BA 5B4MD 4P23C 4PJXE 5E9DA 3RIFF 1AGFA 1RY7B 3RIFK 1DQLH 4PGCA 4ELME 4Y16C 2XWTA 2Y06L 1OCWL 2XA3A 1TQCC 1BZQK 1RZ7L 2WBWB 3EYQD 3OGCA 3BIAX 1VGEH 2GHWB 1RJYA 3F58L 1OAYH 1YN6A 1F4XH 1FAIH 3N06B 5HSFA 3RWCB 5ESVA 4F7EB 5AZEL 2I5YH 5JORA 3G5XB 4FHBD 3WD5L 3ULVE 1IGCL 1MFDL 4LEOA 3IF1B 2XXMB 2V5TA 4YHIB 4XNZB 2EDHA 3HRPA 5FO8A 1SVZA 3TF7C 4ONHA 3O6KL 2HA1A 2QQQA 3NZHH 2WSKA 2FLRT 2YK1L 3DV6B 3DIFB 3DMMB 1OAXH 2HT3C 3KJ4B 1XGQA 3NABH 2RFXA 4TULL 1WIOA 1ZK9A 5J9PA 4OTXL 3U9UA 4HIHB 4KXZH 2DI7A 3BZEB 1Y6MR 4HIJA 4QHLB 4LCUA 2F19L 5DC0A 2VNCA 3KNBA 5I74C 3FB6B 5AG8A 1EGJL 3O45B 1KNOB 1T4KB 5ALCL 2CQVA 1A8JH 5K59F 2AV7A 3ARRA 2D7PA 4ONFH 1XF3A 3KLHC 2GT9A 1NBVH 3T2NL 3FO0H 5DFVD 1IAKA 1N6QH 5JO5A 1C1EL 1UM5L 1VGKB 3ZDXE 4Y19D 3VGAB 5D2NC 1VB9A 3LEXB 2AJSH 1KYOJ 2LVCA 1CWVA 1D9KB 4FG6D 4AIZB 3GSWB 2EDDA 5E03A 3NIFE 3HE6D 1YJDC 1A7PL 4O00A 1IVLA 4FTVE 3OMZA 5EOQH 5LVEA 4BK4A 5FGBA 1SJHB 3T0EE 4H25B 3BO8B 3CVHB 2R2CA 5I18L 4PJEA 4HW6A 1T3FA 5CD3B 3M1BB 4O2FB 3LKNB 3O2VH 1NUFA 4KJWC 4X99A 1V3JA 5J3HD 4PJFB 1WSST 4H88H 4D9QE 4DVBA 1FZJA 5FO9B 3QG6B 2EH7H 5I71C 3QHZH 4KMTL 3BZ4A 2FZ3B 3D39E 1LO0L 5IQ9A 1LE5A 4Z95H 4ZTPH 1LO5A 1WFOA 5D93C 3CDFA 1DVFA 1MREL 1H3VA 5HTSA 2NY0C 5F72S 3OZ9H 3OB8A 3O9WA 3SE8H 3MNWA 4P5MA 5CJ5A 4Z0BH 2QHRL 3D2UB 1PJ9A 4N0FB 3SDAA 3KYKH 3OTTA 4DKEH 4MJ6A 2G75A 3MRIB 3CH1A 2I07B 3HZKA 5LWYH 3QQNA 4OZFA 2FL5A 1P5VA 1X5LA 1MPAL 5DVNA 2DN7A 2HMIC 5F6IB 3C8KB 1BFOA 2VXUL 5EZLB 3EKCA 3C08H 1FCCA 4MJIB 3B6SB 2YS4A 2Z8WC 3WN5C 3ZKSD 1JTOA 1ZS8A 3HMWL 4KTYA 4N0UB 5C0BE 3S34L 3VI3E 3W9EA 5HDQL 2E7BA 4O51A 4LP4A 1VADA 5E9DE 1I9EA 2D9QB 4LCCA 2DQTH 4EDXB 2XZQL 2AJYH 4IRZH 3FQWB 5I75B 1CLZH 3MMEB 4AM0A 5KVEH 2OP4H 1MWAA 5L88L 3MRCB 4MQXC 1LNUB 4NZDA 1H3PH 4YAQA 2P5EB 1WWBX 1BP3B 4WWKC 2BVPB 4DK6A 4Z7VA 3UBXB 3P4MB 1G7LA 1U3HB 2ADGB 2RBLA 4GRMB 1QUNA 2CLVB 3TYGL 1KCVH 4KJYA 5IB2B 5TFSL 3D3VB 2AAVA 2VN7A 4OGAD 5C0FB 5FM8A 2WBJA 3CCHB 2ESVA 3IRZA 2CSPA 3T65B 4FA8A 3NIDE 2R23B 3WFCH 2XWBA 5C09A 1IAIL 3I3BA 3QCUH 4MCYA 1QBAA 5KSAC 4AL8H 1RZ8B 3QUZB 4O58H 1I8MB 2C3HA 1RIUL 4OD2B 4J8RB 5CSZB 3U6RA 1EO8H 4BUGA 4DGYL 3MSPA 5DJCA 1D5ZA 2F74A 4UUJB 5BS0A 3DO3A 3PGDA 3AROA 5MP6H 3VXTB 4I9WD 5IWLC 1AQKH 2YPLA 5T5NG 5HHNB 4QF1A 3QEGL 1A5FL 1AD9A 1UH2A 3HCVA 3IAPA 4JFEA 4MQ7B 5E8DL 4AY0A 2VDKL 1FNGB 5B39A 3AXLB 3VD5A 4UTAL 3DURB 1TNMA 1EJOL 2DIAA 1HEZA 2E7MA 4P48A 5EN2B 4BZ2H 1CE6B 3GRWH 4IOIB 4KUCD 1YYML 1HILB 3DPBA 1LO2L 3GIVA 4X98B 4QTIH 4BUHA 3DGGA 4LPXA 1BOYA 2X4QA 4P57B 4M1GL 3TCLB 2FGWL 4HXBH 1E6JL 4XPTL 4L29A 4PJEE 1KEGH 4CADA 1EEYB 5DJ0A 3LEVL 2OL3B 3MODL 4YWGL 4NNYA 4JZNA 1IAOB 1ZT1B 4XB8A 5J06A 2HFGL 1U93A 2B1HL 1K85A 3LOWA 4RFOH 1DLFL 2PTVA 5BRZA 4F80A 4NHCL 3ZE2E 1CDYA 1IMHC 1N0LA 2ZOKB