4M61B

Crystal structure of unliganded anti-dna fab a52
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
220
Chain Sequence
EIQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGKINPYYGSTSYNQKFKGQATLTVDKSSSTAYMQLNSLTSEDSAVYYCARGRLRRGGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab A52 light chain
publication title Crystal structure determination of anti-DNA Fab A52.
pubmed doi rcsb
total genus 39
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B02
2EH7H 3BN3B 4XCEB 1QSEB 4M03A 1K6QH 4XB8A 2CR3A 2XKNA 1EBAA 1UZ6E 5D6CA 1H3XA 2JJSC 2R9HD 1JN6B 1HKFA 5HGHB 1WBYB 5IBTH 3H3PL 1MFDL 4FTVE 3WNLA 4MZ2A 1AXSA 3RTQB 4M5ZH 2ICWB 2PO6D 1CF8H 4YQXH 5T3XD 5JW5A 3QDGD 4LGSB 5F7DA 4IBLT 2ATPA 2VDKH 3I3DA 1NMBL 3SDCA 4RISL 1YMME 5FCSH 1I8MA 4Y2DA 3FQXB 4I0PB 1I9EA 2R23B 3NFPA 4G8FB 5CZXD 4EEEA 1ZWIB 1NCAH 1UH4A 5LCVL 4YHML 1KJVB 3LAFA 4K7PL 3PWNB 1UJ3A 4J4PC 1M1SA 2DTML 1AY1L 2X7LB 1HXMB 2E3VA 5D7IA 1F4YH 2NY2B 4J1UA 3BXNA 4PJAB 1KEML 5HHQA 3U36A 4AIOA 3KPNB 2YRZA 1QFPA 3N50A 4XPTH 3OKKA 4QRRB 4YDJB 3MR9B 1UACH 1UKTA 3OMZA 1VFOA 5JOFB 1JJUA 1BJ1J 1CD9B 4ZNEE 1GGTA 1JPFA 1CU4H 4TOYL 1IFHL 3BN9D 2XOTA 2A6KB 1T21A 4PTUA 3L3KA 4CVXB 3T0AA 2Z31D 3H9ZA 3KWWA 4JHWL 5DJZA 3KHOA 5ERWA 2I9LB 4NNYA 2GJZB 5KVDL 4GRLB 4S1QH 4IRZH 1UA6H 1HN1A 4YHKL 3RWHA 3JUZA 2ZKHL 5DWUL 3V0VB 1IBGL 1JGLL 2AJVH 1I9JL 4NQDD 4KI5E 4Y19B 4JQIH 4K94H 4PD4K 4S0TD 5JOEA 2F8XC 2J8UE 4NO0A 5EU6D 5TF1L 3U2SB 5DD5L 4GLRI 3KPRB 1RJZA 4A6YH 1XF1A 1CGXA 5F44A 2HN7B 3QFJB 4NGHH 4LKXA 1ZTXH 4FFWD 2V2TB 2CK0H 3MJ8A 3LS4H 4NNPH 5D5MA 3PHOA 1FYTB 2YD3A 2IWGA 1A6ZA 1KCSL 4MLSA 1O7SA 3RY5A 4XNMA 2D31B 3MNWA 4ZSOE 3V5DA 3TN0A 3U4BL 2EIBA 3NTCL 4EDXB 2ATKA 2NNAA 5LG1A 3VFSB 5DHXB 1CBVH 4WJ5A 5ALCL 1A7RH 3R06B 1IAMA 2X70A 3ROOA 1RJCA 4XZUA 3MO1A 1IGML 1QYGH 4I0CC 4OQ1A 3W82A 2IAMB 3IB4A 3BH9B 4GXVH 3VXUD 4GKNB 4XNUL 1L7TH 4X6DA 4YK4C 1HKLL 3QNZA 2BC4A 3ZKMC 3WLWD 3TNNB 5JQ6L 1E4XH 5GHWL 3WFCH 4TVPE 2X1XR 4JRXD 1FZOA 1HIMH 3SE4A 4BKLA 4G8GD 2YZ1A 1QFWI 2HWZH 4OZGE 1IAIH 4LOUD 1NCNA 3LKPB 4JFDD 1A6WL 5DEFA 5HYSA 5JIKA 5DRXB 3PV6A 5E99H 1ZHKA 2B2XH 4ONFH 3L3IA 3PE9A 1Q9OA 4OCSH 1CI5A 1WZMA 3NCBB 4X6CA 1J1OH 4QYOB 1KLUA 3K4DA 3RWIA 3MROB 4OGAD 1Q9LA 1KJ2H 3LN5B 4EOWH 5D96C 4KTEH 5D2NB 3DMMB 2E9BA 3PQYE 2AK4B 3DETC 3DURB 4LLAA 4M1DL 4UOW1 1OAZH 4YNYB 5ICYB 3GSWA 1BAFH 1RY7B 3EJJX 3QXAB 4QKXB 5FKPA 4U1GB 4ERSL 3DROB 2ZOKA 1A4KA 4JKWA 2NR6D 3L95B 4AEIH 1T5WA 4LGRB 3VH8A 1C5BL 4GMTL 5IBUB 5IMLA 3ZT6A 3MJ9H 2P8MB 5JIHA 3BW9A 4PJ7F 4HKBA 3TIDA 3U6RB 2GT9A 2HJLA 2BSED 2ZCKH 5F1IA 3QXTA 4OLZL 2BDNL 2VR5A 3U9UB 4OI8A 5IHLB 4D9QE 1GJIA 4WO4A 3BP4A 3L7EA 3GM0A 5C0AE 4F80A 3EJZD 4JFFB 4P3WA 3MLTB 3VXRE 1N2RA 2QADD 3OR6B 5ACLA 2ZUYA 1EHLH 1BQLH 4LSUL 4LLMA 4ZYKA 3RVUC 2ZUXA 4N1HB 3TJHC 3KPSB 1JNNH 3BZFB 3PWPE 1MI5E 4PRHA 4G8EB 5DUMH 1IC1A 3EIFA 2FJGA 3GRWA 4JHZA 3GB7B 1OPGL 4WTWA 4I2XA 2V9QA 1DN0B 4JY5L 4QOKD 4WWKC 3BGFB 2H6PA 3RVXD 1WIOA 4N8VA 5GRVL 1AXTL 4ZTPL 5C0CD 3VXNA 1I3RB 2C4FT 2XZZA 1TETL 4LCYA 5FO9A 4MB3A 2PYEA 3C5JB 5IW1B 2EH8L 4M7KH 3UYOD 4WCYL 1ORSB 3QUMH 2XWJB 2OBGA 5I16B 2DLIA 5SWQB 4HLJA 1TCRA 5EUKB 1T0NA 5DMKB 5F96H 2O26U 3GKZA 2WWKT 3F7VA 3C60D 2A2QT 4JFPB 1DVFB 4KHXL 1BQHG 3R0NA 2ED8A 3GMPB 3BD5A 1RJYA 4MVBD 1U8JA 3OF6D 1BGXL 3OJDB 3T3PF 3V4PH 1RZFH 3TCLA 1KT2A 4NC0B 2MPAH 4PGZA 2QSVA 3TBYA 3O3DB 4JO1H 4HLZH 3AU1B 3I6GB 1OTUD 3MRQA 4C56A 4UV4L 3OKEB 3DBXA 1ZHLB 5F9JB 1KIPB 4M6AA 4X6BB 1MHHB 1RZIA 4PJDA 5DRZA 4UQ3B 1FNGA 1VFMA 4WTXA 2XQBL 3O0RH 4P3CL 5TPWL 2EDDA 1OM3L 3UTZA 3QO1B 3WFDL 1S5HB 4MZ3A 1JNHB 2NY4D 4N1EA 5L2JA 3Q1SL 3FRUB 3M07A 4ZFFB 2D7TH 5EZIL 3MNVB 4XMLL 3QG6B 3ARWA 1GIGL 3VGAC 1DUYB 2F8VA 3QH3A 1EJ6A 2WUBH 1YEGH 4ONGH 4JZJC 3FB5B 1FL6B 1AGBA 2YPVL 4LRIC 3IYLW 25C8L 5H35A 3CU7A 4D0CA 3SKNA 1U8LB 3DVGA 3PL6B 3QEGL 4HWNA 3RDTD 2OP4H 4NM8L 4V1DD 2ZUUA 4NPYB 2YD9A 1J87A 2DWEA 4UBDD 4GUPA 4YXHL 1EO8H 2SEBB 2IADA 5AEAA 3HR5A 1F97A 4JO4H 4JAMB 4ODVH 5E7BA 1X5YA 4YWGL 2ADGA 3THMH 4F58H 4X5XB 4U1SB 4ISVB 1NGYA 4NSKB 4OSUL 1I1YB 4I4WB 1KC5L 4URTB 3LN4A 1HH6A 3K74B 1L0XA 5FDWA 1BBDL 4LBEA 1RHHA 1X5GA 1I8IA 1BZ9A 1XF5A 1HH9B 2EDYA 1JF5A 4BQ8A 5DSCB 3P11L 4UILL 5JTWA 4RRPA 3BJLA 1P2CB 1I3GL 3JTTA 2YC1B 4NQSA 3BUYA 3VFUB 3QUXA 5GGTA 4X8JB 3GI8L 3MRDA 1NFIA 2V7HA 3UTOA 1AJ7L 2BNRA 4NNXB 3D0VB 3P4OB 5DK0B 4ODXB 3B2UC 5GRYA 2UWEA 5AUMA 2IH1A 3G5ZA 3OB0K 3D25A 1FORH 3MRNB 4P3DA 1KCVH 3RUGF 4JG0L 1CYGA 1MIML 5E08L 1UXWA 5EUOE 1YECL 4YO0A 2P47B 3GM8A 5FA4A 4EI5A 4ZFOA 4Q0XL 4U3XA 3LQAC 4FTVD 4HXAH 1HSAA 3ETBF 4X7FC 1KCKA 2R0WL 1T7WA 5K9KB 2BSRA 1CGTA 3VXMD 2VB5A 1HNGA 5D1XD 1YMMD 1FFQA 5F72S 5E1HB 1G7PB 2CQVA 3LRSA 2FCBA 3TIEA 2CLZA 4P2YA 1AGEB 4L9LB 4AMKL 1HQ4A 1CDGA 3M1BA 3HI6L 5D7IE 5E2WL 4P46D 3P4NA 5C0JB 2ITCA 4TNVK 5FHAL 3CX2A 5BZWA 3W39B 4RDQF 4HWBH 1NDMA 2E9JA 3Q3GA 4WW1B 1GGIH 1AC0A 1IQWH 1LO5B 2JELH 4K71C 3QG7L 4YZFF 4L3AA 3S4SG 1W0VA 5DYOA 2M8XA 4DOHE 4X7CC 3G6JA 3S6CA 5BVPL 5J56B 2B4CL 2IQ9H 5FAAA 4BYHA 1TENA 1KUMA 5ALBH 4HUVA 1HHJA 1R3LB 2LTQB 4PJIE 5IB2A 5DRNA 3PWJB 1S7RB 4BUHA 4PJHA 2VTFA 4WVRA 1U8OA 4MD4B 1YY9D 4J8RB 1MFNA 4LCIL 5CJBA 4KI5D 1FZJA 1KPRA 3CXDH 1QFWH 1DQJB 4M6NL 5JUEL 3O8XB 3HMWL 3S88H 3P0YL 3MFGB 2BCKB 1HNFA 3ARDD 4UT7H 5D5ME 3HE7C 2VZ1A 3LHPH 4IRSC 4NRZA 3W0WD 3B6SB 1L7IL 4F9PA 1LO0H 1FZMA 1MAMH 4GXUM 3O6LH 3Q5YA 3VD5A 3SN6N 4H25A 4XCNB 1S3KH 1T5XA 3LZFL 5DVKA 2X41A 2BVEA 2DLHA 2R2CA 2QQNH 3ULSB 3FN0L 4X6DE 4X4XA 1CXHA 2PF6A 1GYAA 2W0FB 4DVBA 4U33A 4WEBL 3UTTA 4MQXD 4PGEB 4YHOL 5DJCA 3MLWL 1SY6L 2IFGA 2XNAB 4M93B 5SX4H 1SEBB 4IIQB 1FNEA 5AZEH 4FP8L 1IC4H 2BNQB 1F4XH 2WINA 1VFAB 5HHOA 3SBWC 3EUUA 3QNXA 3TA3B 1KPUB 3H9SE 1S9YA 1AKJD 5FGBC 1IGCL 1TQCB 1BOGA 1NCUA 1MCOL 2F5AL 2ZSWA 4ENED 4Q97A 4NDMA 5CIPA 4X6CE 4R96B 3C8KB 5DUBB 5FGCB 1HK6A 1LK2B 4P5TC 3LKRA 4QXGH 4I3SL 5C7XL 3QSKB 4LSPL 2VSCA 1J1PL 3O2WH 1MPAH 1FFOB 4K23H 2DYPA 4HPYH 4P23B 3SDAC 1MVUA 1HINL 2AV1A 5JO5A 4BZ1H 3U0TA 4ZAKA 5H37H 1BFVH 1II4E 4JY6B 5IT2L 5C0BE 4JFQA 5EPMA 3HMXA 4HC1A 3QXVA 4CAGA 4DGYH 1T66D 5E70A 4PJCF 3DRTA 1JV5B 3MLZH 2HKFL 4Q7DA 4XAWH 2VC2L 4LVHC 4YHZH 3IVKA 3NFSL 3MPCA 3C6LA 1DSFL 2ICCA 5FV2A 4XMKL 4QXTB 4RFOH 4R7NA 2VXTL 5EOCL 1EMTH 1XIWD 2ZUTA 5C6TL 4RX4D 3QXWA 4PB0H 3D85A 1ZLWK 3I6LD 4DK6A 3DXAB 1MLBB 1JWUA 4MCZA 5GZOC 1CDYA 5C0AD 3WD5L 1TVHB 3TT3L 4Y7MA 3HG1A 3VXRD 3T8XA 5HDBF 3RWCA 3EO9L 4PRHE 3U0PA 5F7NC 1YQ2A 3OPZH 5E6IC 4WHDA 5A2FA 1FNHA 4JM4H 4NP4H 3J8F7 3IDGB 3T4YA 4OZHF 4BH8A 2JCCB 5I74B 4PJ5B 3K2MC 4I2XE 2FYYB 2H32B 4G9FE 3O4LD 4CVWA 1NAMB 3VRIA 4Q9QH 4HMCA 3T0DA 4GRWE 5DC4B 1UM4L 5E8NB 5ESQA 4PV8A 3UXFA 3QI9C 4KRMB 1FL5A 2BMKB 3RFZC 1U92B 32C2B 1BVLA 1YQVL 2DLGA 1WJ3A 1EIBA 4Y88A 5CINL 4OQTL 1RZ7H 4F37K 3WLBA 5B38B 4KJPC 5FO7B 3A6CL 3B3IA 1VESA 2WIIB 4L8DB 4E9LA 1CQYA 3W2DL 1TMCB 1OHQA 5C09A 1Z2KA 4MDIA 4HUNB 4UUJB 1NKOA 1WVZA 2OL3H 1CGSH 4CNIB 4MDJA 1AIFB 4LLQA 5DQDH 5KVFL 2VZOA 3MBXL 4ELKA 5C0FA 4Y5XB 4K8RH 4QGTA 3DV4B 2CLVB 1I1CA 2JF1A 3O45A 1BJ8A 3CDCA 1Z9OA 4YFLI 2ILLA 5ADOL 3J7HA 3ULUE 3RTQC 1G7LA 5FECA 4L1HA 4PJDE 3LH2H 1IZJA 2VDNH 5DRWA 5I75B 4L3CB 3GBMH 4GSDH 4UU9B 3RNQA 3WXVL 4I0PC 3FMGH 3RZCB 2A73B 3HNTH 3RGHA 4QWWC 4NN6B 3SDDA 4LHUG 3CJJA 5C08B 5C0ND 3GJFH 3ARBB 4JPWL 5EA0H 3CDGB 1CD0A 2NY5H 4Y19D 3S36L 1H3GA 1VENA 5GJSL 2DQUH 4Z0BL 1KB9J 4NWUL 3KPLA 4H8WC 4LCWE 2NY2C 4MJ2A 4XP1L 1RFDH 5EIVA 3QWRA 2AJ3A 2YA0A 5FM5M 4NQVB 2AJYL 4UT9H 5IIEA 4YPJA 2J7LA 4MS8C 4JO3H 1S9WA 3F5WB 4KAQH 3SGJA 5C0EB 3BYTA 2EO1A 5ANMB 2DICA 1YEKL 2P5WE 4EQ3A 1UQSA 5C1MB 5DD1L 3JWDH 4IDJH 1N4XH 1E6OL 2EEAA 4MJ5B 3U4EB 1YNLH 2P24A 5I8EB 4BSWA 2P8PA 2RR3A 4GRLC 4GAYB 4PGCB 4U1HA 1F8TL 4ZS6D 1KIQB 2APXA 4I13B 4WFGD 1XGTB 7CGTA 3P3YA 5TFSL 4QY8A 1RJLB 3H9HA 3L3OA 3MCG1 1JZ4A 4M7LT 5KS9B 5I1DA 2EZ0C 2YPKB 5HI4D 2YN5A 4XVSH 3IJSA 3PGFL 3NACH 3FB6A 1ZT7A 4JRYB 5T1LB 1IC7L 4NUGL 1C16B 3T0EC 2VIRA 1H0DB 2Z8SA 5B39A 3UC0L 5CJXA 4B5EA 4K8RD 2BNRE 1EVTC 2K7QA 2WMPA 4XWOC 4JKPL 2GJ6D 2J8OA 2UWEE 4ZUUB 3UO1L 5KG9A 2D3VA 4YBQC 3QEHB 4XPBH 5FHBL 5GGVL 4WI7A 5I1IL 2D7NA 5C8JB 5F6HJ 1I9IH 4ODSH 5IEHA 2X4NA 2WWMD 5HYEA 4F7TB 1AD0A 3QIUA 4YHPA 1XGRB 2E6JA 3EYFB 4ZPTA 5FUOH 5CSGA 5E9DB 3BQUD 5GS1A 2AP2A 4IOFC 1U8IB 3DYMA 3S3SA 3U79A 5D7JD 5IMKA 3QJFA 4AIXA 1MFBH 4MAYB 2DDQL 5ID1A 3TGXA 1T2XA 3QEUB 2ARJQ 2A1WL 1ZLWH 3WDIA 2V5TA 4OF5A 4CN4A 3PHQA 3AMLA 2VLRB 5HY9A 4MB5A 3STLA 3HUJE 4JFED 2VZSA 4MD0B 1F58H 4PJEF 2MJWA 4JEGB 2G75A 2R1XA 2R0KL 2HMID 1KELL 4FQIH 3S96B 1NBZB 4H5SB 1K8DB 4LVOB 5GGRA 1A0QL 1QUNA 1Q0YL 2YS4A 2D7MA 3KAAA 2F9BT 4XNXH 4G6AD 2XA8L 1OB1A 2Z0BA 2DIBA 1A7QL 5D2NC 3UDWA 3DMMC 2NXZB 3F12B 4Z76B 5T1KA 3PABA 1TCMA 3MBEB 1R3HA 3WDJA 4BK4A 3DX6A 1XGYH 4C58B 2F53A 1REIA 3HZKA 4U1GC 1G9NH 2ESVA 4BFIB 4Q9CA 1G84A 4K3HA 3UZVB 1LK3L 4KDWA 1S7TA 1DUZB 2W0LA 3GMOB 5CMAB 4UNUA 4NZRH 3ZYZA 5AD0A 5KSUB 1R5VA 5T3ZL 1C5DA 4P2CG 3MLSL 3EDFA 4BJLA 4OD3H 2IBZX 4JCLA 1UXSA 5JIPA 3LRHA 4XNYL 1JHKH 4OM0L 4M7JH 1D9KB 3TO4A 3S7GA 5CBAB 2DLFL 1LO2H 2DQIL 1FFNB 1DVFD 3G5YA 3ZO0A 3D18A 3QIBB 5I0ZA 4KV5F 3MV9A 3EYUL 4BUGA 1KCUL 4RMRA 1KSRA 1I85A 1FIGH 3SE9H 3FQTB 5IWLA 4HUXB 1F90H 3OX8A 4X9BA 4PP2B 5I1HL 2VLJA 4HQQH 2BNUB 1V3MA 1J8HA 3RKDC 1MAKA 4LKCA 2Y06H 2BVUA 4F33A 4XHJD 1NC2B 3RL1A 3QUKA 4XP9L 2MCPH 2PR4L 4NKMB 4LDOB 4WHTB 1GZPA 3VRLE 2CGRH 3QWQB 1EAPB 1U42A 2HJFA 1TJIL 4PY7A 5IGXL 4EXKA 3IS1X 1BJMA 3BP7B 2FNBA 1GZQB 4HZLA 1HEZA 3H9SD 4S11A 5TDOA 3WIHA 4P9HL 5F7KC 3MTRA 4ZUTA 3WNOA 4MJ6A 5H94A 3V6ZA 2ITDA 2OTUA 1MFDH 3H8NA 2ADJB 2JIXD 2EE9A 4XCYA 3ROLA 2LFGA 3SKMB 1QR4A 1A7PH 1F3RB 3QISA 3DRQB 1XF4A 4UTBH 4RISH 4Y16A 4ONHB 3SKOA 2IPUG 3BPOB 2CK2A 3CVHA 4DN4L 4OGYL 5ISZD 4MAUL 3DGCR 1QP1A 1Z3GL 4YHMH 5LCVH 2AJXL 3X11B 4K7PH 4ZSOB 3SQBA 4EBQH 2X1PA 5C0BD 4LSVL 2DTMH 2RJMA 3PP4H 3QO0B 5D7KD 1YN7A 2X4UB 3D3VE 1KEMH 5GRVK 1WICA 1Y0LA 1C08B 2CSPA 2VLKA 1CXEA 3ULUH 2BFVL 2XV6B 3E6FA 3VRJB 1JUFA 3DX9B 5HPMB 5I71C 4PJ7A 3R0MA 3GSNA 3QPXH 1YPZB 3L3DB 3HG1E 4X9FA 3PL6C 4CW1A 4TOYH 1IFHH 2W65A 5D71H 5A3IC 4LQ1A 2VH5H 2EEDA 3VFWB 5EU5A 4JHWH 4Z7UB 2V7NA 5KVDH 4HKZB 5F88B 4FHBD 4YHKH 1U3HD 5DWUH 2D0FA 1I7TB 4ONOA 1I1AD 1IBGH 4FQ2L 4JRWA 4I3GA 4CU6A 1I9JH 2HT4C 4WU5A 4GRMA 1H15A 5GSVA 1CGVA 3KPQB 1GC1L 3SCMA 3NAAL 3VDAA 5BZDB 5DD5H 5JHLL 3PQYB 1Q0XH 1DBBL 4OF0A 2BK8A 3T2NL 1X7QB 1MCEA 1CLOL 1FV1A 4FQXC 5D7LA 3SY0B 3MRMB 4KVNL 4C83A 4KRPD 3LOWA 1KCSH 5HYSG 2AEWA 1G0XA 4JFXA 3FT3B 3U4BH 1CXIA 4NOFA 2GCYA 4CGTA 1ACZA 3ZHLA 2NW2A 5D1QB 2VLLB 5F1NB 3B9KA 4R90L 3F7PC 2Q87A 4AT6B 5I17B 4U1IA 5MEOB 1RUML 2A6JA 2R69H 3CSYA 3LKSB 2Q3AA 3OAZK 5INCB 3T2QA 4XVTH 4XNUH 3D39B 4RWHA 1HKLH 4Y4HD 2CRIA 1ETZB 5JQ6H 3GRWL 4IOIB 3EYSH 4BZYA 1G7QA 1HHIB 4JM2D 4WWKA 5IFHL 3G04A 5FKAA 2BVTA 4M3KB 2VDLL 3N85L 4KY1L 3TNMA 4NWTL 4OLUL 3SO3C 4PR5B 5LGJB 2VZUA 3ULUD 5HHME 4KTDL 3VH8G 3L6FB 1OARH 1UWXK 5JXED 3K1KC 4DWHA 3PDDA 3PWPB 1MI5B 1A6WH 3JV6A 4K7PX 4P2OB 4DZ8B 1KCLA 1LEKB 2DRUA 3EHBD 4BQBA 4NQED 5HD8D 3RGVD 3KPPB 2YBRA 3WXWH 1BVZA 3MRKA 3MMEB 5BRZB 1LD9A 5JXAL 1NCWH 4P9MH 3IT8D 1RUAL 5DUPL 2XKSA 4LCWD 5F71A 1T22A 2Y9RT 3SGDH 3U0WL 3QFDB 5E1AB 4YJZL 4G6KL 1U2CA 3PDGA 1I3VA 4MJ4A 3RBGA 4ERSH 1CE1L 1WBXA 3IFNH 1MHPL 5SWSD 3WIFA 5KSBA 1MY5A 1M7DA 5F1SA 2FX7L 1HHHA 3N1PC 2P5WD 3OKDB 4G5ZL 4EQ2A 1U8QA 1HSBB 3BP6B 2LTQC 3PGDB 1W0WA 5D2LA 2OM5A 4ZQKA 4OLZH 5MERB 4ZXBB 4NM4H 3E0GA 5TQ2L 4L9DA 4Y1AA 3LS5L 2VISB 3P9LB 5F7UA 4KK6C 3IDIA 5F3HA 3CFCH 3O11B 4YDIL 2BNQD 4WU7A 1J7VR 1HDMB 4KJQC 4N0CC 1FJ1B 3O8XC 2C7UB 5TDPA 2Y4SA 4PLJC 3TP4A 3FCTB 1HYRC 3F7QA 1KJ3L 5I0DA 3WO3B 5MP6L 1T2QL 1CLZH 1HZHL 1N6QH 2DQTL 1OPGH 2CRZA 2JKXA 4WWID 2HKHL 3TESA 1N59A 2GW5A 2NY3C 3I9GH 5J6HA 4R97B 1R0AL 4WI3A 4X4YB 1AO7D 1AXTH 2VDPL 3LV3B 5HYJB 1CFBA 5FCUH 5D93B 2FECI 5DD0H 3IDMA 1F3JB 1NGZB 1TETH 4XP4L 1NQBA 1T1WB 2FHCA 3O2DH 4YDVA 4R7DA 3RUGA 3SPVA 1S9KC 3O3AB 1NC4D 3CU1A 3X3GL 5I15L 4POZD 3BN9C 5H8DA 1TJGL 3BH8A 5E8PA 4M93C 1ZA3B 1N3NB 3SE3C 1CE6B 3HZYB 3RU8L 3WHXB 2BOCA 1QSVA 3HPJA 2E9IA 3TA3C 2GFBB 2ZNXA 2XRAL 4RGNE 4TSCL 4KHXH 1TQCC 5GGTL 2PCPB 1HWGB 4HK3J 4XP6L 4M1CD 4GG6F 5JR1H 1BGXH 3FTGB 5CGTA 1L4IA 1J1XL 1NFKA 3K8LA 2X9YA 4UV4H 4CVZA 1VB9A 1JPSL 4P4KA 1L6ZA 5HDOA 1A3RL 3RX7A 2XQBH 3P4LA 4H0IA 2ESVE 4P3CH 5TPWH 4FQQA 4ZFOL 4ZOAA 1OM3H 3KLHD 4PJ5D 1FLRH 1KEGL 3WFDH 4OBRA 1OAYL 1Q72L 4A2LA 1NUDA 3Q1SH 1IM9A 2XKNB 5FM5O 5J11B 5I8CA 5D6CB 4XMLH 1C5CL 1QSZA 1P53A 1GIGH 5BV7L 5DA0B 2D03L 3UTPE 1AXSB 1R6VA 4WUUD 3KJ6H 5JW5B 5F7DB 4LK4A 1C1EL 2ATPB 3CZFA 5GRUL 5I1KL 3SDCB 4APQD 3QEGH 2DQDL 2XN9D 4WUKH 2R8SL 1I8MB 4Y2DB 2N4IA 2HT3D 4UOJA 3EOBA 1T04A 2YPLA 3ALXA 4LOUC 1X4ZA 5IEKA 1IL1A 1UJ3B 5GRWA 2OLDA 1UWXH 4QHLA 5TGBA 5CUSL 2WM0A 4YWGH 1KXQE 3O3EA 5D7IB 4YXKL 4J1UB 1NLBH 1KYOJ 2E27H 3BXNB 5J7CC 5HHQB 1OWRM 4XH2A 2VLJE 5I74C 3U36B 1JHTA 4OSUH 4LU5H 1KC5H 1CLYH 4U6TA 1DLHA 1JMXA 1GAFL 3BEVA 3OKKB 5EO0A 1BBDH 2Q86A 1NCDL 4RMWA 4UZGA 5ESAA 2HVJA 3P11H 3OHXA 4BZ2H 4UILH 1JPFB 1T1XA 4FXKA 3V8OA 2PXYA 1GGUA 4PTUB 1T21B 3QQ3A 3L3KB 4O02L 2CLRA 3S34L 2GTWA 3DECA 3KWWB 5DJZB 5ERWB 4G7VL 3V52H 4NNYB 2NR6C 1AJ7H 3RWHB 2G2RA 3R8BB 3HE7A 2W59A 5FYJE 1LDSA 4EUPG 1YEHH 2PW2A 4MHHI 3CGTA 1RUPL 4QHNA 5J89A 3QUYA 5IVXF 2X4QA 2BVYA 4NO0B 4UQ2B 1DTUA 4YLQT 1RJZB 5FF6A 5E08H 4XNZB 4JFHD 3O3UN 3INUL 4Q0XH 4Y8DC 2FD6L 4LKXB 1BHGA 4Z5RA 5FB8A 4WDIA 3MJ8B 5E7FA 3DO7A 5D5MB 1S78D 3PHOB 5EU7E 2APBA 1P4LA 1A6ZB 3RAJL 3IDNA 1LO4H 1OTSD 4XNMB 3ZDYE 3MNWB 5CEZE 3V5DB 3TN0B 2H2SC 2ATKB 2EIDA 5C2BL 4KRNA 5KSAD 4LAQH 5I75C 1R24A 2JJWA 4AMKH 4KRLB 4WJ5B 1WWCA 3EFDL 2X70B 5HJ3A 1MQKL 3ROOB 3RZCC 4XZUB 3CLEL 3MO1B 4MXQC 2XTJD 3T0XA 1D7FA 1CQKA 2J5LB 3ARBC 3LIZL 2VLKE 4X6DB 3QNZB 3C5ZA 2R4SL 2BC4B 2EEBA 1VPOL 3QG7H 3D3VD 3RVTD 2W9DL 2ERJB 1FZOB 1MRFL 3L5XH 4PJGF 4BKLB 2B4CH 1E4WL 3HFMH 3VXOA 3MV7A 4QTIL 3SDAA 5DEFB 5HYSB 1FG2A 3PV6B 4NO5A 1N7ML 4YC2B 3WN5A 3VI3E 5L2KD 4MJIE 1ZHKB 3K3QA 3L3IB 1Q9OB 1OTTD 4XC1H 4X6CB 4LASL 2Y07L 5TE4L 3SJVD 3BISA 1DQTA 1KLUB 2COQA 3HMXL 3RWIB 1Q9LB 4TQEL 1H3UA 1P7KA 4XP5L 4QRSA 2D9QB 4AL8L 1P7QD 1TTGA 4IOSD 4G6JL 3QULA 3CLFH 4LL9A 3GSWB 3O6ML 3P0YH 5BXFA 1PX4A 1TJHL 5FKPB 2F74A 4KUCF 5LAXA 4U2ZA 5D7LE 1XF2A 3ALWA 2ZOKB 3GSOA 1A4KB 5E4EB 1T5WB 3VH8B 5IMLB 1V3JA 5LKNA 4PJ8D 3BW9B 3BT2L 2EDWA 1ITCA 3HZMA 4HKBB 3TIDB 2I9TB 2GT9B 3HB3C 2HJLB 2NYYC 5F1IB 1MHEA 2CKBH 1F2QA 3LZFH 2AXJA 3RY6C 4R2GB 2GIYA 4U2YA 5FYLE 3EDKA 1U8MA 1WT5A 2VQTA 4OCMC 1T7ZA 4WO4B 1X6LA 3BP4B 4KKBD 4WEBH 4WHCA 4DUWA 4RQQA 5FUCC 3U9PH 1FCCA 1N2RB 3MLWH 4ZO7A 4KQ4L 2WBJD 5EZLA 1N8ZA 1SY6H 3T3PE 4FP8H 4LLMB 4MAYC 4ZYKB 2DQEL 4PJ9D 4KK9C 3VXQA 4ZFGL 3BMVA 5ICXA 1CICD 3MUZ1 3KYAA 4HGWB 4PRHB 1JZ3A 3GBNH 1SVZA 4LSSH 4FMKA 3GFUA 1QHPA 1TXKA 4MNQD 2X4TA 2FJGB 4PD4J 1IGTA 1MCOH 2F5AH 4LP4A 4WI5A 1U3ZA 4I2XB 2C3GA 1MREL 4HUMB 4XX1G 3AS3A 1AE6H 3AREA 4GRWB 2H6PB 2DD8L 3JSSA 3ZT5A 4N8VB 4LIQL 3NIGF 3NA9L 3BKJL 3B2VL 3VXNB 1PG7L 4LVOC 3PF2A 5F6IB 1NCBL 4LCYB 3UTSA 1YNTA 5FO9B 2PYEB 5DD3L 1S7WA 1SJVA 2R56L 1D9KD 2CDEA 4NKQB 3W5MA 5KSBE 3MBEC 1TCRB 1T0NB 2J12B 3DV6A 3EOTL 3F7VB 3P40A 1R5IA 4KHTL 4N0UA 3UZQA 2HKFH 4AY0A 2Q6WA 1FO0H 2VC2H 1J05A 4KK5C 1HHGA 5D2LE 1RJYB 3NFSH 4MB4A 3IF1A 4JFOA 1U8JB 2JE8A 1LEIA 1DSFH 3TCLB 3JVGC 1KT2B 1MCIA 2DQGL 3GNML 1PSKH 4Y1AE 3TBYB 2VXTH 4V2BA 5EOCH 4RAVA 1JF6A 5A16A 3MRQB 1W72L 4JDVA 4C56B 1SBSL 3DBXB 1IGFL 3C8HA 3VXTA 1FGNL 4XC3L 3RRQA 1RZIB 4PJDB 3BYYA 1X44A 5DRZB 1FNGB 3IRZA 4ODTL 1PW3A 2ZSVA 3TT3H 3WD5H 5HPOA 3EO9H 3PGCA 1ZLUK 5ITBH 2FSEA 1ZSDA 3UTZB 3WL9A 1NLDL 5L2JB 4P2QE 1I8LC 1WZLA 1FLTX 4NKIH 1P9MA 3QH3B 2ZOLA 1BMGA 1WV7T 3QIBC 4HMEA 4W68A 3BIKA 1AGBB 1YJDL 1X5XA 3RI5K 5IB5A 2NY6B 3D5OF 1H3VA 3MZGB 5H35B 4D0CB 3SKNB 3DVGB 4LEXL 2DB8A 1JGVL 4BFEA 1UC6A 1YQVH 4JLRA 4BH7A 5B3NA 2IALA 1A02N 3BFOA 2OJEA 3CK0H 2DWEB 4OQTH 5CD5C 4GUPB 3FFCA 3TZVA 2XXCB 3QR2A 2IADB 3FOMA 3HR5B 4KPHL 5T1MA 4OF7A 5EBMA 5EU4A 3QA3A 2ADGB 5DJXA 3W2DH 4DFIA 4GS7C 4KROB 1KN4H 4W81A 4N0YL 1NGYB 3JWOL 4OZFG 4YX2L 3HAEG 1IEBA 5EBGA 3F8UB 3LN4B 2DL2A 5FDWB 2VXVL 4LBEB 1RHHB 1I8IB 1BZ9B 1XF5B 1BJ1H 3Q48A 4EDWH 2XACC 3VWKD 4B0MM 4PJEA 3MBXH 3ZKQD 2Y6SD 1F4WL 3TBTA 3P9MA 2A77L 3DPBA 3ZLQC 4KGLA 3JTTB 3ARFD 3QUXB 3T2PA 5D72H 5GIRA 3MRDB 3DI2B 4YZFE 3CAFA 1JWMA 2V7HB 4M8QA 4Y4FD 3BPOC 3QDHA 3WXVH 2YUVA 2D4FA 2FGZA 2Z4QA 4NN7B 1H3WM 2UWEB 5AUMB 5C07A 2IH1B 3G5ZB 2BVOA 5C2UB 3D25B 2IPUK 2ZPKL 4JPWH 4LDEB 2VL5A 4P3DB 3ZE0E 1BEYL 3E6HA 5L88L 2OTPA 2DMCA 4KMLB 4PGJA 4KI5F 4Z0BH 5CZVL 1UXWB 4NWUH 4NO3A 4YO0B 5FA4B 4EI5B 4ZFOB 4XP1H 1RUQH 2J8UF 3GKWL 1HSAB 3UTPD 1CTOA 2BSRB 2W92A 4CJ1A 1JWSA 1FC2D 5IK3A 1YEKH 4KUZL 5BV7B 2YKLL 1IM3A 3L5JA 3LRSB 3LPFA 1OSPH 3TIEB 1B4JH 2CLZB 4TULL 2NX5A 2E7LC 2YUZA 4RBPK 3AM8C 1HQ4B 4LHUD 2V6HA 3KYMA 3M1BB 3CXHK 3P4NB 1U95A 1JPGA 2J8HA 2ITCB 3MOBH 4UINL 5IP4A 1GGCH 3IKKA 5BZWB 4IRJD 4DUVA 1NDMB 3Q3GB 3HE6A 5DHVA 2F54A 3ULVE 1BBJA 1F11A 4G43B 4HWEH 1NANH 3OKYA 1W0VB 5DYOB 5L8JB 2A6DA 3G6JB 3X13A 4CBPA 3TJEH 2H3NA 2YR3A 1BD2A 3EBAA 1QLEH 5F8QC 3TCXA 3U48A 1FRGL 1TTFA 1IC7H 4NUGH 3QB7C 4HUVB 3GSRA 4OZGF 3ESUF 1T66C 4DEPB 1HHJB 3VFOA 5FYKE 3LDBB 3WJJA 5DJAA 5DRNB 5IB2B 4PJHB 1MJJA 5GGVH 4MX7A 4EI6A 3MA9L 1U8OB 5I1IH 1FSKC 2JJTC 2X42A 3WS6C 3HZVA 1B88A 4PRPA 5D1QC 2R2HA 5BRZD 1FZJB 1KPRB 1U0QA 2XKUA 4C59B 5EOTB 1UM5H 2LU7A 2R0ZH 2ICWJ 3HC4L 3QWOA 3BJ91 2DDQH 1MCWW 4LRNH 4WI2A 3OKMA 1WIPA 5FEBA 4NRZB 4TSAL 3GIVA 2A1WH 4MNGA 4TUOA 4JFZH 5GGQL 1EGJL 4ZDHA 5BQ7A 1FZMB 2NY0B 1AP2A 3SDYH 3FQUA 1ZLUH 2W0KA 4H25B 4PB9L 1T5XB 1BX2A 2WLYA 3C09B 4P2OC 1V7NH 4FZ8L 5J12B 2R0KH 4OFYA 1MSPA 4X4XB 4Z78A 4DVBB 3RIAK 4YHYB 1A0QH 4OUOA 1EERB 3E3QE 4TN9A 3UTTB 4LSTL 4U6XA 5DJCB 2XA8H 2A74A 3P73A 5K9QG 4JANA 2AEPL 2WINB 1T1YA 1S5IL 3DO3A 4DKEH 1JGUL 5HHOB 3QNXB 2EICA 4RAUA 2R29L 1S9YB 3MLUH 3V0WL 1BOGB 1QNZL 1WCBA 3PUCA 1V3KA 2ZSWB 4FFYL 4NDMB 3FT2A 5CIPB 4JB9L 3QDME 1QBBA 3LKRB 3CVHL 4K9EH 1K8IA 4MJID 5DZLA 4NIKB 2ID5A 1U8HA 3MJGX 5ILTL 4Z7QE 5T5NF 3MUGA 2B7DT 1WWBX 1V05A 1WFUA 4XAKE 2DYPB 1XH3A 2AV7A 1W8NA 1QFHA 2EDFA 1MVUB 2EXYC 2Q3ZA 1ZLSL 2R15A 4Y5VA 3MCKA 2AV1B 5JO5B 2NY1B 3U0TB 4ZAKB 1F02I 3RP1A 3EYQC 4JFQB 4OM0H 5EPMB 4HIXH 4AM0B 1P4IL 3DRTB 3F58L 2DLFH 1ADQA 5L9DH 2DQIH 1QEWA 1IZKA 1FNLA 4X7EC 3IVKB 5C0NC 1MNUL 2LVEA 3C6LB 1KCUH 4X7SL 1ZS8A 4X5LA 2FX8H 4B50A 3GMQA 4R7NB 3CNKA 5I1HH 4OKDA 3V5HA 1LP9E 4D0BA 2V17L 2PN5A 1ZXQA 2AEIT 3D85B 3PNWA 1U91A 4R97C 1JWUB 4MCZB 3VMPA 5D93C 5LQBH 2LQRA 1W2KT 2XQYG 3HG1B 3M8OL 4XP9H 3RWCB 3T8XB 1WGOA 3U0PB 4JVWA 2G60H 4WY7L 3IXAA 4GAFB 2HT2D 2J88H 3FZUD 1TJIH 3AC0A 3T4YB 4BH8B 4X99A 5IGXH 5EULV 3FO9A 5B4MC 5CP3H 4DTGL 2HJKA 4FQXA 2X9WA 5EZOL 3VRIB 4OD2B 3U30B 4FFVD 3A6BL 3P30H 3WFBL 1OP3H 5F7WC 3T4AA 5I1EH 4OD1H 2ZCLL 4H20L 1JTOA 5ESQB 4DVRL 5KAQF 4PV8B 3KDMA 3MV8D 5EIIA 3QCTL 4YBHA 1FL5B 3B5TA 4OBSA 1BVLB 3B5HA 2ED7A 1GOFA 4H1LG 3Q5TA 2UVEA 4LP5A 3WLBB 2VN4A 2A9ML 5F7EL 43CAA 4WI4A 3UROR 4OGYH 2XTLA 3B3IB 4Q9BA 4MAUH 3BE1L 3L5WA 2E6PA 4N0UE 2AJXH 3PP3H 3D1MC 3CH8A 2LE9A 5GS0C 5C09B 2IG2L 4LSVH 2AEQL 4MDIB 5JW4R 3VG9B 5D8JH 1CS6A 1GXEA 1YEIL 3I3BA 5DK2A 4R26L 4MDJB 2J6EL 1D5XA 2FO1A 4LLQB 2VABA 2EYTA 5J11C 3ARGD 5DFWH 3ZSSA 5C0FB 4ELKB 3LD8B 3O45B 1DL7L 1NBVH 5D7JC 4DZBA 1BZQK 1G7LB 5FECB 4O5LL 2QEJA 1PEZA 1JRHL 1KLFA 1BECA 5EU3A 3NPSB 4Y2DC 3RNQB 4HX1A 3U7YH 3SDDB 5EO9A 2PYFA 4WFFD 1UJ3C 3O6FD 4Q6IA 4P2QD 3GHEL 1WFOA 3U82B 3HHRB 1G6RA 3MFFA 3KPLB 1LVEA 3I02A 1YEJL 1S7UA 4NO2A 2AJ3B 4OZ4A 5JW4M 5IIEB 5IFJA 5EUOF 2OZ4L 3VWJD 1S9WB 5DJ2A 2M2DA 4LPCA 1MCLA 4NC1E 4XHQA 3FFCE 4X5WB 1CLOH 3ZHKA 2PO6A 1UQSB 4DN3H 4G6FB 4KVNH 3QDGA 1CR9H 4XI5D 4AIZA 4JCMA 2P24B 4BSWB 3RVVD 2P8PB 4FQJL 4R90H 5D7IF 4NQCD 5EDXA 4QRTA 3BI9X 4QY8B 2VZ3A 3PWVA 1YEFL 1RK1A 3H9HB 3L3OB 1OAQL 1QVOA 1Q38A 1M05A 5L6YL 4OI9A 5I1DB 4Z7WF 4PRID 4XNZC 2A0LD 1NUGA 4S1DC 3FB6B 1ZT7B 1L9MA 1NJ9A 3N85H 4KY1H 3MX0A 4M02A 4GG6A 2VIRB 4OLUH 5B39B 3WUWG 5K9JL 3ARPA 4FABL 4KJWD 2H2PC 4KTDH 3ILQC 5KG9B 5C07E 1JI2A 3ALPA 3TN0C 4PJIF 4XXCA 1F45A 3UPRA 4MA7L 2Z31A 5IEHB 2X4NB 1PKQA 1LDPH 2CIKA 5GGRY 3VXPA 1AD0B 3QIUB 4YHPB 4ZPTB 4JDZA 5GS1B 5HI3D 5JXAH 2VOTA 5IMKB 4NCC2 3QJFB 1RUAH 5DUPH 3DUUA 5EO1A 4G42A 4NQDA 5ID1B 2P42B 3NH7H 3JXAA 1QKZL 2VRAA 1JGDA 3Q6FA 2ERJC 1AI1L 3PHQB 1MIEH 5HY9B 4G6KH 5EU6A 5DMIL 3SE4C 3QZWG 2NX5E 3MODL 3UJIH 3REVA 1CE1H 3L7FA 4XX1E 2R39A 4IMKA 2FX7H 3TVMD 2G75B 2R1XB 2B1HL 3SEPA 4PUBH 4RGNB 4YC2C 2EDTA 4I9WE 3FHAA 1EFQA 3MGAA 5INDA 1J0YA 1DLFL 5GGRB 1QA9A 3IFPA 1YEEL 4OI7A 5TQ2H 5IHZA 3KPOA 5J57B 1OB1B 4AG4L 4D3CL 3MXVL 5T1KB 3PABB 4PV9A 1R3HB 4YDIH 4M7ZB 3VXUA 3EAKA 4ZD3H 2FBOJ 4QEGA 5F89A 3DX6B 3NIDE 2RFXA 1BZ7A 4CMMA 3HI1A 5MEPA 2F53B 1QACA 1SEQL 1JL8A 2DBLL 1EBPA 3HZKB 3D0LA 1KJ3H 1LO3L 2ESVB 4JRXA 2M26A 1E4KA 5E4EC 5MP6H 4GW5A 4I48B 4QT5A 1GC1C 1S7TB 4FQLL 1ZMYA 1T1ZA 3GSQA 5T5FH 1RIVL 1BREA 1HZHH 4PRPE 5AD0B 2DQTH 1NBQA 1R5VB 4X6CF 4M62H 1N64H 4JFDA 1C5DB 2HKHH 5KTEL 1P4BL 1R0AH 2EKSA 4QRQA 2VDPH 5C6WH 4WO4C 4WI8A 1JZ7A 4XP4H 4RDQG 4MNGE 5KZCD 3ME0A 5CJOL 3V79C 1IC5L 5IVXA 2LVCA 3TO4B 3O9WD 3BGMA 1GOHA 5DHYA 4HJJH 4N5UA 3MRLA 2EDNA 3G5YB 3MCLL 3D18B 4YDKH 3MV9B 1U3HC 2XRAH 4TSCH 3GHBH 1YUHA 3WFEH 2GK2A 3DYPA 3GMLB 3OX8B 3KYOA 2VLJB 5MHSD 1B9ZA 1NEZA 1J8HB 1KIUA 3N1FC 1J1XH 4LKCB 3MRIA 3U7WL 3BDYH 4NYLA 4F33B 1U3YA 1MCPL 3RL1B 3QUKB 1OCWH 3MRBB 3NZHL 5F6IC 1JPSH 1GZPB 3U7AA 2HJFB 4PY7B 2DM4A 4N90D 1JZ2A 5MEND 1U41A 4PJGA 4HZLB 3EYVA 4PBVC 2B39A 5TDOB 1T4KA 4PJBE 4WIQA 4POUB 1OAYH 4ZUTB 1B6UA 3BSZL 5H94B 3V6ZB 2ITDB 2OTUB 3QDMD 4L4TE 5J3HC 5ICZA 4GH7B 4GRWF 2D03H 4XCYB 3ROLB 1FVCA 2VXQL 4JN1H 2LABA 3UX9B 1A22B 1XF4B 5GRUH 3MGTA 2P45B 2WZPD 1Y6KR 3AMKA 4QOKA 4XPAL 1BF8A 2BXZA 4Y16B 1A2YA 3SKOB 4EUPH 2DQDH 1DDHA 3CVHB 4GBXD 2RCSH 4LFHG 1H5BA 2GTZA 5C0CA 3O41A 2VITA 1B2WH 1EFXD 5ABDE 5I30L 1CLCA 5A40E 2NZ9D 2P5EE 3JWNC 2GJJA 1KJ2A 5CUSH 1WFNA 4YXKH 1YN7B 2Y5TA 4B53A 3VD7A 3CSPA 1Y0LB 4JE4B 2VLKB 5BMFH 2CUIA 4WHYG 4Z7OF 3E6FB 2EDQA 3S37L 1JUFB 3C60A 4PJ7B 3RJQB 1NCDH 1JFQL 4CKVX 2LU4A 3GSNB 3DNKA 2NY6C 3OF6A 5D96B 3CMGA 2VAJA 4CW1B 1J0IA 3MOAL 2W65B 3V4VH 3ULUF 4N5ED 4O02H 4DKDC 5IB1A 3DVFA 5EU5B 1K5NA 2IQAA 1FP5A 5IFAL 3UBXA 1P7HL 3GUTA 3MC0A 2XZAL 5FM4A 1OGTA 1A6UH 1XGPA 3IGAA 4OM1L 4LDLB 3RWFA 4OLWH 5JORA 4WU5B 2DKUA 4GRMB 1H15B 5GSVB 5JMOC 3EJYD 4KROC 5BCAA 1EXUA 3X12A 3DX8A 3SCMB 1JPTH 2DIJA 4OCXH 2O5ZH 4HT1H 5CAYB 3G6AA 1K4CA 3BKCL 3FAXA 2FD6H 5JHDE 3OB8A 5JOPE 2F19L 1QLFB 1FV1B 5D7LB 4OB5H 3SKJH 4MCYA 4C83B 4IM8A 4OFDA 3RAJH 3VGHA 1MCNA 1P84J 1CXKA 1R5WA 4JFXB 3QUXC 1F6AA 1T89A 3C2AL 1UEMA 2NW2B 3MRRA 4V1DA 2WV3A 4I0KA 5I1AA 3B9KB 3EFDH 4LCUA 1V3LA 3FQRA 4U1IB 3CSYB 4NN7C 1CZ8L 4Z7VE 2QQKL 3LIZH 4RSVA 2OR9L 5C71A 5IMMB 5K9QI 1VERA 4UNVA 2OK0H 1JGEA 5KN5A 1G7QB 4OGXH 1MF2L 3DHJA 5KANG 4WWKB 3G04B 5FKAB 4EI5C 3QUMA 4OCRL 5J6GA 1P6FA 1OQOA 5CCKL 3LEYL 1CL7L 1CGWA 3ZTNH 5HGAB 3JV6B 2EIZA 3K2UL 3QHZL 4I8DA 2BRRL 2EDKA 1CD1A 4EZMA 2UWEF 4ZPVA 4AQOA 2YBRB 3KG5A 2Y07H 5TE4H 1FAIL 3MRKB 3HMXH 4PRNA 1TFHA 4JGJA 4BA8A 5CWSA 1T22B 4C4KT 4G6JH 4QNPE 3ZT7A 3O6MH 2W0PA 4GG8A 3WFZA 4M6ML 1WEJL 4GKZA 4TSBL 4WTZG 4KMTL 3IRPX 3QDGE 4BFBD 2H26A 2O61A 1WBXB 5CILL 1M7IA 3WIFB 5KSBB 1TLKA 5JA9A 4FTVA 5CKAA 3PWLB 1M7DB 2J4WL 4ZNCD 1HHHB 5CD3A 3OXRA 4BQ9A 3HUJF 1U8QB 3VXMA 2GITA 4HS3A 4DEPC 4H8WL 2F5BH 5D1XA 1W0WB 1YMMA 5D2LB 4ZQKB 5ITFA 3LEVL 4LCCA 3VJ6A 2B5IC 5DR5H 1S7XA 3Q6GL 1UCTA 4Y1AB 1FNSL 5I2IA 4P46A 1Q1JL 1G1CA 3IDIB 5F3HB 3X3FL 4QTHA 3EGSA 3TYFA 4WU7B 12E8L 4CU8A 5HHPA 3QQ4A 5TDPB 2X05A 5CP7A 1UYWL 1TVBA 4HIIA 1AR1D 2D7PA 3ZTJG 2NLJA 1BQSA 2FZ3A 3Q0HA 4F9PC 3OKOA 1PY9A 2DS4A 5E2VL 2NY0C 2X1WL 1PKQE 2IPKA 1N59B 3C09C 4E41B 1EDQA 3KLSA 3VE0A 5J6HB 2MQ0A 2XPGA 4ZUSA 5JZ7D 3G08A 5EZJA 4NQDE 3SDXE 3IDMB 3SPVB 1P1ZA 4R7DB 4YDVB 3RUGB 4ZFZA 3S98A 5J13B 5DD3H 2AGJL 3OKLA 3BH8B 5E8PB 2R56H 3IDXH 4OT1H 5DEGA 3BDXA 5HHVL 4S1SH 1MFCL 2MCG1 2J8UA 2P46B 2BOCB 3H0TA 3HPJB 3EOTH 3ZKXB 4HF5H 4KHTH 1FG9C 3W0WA 3ZKNC 2JTDA 1UCBH 1Y6MR 3GNMH 4MMXC 1BWMA 2NXYC 5KVGL 2IBBA 4NOBA 1HXYA 1W72H 1A6TA 3NVQA 4NJAL 1SBSH 1U6AH 4CVZB 3QUZD 5GXBB 4XC3H 3A6OA 5DDHA 1WFTA 4P4KB 4OZFH 1QOKA 4ODTH 3HAEH 2NY1C 1WLHA 1EO7A 1JYXA 4JRXE 4FQQB 4ZAKC 2HFTA 3MUJA 2VDML 3HLAA 4FG6C 3VRLF 4G8GE 1KF9B 1T3FA 3H7LA 1I4FA 4HWBA 5JMRA 4B41A 1VEMA 4ZODA 1IM9B 1IMHC 5I8CB 5FUZH 4JFDE 4FNLL 3D2UD 1MWAH 3N9GL 3B9DA 1AKJA 1G0DA 4OZGA 3P4MA 4HAFA 5D9SA 3GMMA 4KTYA 3U1SL 3C6LC 5DI8A 1YJDH 5GJTH 3CZFB 3D9AL 1F13A 5DURB 5EORL 2X10A 1JGVH 5IVXE 3EOBB 5AYQA 1T04B 2VLMD 2YPLB 5GRJL 1I3UA 3QQNA 4MGXA 2FJHA 2NTSP 4M4PA 4KPHH 5IEKB 4YHIA 5F9WB 4QHLB 5TGBB 5DJYA 3O3EB 5L7XH 1RZJH 4N0YH 3GSXA 5DTFA 4XH2B 1E4XI 1JHTB 1ZVYA 4YX2H 3Q5OA 3O3BA 1JNLL 5AYUL 3U30C 2K9UA 3FO1A 5J06A 1DLHB 3QCUL 2VDOL 3BEVB 3DI3B 5EO0B 2Q86B 1OD7A 1WCQA 3MRJA 4ZO8A 1JK8A 2JJTA 1IAII 1ZE3C 3OZ9H 5ESAB 3WS6A 2HVJB 2AK1L 3OHXB 1QQDA 3ZYJA 4XBGA 3QRGL 4FXKB 4MA1B 2PXYB 3QQ3B 3W9DA 2CLRB 3TWCL 2GTWB 1RMFH 5LWYH 2ZCHL 1XIWA 4K3JL 1EEZA 2DWDA 3F7YA 1DJSA 2FX9H 4RX4A 3OG6B 5BW7A 1JIBA 4PJGE 2G2RB 4JPVL 3HE7B 4TYUA 3D6GA 4LF3A 3VFRA 2PW2B 4J3WA 5C0AA 1KTRL 2DAVA 4HJ0D 1PLGL 3VXRA 4QHNB 2ZPKH 3QUYB 1K85A 2X4QB 1BEYH 3GMNA 3VG9C 4PY8I 1AR2A 5FFLA 5L88H 5CJ8A 5IV2A 5CZVH 5FF6B 1IE5A 5IBUG 3TFKC 4Z95L 1BWWA 4KMQA 3O4LA 4L4TD 3WE6A 4QOKE 4KKBC 4U0RB 5FB8B 4KK8D 4KKCC 4WDIB 2E7MA 4G6ML 3LD8C 1Z9LA 3DO7B 4Q2ZA 2IPTH 3DYOA 5JLZA 1P4LB 4KI1A 5C0CE 3IDNB 5CJ5A 2YKLH 4P99A 4Y4KD 1N5AA 3UBXI 4TULH 4TUJA 4HD9A 3FJTA 1R24B 4M48L 3F65A 2GK0A 3NPSC 1YEDA 1BVKA 1FH5L 5HJ3B 3I50H 5D1ZD 1DBKL 5DFVD 2F15A 4UINH 3SDDC 3WIIL 5T33L 2P5ED 2OMNA 1IKNC 3C5ZB 4YHLL 2C9AA 4GAJH 4XPFH 3CUPA 4Z77A 3K4AA 2OMBA 3BIBX 4R4ND 3GI9L 4N8CL 5E8DL 3VXOB 3MV7B 1FRGH 3SGJC 3SDAB 4OZIF 3P0VL 1FG2B 4NO5B 2VAAB 1MEXL 3LPWA 3WN5B 1X5IA 1ACYL 2UY6A 2ZG3A 2ZUWA 5HDQL 2R0LL 1MJUL 1MLCA 1YNKL 2A83A 1LHZA 3MA9H 3QIUD 4XVUD 1DQLH 2ADFL 8FABA 4I3RL 1IQDA 4WFHD 3WSQL 1P7KB 1DZBA 4KQ3H 4QRSB 3RNKA 4U6YA 3VFGL 3QULB 4TVSa 2AJZA 3AUVA 3W9EA 3WCYA 5BXFB 2FBJH 1D5IH 4M6OH 2F74B 5LAXB 2VO5A 4DW2L 1PDKA 1XF2B 3GSOB 3NIGE 4TSAH 5I73B 5FA3A 1MCBA 5JHDD 5JOPD 3D87B 4ETQA 1EGJH 3WUZA 4W6YB 2XFXA 3JWOC 4TPRH 3U4AA 4U1MA 5IBLD 4HIJA 3HZMB 5CJXC 1KG0B 5IHUH 4K3EL 5DJDA 2NY7L 4PB9H 1MHEB 1TZGL 2MHAA 1N5YH 4F7PA 4FZ8H 2EXWC 4HCRH 1U8MB 3VFMA 2E9WA 2CDFA 1QRND 2QBWA 4RQQB 3S9DB 3FN3A 3EO0A 5T1KD 3S97C 4ORGA 5EZLB 4XXDB 5GS1C 3N1GC 5DK3A 4O00A 2VQ1A 1Z9MA 3VXSD 3VXQB 5I8OH 7FABL 5ICXB 1S5IH 4S1RL 5FK9A 5GZND 3GIZH 1RPQA 1D6VL 1ZT1A 4JPKH 1UADC 2OL3A 2X4TB 3T0WA 3LKOA 2EIEA 4TRPL 3MXWL 1IGTB 1N26A 2X1QA 4ZUWA 4NCDA 2HTLC 3AREB 4IJ3B 1X6NA 1IAKA 4J4PD 2ZUVA 4YEEA 5ILTH 4RGNC 2GJ6A 2Y36L 3SGKA 3VMOA 3PV7A 2JK5A 3MA7A 1SJHA 2V5SA 3UTSB 1YNTB 3LN5A 1D6EA 2FL5A 1S7WB 4DGIL 2CDEB 3QEQD 4HJGA 3UDWC 5BOZG 1ZGLP 4GAGL 2FEEL 3BQUA 2I24N 4M7ZC 3GJFA 5D7JA 1P4IH 4JZNA 3QXAA 3DV6B 2DQCH 2F58H 3AS1A 5EUOA 4I1NB 4N0UB 3VXME 3F58H 2Q6WB 5IMOA 4ELMF 1J05B 5HGGS 4LLYA 2JB5L 4AH2A 3MRPA 1HHGB 3IF1B 1Q94A 2HG5A 4H1LH 4JFOB 2AJSL 1LEIB 4X7SH 4PGBA 4JFEA 4DQOH 2BZDA 1J8HD 1KN2L 1CFVL 4M4RA 3WHE0 4RAVB 1MJ7H 3CIQA 5A16B 1DQML 4N9OB 2F8OA 3VXTB 2Q76A 3C08H 1RAMA 4WV1A 1KPVA 4BK5A 9CGTA 1AFVL 2CXKA 2OI9C 2ZSVB 3M8OH 4P2RE 3PGCB 3QDJD 4JGUA 2FSEB 1ZSDB 3OR6A 3N1MC 3WL9B 4Z7WA 1JVKA 3TO4C 1XR9A 3R1GL 5F9OL 1H3PL 4DTGH 1QBML 4DAGL 2UUDH 4HGKC 3WKML 4PS4L 2ZOLB 3MNZA 3DUHA 3WFBH 1A4JA 3IU4L 5T3XL 3BIKB 1J5OL 1I85C 4F8QA 4DVRH 5IWLC 5IB5B 4NC2B 4NN5C 4HIHA 3QCTH 1XF3A 3FT4A 4PJIA 4HK3N 4JLRB 4BH7B 3ZKMD 2IALB 3X14A 1MCSA 2X5PA 2OJEB 4CU7A 4AQ1B 3FFCB 2A9MH 3TZVB 3FOMB 5T1MB 5EBMB 5GSRA 5EU4B 3QIWD 3QA3B 4NRXA 4NUJA 5DJXB 4H0GA 3W0WE 1JTPA 4X4ZA 3T0EB 2IG2H 2AEQH 4D8PA 4HBCL 2IAND 4F8TA 1IEBB 4R26H 3FRPA 3NABL 2J6EH 5DT1L 2DQFA 2UY7A 2QHLA 1DVFA 5JPNA 1E27A 1MJ8L 4PJEB 3MZTA 3K7UA 5JW3L 5C0RL 1DL7H 3TBTB 3P9MB 5KJRL 2G5BA 1G1YA 2FH8A 3DETD 5GIRB 4O5LH 4KDVA 5K33A 1JWMB 1CWVA 4FQ1L 4Y16C 2I60H 3JBG7 4M8QB 1DP0A 3IDJA 1YC7A 3OKEA 4YGVA 2Z4QB 5C07B 2BVOB 2VMFA 2AS5M 1NFDE 1WWWX 1EAJA 2Q20A 2VL5B 4P57A 1F00I 3E6HB 3MREA 2EH7L 3CDFA 2VZVA 4NO3B 1UZ8A 3G6DH 4MWFA 1UH3A 4UT6H 2Y7QA 3H9SA 4X0KA 2AXHA 2OZ4H 5E8EA 1LNUA 1OLZA 4YQXL 3VA2C 1JWSB 5GGSA 3OSKA 5IK3B 2VDKL 1G0YR 2JIXA 4EJ1C 4NZUL 2NX5B 5IESL 43C9A 2IH3A 3ZDYF 4LMQI 3KYMB 4QLRA 2FR4A 1WTLA 3MLVL 3BP5A 3RVUD 1U95B 1BLNA 1JPGB 3OQ3B 3TJHD 4AEHH 2C3XA 1D5ZA 1KB5A 5IB4A 5ISZA 2C1PA 4U1JA 3HE6B 5DHVB 1KTDA 2F54B 1A3QA 3GJEA 4NQTA 1BBJB 5C0BA 1F11B 1F4YL 5SX4I 1I1RA 1INEH 1MUJA 4L4VD 4D9RE 2A6DB 3X13B 3SCMC 2H3NB 4YUEH 4JJHA 5DZOA 5E2UL 1BD2B 3SKUD 5ENWA 4XPTL 4JQVC 5ETUA 2EECA 5L8KB 1X3DA 1ZGLA 4LSDA 3GSRB 4YXLL 4LMQE 3I6LE 3UAJC 1N6VA 4DGVH 3VFOB 3SHSA 5DJAB 3HS0A 1MJJB 4MX7B 1T2JA 4EI6B 1NAML 3AXLA 1RVFH 3VI3F 2W1NA 3HZVB 4IRZL 4S1QL 1UG9A 4MA7H 2GKIA 4PRPB 2R2HB 4NNXA 4W4OA 3B9KC 3O4OC 1DE4A 2CUMA 3O4LE 1U3HA 1QHOA 4WI6A 1I1AA 1BPVA 3G5XA 1ORQA 3QWOB 1SBBA 1XMWA 4OF3A 3OKMB 4LVNB 1QKZH 4G9FA 3GIVB 3CVIL 4MNGB 4UTAH 4TUOB 1AI1H 1OQXA 4NGHL 4ZDHB 1ZTXL 3FO2A 3SOBL 3V7AG 3MODH 1AP2B 3LS4L 3FQUB 4D9LH 1BX2B 3RWGA 2D0GA 1BF2A 2YD8A 4Q9RL 3LQZA 3NOIA 3CFKA 3BPCA 4Z78B 3BIAX 1A7RL 3LQAH 1DLFH 4E5XA 2ENSA 4QHUA 4U6XB 1A7NH 4PJAE 3MYJA 4R9HA 1UJTA 4GXVL 2A74B 3T08A 4AG4H 4D3CH 5KOVC 3P73B 1AXIB 4W4NA 2CRYA 4JANB 4WENB 3MXVH 1LO5A 1U93A 1E4XL 1T1YB 3ZE1E 3KYKL 2KPNA 4MYWB 4MA3A 5E2TH 1HIML 1WAAF 4RAUB 2AABH 4Y4HA 5ID0A 4XVJH 5E6YA 2HWZL 1LO3H 1WCBB 3JUYA 4JM2A 3FT2B 1NKRA 4ZOCA 4HXBH 1K8IB 5GRZA 4E41D 1RIVH 1U8HB 5B38G 1A5FL 1G9MC 5JXEA 3MUGB 2QR0A 1VKXA 2D2OA 2BY0A 1QFWM 5B22A 5KTEH 2Y1VA 1XH3B 1ZANL 1IGJA 1VGKA 2AV7B 3CD4A 3HNVH 4R3SA 4Y19E 4NQEA 3T3ME 4Y5VB 1KJ2L 3MCKB 3TH2T 4EOWL 1A9BA 3RGVA 1ZV5A 1UB5A 1OWWA 4YHNA 1QRKA 3QFJE 2X89D 1OAZL 1IC5H 3NZ8A 3OAYK 5I71B 3CXHJ 2UVFA 4HBQA 4LCWA 1E6JL 3WO4C 3LQMA 1FYTE 5HI5C 5KSBF 2CJUL 1QEWB 1RIHL 3MCLH 4CN6A 4N9GA 1ZS8B 5I1CL 5J1AA 3O6FC 3GMQB 4FXGA 5GS3A 3B2UD 5SWSA 5D2LF 3V5HB 2AJUH 5I18L 4QRPD 2ZCKL 2P5WA 4D0BB 3PNWB 1U91B 1I7UA 4MA8H 4WFGE 2XICA 3AAZA 1J9CT 2W0FA 1MCPH 2EC8A 4OV5A 3NZHH 3H6JA 3ZHDA 1RZKH 4FFZL 3IXAB 4HKJA 1EHLL 1BQLL 5J13C 1QSFD 4X99B 4WHYH 4HIEA 1UH2A 3FO9B 4WRLA 5TE7L 2FEDC 2HJKB 4FQXB 1CVRA 1JNNL 5DUML 1DFBL 3T4AB 3ZKXC 5LVEA 2GJ6E 3BSZH 1VEPA 1J11A 3KDMB 4LLVA 3BAEL 5EIIB 1PZ5A 4AK1A 2VXQH 4O9HL 2AERT 2IEPA 5D2NE 3DSFH 2A0LC 2AK4E 43CAB 1JBJA 5CEXA 5LXGH 4RGOL 5FOBA 1AO7A 1NMAH 2GUOA 4TTDC 3L5WB 4L8CA 1FNAA 4P4KC 4YFEA 1GGBL 3ISWA 3SO3B 1CGUA 2DTSA 1NEUA 1NC4A 3CFIC 2DOCA 1G7IA 3DGGA 4YE4L 1KLGA 5DK2B 5F96L 4JFEE 4YH6A 3VFPA 3LEXA 1D5XB 2VABB 2EYTB 1QPXA 3NIFE 4MXWH 4Z7NE 4HHAB 2Y5EA 4NBZB 3M17A 2B0SL 3HUJA 3BRGC 4DZBB 1RZFL 4JR9L 3FQWA 5I1GH 2UZIL 5IR1A 4LFHD 3KR3H 3MOAH 3S5LA 3WBDA 5EU3B 4CDGC 4JFFE 1S9XA 4CUCA 1EX0A 2CMRL 4HX1B 2C3WA 3HE7D 4OCWL 1WUNT 4Z7WE 4IRSD 4L8BA 2XZAH 2FJFA 4P2RD 4OM1H 2QSCH 5EO9B 2PYFB 3O0RL 5F9WC 4Q6IB 4RA3A 4FMFA 4OUUB 1G6RB 1ZLVK 3KXFD 3MFFB 1U8NA 4C55A 2P4AB 2JCCA 1INDH 1D5BA 3I02B 3ZE0F 1ES0A 1S7UB 4NO2B 4OZ4B 1BQHA 5IFJB 5DJ2B 5E24E 1HCVA 1YEGL 2WUBL 4ONGL 3ULVC 4NHCL 3BKCH 5SWZD 2F19H 1VHPA 4GT7A 5DLMH 2PO6B 1P6AB 4WUUA 3QDGB 4MA1C 2PXYC 4L3ED 5B8CA 4AIZB 4APQA 5IB3A 2XN9A 4H88L 1EO8L 4LQFL 2K3TA 4JO4L 4ODVL 2DM2A 4QRTB 1CZ8H 1XGQA 1CFTA 3PWVB 2K7PA 1RK1B 4P5TD 2FIKA 3QUYC 1M05B 2YEZA 2OR9H 3O2DA 1ONQA 2FO4A 3ULVF 1MY7A 3S3PA 4QCIA 3STZA 1MF2H 1X5HA 2YA2A 5E2JA 1NJ9B 2NY3B 3MV7D 4GG6B 1EJOH 4O58L 1FGVL 2FGWH 4U0RC 1CL7H 1T6WA 4QHKI 4UAOB 2L4OA 5GGUA 2BRRH 5EWIH 3UPRB 1CDBA 2Z31B 1PKQB 5JW4N 3RIFF 2CIKB 3GBLA 3DSNA 3VXPB 2A73A 4JDZB 1YC8A 1FAIH 5I1JL 5I1LA 4KKAC 4GMSH 3QAZB 1FORL 1K4DA 4MNHA 3ZTJH 4RA0C 2ZZUT 5EO1B 1KCVL 3DUUB 4AJ0A 1OP5K 5BS0D 4NQDB 3C5ZC 4HS6A 5H2BA 4L8SA 1JGDB 2BSSA 3GO1H 4UOW0 5LBSH 5EU6B 1NPUA 1WEJH 2MMXA 4HXAL 4C4KO 2NZIA 4KMTH 4KZEL 1OW0C 3REVB 3LB6C 3L7FB 5CILH 5GZOD 1G7HA 2J4WH 5SV4A 4NCC1 3W11C 3ARUA 3VMNA 3NN8A 2H1PH 2YXFA 5E6ID 5ISZE 2MOVA 3WN5C 4R8WL 1DCLA 3MGOA 5INDB 3LEVH 1QA9B 3OWEA 3IFPB 5TE6L 2Y25A 5KSAA 3BPNC 2OR7A 5IHZB 3KPOB 5D7KE 4HWBL 1FNSH 2VDQL 1MCCA 2GAZA 1Q1JH 1GGIL 3H3KA 4TVPL 1IQWL 3MRCB 4I18A 4PV9B 4ODUA 4D9RD 3VXUB 3QI9D 2C4FU 3WDHA 5F89B 5CKGA 2RIKA 1E0OB 3NA4A 2RFXB 3OB0H 1BZ7B 4CMMB 3HI1B 5MEPB 1MRCH 1VA9A 4EN3D 3D3VA 3D0LB 1GHFH 2IQ9L 4JRXB 3RWEA 5I73C 3FKUS 3FB8A 1W0YT 5E00A 4GW5B 4KJPD 4PP1C 4QT5B 3V6OE 5MI0C 5E2VH 1T1ZB 2IMMA 2CR6A 1OGAD 4JFDB 5L2KA 2EKSB 4QRQB 5FIEA 4H0HB 5C8JA 2ZJSH 4Z7QF 3MYZA 1S9VA 1NMCB 1WT5C 1QSED 4JQXA 3SJVA 4NJ9H 4LEOA 1XGRA 1DQQA 1QFWL 5J1SC 4Y5YA 5IVXB 1KIRA 3S88L 4F7EA 4XCFL 3BGMB 3RTQD 3S4SA 1P7QA 4E42A 5HHVH 5DHYB 3LHPL 1MFCH 1KCRL 2N7BA 3H2WA 3MRLB 2ZG2A 4PLKD 5TQ0L 4LHQB 2O5YH 3CFDA 5BOPA 4NQXA 3P77A 4CL7A 4JPIB 4I0PD 4GW4A 3O6LL 3SQOL 1YUHB 4G80A 1FHGA 2BJML 4QWWD 1EA9C 3KYOB 2L7UA 2Q7YA 3RBSA 1S3KL 1NEZB 4I77H 3AREC 4IJ3C 4PJ8A 4PG9A 2IBGA 2QQNL 5KVGH 3MRIB 1YMHA 4NYLB 2NY2D 4MSWA 1LP9F 5CS7A 4HAGA 2WANA 3KHQA 1NL0L 4MS8D 4Z7OE 1NCCL 4YPGA 4QRRD 5AZEL 1CVSC 3IU3A 2VDMH 2WBJA 1FVEA 4PJGB 4EIGB 3EYVB 3KPMA 1T4KB 2YD2A 3QXDA 4PJ9A 5JQHC 1CICA 4FNLH 5ICZB 3N9GH 5HSFA 4OZIA 1Z5LA 4MNQA 4GRLD 4JDTH 1FVCB 4NQEE 3U1SH 4QXGL 1T80A 1OLLA 3OTTA 1FVDA 3D9AH 3MGTB 5KSUA 4QOKB 5CGYC 1A2YB 5EORH 4N0FA 1DDHB 1IKNA 3F6LA 5IW6A 3TV3L 1KULA 4Z8FL 4BQ6A 1H5BB 4OCLC 4XMPL 2GTZB 2IGFL 5C0CB 5HGBA 3O41B 3KPRD 5GRJH 2BSTA 2DJUA 3MLRL 5F7YC 2VITB 5JNYA 3K8KA 5DMGC 3QFJD 1BFVL 1FE8H 2RB8A 3T0ED 2ZNWA 2APVA 1ZGLM 5AAWA 1KJ2B 4XNQA 1UWEH 1D9KA 1X5FA 2Y5TB 4XWOD 1FYTD 1KNOA 3H42L 5E95B 3TC9A 3MLZL 5SWSE 4YBQD 5EFIA 1JNLH 2W91A 1P9MC 1AGDA 3C60B 3GK8H 1BFSA 1IEAA 2C4XA 2V2XA 4RFOL 5DMYA 1EMTL 1VFBA 2AK1H 3QRGH 2IAMD 4IOFD 3O81A 3ORJA 4PB0L 5IB1B 4OFIA 3TWCH 3I6KA 2ZCHH 2IQAB 4OIIL 3T04D 3UBXB 3O2VL 1VEOA 3ARVA 4JJ5A 3GUTB 1OGTB 1RI8A 1XGPB 1JTTA 2BNQE 2CKBA 2XA3A 3IGAB 3TZVC 3RWFB 3K4ZA 2UZXB 4XGZA 1I7ZA 4U05A 4XTRD 5DQ9A 5JORB 1KTKE 3HKFA 4JM4L 2EO9A 4NP4L 1PLGH 4DJMA 5IROA 4N0RA 5K9OA 1EXUB 4HGMA 3X12B 1DBML 1PGRB 3DX8B 3UJJL 3SGDI 5I66A 1G6VK 4KKLC 1SY6A 2NY4B 1HWHB 3RHWF 2YA1A 2HFFA 3G6AB 4Z95H 1K4CB 3U46A 3UJTL 1Q9KA 2YMXH 1ZVHA 4G6MH 4HV8A 3TBWA 1AO7E 4MCYB 2H9GA 4HS8L 3C2SA 3DMMD 1R5WB 1JNJA 2AK4D 1RZ7L 1F6AB 3BPLB 4OLYH 3MRRB 4V1DB 3JV4A 1FL3A 4M48H 4LHJB 4LCUB 2QJDA 3FQRB 3PIQA 5DEZA 1A6VH 2E5EA 2OXHA 4A2MA 4P0DA 1NAKH 1MFAL 2OL3L 1CGSL 4S10A 1JGEB 1GPOL 5KN5B 4ELMA 4KVCL 3K8MA 3QPQC 2X4UA 1T03H 5DQDL 3QUMB 1J86A 5J6GB 1RZ8A 4P4RA 3IAPA 2GI7A 3DIFA 5KAQG 3GI9H 5E8DH 3MLYH 3DX9A 5GS0L 1FO0A 3DXAE 3LKNA 3UEZA 3VWKA 3BO8A 1IGIH 2EIZB 3LH2L 2VDNL 4JFFD 3BMWA 1ACYH 3ARFA 5HDQH 1CD1B 3GBML 2R0LH 4GSDL 5CSZA 4ZPVB 1T7XA 3MJ7A 3BUTA 3DVIA 1QG3A 1TTUA 2JCCE 4Y4FA 2ADFH 3JZ7A 4PJ5E 3KPSD 4PRNB 4JHAL 5EA0L 4S0SD 1V7MH 3WSQH 4U49A 1KGCD 2R1YA 3HE6C 2QKIA 5HTSA 1FAKT 5CWSB 3VFGH 1J0KA 4GG8B 5CFHA 4GKSA 5E94A 3QUZC 3RKDD 4GKZB 4DW2H 4WUUE 4UT9L 2AXFA 1PKOA 1F4HA 2H26B 2O61B 2UV3A 1M6OA 1M7IB 2XWTA 4FTVB 3QNYA 5CD3B 2XN9E 5HVWA 3W81A 4U7SA 3VGFA 3VXMB 2ADIA 2GITB 4HS3B 4PJFA 2FB4H 2NY7H 1YMMB 2H41A 3CFJA 3WJJC 5ITFB 4X9HA 4LCCB 3VJ6B 1YNLL 1BFOA 1S7XB 4ZS7L 3SO5A 2X9XA 5MEQA 4LHUA 3IAGC 5I2IB 4LSRH 4P46B 3MLXH 4OQTA 3OXSA 4QTHB 3EGSB 3TYFB 4IRJA 2BVPA 1P84K 5HHPB 3QQ4B 5CP7B 2AQ2A 2VWEC 1LGVA 1T7YA 3IJHA 1TVBB 2VE6A 4HIIB 5IUSA 3NBNA 7FABH 4LVNC 3GSUA 4S1RH 5IKCA 3NIDF 5DZNA 2NLJB 3NACL 4QXUL 1TZHA 2FZ3B 3OKOB 4KXZI 3MXWH 4X80H 2IPKB 3DOSA 5BO1L 3V8CA 5C08E 3VE0B 2XPGB 4ZUSB 4GS7B 3G08B 5EZJB 2Y36H 1NSNL 2KH2B 5FUOL 1DEEA 1P1ZB 2PNDA 1CT8A 5BRZA 3OKLB 1KACB 4JFHE 5DEGB 1QBAA 5JDSA 1JHLL 4GAGH 1WZ1L 3H3PH 1YN6A 3RA7L 2J8UB 3WMSA 3PL6D 3H0TB 4LPWA 5A3ID 1WSST 1PYWA 3UP1A 1NMBH 3W0WB 3MSPA 5DO2C 2JB5H 5GPRA 2IJ0C 1F58L 2DLTA 4ODBD 2AJSH 2JJVA 4HPOL 5IM7A 2K1MA 1KN2H 1CFVH 4PGDA 2HT4D 2XTJE 4AEEA 1HXYB 1A6TB 1AY1H 3H7BA 5DDHB 5KS9E 3BWAA 4Y5VC 5DF0A 1WISA 1RZGA 1AFVH 3TBVA 3HLAB 4RAHA 5TH2A 3ZDZF 3M45A 1DQDL 1I4FB 1T3FB 1XGYL 2HLFC 3VFTA 3R1GH 1ULVA 4OIBA 1NGWA 4M43L 4MQSB 2AKRA 1FYHB 4PJBF 3V6FA 1AKJB 4OZGB 1S7SA 3P4MB 3V4UL 5L2KE 4KH2A 5D9SB 3JV0A 3GMMB 3IU4H 5T3XH 5DI8B 4MXVF 3C8DA 2AW2A 3SJVE 5FUCE 2ZKHH 4MJIA 2VJXA 1KB5L 3ZMRA 5DGRA 1ZA6A 1JGLH 4QRUA 3ARTA 2IFFL 4R4NC 1A3LL 5JW4Q 3PXHA 4DK3A 2FJHB 2YN3A 3T0BA 4X9GA 5TF1H 4YHIB 2DQHL 1T1WA 4M7JL 5DJYB 1A7BA 2QLVB 4JQVA 4KDTA 1NGXA 4JFYA 2QQQA 1IGYA 2EDJA 4K55A 3UZEA 3GSXB 5DTFB 1LO2L 3OGCA 3VI4E 3LVEA 2X2YA 2DI8A 3O3BB 2DLEA 1QTYT 3FO1B 4BSJA 3NABH 1WQVT 4EXPX 1FIGL 3MRJB 5B3JF 1JK8B 1MJ8H 1FSKB 3NFNA 4U7MA 1F90L 3NTCH 1IT9L 1P5VA 5JW3H 1HILA 4XBGB 5C0RH 1T83A 2V2WA 5KJRH 3W9DB 5KW9L 5ALCH 2E8YA 3QQ9D 1XIWB 1IGMH 1EEZB 2DWDB 3F7YB 2Y06L 2YUXA 3ESVF 5ESVA 2P44B 1ND0A 3LY6A 4HSQA 4X6EB 1PFCA 4LF3B 3VFRB 5C0AB 5GHWH 5CHNA 3VXRB 4OZIE 3GMNB 1WAAA 4MNQE 5IV2B 1XR8A 4UIMA 1VACA 3T65A 3O4LB 3WE6B 1WTGT 4HEME 4Q2ZB 5JLZB 4D0DB 2VERN 1GVIA 2BRQA 1A7PL 4KK6D 3MV8A 2X4OA 3NCCB 4UTBL 4JG1L 5CLTA 1N5AB 2RBLA 5GZNC 4KJQD 4N0CD 4NZUH 4TUJB 3O8XD 4LLWA 5IESH 4PLJD 2GK0B 2EYSA 3MACL 5DJ0A 1YEDB 1BVKB 4M1DH 2GQHA 3MLVH 4ZTOL 4D2NA 4Z0XA 4EBQL 3PXJA 4N68A 4RMVA 4Z7VF 3PP4L 4Q6IC 5C3LD 3GGWA 4ZUVA 4HKXA 2R4RL 3VGGA 1C5BH 4GMTH 5KSVA 1MH5A 4NT6A 1TITA 2NY3D 3CUPB 4Z77B 2GHWB 3ULUL 5E2UH 1GGYA 1FQ9C 3ARGA 4N8VG 1T7VA 1HI6A 2BDNH 2R9HC 3QPXL 1N6UA 4YXLH 2PO6C 4PLNC 5CLWA 5D71L 5FGSA 2VH5L 5DVOA 4J2XA 1MLCB 2A83B 1HQRB 1XCQA 1TNMA 5C86A 2H32H 2DMBA 1NAMH 4NFBA 3STBA 5CZXC 8FABB 1CXLA 1XEDA 1IQDB 4LSUH 3TA3D 3BKYL 3OJMB 1K2DA 3RNKB 4RNRB 4U6YB 1MAJA 2VXUL 2AJZB 1H8NA 1UWGL 3W9EB 5BJTA 2C1OA 3O6FA 4P2QA 4UQ2A 3V6BR 3QJHA 3IKCA 1Q0XL 1CIUA 1A47A 4QNPF 5FA3B 3CVIH 4JY5H 4WEMB 3BEWA 5CP3A 4ETQB 2XFXB 4P23D 3CCHA 4U1MB 3SOBH 4HIJB 3VWJA 1BM3L 1A14L 4GQ9L 4ZTPH 5DJDB 1R3KA 5C70A 2MHAB 1RHFA 3Q2CA 2AQ1A 4F7PB 3X17A 1SJEA 4UAOC 4JN2A 5LJYH 1EH9A 1MCHA 4LPUA 1LE5A 4Q9RH 3VFMB 2EH8H 4XXCC 4CN1A 5IOPA 2Z31C 4WCYH 1J0JA 2CDFB 5T1DL 4ELME 2R69L 5E0QA 3EO0B 3TBSA 4ORGB 4GJTB 5E5MA 3QAZC 4XVTL 4NQCA 2VQ1B 3ZL4L 2YWYA 2WWKO 2RHEA 3EYSL 3KYKH 1A7OL 2E7CA 2EE2A 5FK9B 1ZT1B 1YPZE 1KENL 3IFLL 2HLAA 2OL3B 1VCAA 3LKOB 4PRIA 5E56A 4XWGL 1BIHA 3QIWC 4ZUWB 3HC3L 3DXAD 1AGFA 2B1AL 3JV5A 3OL2A 4IMKC 1OARL 4Z7UE 4FFWC 1IAKB 1X5JA 1X4YA 2ICES 3ES6A 3REWA 1A5FH 2GJ6B 2LU3A 5IF0A 6FABL 3WXWL 1ZANH 1OSZA 2JK5B 1CFSA 3MA7B 1SJHB 2CPCA 2AI0L 5HHXL 1EO5A 1NCWL 4P9ML 3SDXF 1D6EB 4TTGA 2FL5B 1U36A 5EZIH 2YD1A 4HJGB 4KXZH 4Q6YA 4X7TA 3BQUB 4IHOA 3GJFB 5D7JB 5HVHB 3OAZH 4JZNB 4RFEA 5EUOB 2YPVH 3VG0L 3WLWC 1E6JH 4PJFE 3EKCA 3QHTC 5IMOB 25C8H 3WJLC 4LLYB 1B3JA 2CJUH 3UYRL 4AH2B 3IFNL 3MRPB 4RRPG 1RIHH 1OL0A 5DXWA 1E4KC 1Q94B 2HG5B 5HXMA 3NFPB 1F6LL 4NM8H 5I1CH 4PGBB 4JFEB 4F2MA 2IBZY 1CDJA 4YXHH 4OFKA 2I9TA 5I18H 4F15B 3TVMA 3GZKA 4NM4L 2Q76B 4L5FL 3D39E 3S35L 4HWZA 4WV1B 1KPVB 1NMCC 4XRCA 1OF2A 1D5MA 2Z8WC 2E8ZA 1U58A 3CFCL 4OGAC 3ECBA 4FFZH 1QO3A 1YA5A 4Z7WB 4F3FA 1U8KA 1XR9B 3HRPA 5TE7H 3QYCA 4UIKL 4O2FA 4DOHB 2H2SD 4HGWA 3MNZB 2OQJA 1DFBH 2GEEA 4K94C 1I3GH 1A4JB 1CLZL 2MTPA 4J3TA 3ZE2F 2HH0L 3GI8H 1N6QL 3RZCD 4HIHB 4MXQD 3BAEH 2QSTA 4PYGA 1XF3B 5C08D 1G7JA 3FT4B 3ARBD 5HVGB 4PJIB 4O9HH 4K7FA 3I9GL 5BRZE 3X14B 1BFTA 4ZO9A 3S5LG 1MCQA 4TNWF 5FCUL 5DJ6A 5DD0L 4RGOH 3TEUA 4JG0H 5GSRB 3O2DL 1MIMH 2YD4A 4DUXA 4NRXB 4NUJB 3A67L 1YECH 1B0GA 4POYA 4KUCD 2YZ8A 1GGBH 3EJZC 3B4NA 1I75A 4D8PB 5BVJA 2QADC 2R0WH 3LSOA 4YE4H 3O9WA 4MD5A 2FLBT 1NANI 4WGVB 1VFUA 2PUQT 2DQFB 3EOAA 5JPNB 1E27B 2NNAB 1VDGA 2B0SH 5JR1L 2G5BB 5GGSY 4JR9H 5DGQA 3HI6H 5E2WH 2UZIH 4UMGA 5KVMC 5FHAH 3RVXC 1T0MA 3IDJB 4YGVB 2CMRH 1H5BC 1KXTB 4OCWH 1UVQA 5FYJU 2ZWLT 3C87A 2M1KA 4JRYD 4P57B 5T1LD 3MREB 5BVPH 1OW0A 3D69A 4FQHA 1FLRL 3FAWA 4PRDA 2WQ8A 4LLUA 3MRHA 5MENA 3HB3D 3BZ4A 1UZ8B 2NYYD 1M71A 4MWFB 1IAOA 1WBZA 2VR9A 4LGPB 4OV6F 2NQCA 2Y7QB 3H9SB 4X0KB 5E8EB 1LNUB 5HGDA 3UCRA 3L5IA 3C60C 5GGSB 3KJ6L 4NHCH 5HYJE 3QDMA 2JIXB 4HC1L 3ARRA 4MVBC 4LCIH 4WUKL 5E9DD 1MOEA 43C9B 4B7IA 2IH3B 2A9NL 4MAYD 2FR4B 4KK9D 3BP5B 4M6NH 5JUEH 3ZSTA 1BLNB 2QSQA 3HMWH 3FONA 1OTUC 4GBXA 4H88H 4LQFH 4NKDA 1D5ZB 2ENYA 1KB5B 5IB4B 5L0QC 5ISZB 2VLRD 2C1PB 4U1JB 1KTDB 5D6DC 3GJEB 5IJVA 5F7FA 5C0BB 1L7IH 2VNCA 1EFXA 3G5VA 1NLBL 2E27L 1MUJB 4LPTA 2PETA 2VYRE 3QHFL 5AG8A 4HULB 4LU5L 4CRPA 1CLYL 3P2TA 2BVQA 2JJUA 2NY4C 1A6AA 5ENWB 1R3JA 4PJXF 5IVZA 5E4IA 5ETUB 5F97E 1SYVA 1QR1A 2CO7B 4KKNA 3IAQA 4L4JA 1ZGLB 4O58H 1FGVH 3FN0H 2BXYA 4BZ2L 1TVDA 2WAHA 3L7EB 3HS0B 2NXZD 4YHOH 1LP9A 3MBED 3V52L 1OAKL 3AXLB 1T89C 3BPLC 3RDTC 2ICEA 1WAAE 2ZP0T 3HC0A 3L3JA 2XWBA 1YEHL 1DE4B 3F6IA 4UBDC 4KK5D 5I1JH 4J3OC 1U3HB 3V5KA 2EDOA 1I1AB 3G5XB 1ORQB 5ELIA 1IGCH 3RVWD 4CJ0A 4K7PY 4G9FB 4R0LC