4M61B

Crystal structure of unliganded anti-dna fab a52
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
220
Chain Sequence
b'EIQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGKINPYYGSTSYNQKFKGQATLTVDKSSSTAYMQLNSLTSEDSAVYYCARGRLRRGGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab A52 light chain
publication title Crystal structure determination of anti-DNA Fab A52.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B02
3VFTB 1FLRL 4EDWL 3QYCA 4POZC 1P1ZB 5ADPL 5HHOE 2YWYA 2J1KA 4OZHB 4DZ8A 4XC1H 3MNVB 4Z76A 1IZKA 1S7XB 2AJUH 3DOSA 3K2MC 1EZVX 1F6LL 3LCYA 3NGBC 4MD4B 4Q2ZB 1RJYB 2ORBL 4IHOA 5AD0A 4LCCB 4PGZA 1DBJL 2AV1A 4LF3B 3T1FA 1VFUA 1KJ2A 3STBA 3GMPB 3LS4H 2V5TA 3DUHA 4P57A 5J1TC 5LBSH 4GMSH 3PWVB 3FO1A 3MRDB 5I1DB 2ZUWA 3LPWA 3R0MA 3UC0H 1PD6A 3PL6D 4KHTL 4QRRE 3QIBA 1QSED 1A9EA 2CSPA 4M93C 1CE1L 3H3PH 3C5SA 4JRYA 3RGHA 1WCBA 1E6JL 2I27N 3EHBC 4OFDA 4AQOA 5FIEA 1WEJH 5FDWB 4H0GA 1MELA 1AO7B 2D0HA 5B8CA 5A2FA 4MHHG 3KYNA 3WYRA 3RWGB 3TBSB 2BY1A 2XN9B 2Q8AH 4BH8B 4DN4L 1WBXA 3RI5K 3GSOB 3PV6A 5K93A 5M7QA 2P8MB 1O7SA 4P46C 3MRJB 4PP2B 2DDQH 3SCMC 2B39A 1ACYH 3I9GL 3P3YA 3KPMB 1UJ3A 3W0WB 3HI6L 4BM7A 1BQLH 3C5JB 5FHBL 2HJKA 1XT5A 4PJIB 2OZ4A 1PX4A 3O2VH 1S9VB 4HKBA 3DSFH 5F1KC 4RQQA 1JNNH 5ACZA 4RGNC 3HS0B 4MDJB 4HUUA 2N4IA 3LZFH 1AIFA 5CSZB 2CRMA 1MCJA 3WS3A 5TFSH 3L5XL 1KCKA 2ESVE 2GK2A 1BMGA 1QHOA 2OR9L 1KENL 3DROA 3QNZB 3QQ4A 5FYLH 3CLEL 3NIFE 3VFGH 1QRNA 1A64A 1MCHA 4CNIB 1ZHBA 4KJWC 5EWIH 5K9KB 4BZ2H 1GRWA 4NQEB 3P40A 4BKLB 4R90H 1U93B 5JHLH 4YE4H 1DQML 1UCBH 5LCVL 3U30B 4NRZB 1IFHH 4Z0XB 4ZUWB 4TULH 4KUZH 4Z7UA 1ZV5A 3PWJB 5DMYA 2FECL 4LKXB 2XN9E 5FUOH 1NMCB 3WHE0 3WKML 4OLVH 4P2OA 5FO8B 2MMXA 8FABB 5MEQA 3QQNA 1WBZB 4Y5YB 2VXVL 4XPFH 2IALA 2VITA 4J23A 1SY6L 2EXWD 3IFLH 4YO0A 5AZ2L 2PKDA 1TCRB 4OZ4B 2AP2A 1OL0A 4BFGA 3HE6C 3TN0C 4CN4A 4ELKA 5C0JA 1X9QA 4JFFA 3OJ2C 4TSCL 1RUML 4UINL 2W9DL 4KKCD 4X6DE 4X83A 1I3GL 3CFCL 4HKXB 4V2BA 1R3HB 1U3YA 5TQ2L 4C83B 2ADGB 1KEGH 5GS3A 2A6IA 1KLUB 1R5WB 4M43H 4GSDL 2X42A 1MY5A 4Z5RB 4BUHA 2H8PB 2YA0A 1EDQA 4WTXA 3NCCB 4ACPA 4PJGA 4P5MB 2BVOB 3RNQA 5BVPH 5IMLB 4PR5B 4ISVB 2XKSA 3FQXB 3PWNB 4R0LA 5HDBF 5FA4B 4ETQA 1AE6H 4I0PA 5E8PB 4PGDB 2YXFA 5DUML 1KULA 4WUKH 4Z7WA 4L4VD 1KXTB 3O4OC 3UMTA 1A9BB 4Y5XA 2J5LC 3FZUD 4OZGE 1NEZB 4L29A 4Q9CA 5J57B 3BDXA 4GFTB 1Y18B 2NY2D 2HMIC 2V5YA 3MYJB 2OMBA 3T0EE 4XNUL 1QBLH 3BW9A 5F44A 2F8OA 2HG5B 3BYTA 4OGXL 3WUWA 2YUZA 3T77A 3V7MA 5KW9H 5H2BA 3DUSA 2AQ1A 5DMGD 3ZMRA 1S7RB 4S1DC 3V5HA 1N6QL 3QWQB 4WCYH 3C9NB 4NQVB 5EBLB 5A43C 1OY3B 1YNKH 2BSTB 2XXCB 4JRXA 5E6YA 4J4PC 2F9BT 1MVFA 4DAGH 5I66B 3OXRB 3GHBH 1MJJB 1A6AB 4LAQL 3ILPB 1KCRL 5DJCA 5DXWA 1OAQH 1ZANH 1MRDL 4GKZB 3NGBB 2AJ3B 4FQLH 4U3HA 3VI4F 2YUVA 3MZTA 1FZOA 2QEJA 4P3WA 1CIDA 4WFGE 1SEBB 1NCCH 2P24B 4DGVL 2OK0L 4RFEB 4YFEA 4AQ1B 3MNWA 5C0ND 2NR6D 4M5YL 5DEGB 1M71B 4CL7A 3HUJB 3KPOA 1MRFL 4Y1AE 1MAMH 2AXJA 2QADB 3GJFB 2V2TA 4CAGA 4JFYA 4M93B 5BZDB 5A40E 5DRNA 1MSPA 4HPOH 1P6AB 1MFEL 2G2RB 4IMLA 2WW8A 3JTTB 4QHUA 1MWAA 3TO2B 4JO1L 1T2JA 1IC7H 5C0CB 2D7TL 3WN5C 3RGVB 1VGEL 3DV4A 4P4RB 5DMIH 3P4OA 3WJLA 2C5DC 4WDIB 5ELIA 3MROB 5KSBE 3BPOC 1LVEA 3TBTA 3KYMB 4P46B 3UTOA 1UVQA 4FFVC 1Z5LA 1ZAGA 3WFCH 2AI0L 1MLBA 2QSVA 4YXKH 1CTOA 4KDWA 4LPCA 1CDBA 5HI5D 1AGFB 2W65B 4RGOH 2V5RA 4G6AC 1ZGLM 3V2AR 4R4BA 2LFGA 1IGFH 4RFNC 4KMTH 4N8VA 2OP4H 4U1LA 3IJSA 1IE5A 2VRAA 5J6HB 4ZS6C 1BBDH 3HAEB 1MAKA 4RGNB 1GGUA 4TNWK 4NSKB 3NCBB 2DM3A 1U92A 5DD6A 5ERWA 4K3JH 4FQJH 4FXKA 2B8OT 1UH4A 2WSKA 3TVMD 2K7PA 1CR9H 5GS0H 4MNHA 4JB9L 1T2QL 3HUJE 4K8RH 5C09E 4E41A 1FDLH 1NL0L 1I8IB 4MAYC 4M6MH 1FH5H 1Q0XH 1RZ8B 5CJQL 1RHHA 1EEYB 3RPIA 4TQEH 1IAOB 4F7EB 1V7MH 4GG6B 5AYQA 4PYHA 1HINL 4LGPB 3IVKA 5EFIB 3LHPH 1I7ZA 5I1IH 2Q76B 5AWNH 3VXTA 4XPAL 4XI5D 4YJZL 1INEL 1FFOB 1NFDE 1RUAH 3BPCB 4NQCE 1RIHH 4UNUA 4R7DA 4TRPL 4BH7B 1U0QA 2YPLB 5C9JA 1MCLA 4G6ML 5CAYB 2E5EA 3N1FC 5FHAL 3UTSB 1I1AA 2VLJA 1NAML 3QXWA 4O51A 5E0QA 2LAGB 1SJVA 4KQ3H 1N4XL 1QZ1A 1NC4A 1PZ5B 5IMOB 1GIGL 2D4FA 1YYLH 3HE6B 3TN0B 1KG0A 4NYLB 5DD1L 4DEPC 4PTUB 2F19L 2Y72A 3HC4L 3A6CH 3MBXL 1KT2B 4ODVL 5DLML 1FO0H 1AQDB 4W81A 1T20A 2VDMH 5BS0E 5IV2B 1JK8B 5KSVB 2X4NB 1OD7A 3PQYB 1TXKA 4MAUH 5DQDH 1ADQA 1H8SA 3AROA 5JHDE 3RWJA 3C6LA 4QOKB 3BZ4B 1CLZH 2NY0C 3X13B 2UZXB 3QDMB 4JQIH 1KTKE 3TO4C 2C7UA 1NCBH 3ARQA 2CDGB 2ICCA 3VDBA 1AGCB 1AXTL 1MPAH 1JGEA 3S5LG 1NBVL 1FNSL 3VFUA 2XZAL 1X7QA 3MLXL 4P2YA 3LOWA 4KAQH 5TPWL 4ERSH 3WXWH 3NIDE 4QRRD 3O4LA 4NBZB 5T5FL 1XGPB 3D3VA 5C0AA 3SO5A 4P2QB 1JHLL 3ARGA 1Q94B 3PABB 5IJVB 3IRZA 5D5MA 3KLAA 2JB5L 4BELD 2J5LB 2AK4A 2APWA 2R4RL 3JWNC 1D6EB 4XPBH 1MF2H 4PJAE 3GMRA 5I1JL 1NCTA 2ZZUT 1CXLA 3FQUA 1SMAA 1RMFH 4DKEL 4YK4C 2X5PA 4NJAL 4AG4L 4HH9A 2R1YA 3KNBB 3VFRA 2DLHA 5E95B 4OM1H 3MJ7B 4F57H 1J8KA 4L8BB 1MEXL 3WFBH 1MUJA 3A67H 4NKQB 2I9LA 3C08L 4HV8A 1D5MB 4R4FL 2Z31A 3B9VA 3TZVA 2NXZC 2X9XA 5DI8B 4OLEA 3SE9H 4AIZB 5JTWA 3NPSC 3DHMA 2ADJB 3L7EA 1A6VH 1WWAX 5T3ZE 1INDH 1U8MB 2P8PB 4JFXB 3MODH 3BH8B 4P2RE 1K8IA 5EA0L 4ZAKD 2DL2A 2NLJA 3QDME 2JCCF 4LQFH 3SDCD 3CC5B 3X3FH 1U8LB 5HYQA 4ZQKA 2OSLB 2ESVD 3T0DA 5ABDE 3FT4B 2A6DA 2CDFB 3ABZA 3C60A 4MCYA 4EBQL 2GJ6B 5KS9B 1CFNA 4LNRA 3MC0A 1KGCE 3WO4C 4F9LC 1YEFL 4WU7B 2LU4A 4P5TC 1DE4B 5DDHB 3T0AA 5CWSB 1I9IH 3SKJH 5JA9A 4J2XA 1AO7D 4XHQA 5GISL 3WN5B 3GUTA 3QFJA 5SWQB 2WWKT 4F37K 5B3JE 2XN9D 2HFFB 5GGRA 3UDWC 1G7PA 2IQ9L 3ZT6A 5GSRA 5FECA 3BPOB 1T1XB 4JN2B 5DFVC 1B2WH 4JKMA 2Z8VC 3HG1A 3S36X 3W0WD 1MH5B 3OKEA 1T21A 4UT7H 2Y36H 5I8CA 2BDNH 5GGTL 3W11D 4KQ4L 3BPLB 1FBIH 4M1DH 1EO7A 4RFNB 1N59A 4XZUA 4P3DB 2CK2A 5D70L 5DJ8A 5DQJB 5ITFA 3LKSB 5HPOA 4PRHA 1BJ1J 4G8FA 4P4KA 3GJEB 1J1PL 4N0UA 4JG0H 2HWZL 1FAKT 1MFDH 2EDBA 2DQHL 1RZKL 3B2UC 4M7LT 5F1SA 3TEUA 1UXSA 1HQ4B 2UV3A 4BQBA 3MLYH 1GOHA 3F12A 4PTTB 4JLRB 5GRWA 2VLME 1VFBA 4NQED 5GSVB 1FFNB 4OQTH 4MAYB 4RA3A 1U6AH 3KS0H 2RQ8A 1PQZA 3ESUF 4YWGL 3GSQA 4HQQL 3M45A 3LIZH 3HPLB 5D93C 4NNXA 4LFHG 5T1DL 5EC2A 2A6KB 3DYMA 2DLTA 2A83B 3QNXA 3DMMA 3HMXH 3SDYL 3IDYC 3X12A 1X4YA 2AJYL 5DK0B 5FV2A 1HOCA 2CMRH 3MV8E 5LQBL 2ZOKB 4YPJA 2OL3A 1X6NA 5CZXC 4DEPB 1J18A 4ZPVA 4PJFA 4FNLL 4EVNA 1LILA 1F90L 5IR1B 3SGKC 3RKPA 1HH9B 3QUKB 5I75C 3P0VL 2WUBH 1HQRA 4P99A 4XNQA 7FABH 1IC5H 4HS8H 3T1WA 4OBSA 4ODBD 3PGDB 5JIIA 2A9ML 2H6PB 2XPGB 2NY0B 2X7LA 1UKSA 1XH3B 1YNLH 3WS6A 1JWUA 5B38A 3P9WB 5F9DC 3TO4B 2VYRE 5JPMA 3O9WC 1AY1L 1BZ9B 3FO0H 4LLVA 2CIKA 1QSZA 3OHXA 3WUWG 2I5YL 2VE6A 1S9XB 2EDFA 3TH3T 4I0KA 4HULB 1G6VK 4NQSA 3QULB 1A7NH 2DKSA 3TBWB 2CKBA 5C07B 3CXDH 3B83A 3QHTC 3LD8C 2NY4D 1MREL 4I8DA 5FA3B 5J7CC 3CUPA 3JBG7 3X11B 2BCKB 5ESVA 5EDXA 4NNPL 3ARFC 4OD2B 3SPVA 1GJIA 3U82B 1NBZA 3NAAH 4O2EB 2A9NL 2K1MA 1DEDA 4YK4B 3C8HA 2C4XA 3NABL 5HVHC 1PBYA 5DK2A 4DZBB 3UAJC 4POZD 4X4ME 5CCKH 4PUBL 3VXRE 5C0EB 5ID1B 1PLGL 5FAAA 1MIEL 1WGOA 1FLTX 2X4QA 5CIPA 3N1QC 1H0DB 4GUPA 2NXZB 4GQ9L 3F6IA 4OCRL 3FO9B 4C57C 2MQ3A 4JR9H 1RZKC 2EZ0D 1PYWA 1N0XL 1GVIA 3PP3K 1B6DA 5F7DA 5IEHB 3T09A 3RVWC 2VAJA 1E4WL 3G5ZB 4JM2C 4YHKH 3NA9H 2O61A 4MQXD 3FQTB 5IVXB 3L5IA 4P5KB 5C0DA 1P4IH 1KCVL 2YSSB 2QADD 4XMLH 3ZE0F 1MJ8H 3ELAT 2C3HA 3HNVH 4FHBD 3ARXA 2EYSA 2AVGA 1CU4H 2F53A 1RPQA 1TJHH 3VRIB 5EUOF 3RGVD 3C87A 4N8VG 4KI5F 1FZKB 1YEKL 4JFQA 5AUMB 5JR1H 4R4NC 4ODWB 2FJFB 4NQCD 5TGBA 3O11A 3CDGB 1NAMB 1LEGA 4OZFG 4NKOB 2AABL 4KK8C 5T1MA 2BVQB 3DO7B 3G6AA 1ZWIA 3FOLA 1YQ2A 4QHMA 5KG9A 4OTXH 3QUMH 1ORQB 4OGZA 3IDNA 2WUCH 2HYMA 3ARDD 3VI3E 4NQXB 2FD6H 5D2LB 2CIIA 4X8XA 2VUOA 3U46A 2FYYA 3QT2A 5BS0D 1JI1A 4RGND 2CRYA 3T8XB 3BP5A 1CICB 4QLRA 4OLZH 1KACB 1M7DA 4GQPH 4NGHL 4X5WB 3IS0X 2RFXB 4O4YH 2W9EH 1JGLL 1HH6B 5JHDD 2FJHB 5ACMA 4OV5B 2BHYA 5DRWB 3SKNA 3DSFL 2M8XA 4KKAC 4UT9L 1B0RA 1UYWH 3BISA 5EU4B 1I8LC 4KJWD 3LZFL 4WI7A 2W0LA 4OD1H 4GAFB 1EXUA 5TFSL 4O2FA 3VGGA 4EDXB 2IWGA 2WINA 1CGVA 1VA9A 1Y6MR 5J3HD 2RR3A 3ZYOA 1U8IB 1G7HB 3BAEH 4HLZH 1S7UA 2ZNWA 3E6HA 1A7RH 2K7QA 5ICYA 2YEZB 5BZWA 4IRJC 1ZLVH 4JFPA 2J6EL 2YPLD 4Y19E 1H8NA 3HC0A 5IESH 2IH1A 3UTSD 2Y25A 4TULL 1FL6B 1XGYL 4OQ1A 5L7XL 5DEFA 5SX4H 3IDJB 1G9NL 1P4BH 4JAMA 4OZIA 1P7KA 1WWWX 4ZDHB 1ZVYA 4U6HB 4U0QB 5FUOL 3VXUE 3GHEH 4OUUA 1OP5H 3TWCH 5CEZH 3IS1X 3HE6D 4OLVL 3JSSA 3VWJC 3GSVB 4F33A 4GS7C 4ALAH 3BWAA 3LEXA 2VXTH 1AGBB 3EO1B 2BSRB 1XZ0B 4MQSB 4XPFL 3HMWL 5IJKA 1K8DA 4RIRA 3FRUB 3RKDD 3VFSB 5I75B 1ERNA 1A14H 5E2VL 3IJYA 4QOKD 1L7IL 3IDIB 1N7MH 4P2RD 3QDJA 4MVBD 5L0QB 3OJVC 1AP2B 3QDMD 1CCZA 3NFSL 2DIJA 4N1HB 5ESAB 1OARH 1UH3A 3IETB 5D6CB 3C09B 5FUCC 4DTGH 1TTUA 3O9WB 5E1HB 1XF4A 4Y2DA 3VCLB 2DBJA 2IG2L 1M05B 1KGCD 4LASL 1EEUA 3V0WH 5HYIA 3BKJH 1HSAA 5IFAH 3DXAA 2JTDA 3LN5A 3D0LB 1WSST 3TP4A 3ULUL 4OZHF 1XIWA 1FNEA 4OKVB 5K9QI 3LD8B 3SE8H 3KPPA 4Q6IA 4R97B 4M5ZL 4MB3A 2FDBP 3X3GH 43C9B 5I8KH 4FS0A 4LSPH 2VLKA 4NM4H 1NCDH 1UACL 1BF8A 4XXCA 2YPKB 3O3DB 5I73C 3QO1A 3NFNB 2FSEB 4JVPA 3DURA 3KPLA 2NY7L 1F3RB 3ARZA 1WBYB 1FZJA 4CGTA 3ZSSA 4MXQC 5KW9L 3GK8H 4UBDC 1EK3A 2QL1A 4XRCA 2DLFH 4KRNA 4NZDA 3OKLA 5C92A 2C1PB 3BRFA 3T2OA 1NCNA 1UJTA 4ZO7A 1A6WH 3PDOB 1F4YL 3QXUA 2YUWA 2FCBA 4JM2B 4FQLL 1KB5H 2BC4B 2O5XH 5GHWH 3RI5F 4OM0H 4ZYKB 1A7OH 4LBEB 1YMME 1WAAA 3V6ZA 1DQJA 2UYLB 4IDLA 2XA3A 4QT5A 2E7LA 1FZMA 3CLFL 2X1OA 4KTEH 3ARYA 5DJ6A 5C0FA 1KJ2L 5INCA 3ZHLA 1TVBA 2FBJH 4PJIF 4ORZC 1EV2E 4AL8H 1IBGH 1HEZA 4NQUA 3FB6A 1MAML 5F1NB 1GH7A 4HK3N 4U1MA 4D9RE 5BRZA 1G9NC 4N0CD 4QXTB 1IGIH 4OBRA 3K8LA 1IC7L 5IVNA 4QGYA 4F7TB 2VSCA 5T1LB 1FVDB 4NRXB 5EPMA 1LDSA 1ZT7A 1JHKL 4G6AD 3T2NH 4HEME 2XICA 5IWLC 1BPVA 3ZKXC 5L2KA 4DVRH 3IAGC 3BP7A 5H35A 1FSKC 1CDYA 3TV3H 5D1QA 4FP8H 4HLZG 4LEXL 3WLWC 4QHNB 3C8KB 4HBCH 4ZS6D 3CZFA 4NJ9H 4YXKL 1CLCA 1C7TA 1HXMA 3ESVF 1MVUA 3DTXB 1EHAA 2VDKH 1IGFL 4KMTL 4GBXD 5EO0B 4D9LL 5KVDL 1QA9A 4FOMA 1P6FA 2EEDA 3BDYH 4Y5VC 4GG8B 1GZPB 3GSNA 2OZ4L 3THMH 1B0WA 3I6KA 3E0GA 1LNUB 5IB2B 1F6AB 1FL5A 4UTBL 4IJ3C 1CR9L 1LO4H 4FQXD 1DQLH 3ULUC 4JKPH 4JDZB 3H9SB 5C6TL 3NZ8A 4Q7DA 1CLYH 3HKFA 1FH5L 4PBXA 3L3JB 1Q0XL 1KLGB 1D5IH 4IRJB 4TQEL 4Q6YA 3VXPA 2IC2A 2APVA 2PTUA 5I1IL 2Q7YB 4BFBD 2DMBA 2DWEB 4MNGE 5DJYA 4W4NA 4PLJC 4Z77A 1TQBC 2QSCH 2DTMH 3H9HB 1A8JH 1UB5A 3EO0B 4MA1B 5KSUA 3RWCB 5IB3B 1V3MA 1E27B 4R2GC 5EORH 5E7BA 5I1CH 3VXRD 3TFKC 4KQ3L 5BOZG 4PJBE 4PLKC 5L9DL 3RJQB 3UJTH 4YDVA 4NHCH 3GNMH 4RAHA 2I07B 4MZ3A 4HWEL 2EIZA 5EZIH 4OCLC 2NY0D 5KZCB 1FO0L 2BY0A 2BHUA 2VDML 5KOVC 4DFIA 5A16A 1FGNL 3P4MB 2OXHA 2CUMA 3ZYIA 1PGRB 1I7UA 4GW4B 3TH4T 4MA7L 1NCUA 4JFDA 5K9OA 4MA8L 2VDRH 3B3IA 2OTWA 1QLRB 4OF5A 3H9SE 4R3SA 1ZLUK 2JELH 3MJ9H 1T0NB 3LSOB 4JJ5A 3OXSA 3SGDH 5E9DE 2OJZL 3DVGB 2GCYB 4HUXB 1DCLA 1KTDB 2MQCA 4KAQL 4NRYA 1FYTA 3KPRB 3WD5H 1G7IB 4ERSL 1KJVA 5IM7B 4H1LA 4FFZH 1D5XA 2GSIA 4U1HB 1G6RH 3QIBC 1MHPH 5CGYC 3RVXC 4IOIA 5C0IB 5HGBA 1P4LB 3SJVB 1OD9A 1C5BH 4PP1D 5MERB 5HYSA 1WJ3A 1XGUB 1G7QB 4UB0L 1P2CA 3HZYA 5EUKB 5I73B 1K2DB 4HIXH 1U8KB 1BD2A 3HUJF 3W9DA 1CT8A 4E42A 3CVHH 1TITA 1NSNH 2NY3C 1G0YR 3QG6A 1S9WA 1NC2B 2Y07H 3D2UD 3SDDA 1IRAY 1EBPA 3FN0L 5JW3H 1S7VA 4ELMA 3BE1H 2CK0H 1JWMA 4U6XB 3K81A 2R9HC 3SGDI 4ONOA 3V6OA 3SE9L 4I2XB 5ITBH 4M4RA 4OJFL 1QO3A 3CFBB 2R0ZL 4KDTA 4YEFA 5I8EA 2IPUG 1A6VL 2BXYA 3LKRA 3MODL 1YEJH 5C08E 4ZTPH 1BWMA 5JW4Q 5I15L 4AH2B 2P5WB 3G5VA 4CRPA 5KN5A 4MS8C 5ANMB 4HUWA 4ZFZA 4ZUSA 4UDUB 5IMMB 2WQRA 4PJ5E 1DANT 3DI2B 3MACH 1FP5A 3GO1H 4K7PH 1ETZA 3JWDL 1HXYB 4U1NB 3O6FA 1ZHNA 2YN3A 4H5SB 4FZEH 2C4FT 5F96H 4YHZH 2OQJA 3AFLA 3GRWH 3LRGA 3AMLA 2W0KA 4TNWF 5GXBB 2FEEI 3KXFA 5I74C 2APTA 3RAJH 4M62H 2YS4A 1U8PA 3ZTJG 4L8SA 4XCYA 3RL1A 4YHLL 4UTAL 3VRLE 4WV1C 1MWAL 4NQDA 1UM6H 3SDXB 3EOBB 4I4WB 3ZKXB 4J1UA 2GK0B 4P2OC 2Z8RA 1B2WL 3NIDF 1FSKB 4GG6F 2QKIA 3FQRA 3MLTA 4BSWB 4NP4H 2Y36L 3O41B 3TYGL 1CICD 3WLBB 4IM8A 4XP6L 1FVCB 3BIBX 1J5OH 1FBIL 3CFJB 4OAWB 4XP4L 3TA3A 1HKLH 5T5NF 3V5KA 5ADOH 4UQ2B 4JY4B 2FIKA 4OCXH 4LIQE 1Z3GH 1DQQA 2YD2A 4PJAF 5HHVL 1YNTB 2P5WE 4XMKL 4KVNH 5ANME 4PJXA 1Q9LA 5DMKA 5E1AB 1NUNB 2ZPKL 4IJ3B 2EXYD 4LPTA 5C0GB 4FTVA 2X4RA 3OX8B 3R4DA 1QHPA 2ZOLB 2C1OA 1HHIB 1HHHB 1AJ7H 3JV6B 1U6AL 5GZND 4EI6A 5C7XH 2P5EE 4XNXH 4R0LC 4X6CB 1BREA 2WBJC 3S96A 3KLHC 3OAZK 2A74A 4JFZH 2F8VA 5F8RC 5HVWA 3QQ3A 1RUPH 2PCPB 1T1YB 1TZHB 2JB6B 3MLUL 1TQBB 3RVUD 4H26B 5F3HB 3CSGA 1KNOA 5F7YC 5JLZA 1JMXA 2VB5A 1C7SA 1XGQA 4LHJB 3DYOA 5ESQA 1NKOA 2A0LC 1NCWL 1WC7A 3DGGB 5E94B 3CVIH 3DX7B 3ULSA 2HT2C 4H20H 4OIIH 1BAFH 5DRZA 3O6KL 3NCYS 3E6FA 2OXGA 1UWEH 4F9PA 2Z35A 5B3JF 4PJ9C 2WUBL 4DZ8B 3O9WD 2BVPA 4Z76B 1LO2L 3MRNA 2GQHA 2AK1H 5B39G 4IS6A 1V5JA 3JWOH 1N3NA 2HKFH 4IHOB 5AD0B 4UAOB 2AV1B 3T1FB 4JCLA 1KJ2B 4IIQA 4U3XA 5IK3A 4G42A 4P57B 3MREA 1CDUA 3JWDC 5D7LE 3FO1B 5FYJH 1OLLA 2D03H 5GRJL 3L3HA 3CXDL 5E8DL 2VISA 4XPGL 3QIBB 1T1ZA 3LB6C 1A9EB 5TE6H 2GUOA 4D9RD 1TENA 4D8PB 3ET9F 3C5SB 1WCBB 1JMZA 1X5AA 4I9WD 5L88H 1UM5H 4ZOAA 3U7YH 3SKMA 2VQTA 5CHNA 1MCRA 1CD1A 3MFGB 1ZLSL 5B8CB 4KH2A 3ZE1F 3KYNB 4HLJA 4N68A 2VMFA 2NY3B 1WBXB 1OCWH 3FN3A 4N8CH 2OTUA 2ENSA 4YEEA 2AEPH 2HAZA 2ZCHH 4AMKH 4ZFFA 1F6FB 1VDGA 5IQ7H 3DX8A 2FX9H 4EUPH 1U3HA 4UZGA 1WTGT 5D71L 2X05A 3UBXI 3TNMB 3CMOH 3RVWD 3ZTNH 3MUZ1 4JM2D 4U7KA 2QQKL 2HJKB 1CFTA 2MKLC 5D2NE 1VADB 3EYUH 1BIIA 4OF8A 4JR9L 5I1AA 4HKBB 1U3JA 4RQQB 1VACA 1XFPA 2DD8L 5ACZB 3VD3A 5DWUL 4HUUB 4LP4A 1AIFB 4YHKL 3PHOA 3O8XC 4LGRB 3WS3B 2A6JA 5EH1A 3PXHA 3O45A 1BVKA 1JNLH 4UILH 3DROB 3QQ4B 3HNSH 4XMLL 1QRNB 3BKCH 4ZTOH 1ZHBB 4R4ND 4JZOA 4M7JL 2F5AH 3UTPD 2HFTA 4JRYE 2GSGA 1FRGH 5T1LD 5HYJE 4NIKB 4Z7UB 4YR6A 1NMAL 3O6MH 2ED9A 2VXUL 3MRBA 4HKZA 3WFDL 3NTCL 4P2OB 4ODHL 2P45B 5I8OL 1QBMH 5MEQB 4OUOA 4WNQA 4NO5A 2IALB 2VITB 3RVVC 1OSPH 5D7IE 4OTXL 2IEPA 1LEKA 1FHGA 3LEYH 2FD6L 5C0JB 1IAIH 5HPMA 4L4TE 4HX1A 4JFFB 5JQ6H 2ZWLT 4TUJA 3QEQE 1PSKH 1OTUD 3WJJA 4O4YL 32C2A 5BV7B 1W0YT 2H32A 1JZ6A 2A6IB 3QEGH 4M9PA 3F7RA 1UWXK 5HD8C 3C6LC 1UYWL 1NGXA 3H9SD 1M4KA 1DBML 3B9EA 4M61A 4GRWE 2FBOJ 3PJSA 5E9DD 1QRNE 1DQDH 4PJGB 3RNQB 1BQSA 1WISA 2IANE 4R0LB 4ZFOA 4ETQB 4Q9QH 1MLCA 4AEEA 2EICA 2AJXH 2AW2A 5F7WC 3BAEL 3ARGC 3WFEL 4Z7WB 4MXWH 1KJMA 2H2SC 2X1PA 4N5UA 4PGBA 4Y5XB 4K2UL 5IESL 3HMXA 2R69L 4L29B 4Z18A 3RP1A 2RCSL 1EHXA 1P53A 3BW9B 5J6GB 2VDOL 3CK0L 3TWCL 3H9YA 3S8WA 4G9FA 4FFYH 3WIHH 3T77B 3WUWB 2FJGB 2FNBA 5H2BB 3DUSB 3QCTL 1EAJA 2UVEA 3NIGF 2V7NB 3N9GL 5JQHC 2ILLA 1IARB 4JRXB 4OF3A 1TFHA 1HSBA 4JE4B 4H1LG 4KWUA 2OL3L 2XZCH 4XVJH 5DA0B 2DQDH 4HT1H 4X80L 4PJ9B 4V1DA 3VW3H 5DJCB 2Z31C 4YFLI 1N7ML 3IKCB 2P48B 1FIGL 5C08D 3JUZA 2J8UA 1R5IB 2APXA 2HTLD 2Y5EA 2BOBA 4KTYA 4ONGH 1OARL 4RISH 1FZOB 4PJGE 2H2PC 4PJ5D 3MNWB 2EO1A 5MEOA 4O5LH 1G9ML 3IYLW 4PIRF 3KPOB 3ARBC 5HHOA 5LG1A 4Y4HD 2NY1C 2V2TB 3SJVD 4Z7WE 4JFYB 3RU8H 4DQOH 3S35H 5BCAA 5DRNB 4MCZA 4XC3H 2CKBL 2O26U 4J6RH 2H1PH 1GGIL 3RY6A 4IMLB 3ZKQD 4QHUB 1MWAB 5IVXF 5I8KL 3QUXA 1IT9L 4NC1E 3DV4B 2DQEH 5EC1A 3P4OB 1NGYA 3MMEA 1IQDA 1NCDL 3V9FA 2DTSA 3TBTB 5IHLB 1WFUA 1UVQB 1EJOH 4JRXE 1Z5LB 4ZO6A 2RJMA 1R24A 4P2CG 4G7VH 4CVZA 4XBEL 1MLBB 4YQXH 4FQCH 1XF3A 5FCUL 4XCFH 4WW1A 1V7NL 3AVEA 1CDIA 4ZNCD 4OLXL 4R4BB 4L9DA 4WUUE 1EMTH 4IRSC 3VD4A 4N8VB 1QNZH 4U1LB 2BNQE 3PWUA 3IJSB 1J0JA 2X2YA 2P5WD 1A6WL 2DJSA 3V4UH 1U92B 5ERWB 2R15A 4OZFB 4YHNA 4FXKB 1JUFA 1C5DA 1EEZA 4P23D 1A7OL 2EH7H 1HHJA 1RIVL 4E41B 2P5ED 4KTEL 4JRWA 5TDOA 2V5SA 3BD3A 1JF6A 5I1KH 1EX0A 3L3DB 5BO1H 1RHHB 3RPIB 4AL8L 4YHOH 4FG6D 3L1OH 3IVKB 1I7ZB 3C2AH 4ZAKA 3VXTB 5B3NA 1A6UL 1OTTD 3GGWA 3SDCA 4J3UA 2D9CA 2ESVA 1VB9A 4Y4FC 3DMMC 4R7DB 5C9JB 2PTTA 4MNQE 5DVOA 1I1AB 2VLJB 3WLWD 3BJ91 2X41A 4O51B 1AXSA 1WK0A 4N1EA 3U7WH 3LQAL 1NC4B 4XNYH 1HWGB 1F2XK 5DHVA 2N1KA 3TV3L 3B9AA 4FP8L 1KG0B 4X7TA 2X09A 3BT2H 4ZMAT 2WIMA 4K71C 4KDVA 1T20B 2VDKL 4QTIL 4Y16A 5KAQG 4X6FA 4H25A 3RWJB 3C6LB 3EYVA 3QZWA 4KRPB 4F58H 3WS6C 4E41E 4JZJC 4G3YH 5H37G 4HIIA 2C7UB 1G9MC 2YHGA 3QWOA 3BHBA 4CU6A 1DQLL 3VFUB 1X7QB 2YC1A 2XACC 1NJ9B 3LPGA 4YDIL 1FE8L 3O4LB 1CLYL 3D3VB 1YEGH 4X6DA 5C0AB 5DHXB 5GZOC 4GOSA 5EOQH 3V0VA 3ARGB 2X4PA 3U9PH 3FB7A 4PJHA 3FJTA 3RPKA 3D0VA 5D5MB 3KLAB 4PRPA 2AK4B 4HC1A 3SY0A 2YD5A 1BFTA 2VLJE 1RZIA 3BQUC 3KYOA 4RWYH 4UT6H 2V2WA 3GMRB 1JZ8A 3FQUB 3W81A 4K7FA 4CVUA 1WV7T 2DLGA 3AXLA 4LCIH 4HH9B 2ICEA 4FN0A 3S4SA 4Z7NF 3MCKB 3VRJA 1MUJB 1T66D 3K8MA 3QUZA 4MSWA 4NHCL 1OAKH 4HV8B 1JTOA 2Z31B 4OZGA 3T04D 2KPNA 3TZVB 3P30H 2YD4A 1HE7A 4ZUVB 3VU2A 3L7EB 3T0EA 5F6HJ 2BZDA 1AHWA 3JUYA 1K8IB 1OGAE 3U0WH 2NLJB 4EN3C 4OI7A 3OG6B 5HYQB 4OGAD 4ZQKB 5SWSA 4GO6B 5HDOA 2A77H 1M6OA 2NZ9C 2VDRL 4DOHE 5CBEA 3C60B 4MCYB 2R0KL 2B0SH 4DN3L 3RIAF 1CFNB 4QCIA 4LNRB 4ZOBA 3QXAA 5C0AE 2X9YA 1MFCH 1L7TH 3RVXD 1KCSH 2NY1B 4ODTH 4PPTA 4ZSOE 4C59B 4CDGC 4JRYD 4N0RA 4JM2F 5FGSA 3IDMA 3GI8L 3GUTB 3KJ6L 3QFJB 3S37H 1Z0MA 5F6IB 1QFHA 2NY3D 3QPXH 5KANI 5GGRB 3PWLA 2CJUH 1G7PB 5GSRB 5FECB 43CAA 4HFUH 1IEAA 1K4DA 4HIXL 5C70A 3LQAC 1BOGA 1YPZE 1J0KA 1P84J 5CD5C 3ZHDA 4Y1AA 3KVQA 1SM3H 3OKEB 1A1OA 1T21B 4K3DL 5I8CB 4KROC 2G5RA 2PXYC 4PV8A 4TVPE 4TTGA 4L3CA 4L4TD 5JW3L 4QF1A 1A7QH 4XZUB 4XMPL 2CK0L 5DJ8B 5IBTH 5ITFB 1A4JA 4PRHB 4YDKH 4G8FB 4N0UB 5KSBA 3S34H 1XF5A 1I9JL 1B90A 2X4TA 2I9TA 1A7PH 2E3VA 3EDKA 4HS6A 1QLEH 3F12B 5EO1A 1QRND 2ZNXA 3K2UH 1B4JL 1IKNA 1CE6A 4PJBF 2PYEE 4S10A 4ZO8A 5FFLA 4M3KB 1VFBB 3G9AB 1X4ZA 2IAND 4MJIA 1PQZB 1G0XA 1T3FA 3GSQB 4TUKL 1EA9C 4NNXB 4S1QL 3ZDZE 3QFJE 2HFGH 5EC2B 1JF5A 3HZMA 3K0WA 2AGJL 2BX5A 2QSTA 3Q48A 3G6DL 3L7FB 3QNXB 3DMMB 3X12B 5IROA 3TLRA 1JBJA 4M62L 2P8LA 3BO8A 4FABH 3MA9H 5C09A 2D7QA 1HOCB 1UG9A 3HG1E 2EIDA 2ERJC 4U6VL 2NTSP 3MLWH 4KZDL 2OL3B 4GAGL 4XAKE 4JFFD 4ZPVB 4PJFB 4DK6A 3T0XA 1CF8H 3GB7A 4K71B 4KK6C 4N0FA 1NFDA 1HQRB 4NQCA 3MJ8A 4XNQB 4FA8A 3BKML 1LO3L 1WUNT 5D6DA 3OJDA 1YEDA 2E27H 1RZ7L 1JL8A 2X7LB 3AS1A 3IXTA 5H94A 5MI0C 1RVFL 1JWUB 1E28A 2AKRA 4M48H 4ONFH 5B38B 4EI5A 5I19L 1J05A 5JPMB 3GMQA 4LLVB 3BXNA 3GSNL 3KLHD 2CIKB 3OHXB 4I0PD 2BOCA 2VE6B 1TETL 3ARDA 5CKAA 2FGWL 2CKBB 5BS0A 5C7XL 4LSUH 5CD3A 1XIWC 3MOAH 4OF6A 4FQ2H 4JFZL 4Q0XH 2MCG1 3M17A 3CUPB 3V6FA 3MQIA 1INQA 3QISA 5ESVB 4CMMB 3SBWC 4Y8DC 4U1SA 5EZLA 2A0LD 4JFHE 5SV4A 3VXSE 2XRAL 1NBZB 2DBLH 3TCLA 4KI1A 5FKPA 4W70A 4N9GA 4NO0D 4PJCB 5IBUG 2RIKA 4JRXD 5DK2B 4K7PX 5GS2D 4ZXBA 5CBAA 2NZIA 5MHSE 4JM4L 2W9LA 2VLLA 5I1GH 2X4QB 5CIPB 4GUPB 5JO5A 1BAFL 2MCPH 4CUCA 1V3JA 3F7VB 5DJXA 1PYWB 2DM7A 4PJAA 5F7DB 2ZUTA 1EERB 5MP6H 4LCUA 1N5YH 5J1AA 3RDTA 3JWOL 4YC2C 2HKFL 5J89A 2O61B 1T7ZA 1G84A 4LLDA 4KZEH 4RMRA 4AY0A 2NTFA 4GRLC 1JZ7A 4A6YA 4N90D 4HIJA 2E7LC 4NZUH 1JHTA 2DQJL 2EYSB 2B1HL 2NW2A 3GSWB 1DEEA 1B3JA 2F53B 3LQZA 3Q3GA 4X4ZA 3N1PC 4RBPK 4YNYA 1G6RA 2HJLB 1MCPH 3NH7L 5TE6L 4JFQB 1YEIH 4FFWC 1WIUA 4HXAH 5TGBB 4FQ1H 1IAIM 4K7PY 1LEGB 1UM5L 3U7YL 5J8OA 1I1YA 3MSPA 4JFEB 2XTLA 3QHFH 4MD0A 3OF6A 5T1MB 3G6AB 1UADC 1ZWIB 3FOLB 4QHMB 4KROB 2W92A 2AEPL 2ZCHL 4JPVL 5KG9B 1HKFA 3IDNB 4NCC1 3B8SA 1EO8H 4ONHA 2CIIB 4JO2L 2YPVH 5F7LB 3U46B 3B9KC 4JN1H 3PHQB 3CMOL 4YGVA 3AM8A 3BP5B 4W4OA 1CVSC 1M7DB 4HG4K 1M7IA 5D8JH 3EYUL 3BKYH 3BIAX 1U8NA 3SKNB 1B0RB 4E41D 3FQNA 3AS3A 1W0WA 1UT9A 1KB9J 4O2FB 1YEHH 4MJ5A 3SDAA 4UILL 3KR3L 1LQSR 5DFWH 2WINB 4S1RH 4B7LA 4LARH 4X7FC 4L3EE 4U6TA 5ID0A 2JF1A 4XX1E 3ECBA 3E6HB 1T5WA 4LRNL 5ICYB 5HHME 5BZWB 1QSFE 1NDMA 5F8QC 4JFPB 3KHQA 1Z0NA 4LU5H 3HC0B 1QFWI 3MGOA 1I1AD 2VLJD 1YECH 3IFOA 2CD0A 5DEFB 3O6ML 1QACA 4R26H 4JAMB 4OZIB 3RVVD 3QZWG 1P7KB 1NC4D 5FGCB 4HJGA 1U8HA 3EOTH 2ERJB 2YKLH 3DO3A 2XWJA 4OUUB 3OKDA 5D96C 4F33B 1G0DA 4X6CF 3RBSA 4QGTA 3LEXB 3EYQD 3GJFH 1W72A 3FT3A 1K8DB 4RIRB 3ALXA 2ADFH 2AV7A 1PX3A 5JXEA 3BH9A 3JVGC 3LEYL 3IJYB 2YRPA 4RDQG 4PFEA 1QKZH 4LLWA 3QDJB 2N7AA 4KRPD 4D3CL 3SE3A 4UIKL 2HLFC 3JWOC 3LDBC 4M00A 5MI0B 1FG2B 1I9EA 3GDBA 1IGCH 5EU7C 3MV8A 5J12C 2AJVL 1S8DA 1XF4B 4Y2DB 2IMNA 1NLDH 5FB8A 5K9QG 3O4LD 4UUJA 3D3VD 3EYSH 5C0AD 2AERT 1HSAB 3ARGD 4PRAB 1K6QH 3DXAB 3LN5B 1SBBA 4NKIL 4WRLA 3O6LH 1XIWB 1FNEB 2AK4D 1R0AH 3KPPB 4Q6IB 4M1CC 5I0DA 5KTEL 2Q8BL 3OR7A 3HAEH 2YD9A 3SO3C 2QSQA 1AQKL 3E3QE 5D1ZA 4XHJC 3QCUL 1KEML 4MXWL 1IGJA 1FQ9C 2VLKB 4Y2OA 2D0FA 4AEIL 4U1IB 1MCQA 4LPYA 3G6JE 2CUIA 35C8H 3A6OA 2UY6A 3IDXH 5TH2B 1OGTB 3QO1B 4FQXA 1BZ7A 3DURB 2H26A 3KPLB 5KVEL 4E5XA 1FZJB 2JJUA 3AS0A 3B43A 1TCMA 2H45A 4X9HA 2Z31D 3TZVD 3SGJA 3SDDC 5SWZE 3KDMA 3OKLB 1NGPH 1IAKA 2XZCL 2DQDL 3VWKC 4HT1L 3CAFA 1DLHA 3V6OC 3VW3L 2KQMA 3UJJL 2O5ZH 3QPQD 1JPSH 4D94A 4OLWH 3W5MA 1RZFH 4YC2B 3C60D 1XGRA 5DYOA 1WWCA 2HLAA 2ZUXA 4ONGL 5DHYA 2DYPD 2VWEE 1RD6A 4X4MA 4HS3A 1X5JA 3V6ZB 1DQJB 3VXRA 1FLRH 4QT5B 5D7IF 3RY4A 1FZMB 4HUMB 3UBXA 4JO3L 4PJEA 5D72H 5ADPH 4HGMA 5DJ6B 1NGWB 5C0FB 3R1GH 5INCB 4O9HL 3QFDA 1TVBB 3ZHKA 3DWTA 4WTZG 3QFJD 1HEZB 3FB6B 2ORBH 3O6FC 4MZ2A 1UKTA 1DBJH 4Z7VE 2RB8A 3QQ9D 1F2QA 2VLKE 4U1MB 2W59A 1KC5L 5BRZB 3W9EA 1VFAB 2JE8A 4XTRD 5HDQH 2DQEL 4L1HA 3HG1D 4L8SC 4FQIL 1EVTC 5EPMB 2DRUA 1T0MA 3QJFA 1ZT7B 4F8QA 1I7TA 4UMGA 4XCCL 1CE1H 2ICWB 3BP7B 4LCWB 1E6JH 5H35B 4F3FB 5DC0A 1NANI 5D1QB 1I3RA 4NPYA 4PRHD 3C5ZD 5C8JA 5DJ2A 3TF7C 1U42A 3CZFB 3PL6C 3CU1A 1URLA 4P4KD 5IVOA 1TTGA 4YQXL 1HXMB 1Q1JL 4XCFL 4C58B 1HZHL 1MVUB 4WHTA 1E4XH 2FATH 2NNAA 3TA3C 1QA9B 1X5KA 1CI5A 3V4UL 3RWHA 3GSNB 4LLAA 3I9GH 5E2WH 3HI6H 3HC3L 2AEQL 3I6KB 5DURB 1FL5B 4FZ8L 3CZJA 5F89B 1FNGA 2ATPB 4MLIA 3QH3A 3DMMD 4UV4L 3L5XH 3L1OL 3ZT7A 3VXPB 2OR9H 3NBNA 3C2AL 1KENH 5BW7A 4CKVX 3SOBL 3CLEH 5DJYB 1TZIA 4PJGF 1C08B 2HRLA 1D9KA 4TN9A 1UB5B 5D96B 5KSUB 4MD5A 5L2KE 2I26N 1JRHI 1DQMH 5LCVH 3G04A 4GW5A 3U7WL 1YN6A 4S11A 4Z7WF 2X10A 1IMHC 4OFKA 3S35X 1JZ4A 2F54E 5ALBH 2ZJSL 4YDVB 4Y19A 5J0BA 2QBWA 2EIZB 1KN4L 3WKMH 3BT2L 4Y88A 4JFOA 1V05A 3LDBB 4IRZL 5A16B 2VXVH 1J0ZA 5KSAA 3VXUA 2X70A 3UZQA 1GGBH 5AZ2H 2XZQH 4JFDB 2X4SB 3RIFF 5K9OB 3B3IB 2OTWB 4JDVA 4F58L 5FYLE 2WAHA 4KKLD 4G3YL 4IIQC 2XNAB 4TSCH 1RUMH 4JJ5B 3OXSB 3CFCH 2WK2A 5I71C 2EXWC 5TQ2H 2A73A 5GS1A 1WVZA 1G7JA 3B4NA 3GSUA 4NRYB 4FXGA 1FYTB 1LE5A 1KJVB 4GSDH 1ORSA 4H1LB 3SO3B 1D5XB 2GSIB 2WNGA 5T5NG 4RZCA 4ZFOL 1RZGA 3VGBA 4IOIB 5HGBB 4EZMA 4IBLT 2FECI 3T4AA 5HYSB 2R2CA 1CN4A 1P2CB 1OAZL 3HZYB 3N85L 3WXVH 4LAJH 4UT6L 5SV3A 2AXFA 4OSUL 4X7DC 3W9DB 2GEEA 2C3VB 1CT8B 4E42B 2H9GB 5EBGA 3WNKA 4X5XA 4D9QE 3QG6B 4LCIL 1S9WB 4APQA 3SDDB 1DBBH 1MCSA 2BNUA 1QBBA 1S7VB 1I9RL 4G43B 4ELMB 3M1BB 1BWWA 1JPGA 1JWMB 5EU5A 3HZVA 1BFOA 4XNUH 1G9EA 4WW2F 1CTNA 3P30L 3BP4A 2E6QA 2NZ9D 1QO3B 1JZ5A 1AXIB 5I8EB 2R1WA 3LKRB 4U1KA 3U0WL 2NY2C 4K3GA 3DIFA 4LVOC 5DD3L 2B5IC 4TUOA 3G5VB 5KN5B 3QIUA 4B5EA 4HUWB 4ZUSB 1YMHA 1XCTA 5DMGC 4OCYL 4FQQA 1MRDH 1B88A 1ZHLB 1ETZB 2IBGA 4LPXA 5F70A 5F9JA 1QG3A 3ARUA 3O6FB 1OAXL 1ZHNB 2OQJB 5F72S 4F80A 2Z92A 4KJQD 2OK0H 1XMWA 3CFKA 3D9AH 3KXFB 2R23A 3S37L 1YMMA 4M5YH 1DL7L 1BD2E 1U8PB 4L8SB 4XCYB 4KROD 1KYOJ 1MRFH 4GW1A 1D5BA 2NPLX 1KIRA 3KPQA 3HFML 2NR6C 2V6HA 4J1UB 5C0NC 4IDJL 2E7BA 1AGEA 2QKIB 4JO1H 2D7TH 3LKOA 4DCQA 2YUXA 1VGEH 1LGVA 4IMKC 5EO9A 5BJTB 1CFQA 1XEDA 1A7QL 3QDGA 3TA3B 3V5KB 2FIKB 4YDKL 4KV5F 4WU5A 2IFGA 5EB9A 1AFVH 4J3OC 4OCSL 2Z8WC 2PW2A 1A7PL 1Q9LB 3JXAA 2KBGA 5DMKB 3K2UL 4FTVB 3IFNL 1MI5A 2X4RB 1CLOL 3EJJX 2C1OB 2E9JA 3DETD 1CL7H 2OTPA 4PRDA 4KC3B 4EI6B 3P77B 1RULH 1HHKB 5HI5C 3ZKSD 3FL7A 3ZDXE 5MENA 3S96B 2A74B 2OJEA 1C5CL 1I85C 5E00A 2HFGL 4NUJA 3VDCA 2V9RA 1GPOL 3I6LD 3QQ3B 2Y7QB 4G5ZL 4PBVC 2Y1VA 5HGGS 4JB9H 1T2QH 1CXHA 4NQDE 3QXDA 3KS0J 5DJAA 3REWA 2CRZA 1JV5A 4XP9H 1KNOB 1IM3A 3TT3H 3H0TA 5JLZB 3TVMC 4LEOA 1J87A 3WCYA 3K80A 5ESQB 1HINH 4CN1A 1OF2A 1WC7B 1RJLB 3MLWL 5HI3D 4IOSD 4XPAH 1ZS8B 1INEH 1DUYA 3ULSB 3MGTA 3QDJD 4GJTB 5DRZB 5DD5H 4G6MH 1CF8L 5DJ0A 5FHAH 4MJ6A 4MNGA 3E6FB 3KPSE 4U4BA 2Z35B 1NAMH 4XI5C 2ICES 2BVPB 1N4XH 1T7VA 4Y2DD 1OP3H 4PJXE 3MRNB 2EDLA 1GIGH 3BGFC 5C1MB 6FABH 1MCWW 1N3NB 1YPZF 4QHLA 4W68A 4FTVE 5DD1H 3S3JA 3NCJL 2CR3A 4PJBA 1QFUH 3HC4H 3OAYH 1FCGA 1OWWA 2F19H 3DXAD 3MBXH 4IIQB 3GSRA 3QR2A 4ODVH 5DLMH 3D39E 1XIWD 5IK3B 1B4RA 4JQVA 4G42B 2BJML 3MREB 4I13B 2Y5TA 2DQCL 3FB5B 2HVJA 3L3HB 5I16A 3F6LA 4NC2B 2VISB 3BMVA 2VLKD 1T1ZB 1FCCA 1ZTXL 2IAMA 4NN7C 4PGEA 1OSZA 3ZDYF 1OT1A 4FQ2L 4Q0XL 3BSZL 2EIBA 3CD4A 5FOBA 2G5BA 5CHNB 3ARSA 3SKMB 1CD1B 1FNSH 2XZAH 3MLXH 2LV4A 5TPWH 1IGTA 2ARWA 5T5FH 4HC1L 1EUUA 5E9DA 4JO4L 3MV9A 5CEXA 4UV7H 2OTUB 3U9UA 4ZFFB 3AY4A 1OT2A 1UWGL 4JREC 2JB5H 3GSXA 3G5XA 3DX8B 2DAVA 1CD8A 2OCFD 2IADA 3OZ9H 3VD7A 3ZDZF 3HE7A 5I76A 5DD0H 1XCQA 2HN7A 2NYYD 2F58H 1L6XA 5I1JH 1UENA 2D7NA 1CFTB 2Y4SA 4XP1L 4DKEH 1S7TA 3GMNA 1BIIB 3RQ3A 4NJAH 2J3SA 5I1AB 2BFVL 4LVOB 1KN2L 2Y9RT 4C55A 1OAUL 1MEXH 3KAAA 1MCBA 1KTRL 3PHOB 4WO4A 1DANU 4GAYA 2A6JB 5I30L 3MLVL 3O45B 4R4FH 1S5HA 3P9MA 1BVKB 4LHQB 5IMKA 1KYOK 1TZGL 3L3GA 1KXQE 4XVTL 3KPNA 5CJ8A 3PNWA 5IKCB 4FFWD 5EA0H 5ISZA 5E8NA 4JZOB 1FJ1A 1K4CA 3D85D 5MEPB 3MR9A 1IC4L 4DJMA 2GSGB 1ZMYA 1BF2A 5C08A 1MCPL 4EBQH 4YR6B 4ZAKC 1S7WA 2WWMD 1KTLA 3TBYA 1PG7L 3MRBB 4HKZB 3SDCC 1YEFH 4K9EH 5IEKA 1R3JA 5KOMC 5L2KD 4PJ5A 4XB8A 3RWIA 1VHPA 5D1QD 3CH1A 1JVKA 3ULVE 5GISH 1EH9A 4WNQB 1E4JA 25C8L 2F54D 5EN2A 2OYPA 5F7HA 5D1XD 1LEKB 5AG8A 3O3AA 4N0YL 3IDGB 2IQ9H 5HPMB 4LHUA 1ZHKA 2YPVL 2ADIB 4HX1B 2XKNA 4TUJB 1N2RA 5ENWA 1K3ZA 32C2B 2DMCA 4UI2A 5IGXH 2H32B 3BKYL 4AEHH 4XXDA 4F7PB 4KQ4H 4YZFE 5FYLD 1NGXB 4PJFF 5D70H 4M61B 1N8ZA 3PJSB 5JA8B 1J1PH 2HWZH 4ZFOB 2O5YH 2COQA 1I8MA 2DQHH 1PG7W 1MLCB 3GIVA 4LARL 3OKOA 5LVEA 1JI2A 1P9MA 4OCMC 4PJ8D 5CSBA 1PFCA 3EO9L 4J3VA 1KJMB 2LU3A 4PGBB 4CW1B 1A6PA 4LF3A 3B5TA 2YD1A 4YWGH 4HQQH 4R26L 3KHOA 3NN8B 3RFZC 2EEBA 5LWYH 3V5DA 3H42L 3EOTL 1A5FL 5T1DH 3S98A 1LWRA 3DHJA 4D9QD 2P5EA 4G9FB 5DK3A 2HT3D 5AZEL 3W39A 3SDYH 2HLFD 1HSBB 2AJYH 3UCRA 3Q1SL 2GI7A 4V1DB 4K3HA 5FDWA 4MX7B 4JFDD 1NEUA 4MQ7A 5LQBH 2EE3A 2J8UB 2B1AH 4BH8A 2BOBB 1OW0C 5JPNA 4FNLH 2OR8A 1H15A 1F90H 3BDBA 4WENB 1FYTD 3P0VH 4NZRH 3EYSL 1J0IA 1DFBL 4RAUA 3ES6A 5MEOB 4XHJD 2A9MH 5FGBA 5HHOB 4NN7B 1ZGLP 1R0AL 1T03L 4MCZB 1R6VA 1AY1H 3GKZA 5IB5A 4NM8L 1YJDL 1JFQL 2I5YH 1BD2D 2YD8A 1WT5A 1MCEA 5EC1B 5T33L 1NGYB 3MMEB 1IQDB 3SDDD 5D7LA 2DQUL 35C8L 1BZQK 2F5BH 4JREB 1MREH 4ZPTA 3DJ9A 2D31A 4QRRB 4CVZB 1U93A 3UZEA 1XF3B 4WW1B 4NWUL 4V1DE 5JOFA 2NY4C 2A9NH 2EDXA 2Q7NA 2E8YA 3QAZC 3PWJA 1X6LA 3NABH 1RI8A 3PWUB 3G08B 4PUBH 2EYRA 1PLGH 3LEVL 1MIEH 4YHNB 2KDGA 3HR5A 1JUFB 5GIRB 1EEZB 3QB7C 5JMRA 1A3LH 2YA2A 3O6FD 3MOBH 4LLYA 4OCRH 1HHJB 4PLOB 1CXIA 1KOAA 1VEMA 2X4OA 5HHNA 3UTTE 5D72L 4PY8I 1N0XH 4PGCB 3DECA 1BOYA 5TDOB 3RTQA 3R1GL 5D2NA 3CFDB 4A6YL 3KYAA 3DSNA 1E4WH 3DVNA 3KXFD 4HKXA 4Y4KA 1R3HA 4C83A 4QRQA 2Z91A 3S6CA 3L3IA 2EZ0C 3MLSH 4ZAKB 3Q6FA 1KCVH 4NQDD 4OFIA 3GGWB 4M03A 5T3ZL 2CXGA 2VZOA 3SDCB 4XNZB 3AAZA 5LGJB 3F58L 2ESVB 1XAUA 4HWBL 4KY1L 5HDQL 5IROC 2BVOA 4MQXC 2PTTB 3MBEA 3SN6N 3PWNA 1AXSB 2QADC 2NX5E 1YEKH 3TPKA 4TNVF 4FQHA 4S0SD 3TA3D 5DHVB 4E9LA 3VDAA 1T83A 4J3SA 4X7TB 5F71A 3T4YA 1A9BA 5HYJA 3RGVC 3ZKND 2AABH 2FEEL 3TCXA 4OZIF 2J4WL 5I17A 1E4XL 1A1MA 4M6NH 2FATL 3Q5TA 4Y16B 1KPUA 2PR4L 2Q87A 4Y7MA 1BEYH 4X6FB 3ZYJA 4H25B 1IC1A 4FTVD 2AJZA 2N56A 3C6SA 3EYVB 3QZWB 3CX5K 1JNJA 1A4KB 1NPUA 5GGSA 5E2WL 5D7IA 1H3WM 4HIIB 3QJHA 1YUHA 2BSTA 2KH2B 3QWOB 3VXQA 4NGHH 1JGDA 3OGOE 1JGLH 4L4TA 2YC1B 3ARDC 4W6YB 5GRZA 1LDPH 5GJTL 4JGJA 3D5OF 4X6DB 3QEQA 4UT9H 3OPZL 4X0KA 1ZLVK 3V0VB 2X4PB 3FB7B 1YC7A 1YJDC 3UJIH 5HGHA 3D0VB 5FM5M 1ZE3C 2VZTA 3MRLA 4EIGB 3IU4L 4YH6A 3SY0B 1HI6A 5I1LB 2DJ4A 1RZIB 3KYOB 2IPTL 1OP5K 2VKXA 2V2WB 2VLRE 3DUUA 2IANA 1M71A 4K7FB 3MFFA 2QHLA 3AXLB 2J6EH 1A02N 4P9HL 3BD5A 5J3HC 5ALCL 1XGYH 3RHWF 3U4AA 4OLYL 1WFNA 3VRJB 5L7XH 1G9NH 1C12A 5ALBL 1W72L 3QUZB 4QRTA 3FMGL 4MSWB 4YX2L 3TNNA 4OZGB 5B4MD 1T22A 1GOFA 3T0EB 1AHWB 3PIQA 3HMWH 3K4AA 4GT7A 1LK2A 1EGJA 2VDLL 1GGBL 3ROOA 4F7CA 5SWSB 2XZQL 3SCMA 4BSJA 4KPHL 1M6OB 2DI9A 5E2VH 5CBEB 4YFDB 1L7IH 3QXAB 5EU6E 2DICA 3NFSH 4OKDA 4YGAB 4PJHE 2PW1A 1W0VA 3K8KA 3RKDC 3MCLL 2F74A 4ZG1A 4HK0A 5JXAL 2GTWA 4PRPE 3IDMB 4YXHL 2XQBL 4MVBC 4U05A 5E4EC 1WAAF 2IG2H 3NOIA 4LASH 3GIZL 1ND0A 5DUPL 4RRPA 3PWLB 2V7HA 5CEZE 3ULUH 43CAB 3WXVL 1IEAB 1K4DB 5CGTA 3WIFA 3ULVD 1BOGB 2C3WA 3MRGA 2AEIT 4M5ZH 1U3HD 4Y1AB 5L2JA 1RZ8A 1A1OB 2OR7A 5HY9A 4PV8B 5C3LD 1DBBL 4L3CB 2NY4B 4G7YH 1UACH 1FYHB 4QF1B 3QAZB 5E99L 1PKQA 3M8OL 3FHAA 1A4JB 1K3IA 4WEUD 4X4YA 2NY7H 1DN0A 3AM8C 5KSBB 2ED7A 1RURL 1TNMA 2I9TB 5SWSE 4LSVL 3HRZA 4NO0A 5HSFA 4HS6B 3CGTA 4LVNC 4HKJA 5EO1B 5FM8A 3U79A 1CE6B 1LP9E 1DLFL 3TN0A 3T65B 3LV3A 3S9DB 4WWKD 4MJIB 1FFRA 5IB4A 4WUUA 1F4YH 1T3FB 2MJWA 3UYRL 1JPTH 1Y0LA 2BNQA 1YYML 1XF2A 3DX6A 3HTLX 2ATKA 2CLRA 4K94L 5J9PA 4HJJL 3HZMB 1UZ8A 4XWOD 4QRPE 3MO1A 2DI8A 3CLFH 3D9AL 3UXFA 1KJ2H 2IPUK 4ZOCA 4JKLA 3ILQD 4LMQE 1CQKA 4H88L 3BO8B 4ESKA 5C09B 3PE9A 3F7PC 4YUEL 4RGMC 1YY8B 1UZ6E 5LGKA 2WZPD 4P9HC 4RCAA 3FRPA 1F45A 2JJTA 4DKFH 1MFBL 1BJ8A 3VGHA 3KGRA 4ORGB 3P0YL 3DLQR 2OX5A 2Z4QA 2YBRA 2UWEE 1MJUL 4PB0L 4WW2A 4N0FB 1NFDB 5JXEC 2EC9T 4NQCB 1JHKH 3MJ8B 1F11A 4N0CC 3OJDB 4MNQA 1YEDB 1QP1A 1AFVL 5H94B 3IXTB 4LEXH 2AKRB 1B9ZA 5DQ9A 4HCRA 5GGQH 3GMQB 4MJIE 4E0RA 3BPLC 4L8BA 1V3KA 1H3GA 1MFAH 1JWSA 3ARDB 4B0MM 4D9LH 5KVDH 1UM4H 5FM5O 1KBGL 1CL7L 1I7RA 2IBBA 2LE9A 4I77L 5BS0B 1RULL 1F00I 1QLFA 4W6XB 5CD3B 2OZ4H 4G8GE 1EEQA 3ARTA 4ZNEE 5JHDB 3M17B 3O2DA 4GBXC 3V6FB 1INQB 1SJHA 4UTBH 1A47A 4U1SB 5EZLB 5K59E 5C6TH 3RX7A 2E7MA 4G9FD 4XPHL 3TCLB 4NHUA 2GJ6A 4XP9L 3TT3L 3MYZA 4N9GB 5D7JD 1T1WA 4ZXBB 2CLVA 4FQXC 4J3WA 5CBAB 1AR2A 3VFMA 2B4CH 4QYOA 4C4KT 2ZSVA 1X5ZA 4V1DD 2ZUQC 3QDAA 2VDNL 3SGJC 3WN5A 4HPYH 5JO5B 4J8RA 2C9AA 4X7SH 5DD5L 3VFWA 4WI4A 5E70A 4ZFGL 4PJAB 1U3ZA 3F8UB 2X89A 4LCUB 1SY6A 1QYGL 5L9DH 1LD9A 3BRGC 3RDTB 3V4VL 1U8QA 1C8PA 3RJDA 6FABL 5IOPA 1HYSC 3BP6B 2VXQL 4LLDB 4HWEH 1QFUL 3SHSA 4ELMF 5HHOD 4I1NB 2NTFB 4A6YB 4AK1A 4HIJB 1JHTB 4B41A 1FGNH 5IB1A 2NW2B 4BQ8A 5CZVL 1F4WL 1DEEB 3LKSA 3LQZB 1VPOH 1IL1A 4MA7H 1T5XA 3Q3GB 4K94C 1FPTL 3QUXD 4P2RB 4MA8H 3UPRA 1OGAA 4YNYB 5BV7H 5E4EB 1F42A 1TLKA 4YDJA 1DZBA 2OJZH 4HIEB 2FR4A 4MD0B 2QLVB 4MAYA 5FOJA 4GH7B 1CFBA 4UV7L 4ZSOA 3H9ZA 3ZDXF 1J10A 2UZIL 1Q9OA 2GAZB 4ONHB 3OZ9L 2A6KA 4UB0H 5DSCA 4RMWA 2BXZA 1H9VA 5DD0L 2F58L 2A83A 4NWTL 4EOWL 2DS4A 4YGVB 1HCVA 2JK5A 1M7IB 1I1FA 1MHEA 4PP1C 4NQTA 2VQ1A 5CP3A 3BVNA 4F2MA 1YPZA 1U8NB 4O00A 3QEUA 4LVNB 3FN0H 5TJWK 3FQNB 1W0WB 1K5NB 1P69B 3RL2A 2E6JA 2VXSL 2E7CA 3IJHA 5GS2H 1SJXA 4MJ5B 5CZKA 1TQCC 1T7YA 4OJFH 1PKOA 4TTDC 3RWFA 2R0ZH 1S7SA 1WICA 1HCFX 5ID0B 1U2CA 3ECBB 5I15H 5BQ7A 1T5WB 4XBPA 4X8JA 5IHUL 1NDMB 2XPGA 4PJXF 4AYFA 5B21A 4K3EL 5EU3A 3IFOB 5DR5L 1GHFL 2DYPA 2PYEA 3BMWA 1OVZA 3JWDH 3U7AA 4K9EL 2QR0A 4HJGB 1U8HB 4TSAH 4RGMB 1AKJA 3IU3A 1NGZA 2KUTA 2XWJB 3OKDB 3P11L 2GT9A 5C07A 3WUZA 1W72B 3FT3B 2VC2L 15C8L 1CXKA 4WFFE 5I1HL 4Y16D 5KAQF 4YHLH 4UTAH 3GBML 1MWAH 3MUJA 5IG7B 3GMMA 4L3AA 3BH9B 4WFEE 4YHPA 4S1SH 2P49B 2X40A 3OKYA 4U2YA 4N5ED 3IDUA 1BBJA 5IGXL 3TYGH 4AEHL 3V52H 4Z7QE 3MV8B 5HHPB 1S8DB 4XP6H 1CBVL 5T1KD 2VDPL 3TH2T 2ARJB 2NXYC 4XP4H 5FB8B 4UUJB 5EU6D 3ARPA 3CX2A 4U2ZA 3C5ZA 4UOJA 1Q8MA 5CMAA 5J4MA 4I3GA 1CICC 5HHVH 2O5YL 2R8SL 4PRPD 4AT6A 4P9ML 4DGYH 4XMKH 1U95A 3OR7B 4XNMB 4GBXB 1H3TA 2ZPKH 5D1ZB 3ZKMC 4OZFH 1IGJB 4RX4D 1WZ1L 2YSSA 1ZT4A 4FQXB 5LWYL 1BZ7B 2EXYC 4PS4H 3H7LA 4P5TA 5GGVL 4E5XB 2VR4A 4JANA 1FVEB 3QUZD 3NCFB 1NMBL 3WL9A 3MLRL 2ZUQB 5GZNC 3L5JA 3MLUH 2AXGB 2VDQL 3RVTD 1ZVHA 3KDMB 3T0ED 4RWHA 2XTJE 1IAKB 3OKMB 5KVFL 3CDGA 3VXSA 1A2YA 5DT1L 4X6EA 2AEWA 5SWSD 1NCWH 5E7FA 3MRFA 2CDEA 4LLUA 3RVUC 4RRPG 4ZS7L 5DF0A 1XGRB 5T3XE 2B1AL 5DYOB 1EFXD 4NNYA 4WI6A 2HLAB 3Q6GH 3MUY1 4WI2A 3ULVF 4HS3B 3VXRB 3O6KH 3MJ6A 3UBXB 2EKSA 2BNRE 4NZRL 5F7FA 2HVKA 4HAFA 3QFDB 4LL9A 1LO2H 5L0QC 1ZVSA 3EJYD 3FT2A 3LH2H 1A6ZA 4WJ5A 3PWPE 3LRHA 2NMSA 1ADQH 1IVLA 4QRPD 5E5MA 1NGQH 3MV01 4WFGD 3C09C 3T0BA 2DQIL 2CRIA 3W9EB 1VERA 1CD9B 3CCHA 4K9EC 4YZFF 1ZGLA 2DQTL 4Y1AD 3BN3B 5GRJH 1UCTA 5AYUL 4EDXA 5E8DH 4XPGH 1T0MB 3QI9A 3QJFB 5GGUA 1I7TB 2F5BL 2BVUA 4R97C 2L0DA 5JIHA 4PRIE 1I3RB 4NPYB 2ZCLH 4U7SA 2HKHL 1KFAL 5C8JB 5DJ2B 4S0TD 1JPST 1ZLSH 1EJ6A 1NLBL 4WHTB 1FL6A 3B6SA 3UX9B 5F1OB 3GBNH 2NNAB 2G60L 4BZ1L 3LKPA 2IPKA 3QRGL 3RWHB 3GSVA 1X3DA 4MJID 5D71H 4PJEE 2D2OA 5IT2H 4DUVA 1TQCB 3D2UB 1A3LL 2QQKH 5FYJE 1QVOA 3FRPG 4Z95L 3MOBL 2DD8H 4X9BA 1FNGB 3EIFA 5CJBA 5DWUH 3QH3B 4HWNA 2XQYK 4I5BA 5GRVK 4Q9BA 1P5UA 1J8HE 5C09D 3MLSL 1DQTA 1NKRA 1TZIB 2EDNA 3J7HA 4MMZC 1D9KB 1ONQA 4M7JH 2XZZA 5JW5B 2NCMA 1MIML 4IOFD 1S78D 2EDJA 4L3EA 3SQBA 1DDHA 2J8HA 1YN6B 5F21B 1NMAH 5DMJB 2VXUH 1KPRB 1QSFA 3RZWA 5JIPA 2GKIA 3WFDH 4JVUA 3ARFA 4Y19B 2OLDA 4HDIA 3NTCH 5GGVY 4KRLB 1GC1H 4ODHH 5E08L 5I8OH 4JFOB 2EYTA 1MRCL 4KXZH 4M6NL 4EI5D 2QQLL 5KSAB 3O2WH 3VXUB 4OD3L 3NFNA 5F3BA 2X70B 1H3XA 5GGTA 1BEYL 4QWWC 1HN1A 4WHDA 3GI9L 2NXYB 4JDVB 4Z8FL 3R0NA 1T6VN 2A73B 3WHXA 5GS1B 2R56L 3GSUB 3MPCA 3ALWA 4FXGB 1LE5B 1LDPL 1ORSB 2UVFA 2J8UF 4RZCB 1R3LA 1RZGB 1DBMH 1P7QA 2IAMC 4MQTB 3UJIL 1OTUC 1MCOL 3T4AB 4LIQL 4ZXBD 2UYLA 2WMPA 1AR1D 4V2CB 4MLSA 4WEBL 1S3KL 3G5YA 1P7HL 2X44D 4M7KL 4P59L 2AXFB 2F15A 4Y8AA 3RA7H 5J1SC 3BEWA 3WFEH 2G9HA 4X5XB 2CO6B 2NY6B 2W38A 4K2UH 5F88A 2BNUB 5C2UB 2R69H 1QSEE 2I60L 4QO1A 1KIUA 5EIIA 1JPGB 5EU5B 3HZVB 1BFOB 2RCSH 3RDTD 4LPVA 2PETA 2VDOH 3CK0H 1N5AA 2BVEA 4MA1C 5E2UH 3G6JA 4FQPA 1T0PB 3QCTH 4MJ4A 2R1WB 2JCCE 1IEBA 4PB9L 12E8H 3H7BA 4U1KB 3N9GH 4JGUA 2CLZA 3DIFB 5LGHL 1T04A 4R96A 1HHGA 4TUOB 2OL3H 3QIUB 2HH0L 4WO4C 2DKUA 3MA7A 3QWRA 2ZUYA 4X80H 1XCTB 5SWZA 5HVFB 4FQQB 5T3ZD 1FIGH 3WE6A 3QIWA 2NW3A 2Z92B 4KK5D 3QA3A 1I8LA 2EIEA 2A1WH 3GMOA 3CFKB 2FB4H 3OF6D 2R23B 1YMMB 4QRUA 1RUKL 5ICXA 5SX4I 4YXLL 2HTLC 5TE4H 5CLWA 1G9MH 4ZUUB 5ETUA 5IFJA 1N0LA 4GW1B 4YBQC 4LK4A 3B5GA 1D5BB 4MA3A 1KIRB 3KPQB 2CKBH 1GGIH 1FV1A 1AGEB 2BY2A 5HTSA 4Z7VA 3LKOB 1IT9H 4HF5L 4DCQB 4Y4HC 5EO9B 2VSDA 4NDMA 4OB5H 4G7YL 4UQ3A 1CFQB 3QDGB 4FMKA 3ARWA 4RMVA 4WU5B 3QHZL 3NIFF 2B2XL 1KCUL 3GM8A 3VWJA 1H8OA 1LO5A 4XBEH 1JPFA 1ULVA 3SDAD 4KVCL 5FCUH 5F7NC 1V7NH 1J1XL 2M26A 4OLXH 3FKUS 1TJIL 1MI5B 3PGFL 2R2HA 4G80A 5CIPH 1FAIH 1XR9A 3MGAA 3D18A 5JDJA 4PRDB 1QQDA 4KMQA 1PEZA 3UP1A 3FHQA 1TIUA 1JPTL 2CQVA 2OJEB 5E00B 1J1OL 4NUJB 2VLMD 4CVXA 1EAPA 4BFIB 1ES0B 3SGEH 3A6BL 1RIVH 2BSSA 3QXDB 5DJAB 3REWB 3RWDA 3FOMA 1IM3B 1CWVA 2R29L 2Z0BA 3H0TB 2DQGL 4LMQI 4OFYD 4P23C 1NBYB 1SBSH 1AC6A 4X6DF 2VIRA 3EYOA 1OF2B 1JZ3A 4PJHF 5JXED 4PJ7A 4LP5A 2JKXA 1A6UH 3D85A 4RDQF 4DKFL 1DUYB 2XTJD 3MGTB 3QDGE 2ZSWA 4AEFA 2BK8A 4RBPH 5AG9A 2DWDA 4NFBA 1NDGA 2K9UA 2XA8H 4FG6C 5DJ0B 3CDYA 3OGCA 4MJ6B 4MNGB 2BP3A 2MPAL 3ZYZA 1QFWL 3MV8D 1OTTC 2NY5H 1JIBA 4HBQA 3LQAH 2JJSC 5T3XD 4KKBC 1N64H 2V2XA 2AJSL 5LXGH 2PO6A 1LEIA 1RJCA 4QHLB 1MI5E 3SGEI 4PJBB 1UXWA 2Q1EA 3GSRB 5GGQL 1I8KA 2F54A 2BNRD 2FO4A 2EH8L 5I1EL 5D1XA 4QTIH 4OZGF 1MFAL 5EOCL 5MENE 2GHWB 1UM4L 5D1ZD 2Y5TB 5I16B 2HVJB 3PWPD 3EW3B 5FGBC 2AXHA 2E9WA 5E24E 1CFVH 2P44B 2IAMB 4RFOH 3SE4A 4PGEB 1OSZB 5L6YH 1D3CA 1Z9LA 3ZTJH 3D69B 3BD4A 3VXNA 3VGDA 4UU9A 5FOBB 2G5BB 5M94B 2R1XA 3LY6A 1WT5C 4YDIH 5BMFL 1IGTB 1FE8H 5IMMA 3S3PA 2GFBB 4M7LL 5CEXB 5E9DB 3P73A 3MV9B 3FB8A 3UTQA 3MXWL 3ETBF 3ARED 3GSXB 5I0ZA 2Z93A 3G5XB 4L5FL 4XP5L 2B4CL 3U0TB 2IADB 5FYKE 1Q9WA 5I76B 1XCQB 2HN7B 4PJ8A 3WO3B 1O5DT 4BA8A 4J3XA 4HPYL 1NBQA 1U91A 4G8EA 4DVBA 5B38G 1HYSD 4X7SL 4RAVA 1S7TB 3F5WA 3SDXA 3GKWH 1IGYA 5IWLA 3MV11 5DVMA 5F7UA 1UZ6F 4WO4B 4YIQA 4GAYB 4QXUL 4BSWA 4JHBA 1S5HB 3P9MB 2HFEA 5IMKB 1S5IL 3L3GB 5LAXA 5ISZB 1GGCL 5IVZA 5E8NB 1K4CB 1FJ1B 3VXME 1T66C 4NCDA 5KSBF 3L3OA 2Y6SD 5D2NC 4WIQA 3MR9B 1VPOL 2WLYA 4Y5VA 4KI5E 5BV7L 5C08B 4UAOC 2IBZY 2R0KH 1S7WB 2WWKO 4DN3H 5E1AA 1KTLB 4PJDA 3TBYB 3MV9E 5IEKB 1R3JB 4G6JH 3RZCD 4OGAC 4PJ5B 3RWIB 5A2IH 1HILA 3AUVA 2VZ3A 3CPLA 5F1IB 2EDWA 3CH1B 3MBEC 1AD9A 3GI8H 4OIAA 3KJ4B 1DBAH 3HI1A 3KJ6H 4GAJH 5EN2B 4Y4HB 1YDPA 2V5MA 5CJXA 3O3AB 2MQ0A 1T83C 3MCG1 4LHUB 5DUBA 3NA4A 1ZHKB 4RSVA 4JHAH 3IFPA 2XKNB 5B8CC 5K59F 3T3ME 2OS7A 1N2RB 3QUYA 5ENWB 4K3DH 2SEBA 2VZUA 2PUQT 4TTDD 3CJJA 1QEWA 4JY5L 3S5LA 4XMPH 5EZOL 1N8ZB 1U8JA 1UJ3C 1BVZA 1DSFH 5ISZE 3I3DA 1CQYA 1NFDF 5DGRA 1I8MB 1I9JH 2W60A 3DYPA 3MLZL 1MNUL 2X1WL 3CDCA 3P4NA 3GIVB 2FZ3A 3OKOB 1PW3A 3U4EA 4Q9RH 1A6TA 4I48A 4JCMA 5L8LB 1GAFL 3MRIA 3HB3D 1B4JH 5A2JH 1D9KD 3HPJA 5EOCJ 3QCVH 5GGSY 5EBWA 4OF0A 5CSGA 3VH8A 1CGSL 4PREA 5DC4B 1M7XA 4P23B 4TUKH 4A2MA 3V5DB 1CFSA 4JKWA 4S1QH 4TSAL 3RNKA 2P5EB 1GOGA 1RZJL 1C1EH 2B4CC 3I50L 4Y19D 2AGJH 3D25A 5HI4D 4DWHA 5FEBA 1GL4B 1VEPA 3G6DH 3W39B 1KJ3L 4D8PA 3MRRA 4HMDA 5KSAD 5JDSA 3VXUD 2P46B 4PG9A 1ZSDA 4MXVE 4U6VH 4S1SL 1L6ZA 1TNNA 4MQ7B 2NXYD 4KZDH 1F3DJ 4GAGH 5I2IA 1VEOA 3LKNA 5I18L 4GKSA 3V52L 5JPNB 2WIIA 5DZNA 3X17A 1H15B 1JRHL 4WHYG 4PRNA 4LSRH 1A3QA 4RAUB 4HCRL 3BKMH 3ES6B 1LO3H 3TNMA 3EGSA 3EJZC 4OZHE 4MJ2A 5IBLC 1EZVY 3GMLA 2M1KA 1KPVA 3KPSA 3ZKMD 3VD9A 1RZ7H 1VADA 1RVFH 4BYHA 5BV7C 1TVHA 4K23L 1QUNA 4DGYL 5SX5H 5I19H 3FAXA 1FL3A 4XBGA 5IB5B 3GSNH 4FMFA 5IW6A 2C26A 4D0DA 4EXPX 1TETH 3NFPA 3O2DL 1H5BA 3D39A 2FGWH 2FO1A 4APQD 5D7LB 1GZQA 2NY6D 4HUVB 4U33A 1MJ7L 4I0PC 4PS4L 1R3IH 2N7BA 4ZPTB 2D31B 3UO1L 3N06B 3GEWB 2ICWI 3VGEA 1MY7A 2XRAH 5JOFB 4Y5XC 1AO7E 2APFA 1RUQL 4WV1A 4NC1C 3QIUD 4JM4H 2EYRB 5DEZA 1MCNA 5FYJU 3HR5B 1GCFA 3Q6GL 5CILL 3W0WE 3U48A 2L7UA 4LLYB 3HZKA 1FO0A 2LABA 2X4OB 5HHNB 3VFNA 4PJIE 3RTQB 3BJLA 3DRTA 5D2NB 3TYFA 3DVNB 4Y4KB 1ZA6A 1YMMD 3LH2L 4QRQB 3TIDA 2Z91B 4L1DA 2CH8A 1ADQL 3L3IB 1RSFA 1NGQL 3Q6FB 1HNFA 3NACL 4XVUD 4Z7QF 3EFDH 3AAZB 2VL5A 2DQJH 2B1HH 2MOVA 1F8TH 3S7GA 1RZJC 3MBEB 4NQEE 4K07A 5A3IC 2F8XC 2WBJA 3NH7H 3AU1A 4GXVL 3N50A 4H1LH 4FQHB 4U1JA 4JRYB 2JJTC 3QDGD 2OMNA 1XR8A 4M4PA 2DN7A 2ZCLL 3T4YB 2UUDH 5HYJB 1PY4A 3EYFA 1Q0YL 3WJLC 4XVSL 4OIBA 2R4SL 4WW2C 5I17B 1A1MB 2KZWA 1H3VA 3GBNL 3U4BH 1KPUB 4JPVH 3PV6B 1A3RL 5J6GA 4P3CL 1MI5D 2AJZB 3C6SB 4O58H 1G7LA 2P4AB 2FJGA 3ZT5A 5GGSB 4OT1H 4JO2H 1UJ3B 4HJ0D 5D7IB 2V7NA 5IT2L 3QJHB 2GY7B 1YUHB 1SVZA 3FONA 4X99A 1L9MA 5DS8A 5MEND 3VXQB 4F37F 2Q86A 1JGDB 5GJSH 2YMXL 4L4TB 3OAUL 4TVSa 4NO3A 4PJ9A 1EHLL 4TVPL 3DNKA 3QEQB 1IGML 1SEQL 4X0KB 4DKDC 5BXFA 3IKCA 4AIOA 5HGHB 1R5IA 4KGJA 4X5LA 2XFXA 3MRLB 4HAGA 3T3PE 1BGXL 1QOKA 1HI6B 4KJYA 1L0XA 3KR3H 2ITDA 4LKCA 4GRWB 5B22A 3TBVA 3CDFA 4BSVA 3DUUB 3HN3A 2IANB 1A1NA 3GJFK 4WWKA 4LRNH 3MFFB 2X4UA 4LSTL 2FIRT 3E8UH 5FYKD 4D0CA 2B20A 2HRPH 2QV2A 3B5HA 4EXKA 4M8QA 4HW6A 5HHXL 1X5XA 4ZUTA 4YAQA 1ZEAH 1C12B 1H3PL 5CJOL 4QRTB 1AD0A 3TNNB 1NCAL 2VH5L 4QWWD 1RJZA 1A0QL 3WDHA 1T22B 1GC1L 3OMZA 1I1AC 3PIQB 4ZD3H 1B0GA 1I1RA 3O2WL 1QR4A 1LK2B 3P2TA 4PRBA 4YO0B 3ROOB 4F7CB 3SCMB 4ELKB 4S2SA 4MB4A 5DRXA 3EYQC 1Q38A 3QXTA 4D3CH 3VXMD 2IAMD 4UIKH 1J9CT 2BRRL 5JW4R 2PW1B 1W0VB 2F74B 3G9VA 4KI5D 2P1YA 4HK0B 2GTWB 4DUXA 2J8OA 2AJVH 1JNHA 3MXVL 5HYFA 4KRPC 1ZK9A 4PY7A 4OZFA 3O8XA 1ND0B 3QNYA 3L6FA 3MV9D 4RNRA 4OQTA 2DM4A 2Z8SA 3T08A 3QEHA 4PJEF 4NKIH 2V7HB 2CGRL 3QO0A 1VGKA 3WIFB 4I0PB 5KTEH 2Q8BH 3MRGB 3V7AE 5FKAA 3HE7D 3L3KA 1AQKH 1RU9L 5C0BA 3RA7L 5L2JB 1UA6H 3L3DA 4OFVA 3QCUH 1ZLWK 1KEMH 5HY9B 2MNUA 3IGAA 4TSBH 5C0CE 4AEIH 1IAII 3PXJA 4HZLA 3EZ8A 1PKQB 1BFSA 2XG4A 1A7BA 4Z0BL 5L8KB 1X5LA 2XXMB 4X4YB 1DN0B 5HBBA 5KVEH 3T0VA 4KMLB 5E2UL 4WO4D 4CJ1A 2J2ZA 3KWWA 1IKFL 2R0WL 3V5HB 3HRZB 5H37H 12E8L 4NO0B 1JF1A 5D7JA 4HKJB 2ZKHL 3MTRA 4J12A 5ISZD 2CKNA 3LV3B 4BZYA 4C54A 3D48R 3UJJH 3TZVC 5IB4B 4WUUB 1G1YA 1ZKAA 3CFEA 5BVJA 1DUZA 5HYSG 5CINH 4RGNE 1Y0LB 2H3NA 2BNQB 1X5GA 1CGUA 5E5UB 1XF2B 4M02A 1OM3H 4KTDL 3DX6B 2GJJA 4QXGL 1VKXA 2ATKB 2CLRB 5J9PB 4YBQD 4JHWH 1UZ8B 3MO1B 1F4XL 3RUGA 3QPQC 4JO3H 2A1WL 2FB4L 1QRKA 1OAYL 3C60C 3VI3F 4O9HH 3BZFA 5TE4L 1NAKL 5DTFA 5DVKA 3UTTA 3WEXA 3UYOD 3VXOA 1NJ9A 4GG6E 3S36L 1UFUA 4TYUA 4G8IA 4LHUD 1KC5H 5GRXG 3O4OB 3OJMB 4XH2A 3QDHA 1PKQE 5F6IC 2Z4QB 2YBRB 4KJPD 2XG5A 1GC1C 4WW2B 3QQ9C 4OB5L 3LS5L 4FQIH 3FQWA 2YPLE 2J88L 2FLRT 3UTSE 5TF1L 1F11B 3K4ZA 1FGVL 4XCCH 2DM2A 2W07A 4MNQB 4NBXB 1TMCB 3WNLA 3VH8G 4XTRC 4PV9A 1EVUA 2NX5A 2FEDD 5GRUL 5DQ9B 1Q1JH 1HZHH 3VG0L 1YY9D 3ULVH 4E0RB 3MCKA 4HGWA 5GGRY 4HFWA 1OPGL 2MFNA 3DVFA 1JWSB 1FAIL 5F93C 4TPRH 1I7RB 2FWOA 3C5ZC 3PQYE 4WI8A 4P4KC 4M3JA 4ZUVA 1QLFB 5DVNA 4YHYC 4QOKE 3LKQA 5DD6B 3W2DH 3HC3H 3JV4A 2AEQH 3HLAA 2YOCA 1SJHB 3OKKA 3IKKA 3OQ3B 5E6IA 4MNHB 3J8F7 4FZ8H 2Q6WA 4DGIL 2IGFL 4NHUB 4OGYL 3JV5A 1JYVA 4YFLF 5FYKU 3ARBA 1T1WB 4KK9D 1SBSL 4P2QE 4UV4H 2CLVB 4FRWA 3DX9A 4G9DA 1KELH 3VFMB 3DBXA 4QYOB 4NZTH 2MHAA 2ZSVB 2EE6A 3SOBH 2V17H 2VZ1A 5HXMA 4KKBD 1T7WA 5DA4A 1Z9SA 3BIKA 4J8RB 1D6VL 1F4HA 2XA8L 3VFWB 5JORA 1MCIA 3PV7A 4LCYA 5ILTL 3WDIA 2VLRA 2NY5L 3BUTA 2IMMA 3FO2A 3L5WA 4U7MA 1LD9B 1N64L 5LXGL 3QUMA 1U8QB 3VG9C 5TQ0H 2ZJSH 1JGVL 5IOPB 4OI8A 3WNPA 2DB8A 3KG5A 3H3KA 1VCAA 1KN4H 3X14A 2HTKC 2VABA 4IRSA 4IRZH 5IB1B 4BUGA 1KIQA 4M6OL 1IL1B