4M61B

Crystal structure of unliganded anti-dna fab a52
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
220
Chain Sequence
EIQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGKINPYYGSTSYNQKFKGQATLTVDKSSSTAYMQLNSLTSEDSAVYYCARGRLRRGGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure determination of anti-DNA Fab A52.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab A52 light chain
total genus 39
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B02
4GQPH 2KKQA 3U7YL 4LHUB 1QLEH 1VKXB 3EO0A 4HIJB 2DLGA 3P0VL 4M7LH 1O5DT 3TYGL 4K2UL 1L6XA 4KKLD 5ANMA 3RBSA 3D48R 3DNKA 3O11A 1NCUA 2NY4B 3MLPA 1DLFH 3OL2A 5IB1A 2DQTL 3NN8B 1G7IB 3S35X 3WUWG 4FTVB 3GHEH 2Y06L 1AJ7H 4JO1H 4X6DF 5D7LE 4GAYB 1G7PB 1HSBA 2ZSVB 1NFIB 2OL3A 1TZHB 2J8UB 2VDNL 3H0TB 4GG8B 4JM2B 4QRRE 5E56A 2AV1A 4WUUA 1H3PH 3BZ4B 4G6AC 4ERSL 2C26A 3QEGH 2FL5A 1CWVA 4Q74A 5F1NB 4WU7A 4XXDB 1H8OA 4GMSH 5FGSA 2GITA 3OXRB 4MHHI 1JGLH 4HH9B 1X4ZA 1KB5B 2BJMH 2NZ9C 5BW7A 1KTKE 3DOSA 3FB7B 4XPHL 1MAKA 5J6HA 2P5WA 3CK0H 5JDSA 5BV7B 3U1SL 1XZ0A 2LVCA 1LEIB 3OKEB 2A6JB 5KOMC 1RUPL 3DMMC 4AEFA 3KXFA 4L9DA 4J3UA 5HVHC 2VXQH 2JB6A 5F7UA 5TQ0H 3ZKXB 1YC8A 3JXAA 1CFBA 4WEMB 2MKWA 5B3JF 3MREA 3OJVC 4UZGA 4Z5RA 4PJ9D 4I9WE 3D87B 1LO3L 2M26A 3LPFA 5A2FA 2EYTA 4HKZA 3SN6N 4WFGD 2CKBA 3VXPB 4HKXA 4V1DD 4RAUA 3ORJA 1UVQB 4IOIA 4TOYL 5HHMB 1GCFA 5EUOA 1BQLH 4NQED 4NJAH 4LBEA 2PR4L 3P30L 1YJDH 1DUYB 2DTMH 3IF1A 4HH8A 3DSNA 4ZFOL 1YNLH 4RSVA 3IAPA 4F7CA 5B38A 5BRZD 4NQXA 4MJIE 1OAYL 2H2PC 1M7IA 2XA3A 4O2FB 1KJVA 3PWLA 4X9BA 3VI3E 3ZDYE 3VI4E 1F02I 4PJEF 1HDMA 4MA1B 4CUCA 1N64H 2CK0H 1IGTB 3RVXD 1DUYA 4H0GA 3MRLA 5T3ZL 3M07A 5D2LF 3GRWH 3QWQB 1I7TB 4I18C 5LGHH 1AGEA 1IJ9A 4Z78B 3DX7B 5D6CB 1TNNA 3VH8A 4PJIE 1YNLL 2DQDH 2J3SA 1UH4A 3GUTA 1GHFL 2ESVD 3ILPB 3BJ91 4ZNEE 1RUPH 1F4WH 4NFBA 4Z76A 4C56D 2FRGP 5BZWB 3I9GH 4G8FB 4NQSB 1PLGL 3IDXH 4NKOA 4I0PC 5AWNL 4IIQC 3VWKD 3O6KH 2F8XC 3KYKH 3IJSB 1KJ2H 3REVB 4P2OB 4LARL 4I3RH 4PRHB 1WWAX 3X3FL 2YPVL 3WLWD 5BXFA 2FX8L 1LNUA 4PRPD 1LEIA 3MGTA 4N0YL 2ITDB 3ARFC 3QNXA 3ZTNL 5F6IC 1IAIH 3Q6GL 5CEZD 1BX2B 1TVDA 5C0AA 5EO1A 4PUBL 2AK4D 3IU4L 4NKMB 4KDTC 4A6YB 3BFOA 4HIHB 5KANI 4YHNA 3SKMB 3QIUB 2GITB 5CJ8A 1NAMA 4RA3A 4JRYE 4NKDA 3IFPA 3EDKA 1GGYA 3OKDA 3SE4C 2GSGB 1EXUA 2R8SL 3UTSD 4MWFB 4XB7A 2PO6A 3VFTB 2G5BB 4JZJB 4ALAL 2F53A 3A0OA 3RGVD 4BQ8A 5DD1L 4AZ8A 2A6IA 1ZGLB 3HE6B 4MNGE 3LKPB 3RVUD 4MQTB 5DQDL 5ETUB 5FYKL 2D7PA 3ZE0E 1ZLVK 5HD8D 1JYNA 2D0GA 1T22A 3C2AL 5C6PB 3TZVD 1DUZA 3BIAX 4HK0A 5F21B 4P4RB 1NAMH 1U93B 4I3GA 4RFNB 5FYLH 4P5MA 4KKCD 2I25N 2VAAB 1BIIA 2VZTA 4KUZL 4L4TE 4HIJA 5F93C 4X98A 4RX4D 4FQHA 5GGUB 3KPMB 1IEHA 2VLRA 4TULL 2GQHA 3O6KL 2CGRH 3S5LG 3ALPA 5CD5D 3OKMB 5EIIA 2AXGB 3BDYL 1AP2B 3FN0L 3OG6B 2EXWD 4RRPA 5C0EB 5FF6B 3S3SA 1ZLWK 4I4WB 3C6LA 1ZVYA 4KHTH 3QHZH 1MFAL 2VDLH 3LVEA 2EDLA 4JM4H 3BKJH 3MJ9H 3TIEA 4HLZG 5C08B 2IG2H 5LQBL 1U3HA 2F54B 4DGVH 1T5WA 3IDIA 1NCAL 1J1PH 4Q6IB 3LY6A 1ZTXL 5DUMH 3ZTJG 5DT1H 3F7VA 5F96H 5JW5B 4LDLB 3U0PA 1MLCB 5A3ID 4LLUB 2CJUH 4P57A 3RPIA 1J1XL 2FX8H 1A21A 4U6XB 4QRRA 4Y4FC 3KPNB 1SEQH 1SYVB 1QA9A 2VXVL 3BRDA 3P0GB 3T0EC 1LE5B 5BQ7B 2H2SD 3D0LB 3IDYB 3GMPB 2UY7A 1UH3A 1NL0L 1H3VA 1UZ8B 3G6DH 3PQYE 3WKML 2ADJB 2G5RA 3LIZH 2UYLB 3GIZH 5DRWA 4OZFG 4MS8C 4Y4HD 3IYLW 4CVUA 3HI6L 4DTGL 3CU7A 2ADIB 3WFBH 4HMDA 3UTTE 3FOMA 4F8QA 5L2KE 2XT1B 3WSQH 3P0VH 3HUJE 4OLWL 5I74B 2A6KA 1JGDB 3VG9B 2EO9A 2WLYA 3DXAA 1AKJA 4N0UB 1DLFL 1J18A 1V8HA 1D5BB 1AGDA 4PJCA 1DVFB 2COQA 2YZ8A 5JO5B 2XZZA 2QR0A 2XRAL 2DQGL 5EWIH 4LMQE 3GSXB 2VDNH 2HYMA 4F57L 4TPRH 5LAXA 3EKCA 3NTCL 5DHYA 2OR8A 3VXRD 4DKEH 1UXSA 5I6XC 4OCSL 3C8DA 4DEPB 1UACH 4ODSH 5F7DA 3FB6B 1T7WA 1A7OL 4G8IB 2GJ6E 2AKRB 3T65A 1RFDL 1LO5A 4I3SL 3SPVA 3NMEA 4UOW1 4G8IA 4FQXB 1NC2D 3P2TA 4NM8L 1TTGA 4OZGB 1FZMA 2A9NL 3MLTA 4JCLA 3HC3L 2HTKD 3WNNA 3BVNB 3OKMA 5EIIB 5ACZA 4Y4KA 3IDYC 4B0MM 3WHXB 5TDPA 1RZ7L 4OV5B 3SJVD 5C7XH 4HJJL 4JRXE 5D7JA 1I3RA 4D9LL 1BIIB 3D5OF 4A6YH 3GMRB 2X4NA 3QR2A 4DGIL 2EEAA 1IQDA 4MJ5A 5CINH 3FB8B 3FN3A 5HGAB 4HV8B 2B2XL 3TT1L 1NC2B 3HZMB 5C07D 4X4ME 4JY4A 4JZOB 2JIXB 2IAMA 1EHXA 1TTFA 2VB5A 1DSFL 2UWEF 3K0WA 4WWKC 3V4VL 3LEXB 3BPOC 3QO1A 5K9QI 4AT6A 3FQWA 5EUOF 4BUHA 2LU3A 4R97B 3MUZ1 2EDHA 1FFPB 1EXUB 4J3VA 1EEYB 2DM7A 2NXYB 1MAJA 4LVOB 1A6AB 4PRIE 1HYSD 4DQOL 3F8UB 1IGMH 4AEIH 1R3HB 3T77A 1ZT4A 5C0RH 4CW1B 4L5FL 5FYJU 1I1AA 2Z9TA 3N9GH 3G04B 3N1FC 5F88B 3SGKC 3G08A 5I1LB 2E5EA 3L3HB 3BN9C 2OZ4L 4PLKC 4PRAA 1Y6KR 3CPLB 5DJAB 5E4IA 2AJUL 4XNYH 3V4VH 1DANU 2JJTA 5F9OL 1CD1A 5JXED 4IJ3C 3PWNB 2VTFA 1AJ7L 2DMCA 2VIRA 1XGQA 5DQ9A 1KPRA 1MCWW 4Q6IA 3WLBB 2V6HA 4OCWH 5E8NA 1BJMA 1DFBH 5F3BA 2IANA 2I27N 1RIVH 3TO2B 2Y5TB 4ZS6C 5DJ8B 4NO5A 3ULUF 1A3LL 5IM7B 1S7XA 5I1DA 5HD8C 1A7PL 1KTLB 3G6AA 2EECA 5JA9A 4PBXA 3JBG7 4LVEA 3HZKA 5HHQA 4M6AA 4KK6D 1IM9B 4GW1B 4PIRF 1HQ4A 3SQOL 4CVWA 3HB3C 4WFFE 4PLJD 2XTJC 5D5ME 3ELAT 5DK2B 4E0RA 4NRYB 4GKZA 2YN5A 4K07A 5B3NA 5IF0B 3V7AE 5I9QC 1KTDB 1DQJA 4XBEL 5C0BB 1X7QB 1PEZA 4F7TA 4UINH 5I71B 4O4YH 5T3XE 1YYMH 3QEQE 3TIDB 3AB0B 1D7FA 3WNKA 1XGQB 2APXA 5FYJH 2C3HA 2YN3A 3HPLA 4FZEL 1M7IB 3I85A 4EUPB 1SY6A 4M8QA 4PJ9B 2BFVL 2VN4A 3HRPA 5T3XD 2P47B 1R3KB 3P4MB 2JB5L 3C60C 2ZOKA 4F7CB 4QRRD 4J3SA 4NZUL 4X4XA 5J11B 5DHVA 4QNPE 5T1DL 5JXEC 2YEZA 3CK0L 3QDGB 4RCAA 3UJTH 3HG1B 1DLHB 3NCCB 4G8GB 2JJSC 5J57B 1R5IB 4NSKB 4RFOL 4XNQB 3NFNB 2HT3D 5DYOA 2B5IC 4NCDA 3D3VE 3HAEG 5BVPL 4QTHA 4H20L 1BVLA 5GGQL 2IQ9H 3QQ9C 5DS8B 3MA9L 1H3WM 4UV7H 1Z9MA 3SDDA 2V5YA 1CLOH 5E99L 5HYJD 4CJ1A 3TNNB 4KAQL 2IH3A 4KTDH 5H35A 5KSBA 5SWZA 1CT8A 5EA0H 1OAUH 1RK1A 2XKNB 2GFBA 5E24E 3GJEB 4QXUH 1PEWA 4DW2L 2XICA 4HT1L 4WO4C 3S4SG 4F15B 5J3HD 1WICA 1T3FA 2J4WL 4QHMB 3I75A 4L3AA 4BQBA 4OI7A 4G9FE 4FA8A 2GIYA 2Q6WB 1B9ZA 1SVCP 1KIQB 1P2CB 2I26N 5FYKH 5GRVK 2PO6D 1A9BB 1R6VA 3MMEA 1BFOA 2MTPA 1NANH 2EYRB 2E7CA 5DYOB 3F7QA 1I7TA 5E6IC 4EIGB 3WMSA 2FIRT 1CVRA 5GGVL 1F3DJ 3VGBA 1RJLB 5C0GB 2AJVL 3UAJD 4Y1AB 4Z7UE 4UNVA 5EZLB 4E9LA 4NRXA 4PRNB 4D0DA 5C8JB 5MP6H 1A6ZA 5EBLA 1KEGL 3ET9F 4Z7WE 4PJXA 3QULB 4X6FA 1FYTD 3SKUD 3P4OA 2VRAA 5ITBH 3L5JA 3QIBC 5KSBE 2YUZA 1HH6B 1E4KC 3ROLB 3RIAK 1FVEB 3PIQB 4YE4L 1ZK9A 4RBPH 1JZ6A 1D5MB 3ARGC 1BM3L 3OKNA 4HFWA 5ICZB 1ACZA 4XH2A 1QSZA 3TBYA 3MACH 1CZ8H 4J3XA 5I1JL 3BKYL 1OF2A 4FFWD 5J1TC 2EC9T 4HUXB 4XWGL 4YHZL 3IDNB 5FO7B 4HMEA 3V6FB 2ATPB 4GAGH 5EO0A 5DD5H 4WI9A 4IRSA 1EJ6A 4W4NA 3STBA 3EDFA 4P0DA 1FZJB 1T1XB 2BVPB 1FAKT 1YUHA 1KELH 5L7XH 4UNTA 4PGEA 1K2DA 4P9HH 4TTDC 5DRZB 1UQSA 4PY7B 3TJHC 3EDEA 5FFLA 4WHYH 4JFHD 4MCYB 4X4MA 3C87A 1G0XA 1KFAH 3FCTB 3QXAB 3T0DA 1OP9A 2O5YH 5JHDA 3BO8B 5HYQB 3UC0H 4FQ2L 4JPIB 5DK0A 4YDLB 1DL7L 3MLUL 2ARJA 4JFPB 5DSCA 5D6DA 4NQCD 3FRPA 5FM5O 1OLZA 2YKLL 5JW4Q 4AJ0A 1J11A 2W9LA 3PGDA 4XCCL 4ZXBC 1FH5L 1NAKH 3GI9H 3NVQA 2UV3A 5H8DA 43CAB 1NCCH 5GGVH 3SDCA 1WAAF 4PJFB 1U3HB 2F54A 4Q9CA 2CO6B 4XXDA 4G6AD 5D2LA 3LKRA 1ZHKA 2BVQA 4J3WA 3VFPB 3QHFL 4Q0XH 2DDQL 3VGGA 4ZOCA 4EN3B 1Z3GL 2BVPA 5KSAB 5IVOA 1EZVX 3FO1A 3MJ7B 2Q86A 1RZKH 1E4XI 3TPKA 1MJ8H 3PGFH 4X98B 2PYED 1FFNA 1NLBH 4U3XA 1QUNA 1X5LA 3GSRA 5F3HB 1OCWH 3LQAC 3LN9A 2A9MH 5HGAA 1EHAA 4KKLC 4LIQH 3BT2L 2DLFL 4FS0A 1NBYB 1U9KA 4J6RH 4LCYA 4Y16B 3ARGD 4U6TA 3FO9A 3UTZA 4EOWH 2X4RA 3DURA 4JFYA 4P2CG 1WJ3A 5DJ2B 1D9KB 1R24B 4ZUWB 5IVNA 2NY0D 1A6ZB 1ZHKB 5HGBA 1KACB 2OR9H 1ZEAH 4H1LH 4WFED 5I74C 4YUEL 2P5WD 3SDCB 1ZGLM 1YYLH 5DC9B 3VXUB 2A0LC 3HC0B 1CGUA 3V0VB 2R1YA 1EEZA 2IFFH 4LSUL 2JE8A 4G9FD 4Y1AD 1KLUA 5IMLA 4X6EB 2SEBA 3GMOA 1VGEH 4ZPVB 3NCEB 3C8HA 4R90L 3MC0A 1MY7A 3GMNA 3IDMB 5J89A 4LL9A 4P5TB 5E2VH 5CSZB 3QDMB 1QFHA 2ICWB 3WLWC 4L3EE 4NP4L 1N6UA 1N7ML 4P5KB 4PGJA 5BO1H 2IC2A 4P3CL 1MCEA 1MVFA 4YZFF 2IH3B 4OCLC 5H35B 4TNWF 1N2RA 5T1KB 3Q1SH 4XRCA 4M7LT 5CAYB 5IFAH 4X6CB 5E9DE 5EDXA 2XTLA 3REWB 5TF1L 5FGRA 5IQ7L 4OLYH 1SM3H 4XCYB 1OAXL 3OGCB 2R29L 3KPSA 4LGSB 5I16A 1BFVH 3MRLB 3TO4C 1T5XA 5D5MA 2VDOL 1WT5A 2BMKB 3FJTA 2P45B 4RWHA 4J8RA 4MZ2A 4X4XB 4OD2B 3BP5A 1K9TA 3DYOA 5A2JH 2KDGA 3IRPX 1S7TA 4MA1C 5F9JB 3HNVL 4L4VB 4PJ9A 3O3EA 1UFUA 5HVFB 1G6VK 1VEPA 5IVXE 1E28A 1IC5L 5IW3A 1Q94B 2P42B 1G6RH 4NC0B 5TJWK 5IJKA 1IEBA 4U1SA 1A14H 4L5FH 2NY7H 2WBJB 1OB1A 5AZEH 2FHCA 1KC5H 4GKZB 3O6FD 2GT9A 1RHFA 1IILE 1BQHB 1KGCE 3H3PL 2PUQT 4BFEA 3BGMA 2IBGA 3ZO0A 4IDLA 2XTJD 1QNZL 2HFFB 4GW4A 3HMWL 3HPJB 3MRCB 3RNKB 2ZUYA 4M7JL 5SWQA 4C56A 2F5AH 3PQYB 4PLOB 4Q9QL 2PKDA 5BOPA 4JKPH 3GHBL 4DN4L 2CKBB 3P0YH 1F11A 3U4EB 3JTSB 3FL7A 1TQCC 4F8TA 4LLVB 5TH2A 5E6YA 2IPTH 3GZKA 3B6SA 1CDUA 1H9VA 1FPTL 4M7JH 5IBLD 1JUFB 3LN5A 2MQCA 4IMLB 3QXDB 4QY8A 3TN0C 5IB2B 5CZVL 3RWJA 3R0MA 1S7UA 1U91A 1UWEH 2AI0L 3BKML 4GW5B 4OUUB 4TSAL 3MNVB 4WHTB 4DZBA 3WXWL 4YC2C 5AZEL 2C4FT 1F2QA 5D1QA 3S3JA 3QDAA 3MBXH 5JR1H 2VIRB 3DETC 2FHFA 5HHOE 3A67H 1NCTA 2V9TA 1D5XA 1S5HB 4NM8H 5DI8A 2P7TA 2BVUA 2HFEA 2P49B 4NT6A 3F58L 2VLME 3MRFA 5CMAA 5I1GL 1PKQB 5BVJB 2XKUA 5DFTA 4HUWA 1LO4L 3ES6B 4ZTOL 2AK1H 4Q58C 4ZO6A 2VDOH 4XAWL 4HIIB 3CFJA 5D7LB 2VMFA 1EEYA 3BZ4A 4ZFOB 5JIIA 2NY6D 3V6OE 3PWPE 4PJXF 5SV3A 1JRHI 3NFPB 2VYRE 3T2PA 3TWCH 4OGXH 4K9EH 4AT6B 4M7ZB 3LRHA 3NFSH 4LCUA 5E4EC 3KJ6L 2Y7QA 3QUZB 4B41A 2J5LC 5DRXA 3LEVH 4F9LC 2QQLL 3U2SB 2OSLA 2IAMB 3RVTC 2YPLA 2X1QA 1HHKA 4ZOEA 4I48B 4WHCA 3O4LD 5FUOH 2QSQA 3STLB 4I1NB 3WNMA 4MJ4A 3HE6C 3QRGH 4W68A 1E0OB 4PS4H 1V7NH 5GRUH 1F11B 4PRHD 4CNIA 4ZG1A 1MCKA 3SKJH 2W0PA 1I1CA 2DB8A 2XNAB 2NY5C 3JTTA 1XGPB 4KPHL 5INDB 3IJHB 3MV9D 1EAPB 1S7VA 1FG2A 4MQXD 3S37L 1I9JL 2XWJA 4XC1H 3O6LH 3GIVA 5DJYB 2B8OT 2DTSA 3VRLE 5HHPA 1T7ZA 4WW1A 1TIUA 4PG2C 1EJOL 1UWEL 2AI0H 1AD0A 3CVHB 3QUZC 3WS6A 4QRPB 4TNVK 5EOTA 5TFSL 3O3BB 3EYOA 5GRXG 3RJQB 5T3ZE 4HULB 3DTXA 4KK8C 4OZFB 5EU6B 4I8DA 3SO3C 1XH3B 2CR6A 3SDXE 2O5XH 3RWCB 1UJ3B 1GPOL 4EXKA 5C09D 4L9LC 2GJZA 4YDVA 1C5CL 1CDJA 3KLAB 3ZKSD 2ZCHL 4OD1H 5CHNB 4OD3L 3P77B 3MA7A 2PETA 1W8OA 2IBZY 3O8XA 1A2YB 3P9LA 3DVNB 4MLIA 3PDDA 1A5FL 2R0ZH 2MOVA 2Q8AL 2HA1A 2Y7QB 3QUZA 3RZCD 3SDYH 3EOYG 4LRIC 5IESL 3VFRA 4MD4B 2OP4H 3CXHJ 5DHVH 1HXMB 2A83A 1U92B 2CD0A 4TSAH 4P5KA 1RZGA 3V7AG 5IGXL 3ZSTA 3KPPA 3LN4A 4ELKB 1S8DA 4K9EL 2OXGA 1B2WH 3ES6A 4NBXB 5F9OH 4XZUB 1JTPA 4I0CC 1GGIH 3I50L 5FHAL 3U4AA 4ZPVA 1TCRB 3O2DA 1JPFA 5DC4B 3RBGA 2WMPA 1AI1H 3GSOB 1SBSL 4R9HA 4BSWA 4NDMA 1EEZB 2VH5L 4JPWL 4H20H 3NA9H 3IDJA 1BGXL 2MHAA 4DN3H 3MXWL 5JW4M 3V5KB 5IV2B 1NAKL 1X4XA 1H3UA 5HGHB 4KZDL 4HH9A 3ARDA 3KDMB 2AKRA 2X7LB 5HHME 3WFCH 3B4NA 4J23A 1XGTB 3KPQB 3MLUH 4PJBE 1PQZB 5C86A 4CMMB 2HWZL 1KLGA 1AP2A 1KNOB 3OBAA 4KY1L 2EXWC 5B22A 5GS0L 4LNRB 4Q2ZA 3BZFA 4RWYH 3U4EA 1T0NA 5J12C 3S9DB 3MV8D 5AUMA 3FFDB 3SKOB 2DAVA 3F7YB 4PJDA 3V6OA 3TBVA 3T8XB 4UINL 3BGMB 4HPOH 4RBPK 1G7IA 3FMGH 3MCKB 3P9WB 2V2XA 5AWNH 3FB5A 4M7KH 2MPAL 5HHOB 5ANMB 3MRQA 5F3HA 1FFNB 3CH1B 3DMMB 4LCUB 2Q7YB 3CAFA 4OFYD 2LFGA 4Z0XB 3MJ7A 1PKQE 3UJTL 4Z7VA 3W11C 3PWPD 3RGVC 1F97A 4L4VE 2A0LD 1OT2A 3MRPB 5D2NC 1DBML 1LILA 2D7TH 3G5ZA 4MJID 3JVGC 4PTTB 2H2SC 3ZLQC 3X11A 4H8WC 3T0ED 2XIDA 3ZT5A 2W92A 5JW4N 1BOGB 2ATKB 1FL6B 1IMHC 4NT6B 3U82B 1OP3K 3WFCL 4UTBH 3W9EA 4FHBD 2VABA 5DUPH 4Z77B 2YSSA 3KAAA 1VB9A 1QLRA 4POZC 1T0PB 4JB9L 3WFEH 4FXKB 2PYEA 2E9WA 3NA4A 1II4E 3REVA 1MHPH 1EBPA 3ARFD 5C08E 1CTOA 2HJFA 4OF0A 1XGUB 1LP9A 4ODTL 1GGCH 5D72H 3C9NB 4JRXB 1HCFX 1GZQA 3BP4B 1KCRH 4N0RA 3D2UB 1TJHH 4PJDF 1OPGH 1AC6A 1KBGL 2ILLA 4P5TA 5F44A 1NUFA 5J1SC 5I0ZA 5BV7L 1JYXA 3MV7B 4BH7B 3QEGL 5HHXL 1NGXB 3Q6FA 3TBSB 3MCG1 3RQ3A 2BRRL 5FM5M 1H3TA 4X83A 1A9EA 3W2DH 4AENA 4KTEH 4R4BB 3ZYZA 1I9EA 2DQEH 3RI5F 3RVTD 4TNVF 3GMMA 1TJIL 5HPMB 5KSVB 3S88H 3UTSE 3VGAB 5HHVH 3PNWA 3ROOB 2NLJA 3MCLL 2VDPL 3LRSA 1IGIL 3JZ7A 1KXQE 3DLQR 4R4FH 2EDWA 3BQUA 2M1KA 1HHHB 3PHQB 1E4WH 1KCRL 3IVKB 3G5VB 5EBLB 1GGTA 3BKYH 1EFXB 4X4YB 3QPQC 5FXCH 4QXGH 2VQ1A 2UVEA 1HIMH 1QPPA 4B7LA 1HHJB 2VDKH 2BOBA 4G6JL 1HINH 2XOTA 5EZOH 3RA7H 3FO9B 4ZODA 1U8IA 1CFTB 5D1ZC 4RISH 4XXCC 1B4JL 5DD3L 1HWHB 3GJFK 1X6NA 5DEFB 1CLYL 1CU4L 3BISA 2EYSA 4MGXA 1ROWA 3SCMA 3SHSA 2GHWB 3LS5L 3PJSA 4LSVH 4XWOD 1U8JB 4PGCA 1U8KA 3PV7A 3RUGF 2DWDB 3QEQB 1A9BA 1Z2KA 5FGCE 3VGAC 3U30B 1AD9A 4WI7A 5JXAH 1V7MH 3MV7A 3OKLA 4M48H 4OIIH 4BH7A 1H5BC 4M6OL 4Y1AE 2WBJC 4LIQE 1JI1A 4L8DB 4H1LA 4RFNC 4RGMB 4QHMA 3TN0B 5E1HB 3GO1L 4OLEA 4I0PD 1CXLA 1I7UA 4ZPTA 1BAFH 4ZQKA 1JWUA 1QP1A 4EQ2A 5D1XB 1MCFA 3O0RL 32C2A 5GS1B 4PY8J 2DBLH 1CFQB 4RGMC 2VLKA 3L6FB 3TVMB 1S9WA 3IDMA 2OTWA 5IB4A 1I9RH 1RUQH 5HSFA 1GOHA 3T4YA 5CGYC 1XZ0B 4Z77A 2XWTB 4U3CA 3DJ9A 2IPTL 5ILTL 3THMH 4PJ5D 3KPSD 5FK9A 2QQLH 1KV3A 4K7PX 4OZ4B 4R3SA 3FB7A 4QGYA 3V0VA 1CDBA 3EO9H 3GSQB 3BP6B 3SGEH 5D4QA 3FCTA 3QXAA 3LB6D 3VH8G 3X14A 4GLRI 1U2HA 5L6YH 1F3RB 2J5LB 3QIWA 4XX1E 1MIEL 3QDJD 3WFDL 3ARSA 5D70L 5EC2A 4ETQB 2ZOKB 1K2DB 2NTFB 1FNSH 4MNQA 5IEHA 4Z7VF 2NY2D 2RJMA 2Z35B 4RMSA 4UOW0 1Q1JH 2QKIA 2D9CA 1G6RB 3NH7L 1J10A 3JWNC 1BREA 3PDGA 1P53A 4Y5XA 1LEGA 5CJOL 5TPWH 2EE6A 2X2YA 1T7YA 5I0DA 3UTPD 4HZLA 4L29B 4LGPB 1YEDA 4PRIB 1KTDA 3MXVL 5L8LB 4DKFL 5HY9B 1FV1B 3DARA 3I6GB 4OF6A 4RNRA 3GMMB 4RISL 4AEEA 3MRJB 1S9YA 3L5XH 4D9RD 1REIA 1I4FA 5I8EA 5B4MC 4FRWA 3BW9A 4YBLC 1FAIL 2JKXA 3OKKB 1DP0A 3QCVH 2D4FA 5D71L 2VC2L 4R7NB 1U58A 3P73B 4WV1C 5CZVH 5CGTA 1INQB 4PGDA 5IJVA 1KNOA 3HE7B 4RQQA 4IOFD 4JJ5A 5KSAA 1E4JA 2CIIB 4KPHH 4MA3B 5DEZA 4O02L 3C09B 5HXMA 4JFED 5IMMB 2P8MB 1JK8B 3ILQC 4NYLB 4FMKA 4UDTA 4XPAH 4UUJA 2CLRA 5ALCH 5K9OA 2X70A 1TQCB 3HRZB 3MRDA 1F58H 1KJ2B 4P4KC 1A22B 4DZ8B 2BOCB 2IQ9L 3W9EB 1BOYA 1G0YR 4GBXB 4YDKL 4DQOH 2ARJB 3IB4A 3MXWH 3S4SB 3G08B 1FO0H 2NY0C 5F89B 4JLRA 1AXSB 5IFHL 3B5TA 4OJFL 2NY4D 2GK2A 1DBBH 4YEEA 5K9QG 3I75B 5CGYD 4NYLA 4NO3B 4GG6A 1RIVL 3O4OB 1HHGB 2Y4SA 3GBLA 4ZDHA 4P4KA 3SBWA 2VKWA 1TENA 3QUML 1AR1D 1CICA 4NC2B 4IHOA 4OLYL 2CH8A 3C60B 3KLHD 3CDGA 2VQUA 3BH8A 4B50A 4U1IB 1EZVY 2H8PB 4DUXA 4FQLL 1MJ7H 1VENA 5TE4L 5T5NF 4DCQB 5EU3A 4BFBD 5C0FA 4I18B 5E99H 3SCMB 5GS0C 3BD4A 1MLBB 5D7KD 2WUCL 5IEKB 1OT1A 2FNBA 3LKSA 5KSUA 3EZ8A 1I3RB 3A6CH 4YDIL 4NHCH 1VKXA 2VWEC 3X12A 5I1AB 3GSUB 4LCIL 5SWSA 2A77H 3QI9A 2ESVB 4LSSL 1M1SA 1HEZB 3I6KA 5C3TA 5GRJL 3K8LA 4CMMA 3O3BA 1OVZA 1EJOH 5EOTB 3LKOB 4YHOH 1KUMA 4U7KA 2NTFA 3L3OA 2C4FU 4LPUA 1FRGH 1NGZA 3QG7H 1CXHA 4XB8A 3IJYB 2ZUXA 3TCLB 2XZCH 1N59B 3D69B 2HFGH 4NZDA 2R4RL 2ZCLL 3IDUA 3FB6A 1AY1H 3VCLA 3UTOA 2HMID 1RUML 4JO1L 1ADQL 5ISZD 1BF2A 2HWZH 2X89A 4K3DH 2UZXB 4N9GB 2X4SB 2A38A 3MYZA 4MHHG 1MCBA 1CXIA 3IXAB 1YEGH 3TJHD 1CFSA 4BSJA 3CUPA 5GGTH 4O2EA 4PJCB 5E5UB 3KPTA 4PJ7B 3W0WE 5J6GB 1F4YL 3S37X 3S8WA 2VZ1A 4Y0GA 4HD9A 1QSFA 3QFJA 1W72H 1TPXC 4BZ2L 3QI9D 2C3GA 5DJ0A 1VEMA 3KYAA 1LD9A 1IZKA 2HG5A 2X4PA 3P3YA 3QH3A 4LKXB 3P4LA 4ZAKA 3T2NH 4LCWD 4BUGA 4YR6A 4K94H 2HVKB 5FYKU 3N0PB 5IBUB 1LVEA 4I9WD 4F33A 3FT4B 5JZ7D 5DRNB 1K5NA 3O2VH 3VW3H 4OF5A 1N6QL 1HOCA 3DYPA 1YEEL 5I1LA 2DIAA 4G6ML 4QRTB 2HTLC 3LD8C 3O6FA 4YLQT 1KYOJ 4P9HC 3MO1A 1UJ3C 4S0SD 4BH8A 5GZOD 3TO4D 1U8IB 5I1HH 2F9BT 4MAUH 1FN4A 4OFKA 1MCCA 2ARWA 3VD3A 1A4KB 3MRKA 3MUGB 3D39B 2BHYA 1FFPA 4PD4K 2A77L 4LSSH 3VXSA 4CL7A 5C0DB 3MZGB 3U0PB 4XBGB 1TDQA 3FO0H 5IT2H 4HDIA 4ONHA 3A6CL 3BD3A 4KTEL 1E6JH 4G7YL 2EDNA 4KROB 4PJ8B 5GSRB 4MD0A 5C9JB 5DD0L 4YXKL 1ORQB 1KEGH 4C83B 5H37G 5TDOA 3GSWA 1JHLH 1U8NB 4NCC2 2V2XB 4LVHC 2R23B 3AGVA 5D96C 4YPGA 1U8HB 5HHNA 1WTLA 4GRWE 2GTWA 1A64A 3RL1B 1QVOB 3B9AA 4LARH 5DJZB 2VLRB 3RIAF 2WBKA 4S1SL 4EUPH 3PQYA 3T4AB 2VDKL 5IR1B 3OJDA 1P4LB 5K59F 4ONGH 1PG7W 4C83A 1J5OH 1XGUA 4PJ9C 5E9DB 5J4MA 2PXYA 5BJTB 5E4EB 5D7SH 2PW1B 4EI5D 3WLBA 1NDMB 3RWFA 3FFCA 4L4TB 5DQ9B 3MLZL 1QZ1A 2KUTA 3LSOA 3ZDXE 4CVZA 4KZEH 3S34L 5ALBH 3K4ZA 1H3PL 3Q6GH 5C6WH 3WXVL 1OAYH 3V8OA 2AVGA 2IBZX 3MLRL 4J8RB 5HYSA 4JKLA 3U6RB 3QEHB 1WZMA 2VR4A 1A5FH 2R0ZL 4KZEL 1H5BA 4PJHB 1YZZA 4U1KB 3VRIA 4EEEA 4KK9D 1VA9A 3SE3A 5DI8B 1VCAA 1EMTL 2UZYB 2BSRA 3C5ZB 3QHTC 4CMHB 4MXVE 5D7IA 2NY3D 3VG0L 3ZZ1A 4PJBA 4BM7A 1RJZA 4ZS7H 5I9QB 5D1QB 4MD4A 1NDMA 3HB3D 2DM2A 1G9ML 4MXVF 3MOAH 3F7PC 2CDGB 1IAIL 3BKJL 2VXTL 4E42B 1YEIH 1ZAGA 4M9PA 3L9RA 3QWOA 1OSPL 1NC2A 3L3GB 5DURD 4JFOA 2NXYD 1MJJA 5DJXB 4YO0B 2EH7L 3A67L 1FFOB 3UDWC 1WIOA 3GMNB 5JHDE 2JB5H 1IKFL 1YECH 1WBYA 2FJFA 3T08A 4MXQD 4DOHE 3NABH 1U36A 1XEDA 2NYYD 1WFOA 2H32B 3P11H 5EUKA 2Y5EA 4GSDL 2OTUA 2XZAL 2K1MA 5EOCH 5KVFH 5ADPH 2P46B 4NKIL 2C3VA 1FORH 3FT2A 4L1HA 1BZ9B 2GSIA 2DBJA 1X44A 1YQVL 3GIVB 5DJYA 3SDXF 1J0KA 5MEQA 3MR9B 1NGWA 4WHYG 1N5AA 4ONGL 4RGOL 3PP4L 2XWBB 4NDMB 2GW5A 3D1MC 3HMWH 4PGZA 4LPCA 2OYPA 4FQQB 2ESVA 1ZLSL 5HDQL 1O0VA 4L8SA 4MDJA 4EUPG 1W72A 2B1HH 1FFOA 3TO4B 4PP1D 3VRLF 3P11L 1J05B 4HKJB 4LBEB 1KG0B 3HMXH 2WM0A 5HDBF 5I75B 2W60B 5LCVH 1D5BA 3CMOH 3W11D 5F7HA 4Y5VB 3T0WA 1YQ2A 4X6CA 3WS3A 1OSZA 3BAEH 1MOEA 3SGJA 4IRZL 4K8RC 1S78C 4YHKH 4JM2F 3SDAA 2FB4L 4XVUC 4Z7UA 3GRWA 3B5HA 3PF2A 3OAZH 1TNMA 3T04D 1K8DB 1WAAA 3KYNA 5C3LD 5I6XB 3BSZL 4WV1B 3QDMA 4YIQA 5DR5L 2OL3L 2NQCA 4R0LB 4F7MA 5ILTH 1CR9L 4UDUA 5BRZE 1HINL 4HFUL 5TFSH 1N0XH 1WSST 3KXFB 4AL8H 4MB5A 3UZVB 1PG7H 1D5ZA 1YY8A 4LASL 5EU6A 5I75C 3LEYH 1CXFA 2PXYC 3AXLA 1S5HA 1L0QA 1KT2A 4NWUL 4PJIF 2FWOA 2HT4C 4JFFD 4JPIA 1UM6H 4N90E 5I1JH 3S98A 4JAMB 1RZ7H 2X70B 1A1OB 1Z5LB 3EZJB 1PKOA 1UM4H 4HCRL 5CILL 5D8JH 3RWFB 3SDDC 4MCYA 5EOCJ 2EC9U 3CLEL 3CDCA 2DJ4A 3DIFA 1KGCD 3KPLA 2AQ2A 4F37F 3IAGC 4PYHA 5HGBB 4WRLA 4PJEE 4S1RH 1FC1A 1N26A 5FIEA 3LKOA 3NCBB 2OMBA 2A73A 3TA3C 5GIRB 4PS4L 4IJ3B 1OAZH 4XNZB 1CE1L 1OARL 3MV11 8FABA 3VFSB 3BPLC 2A1WL 3GSUA 4HG4J 3OKKA 2E7HA 5GHWH 4MJ6A 4OCNC 3HPJA 3MRCA 2FH6A 3IFNH 2CXGA 3U4BH 1SJVA 1RUMH 4P4RA 3AB0C 1PZUB 3OKOA 4IOSD 1DUZB 1EHLL 2Z31B 3BYTA 3C8KB 3O11B 3ARFA 2R2EB 1U0QA 4R7DA 3QBTB 4QCIB 3CC5A 3I84A 2NXZC 3U36B 3WO4C 5C9JA 5HGGS 3HE6A 4JDTH 1NC4B 5IHUH 4HC1L 1AE6H 4PBVC 1JPSH 3V52L 2AJYH 2FO4B 4LSTL 3MRIB 3C60D 4JZJA 2QKIB 5JORA 3GNMH 3VW3L 3G6JE 2APWA 5EC2B 4D9LH 4LVNB 4MNHB 4GKNA 1CGYA 2DQGH 5CBEB 2ZCKH 4QF1A 3QIBB 4G6FD 3DHJA 4P23B 4RMWA 3SGKA 1ITCA 1SYSB 4MJIA 4I3SH 4JN1H 4ZFZB 1IL1A 3OGCA 5ERWB 1HNGA 1PX4A 1QO3B 4PP2A 1K5NB 2R69L 4ISVA 3MGOB 2ITDA 4PJ8C 2Y6SD 4NOFA 3RU8L 4APQD 4HUNB 1T2QL 1PBYA 1M7DA 35C8L 4LLDA 1XCQB 1Q72L 3INUH 3H3BC 5D7JD 4TTDD 4HPOL 4JFQA 1LO0L 1KIQA 3DGCR 1XF5B 2AABH 3VXMA 1MFDH 1I8LA 4NKQB 1YEGL 5CZKA 4P2OA 2MPAH 3QA3B 3VXTB 2P48B 4BA8A 1DQLH 3LS4L 1T80A 4AMKL 2OMNA 3ARED 3BKCL 5T1MA 4K3EL 1EGJA 3FONB 3WS6C 1UH2A 2WWMD 5I8CA 5FGBC 1U8QB 1EHLH 2IGFL 2V7HB 4R96B 4OJFH 2EZ0C 2EEBA 3U0TA 2ATPA 15C8L 2B20A 3V6BR 5KSBF 4M6NL 4YZFE 1VPOH 2DKMA 3W9DB 2BY3A 1QRKA 4JFZH 4PJAF 4JFFA 3NA9L 3RKDD 3QWRD 1JZ4A 3U79A 4Y4HA 2ZNWA 2YHGA 1MCPL 1WISA 3HS0A 3KVQA 3CFCL 4WFFD 2GJJA 5FOBA 2OK0H 3MZTA 5JOFB 2VZSA 1A7RL 2Y6SC 1BD2E 3V0WH 1XGRB 5GRUL 4PTUB 1C5BH 2BOBB 4C58B 1UWXH 4HEME 2X4QA 1YMMD 2AAVA 2PTTB 3ARTA 5INCA 3PV6A 2Z35A 1ZGLP 4JKWA 1R0AL 1KJ3H 1H15B 1HHHA 3NPZB 2E9IA 4JFXB 1XGYH 5GSVB 4PJ5A 3QIWB 4F9LA 5C09B 3X14B 5H94B 4FABL 3RY6A 1LWRA 2BMKA 4FTVA 5D72L 3H9HA 3ARFB 4R3SB 4Z7OE 5AYUH 4FNLH 2Z4QB 2EDYA 2XWTA 3Q6FB 3TBSA 1EO7A 2DQIL 2CMRH 4NQDD 2P5EE 4KMQA 3RIFK 2V7HA 1BZ7B 1QFWL 3EYQC 4MAUL 3D2UD 4TRPH 3B3IB 4LCCB 1CK0L 2XN9E 2FZ3A 5I2IA 5IW6A 1GZQB 4NZRH 1GGUA 3QPXH 4JO3H 1DZBA 5C0CB 5FHBH 3MV7D 15C8H 4TVSa 4HW6A 5E2TH 5E95B 2HN7A 1L0YA 1BD2A 1ZHNB 1F4XH 1H3GA 1IQWH 4U0RB 4FABH 4AYFA 2JTDA 5DMKA 3OGOE 5DTFA 4K3EH 1YPZA 3VFGL 1M6OB 4QNPF 1CGWA 4UIKL 5I19L 3KYOA 4O2CB 4KRPD 4AMKH 1LO3H 2FEEL 2ZUSA 4YC2B 4HWBL 1U8JA 4CGTA 1ZV5A 4F80A 2XY1A 4YHLL 1R5IA 4NSKA 5JHDB 5DC0A 2BXYA 4JY5L 2VKXA 1I3UA 4KRMB 3CFKA 4MB3A 3RX8A 4KRNA 3NIGF 3FO0L 4HK3J 3TBWA 3GKWH 5IT2L 5CBEA 1OQOA 1JZ8A 4G5ZL 4PY7A 4WV1A 3O45B 4W6YB 4EQ3A 3NPSC 1KEMH 1RZFL 4PJ7E 1UWXK 4QOKA 4Z7WA 4Y88A 5C9KA 4ORGA 5EOCL 5KVFL 1MI5E 1G7LA 4WWID 1XF3B 2R1XB 2HVJB 4GRMA 1JZ7A 4NN5C 2UWEA 1M05A 2C9AA 3WS3B 1QFWM 4BK5A 4JG0H 1AO7E 3ZKMD 5ICXA 4XX1G 1JGLL 1T0MB 5D9SB 3QWRA 4M3KB 4AM0A 1N6VA 4MAYA 2Z31A 5TE6H 3W5NA 1Q0YH 2J6EL 5CIPH 1J8HA 1SY6H 2KH2B 5F1OB 3WD5L 1QACA 4TN9A 5D9SA 4OZFH 3CSYA 5IB3B 4MJ6B 1JBJA 4G9FB 3Q3GB 4XT1C 4HPYH 3BIKB 4X8XA 4BK4A 4JO2H 1EV2E 5KW9L 1B4RA 3WHXA 4OV5A 2OJZL 2Q86B 5CEZH 4P2QE 1M7XA 2EXYC 5D2NA 4WI6A 2Y5TA 2GTZB 2XA8H 3D39E 4N0CC 4OZGA 4LPYA 1F4WL 4N1EA 5FOJA 5D2LB 3MODH 5MENE 3VRJA 4JPVH 2CGRL 4U1HB 1VADB 1ZT1B 5BZDB 4JM2C 5EU4A 3ETBF 2FB4H 3CDFA 1U41A 3TYFB 2W65A 2BY1A 1BZQK 2IPUK 2ITCB 3QDME 1A1OA 4YXHH 2IALB 4LOUD 4YK4B 1A7PH 1MCRA 1NMCB 1QLFA 4NN7B 1P6AB 2ZZUT 3MOBH 1F6AA 2VLJD 3PWPA 2NY2B 1DBJH 2CDFB 5EN2A 3TV3H 4KK5C 3DVGB 5I1CL 4QLRA 5A43C 3DROB 2WANA 3CVIL 3T4YB 5LAXB 5KVDL 1HILB 1MJ8L 4U1LA 4HS6A 5TQ2L 2BRQA 4M6MH 1GSMA 1R3HA 4U4BA 3DRTA 1LDPL 1ORSA 2CKBH 1CFQA 2FLBT 2J8UF 3VXUE 1MJUH 3PHOA 3RZCC 5IHLB 3KYKL 3AS1A 3WFHB 3DX9A 3VD5A 4ZFFA 4JGUA 3JV5A 1CTNA 1U42A 4TUJB 3VWJD 2BCKA 5CJBA 3ULVC 1AR1C 3MUJA 1RJYB 4NO0B 3FQWB 4RX4A 3TNNA 3I9GL 3EFFA 4PJAB 4XCNB 3GIZL 2W9EH 5TDNA 2O5ZL 2VISB 3CVHL 1YMHB 3BPCB 1FVCB 2AQ3A 2XI9A 1CDHA 4HIEB 3TC9A 3HCVB 4JY4B 4XP9L 3CLFL 4M02A 1NFDA 4N8CH 3C6SA 4P9ML 3FB5B 2L7JA 1A6UL 2CLVB 4DW2H 2EKJA 2FSEA 1BBJA 3HG1A 4G8GA 3SY0A 3B43A 2H1PL 3RWCA 4HS6B 1CN4A 3IGAB 2QV2A 4X8JB 4YHIA 3ZMRA 4P4KD 2NW2B 4KUZH 4Y4KB 4LOUC 3FRUA 1U8OB 5ECJE 1Z9LA 3L7EB 1H0DB 2FDBP 1NAML 1YPZE 2VAJA 3EYOB 2BZDA 4ELME 3NCFB 4NWUH 4BFIA 4CVXA 3HPLB 4MA7L 2FBOJ 4APQC 3NCYP 4LFHD 3TYFA 5EZLA 3VA2C 4IS6A 1RZIA 5HVWA 1X7QA 1JN6B 3I02A 1RUKL 5IF0A 1UADC 5HPMA 3EW3B 4BQ9A 2Q3AA 2CDEA 3VFOB 3BMVA 2KQNA 3BGFC 3HUJB 5DUML 4OQTL 2D9QB 5KJRH 2J1KA 4P5TC 4Y2DD 4JN2B 5E2JA 3W9DA 1MREL 3K81A 5LQBH 3HLAB 3MMEB 4OM0L 1J0ZA 4JHAH 2FATH 4N5EC 3CU1A 4XZUA 4NN6B 2XQYK 4LF3A 1MJJB 5DJXA 1BAFL 4QWWD 3VFWB 3WO4B 3LN4B 4BQ6A 4ELKA 1TLKA 4R4ND 1WWWX 3EDJA 1HHKB 3TV3L 4GXUM 5E94A 5D5MF 1PYWB 3S36L 1U6AL 3H3KA 5DHXB 3ZHDA 2DYPB 2UWEB 3X3FH 3O9WA 2Y36H 3QUMB 4R2GC 3X13A 4RGNE 4JPVL 1CBVH 1H3XA 4YGVB 5IMKB 3B9KD 4QTHB 2XN9A 2R29H 5C0IB 2YC1A 3LMJL 1DE4A 1E4XH 3L3HA 5DD1H 2HH0L 2CUMA 4PUBH 3DUHA 3QUYD 2YUWA 4ZYKB 4HUWB 1DLHA 1CBVL 4YHMH 3U6RA 5SX4I 1IRAY 4PLKD 1P84J 3UZEA 4GKNB 3S88L 5IFJA 1I3VA 2H45A 1ZHLA 5ESQB 4M03A 3P4MA 5DVMA 1P7QB 3TPUA 2UUDK 5HDLA 2I9LB 3EOBB 4QRPA 2MCG1 4OCXL 3EOAA 2WUBH 3V8CA 4EI5C 1S7WB 4KKBC 3MJ8A 4G7VL 4PRDB 1C7TA 3DMMA 2GYSA 4CN6A 3K1DA 3WNLA 3C2AH 5CEXA 5HI5D 4ZAKC 5MEND 1A3RL 3CSPA 2WZPD 5KS9A 1KENL 3B6SB 1A3QA 2H9GB 1MWAB 2DDQH 1XF2A 2WK2A 2R1WA 3HE7C 3RUGA 2I60H 3GMRA 3SO3B 5GRZA 1Q38A 2VWEE 3FHAA 4YPJA 2Z92A 5DT1L 3ULUC 3GI8L 2BVTA 1SMOA 4OCSH 4N1HB 4YBLB 2VAAA 3VXSD 3FQNB 1R3JB 3AREA 3FQRA 2R23A 3MTRA 2Y1VA 2IANB 2ORBH 3GO1H 1IAKB 5CEXB 4LIQL 1IGTA 2X7LA 4HG4K 1MWAH 4PRDA 1QFUL 2Q76A 1U6AH 2LTQB 5GGRY 1DQLL 1ZANH 3R06A 1ACYH 4OTXH 4V2CB 1NPUA 4XBGA 3VXSB 1F4XL 2PO6B 3GSOA 3QQ4A 4XMKH 2NNAB 3V2AR 4FQ1H 3QPXL 5JMOC 4Y4KD 1S7QA 4Y5YC 4OV6F 3IGAA 4S1DD 5E6IA 1C08A 1OM3H 4WIQA 1G7HA 3ZDZE 2MSPA 1RSFA 1Y0LA 4QRTA 2OJEA 5E2UL 1NUNB 1DVFA 3QI9C 4QRQB 5IHBA 1BBDL 3VXQA 4KROD 3C5SA 4ODWB 1NFDB 3PWUB 4Y2DA 4ONFL 1FDLL 2DTML 4R2GD 1LNUB 3DXAB 4RFOH 2OX5A 4XCNA 4PJEB 4R90H 2B2XH 4LEOB 1N2RB 3QUXA 1M4KA 1OTSD 3SDXB 3E6HB 2CLZB 2DQFA 3ZT7A 3S5LB 4P99A 5GGVY 2HJKA 1KN2L 4X7EC 3MGAA 1R0AH 2QJDA 1NCWL 1CLOL 4GMTL 5J11C 5GZNC 2WUBL 1ORSB 4FFZH 4P5TD 4Y2DC 5IQ9B 1KEML 1FBIL 1RZFH 4ELMB 2QQQA 1YEHH 3CXDH 4JG0L 2JCCA 1LE5A 4QOKD 4QXGL 3DVFA 4NWTH 5JLZB 4E41B 4MVBC 2OK0L 4YWGH 3MV8B 3L3JA 3E3QC 2SEBB 4HJJH 3BVNA 3WUWA 4NO2B 1RURH 3L5WB 4X99A 3RVWC 2D4DA 1QLFB 2WAHA 2AK4A 4ZFZA 1NGWB 4P23A 4P3WA 3QCTL 3QUYA 3PL6C 3BZEB 3I02B 1MCOH 3TF7C 4JQXC 4FQCL 4UUJB 4XMPL 5J12B 3P4NB 2J8HA 1S7SB 5BV7C 3L3KA 5I19H 4HXAH 3O2VL 1AY1L 5BCAA 1LE9A 1WEJH 5ADOL 3BRFA 3QT2A 1N8ZB 5DHYB 1HEZA 3RY5A 5I1KH 5DUBB 4XBEH 1MEXH 1PAMA 3A6BH 4OCWL 4RGND 3PWJA 1FRGL 4I5BA 3UO1H 4LCYB 1QBMH 1OGTB 1ZANL 1OAQH 3MLWH 1CGVA 3HR6A 3SY0B 4HGMA 1TVHB 3I3DA 3UCRA 5H2BA 4XPGL 2CMRL 4B53A 4JFOB 3KPSB 1CCZA 1E6OL 3L3GA 2V17H 1IGYA 1MPAH 1U8LA 1MCDA 2X1XR 5C0FB 4X0KA 3ULVD 4NUGH 3EDDA 1JE6A 3TZVB 3HCVA 1J88A 4NOBA 4KI5C 4LCWE 4HAGA 5HYJA 3QRGL 4WEBL 3S36X 1ZGLA 3BXNA 4U6HA 3EFFB 4G5ZH 4YXLL 1UEYA 4TQEH 1JNNL 4HS3B 4OF3A 3U48A 2GK0B 1MSPA 1IC7H 1CICB 1ZVSB 1MEXL 4RMUA 2GSGA 5IEHB 4WNQA 1FZOA 2H6PB 5ITFA 5AYUL 4BSVB 4P49A 5DJDA 5CEYA 3CZFA 4QXUL 1HI6A 1MCSA 2ZUUA 3ZE0F 2ICCA 1CL7H 2JJTC 4WW2A 1T4KB 1WWBX 3P0YL 3PGDB 4KROC 2E6PA 3GK8L 5FCUL 2ICWJ 1MCOL 4J7RA 5FK9B 2J6EH 3WD5H 3DVGA 2IAMC 4Y16D 2HFEB 3IT8D 4HGKC 3MA9H 4S2SA 4PRBB 1FPTH 2MQ3A 1YY8B 1T6VN 4X5XA 2BSSA 5JW5A 2BSTB 3WN5B 3MV7E 5BXFB 2IALA 2NX5D 3D6GA 3PXJA 5EA0L 4IDJL 1VADA 2FR4B 3WV0A 4WO4D 2NX5E 3WN5C 5DEGB 1YUHB 5CLWA 4C59B 4MA3A 3E1F1 4M7LL 1T1WA 3MACL 4G43A 4I13B 4M6NH 5IIEA 2VXSH 3F62A 2F19L 4JFZL 4LLVA 5TH2B 3VFUA 1EHNA 3SKNB 4DFIA 1WT5C 1JNLL 1KN2H 4LPXA 3BXNB 4U6HB 4FQIL 3TESA 5KANG 1ES0B 1ONQA 2YPVH 5SWQB 3IFOB 1JPGB 1QBML 1DN2A 1J1XH 2DD8H 4M1DL 4P2OD 5IGXH 3S36H 1QSEE 3L1OL 5E9DD 2K7PA 4OLUH 2WIIA 1J05A 3Q0HA 4M5YL 2IQAA 3KPRE 3FTGB 2UY6A 5DFVD 2QQKL 4WI2A 2YD6A 3OXSA 4XNUH 5EU6D 2WW8A 1S5IL 3NIDE 4IRJB 3MJ9L 4YGAB 2ERJC 1EFXA 4X4YA 2QSCH 5FUCE 4GUPA 5J0BA 5DMJB 3O3EB 5ESAA 5CBAA 3KXFD 3K2MC 2X4QB 1T89A 3MUGA 2X1OA 3H7BA 2RR3A 3VDBA 4EOWL 5D93C 2E8YA 4MX7B 1KB9K 1BZ9A 4KKNA 1U95B 3VMPA 3QUYB 2PO6C 2CK0L 3VI4F 3WBDA 1DEEB 3ZDYF 4GAFB 2JELH 3IRZA 4O5LL 3L5WA 1A6TA 1K6QH 4LGRB 3HE6D 5HYEA 4LQFH 3QRFM 1FHGA 4F37K 1KTRL 5BMFL 5E00B 4NUJB 4WDIA 1ND0B 1I1FA 3F6LA 2YD5A 4LP5A 5I8CB 2AXJA 2WBJD 4OGYL 2BX5A 4EI5A 4G80A 1ZA6A 1ZEAL 4NKOB 5KSAD 1EA9C 2XQYG 1WAAE 2NY3C 3FQXB 3QCUH 2RHEA 1JGVH 2FO1A 4TOYH 1JNNH 4U31A 3E6HA 5FB8A 5BRZA 5KG9A 3WUZA 1FGNL 3L3IA 4N1CA 1HSAA 5DD6A 4R4FL 4DEPC 1IM3A 4JFQB 2LABA 3IXAA 2H26B 2OR7A 1QOKA 2D7OA 2FGWH 1FQ9C 3BYYA 1QPXA 4WFHE 2DMBA 3GMOB 3QDGE 3KNBA 5JDSB 1OGAD 4L4JA 2VOTA 3UZQA 4QRQA 1X5IA 1G7QB 3QSKB 4MSWA 1N4XH 3QAZC 2VSCA 4XH2B 3RVUC 3TBYB 5ICZA 1U95A 5FECA 1IKFH 43C9A 5DK3A 3SGDH 1JTTA 4ODSL 4DGIH 1CFTA 1ODAA 1YEJH 4M6ML 4J1UB 1Q9KB 1P4BL 2IJ0C 4OB5H 5GSVA 5FA3A 3G5VA 5L9DH 4X6CF 1P5VA 2AV1B 1GOFA 3VXMD 2VDRH 4JRYD 4XBPA 5EZOL 2EIZA 3QI9B 2A9NH 4HSQA 1OM3L 1FIEA 2B7DT 2Z91B 4NIKB 3O6MH 1INDH 3D3VD 5IB5A 4OLWH 4LCWB 1ZMYA 5C0GA 4QCIA 4RGOH 2WIIB 3EO1A 4PGBB 5FHAH 1OW0C 4X0KB 4WFEE 4XWGH 3KJ4B 5J56B 4UTBL 2I9TB 4NQTA 3GRWL 4U6YA 4DCQA 1INDL 1HQ4B 5AAMA 5IR1A 5HHQB 3T4AA 5AAWA 4U1JB 4M48L 4OIIL 1TJIH 3U0TB 5EU5B 2O5YL 1T0NB 5DA0B 4GKOA 3BH8B 1S9XB 4LVHB 2Q6WA 1F4AA 4ENED 2EIBA 4F57H 1FH5H 4NO5B 4Z5RB 4U2YA 5CD3B 1B88A 4Z7WF 2PW2A 3B9KA 2KBGA 1NCWH 4EN3A 4ZD3L 3QJHB 1VGEL 3VFVA 3NOIA 5DEGA 2E7LA 4W70A 3R0NA 3HMXL 2AJ3B 1UG9A 3KDMA 2RFXB 1LK2A 1L9NA 1MQKL 1SM3L 4PJFA 3SEPA 3RA7L 3TA3D 1CFNB 2P8LA 4C55A 1AGFA 4GG6F 3C5JA 4MMXC 2NXZB 3QFDB 1KENH 3BEWB 2AW2A 1HYSC 1J86A 3WUWB 1IGFL 5DR5H 3VGEA 2OL3H 4P3CH 2EICA 1QO3A 3ZYJA 2NY1D 2EDDA 3MXVH 3I2CH 2DQHH 5E5MA 3BDYH 1KB5A 3BWUC 3X11B 2GAZB 3QIBA 4KV5F 2XZAH 2YEZB 4DFHA 2P8MA 1HOCB 2VITB 2FBJH 4WTZG 4WU7B 5K93A 3T0XA 1A1NA 5E7BA 2AP2A 4GS7B 5BW7C 3IKCB 4QRPD 1CF8L 4OB5L 3O4OC 2M8XA 4HS3A 4RQQB 3TH2T 4Z7VB 3QH3B 3SDXA 1TZHA 2J8UA 2NW3A 1IAII 1AFVL 1RULL 4ODUB 3B9DA 4ODHL 5JMRA 1WCBA 2RQ8A 3O3DA 4MNQE 4M4RA 5TE7H 5HYJB 1JHKL 2B5IB 5F7LB 1YEKL 2J6EA 2JIXD 5KOVC 3AAZB 1OAXH 4RFEB 2HT2D 4ONOA 3CSBA 2C1OA 1VFBA 2OR9L 4PJFF 2OJEB 4ODTH 5HI4D 1AO7D 3KLAA 5IFAL 2F5BL 4FXGA 1A7QL 3OWEA 1CGSL 4YNYA 1OPGL 1OGTA 4OI8A 2ZWLT 4GBXD 1Z3GH 1BWMA 8FABB 3HZYB 3RZCB 1XF4B 2V2WA 1CG9A 1ED3A 5C2BH 2UZIL 2OXHA 3S35L 2VSDA 3QG6B 3KGRA 2CIKB 3KPQA 1WF5A 3JWOH 2YWZA 1MVUA 4CADB 1JF5A 4PRNA 1A4JA 1E6OH 4TTGA 5CP3A 1AO7B 4N8VB 4PJIB 2JK5A 2OCFD 4QXTA 5DZOA 5LBSH 3QQNA 3VE0B 2F58L 2XWJB 4OM0H 1UZ6E 3ARZA 4G3YH 3GSQA 5HHXH 1WGOA 2AEWA 4BFIB 1IBGL 1BJ8A 4X7TB 5B39G 3GJFB 3FQRB 1MHHA 4Q9RH 3L3JB 2FX7L 5IWLA 3K46A 4GLRH 5F7EL 3C08L 3CZJA 1S3KH 3QUXC 4ESKA 4BJLA 2YD9A 5M7QA 3T77B 3PWVA 1BBJB 2R1WB 1MFCL 1O7SA 3RVWD 3FO2A 2H9GA 3MPCA 4F2MB 2VO5A 4PY8I 1VFBB 2G60H 1NGYA 5EBWA 3SCMD 4KK6C 4JZNA 4L8CA 1IC4H 2GUOA 3QJFA 1FVCA 1GL4B 3KS0H 3Q48A 4WFHD 5GISL 5IVZB 1WCBB 4WW2C 4H1LB 3FFCE 4KJQD 3A6OA 1KCVH 1MNUL 2YRPA 2YPLD 1YC7A 3QP3A 4I2XB 2W0LA 2DD8L 4M1DH 2BSRB 3C5ZA 2IMMA 3GM0A 2FH8A 5TE7L 3WEXA 3O8XB 1K3ZA 4FXLA 3PHOB 3DRQB 4KK9C 1BLNB 3TBTA 4MJ5B 4ZO7A 1QHPA 1GIGH 3D9AH 3VGFA 5DEFA 2HKFL 1NCDH 2A74B 1CICC 1J0YA 1PKQA 3UTTB 1IGFH 3QDGA 2R0KH 2F19H 4BQCA 1T2JA 4KK8D 4PV8B 1HHJA 1D6VL 2AJVH 2V17L 3HA0A 5C0IA 1OD9A 1PSKH 5CZXC 2W9DL 3PWPB 1RJCA 1KPUA 4QOKE 3KPRB 1FZMB 1KPVA 1GGIL 1TZIB 2R39A 2BNQD 2DJSA 1L7IL 3O0RH 5C0CE 4TYUA 4XP5L 5GS2D 3ALWA 3SE8L 3DGGB 5T3ZH 1LO5B 4XP1L 4AQOA 3ROOA 1YNTA 3ARQA 3EFDL 4NQEA 1A3LH 2YXMA 3AS3A 1PYWA 1IFHL 5L6YL 1V3JA 2ZCKL 2X4OA 5F7DB 1OL0A 1W72L 1B2WL 2WQ8A 5DK2A 3S6CA 4G8EB 3BP7B 2P5ED 2NYYC 4JJ5B 3KHOA 4EI6A 1T1ZB 5D2NB 3RDTA 3ZHKA 4OFVA 5T5NG 1FL5B 1KFAL 2CUIA 3WDJA 4A2LA 4QO1A 1CK0H 2QL1A 1JVKA 4G9FA 4M43H 3HLAA 3N50A 1GC1C 4KGLA 4NQDA 2X44D 4OCRH 3EHBD 1MY5A 4FXGB 3RNKA 3RY6C 3EYSL 2IFGA 5E2TL 1K85A 1U93A 1S9YB 1J8HB 3EJZD 3HUJA 5DWUH 4QHUB 4OZIA 3L9RB 4PRPA 5JPMB 5TDOB 2RAMA 4N0FA 2WWMC 5CFHA 1HXYB 2BJML 3OV6A 2EIZB 2Z93B 4RA0C 3MLWL 1BVZA 3JUYA 4J12A 2HFGL 1ADQH 1ZT7B 2GKIA 2A6DA 2EH8L 4U1GC 4HCRA 5JOPE 2HRLA 4WTXA 1UKSA 4Y5YA 3NAAH 1MFEH 4PRAB 5DJAA 1G7JB 2OJZH 1I75A 3MRRB 3U9UA 4AQ1B 4I3RL 2DQJL 1I9IH 3ULUL 4K7PH 2LAGB 4PJHA 2JJVA 5E8PA 1IT9L 3ESUF 5TQ0L 4W6XB 4ZYKA 1BWWA 1HH9B 3QNZB 4OLVH 4C54A 5L8KB 5GGRB 3PABB 4UIKH 1TMCB 3X3GH 1A6AA 3KWWA 3VG9C 3N9GL 1SJHB 1NCAH 2PYFB 4KMTH 1A6VH 2Y23A 1YMHA 3HUJF 3KYMA 4JANA 1CFNA 2P8LB 3VGHA 3T0BA 1IM3B 1NC4D 1S9WB 4M4PA 3O41A 1RAMA 2EH8H 4X6DB 2CO7B 3NZHL 1FL3B 1RZJL 3BDXA 1LK2B 2ED9A 5EC1B 5D1XA 4R2GB 5A2IH 2VDML 3LN5B 4QHUA 4OZIB 3QUKA 3CUPB 1OAKL 1JGVL 4XNMB 2AJXH 1XIWB 4J4PA 5HVHB 2VDRL 3OZ9L 3U7WL 5I8OH 2F53D 5EU7C 1B6UA 1RZKC 5LXGL 4UNUA 1RHHA 2G2RA 3TWCL 2FJHB 3HKFA 3H2WA 3QZWG 4HK0B 5C70A 4IM8A 5DMGC 5KBNC 3MLRH 4MD0B 2WQRA 3OAYH 2QTEA 3ISWA 1L4IA 4QXWA 4L3CA 3OKYA 1K4DB 1AHWA 1Q94A 4KHTL 5ICYB 4UOJA 1G7MB 1S9VA 3RWDB 3RY4A 1IZJA 4MDIB 3TEUA 1EIBA 1FGNH 2BHZA 2R9HD 5MEPA 4XVTH 1UM5L 3T0EA 3LRSB 3OXSB 3U0WL 1I8KA 5JOFA 1MI5D 3Q3GA 4NZUH 2A74A 1P1ZB 3MV01 3CFEB 3KPRD 4YHLH 3UPCA 5IEKA 1MFNA 1X5ZA 1KN4L 1XR9B 3KPPB 4HHAA 4UIMA 4Z18A 5GS0D 5FDWB 2K7QA 1T21A 4F33B 4ZUVA 2E9JA 1JPGA 2YUVA 1PY4A 3AAZA 3TA3A 3X3GL 2HJLB 4KKAD 1KB9J 2Y07H 1ZS8A 1ES0A 4ZOBA 1A02N 1M05B 4R96A 2R4SL 1HSAB 1E27A 4OGAC 2X9YA 3BIBX 1FE8L 4ZNEA 3GGWA 1EGJL 1Q8MA 5DF0A 5J6GA 2D3VA 3NZHH 1I8MB 2MWCA 3LKRB 3VFPA 1HE7A 2EDJA 3RFZC 4G8FA 4NQSA 2E6JA 3P77A 5A2KH 1UWGL 2QADD 4DN3L 2WWKT 3VXTA 4LLMB 4DVBB 3D0LA 4N0UE 3OF6A 1QSEA 1JHKH 1AXSA 5JNYA 3CGTA 1BHGA 1DQDL 2A6JA 1M7DB 3PL6B 2DF3A 4H5SB 3SJVB 3L95B 1SMAA 3C09C 1QSFE 3QFJE 3VG0H 5FYLL 3SDCC 1F6AB 3DX6A 5DA4A 2P5WB 3SDCD 4D2NA 1ZA3A 4M6OH 5HHOD 2R1YB 1DEEA 1AGFB 5EB9A 4M3JA 4URTB 1AD0B 2Z31D 4P2YA 3V4UH 4QF1B 5K9JL 1H8NA 5LCVL 5DMKB 4WU5A 4JDZB 5D1XD 4NN6C 4DKEL 3WNPA 1D3CA 3DO7A 3O2WL 5ITFB 3MRPA 1CU4H 5F7FA 4PB0L 5IJVB 2FATL 4NQXB 4PLNC 2EEDA 4Z0XA 3JVGA 2V9QA 1U2CA 1OTSC 1NC4A 2AEPL 4JDVB 3UPRA 4OBRA 5E2WH 3IF1B 25C8L 2XXCB 5D2LE 4HX1A 3WYRA 2LV4A 1FSKB 1T22B 5EORL 2VDPH 2MCPH 2W38A 3H9YA 4LU5H 2OSLB 1Q0XL 3JV4B 2H8PA 1ONQB 4KJQC 4IRZH 2P8PA 4KXZI 3LKPA 1AQDA 4JE4B 5D7KE 2E27H 2V2TB 4J2XA 4LNRA 4I0PA 1XF3A 2R1XA 4S1SH 2NW3B 1V7ML 4XAKE 1SVZA 4RAVA 3CDYA 4NNPH 4NQDE 3ARBB 4QOKB 1CGTA 1NCBL 2D03H 5T5FH 1A1NB 4Y19E 5EH1A 2FR4A 2PCPA 4NRXB 5C0RL 1AGCA 5JUEH 2E8ZA 4HIHA 1EK3A 4JKPL 5C0NC 1A6UH 1UWGH 3V5KA 1CL7I 1YYLL 4MSWB 1PG7L 5EZJA 3P30H 1LMKA 3TFKC 3L5XL 1EGJH 4NFDA 4BSWB 2IF7A 3AM8A 3DX6B 1KC5L 4HWZB 2FECI 2IADB 2RB8A 2AERT 5JUEL 2KL6A 5KS9E 1A7NH 2YRLA 4LLYB 5JLZA 2I24N 4Y19A 3SGDI 1LQSR 3KYOB 1A47A 1HQRA 4CKVX 5D8JL 4YBQD 2YKLH 3L3IB 1FNGB 3DX8B 3RL2B 5B3JE 3OXRA 4NUGL 4BZYA 3V7MA 2XPGB 1S8DB 4JFEB 4OUUA 4DZBB 5T1MB 1Y6MR 4FQ1L 4OZGF 3FN0H 4JJHA 5JXAL 4PGEB 1OCWL 4ZPTB 3WFDH 4UV4L 1MFBH 5FKPA 2A83B 3T1FA 1JZ5A 3V52H 4FFWC 1AQKH 1JFQL 5K33A 3SDAB 1T7XA 4NUJA 1KCKA 5JPNB 4HC1H 4ZO9A 4PJEA 1TITA 4RZCB 1XCQA 4K9EC 4F7EB 3PGCB 4OKVA 4WWKB 4ZTOH 1B4JH 5I8EB 5DD3H 1J1PL 3VH8B 2ORBL 3PWUA 5IP4A 1XR9A 1HIML 4M93B 1OP3H 2XQBH 1RUQL 1EMTH 3ULSB 4AH2A 5F7EH 4HGWA 4LPVA 5C1MB 1OWRM 1C8PA 4GAJH 3IU3A 5EZIH 1KIUA 3GI8H 5I76B 5H94A 1QSED 2R69H 3EYFB 2BDNH 1FNEA 4I77H 4XWOC 1N7MH 3LEVL 2D7NA 1H15A 4YBQC 4XC3L 1PSKL 4JG1H 3TFKD 4PJXB 5JORB 1SJEB 5E1AA 2NY5H 3CNKA 2VJXA 2MFNA 4DVRL 4N0YH 3VD7A 1MAMH 2CRIA 1OGAA 1GIGL 3D9AL 2E27L 2GSIB 4HK3N 3W2DL 1AH1A 7CGTA 4F7TB 2C3VB 2X4UA 3FT2B 4NCC1 4OSUH 3T3ME 1DQJB 2HRPL 4F9PA 1FG2B 3BN3B 1G7QA 4KQ4L 4MMZC 3TNMB 4LSVL 2ICEA 2ENYA 3HFMH 4AENB 2G2RB 3QCVL 3QDMD 1L0XA 4ZTPH 2NXYC 4K8RD 1WBYB 4WO4B 2YS4A 4KI5D 3CLFH 3ESVF 5ADOH 4S1QH 2ZJSH 2EYTB 4NKIH 1V3LA 1G9NH 4XNMA 4XP1H 3GMLA 4OQ1A 4NQVA 4OM1L 32C2B 4K55A 1VFOA 1MCPH 3C9NA 4JRXA 5KS9B 4JQVC 3LAFA 3N1MC 1DQMH 3DV6A 1TPXB 1G6RL 2DL2A 1ZA6B 5A1AA 1B3JA 1BM3H 2Z8VC 5E8NB 1OARH 1I7UB 3GSNB 4MNGA 1FP5A 3SDDB 4YHKL 2QHLA 4XVSL 2FECL 4MYWB 1AD9B 2BSTA 5E5RB 2B4CC 2HJLA 2HKFH 2VLRD 1JWMB 5F7NC 2PYFA 5EG6C 2NZIA 3CH8A 3MV9B 5ID0B 3G6JB 4KY1H 4MQ7B 4NN7C 4MAYD 3PXHA 3HC0A 1SYSA 4L4VD 4MJIB 2OI9B 3ZYOA 4U1GB 3QEHA 1TXKA 3PE9A 5E6IB 4P2QA 3ARBD 2HMIC 4PTTA 5SX5H 4FNLL 3T0EB 3MRFB 3U9UB 5EZIL 1K8DA 1A14L 2ZCHH 4LAQH 3QQ4B 2OLDA 1QFWH 1U8PA 2X05A 2A6DB 3UX9B 3VJ6A 4Z7UB 3UO1L 3E6FB 4YFLF 3LQZA 4K94L 4GAYA 5T1LA 4L3CB 1X5JA 5KN5A 1CZ8L 1FVDA 3MNVA 3K8MA 3MROB 2ZSWA 2Y72A 2BNQE 2DQUL 5C0CD 3ME0A 4CU8A 3V5DB 2R4RH 4H26B 1JV5B 3V0WL 3WE6B 4LPWA 3S3PA 3OJDB 2YWYA 3UBXG 3V9FA 3BGAA 4FZ8H 2VLJB 4HUVB 3V79C 1MHEB 2NY6C 2X1PA 1TVBB 1KCSL 1S7XB 3IFLL 1PZ5A 5HI3D 4TRPL 3WJLC 2NY3B 3M45A 1CDYA 1L6ZA 1RZJH 3RUGB 3TJEH 1KELL 4G6FB 5L7XL 5IROA 4EI6B 1GC1L 2XFXA 1P7QD 2XWBA 4YDLC 2P5WE 3OJMB 2X4TB 4M1CC 1XR8A 1C5CH 1LP9B 3NIDF 3BJLA 4NHCL 3F5WA 2ZUWA 4OD3H 2XZQH 4KV5E 4PJ8A 5GSRA 3DIFB 1Q9LB 4KC3B 2E7BA 3KR3L 2WV3A 4NJ9L 5MHSD 5IV2A 5L88L 3RDTC 4YJZL 2ZG3A 1E28B 1NFDE 3QEUA 4JFFE 3AUVA 1DFBL 4OGZA 5C0DA 5EUKB 3N85L 12E8H 3MYJB 2RIKA 4JFPA 3BP5B 3ZKNC 4OD2A 1OY3B 5C6TH 3G04A 5F88A 5KVEH 3GSXA 2W1NA 2J8UE 3QIUC 3O6LL 1QSEB 5FUCC 2DLHA 1JNHA 5CGMA 4QRUA 4D3CH 5GRYA 4JEGB 4Y5YB 3WEXB 4YFLI 2VR9A 1ZVSA 3D18B 1RZKL 2HVKA 2CDGA 1MI5A 1C12A 3BHBA 1YN6A 3X13B 1ZT7A 2H3NA 2P24A 2BP3A 5SWSE 4DKDC 5LJYH 5E2WL 5IKCB 3QO1B 1EEQA 5DFVC 4YDKH 1C12B 2ADIA 3U46B 1O7VA 1EUTA 1N6QH 2GUOB 4N0FB 4ZUVB 1FYTB 5I73C 1MRCH 4JZNB 1K3IA 4EJ1C 3G5XB 3PWVB 2AQ1A 5DQJA 5HI5C 3FFDA 4M1GH 4H25A 2F15A 2NZ9D 4NQCB 1KN4H 4UT9L 3VXNA 3HR5A 3L3DA 3LV3A 4P57B 1I7RB 3CD4A 5EO9A 1HZHH 3MSPA 3QQ9D 4HIXL 1DBKL 3ZYIA 2E3VA 1QR1B 3ZKND 4D8PA 2F8OA 1LK3L 4B5EA 1ZT1A 2HT3C 5BZDA 4M5ZH 3BQUC 4C4KO 1A4JB 1EBAA 4TVPH 1I7ZB 1R3IL 2YK1L 2EIDA 3IDJB 3SQBA 4YHPA 1UKQA 4I4WA 2VL5A 3IJHA 4KI5E 3WJJA 1KPUB 3L7FB 5DJ2A 3G6JF 2LVEA 4LAJH 5KW9H 1LK3H 4PB0H 3FQNA 4D9QD 2ADFL 3FRUB 1T66C 1W0WA 4PJ7F 1DVFC 1LP9F 1CQKA 4Y16A 2JCCB 2XA8L 3UTSB 1MJUL 4RDQG 1YEHL 3CXDL 5AZ2L 4JRXD 1DN0B 2DQEL 5GGSA 3ARUA 1T20B 3GSNL 5JTWA 1CT8B 5EBMB 1NMAL 1FYHB 2VR5A 4LQFL 5MEOA 4PJAA 3LQZB 2FEDD 3WL9B 4K7PL 1NH6A 3HNSH 4MZ3A 5DS8A 3WIIL 5A40E 2G9HB 2ADFH 4MWFA 5C0AE 1P7QA 5J7CC 2MJWA 1BFTA 1NSNH 4L8CB 3CFJB 3OB8A 1WBZA 1C16B 2FIKA 4R8WH 5MENB 2UUDH 1JNHB 4XGZB 2VH5H 4JPWH 4K94C 4DAGL 4PG9A 3MRGA 4GRWH 2CRYA 4OZHE 3M8OH 4ZOAA 3EOTL 1OTTD 2CDFA 4MAYC 5EN2B 1MHHB 4MQSB 3WXWH 5DSCB 3GSNH 2FYYA 3B2VL 4TVPL 5HDOA 5CIPA 4PRHE 4DVRH 4O58H 5DMIL 4Z7OF 5C08D 4XPGH 2B1AL 4M8VA 3OHXB 5CCKH 4JHAL 2Z93A 1F3JA 4XPTH 4EDWL 4L4TA 3TLRA 1EAJA 1Q9LA 3O4LE 4P46C 1QKZH 1S7UB 1U91B 5FV2A 2QHRH 1MVUB 4CADA 3DBXB 1XIWC 1XCTB 2NY0B 5I8KL 5KVGL 4GQ9H 4PJ7A 3C6LB 2X4TA 5LKNA 2DYPD 4KKCC 5C0EA 1YY9C 4K7FA 4EDXB 2R8SH 4UQ3A 4NQVB 4LCCA 4APQB 1XF4A 2V2WB 3OX8A 2JELL 4IRSB 3CFDB 1OGAE 1PZ5B 4WY7H 3KPMA 1NMBH 3VWJC 4YX2H 4HF5H 2C3WA 2Q7NA 4EIZC 3O2DH 1FL5A 2FEDC 5DJ8A 4KQ3H 1XF2B 1JV5A 1F00I 3STLA 5HDBE 2R9HC 3W0WB 3HNSL 3WIIH 2VZUA 3EO1B 4PGBA 5LGJA 3I6GA 3QDGD 3MROA 4DKAA 1YEDB 1QBLL 2F58H 1JN6A 2X4UB 1JTOA 5IOPB 1FVEA 4PJ5B 4ODUA 2VLLA 4NQUA 3TGXA 1HH6A 4Y5XB 3O6FC 3PWLB 5FO8A 3QUXD 4CVXB 5D2NE 1OWWA 3K80A 3PV6B 4ORGB 4KFZC 1ZLSH 1W0YT 2N7AA 3D39A 3L5IA 1DVFD 2APFA 3MOAL 2FGWL 3I6KB 2DQHL 4HLJA 1NANI 1NJ9B 1D6EB 2PNDA 4ETQA 2HH0H 5B8CC 1SY6L 1U8OA 2YPKB 2EKSA 2APTA 2OQJB 2IG2L 4P48A 2PTUA 3TBTB 2HP4A 1RVFH 2NR6D 1VHPA 4K3GA 2BVOA 4WENB 5EU3B 2D7MA 3HFML 4HIEA 4IMKC 3K4AA 1I1RA 4F7EA 4TUOB 5E8DH 1SBBA 3DETD 3GMQB 3VGDA 3EYSH 5IB4B 4FFYH 4G7VH 2OTWB 5JPNA 1YPZB 1FCGA 2YA0A 3OG4B 3MFFA 1YECL 2R2CA 1ZLWH 4XHJD 2BC4A 1XAUA 4XVJL 5IB2A 5HJ3A 2ICWA 2M2DA 2AABL 4JREC 4RRPG 3D85D 3PP3H 4JGJA 2VDQL 5KSBB 2HLAA 3OAYK 1IGJB 5EU7E 1GH7A 3VXRE 2XKSA 4HKBA 1TETH 1GYAA 2DWDA 1IVLA 4XP4L 1T03L 4KJWD 2B1HL 2HT4D 4OM1H 3HI1B 2BVOB 4OAWA 5DGQA 2QQNH 4OI9A 3U4BL 4GS7C 4KMLB 4UAOB 5FEBA 2B0SH 1JP5A 3SPVB 1T6WA 4H0HB 2UVFA 3HZVB 2IMNA 1OLLA 1VFMA 2RBLA 4KMTL 2E7MA 2WP3O 4ZUUB 2ZPKH 1IGIH 3H7BB 4PD4J 4PREB 4EDWH 4L4VA 4LSDA 3MFGB 5JXEA 3MRBB 1TTUA 4P2OC 3BWAA 1DL7H 1JPST 2NW2A 1FNEB 3K74B 1AIFA 1AQDB 1AXTL 3LKQA 3C2SA 5FECB 4G6JH 3EHBC 3VU2A 3CC5B 1S7RA 3U36A 5LGJB 2QR0B 1KJ2L 2FSEB 2CLVA 3RIFF 1L7IH 3T3PF 4RMTA 4XPFH 5J1AA 4AIOA 2APBA 1JWSB 3PGCA 3HZKB 4RAUB 2OZ4A 4PRIA 3UBXA 3EO0B 3QHFH 4JDVA 3GBMH 4IBLT 4ZFGL 1MCNA 3OX8B 1S3KL 4LKCA 4XMLH 4P46D 2R56H 3SE9H 3FONA 3C5ZC 1GC1H 2X1WL 4LSRL 4UB0H 5DRWB 4ZDHB 1D9KC 3BMWA 3O45A 5F7MC 4DWHA 4C56E 5DO2C 4WU5B 3ZDZF 1RQ5A 5JW3L 5ESVB 3O81A 4E5XB 3BP6A 2YXFA 2ZG1A 5F1IB 2DLFH 5DVLA 1FC2D 2ZUVA 1JGUL 4XVJH 4JFHE 5F8QC 3O4LB 1W2KT 4FQJL 1F8TL 4H5SA 3PL6A 1C1EL 3C5JB 3RWEA 1UXWA 5C07B 4DZ8A 4Z6AT 1CFVH 3VFNA 1MWAL 3FZUC 2Y25A 3MNWA 1EFQA 5F6HI 1TETL 1RIHH 2IANE 3UP1A 1HYRC 4F7MB 2EE2A 4U49A 1G9NL 1JK8A 1FNHA 5DJDB 2B0SL 1BD2B 1ZHNA 1F5WA 4GXUN 4GKSB 2AK4E 4FG6C 2P5EB 3NCYS 4LRIA 4MD5A 5TGBB 2NTSP 3QJHA 5L2KA 1DBKH 1WCQA 3LQAL 3TN0A 1RIHL 3C5ZD 3H0TA 5DVOA 2Q87A 5T1DH 1X5YA 4KRPB 3ARGB 1E27B 3UTZB 3S96B 2VN7A 4U3HA 3LEXA 4K3JH 3QEQA 6FABH 3CSYB 2YD1A 1B6DA 4KKAC 1AXTH 2W0FA 1IFHH 1BD2D 1VDGA 2OS7A 3MRJA 1WZ1L 2YPLE 3CLEH 5KVEL 3WDHA 5E03A 5DZNA 5D7JB 4OCXH 4KAQH 3HMXA 5F6IB 4JFXA 1HKFA 5I1GH 3T0VA 1N8ZA 4AK1A 1U8PB 1PQZA 3U1SH 1QD0A 5FA3B 4MD5B 4JKMA 4ZUUA 2ED7A 2XN9D 1RI8A 2O5XL 3P4NA 3TBWB 3MV9E 4IRSD 4LSQH 43C9B 3MJ6A 4Z8FH 5FGCB 1RJLA 3QXTA 1XF1A 1HHIB 5FCUH 5EO1B 2NY2C 5C0AB 1QRNA 1ZA3B 1UB6B 3M17B 3RPKA 5DUPL 5FV1L 2H32A 2VE6B 3HI1A 3MCLH 5JW4R 1D9KD 3VXNB 4YHOL 2KZWA 2JCCF 1LO0H 3GM8A 2FJGB 1D5IH 4FQIH 1P2CA 1P9MA 4CN4A 2A9ML 4JO3L 4OQTA 3BX7C 4PRHA 4ELMA 4HBCH 3JV6B 2QADC 4ERSH 4LLMA 5C7XL 3D2UA 1KSRA 5EPMA 4MCZA 1UB5B 2CPCA 4YIQB 3ECBB 1BVKA 4QHKI 5I1CH 4JZJC 3KYNB 4JVPA 1P69B 1YN7A 1UCBH 5MHSE 2DM4A 1G9MH 1JWUB 1FYTA 4JO4L 5ALBL 3T2QA 5I18H 3P9MA 3NIGE 5B4MD 1U92A 1T1XA 1F4YH 4JGMA 5GGQH 5HBBA 4RDQF 2XACC 1NMBL 2EDFA 4YX2L 3GMLB 1ZOXA 2J7LA 3O2DL 4JRYB 4JKKA 4X4ZA 1OTUD 2NMSA 3KLSA 3CCHA 4JANB 1NQBA 3FAWA 4PJHE 4TUOA 5FYLD 3BUTA 1A2YA 1N5YH 5I66B 3MA7B 4IRJC 5EU6E 3PABA 1Z6JT 3I6LE 2EYSB 3WKNA 5E8EA 1CE6A 1OOAA 1D5MA 1ZHBA 3LKQB 2N1KA 2EDKA 3PIQA 1FNAA 4P46B 2IPUG 3WIHA 5FGBA 1NGQH 3P4OB 3EOTH 3UJJL 4X6FB 4A6YL 4BZ1H 3B8SA 4GRWF 4FTVE 2V5SA 3OQ3B 7FABL 4DGYL 5D7IE 5IOPA 1VFAA 2WIMA 5IBTH 2PW1A 4S11A 3V4PL 3PP3K 3BGFB 3DECA 5KSVA 4P9MH 2V5TA 4G6KL 2GJ6D 4LHJB 1WZKA 5L2JB 4R4BA 1A0QH 1I3GH 3BPNB 3HN3A 2FJHA 5J3HC 3E3QE 2XNAA 2PTVA 2R4SH 5AZ2H 4KU1A 4FQHB 1F42A 4WEUD 5GGUA 4NHUB 1MHEA 3BZFB 5GXBB 3QXUA 3VFSA 1BQHG 4NQCE 5LGHL 1Q0YL 4UU9A 4ZUTA 3EJZC 3SKNA 4APQA 2HLAB 1Y18A 1NMAH 1U8HA 3QYCA 5HHNB 3D0VA 4H26A 1N4XL 4U0QB 3K2UH 3VWJB 2CR3A 1ZE3C 2B1AH 5JIPA 3DBXA 4N5ED 3MBEA 5JQ6H 2HJFB 4JFEA 5IG7A 1LO2H 1FL3A 1JYWA 4G6KH 2Y07L 3MFFB 4PPTA 1Z5LA 4MXWH 1F3JB 1NLBL 3E6FA 4M5ZL 5A3IC 2H1PH 4LVOC 4PJAE 1WLHA 3H42H 3BH9B 3VFMA 5I1HL 4XXCA 3CPLA 4Z7VE 3D3VB 4NKDB 1MPAL 3EUUA 5IFJB 2YD7A 4W4OC 3NPSB 1JPTH 3BPLB 3UJJH 1A6WH 1HH9A 3QNZA 5FA4A 3O6ML 1G7HB 4WW2B 1RZ8B 1Z0MA 2FLRT 3H42L 1S5IH 2ERJB 7FABH 5GGTA 5IVXB 4M61B 3VXME 2DI8A 3DRQA 4LLQA 1D6EA 3GK8H 5DRNA 1RIUH 4WNQB 3GBNL 4MVBD 3RWHA 3ZSSA 4YGVA 4J4PD 3MGTB 3ARBA 3VFGH 1AQKL 1JFQH 3WL9A 5K9JH 3TN0D 3V5HB 3R06B 4I0PB 4NFCA 4W4OA 3VFRB 1MREH 4GO6B 2PXYB 1G1YA 4AL8L 5C0BA 3ALXA 1BIHA 3J7HA 1QTYT 3RVVD 5JPMA 3DV6B 3C8KA 1JUFA 1FNLA 1R5VA 4WI3A 4Q0XL 2XG5A 4XP6L 1FLRL 5H2BB 1R3JA 3AREB 1T1YA 1F4HA 4Z7QE 3MLYH 1A0QL 3LKNA 5SWZD 1UJ3A 4HXBL 3EGSA 1KTLA 4MDJB 3PWJB 4TVPE 4OGAD 3DTXB 5E70A 1IAIM 3NABL 1BQHA 4K7FB