4M61B

Crystal structure of unliganded anti-dna fab a52
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
220
Chain Sequence
EIQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGKINPYYGSTSYNQKFKGQATLTVDKSSSTAYMQLNSLTSEDSAVYYCARGRLRRGGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab A52 light chain
publication title Crystal structure determination of anti-DNA Fab A52.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B02
2XKSA 1EAPA 4KHXL 1D9KC 4FQCH 1SBSL 4LPTA 3BMWA 5CEZH 5CJOH 3T3PF 1YMMA 4TUJA 4FNLL 1H15A 1OSPL 5I75C 4PJ9C 4FQHA 3W5NA 2ADFL 1ITBB 5DDHA 5DQ9B 5GZND 1KPRB 3ZKNC 2XWBA 5JMOC 5IB3B 4OQ1A 3BXNA 12E8H 3RTQD 5ESAB 4HUVB 1BBDH 3HE7B 1S7VB 3L7FA 1FORH 3UAJC 5D7KE 1OTTC 1V8HA 1MY7A 1JF1B 1FBIL 3HCVB 2NY4B 1RUQL 2JIXB 1PBYA 1E4WL 2Z93A 3DYMA 4ODUB 3HHRB 2CD0A 1MH5A 3HNSL 2XZQL 1CXIA 4OKVA 4POZD 4ZFFB 1ITCA 3LV3B 1GPOH 3HI5H 3KS0H 2HAZA 3P9LB 3CFEB 3Q3GB 5F7LB 4IEFB 4IJ3C 3D0LA 3RWEB 1O7SA 4XVSL 5F7WC 4WFGD 4HWNA 3T2QA 2X9WA 5J13B 4WI8A 3IU4H 2YPLB 2DWDA 3RNKB 3FO1B 3KYMA 4WFHD 3KXFA 3VCLA 4OD3H 4ZO7A 1S7QB 4L3ED 4Q58C 1AO7D 2ICWA 3A67L 1QBAA 4HF5L 4TVPL 5DD5L 4CVZB 3GBNL 1NAMH 5C08B 3AREA 1YQVL 1N64H 5DJYA 3VFNA 4X7CC 2HLFC 3DSFH 3QEHB 4LSSL 4AEHL 5MEOA 4B7LA 2VWEC 3IGAB 4NO3A 5CINH 2FRGP 1CE1L 2XWJA 1AIFB 5BXFA 2DLHA 5D1XC 2ZUYA 4QRTB 3D3VA 1A7PL 5C09E 2Y06H 3VA2C 3KLAB 4NO0D 4UV4H 1VFBA 3ORJA 1AI1H 5CGTA 3B83A 1DBAH 2HMIC 1KCSH 1A3RH 1T1ZB 4CKVX 3RAJL 1NL0L 5GGTA 3SGJA 4PG2C 3BAEH 3NABH 4K7PY 2CO7B 1PD6A 4NNPL 1TDQA 4KKAD 2YRLA 3PGDA 1N4XL 1JUFA 5AZEH 1OSZB 1VADA 3RPIA 2Y36L 4R4ND 3X13B 5SX5H 2ENYA 4L8SC 1IL1B 1NC4D 2VDKH 1UQSA 1W0WB 4ETQB 1FG9C 3BEWA 3PP4L 2Z35A 5DMIH 2Y72A 3QXDA 3QH3A 4ACPA 3K3QA 3UC0L 1T5XA 3EDJA 5DJZB 4DAGH 4QWWD 5BO1L 4ZFOA 2FHCA 3ULUE 4X6DF 3QAZC 3WIHH 3GSXB 1X7QA 3IDYC 3W39A 1FFQA 2XFXA 3QJFA 4PRHD 5CSBA 5IT2L 1VFMA 4WW2B 3RWDB 1TJIH 1YEIL 3VG0H 4K3JH 3WNKA 8FABB 4NRZA 2QLVB 5F44A 3DVGA 4L9LB 3MLVL 5HYJB 4V1DE 4HWBL 1QPXA 1CS6A 4N0FA 1MFDH 1YNTB 2VQ1B 1AQKH 2YWZA 1TLKA 5IJVA 2MFNA 3OJDB 3UBXG 2QBWA 1J8KA 5DJXB 4UT6L 3SKMB 5ICYA 1KFAH 4JY6B 4OLEA 2AGJH 5C6TL 3O9WA 4P4KA 3MRGA 5AYQA 1TZHA 3MV7D 2NR6C 3QDJE 3STZA 4MXVE 3UDWC 2WBWB 3FKUS 5F7FA 5GGUA 1QNZH 1KXVC 3TM6A 3WUWG 3CFCL 1Z9MA 3W82A 5FYKU 3GO1H 3VFTB 3HB3C 3W9EB 5EC2B 2A74A 4GKNB 5LWYL 1FLTX 5EFIB 4CMMB 1I8IA 4ZOCA 3ARQA 4OF5A 2UZIL 2BNQE 3T0AA 2OLDA 1Q0XL 3MRQB 4NBXB 3MLTB 4ZUSB 1MCFA 4RMVA 2CJUL 1OAUL 1TFHA 4FHBD 3V4UH 4HBCL 5ERWA 4HUKB 3HPJB 3D69A 5FDYA 1A14L 1EO5A 4NKOA 5HDLA 2F8XC 4MAUL 4UILL 4ZODA 3D2UA 4AT6A 2H41A 4XCFL 2I25N 1YECH 3MNVB 1YMMD 4ODBD 4CJ1A 3PGCA 3LKPA 3RI5F 2F74B 3G5YA 3ARWA 1FVEB 1GZQA 3ARVA 3QXUA 4OM0H 4FQ1L 3RIFF 4YHLL 4JQXC 4YXKL 3SDXE 1QFHA 4PJ5A 1VA9A 4YBQC 4A2LA 4EOWH 3FZUC 1ZVSA 3NCFB 4M8QA 3NZHL 1D6VH 2EDKA 4FQIH 1MAKA 2IG2H 3ES6A 4MA7L 3KPLB 1U3ZA 4Y5XA 4U1KB 5I1GH 4RMUA 4GG8B 4RFNC 3GSNB 4HKJB 2X4OA 5EO1B 1CR9L 4IMLA 1XF2B 1FNGA 4GS7C 1KF9B 4X8XA 4M1DH 2GJ6A 2WINA 3QIBD 3O2WH 4F58L 3QUYB 4Y16B 1T83C 5AUMB 2MMXA 5IVZA 1W72B 2IMNA 3NFSL 1OCWL 1PZ5A 5HGDB 5T3XD 2VLME 2SEBB 1FHGA 1IVLA 1GHFH 2Z31B 3NTCH 4TUOA 1HHHA 1RIVL 1LDPL 1JGLH 4R4BA 4LLDB 3ULUH 3KXFD 1CFNA 3PWPE 3ZKMD 2AJZB 2ZCKH 2DI9A 4OLUH 3BP6B 2YPLE 3RQ3A 4NRYA 3RZCC 1I7UA 1G7IA 5CILL 3TBVA 4Z76B 2OR9H 4JCLA 1NUDA 1SY6H 3ARED 4X6DB 2A9NH 2GEEA 3EYVA 5FCUH 3SKOA 4EBQL 2J3SA 2X7LB 3S3PA 5DMKA 2O61B 5JORB 3WHE1 5BS0E 4ZPTA 3D3VD 1FNAA 3RX5A 5DHYB 4LGSB 5E9DB 5HHQA 4YHOL 4OLXL 3WKNA 4G5ZL 1FO0B 2VL5B 2C3HA 3R0MA 4BQCA 2FX9H 4U1LB 3VMNA 3MOAH 1M4KA 4OSUL 2FL5B 1FZOA 3WYRA 5D93C 4KZEL 5DZLA 4IRSB 2UZYB 1D6EB 2XNAB 3K8KA 4QRPE 3KJ4B 1A7RL 5HVHB 4S10A 1U95B 1JNLL 3QPQD 3EJZD 2YXMA 1B4JL 5J9PA 4LSRL 4K71B 4NM8L 2BOCB 5DFTA 3VXRA 5B3JE 1AXSB 2AJYL 1NDGB 2W65B 1MAJA 4F80A 1R0AL 1F11A 4OFIA 1TPXB 4M5YH 1DSFH 1ZVYA 1F4HA 3ZDZE 1XAUA 4QHLA 1YY8A 3CLFL 4QTHA 1ND0B 2PXYA 3UX9B 3N9GL 5D70L 2ORBL 2OSLB 4YE4H 4YDKH 4Y4KA 1JV5B 1S7WB 2BVEA 1FYTB 4QRUA 2YC1A 5ITFA 3AS0A 1N6QL 3FB7A 5E00B 4XH2A 5LAXA 4I5BB 1VB9A 4P3DB 4ZXBC 1UVQB 9CGTA 5EH1A 5F97E 1BPVA 4FFWD 1WAAE 3ARDC 4G8IB 3C5ZB 1LO3H 2P24B 2R0WL 3TBSB 1MCKA 3BPLB 4WNQA 3O0RH 4U3XA 4I3SH 3C5JB 3FONA 2R56H 4PJGA 2ZKHL 4QTIL 1FVDB 4P4KD 3EO9L 1EZVX 4XRCB 1IAII 3P30H 2XA3A 4QHKJ 3AY4A 3VXMA 1IC5H 4MSWB 5C0RH 4HK3N 4RDQF 1B6UA 3P4OB 4JDTH 3VH8G 3WL9A 1IFHH 4NHUA 2EDQA 4LAQH 3GNML 2J1KA 3MLUL 2EO1A 2MCG1 5EO9A 2A1WH 3RY6C 1J0JA 1BFOA 4A6YL 5L9DL 4ORGA 4XPBL 4PB0H 2H2SC 1MCLA 1B0WA 1S9KC 2MHAA 1AGFB 1E4XI 5KSAA 3VXSE 1QHOA 1NLDL 4PGBA 3BPNB 4R3SB 3F7QA 3D2UD 2QSCH 3WJJA 2FYYB 1NCAL 1NH6A 4WW1A 5H37G 4Y4FB 1NEZG 4QXTA 1TJHH 3TV3H 3LDBC 5I6XB 4XNZB 4QHMA 3ALWA 5JA8B 2FJGB 3WNMA 4PJ5D 1NCWL 5TDOB 4YDLB 2NY6D 4LIQL 3VWJC 5I8OL 1IAMA 4QRSA 5SWZA 2A9MH 5HGHB 4WHTA 3N1MC 3OJ2C 4U05A 1INEH 1K2DB 4KK6D 4HGWB 1JYNA 3BFOA 1D5IL 1EFQA 4B50A 4N8VA 5IQ9B 2Y6SC 1T7VA 2ATKB 4WFEE 4P4RB 5A2IH 3LKQA 1AP2A 1RZKH 2DQCL 3GK8L 2DRUA 3Q0HA 5MI0B 2GJ6D 4K7PH 2FH8A 4LHUG 1BIIB 1H3PH 3IFLL 3T3MF 5L2JB 5L7XL 4CADA 1X3DA 4MA3A 1BJMA 1QLFA 1RFDH 5D71H 5BJTB 3VFMA 4ZS7L 4K8RL 1QSEE 1XZ0B 4LLUB 3RPKA 4HXBH 1ZA3B 2JCCA 3IDUA 3BKYH 2W60A 3VD3A 2IBZX 3ILQC 4NFDA 5D4QA 3NAAH 5C1MB 3MFFB 1FV1B 2V9RA 3VWKB 1F42A 5K9OA 5KZCB 2OMBA 3VJ6A 2OL3L 1XGTA 4GRLA 5HDQH 3QEQA 2B4CC 4ZUVA 1RUKH 5C0BB 3WE6B 4PJDA 4R9HA 3ZDXE 4OGYL 4EUPH 4M6NH 1G7MB 2DTSA 2YUWA 1W0VA 3TNMB 1CDYA 3F7RA 3SE9H 3DRTB 3L3JB 1NFDF 3RWHA 3KNBB 1JJUA 3BGFC 2VN7A 1OGTB 3K81A 2FEEI 1MNUL 4NIKB 1XIWC 1RURL 1I7TB 1URLA 4UT9L 5CP7B 3JV5A 3HMWL 3I3BA 4LCCB 5LQBL 1A4KA 3SDCA 3ZT7A 4OF3A 4I48B 1H3UA 4GXVH 1AR1C 2XICA 3WO4B 3MUY1 2RCSL 1DBJL 2FJHA 5FECA 1G0XA 5HD8C 2WWMD 1KTLA 5I8EA 3MJ9L 4QT5B 2EIZB 1DQQB 4LSVH 4JPWL 3U6RB 2CMRL 3S96B 2O5YH 3I6LE 4M5ZL 3W0WA 4C4KO 3VXRD 4NJAH 1S7SA 3PQYD 4K3EH 4KRLB 5KANI 1EVUA 5CHNB 1E6JL 2YA2A 4G80A 5DEGB 4XC1L 1Z5LB 4IIQC 4M6OH 5L0QB 1LVEA 4NSKB 4C58B 1DANU 2GFBB 3EYOA 1FZMB 2PXYD 2BNUB 3HZMB 4ONHB 4MCZB 4Y4KD 2ERJC 3MACH 1J1OL 4CW1B 1J5OH 3WIHA 1A6TA 1KCRH 5AYUL 1N6VA 4XWOC 2LABA 2FD6L 2VLLB 4JKPL 3VXOB 1MCNA 4YHIB 4YEFA 4MXQD 2HN7A 3W9DB 3MO1A 1C1EH 4Z77A 1DANT 2R1XA 2Q87A 2PO6C 2AABL 2B1AL 5ID0B 5TDPB 3ALPA 4I13B 1N0LA 2ZOLA 4WO4B 1I1AB 4XPHL 1A7BA 3KHOA 4OGAD 4P23A 4AEFA 4XHJD 1CD0A 4OGXH 5HHVH 1A0QL 4MA1C 3PL6B 5DUPL 2FATH 3R8BB 3L1OL 3VXMD 1A1MB 2C3GA 1BOGA 2FBJH 4RWYH 1JHKL 1KB5L 5FUOH 25C8L 3I9GL 1IAKA 2DQIH 2R0ZH 2VISB 1XR8B 2HVJA 4UNTA 4YHZL 4HS3B 1RZFH 3ZKQD 4HK3J 5KN5B 5J0BA 3BN9D 3PDOB 3VFGL 2D7QA 5GIRB 5DC0A 5L6YL 1W72H 1JNNH 3G6JE 4PJIA 2XY1A 3H2WA 1IC1A 3QXTA 4FXGB 1S9VB 2EYSB 4LLYA 2AEPH 4HCRH 3FN9A 4H0HB 2EECA 5KSAD 5F88B 2IEPA 1JK8B 4DOHB 4X7EC 2XN9B 1FNSL 1GC1C 2Z4QA 2ZPKL 4ODXA 4U1GB 4JFHE 1S7TA 1KG0A 3CK0H 3ULVD 5FO9B 3AM8A 1BEYH 4QCIB 4PP2A 5T3ZE 2DJ4A 4LPYA 1CGUA 2CUMA 4NDMB 5K9KB 5LCVL 1U36A 1N0XH 4G8GE 5KSBA 3RWIB 4Y5YA 2C4XA 2VKWA 1Y6NR 3EUUA 1AHWA 4OM1H 5E2WL 4NQTA 5C09A 3QUXA 5SWZD 1A2YA 5ITBH 3UJIH 3FFDA 3T0EB 1MOEA 3LKSB 2BC4A 3EO1A 3JWDL 1NFDB 4P9ML 5DMYA 3EKCA 1D5XB 4ZG1A 3VDBA 3X11A 5CCKH 4XPTH 2X4UB 1DQJB 3MRIB 2XIDA 5EPMB 3TPUB 1XGYL 4YDVB 2C26A 1OWRM 3C5SA 2AJSH 5H8DA 3B9KA 7FABL 4KK9C 1KUMA 1PKOA 4O51B 4ONGL 4K2UL 5HHMB 3EHBC 4K23L 1V7ML 1BD2B 2UVFA 2CK0H 4XCEB 3MRJA 2HKHL 3BP7A 3MRBB 4N0YL 4M6ML 1S9XA 2IBZY 2VZ3A 4LASH 3BP4B 3LQZA 2E3VA 4P57B 3DX7B 3NCCB 1WBXA 3MQIA 4ZSOB 3E2HC 4K3HA 1JHTB 4J3WA 2YD6A 3CH1B 4XC3L 1T03L 4GRLD 4XTRD 3QEQD 1WTLA 4G6KH 5FB8A 5EU6B 4I3RH 4U1NA 4WUKL 3JWOL 4PS4H 1SY6A 4RQQA 3ARGB 3V4PH 4UDTA 4V1DA 2VDLH 3QDMA 5DJDA 5EBWA 4TOYL 4MDIB 2HTLC 4Q9QL 4R0LA 4G7VL 2MJWA 4LCWD 3ARXA 2OM5A 1N8ZA 5CGYD 5E8NA 2Q3ZA 3B9VA 4C57C 5HI4D 1S9YB 1F3DJ 3GJFA 5C07A 3QDJA 3AS3A 5IEKA 2OTPA 3WFEH 3SDCD 3HRPA 3QCTH 4Y0GA 1F4XH 2AJ3A 3OR7B 3S88H 3UXFA 1GOFA 1S7UA 5IW6A 5I73B 2XZCH 1OQXA 5DHVH 1HEZB 1MCRA 1UB6A 3DVFA 4P2CG 5F7EL 4GQPH 3FQNB 3K2MC 3DRQB 2LFGA 4XVTL 3W0WD 5E2TH 3PV6B 2BNQA 3L5WB 3U82B 4PRBB 1GAFH 3PF2A 2WUCH 1NGQL 1NGPL 3HG1A 4MVBC 1L7TH 4DGVH 3DV4B 4EN3B 5HYQA 4S0TD 4ZUUB 1S78D 1XF3B 1RZGB 1JPTL 3F8UB 1ZVHA 3VFSA 5EOCJ 2DL2A 4MX7B 5H94A 3IDIA 4HS6A 5T3ZH 1FCCA 1MQKH 1WIUA 1U8PB 5FCSH 4BZYA 2CRYA 2BNRE 3I3EA 4O4YL 3RVVD 4C55A 1HQ4A 3CVHH 5FGCB 2QQQA 4XP5L 2F8VA 3E8UH 1M7IB 4ZAKC 3SDXA 3X3GH 2R69H 4YNYA 2D7NA 3IDMB 4JRXB 4HFWA 4IOIB 5HGAA 3E0GA 3DBXB 3V0VA 4YHKH 3Q48A 4W70A 4EI6B 3L3DB 3WS6C 1H3WM 2ZUQC 2GY5A 3VRLE 2B5IB 1S8DA 2R0KH 4MJ6B 4G9DA 4IRJB 1VESA 5GGTL 1ZXQA 4GOSA 4IM8A 3MXVH 2GJJA 4NQCB 4WIQA 1INQA 1JF5A 1XGPB 1RUPH 3MLRL 1NSNL 4XP4H 1FAIH 5FFLA 4L8DB 3QIUA 1ZOXA 3GMQB 1JNHB 2ZCHH 3MGTB 1NBZB 4WU7B 4X98B 2AV7A 2ZNXA 5INDA 4OGZA 2NW2B 2BY1A 2W92A 3EYUL 1MWAB 3B2VL 4NM4L 4X0KA 5GJSL 5I1CL 3PWPA 3D9AL 5HHNA 2X4PB 3FCTA 3S5LA 3PABA 3ZHKA 5I1EH 4Z5RA 3RBGA 2NYYC 4KJPD 1A6WL 3BUYB 2VDRH 3BISA 5J57B 4HW6A 2XN9E 4OBRA 3N1PC 4OZHF 1RVFH 4LARH 1KTRL 3C60B 3U9UA 4P46B 1NCCL 4ZS6C 1PLGL 1T3FB 3B8SA 4H88L 5T5NF 3UTTB 1T0NB 1KCLA 5FF6A 4BUGA 5ELIA 1T4KB 5BS0A 5C09D 1OPGH 3LEVH 3P0VL 4PV8A 4X6FA 3TYGL 1Y6KR 2H32H 3RGVA 3BQUB 3WIIL 4YX2L 4JFEE 4OZFG 5JOFA 2HFFB 1IGIL 1CDBA 3QCVH 3EYSL 1Q1JH 4AM0B 2X4TA 2FX8L 3K2UL 1AXIB 4QRPA 4LLQA 3BUTA 1CICA 3O3AA 2QQLH 3EFFB 5I18L 4OJFL 4PIRF 5HYSB 5TDNA 3B9KD 5AZ2L 4OCSH 4PBWD 5LGJB 3VI3F 3VFRB 2E9WA 4MHHG 4G9FB 1I7ZA 3KGRA 4N8VG 3GMRB 4GW4A 4YWGH 43C9A 4KUZL 4MCYA 1ZHBB 4K7FB 3BP5B 2FDBP 3AFLA 3TCLA 1ZTXH 5HHME 4DZBA 5BZDB 3ULUD 1IEBA 1JP5A 2X1PA 4JHWL 2FR4A 1DEEB 2ZUVA 4ZPVB 5L2KE 2Z92A 5BVJB 3SKNA 1GVIA 4ZUTB 4AZ8A 3D6GA 4F3FB 2R2BA 1J0ZA 4LLWB 2ZZUT 2ZUUA 4ZSOE 3DV6A 5FUCC 3F58H 5GGQH 3ARYA 2APTA 1MEXL 4V1DD 2D3VA 1WAAA 2BFVL 4EUPA 1JPST 1UGNA 3QDMD 2VZTA 3OXSB 3H7BB 5EU6E 4BH7A 2DDQL 1JWSA 3OQ3B 3DGGA 3UEZA 3LY6A 1SJEA 5HJ3A 3MUZ1 4G8EA 3RNQB 2IQAA 1RJLB 1U3JA 3OKNA 3IETB 3QDJD 1CLZL 4WU5B 3C2AH 1XGRA 3SJVB 2H1PH 1IM3B 4UQ2A 5FGBC 4OUUA 3LS4L 4FQJH 4WI9A 3CU7A 1RQ5A 5JW4Q 4QNPF 3S98A 2C3VB 2GK0B 2RIKA 3O6FC 4L3AA 2F19L 1MUJB 5J12C 5DLMH 5KS9F 2AJUL 4TNVK 2BNQD 3RVUD 1C8PA 3DMMA 4XMLL 3GSVB 2AVGA 3CSYA 3HMXA 4U1IA 2R2HB 1LP9E 3EOAA 3HG1D 2R1YB 4FQLL 3VXSA 1MFCH 32C2B 3PNWA 3DXAB 4A2MA 3LH2L 3WLWC 3FJTA 3GHBL 4JFXB 4PRDA 2NY1C 1PG7X 4PP1C 4JFOB 5CD5D 2AQ1A 2D31B 5DQDL 4D9QE 5CIPB 1TVBB 5F6HJ 2X4SA 1TCRB 5MEPA 1LNUB 1GXEA 1P4IH 1QR1A 3WIFA 1I9RL 5DMGD 3S36H 4OZHB 4KROC 1NBYA 3TFKC 5HHXH 5FGCE 3EGSA 1TETH 3QQ9C 1FLRH 1QG3A 1UB5B 3M45A 1MPAH 3RP1A 4JRXE 3U36B 4N9OB 1YEKL 2I60L 3QDAA 4GQ9L 2W0LA 5HY9A 2AEIT 1PW3A 4TQEH 3I3DA 3FOMB 4PJBF 3G5XA 3I2CH 1IBGL 1G7QA 4H26A 1HH9A 3ZL4L 1WT5C 5KJRH 5IHZA 1IILE 4Q2ZA 3P0YL 3QIUD 1D9KA 3U7WL 4P5MB 4HH9B 4HUXA 4WTZA 4MNHB 1P7KA 3CPLA 4PB9L 1BFSA 1HHJB 5C8JA 2EZ0C 2FX7L 2VLMD 4ZO8A 1I8MB 2CKBH 2W0FB 1RJZB 4DKEH 5IB2B 1QSEA 4NC1C 4LVOB 4BZ2H 1TZIA 4D3CL 1EFXB 2BK8A 1I9IL 3PWPD 2L7UA 3GJEA 3QUYC 1MAML 2FECL 3TT1L 1LO4H 5C0CA 3C6LB 3BIKA 4HKBA 4NKQB 4MJ5A 3ZE0E 2ITCB 1JHLL 2FLBT 4GAJL 2Z31C 3T1FA 3EOBB 5D1QB 4LDOB 4JRYE 4FTVA 1DVFB 1KT2B 4S1RH 5BS0D 3PHSA 2A6DA 1FFPB 2O5ZL 3O2DL 4UINL 1NCUA 5H2BB 5H35B 2J12B 4AENA 3RGVD 4K9EC 3UTTE 1MHPH 5IMLB 1T21B 2NY2B 3KPMB 2DS4A 4OZ4B 1HOCA 3BH9B 1E6OL 5CGMA 3DECA 4QRPD 1VEOA 1CICD 1QSFB 2X9YA 5CP3A 5BRZE 2YK1H 2Y5TA 1SEBA 4OV5B 2MKWA 4GMTH 5IFHH 3G08B 4HZLB 3FB6B 4WV1B 4YZFE 1F00I 3C8KA 5T1KB 1MLBA 3CSBA 4APQB 3HZYB 1YPZE 5EN2A 3MV9B 2AJVL 4J12A 3EJYC 1X4ZA 2BRRH 3MRLB 2EH8L 4OIIL 4DN4L 5KS9B 3C8HA 3D39B 1OARL 3KJ4C 2VDPH 4IDJL 4XMPL 5D1XA 4U6YA 3RDTB 5IHLB 1NUGA 2HH0L 4NT6B 5ANMB 1KB9K 5D8JH 4TN9A 3DURA 3SEPA 2CDFA 3R0NA 5IIEA 1SM3L 1EUUA 3CUPB 4QO1A 1O5DT 3BGMB 1WBZB 5CJOL 1TPXC 4H25B 5CD3B 1CLYH 3KPNA 5D7SH 2VXVL 4FXKB 4M1GL 4WY7H 1VGKA 2Z8WC 2DQJL 1JZ6A 1T20A 4X7TA 1H8OA 3QRGH 1LHZA 4HMDA 4B41A 4BSVB 5I1IL 1ZHKB 4LCUB 5JHDE 1HHGA 1HH6A 1HYSC 2LVEA 1ZLVK 4YXHH 5DJCB 4LBEA 4JM2C 4WHYH 1KIPA 2X4QB 3JV4A 3NN8A 3T4YB 3TLRA 2JJWA 3VRJA 3QI9C 3QXVA 4RAVA 4UUJB 5EBLB 2VXTH 2Z8SA 4YR6A 3C87A 4OZGE 1MJ8H 3CFDA 3LS5L 5CZKA 4R90L 3SJVE 5D7JC 4PJBB 4C4KT 5DHVA 3QBTB 2OTWB 1GPOL 3HI5L 3BKJL 3E3QC 5A16B 2DLFH 2IBBA 4UTAH 3G6JA 2GAZB 3UYPA 1CG9B 4N8CH 3VW3H 1U8QA 1LD9B 1D3CA 2GSGB 6FABL 1G9MC 1KOAA 3NPZB 3EOTL 1DBKH 5IG7A 3VXSD 4X5XA 1MWAH 4PPTA 2FO4A 4L9DA 5DD6B 1IC7H 2F5AL 4EXPX 1AR2A 4JN2B 3AC0A 2JJVA 5JQ6L 1IAOA 3UDWA 3DXAE 4XBEL 4BH8A 4LSDA 2MCPH 3CLEH 2QKIA 2HRLA 4G8GA 1AC0A 1N64L 2EEBA 1GGUA 1MFBL 3CVHA 3LMJH 4LFHD 4P2RA 2CLRA 4KQ4L 3UZVB 1U9KA 5TH2B 3BPNC 3X3FL 4HDIB 3OG4B 3GJFK 5DD0H 4HPOL 5I1KH 1H0DB 3C9NA 1MI5B 5F6IB 2Y06L 3ETBF 4QF1A 3TBTB 2BOBA 4KI5F 4Y4FC 3KYKH 2IMMA 4PY8I 3TA3B 5J1TC 1RK0A 5HYFA 4P9HH 4HQQH 4WFED 5I6XC 3H9HB 4JO1L 1N7MH 3KPSA 4HJ0C 1GGBH 2LQRA 2VE6B 1DN2A 4CNIA 2VXSH 3QZWA 5TE4H 3VXUB 1GC1H 5ADPL 4NKIH 3Q6GH 2ESVB 3UJTL 4Z8FL 2Q86A 4QOKB 4O58H 1I1FA 1ODAA 1D9KD 1K8IA 2FIKB 5DK2A 2OP4H 3SGDI 5E8PA 3TBYB 5GRUL 2VDKL 2VLRE 2YD9A 1EJOL 1FL6B 4JDZB 5IHUH 1QSED 2NLJA 2YBRB 3MJ8B 2D03H 4JQXA 4NZTH 4DW2H 3GI8H 1VGEL 5C0CD 3VI3E 4PTUA 3KLSA 3ZE1E 1NMAL 1EV2E 5GS1C 1I1YA 3UAJD 3O4LB 1NDMA 3GSQA 1UCTA 4EDWH 2ZSWA 1UWXK 3QUMH 1WCQA 4JFDE 5T33L 2P7TB 4Z7OE 3P4MB 3MLZL 4FTVD 1FL3A 3VG0L 1CZ8H 2Z0BA 3DPBA 1I3GL 4QHNB 1T83A 3GRWH 3DUSA 4N0UE 3QJHA 1ZE3C 3UTQB 3VWKC 5J7CC 5E5MB 4X80H 3ROLB 3DETC 2OJZL 2H32A 3FRUB 3U0TA 5F1IA 4CN4A 4JGUA 1LDSA 4NQEE 2VIRB 3S8WA 5B38B 5BV7C 1WZ1L 3QIWB 1CYGA 2R23A 4KRPB 1IGJB 1Y18A 3WMSA 5I2IA 3BH8A 3H0TA 5BCAA 1QBBA 4PJXF 3U0PB 1IC4L 1QSZA 5JNYA 3RZCA 3UPRA 5K9QG 1MCJA 3L5HA 2BSRA 3I6LD 1WWWX 1TMCB 2A6IB 1EO7A 4HHAB 5GQBA 4ZFGH 5D7IE 3VRIA 4LCCC 2HLFD 3S35H 2VAAA 5A2JH 3WO4C 5BMFL 5F1SA 4HJGA 4QNPE 4U1JA 2B8OT 5D1XD 1QFWL 1II4E 3IT8D 5DJ0A 3MV9E 5DGRA 5F1KC 5FOBB 4CMHC 3JBG7 3K46A 2EDNA 3SPVB 2HMID 4KVNL 4OAWB 4DKFL 5ANME 4O2FA 1NEUA 2BNRA 3MCLL 3QP3A 3UCRA 4TSBH 5FYKL 4NQSB 2NNAB 2W9LA 1EBAA 2CLZB 1IARB 1FE8L 2NXYC 1QHPA 2HVKB 4I0PB 4NO2B 4YDIL 5ETUA 5ECJE 1J12A 4OM0L 1GSMA 1U8JA 3QNXB 1Z0MA 1BQHA 1RAMA 3REVA 3CFJA 2CIIA 4XNYH 1D6VL 3QG7H 1X4XA 1RI8A 1EHAA 3ZO0A 1Y0LA 3WXVH 4AEIH 4DK6A 5KSVA 1KIRB 2GJZA 2H26A 4P48A 5LXGH 5HGGS 1U8IB 2R4SH 4WWID 1KLUA 4YFLI 1TQBB 3IDNA 2A77H 4XPFL 5SX4H 3OAUH 1WC7B 4JHBA 2H6PA 1KV3A 1RK1B 3H3KA 4BSWA 1CL7L 3F7YA 3IS1X 4JAMB 5F7DB 3CZJA 3O6ML 3VG9C 4ALAH 4P3CH 3PL6C 2OMNA 2C7UA 1UENA 1P7QA 3VXTB 4PJBE 1Q9WA 4UU9A 4ZXBA 2NY0C 4QY8B 2O93L 2YRZA 2FEDC 5FUCE 3FO0H 4K8RC 2OYPA 2YN5A 2VSCA 3ARDA 1S7RA 2ZSVA 1EUTA 2JB5H 2UYLA 3LEYH 4R2GC 1OLZA 5FK9A 3ZMRA 4JFHD 1ZHLA 2NR6D 2Q8BL 1A6ZA 5T3ZD 3MV8B 2WLZA 4YBHA 4G8GD 4M00A 1IAIM 5IB4A 3SE3C 3SO3B 3ROOA 4P2RD 5GSVA 5ISZA 3LRHA 3HB3D 1X9QA 4OLVH 4RMRA 2APXA 2QJDA 1J87A 4NCC2 2P8PB 1KCKA 1K6QH 3LPWA 3LB6C 4C54A 2X4NA 4JFEA 5DJAA 1CE6A 1HN1A 1SYVA 2DQUH 3CFBB 5DURD 3RU8H 2FX9L 3GUTA 3MOAL 2P8MB 1F4AA 4JB9H 5LBSL 1QLEL 5GRYA 5E5UB 1HINH 3AU1A 4K94L 5KW9L 3LN5A 5JMRA 1MELA 7CGTA 4TVPE 3OGCB 5FKAB 3F12B 2YUVA 1U6AH 1NC2B 2XTJE 1YZZA 4OCLC 3QPXH 4PJXB 2NY7H 4M7KH 5ICXB 4IOFC 5K59F 3RVTC 4I18C 4OI9A 3QNZB 2M26A 2CKBA 3GIVA 3UTZB 4YBQD 3TVMC 1RUAH 3FZUD 1L7IL 3H8NA 3VWJA 3K4AA 2YN3A 3OB0H 5I9QC 3NBNA 4G6AD 1QACA 4W6YB 4JG0L 4WTZG 2QADB 1LWRA 1X5IA 3BKCL 4F9PC 5L2KA 1P1ZB 4XPGL 4YDKL 4OFYA 3OXRA 4YPGB 1A3LH 3KPPB 1D7FA 1F4WL 2ZJSH 1CIDA 1BQSA 2JK5B 3KJ6L 2MNUA 3S4SB 1NPUA 3FMGL 3G5ZB 4BM7A 4Z7VF 4J3TA 1EGJH 2HFGH 4PJFF 3G6DL 4P2OB 2PN5A 5ESQB 2WBJB 1YN7A 1C5CH 5HI5C 2EH7H 2AEQH 3ARGC 2E9BA 4OI7A 1L6ZA 4KHXH 3ARUA 4G42A 2VAJA 3QSKB 3D18B 3CC5A 4TNWK 2LTQC 5B21A 3RZCD 4FNLH 1O7VA 1OSPH 4UZGA 4ZUWA 3BD4A 4ISVA 2AK4A 1M71A 3LEXA 1HNFA 4HIJA 4LAQL 2ADFH 4C56E 3AS2A 4M3JA 1LP9A 5DJ8B 3IDGB 3O3DA 2EYRB 4GRMA 4NUGL 4NRXA 5I73C 1HK6A 3TP4A 5IEHB 1JFQL 4WWKB 3OMZA 3T2PA 4L1HA 4EVNB 4PJHF 2Q1EA 1RUQH 4O2EB 3WHXA 1XIWA 1E4WH 3I50L 5E6IB 1PZUB 1CFTA 1D5ZA 1FGNL 2BNRD 3HNSH 2NY3C 2ILLA 1R3JA 2XZQH 1VENA 2EE6A 4MWFB 1DQTA 1R3LA 3QB7C 4H8WC 5EOTA 5F21B 2QSTA 3CCHB 2NX5B 1UZ8A 5AD0B 3Q6FB 2IADB 3HZKB 3CX2A 3RHWK 4XVSH 2E7HA 1K5NA 5DEFB 1KYOK 2APWA 3JWDC 3V5KA 4H1LH 2APFA 2ZWLT 1XCTA 1J10A 3FOLA 4MQXC 3V6ZA 4LPUA 5CZXC 4JZNA 4WDIB 2KZWA 5B4MC 2HYMA 2XWTA 3UBXB 4YC2B 4D94A 4HF5H 4TVPH 5D7LA 5DD5H 3GBNH 2A6KA 4KKCD 4Q6YA 2ICWJ 1FCGA 2I24N 1OOAA 1I7RB 4R7DA 3NH7L 1KLGB 1YQVH 4KI5E 2B5IC 2RBLA 3MRDB 5C0AE 1TVHA 4LDLB 3E6HB 1ZHNB 1P7QD 4KJQC 4ZXBD 4RZCB 2CDGA 1CE1H 3V52L 3S6CA 3ARDD 1G7PB 4B53A 4GUPA 1LE9B 3BKYL 4JO2L 1AGCB 1F6AB 4HPYL 1TENA 5DJ6A 1PFCA 3RAJH 5SWSB 4F7TB 1NL0H 1A1NB 2YMXL 1MVFA 5CJXC 4PV9B 1PYWA 4ZTPL 4D8PB 3S97C 4OCMC 2VR4A 1N4XH 4JRYA 5HPMB 2JELL 3LIZL 1CD1B 2Y36H 2DQFB 2DM3A 3MV8E 3VGAB 5CJQL 2P5EB 3CNKA 2PW1A 1VFUA 3PP4H 5DRNB 4QHUB 3Q1SL 4JFED 4XVJL 3UC0H 5E0QA 2P4AB 4KPHH 2XPGA 4Z7VB 1RZ7H 3NCJL 4PJFB 1QYGL 2H2SD 3WN5B 1Q72L 4TSAH 5BO1H 1CQKA 4KXZH 3L3OA 4DVRL 3G04B 1ED3B 1FL5A 1ROWA 1L9MA 2OL3B 3JTTA 2VH5L 5IT2H 5BRZA 2MPAL 1INDL 4KI1A 3BWAA 3GMNA 2BJML 2BVPA 2R29L 1WCBA 1YEIH 3MX0A 5MENA 1Q94B 1CBVL 1JGEB 1YPZA 2ZG3A 1JZ7A 3MLVH 3HMXL 4HWBH 2I9LB 3NGBC 3RTQB 1K4DA 3QZWG 2Q6WB 3ECBB 1NJ9A 4KC3B 3QO1A 5F7NC 3VWJD 4PJXE 4UT6H 5C6TH 5C9JB 3ESVF 1RV6X 1BZ9A 3P2TA 3HN3A 5L2KD 1F3JB 1QQDA 4YGVB 4OFYD 1UKQA 1EERB 5DO2D 3QUMA 2V2TA 4PJHB 2PKDA 1WWBX 3RVXC 5C2BL 2X70B 5LWYH 2I9TB 1KIQA 1BMGA 1UA6H 2VITB 1CFQB 2UZIH 3BW9A 1C1EL 1DFBH 1DJSA 1Q0XH 3GRWA 3GZKA 4RMSA 1N5AB 5JHDA 2CJUH 1OAUH 4NQDA 1EH9A 4HBCH 4O02L 1I9JL 4L3EB 2FCBA 2EE2A 1A14H 1KENL 2V5YA 3EW3B 3DROB 4HFUL 5EU5B 1EEYA 4MAUH 4UILH 4GRWF 4HK0B 4X6BB 3ILQD 2WANA 5C71A 4YHML 4OZGA 4XCFH 1MQ8A 1JYWA 2V7NA 4NN7C 3TH4T 3FQWA 1I4FB 2H8PB 5J8OA 1BX2B 3M07A 4PD4K 4ZYKB 3BZFA 1J8HE 4RGMB 3M17B 1J0YA 4NO0B 1V3LA 4LL9A 3GEWB 1JTTA 5F9WB 3QNYA 4MA7H 1YYML 4F33A 3PUCA 5JO5A 4HD9A 2WZPD 5F89B 3KDMA 1UM6L 1XIWD 1CR9H 4ZO6A 2QR0B 1BAFL 4IMKC 4J8RB 4L8CB 4D9QD 1RIHL 1A7OH 3CK0L 3MSPA 4RA3A 3TNNA 1AR1D 1BEYL 1DE4A 4F58H 2VDNL 1LEIA 4NFCA 4ENEC 3N1GC 1NC4B 2KZ1B 1NMCC 2WK2A 5HD8D 5K93A 1ZGLB 4I77L 3NFSH 5I74B 1A9BB 3N50A 1BQUA 1OCWH 3IXAB 5D2NC 1NLBL 4M48H 1OGAA 1EHXA 2YD3A 4YHNB 3VFUB 3JZ7A 1RZIA 1RIVH 1LDPH 2NX5E 2XOTA 4LNRA 3F5WB 2ADGA 3KPRA 4PRHB 5D7LD 4O2CB 5T1MB 3GM8A 2J4WL 2HKFL 2IBGA 4L4JA 1A47A 3OX8A 3QEUA 4LCYA 2NTFB 4FZ8H 1RJCA 1Y6MR 1C12A 3LPFA 1WEJL 4XWOD 1FFOB 1IGYB 1NAKH 2VLRA 1KIUA 3OKDB 3HLAB 4JKMA 5IMKA 2CK0L 1NCDL 1NGWB 1RUML 3HKFA 1QRNE 1RZJC 4LIQE 4YHOH 1FG2B 3MV7B 4OLXH 4G5ZH 3SE4A 5BQ7A 2FHFA 3P77A 1UZ6E 3ABZA 2CDEA 1U8NB 2IGFL 4NZRL 4OSUH 2AXGA 3GGWB 1W8OA 2EXWD 5EZLA 5I16B 3FT2B 4I8DA 1N2RA 4JFDA 3FQRB 4KZEH 4LGRB 4JRYD 4LVOC 1B90A 1EHNA 1JNLH 1PKQE 1TZGL 4FQQB 4JR9L 1B4JH 5CBEA 1SMAA 4LSRH 1IQDA 4NM8H 3ARSA 1DUYB 4JFQA 1NEZB 2VDLL 3ZTJG 2AJYH 4LHJB 4AIZB 3DGCR 5FDWA 5J11B 1R0AH 5TQ2H 1H3GA 3O3UN 4JZJB 3CLFH 4NHCL 2BSTA 4NQEA 1MHEA 3RVWD 3VI4E 2B39A 1EAPB 1DVFC 3N9GH 5D70H 2ORBH 2F53E 3HR5A 1YEJL 2CK2A 5HVGB 1T2XA 1YMMB 1F4XL 4TUJB 3SDDC 1H15B 3BIAX 4HUMB 5BRZD 4RRPA 4YO0A 5AG9A 4FQHB 5I8CA 1N6QH 5E8OA 2C9AA 4GRWB 5DDHB 5MEND 4PGCA 4CJ0A 1X5JA 2NY2C 1MCDA 2D9QB 2XWBB 4WI2A 3P4NA 1LQSR 3BXNB 3ISWA 4HUWA 2R0WH 3L7FB 4HS8L 4M7ZB 1T7ZA 4L29A 1UJ3C 2ZKHH 4QTIH 3EO9H 2Z93B 1B2WL 3G9AB 1MH5B 4DQOL 5JR1H 3V8CA 5BV7H 4OKVB 1EO8L 4EQ2A 5T3ZL 2I07A 1T6WA 4JKLA 5L88L 2M8XA 1V7NL 3QULA 5A43C 2XYCA 3GNMH 3D0LB 2A0LD 3MLUH 2JLLA 4KK9D 3NIGE 3VGGA 1OD9A 2YR3A 2DWDB 1HXMA 3AXLA 4A6YH 3KYMB 5JHDD 2GITA 5L9DH 3KXFB 1EGJA 3EHBD 4NQDD 3VCLB 2CO6B 4WFGE 2R0KL 2ICWB 3PWVA 5EO0A 1NLDH 1JZ8A 3EBAA 1DTUA 4CDGC 3CX5K 4WFHE 1DLFL 1M6OA 1T66D 1VDGA 4RNRA 1S5HA 3AAZA 3TCXA 4F7PA 1NCAH 3AREB 3QHZL 5A2LH 5DJYB 3VFNB 1CFBA 3B4NA 3SJVD 1K8DA 4G6FD 4GH7B 1FAIL 1K4CA 1NCBL 4NO3B 4X4ME 4F7MA 2XWJB 2GUOA 1OAQH 5BXFB 5IMOA 1ZT7A 3D3VB 1NCWH 2HRPL 1CDCA 5BZWA 4LIQH 5I8OH 2EIDA 5F3BA 1VFBB 4MD5A 2X09A 2HTLD 4Q9CA 2ICWI 3PWNA 1X5FA 1I75A 3GKWH 1D5IH 1HI6A 3K1DA 4IBLT 4PUBH 1J88A 1LEGA 1YYLL 3PGDB 4LLMA 1JUFB 2VDRL 2DQCH 1ORQA 1VADB 3L6FA 3RPIB 4Q6IA 3KLHD 2B1HL 4Y2DA 1RVFL 4LARL 4QRQA 2Z8VC 3IFLH 1UQSB 5L7XH 5I19L 5EIIA 3BEWB 2Z35B 3O6FA 3QXDB 3QH3B 4OB5L 3NCYS 4J4PC 5DJXA 4KY1H 4JY6A 3KS0J 3LD8C 1T5XB 3LAFA 1OPGL 4ZS7H 3SE8L 4K8RH 4ZFOB 5I1HH 3BRFA 5GS2H 4LLVA 4WUUE 1X7QB 2JJTC 4H1LA 3A6BL 3W39B 5JXAL 2XFXB 3QJFB 4MVBD 3QCVL 4RBPK 3ARFC 3AMKA 2OL3H 4N0RA 2NXZC 1IM9A 1MJ7L 4NRZB 4XVUD 1Q0YL 4MJIE 4ODSH 5F6IC 3DVGB 1NBQA 3O45A 3LZFH 4LEOA 4OGYH 5DS8A 3MRQA 4N0FB 3TA3C 3T09A 2VLRD 3P9WB 5IJVB 1NGYA 2R9HD 3SGKC 5C0IA 5IMMA 5HHOA 2RFXA 5ICYB 5BW7A 2GI7A 4P4KB 3MRGB 1TZHB 3STZB 4M4PA 1MNUH 3P3YA 2OQJA 1WFNA 1UM5L 4HIEA 5GGUB 4UT9H 4ORZC 4BQBA 1EHLL 3HMWH 5D5ME 5LQBH 5JDJA 3MV7E 4JFDD 3RWCA 4AH2A 4PY7A 2F74A 2V7HA 1JE6A 3IB4A 5DR5L 1DBJH 3DX6A 5F7KC 2X1XR 3U4EA 1H3XA 2A74B 3MJ9H 1LMKA 3RUGE 1B0GA 1I8IB 2HT2C 4E0RA 4DEPB 4M93C 1WT5A 4JPWH 2FJFA 2CMRH 3F58L 3JUYA 3H9SE 2MTPA 4M5ZH 4JREC 2DKUA 3OJMB 2VKXA 1E6JH 1NANH 2IALA 4XC1H 4I2XA 5ERWB 3IFPA 3D69B 1T1XA 3VFPA 3S34L 4NKOB 2WWKO 4NQED 4AT6B 1CDHA 1JPSL 3D2UB 5AAWA 3RKDC 5ID1A 3ZE2F 1J1OH 4FQJL 3PGCB 5FM5O 3LKPB 5AYUH 3G5YB 2NYYD 1ONQA 1ZLSL 1GZQB 2FD6H 4JKPH 5EZIL 1Q9OA 1J18A 3A6CL 3QUKA 5C0EA 4D2NA 4PJ5B 1YMME 4PJGF 2NY6B 1ZVSB 5A3IC 5ADOL 4M8QB 4C56A 3VD4A 4ZS6D 3ZYJA 3ES6B 4KRPC 4HWBA 4R97B 2AABH 2B1AH 2JE8A 2RB8A 5JLZA 4XPHH 1MFCL 2ARJQ 2X4OB 2J8OA 4IMLB 3LOWA 1A0QH 2ICES 5DUPH 1FNGB 3QDGE 1DQLL 1OW0A 3L1OH 1A4JA 3RDTD 4HAFA 2GJ6B 2WINB 1JHKH 1KB5H 5C3TA 3MLPA 2V5MA 25C8H 3I9GH 5IVZB 3QFDA 1A8JH 5I1DA 4YHZH 1PZ5B 3WCYA 4NP4L 3UO1L 3QCUL 5DVOA 3S36L 5L6YH 3PDGA 1MF2L 4TUOB 1HHHB 1ZS8A 2IQ9L 1G9EA 4R4BB 2EYTA 3GHEL 4U3CA 3ULVF 4U4BA 1TTGA 1CFNB 4EDXA 5DRWA 3IU3A 1A7QH 2YD7A 1Q38A 2AAVA 2QQKH 4NRYB 1FNSH 4I0PC 1I7UB 1G7IB 1MHHA 2DWEA 1N5YL 3PJSA 3TBVB 2ZPKH 3OKMA 2FNBA 4ODWA 4CU8A 3O3BA 5J1AA 5DXWA 3EYVB 3SKOB 1ACZA 3RX7A 2EIBA 4OKDA 2I5YL 1AXSA 2O5XL 5DMKB 5C0AA 5IWLC 4E9LA 4ZPTB 3E6FA 4NGHL 1CDIA 2JF1A 4XNXL 4X5LA 5C0JB 2J8HA 3RBSA 5E2WH 4E41A 5HHQB 1JRHL 1Z2KA 1GL4B 5ENWA 2FZ3A 5E8EA 5KTEL 3D3VE 3V6OC 4D0CA 3JWDH 4P9MH 5DTFA 2F5BL 1FZOB 1U3HC 1MCHA 1MLCA 5TE6L 2ZUWA 2P47B 1LO4L 3J8F7 4XP1L 5E4EB 3U2SA 1ZGLP 4OLYL 4JM2A 1XGYH 5J3HC 1BJ1H 3QI9A 1ZANL 4TNVF 4Y2DD 3W2DH 5J9PB 5EIVA 2E9JA 3VXRB 4LGPB 2JCCF 4UIMA 1F11B 3O6FD 4ONGH 5D7JA 1G84A 3HE6C 4K2UH 1REIA 1V7MH 4K23H 5H37H 4RAHA 3HC4L 2HKHH 3MRNA 4QHLB 4N0YH 1YY8B 4FN0A 3D87B 4QTHB 2DB8A 1JZ3A 3UTPE 1S9WA 2PXYB 3MRPA 1MHPL 3I02A 2Q7NA 2OI9C 4Y4KB 1AC6A 4LK4A 4PJDF 3OGOE 1ORSA 4QRUB 1F13A 4NWTH 1H5BC 2YC1B 5ITFB 3PXHA 3WLWD 3FB7B 1XF5B 4XCCH 4XH2B 5FO7A 5LAXB 4NQVA 4XC3H 1T03H 3QWOA 4MJ4A 1I3VA 3N0PB 1IM9D 1EXUA 4WUKH 3JWOH 4AEEA 2XTJD 5E7BA 1R5WA 2B4CL 3B5GA 2V17L 1JNJA 4FMFA 2D9CA 4WNQB 2BCKA 4TOYH 4Q9QH 1BFTA 5HHOD 3MLWL 3FONB 4G7VH 4PJGB 1OM3L 4L8BA 2EDJA 2BRRL 2VO5A 4KROD 4CU7A 5E6ZA 5D2NE 3QQ9D 1YMHA 5I30L 3VXMB 2ENSA 2P49B 3ARTA 3WL9B 4NHUB 1JWMA 1ZWIA 4UI2A 1EAJA 5F7EH 2WLYA 4AMKL 1CLYL 5EO9B 1DUZA 3I84A 4WY7L 4XVTH 1RD6A 1BFOB 4ORGB 2P46B 1EEUA 2MHAB 4GBXC 5KSAB 2EZ0D 3OKEA 5IGXH 1NGQH 3WDJA 1NGPH 4PGBB 4UAOB 1NKOA 4BFEA 3NFPA 1JPTH 3RJDA 4WW1B 2E8YA 3LVEA 4HMEA 4YBLB 3BD5A 4OZIE 4MNGE 3DVNA 3FB8A 4QXTB 4AJ0A 5GS1A 1BGXL 4QHMB 4AG4H 5EDXA 4XP5H 3TJHC 4M4RA 2J2ZA 1BVLA 4C56D 2AV1A 4DGIH 4H0GA 4QRSB 5SWZB 1J8HA 5TF1L 4WHTB 2DL9A 3TN0A 2VQTA 4N8CL 1KEGL 4KDTC 1CTOA 4NZUL 3SGEI 4RRPG 4KKNA 1WVZA 3MFGB 3NIFF 1DBKL 4N8VB 4LDEB 1KJMA 3LKQB 1AP2B 2BSSA 5LKNA 1WICA 1OAZL 3PGFH 3WXWH 4P3WA 3BWUC 4PJIF 2WBKA 3D0VA 4CADB 4MA3B 1QLFB 4PR5A 4XX1E 3V2AR 4F15B 1QZ1A 3MJ7A 5LGHL 1GCFA 3VFMB 1RIUH 1V05A 2X2YA 1P4BL 2JCCB 5IVOA 2W60B 5DD0L 3CU1A 5GJSH 1FN4A 4A6YA 3DUHA 3MCKA 3EJYD 3RWJA 3WS3A 1LE5A 4GG6A 1FNFA 4HQQL 4OLWL 3WSQL 5K9OB 5KSBF 5J1SC 1N7ML 3VJ6B 3HUJA 1A6WH 4GRLB 1XGTB 1OHQA 3QEQB 4ZUVB 4PJDB 4NKIL 1BVZA 1W0VB 3JV0A 4PJEA 4BFIA 5C0AD 4BFBD 5IR1A 4MD0A 1NCCH 3MJGX 3RWHB 1PLGH 4H88H 1QD0A 4E41D 4XCNA 4LEXH 3WUWA 2E6PA 1QRNA 2GFBA 3P0VH 4PLJC 4TRPL 3TYGH 5IHUL 3WIIH 2D03L 2ED7A 4WJ5A 5F70A 1A4KB 3SDCB 1F8TL 1IGIH 2D7PA 4XAWL 1HYSD 4POYA 4OF8A 3EYSH 2FJHB 5FECB 5I8EB 1KTLB 4JM2D 2AQ2A 2FX8H 3K2UH 4JJ5A 1PG7W 4EDWL 3QI9D 4PJ8A 1J1PL 4IOSD 4UQ3A 4X6EA 5I18H 4OJFH 3BPOB 4OTXH 3QRFM 2CPCA 1PKQA 3W0WB 1H3VA 4GKZA 5AZ2H 1S7SB 2XY2A 1CXFA 4G80B 5D7JD 3ULUF 3MLYL 4KUZH 1FVCA 3PL6A 1UT9A 3EYOB 3UYOD 1RZJH 4V2BA 2F53A 3HZVA 3X12A 1A6TB 3GDBA 2J8UA 3L3KA 4MQTB 4LCIL 2HN7B 1A6VH 3MO1B 4Z77B 5ALBH 1A5FL 2GKIA 2R1XB 1YUHA 1MEXH 3T04D 2BFVH 2ATPA 2PYEE 3SE3A 2DDQH 1WZKA 2ZOLB 3ZE2E 4HXAL 4P23B 1Q9LA 5HYIA 1MCCA 3PWJA 1NUFA 1CLZH 2UWEE 1P4LA 1MRDL 4PJGE 2ZOKA 5CEYA 1BOGB 1U92A 4LQFH 1HSBA 3L9RA 1IAKB 1UXSA 4P5KA 1UXWA 2HVJB 1FRGL 4Y8DC 1XGUA 1E27A 1FNHA 4U33A 4KK8C 5CMAA 3MJ9A 4OD2A 3LQAC 2MWCA 4PJIB 2AJUH 2HJKA 4R96A 1KNOA 2B7DT 4LLYB 2JKXA 4POZC 3SCMC 4FQLH 4I18A 2MOVA 1AGDA 4Z0XA 5C70A 2Z4QB 4AEIL 2FO1A 4ODXB 3TVMA 3LH2H 2CIKA 1S7TB 1KG0B 3GHBH 5E94A 3Q5TA 3SDXF 4PP2B 4L4VE 4F37K 2WAHA 2KQMA 2YEZA 5DQDH 4F9PA 4MYWB 1OTUC 5J4MA 5KSBB 3OAUL 1HXYA 4Y5YB 2CGRL 1I9RH 1AHWB 4OF7A 4RGNC 2IFGA 5C09B 3QUXB 1A2YB 1J8HD 3UZQA 2KL6A 4ALAL 3FFDB 1UWEL 1I9EA 5EZOL 3TN0D 4HULB 2BC4B 3EO1B 5TPWH 4RMQA 1CVSC 5C92A 4ETYA 5AWNL 3BJLA 4MLIA 3X11B 2PF6A 3GMLA 5FOJA 5JOEA 1YEKH 2I60H 4GQ9H 1JGUH 2ED9A 2M2DA 2N56A 2R2EA 4WWKD 3K74B 2QTEA 1FGVL 3C5SB 5C0NC 1IBGH 4PLKD 3D25A 1OB1A 3B9KB 5DHXB 3ZL4H 1E4KA 4X9GA 1SQ2N 1KB5A 3P0YH 3U7WH 4IRZL 1I85C 4IS6A 3QXWA 15C8L 3L7EA 4N0CC 4Y1AA 3O8XA 4PB9H 3R4DA 3MRJB 3BP7B 2FX7H 5CBAA 1S9XB 1OT1A 3LQZB 5EBMA 4D3CH 1I9IH 4UOW1 5DUML 1ZLWH 1WBXB 4WUUA 4ESKA 3LQMA 4R4NC 3FHAA 1AGBA 1ZSDA 3HS0A 3TT1H 2FGWL 3RU8L 2YOCA 3KPQA 2DF3A 3BRGC 2XRAL 2DMKA 3NCBB 5ALCL 5F9JA 5FB8B 3FAWA 3HI6L 4U1NB 1GRWA 4RQQB 1DP0A 1JHLH 4MJIA 4GAJH 3K80A 4UDTB 3GMPA 3OAYH 4V1DB 3JV6A 4QWWC 2DQHH 3QDMB 5DJDB 3QEQE 5EBWB 3X14A 1F2QA 5I15L 4HLJA 1OVZA 1HDMA 1U3YA 4R0LB 1HCVA 1NGXA 2NXYD 1N8ZB 4HWEL 5E8NB 2O5ZH 3O2DH 4UINH 4V2CB 1F4YL 4PTTA 5HI3D 3BZEA 1QRND 3GJFB 5C07B 3VH8A 3QDJB 4QXWA 3V9FA 1VFOA 5IEKB 5E4IA 3QXAB 2EC8A 2J88H 5D5MA 1QBMH 2AJ3B 4W6XB 1S7UB 4U1SA 1KYOJ 5IW6B 5B3JF 1E6OH 3CZFA 4GKSA 1UB6B 1GH7A 2XKUA 4PJ8D 4JPVL 3RUGA 1EEZA 3BSZL 4ONFL 3VXPA 3ZDZF 43CAA 5F72S 2BNQB 3H9SA 2PW2A 4P49A 4JQIH 2P48B 1YDPA 2X9XA 5EA0L 1HHIA 2AJVH 3HG1B 5JHLH 1EGJL 5HYQB 4OIIH 4DN4H 2NY0D 3VFSB 5JPNA 1O0VA 2GTWB 4IDJH 4XMPH 5DUBA 4K8RD 4NQCA 2DM2A 5H94B 2HH0H 4AIXA 2F53D 3GFUA 3OAZK 3IDIB 4HS6B 4G43A 5DFVC 3T08A 1WIPA 1A6UL 1WAAF 4NUJA 4R2GD 1HQ4B 3B9DA 4OZFH 3T8XA 4EKXA 5J11C 3BYYA 5DFWH 4NWUL 3SDXB 5CJXA 2VXVH 4M1GH 4YNYB 3OBAA 4HFWB 5HGAB 2DQJH 2G75A 1FDLL 3V0VB 3L3GA 4DTGL 2VNCA 1S8DB 5I1IH 3NIDF 4G9DB 4F7CA 2PTVA 4PJ7E 1AGEA 4LHUA 1UM4L 1GJIA 3LB6D 1P9MA 3QDGA 1A1OA 1INQB 1JGVL 5KVMC 4ZDHA 3QIUB 4HUNB 2BMKA 1R3HA 1X5YA 3LS5H 5C0FA 1G7LA 4R90H 3RIFK 1TXKA 3NIFE 2AV7B 3BKJH 5D1ZC 2YA0A 5INDB 3OWEA 1DQML 4LPCA 4X0KB 4UIKL 3ZSSA 1LK2A 3JXAA 2WWKT 6FABH 3PWPB 3QIBC 4PJIE 5HHNB 3EOTH 3RVTD 3FCTB 4Y19E 3S5LB 3PABB 4Z5RB 3B5HA 2OXGA 3TO4C 3TVMD 2MSPA 4H20L 2N4IA 2F5AH 2Q20A 4S2SA 5JQ6H 4D0DA 3MTRA 3RL2A 1FH5L 2YSSA 2IPUG 3DNKA 4XBEH 4PJAE 3SHSA 3U9UB 3BHBA 1XCQA 4I3GA 4NYLA 1I1CA 5FF6B 5BS0B 1MFBH 5FYKE 4KQ4H 2W07A 1ZT4A 4X6FB 3CXDL 3IJYA 4PV8B 5KSBE 3H9ZA 5B3NA 1TITA 3RGVB 3X3FH 2F54E 1AJ7H 4RIRA 4HPOH 5JOFB 1B4RA 3AREC 4U0RB 3RRQA 4Z7UE 2X4TB 2BVTA 1ZEAH 5B8CC 3ZYIA 4QRPB 4JO1H 4LLQB 2AP2A 1CICB 3O3AB 4HC1H 5ADPH 5TDNB 1YC8A 1OF2A 2YD2A 4I9WE 3UJTH 4Z8FH 2HA1A 2G60L 2E27L 5F7YC 1I7ZB 3VXNA 4KTEL 5IESL 2V6HA 4DGYL 2QHLA 3RL1A 4L3CA 3O8XD 3SGJC 4GW4B 43C9B 4MCYB 3RNQA 5GRUH 3FT3A 3TCLB 3VE0A 2OK0H 1EJOH 4DZBB 3A0OA 3GSNL 3HC3L 4Z6AT 4YHYB 4WUUD 1P2CA 3ZDXF 2FR4B 4KPHL 1VGEH 1RZ7L 2Z92B 3MRFA 3SKNB 1NMAH 4TSAL 1ZLUH 4CAGA 5KANG 2R2BB 3LRSA 2Z91A 2V2XA 3HAEH 5T33H 1EMTL 3DV6B 4BJLA 3TH2T 4MJID 5FO8A 1KPUA 3MLZH 4EUPB 2BXZA 2GCYA 4BH7B 1F3RB 1G7HA 2NY3D 3RHWF 1I3GH 1JWSB 1SJEB 3TC9A 5EUKA 3M1BA 4G8EB 3V6FA 2IQAB 4F7EA 3QDME 3OKNB 4M8VA 5D2NA 1XGRB 2OJZH 4J23A 4ZQKA 4ELKA 2VMFA 4K9EL 4UQ2B 2ADJA 4OUUB 5F7HA 5C07E 1WZ1H 3NPSB 2HJLA 4OCNC 3JVGC 5DI8A 3SBWC 1FNEA 5B4MD 3GIZH 4DUVA 2IPTH 5MEQA 4OZHA 3CFKA 3D85A 1IC4H 4P4KC 1BM3L 4JY5L 2B2XL 2BVQA 2K3TA 3DMMB 3H9SD 3CSYB 1T04A 4U1IB 1FO0L 1MHCA 1UA6L 5GRVL 3EOAB 3MBXL 3IJSA 4NC2B 3VXSB 4FXLA 1DFBL 5BMFH 3PNWB 1ZGLM 3S7GA 3U30C 3VD9A 3D5OF 1QFWH 1M7XA 4PRDB 2NW3A 1R3IL 5IUSA 3HG1E 1RU9H 1JZ4A 5F3HA 4OZIA 4MNGA 1FQ9C 4MS8D 3UJJL 4KVNH 2IANE 4JY4A 2X4SB 2XQBL 5MEPB 4U1MA 3MODL 4DKFH 3MCLH 3WIFB 1QR1B 1KJ3H 4UT7L 5FYKH 3WNLA 5IJKA 5D9SA 1FE8H 5ESVA 1NBYB 4YDIH 1OP5H 2G9HA 3EGSB 2P5WA 4MNQE 1FSKB 4GAGL 5CJ5A 2DQDL 4LHUD 5HY9B 1F2XK 2PNDA 1IAIL 4LP4A 4I0CC 1C08A 3G5XB 3MRMA 5CS7A 3QDGD 5CLWA 2NY6C 4HGMA 4OLZH 1G7QB 4H26B 4NN5C 1ZLVH 1HH9B 5IHZB 3G6JF 4QRRE 2H2PD 4Q2ZB 2A83A 1D9KB 5DD1L 1YN6A 2BHYA 4HUXB 4XPFH 1A7OL 5IB5A 4J3SA 1P7KB 3CPLB 1SMOA 1ZT1A 3SDDA 2HG5A 5C8JB 1KULA 1CL7H 3EDDA 3O6MH 5I75B 2VLKA 3BN3B 1QSEB 1TZIB 5MP6H 4M48L 3GJEB 4ZOAA 5C0CB 3J7HA 4WCYL 4HKBB 4MJ5B 1G9ML 4ODHL 4U7MA 1QSFA 1UJ3A 3FQXA 4U7SA 4TYUA 1X5KA 5K9JL 4U31A 1H8NA 1J86A 4NPYA 3T1FB 2Q8BH 4FTVB 5I1LA 1WWAX 4FZ8L 2A6DB 3OSKA 1GGIL 4M7JL 3RVXD 4AENB 2F8OA 1NAKL 4IJ3B 1CN4A 2NQCA 3L3HA 1YEGL 5DMJB 5DEZA 3GJFH 4LVHB 1HOCB 3DX8A 3RWFA 3E1F1 4JQVC 1YQ2A 4PYGA 5LBSH 1QLEH 4IHOB 4K94H 4N8PA 5KW9H 1LEKA 2Y5TB 3TYFA 1Z9LA 1SEBB 1G6VK 2X44D 3O81A 1HCFX 4EI5C 3CX5J 3C8KB 1MLBB 1I8KA 4KTDL 3RFZC 1N59A 5EN2B 4JN1L 1BVKA 3NZ8A 4HIIA 3PP3K 3D48R 4NZJA 1QEWA 5E4EC 1BWMA 5D1XB 1EX0A 4MQ7A 4RGNE 4U6YB 3UTPD 2VDOH 5TQ2L 3RX8A 3VFWA 2HP4A 1L7IH 3DURB 4XBGA 3DO7A 2CDFB 3GBML 4JG0H 5IIEB 3BKCH 3TWCH 1MRFL 3MREA 4FZEL 4XPGH 2BY0A 1MFEL 3KPNB 3VXQA 4QYOA 1VGKB 4JM4L 4NQUA 1F4WH 1T20B 4X7TB 1UWXH 2PYFA 3B3IA 3I75A 1Z0NA 4M9OA 2X40A 3KJ6H 2Y25A 2PYEA 4KJWC 5CWSA 2FEEL 3BE1L 3FMGH 5B39A 1HHGB 1HH6B 4ZD3L 3G6DH 2XKNA 3GSOA 3O2DA 2PUQT 3V5DA 4LBEB 4J4PA 1KIPB 4O5LL 3JV4B 3NN8B 4P59L 2UWEA 3VRJB 4RAVB 5IM7A 4GLRH 1B0RA 4Q9RL 3O9WD 2E7BA 2XG5A 3HRZA 4O00A 1QTYT 1BIHA 5IBTL 2APVA 4YR6B 3QAZB 4BK4A 3CFDB 5JR1L 5I71C 4PGJA 3IDYB 5BV7L 5DHVB 3LKRA 3NIDE 4R4FL 5E56A 3D85D 4OGAC 3ZYOA 4XHJC 4M7LT 3ARFA 3G6JB 3GSWA 4XXDA 1U8QB 4LQ1A 3O4OC 1IKFL 1BOYA 5IG7B 3MROA 3GKZA 4NUGH 3WKML 2FO4B 1LO5A 4HKZA 1FC1A 1JFQH 3MJ6A 2VYRE 4P2QE 2V5SA 5IKCA 5L8LB 2MQ0A 1IAOB 5IVXE 4L4VA 2IAMA 3QWQB 4BH8B 3I50H 4YK4C 4TSCL 1AKJA 2QKIB 1FGNH 4G8GB 3B2UC 4FQPA 5KSAC 3CVHB 4OZFA 4UOW0 4P2RB 3VRLF 4B0MM 2CLRB 3MBEC 1E28A 1OAQL 2DQEH 2P5WD 3S36X 3C9NB 3ULVC 4FOMA 4QF1B 4G6JL 4NKDA 3FFCE 1SJVA 1TTFA 5DURB 1RK0B 3AB0C 3KPSB 5GJTL 4CNIB 4HLZG 1MCOH 2PTTA 3GKWL 3IXTA 2BP3A 2Q86B 3QYCA 4HMCA 4PUBL 1I1FB 3BGAA 4XWGL 2DM4A 1K8IB 3MLSL 4HGKC 3K8MA 3NH7H 3SDDD 5E1AA 3OPZL 5DK2B 5E8PB 2VLKD 5DJ2A 4AQ1B 3MA7A 2NLJB 1YEDA 3V52H 4KY1L 4P5TC 4MGXA 3DTXA 5EOQL 5GRJL 4PTUB 4JO4L 4MD4A 5I1HL 1C7SA 1I1YB 3KG5A 4JO2H 1NDMB 4HPYH 3GSQB 1YY9D 4UOJA 2ZSWB 4RFNB 4F15C 2DJSA 5ACZA 4OD1L 1BFVL 5C0CE 1JGDA 2YMXH 1UYWH 5F7MC 4PREA 1A02N 4GS7B 1U58A 2Q76A 4ZTPH 1FL3B 4BQ9A 5INCA 1M7DA 2JELH 3LIZH 4ODSL 5E8DL 3LZFL 4JFPA 3DUSB 4XI5C 3QJHB 4FTVE 4KMTH 4NNYA 3TZVC 5CJQH 5MERA 3BKML 3DLQR 3FO9A 2H32B 4XTRC 5JUEL 3Q1SH 3U0TB 5F1IB 4XVJH 4RISH 1FIGL 5CLTA 3IKCA 2R23B 3NCJH 3MOBL 1QYGH 1Y18B 1Q72H 5I2IB 3BH8B 2VJXA 3H0TB 3TIDA 1W0YT 4NZDA 2RJMA 1OTSD 4DVRH 2AJXL 5SWQA 5CGYC 5FYLL 1IGML 4HC1A 3UPRB 3RZCB 5GZOD 2VH5H 5JNYB 1S3KL 2MPAH 1INDH 2BSRB 1SVZA 2BJMH 2R29H 3L5XL 1E0OB 3VRIB 1CDJA 1MJUL 3HPLA 1QA9A 1CBVH 4MQSB 2VAAB 1KN2L 5FAAA 5DF0A 3HMXH 5IK3B 5HDOA 1OP9A 4HJGB 5IWLA 4U1JB 2R1WA 4FQXC 3O41A 5DJ0B 4NBYB 3D1MC 2VWEE 3BPOC 4Z0BL 1XEDA 4FS0A 3V6OA 2J6EA 4O2FB 2BNRB 1U3HA 5CEXA 5D93B 3BO8A 5CUSL 1KPVA 3HAEA 1TNMA 5ETUB 3WD5L 5C2BH 1U8JB 4RSVA 1BQHB 3REVB 3CFJB 2PYED 2FWOA 2CIIB 4W81A 3SDAA 4NNXA 1T1WA 1Y0LB 3P11L 4PJ7A 5KSVB 3HE6A 2GJZB 4J4PD 2H26B 4O02H 2D7TL 1I9JH 35C8L 1FZJA 2JJSC 3L95A 1CU4L 1KLUB 1KENH 4HFUH 4OCYL 3R1GH 3IDNB 1DN0A 1CGVA 3Q5YA 3UTSA 1KJ2H 2H6PB 4YHMH 3U4AA 4BSWB 1LP9F 1H5BA 3F7YB 3GMOA 4OFKA 4Y5VA 3PWUA 4YLQT 3ARFD 2C7UB 1P7QB 4JPKL 4ZXBB 4UU9B 1Q9WB 2J5LB 3WV0A 2NXZD 5KG9A 3T0BA 2JB6A 4KHTL 2N7BA 1AD9A 1ADQA 1R5IA 3ARDB 3C09C 1S7RB 2ZSVB 3ZT5A 3CFIC 4Y19A 4ZMAT 2UYLB 1CF8L 5I17A 1YYMH 2XTLA 5FK9B 1A7QL 3T2NL 4FG6C 1FAKT 1ZHLB 2EXYC 2QQKL 2W59A 4WTWA 1A6ZB 4N5UA 4L4VD 2IAMD 4QXUL 1UM6H 5T5NG 1BAFH 2FGZA 1B88A 2W91A 3I6KA 3RIAK 3F12A 1RIHH 4PJAA 2A73A 4LPVA 4TULL 2HLAA 5IB4B 3ZDYF 1CLOL 3ROOB 1JCKA 1C16A 2VDNH 5GSVB 3QUZC 5ISZB 2VUOA 3ARBC 3O6LL 4I77H 4H8WL 5C86A 2HT2D 3JTSA 3MRCA 2F54A 2X4NB 4P2RE 3AM8C 4JFEB 5DJAB 1CE6B 4PGEA 2WIIA 1NLBH 1SYVB 4NN6B 2FSEA 4I0KA 1SYSA 3KYOB 1LO2L 5DSCA 5FYJL 4Z7UA 3GUTB 1RHHA 4GBXA 3O3EA 3AU1B 4YIQA 4J7RA 1AHWC 3IDJA 3LN5B 4KKLC 4W68A 4WEMB 3FN0L 5HVFB 2EKJA 3KPSE 2KPNA 2MQCA 2J4WH 2HKFH 4LF3A 5CP3H 5KOMC 1JTOA 5DWUL 1U91A 2BY3A 3W2DL 5FV2A 3VFOA 2VXQL 1WEJH 1KGCE 1A6AA 4P99A 2CKBB 3GIVB 4OCWL 3ZE0F 2VOTA 2VABA 3MNZA 1XGQA 2DBLL 3VWJB 4S1QL 1NCDH 3OKKA 4HV8A 1RUMH 4DVBA 3SQOL 2V5TA 1KJVA 4LRIC 5L2KB 4RGOL 4KDTA 4XX1G 2BX5A 2IGFH 4NZRH 4XGZA 4CVXA 3OXRB 2QQNL 4KJYA 4NWTL 4X9BA 2Z8RA 4XCCL 1RMFL 1TZGH 4DZ8A 3MMEA 4GW1A 4JR9H 4OFDA 1AQDA 1G1YA 3ILPA 1YN7B 2OCFD 3U1SH 1XH3A 1AD0A 5LG1A 1VKXA 3KYNA 2P8LA 4J1UA 4NHCH 1G7JA 3R8QA 4YZFF 5IQ7L 3GBLA 4KV5F 1YEJH 3CC5B 4R0LC 1YPZF 3VGBA 2OZ4H 3MRRA 4ZUWB 3WEXA 2AK1L 4GAYA 4ISVB 4ODVL 2AK4B 1PQZA 1M71B 2X5PA 3EYQC 3LEXB 4HIJB 2X89A 5EULV 4D9RD 3HA0A 1J05A 5DQJA 1LP9B 3FB5A 3O3DB 4YXLL 4AL8L 2K1MA 1T5WA 5JW5A 3NA9L 4NRXB 5E99L 3S35X 5D6DC 1BWWA 4HS8H 4FFYH 4QHKI 3BGFB 4LVNC 1KTDA 4PLOB 5IW1A 5IGXL 5FKPA 2EDFA 2OR8A 3WHXB 1XIWB 2X4RA 4HIXH 1B2WH 4Y4HC 3V4VH 1D5ZB 5EWIL 5JPMA 4DQOH 2CR3A 2IANA 1U3HD 1R3JB 1HWGB 4HJJL 1EO8H 5EOTB 1R3LB 1C5BL 1UCBL 1K3IA 4YFEA 4JZOA 2HJFA 5L88H 4AG4L 5J3HD 1OAXL 1V7NH 2GW5A 1UZ8B 2VTFA 4MNQA 4DGIL 1K5NB 5CD5C 3SDAD 3V5KB 4PRNA 3HE6D 3DUUA 1XCTB 4OZGF 3FOLB 4XPAL 1T22A 3V6ZB 4E42A 4JZNB 3VGFA 2XWTB 4N1EA 4P23D 5ILTL 5D7LB 3BD3A 2A6KB 4PRIE 1DLFH 4QRRA 3PGFL 1MRCL 3WHE0 3WXWL 2EDDA 2ERJB 4R7DB 2DTML 3QHZH 5B39G 3S3SA 1IEHA 3T0WA 1TVHB 4LRNL 4PRPE 4QGYA 3V6BR 3BDYL 1NCBH 3NFNA 3HE7C 2CDGB 5FUZL 2V2WA 3DIFA 2HRPH 5IROC 1J1XH 1RIUL 1EBPA 2NY4C 5HTSA 4OCRL 4GUPB 4PJCA 4Y19D 1ZLWK 4OQTL 4CL7A 5DJ6B 1U8LA 1WV7T 3FTGA 3QISA 4KMLB 4MA1B 4UMGA 1PYWB 3FQTA 1YYLH 3RY5A 1VPOL 4JRYB 4TTGA 3OAYK 3KVQA 4L4TE 2B1HH 2EKSA 3DVIA 1ZKAA 5J13C 5FYKD 1ACYL 5I8KL 2ARWA 1T80A 2PW1B 5I19H 1LILA 2F54D 1NFKA 4OB5H 4Z7WE 5ISZE 1J7VR 4LEXL 3QUXD 2XPGB 4J6RL 3SE8H 4WRLA 4MAYA 5DVKA 4GBXD 1PSKL 3VMPA 3L3OB 3FT4A 3SCMA 3A6BH 3NA4A 1FL5B 1MJJA 2X42A 3JTTB 5JXAH 5BRZB 4I9WD 2AI0L 3BWAB 3GMNB 3RWGA 1MVUA 2BVPB 1WCBB 4R8WH 5MENB 1M05A 1MJ7H 4U0RC 1Q0YH 3ET9F 4OTXL 1YPZB 5DC9B 5KVEL 2OTUA 4XNMA 1K4DB 3F65A 3ZE1F 3H9YA 4MDJA 5I1AA 1NJ9B 3QO1B 4M61A 2VZOA 1RZKC 1UADC 1AO7A 2F9BT 4Z7OF 3QQNA 1KEML 4JHAL 5FHAL 1RZJL 1QQDB 1UM5H 1X5HA 5D96B 1EHLH 1WBYA 5JIKA 5JDSA 1QFWM 5HSFA 1HYRC 4ERSL 1QLRA 3QUMB 2V2TB 1R3KA 1UFUA 5DR5H 4JGJA 2DKMA 3KWWA 2EE9A 1KIQB 4YHYC 5D2LE 4HWZA 2DOCA 3BW9B 1A6VL 5ALBL 4RA0C 4CN6A 3DX9A 1I85A 2A6JA 5JHDB 3RA7L 3HNTL 4F9LC 5BVPL 4NQDB 3F7PC 2CLVA 4WW2C 3S34H 4B5EA 1FJ1A 1EEYB 5C07D 1WFUA 1JPSH 3IAGC 1F90L 4TPRL 3OV6A 3MRHA 4OZGB 4NC0B 5D7IF 2V7NB 2Y9RT 3QQ4A 4LQFL 4L9LC 3E2HB 1DBBL 4G6FB 1SJHA 3FQWB 4LKXA 1ZLSH 1P69B 1HZHL 3EJJX 2ZG1A 3N1QC 5EZIH 2X89D 4PGZA 3A6CH 1S7XA 3BZFB 1DDHA 2KH2B 3IFNH 5T1DL 5ADOH 1QPPA 4YFDB 1R5VA 5E2JA 5IW3A 2AK4E 3QNYB 1QKZL 3H6JA 3IKKA 1PJ9A 5T1LA 1HILA 4F33B 1CFVH 5JO5B 4P2QA 3KDMB 2X41A 3ZTJH 5IVXA 5JW3L 4U6HA 4BFGA 3TBWA 1DQLH 1MIEL 2IAND 5GGSA 4YEEA 3TNNB 1G6RA 3V5HA 1DE4B 2W38A 1LEIB 2Q3AA 5GRZA 1CLCA 1QR4A 2G5RA 4NP4H 3MLXL 4MNQD 3UO1H 1OGAB 3QCUH 1JTPA 1MF2H 1BBJA 1NGZA 1RZIB 3FFCA 5TFSL 2IQ9H 3N85L 3REWA 4LNRB 5TPWL 3GHEH 2W9EL 1PY9A 3ZDYE 3ARRA 1NBVL 2ADGB 3F6LA 3HAEG 3KPRB 3ESUF 3LHPL 4ELME 1TQCB 3TT3L 1JGUL 4RFEA 1N5YH 4QRRD 4Z7QF 4WI4A 3H7LA 3OX8B 3QEUB 4LCYB 3T4AA 1QP1A 1KJ2A 5D7LE 3T65A 1C12B 1T1YA 2I5YH 1X5XA 2L0DA 2O5XH 4I4WA 2VLRB 2C1OA 4M1CD 2IH3A 3BZ4A 4NGHH 5IMKB 1CGTA 4XNXH 3CD4A 4HKXA 1JRHH 1L9NA 4PJ9A 5BQ7B 4UNVA 3P77B 4BKLA 1K85A 5KTEH 1GGCH 2CDEB 2D0FA 2ZUQB 2AXGB 5EZLB 3KPOA 2KBGA 2F5BH 3I85A 2D7OA 1ZLUK 4JDVA 1N2RB 4JFDB 4K55A 4U6XA 5TE6H 4Y16C 5AG8A 3U0WL 4XP1H 3MPCA 5SX4I 4OV6F 4OLYH 1GOHA 3EDFA 5HDBF 1ZANH 1KC5H 5CBEB 1IQDB 1RJYA 4JFQB 4N0UB 2DQHL 5FDWB 2WM0A 4KK8D 2W9DL 4LMQE 5D1ZA 3HC4H 1PG7L 4UBDC 3QO0A 2BSTB 3MGOA 4NQEB 1MHEB 4MAYD 3HR5B 4N90D 2C1PA 3QIBA 4F37F 2J88L 3SCMD 1KELH 1QBML 1DBML 4KVCL 4YO0B 1EIBA 5CSZA 3TO4A 1L6XA 5I8CB 5E8OB 2BSED 4PGCB 3WLBA 4RBPH 1FFRA 5D7IB 5DD3L 3P4NB 3STLA 4LVHC 1OTUD 2B4CH 3OKOA 4U2ZA 2V17H 4HUWB 5IB1A 5MENE 3IFOA 4JQIL 5EU3A 2DIJA 4KV5E 1HKLL 5DK0A 4L29B 4RGND 3MLWH 1HQRA 5JHLL 1OM3H 1PGRB 5TE7L 3VDAA 4IRSC 2ICEA 2RAMA 4TUKL 3S4SG 5C0GA 5HVHC 5I30H 2WSKA 3X17A 4BA8A 3CDGA 3S37L 2I07B 3OHXA 4Y7MA 2VC2L 4K71C 5B8CA 5D72L 3QULB 5C0ND 4AMKH 5FA4A 1OP5K 4PG2A 1QFUL 1N26A 3FO2A 1HXMB 2IC2A 3AXLB 3CMOH 1JN6A 1UH2A 2DD8L 2Y7QA 2GITB 4N0CD 3QQ3A 4XBPA 4WVRA 4XMKL 3ELAT 1PAMA 1CFSA 1KBGL 3PWVB 3PXJA 4L8SA 4LVEA 1WZMA 4O9HL 5EO0B 3GSUA 3N1FC 4YJZL 1M6OB 3LPGA 4RNRB 1S5HB 3VFVA 3AAZB 4NQDE 1OT2A 4F7PB 2EE3A 1K8DB 3G5VA 3LKOA 3P4LA 1K4CB 3C5ZC 1YNLL 1BGXH 3U48A 4F7MB 2OZ4A 2GUOB 5FM8A 3BPLC 4XNQA 5HHPA 5IMOB 5IBUB 1ZT7B 5BZWB 4LSPL 3HC0A 2AEWA 5F3BB 3LN4A 3O2VL 5TF1H 4EIZC 4MD5B 3DMMD 1LGVA 3DWTA 2LU7A 4PGDA 3BVNA 3PWNB 5T1LD 3WBDA 1KEGH 2GSIA 4WI6A 5JXEC 4NZUH 2CRZA 4P2QD 1HI6B 1UEMA 1I8LC 1LEGB 3L3IA 5GHWL 4LLMB 4DUXA 4BQ6A 3PWLA 1OAZH 4YAQA 1ORQB 1NFIA 3L6FB 1JPFA 4Q6IB 2CKNA 4Y2DB 2CQVA 5GGRA 4QRQB 3SKUD 4JG1L 4J3VA 5EIIB 2ADIA 4XP9L 3JVGA 3O6FB 3SBWA 4CVWA 2FB4L 3U46A 5J12B 3T0XA 5AEAA 1OD7A 5LGHH 3SDYL 1U93A 3FFCD 4MZ2A 5KSUA 3MXWL 1C5DA 1P4BH 1FPTL 2R4RH 1AJ7L 3RKPA 3IJHA 2PTUA 5KOVC 4LLVB 1OGAE 3IF1A 4H1LB 3BPCA 1HIML 1QVOA 1FZKA 2G5BA 1G9NL 1ZEAL 4OLWH 3WSQH 5BOZG 4KK5C 4XNZC 4ODTL 2NY1B 3K8LA 4HC1L 1IM9B 3KPRE 5DFVD 4YDLC 1CDGA 1JL8A 3O45B 2HFEA 4LEOB 5DS8B 2XTJB 2BRQA 1DZBA 4OF6A 3INUL 1HSAA 1NGYB 5C0IB 5IMMB 5HHOB 2RFXB 5E03A 5IF0A 1UJTA 4KROB 1GYAA 4PJ9D 5HGBA 4TRPH 1ETZA 2OK0L 2OQJB 4JM2F 4HIEB 5EUOA 4Z95L 3B5TA 3IYLW 5MI0C 3ZKND 1F8TH 3OF6A 3RWCB 5KVGL 4AH2B 4PY7B 3BEVA 4XAWH 2V7HB 2OBGA 2J6EL 3VGEA 4GSDL 3DX6B 3MUGA 3U4EB 2H3NA 4YDJA 1OTTD 1U8OA 1B0GB 4JANA 4E0RB 1J1PH 1AFVL 2FJFB 2AERT 4G6AC 1Q9KA 3PHQA 4JGMA 4U2YA 1UACL 2IALB 3T2OA 4I2XB 5J6GA 3IFPB 1YEEL 5D1ZD 1H3TA 1T1XB 3MLYH 3QFJA 1RZ8A 3VFPB 5ICZA 1IEAA 2GTZA 5KVFL 3ULSA 5IOPA 5ID1B 3GB7A 1VFAA 1ONQB 3TO4D 5FA3A 1Z3GL 1BLNA 1Q9OB 2PCPA 3QUKB 5C0EB 4M9PA 5C0DA 2QEJA 4NKMA 3GIZL 3CDFA 2IPTL 4LCIH 3WFHA 4C56B 2I27N 1A5FH 3BOVA 1T0MA 2P43B 1ADQL 4NO5A 5JLZB 3IDXL 4HXAH 5I66A 5TGBA 3CVIH 3NVQA 4KXZI 2NY5C 1A4JB 2QSQA 1MRDH 1RU9L 3CJJA 3T77A 5F8RC 4JQVA 5C08E 3MV01 3QFDB 4LSUL 4OFPA 3QR2A 5I1DB 1FRGH 3BIBX 4LKCA 1KJ3L 5C0JA 3SY0A 1X5GA 2VLJA 3OZ9L 5ACMA 1MCSA 5GRWA 1CXEA 5L0QC 2G2RA 4F2MA 1ZS8B 3UYRL 4EI5A 1AH1A 3F7VA 2EYTB 4DFIA 1YEFL 4EDXB 5DRWB 3IU3B 5I76B 1ES0A 3U9PL 2Q8AL 5IVNA 4KUCD 2DWEB 1MHHB 4ZTOH 4BUHA 3PJSB 5GS0L 5F6HI 3OKMB 2IH1A 4PRIA 4ODWB 5LJYH 1U2HA 3O3BB 3MUJA 5DYOA 5J1AB 4OLZL 2CXGA 3W11C 2AS5M 3MR9A 2YKLH 3PQYA 3DSNA 5C0AB 2DQTL 2YD1A 4S1DC 4PRPA 3V95A 3E6FB 4XB7A 4G8FA 1BZ7A 2CGRH 4WO4C 1I1AC 4YUEL 4E41B 2YD8A 5ENWB 1UWEH 5EZOH 5KVDL 2FZ3B 4KKCC 5E8EB 3UZEA 4Z7QE 4DKDC 2COQA 2ITDA 4D0CB 2BERA 2E6QA 1G1CA 3LSOA 4JFYA 5DTFB 5MP6L 1MLCB 2N7AA 5AWNH 3G6AA 3U2SB 1OAYL 1XF5A 1BQLL 3WFBL 4JM2B 3SKJH 2J5LC 1AE6L 3LKNA 3QI9B 1FGVH 1DEDA 4M43L 4ZFZA 4XZUA 1BZQK 3BYTA 1CQYA 4L4TA 4UIMB 4Z78A 4IRZH 1R24A 5D7JB 4ZOBA 3T3PE 15C8H 5HYJE 4J3OC 3FHQA 2R8SL 5EC1B 1I3RA 3MRNB 3ZYZA 4GG6F 1Z9SA 4Z7WA 1QO3A 3CIQA 1S9WB 3HUJF 3MRPB 3I02B 1UH3A 4U1GC 3P73A 1VACA 5HDBE 1ORSB 5DUMH 3RY6A 1IKNC 4PJEF 5IV2A 2FGWH 2C3WA 5FO7B 1HHKA 4NQVB 2XRAH 3KPSD 3QWOB 5ALCH 3HI6H 1EXUB 2V9TA 4U6VH 2GQHA 4NN6C 4X4YA 1R5WB 4HT1L 2CSPA 3T0EC 3RZWA 1KGCD 1GIGH 1UZ6F 5J06A 5I15H 2BCKB 3OTTA 2YPVL 5JW4R 5DRXA 3MBEA 4L8BB 4HWEH 2F58L 1F4YH 1JWUA 4Q74A 3K4ZA 1YMHB 4JFZL 3GMMA 5EU4A 5HHOE 4JLRA 2VDOL 3CXHK 3OF6D 1GGYA 2ARJA 1NMBH 3BDBA 5TF0A 3TWCL 2E6JA 1JWMB 1ZWIB 1U8HA 2H45A 4JPVH 4FFZH 1DUZB 3BSZH 4ONFH 5D2LA 2X6MA 3BI9X 3HNVH 1MREH 2AXFA 1WJ3A 3VI4F 1BJ1J 1IZJA 5EA0H 1I3UA 3OKEB 4U3HA 5DO2C 3QFJD 4J3XA 2J8UF 3NFPB 3QG6A 4X6CA 4I2XE 4P5TA 3I6GA 3UTOA 3FQUA 3BDXA 3DVNB 3FB8B 2VB5A 2W0KA 3CSGA 4NQXA 1A6UH 4NC1E 4M3KB 5IFJA 5GS1B