4M61B

Crystal structure of unliganded anti-dna fab a52
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
220
Chain Sequence
EIQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGKINPYYGSTSYNQKFKGQATLTVDKSSSTAYMQLNSLTSEDSAVYYCARGRLRRGGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure determination of anti-DNA Fab A52.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab A52 light chain
total genus 39
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m61B02
2EYTB 3O6FB 4KPHH 3MJ8B 5GSVB 2ITCA 1WT5A 1CFBA 4Z7WB 4LP4A 5LGJA 4OLWL 1T2JA 2ZNXA 3BUYB 1ITCA 1E28B 3CCHB 1BAFH 2X4SA 3WNLA 1ITBB 4TNWF 1S7WB 3GMPB 1WV7T 3O6FD 5HJ3B 4CVUA 3BE1L 2CD0A 3I6GA 4JPIA 5FYJL 1C8PA 1MCWW 1BOGB 2FZ3A 3H9SB 2CDGA 4JG1L 5CEXB 2A6DB 3DMMD 2PTUA 1S7VB 1RUQL 2J2ZA 4DW2L 1F2QA 4LKCB 5T1KD 2HT3D 5C86A 3B5TA 3KXFA 3MJ6A 5CSZB 1VGKA 3SDXE 4XP4H 3GRWH 4Z77B 1CL7L 1NGYB 1GOFA 4CU7A 3TIEB 1NMBH 4YC2C 5F1IA 3VFRA 1J1XL 3TV3H 2E7LA 3VE0A 1EAJA 4K3JH 5JUEL 4JPWH 4G6FD 4BKLA 2APTA 1IKNA 3D9AL 4OFDA 1YNTB 2PYFB 5LBSL 2GY7B 1CU4H 4HPYH 1ORQA 3IT8D 5CWSB 4ACPA 4BJLA 4DZ8B 3GHBH 1QFWH 4LRNH 3RZWA 2NY3C 4PJ7B 5FM8A 4TSBL 1CDIA 1KPUB 5F1NA 5INDA 1FZKA 2F5BH 2F74A 2G60H 3BH9A 4OCLC 1AXIB 2AEPH 1FFRA 1HHKA 3DX6B 3LQZB 2VQ1A 1XF3A 1A7RH 2V7HA 2WBWB 5CEZE 4HV8B 2YXMA 1XF1A 4LSPL 4HUVA 2W65B 5IFJB 3MX0A 4ALAH 2PW1B 3MOBL 5I1LA 1NCAH 3KLHD 5HY9B 1E4WH 5IWLC 3D87B 3BZDA 2P5EB 2Z92B 4N1EA 2VH5L 4ZOCA 2BNRD 3QIBD 4HV8A 3NMEA 5ALBL 1YMMB 2XPGB 4JO2L 1BX2A 2BRRL 2AW2A 4HIJB 3C5SB 1OAZL 5IEKA 4OZIE 4LOUD 5C9KA 2QSCL 5J6HB 1JI2A 4ODTH 2YD6A 1L7TL 5DMJB 3V5KB 2WUBL 2DKSA 3IXTB 1TFHA 3RNQA 5IJKA 3OX8B 5JDSB 5DD1L 5TQ0L 4QRSB 4Q2ZB 3TJEL 3LPWA 4WRLA 1VKXA 1YECH 4LCCB 5ALBH 2JTDA 5TDNB 4NNYB 5I1CL 1J10A 1F13A 4L8SB 3BP7B 2NR6D 3CFDB 4XXCC 1YC7A 1B0GB 1IL1B 1PEWA 1EXUA 1T66C 3CSYA 4XHJC 1HDMB 2WM0A 4UNTA 4X9BA 4LCCA 2QSCH 1IBGL 3GSVA 1KTLB 4NRZB 4QTIH 4FQIH 1MHCA 1TENA 4MHHI 2FD6H 1A6WL 1C08B 1QFPA 1TJGL 2EO9A 5DQDL 4DGIH 2IADA 4LPYA 5D96B 3IS0X 4Z0XA 1JGDB 4V1DD 4DZBB 2VTFA 1T7VA 4TN9A 2AJZB 3CXDL 2IANB 4PJEB 4YX2H 3HE7D 3LN4A 4V2BA 5GS2D 4HZLA 4JB9L 3RWGA 3ZYJA 3D1MC 3IVKA 2I60H 5HHXH 4FG6D 3P4OB 1MHEB 3TZVD 1J8KA 1XCTB 1RZ8A 1WFNA 2VO5A 3C08L 1KXTB 3KPPA 3MV01 4ZFOB 3WHXA 3QEQB 4JO1H 5AWNH 1CIDA 1KNOA 2FEDC 4JQIH 4YHLH 3KPSD 1MRFL 3DJ9A 4YUEL 2ITDA 1JNHB 4BFIB 2CUIA 2AQ2A 2R0LL 5HYEA 1MCJA 1A3RH 5J6GA 3D6GA 2J3SA 3B9DA 1DBBH 3A0OA 3V5DA 2BNRB 4WWKA 3D0LB 2J8HA 2P5ED 3EYQD 4XVSH 4JRWA 4NQXB 3LRGA 4LGRB 5EUOA 4E42A 3KJ4C 4X8JA 1AHWC 2CKBA 5J1AA 2NTFA 2F8VA 3EOAA 4LHQB 5FOBA 2LVCA 3FOMA 1E6OL 4O2FB 4OGZA 4DVRL 3HMXH 2PXYB 1V7ML 1MFCL 2VISB 1VKXB 2D9CA 1F8TH 2RHEA 2VN7A 1RHFA 4IOSD 1V05A 1KB9K 2YN5A 3TYFA 1EUTA 2YBRA 1UA6H 2PR4L 2IBGA 2FJFB 4IDJH 5F9OL 4NBYB 1CT8A 1S7RA 5EIQA 2VSDA 4JQVC 5HXMA 2ITDB 4M43H 1YYLH 4BFIA 1QFWL 3LKNB 1N5AB 4NKOA 4TUJB 4N9GB 5CMAB 2DQUH 2BNQB 2H2SD 2Q6WB 5GRJH 1OP5H 1UA6L 2B4CC 2CDFB 1Z0MA 3AAZB 3H42L 5T5FH 1F8TL 4ZSOA 2EDXA 1U8IB 3TA3A 4N0UB 4KK6D 3ULUD 1CDHA 4POZC 5IJVA 1PG7X 1RJYB 4JZJC 4KJYB 4XVTL 4QRPE 3ALWA 4WWID 3QRFM 1EH9A 4WY7H 5DI8B 2IPKB 3H0TA 3D25A 4IRJD 4RSVA 4YDJB 3W2DH 4PGBB 4RIRB 2OP4L 5K9KB 1HXMB 3RIFF 5GHWL 4LARH 4AEHH 3PL6B 3NFSH 5BS0D 1T1WA 1DBML 2ID5A 3ISWA 4U2YA 4JM2C 4KU1A 4WGWB 4FG6C 3LHPL 4JN2B 4NNYA 2D4FA 3MZGB 2JIXB 4OCNC 2ATKA 1U8MA 1F4AA 3V6FA 3HUJF 3VCLB 2Q76A 3MZTA 4Z7UF 3CZFA 4GXVH 3MACH 4TULL 4YHIB 5DEGA 1UWXK 3Q6FB 3C5SA 2JIXA 1IGIL 1FIGL 4JHAH 2RAMA 1FNGA 1G7PA 4C55A 4KJYA 1MJUH 5I1JL 1XCQB 1JRHI 3NZ8A 3F7VA 5ERWA 4W70A 2DD8L 3VFVB 3STZA 5EZOL 2VERN 3QDJA 3VMPA 4RFNC 5FAAA 4GKZB 4UV4H 4L8CA 2VL5A 4BUGA 4FABH 4WV1C 4HS3B 3ARDC 5JW5B 4WI3A 5C0CE 5ID0A 1FZOB 5CMAA 2DWDB 2FGZA 5IVZB 5C8JA 2GJJA 4MJIE 1F3JB 2DQTH 3D0VB 4YHML 1Y6NR 3ULVE 4JQIL 1UJ3A 3U7YH 1Y18A 2LU4A 5ENWB 4E5XB 4D2NA 1SMOA 1DBJH 3PWLB 4PRHA 3L3IB 1D5BB 1NCDL 5D6CA 2VISA 3I02A 1N5YH 4KROB 1XF4B 4N1HB 5EOQH 3WL9A 4ZG1A 3M1BB 3SE8H 4G3YL 1ZHNB 2P8MB 4HUXA 1MH5A 4Z5RA 1F00I 3OXRA 2QV2A 2ZNWA 4ZUWB 5EU4A 1BWWA 2FD6L 1RUKH 1KT2B 3LIZL 4JFFE 5E56A 1N7ML 4G6MH 5D1ZB 4CU8A 2W9LA 4GMTH 4KTEL 4ODHH 2J88H 4KKBD 5IB5B 5DK0B 5I1DB 4XVSL 3NPSB 1QSFD 4MX7B 5DUPH 3ULSB 4X6CE 5EU6A 5E03A 1H15B 5IKCB 1H9VA 1KPUA 5F1NB 4HEPG 3KJ6H 5C0ND 1JUFA 2HJFB 4X6FA 4P59H 3MRIB 1I1AA 3R0NA 2I5YL 4JKMA 4MZ3A 4DGYL 2VQ1B 4TSBH 3ZSSA 4EUPH 4FFZH 3GKWL 4NM4H 4CVXA 4G8EB 5BVPL 1EO5A 2HFEA 3VFRB 3VWKD 5IG7B 1X5XA 3OHXA 4JFEB 3MC0A 5J11C 1N8ZA 4JFDB 1YPZE 4HT1L 2PYFA 4JRYD 4JFQB 5CEZL 4HKBA 4HIXH 5MENA 4AMKL 1G0DA 1V3JA 2VDNH 3L3DA 5SWSA 4L29B 2A73A 1D6EB 4K94L 4L3ED 4PRPE 4XXDA 1XGYH 5TE6L 1A1OA 4L4TD 3ARYA 4IIQC 2F58H 1S5HB 3FRUB 4PJCF 5IVXF 3OKKA 2X4QB 1MVUA 3EJZC 4GG6F 5J11B 1TDQA 2ADIA 3B2VH 1LD9A 3IDXH 4MD4B 5DRZB 3HPJA 3HAEG 1YEHL 2F58L 4X8JB 4LLVB 1CL7I 3KWWB 4JR9H 5A2IH 43CAB 1J12A 1NBZB 5KSUA 4P2QB 1RZIA 4Y4HC 5C0DA 1BF8A 4ZD3L 5HI4C 2G60L 2YA1A 1ZANH 4C4KO 1I1CA 3WDIA 5I1GH 4LVEA 3WN5A 1CTOA 5I1EL 2GUOA 4QNPF 2AJUL 2X4NB 1FC2D 3F62A 3MROA 3T0BA 5C2BL 2IF7A 3D3VB 5I16A 4A2MA 3L6FA 3MLXL 1FE8H 2F54B 1GCFA 1NDMB 4G8FA 1DBKL 2P8PA 4JFDD 4CADA 1QSFE 1P4BH 3PE9A 3EDJA 5FA4A 4APQD 3NZ8B 5ERWB 3C5ZC 2H9GA 2ZSVA 3PWPE 4F15B 1AGFB 2X4QA 3ARXA 4Q0XL 2JCCB 3F5WB 3BGFC 3QRGL 2VAJA 3MYJA 4JHZA 4JAMA 4JCLA 4KY1H 4Y5YA 3I9GH 5A43C 3H9SE 3MOQA 1FGVH 4NQED 1C1EH 1FBIH 1P9MA 3V6OE 3MCG1 3L3HB 1IGYB 5HHQA 3E2HC 1J0IA 2ZSVB 4OT1L 1P7QA 1IC4H 4XGZA 1Q94A 5ADPL 4OZHF 3QIWD 5CD3B 5D7IE 1MHPH 3FT3B 5FA3B 2EXWD 2R9HD 2CKNA 2V5YA 4KK8C 4WV1B 3B2UD 3RX5A 3BIBX 4PJIB 5AEAA 1HHKB 2APBA 4LGSB 2X7LB 2JF1A 1A1NA 4X6BA 4PRIA 3ILPB 4KKNA 5LWYL 5C6TL 3O6LH 5B39B 3G6DH 4KTYA 5FGCE 3HMWH 4ZUVB 1JNHA 5D70L 2YPLD 4F7PB 4RQQA 4WHCA 1J8HA 4ZAKA 1IC5H 4UV7H 4M3JA 5I1DA 3UBXI 5EO9B 3P77A 4ISVA 3TNNB 2WWMD 1HKFA 2OMNA 4IMKC 1R5VB 3TBWB 4M61B 1P69B 3BO8A 4JRYB 1KYOJ 1W72B 4ELMB 4NZUL 4HK3J 5DRWB 4G6ML 2NY2B 4OKDA 5EFIA 5HHQB 4PJ8D 1FVEA 1HQ4B 3GIVB 1MWAL 4KK6C 4L29A 2AXFA 5C0AD 2YPKB 3EAKA 3TCLB 1DEEB 1QYGL 5E7BA 3EOBA 4U1HB 4U1IA 1BECA 3MRKB 5HHMD 1KIPB 1A3LH 4YDLB 2C7UB 4UUJB 5IP4A 1LO3L 1AXSB 3MRPB 4LLYB 4WW1B 2EKJA 5ESQA 4I77L 4H25A 3CZJA 4QRUA 4OFIA 4EOWH 1NJ9B 3AROA 4GQPH 5C0DB 1P4IL 5EU3A 1JWMA 3TO4C 3MV11 4JFYB 2XIDA 2NZ9C 1P6AB 4OCRL 2HJFA 4X6FB 3QJFA 5C08B 4ZFFA 1Q1JH 3VXSE 4FQCL 4DZBA 1N6UA 1FCCA 1CYGA 3HC4L 3NIFF 4N8VG 4D8PA 4RAHA 4UNVA 1X5AA 5E8EB 1OB1A 1S5IL 3MRHA 2DQGH 3VXSB 2FATL 3MV7A 3RWJA 3IAPA 3EYUH 1OAKL 1H0DB 1H8NA 4FTVE 3WJLA 2OMBA 4KKCC 4KTDL 2D7NA 1WUNT 4YAQA 1LE9B 3U9PH 5DK2A 3RGVD 3RIAF 1FPTH 3L7EA 3HC0A 3FFDB 4PJ5E 3UX9B 1L0YA 4M4RA 5J0BA 5EWIL 2BVYA 5F96H 2NX5E 4XNZB 1IRAY 3PQYD 2CJUH 4NN5B 5JMRA 4P57B 1JNLH 4NJ9H 4LCWD 3EBAA 1CXEA 3W39B 4HJ0D 1MFEL 1SVZA 5IHLB 1NC2A 1VADB 3O4LB 2GJ6A 3A67H 3TZVC 2HVKA 2FHCA 4DVBA 4M7ZC 4EEEA 2VMFA 3Q5TA 3VA6A 4XMLL 4R7DB 2GSGB 4LNVA 4WU7A 1T03L 4PYGA 3SKOA 5IV2A 3DMMA 1PZ5A 4AM0A 3KXFD 4XGZB 1OLLA 2NPLX 3SE9H 2WANA 3QDGB 5A16A 4QOKA 2A77H 2HLFD 1ADQH 4KAQH 1YJDC 3HPLB 1N6QH 5AD0A 3MRLB 4QRUB 4QKXB 1DBBL 3FFCE 3G6JE 5ANMB 3PG2A 1G1YA 4TOYL 5HYJB 1ZHKA 1ZV5A 5JHLH 4FOMA 4Z7VF 3RFZC 4HIEA 3VGAC 1TJIL 3MNZA 4HEME 1NFDB 1JP5A 1TJIH 2HRPL 1T20B 3BKML 4GAGL 2XKSA 4LSTL 3F7YA 3ZKXB 1XFPA 5EBGA 4OCSL 1VPOH 1RK0B 4LVHC 5D2NE 2M2DA 2YC1B 3DUUA 3V7MA 1GZQA 1A9BB 4XVJH 4M9PA 2ADGA 3WE6A 4PGBA 3O4OC 3BQUD 3RVUD 3UJJL 1JWSA 2O61B 4K94H 4BA8A 5FGSA 2P42B 4UB0L 4BSVB 3NGBC 1UKSA 4FQIL 4Y4FC 1YEKH 3B9EA 4X4XB 2FYYA 3MSPA 2BNRA 3QIBA 2UWEE 2ESVE 4I18B 4JGMA 1QQDB 4JM2F 2O93L 3DTXA 4V1DB 1IM3A 3Q1SH 3LKPA 4HS8H 4FTVB 5J13B 5CJXA 1ZWIA 4EI6A 3WDJA 4FQHA 2EH7L 3S97C 2LV4A 3IDIA 4JVWA 1YECL 5CD5D 4LEXL 3UTPD 4RWYL 4IM8A 1BVKB 3QZWB 1SVCP 1J1PL 3QDGD 5C08A 3FQUA 5L7XH 3EHBD 3SDYL 2X4RA 5HI5D 5L8JB 4JM2A 3FO2B 1MHHA 4X7SL 3HS0B 3QDHA 1CXKA 4I3RH 1NH6A 5DWUL 4K9EH 1K5NA 1RZIB 1SJXA 3FFCB 1BJMA 3SJVD 4MJIB 4TSAL 4Z18A 5IB2A 2B39A 2A83A 3IJYB 2OL3L 1FV1A 4ZQKA 3SE4A 4K7PH 1OSZA 1DR9A 1JWUB 4OCYL 2IFFH 4F7TA 5CBAB 4NQCB 1W8NA 1CZ8H 4FQ1L 5ELIA 1YPZB 3O45A 5T1DL 3HE7A 3PWVA 3QUYC 2A6JA 4Y4KD 4XVUD 4E5XA 3HC4H 5LAXA 1GGUA 1YJDH 3QPQD 4GBXD 4J3WA 5HHNB 2GITB 4NSKB 1B2WH 4J6RH 1EO7A 2ZCLH 4MJID 4NQCA 4UTAL 1RY7B 4FZEH 3MLUH 3WIFB 2YRPA 1SEBB 5A3ID 1ROWA 2VLLB 4MB5A 2ICEA 1E27B 1KB9J 3LD8B 1RVFL 1WGOA 3QUZD 3N0PB 1Q0XH 4QTHA 1MFBH 1NCDH 1T83A 1K5NB 1OAXL 2XN9D 5F96L 4YDKL 3C6LC 5C0FA 2IH1B 2QHLA 1MCPH 4J3SA 3S35X 3U79A 1X5HA 3CVHL 4JO3L 5M7QA 4OLEA 2YUZA 2AV7B 1KEGL 4O02H 4YJZL 1U8QB 2NY5L 5LXGH 5GZOD 1MJ8L 4NZRL 1HZHH 4WUUB 5GSRB 5GQBA 2Z92A 4XWOD 4FQPA 3NABH 4HAFA 5IGXH 2C5DC 1RZGB 1BQHA 1FNHA 3WO3B 1KV3A 5HDBF 5CKAA 3BQUB 5JPMA 4YFEA 5IFHH 3WFEH 2F5BL 3KYNA 1NLBH 3PDGA 1R5IA 4JPKH 5T3ZH 3REVB 1EERB 4X83A 3V6ZB 2Q3ZA 1LE5A 2R0WL 2YXFA 4XC1L 5CGYD 2R0KL 3GSQA 4JREC 2HH0H 5TQ2H 4A2LA 1MHEA 4Y7MA 1FDLH 1YNLH 1NCNA 1XZ0A 3FO9A 4KXZI 4H26B 1GZQB 4OB5H 3NIGF 4AL8L 1BJ8A 2H32H 1TTUA 4KUCD 2ZZUT 4MJ2A 3P2TA 2JJSA 4XVUC 4S1RL 2YPKA 3TCLA 2P1YA 4L8DA 1RZKC 3ULUE 3QXAB 3IDIB 5M94B 4KQ4H 1YN7A 3O45B 4LCIL 4MCYB 3UJTL 4XVTH 1ES0B 3BZ4B 4LLDA 4NRZA 3ULUF 3NVQA 3VXPB 4CBPA 4HUNB 2R2EA 3BPCA 4Y8AA 3VFSB 5M95B 2W0PA 1QQDA 4N9GA 1MCEA 1WFTA 2OP4H 4HUVB 4U3XA 5GRJL 1HINL 4U1SA 4RFOL 2VXVL 3FT2A 4TPRL 2XY1A 3S3JA 1IKFH 5KSAB 4ZXBA 2EDDA 4M43L 5INDB 2VZSA 5KS9F 1LILA 3MRDB 3ARQA 4HQQL 2X05A 4MQ7A 4MYWB 3VXME 1LWRA 3QI9C 2NYYD 5I1GL 3EYQC 2A6KB 1S9YB 2WW8A 4PGDB 3QEQD 4TUJA 5I30H 1N26A 3DTXB 5ABDE 2FX8L 2IFGA 4JO4H 2CLVA 4W81A 3ESVF 2EDYA 1X9QA 1JNNH 3VGHA 4YHNA 1IGYA 2FNBA 5E70A 2D03L 4U1LB 4JKKA 3OAUH 4U0RC 3MFGB 1AQDA 4P57A 4NN7B 3CFCH 1R5IB 2HTLD 2R23A 2AJYL 4NC2B 3T3ME 4U1JB 3U48A 5I76A 2JELL 4FNLH 5GRZA 5BW7A 2DM3A 1NAMB 5LGKA 1KJVA 1J0YA 4KKLC 3FTGB 5D96C 1FVCB 3QFJA 3BN9D 4WUUA 4KK9D 4D0CA 1QR1B 3PDOA 3FQWA 3WNOA 2KQMA 4LHUA 3U1SH 4EBQH 1T1YB 2AP2A 4XZUA 5I71B 1OW0C 2OTWB 3QISA 3T8XB 1S78D 5EB9A 1MHCB 1T21B 2V7NB 5JIPA 4LKXA 4XPGH 3W39A 1IC4L 3U0TA 5AD0B 2YHGA 1F97A 1SQ2N 1FFQA 2FX9H 5EBLB 4Y16C 3NTCH 4L3EB 3EDDA 2UY6A 5HHVH 2R56L 1UEYA 1KBGH 5KSAC 1FRGH 1JFQH 1Q0YL 5TE4H 1HI6B 5ANME 3W9EB 4HFUH 3F12B 1WIOA 4NQXA 3JV4B 1GIGL 3GMPA 3D85B 5TFSH 4AZ8A 4NRXA 2BDNH 1LO0H 1MI5E 2VWEE 4RGMB 4ELMF 1W0WB 5EBWB 4RFEA 2NY3B 4PG9A 1MCLA 2CDGB 1G9NC 3KPOB 2IQAB 4MA7L 1D6VL 4QO1A 2BMKA 1JRHH 3UZEA 4RRPG 2YOCA 2HMIC 3IDYC 5F7KC 3ZYIA 1M7IB 3BP4A 5JOFB 3JWDL 2EEAA 5ACZB 5IFJA 3H3KA 5F1SA 2XFXA 3ZDYF 4ZOBA 4LCYA 3UYOD 4L3EA 4PJ9B 5I6XB 1O7VA 5GRUH 3ROLB 1FFPB 1KCLA 3SDAC 3IDYB 3JZ7A 1CZ8L 2EDJA 1OAZH 1TMCB 5AZEL 5GRUL 2OK0H 2VXUL 1DBMH 4K7PL 4NQEB 2HJKB 4K3DH 4L8CB 1DCLA 4OZ4A 4BZ1L 3EO0B 5IIEB 3HB3C 4PJ9A 2HT4C 4PJHB 4WNQB 5F9WC 3VJ6A 2MKLC 4JHAL 2NY7H 1LEGB 5HHOA 3E0GA 1NAMH 3G04A 4OFPA 4K9EL 5IB3B 3QDAA 4GRLA 5JXEC 2LABA 3K4AA 2JJWA 2NX5D 1J1OL 3QCTL 2FIKA 3MO1B 3PL6C 3LKOA 4RCAA 3SDCB 4QYOA 4CNIB 4X7TA 3HUJB 3IFNH 4PLNC 2E27L 4P5TD 2KQNA 2Y06L 5D2LA 2PO6A 3H2WA 3CK0L 4QT5A 1AP2B 2DQTL 2F53D 2AJXL 1EEZA 5E2JA 3QUKA 2NXYD 4ODXA 2Y4SA 4LEOB 3D85A 5I73B 1DDHA 3E2HB 4N0RA 3LKSB 1NMCB 1T1WB 4PJBB 1LQSR 5C1MB 5EZIH 5DJ8A 4NQEA 2ICCA 3P0GB 1FLRL 5D7LA 1Z6JT 35C8H 4GQ9L 1AJ7H 4XP4L 3SCMB 3WFZA 2A2QT 2HJLB 5H35A 4G8IB 5SWQB 2GY5A 4NCC1 1P4LB 2H6PA 2Z8SA 3M17A 5JHDD 4HWNA 2ESVB 4XC3H 4P2RE 4JPWL 2N1KA 2V2WB 4P3WA 1Q9KB 3TPUA 1RUPH 5BV7H 4OD2A 2VJXA 4OTXL 5DD0L 1BGXL 3DXAB 4GKNA 5IMMB 5IVZA 3VFMB 1I9JL 1CD1A 4HUUB 4JJHA 1WTGT 2XKNA 5D2NC 3UTSA 3MYZA 2I9TB 4ZFOL 1AP2A 4TOYH 2GUOB 3AS1A 2NY1C 2KKQA 3ILQD 1G6VK 4NNXA 4OIBA 1T6VN 5BXFA 2WK2A 1D6EA 1QSED 4WFFE 1T89C 5FUCE 3G08A 2H45A 3BXNB 1AKJB 3N1PC 4N5UA 2NW2B 3ARWA 3I2CL 1OF2A 4I13B 2FATH 3P9LB 4XBGA 4U6YB 4GRLB 1AGFA 4NIKB 3BT2L 1S7XA 3UTSE 1EHLH 2X09A 4CN6A 1RFDH 4UTBH 4RBPK 3BXNA 2VC2H 3HZMA 5JW3H 2FBJL 4CN4A 3T2OA 3MRGA 1FDLL 1YNLL 4R97B 5EU6B 3LCYA 3PGCB 1DL7H 1NFDF 1SMAA 3QIBC 2BNQE 3VXUD 4ONGL 4KV5E 3ARBD 4MJ6B 3UTZA 3FO0L 4XI5C 2G75A 4HIHA 1FO0H 1WK0A 5DK0A 1OD7A 3IJHA 2Y5TB 1B6UA 3NABL 2P45B 3IXAB 4MDJB 4YNYA 5CSGA 1IZKA 2ZCKH 2ZPKL 4U3HA 2HAZA 5SWZE 4LSQH 4OD3L 4ZO6A 5DTFA 3MV7D 4NHUB 4GG6B 4YQXH 4G80A 3T0EA 1QRND 4WUKH 1KSRA 2BRRH 3SKMA 4G6JH 2MMXA 3AAZA 1A6TA 1X6NA 1BX2B 4HBCL 5K9JL 2NY7L 3V6OC 1I1FA 2R1YB 5CIPH 2X4OA 3L3OA 3QBTB 4E41E 4EDXB 2CPCA 3LKRB 4HWEL 2VLJB 1RIVL 2VZ3A 5CZXC 3KR3L 5ESAB 3T3PF 4BSWB 4BZYA 1P1ZB 4ONOA 1TZIA 4B0MM 3QWOA 1SY6L 4P4RB 1HKLL 3NFPB 2ZCLL 2X4OB 1SEQL 2ADJA 2QR0A 1HOCB 4KHTL 1YEJH 2EIZA 5IM7B 1F90L 1NC2D 1KNOB 4HZAA 4G42B 5DA4A 2KPNA 1NUFA 2B20A 2X1OA 1MUJA 1KN2L 3MLTB 4F15C 5BRZE 1TVHB 2ZOLA 2E3VA 3U82B 3OKOB 2XQYG 3TBSA 2X4UA 5HYIA 4JRXD 1OAYH 4GSDL 4X5LA 2CH8A 4KQ3L 5ESVA 43CAA 2CGRH 4Z7VE 4JPVL 4AT6B 2Q86B 5HI3D 4P2OB 4M8VA 4Y19A 1CFVL 1QVOB 3FONB 1S78C 2O26U 2NYYC 5EN2A 5MP6L 1TVHA 1P2CA 4Q9QH 5D7IF 4EIGB 2FWOB 2BP3A 2DLFL 3MR9B 4OLVL 3QXWA 4K23H 1GHFH 3X14B 3I84A 4R4BA 5F9AC 3IJSA 5L9DH 4KKCD 1CG9B 3IAQA 4DW2H 4TNVK 1U8HB 5H8DA 1XCQA 4PJ5D 3VFGL 3IFLL 4JLRB 5DMIL 2QADD 4ZO8A 1AY1H 2CUMA 1U8KA 4BFGA 4WO4C 3BKYH 2EH7H 3BH8B 1KOAA 4ZMAT 4U1NA 1CU4L 4HPYL 1CGVA 2EIBA 1B90A 2XRAL 2I60L 3LEVH 4K3JL 5JUEH 5DJZA 1IC1A 4MAYD 3WLWD 3LS5L 3ZDZE 4AIXA 4I0PD 3ECBB 3LDBC 3T4YA 3L3KA 3WSQH 5GJSH 1SJEB 2V5SA 2W38A 3WN5B 5HYQA 5MHSE 4UT7H 3NCBB 1UCBH 2HLAB 1FG9C 5IBTL 1I7UA 2EDNA 4NNPL 3ZTJG 1T5XB 2EDLA 4OD2B 4H88H 4HD9A 4L5FL 4F9PC 4BUHA 3MXVH 2XKNB 5J13C 1NGZB 4OZGB 1PSKH 2PYEB 5TPWH 1NCBL 2ED9A 4RX4D 1EEUA 5C09D 1M7DA 3PWJB 4LSPH 1FFNB 1S7UA 4PBXA 1ZHBB 3BIKA 4ORGB 2A6DA 5I75B 4JDTH 2KL6A 2C9AA 4XNXL 2LQRA 3S34H 5CJQH 1W72H 5A16B 1SY6A 5ACMA 1CWVA 1RJYA 3DSFL 5DFTA 3BHBB 3RVVC 2Y6SD 4WI5A 3WD5H 3M17B 1GOGA 2OYPA 4AEIH 1BZ9B 3QIUA 2WBJA 2VE6B 3DVFA 3WUZA 1UH4A 2BVQA 1YQ2A 5DD3H 1EBPA 2C1OA 5J1AB 4JM2D 3HLAA 4R2GB 3VFUB 5FYJE 2K9UA 3PQYB 5HBBA 4GOSA 1A1MB 2OL3A 2ARWA 4R3SB 1LEKB 2AJVH 2GSGA 5C0RH 4I2XA 2YZ1A 3UJIH 4PY7A 1VERA 32C2A 2FLBT 4JGJA 2J8UA 4C54A 2WSKA 3C2AL 3SCMC 1A6TB 4XH2B 1PD6A 1LO2H 1HNGA 4NQDE 5T33L 4QRQB 3BUTA 3B2VL 5DJ2B 2B5IB 2J4WH 2W0LA 4Y4KA 4LPUA 5E2WH 1UM5L 2DLIA 3SDXA 3C6SB 3PHQB 4PPTA 3W0WE 4P9HH 4P9HC 4QOKE 4GKOA 1RUML 4JREB 4WDIB 1NFKA 4MJIA 4JO4L 3MCLL 1RJLB 5E6IC 1T7YA 3H8NA 4KI5C 3T04D 4UU9A 5JR1L 2DM4A 4H20L 3L7EB 4GS7B 1OTUD 2J8UE 1NBVL 1HH6A 4O58H 1A9EB 1BM3L 3WBDA 5MERA 1KTLA 3QUYD 1TZHB 2Z31C 3FN3A 2H1PH 4BQ9A 5AYUL 3DX8B 4OQTL 3HC3H 2E7LC 4JFEA 4MJ6A 2XN9A 2HLAA 1Z5LB 3RWJB 4P3CL 4OM1H 4PB0L 4DKEH 3WJJA 4PLJC 1JPTH 2YUXA 3HCVA 3KJ6L 5JORA 1Q9WB 5E8DL 2IWGA 1T5WA 1QNZL 4Y0GA 3UEZA 2Z35B 4AENA 1BZ7A 5GIRA 5DRXB 2D3VA 2R0KH 3F65A 4NKDB 4OQ1A 1JZ7A 2AK1H 4WU7B 5ID0B 2BCKA 3SDAB 1WBZA 1BJ1H 3CDGA 3STLA 4IS6B 3CUPB 1ZOXA 1BZ7B 5D1QD 1LO5B 4D9QE 6FABL 1UM6L 4QXUL 3K7UA 4GJTB 4MMZC 1VESA 1REIA 5HYSA 1PG7L 4XPBL 2XNAA 4MAYB 3NCEB 4R7NA 3GB7A 1PG7H 4LMQI 3DV4A 3FONA 1EAPA 4FQXB 4LOUC 5LCVH 1BMGA 1HSBA 3AS3A 2WBJC 4RNRB 4U1GB 3AREC 2OSLB 2IALA 4NQDD 1XIWA 7CGTA 5DLML 4PJIE 5MENE 4IOFC 3X3FH 1EV2E 4LFHG 1G7HB 5H37H 3LPGA 4ZUSA 3KLSA 3TYGH 5DC4B 3MLTA 5L2JB 1U6AL 5MEPA 5HPMB 3MRLA 2IBBA 1EUUA 4N8CH 1HH9B 3SEPA 5KN5B 1UEMA 4MX7A 1T21A 1U8NB 2Y07L 2Z93B 5T3ZE 3HZVA 2D7PA 3DYPA 4MA1C 1ERNA 3NPZB 2P43B 2DBLL 3OQ3B 2VOTA 1VACA 2G5BA 4ZXBD 2VDKL 3N9GH 4LPVA 3OTTA 1YEKL 3QP3A 3WIFA 2Q3AA 3V9FA 1ZT1A 1K2DA 4QT5B 1WZ1L 3K74B 1MIEL 1QEWB 4PJXB 3MRJA 4FS0A 4HJGA 4NC1C 1NGPH 1OQXA 2BSED 5EBWA 2DI9A 5GGQL 3FQRA 4GMSH 1Z9SA 2APFA 2DQFA 5GS1A 1DSFL 1XR9A 1IGTB 1RZ7H 3SKNB 1K2DB 2HRPH 15C8L 5TE7H 4KZEL 5TH2A 1X4ZA 4N0CD 1YQVH 3H9ZA 4MJ5A 43C9A 2VZVA 4LK4A 3BKCH 3CGTA 2FBOJ 3U4EA 3GBNH 3GGWB 5FCUH 3GSNB 1F4YH 1DTUA 4M9OA 2Q8AH 1H3TA 4KK8D 4M6MH 2ZOKA 5DFVD 3Q3GA 4G6KL 4F80A 4OGXL 4YDIH 1OGAB 4D8PB 3OF6D 3CLEL 3X3GH 1FFNA 1S7UB 1U9KA 3H3PL 2Z4QA 3CPLA 3DYOA 5D1QC 4HULB 2JCCA 5JMOC 1RJZB 3NA9L 2R2BB 1OT1A 3ARGB 3ZHKA 1J18A 1KB5A 3RU8L 4Z7QE 5GRVL 4ZAKC 2HLFC 2R4SL 4YHLL 3IU4L 4H25B 3OGOE 4RMWA 3TBTA 1FGNL 4G8FB 4X0KA 4HCRH 1I8LC 4I9WE 4MXQC 4JKLA 1KLUA 3MMEA 1ETZA 2Z91B 1OP3H 5E8NA 4WO4A 4KVNH 4Z8FH 3M07A 2BVPA 2VLRA 2XNAB 1S7RB 2AXHA 2XZCH 25C8H 3HMXL 3ES6B 4HHAA 3THML 3O6KL 4YGVB 4OFYD 1L9MA 3OPZH 4KDTC 3ZTNL 4K23L 1YN6B 5DJDA 4F7CA 5FYKE 4LCCC 1DBAH 4DGVL 4HMDA 5DJCA 1R5VA 3FQTB 3HNSH 3TBWA 1MLCA 3IDNB 2QQKH 3KYMB 3MREA 4JZJA 5H37G 2QHRH 4ZS6C 3RUGB 4KGLA 3KPQA 3BMWA 4LPTA 2K3TA 2XZAH 5FYLE 3O0RL 1WVZA 1SBSH 2OJZL 5EPMA 3TT1H 3F7YB 1MEXL 3RBGA 4D0BB 3SCMA 3U6RA 4K7FA 4YHYB 3CFBA 1EHNA 4P59L 1VDGA 1BVLA 3SDDB 5J7CC 4ZD3H 3PDOB 2FJGB 1BQUA 43C9B 1B0GA 5HYJA 2EC9T 1FFOA 4YHZL 2D9QB 4WU5A 5D7KE 1F02I 4LPWA 1CTNA 3MXVL 1PW3A 4Z7WF 1J0JA 2B2XH 4N0CC 2CO7B 5LGHL 5ESQB 4RGND 3N85H 3DARA 3P0VH 5CSBA 3VW3L 3S9DB 4K3DL 5CZKA 2R23B 3O2DH 4YR6A 3VFNA 2CXKA 2UYLA 3KPNB 4WTWA 3UTOA 3U83A 2DS4A 3MV8B 2FJHB 4Z0XB 1YPZF 3AM8C 2WNGA 1A7RL 3T0DA 5C0AE 1WSST 3WXVL 1VHPA 3BMVA 3LEVL 5FFLA 4OBSA 1IGMH 1GC1L 1QEWA 1CICB 2AGJL 3UTTD 3UTTE 1A6AA 4MB3A 2NX5A 4PY7B 2A9NL 1AD9A 4RFNB 5BOZG 4TVPL 5BMFL 1KLFA 5F93C 1S5IH 4PJCE 4YDVA 3JWDH 3MRRB 4UT6H 4DUWA 2ED7A 2F54A 1U92A 3QDMA 4M6OL 3IDMB 4P5TA 5D1XD 4PJ8C 5DD1H 1KB5H 4NRYA 1HIMH 5C07A 5AAMA 4XRCB 3W9DA 4ZS6D 2F53A 3U0TB 4N90E 2ZG3A 3T1FA 1FV1B 3RWEA 3T77B 3C5JB 1MIMH 4J3VA 3AFLA 5E9DB 5EUKA 1I9EA 3CLFH 5C0JB 3QQ3B 4ZNEE 1JIBA 3QG6A 1KIQA 5F9JB 3FB8B 3BDYL 4F8TA 1H5BC 1U8JB 1OCWH 3PL6D 1OWWA 3CDYA 4MNGB 5GGUB 5GZND 2GCYA 4HFWA 4PS4L 4U1KA 4U1MA 4WEUD 3J7HA 1HSAA 3FT3A 2I07A 3P73B 5IW6A 3FRUA 3RVXD 4ESKA 1OGTB 1MVUB 1T2XA 5J1SC 1ES0A 1F4WL 3BZ4A 5DJ6B 5EC2B 2HVJA 4PV9B 3BWAB 5E6IA 2YSSB 3QJFB 4ZFFB 3VXMB 4DN4H 3MBEC 2W60B 5HI4D 4DQOH 3HN3A 2GEEA 3EOYG 2BFVL 4NQDB 4Y4HD 2RCSL 4OLXH 4F3FA 3GSOB 1CE6A 2VR9A 2Y23A 1AIFA 3K2MC 3UTSD 4PUBH 3DWTA 5IOPB 5KVEH 3ARGC 4G8GD 5CS7A 2O5XL 2H32A 4XCCH 3O6LL 3OR7A 4O2CA 2CDFA 1U3HB 4ERSL 1CL7H 5GGVY 3C2SA 3GZKA 1U8IA 2H2SC 5DJXB 5KVGL 4I18C 3W5MA 1D9KC 2DQCL 3ZZ1A 1C12A 4WI2A 4POYA 3TIDA 1FCGA 1JV5B 4NZTH 5TGBB 5EU7C 2G9HA 1PY4A 2Q8BL 1NL0L 3O2VL 1JBJA 1XT5A 2ZCHH 4NCC2 4DGVH 5BV7C 5CEXA 5CZVL 1JN6B 4QXGL 4K8RC 2E8YA 5DEZA 2HFFB 1DVFC 2UWEF 1ZA3B 3AXLB 1BGXH 1VFOA 4MD4A 5DRZA 4LBEB 3L3JA 2J6EH 3VXUA 4ONGH 5D9SB 3QO0B 3ARBA 1WTLA 1UCBL 1BFVH 3HE6B 1R5WA 3CJJA 5JLZA 2DAVA 5D2LB 2R1WB 1NUGA 1JCKA 1ZT7B 1YY9D 4HF5L 4ZXBC 4HLZH 5D5ME 2J8UB 4R90H 4RMRA 3VE0B 4DTGH 2KZWA 1E6OH 3KPMA 3OL2A 2VDQH 2XTJE 2VUOA 5I9QB 4X7DC 4D0DA 1NAML 4PLKD 4PV8B 4FXLA 1IM9D 4KRPD 4NO0D 1G6RL 3V5HA 1ZE3C 2YS4A 1EFQA 4ETQB 1QRNA 2DQJL 1LHZA 3RY4A 5E6IB 2VXQL 2Z9TA 3NCYP 4I1NB 2D0GA 1DANU 1SJVA 4HGWB 4IOFD 2DQHL 3JSSA 2UWEB 2X44D 3SE3A 1FL3A 1QLFA 3PJSA 3S3PA 4U7SA 2CKBB 3T0WA 1JGVH 5F6HI 2HFFA 4DOHE 2OR9H 1NC4B 2Y6SC 1QFUH 5TE7L 4KZEH 1MRCH 1OLZA 2MQ3A 2OJEB 4FHBD 4QHUB 5DZNA 1TTGA 4HKJB 2X4RB 3QUMB 5HHXL 3FT2B 2WP3T 5DJAB 4LVNB 1WIPA 3STBA 1YYML 3BP6B 4PB9H 1C12B 1KN2H 4H1LH 1JNLL 3M1BA 1F3DJ 3VH8G 4OLUH 4K8RL 2CLRB 2AEWA 5DQDH 4DGIL 1IM3B 3HR6A 3QUMA 4QWWC 2J7LA 4AIZB 5C09B 1ED3A 4Y19D 4IS6A 4O4YH 5DVLA 1EDQA 5L88H 4BH7A 1BBDL 2W9EL 4A6YH 4U6XB 5FK9B 5FHBH 4O5LH 3UAJD 5E4EB 5F6IC 5DVNA 3EYUL 3BPOC 4MSWB 1FNSL 3BD4A 1K6QL 2W60A 3C5JA 4XMPH 2FECL 1J9CT 3GSNH 4PRNB 3O3AA 2HT4D 2VDLH 4HWBH 4HJ0C 4OSUL 3UBXB 2NY0B 5E5UB 5HGBA 1MJUL 3G5ZB 5I1JH 4JKPH 2LE9A 3TF7C 3FJTA 4HCRA 1V7NH 2VLKA 3VXTB 4YO0B 1UZ6E 3DRQB 3ARZA 4YDLC 3CVIL 4D9LH 3V52L 3V4UL 4M7LL 2AAVA 1XF5B 1S3KL 4HFUL 4M48H 1R5WB 1H8OA 3T0EB 1KBGL 1S9WA 3PJSB 3TBSB 1S9KC 3HZKB 4PGJA 5GISL 4P23A 1BFSA 1MQKH 8FABA 2CK0L 2XQYK 4JVUA 3K3QA 4JFFB 5AZ2L 5KSBB 1HDMA 1PZ5B 3VFOB 5EUOB 1BBJB 4RWHA 5I8KH 4Z78A 3GHBL 3V5HB 2CSPA 1RK1A 1KCVL 3T4AA 2IAMA 2HG5A 5IBUB 3TVMD 3ZKND 3SKJH 1I1YA 1FZMB 3K81A 4NC1E 1ZSDA 3D2UD 2QQLL 5ITBL 3SKNA 4EI5A 3W0WB 4NQCE 2FDBP 2EDTA 3SN6N 3A6OA 1QZ1A 4K3EH 1LO5A 5FGCB 1AC6A 4FQ2L 5LCVL 5F88A 1BFVL 5AUMB 1KENH 3Q6GH 1XAUA 5IB2B 5FO9A 1XCTA 1CBVL 3MUGB 4G6AC 4KRNA 3RX7A 1PKOA 4J3XA 1CGSH 1F58L 1Q9KA 1Y6KR 1QO3A 4MAUH 4Y5YC 3BD5A 2DTML 2JB5L 3KPLB 4S2SA 1WCQA 1FO0B 3BEWB 4PJHA 2AJSH 3DGGA 4OM0H 3LHPH 4RFOH 1BF2A 4QGYA 3EYVB 4MDIA 3AREB 1C08A 2LTQC 4A6YB 3FOLB 1U58A 1JPSL 4OJFH 2SEBB 2JJUA 3T3PE 4I0PC 2GK0B 4KK9C 3LZFH 4M7KH 5CSZA 5FDYA 4KZDL 4PTUB 2YKLL 1K8IB 4Q7DA 3ROLA 5I1KH 1G6RB 4LIQH 4PG2C 1SYVB 3IKCB 4HKJA 5KZCD 3QNYA 4ZPVA 2I9LB 4I18A 4M8QB 4WFHD 4GXVL 5CIPB 4GT7A 3PGFH 3OKKB 2VZOA 4JFED 4ZOAA 1WZMA 5I17B 1N59B 5F88B 3HPJB 1G7QA 4ODVH 2MKWA 3RBSA 3SDXB 5IESH 5J06A 5DJCB 3EFFB 1KFAL 1VFMA 2R69L 3HRPA 3QI9B 3SBWC 1MRFH 3PWNA 3O6FA 4LSDA 4AH2A 2X9XA 3TNMA 4TUOA 1F4WH 1G7QB 3ILQC 3GRWA 4Z78B 2P24A 4XC3L 1GAFH 5KVDH 5EC1A 4F7EA 4PJAF 3ROOA 3EO0A 2QADB 2NY5H 3MGOA 5LXGL 4IDLA 4O02L 4W4OA 4H1LG 5D8JL 3LQAC 1A6UL 1BFTA 1RULH 3QZWG 3B6SB 3U2SB 2CRZA 4G7VL 4DN3L 4MGXA 3S4SB 1FZJB 2F74B 2IG2L 2ZOLB 5F7MC 1XGQA 2GSIA 5E2UL 2BHZA 4KWUA 5JXAH 2YPVH 2IH3B 4NUJB 2O5YL 4G8IA 5DMGC 1OP9A 3PNWA 5D71H 1XIWD 3HI5L 4PFEA 3GSUA 4I48B 1YNTA 3IFPA 1U2HA 5MERB 4HC1L 4GW1A 5MEOA 4U2ZA 4AEEA 3CFDA 5F9OH 1AHWB 1RHHA 4QHNA 1DQML 4LSSH 1FIEA 5F1IB 4M6NH 2Q8BH 4EUPG 4JRXE 5CD3A 5JW4M 2FECI 2IH3A 4NUJA 3BJLA 4N5EC 3I02B 2Q20A 4POUB 3D69B 5CJQL 4WI7A 1YEFL 1K4CB 2OJZH 4LF3A 5F8QC 5FO8B 1A14H 4U6TA 1A47A 3QEHB 1CFSB 1MAML 1YY9C 1IKNC 5HGDB 3OBAA 4K9EC 2BJML 4QHMB 4DVBB 1INQB 1I8MB 2V9QA 3OB0H 1G7JA 1KTKE 2AABH 3O2DL 3P40A 1OSPL 3F5WA 1IGFH 1U3JA 3ZKMD 3EIFA 1MRDL 1MQKL 4JY4A 1N59A 4NT6A 4EDWH 4X5WB 2BSTA 2G2RB 2IQ9L 5DWUH 5J3HC 4NKIH 3EFDL 4KI5E 5GJSL 4LSRL 5AZEH 3INUH 5EOCH 2A6KA 1QRNB 2NXZD 3WO4C 5FB8A 1LK3H 3AM8A 3TO4B 2R0WH 3KYNB 4EN3A 4PLJD 4PRHE 2IMMA 4X9GA 2XICA 1R3KB 4KMQA 3KLHC 4D3CH 2WUCH 1SYVA 4KHTH 4JO1L 5AWNL 5DA0B 1IFHH 2BVOA 3VG0L 2F8OA 5LQBH 3RI5K 4YHIA 1IEAA 4PREB 2DLGA 2XG4A 3R8BB 4LSRH 4U0RB 1UFUA 4BZ2L 4PRIB 1MY5A 1EFXB 2WIIA 2XV6B 3FOLA 1JGEB 2HKHL 1WBXA 4Y16B 4YX2L 4OZIA 5CGTA 5DYOA 8CGTA 4RAVB 1MFDL 1M05B 4P2YA 3MCKA 4J12A 1YZZA 4W6XB 4HXAL 4DKFH 5C0FB 4HUXB 4Z5RB 1M1SA 1CDGA 3QEUB 4LCWE 1MF2L 4M93B 4R26L 5C70A 5MP6H 2OBGA 2W59A 2OZ4A 5ILTL 1A4KA 4L4VB 1J1PH 1B9ZA 3TNMB 1P6FA 3LV3B 1CDJA 1YDPB 3CFCL 5FYLL 2Z8WC 1CFTA 1NKRA 2OTWA 3CDCA 4KVCL 4A6YL 1R3HB 1NCCH 2GJZB 4QRPA 2R2HA 4NQVB 5FYJH 5I75C 4MWFB 1MWAA 4G9DB 2UVEA 2EC9U 5C0GB 4MD5B 4IIQA 4B41A 2EDBA 4U6XA 5FK9A 2HT3C 5GS0L 3LKRA 4LCUB 3KPSA 3KYOA 3MRBB 1V3MA 4HK0B 1VFBB 2VLRD 4ZUTA 3B6SA 4H0IA 5E5MA 3GJFB 5HHMB 1YEEL 3ARDD 5D72L 1L9NA 3DPBA 4QRTA 3BDXA 4UI2A 2X4NA 5L2KD 4N0FA 4TSCL 1HYRC 1L0XA 5DTFB 2C26A 1HEZB 3SGKA 4CGTA 5KSBF 1X5ZA 1VCAA 3H7BB 1U3ZA 1BEYL 5A3IC 4X80H 1J11A 1CGUA 4YXLL 1G7IA 3LRSA 3CC5B 3TT3H 4FN0A 5T3XE 3OJVC 3O6MH 4FFWD 2CUHA 5FUOL 4CVWA 3RY5A 3OB8A 1RIHL 5F7UA 5KAQG 1BFOB 5T1LB 2VKWA 3RJQB 4R7DA 3OGCA 1CF8L 3SCMD 3DSNA 2ZCKL 1CLOH 3WFCL 1NFIA 5KS9B 1CD1B 3B9KD 5L0QB 1IAOB 5JHLL 1QG3A 3NCMA 1LDSA 4WFHE 1CGTA 3QDJE 4N8VB 5IHZB 3OR6A 3MQIA 1I8KA 1XGPB 2NY5C 1ADQL 4JZJB 4KAQL 5IROC 4HKBB 1RIUH 1EMTH 4Z7UB 1BD2A 4R90L 3D0VA 3TLRA 3TZVB 4Y5VB 1ZTXL 5E08L 3O3DB 3QFJE 3O3EA 1PKQA 3VXUE 1MREL 1WBYB 1AGCB 3U36B 3VXQA 4LIQL 3MROB 3SDCD 2DDQH 3H7BA 5H94B 1A4KB 1FSKC 3A6BH 3RDTD 4KZDH 1C5CH 4JPKL 3S88H 3STZB 3NFNA 1E4XH 1U93B 4D9RD 1M71B 1VPOL 3WUWB 3GMQA 1S9VA 3IFOA 2BK8A 3O3EB 3ZDYE 1IT9L 2VE6A 3UTTA 1BD2E 2GTZB 3VWJC 4APQB 4WFED 3D39B 1HILA 4JN1L 3QHZH 3P0YH 3EGSA 3MBXL 4QHLB 5BS0A 3LMJH 4MA1B 5ISZE 4UDTB 2F54D 5GRWA 2ADFL 3H9HB 4H8WL 2PYEA 2HFGL 4CJ0A 1A02N 4KJWC 4Y5XB 4X6CA 1ZHBA 3BIKB 4ORGA 4LLUA 1DZBA 3CLEH 4ZDHB 5HTSA 4ZS7H 1MIML 2Y7QA 1D5IH 2BSRB 4HKXA 4WI9A 1WZ1H 4LLYA 4WW1A 1Q0XL 4C56A 2O5XH 3L7FA 4XCCL 4QRRA 1KC5H 3BYTA 3IFPB 3I50L 1F4YL 3ARED 4P4RA 1MFAH 2NY1B 1JMXA 1OY3B 1KELH 4OZGF 3QEQE 3B9KC 1GGTA 2L0DA 1CGWA 4X6DA 1JPGB 2XA3A 3MCLH 5IG7A 3HAEH 3D0LA 3L3OB 2DWEA 2WBKA 4MLIA 5AG9A 2EYSB 1QLRB 2RB8A 1A5FH 5FV2A 2UUDK 3KPNA 2NY3D 5EZIL 4J3OC 3ARUA 4N0FB 1C5BH 1JUFB 2B0SL 3RWIA 5FF6A 4R4BB 2PXYC 4Y4HA 3RWHB 1A64A 3PIQB 4R97C 2EIZB 5FUZL 3F7VB 1GOHA 3U7WH 5I8OH 4YBQD 3MV7E 1CICC 3GMNB 4Y5VA 3FMGL 3ARRA 1X5FA 5L6YL 5ALCH 1A6PA 3I3BA 4FMFA 3QPXL 1CT8B 2OXGA 1V7NL 4WEBH 4Y4HB 3RWHA 3TEUA 3VFUA 2YUVA 4J1UB 4HUKB 4X7SH 1NDGA 5ESVB 3EO1B 4EDXA 4RQQB 3QA3A 1ZLSH 2ZUQC 4GRMA 3TFKD 3C8HA 3VI4F 5F7NC 2KZ1B 3HNTL 3C09C 2P5WE 4W4NA 2EDKA 3GSNL 3RWEB 3T77A 3S37X 1GGIL 3PHOA 3QNZA 2XTJB 1N3NA 3FKUS 1MEXH 3QG7H 3IU3A 3ZE0F 3O0RH 4JKWA 1IC5L 3WFHA 3NZHL 3TT3L 3T4YB 5GISH 1QSFA 1HHGA 4PRAA 5EC1B 1A6AB 1KPRB 3QHFL 4S1DC 5C0RL 5CHNA 3R06B 2G75B 2Y7QB 3CD4A 2N7AA 3G08B 1HEZA 2GIYA 2APVA 4KROD 4FMKA 3G6JF 4BSWA 1QBMH 3NIGE 4RISL 4LLMB 3WNNA 1S9VB 3OV6A 3VI3E 2X2YA 1FZJA 3PV7A 4S2SB 4W6WB 2AQ1A 3UZQA 3K46A 3TJHC 1RIUL 2X70B 3GMRB 2E7CA 4AY0A 5JOEA 1A6VL 1Z3GL 5EA0L 2W1NA 3V0WL 4GKNB 3X14A 4XCYB 3FRPA 3M8OL 4M1DL 4ZO9A 5GS0D 3G5YB 3N1FC 2V6HA 3DSFH 4G80B 3BO8B 4JRYA 1EHAA 4FXKA 4R8WH 2VR4A 1ZT4A 3VFTA 1I1AC 4JJ5A 5D7JC 3OWEA 4U1MB 4U1KB 1M71A 1U8KB 5SWSD 4Z7NF 5IHUH 4ZNCD 5F97E 2DQHH 3EHBC 2V9TA 4ZUVA 1CFSA 2ADIB 1U95B 1NEUA 3DBXB 1INDH 3R1GH 5CLWA 2BC4A 2E9IA 4XAKD 3K8KA 1U8LB 2H26A 3QWQB 5CEYA 4NO5B 3P30H 1WFOA 1DQJB 4NBXB 4PJBA 5IV2B 2NW3B 4R8WL 2IPUK 3NTCL 1AGCA 1FL5B 3GM8A 4P46D 4Y16A 5KSVA 3MRGB 3Q5OA 4ZPTA 5B3JE 5EBMB 4MNQD 3C5ZB 1NCTA 4XCNA 1A7QH 1Y0LB 5I1AB 3MUZ1 2CIKA 4WW2B 3TP4A 5I66B 1QTYT 3PABB 3LSOA 1I8KB 3B3IB 2BZDA 1YNKL 4NRYB 3MRKA 5D2NA 3EGSB 1JI1A 4IRSD 4KKLD 2F5AH 5LVEA 4XAWH 3MRNB 5KVMC 4OIAA 1V8HA 2R1XA 4GAJL 3GMNA 3U0PB 1ZLWH 1JHTB 4LL9A 1KGCD 3GMOA 5CILH 2V5TA 2Z31D 4S1SH 1E4KA 4KKAD 1H3PH 1BEYH 4YBQC 5HVHB 4PJ5B 5IB5A 1ZVSB 3O6FC 1MAJA 1N64H 2I25N 1F3DH 3TYFB 2A0LD 5KANI 2BOCB 3RVTC 2FIRT 1P7QD 2UYLB 3QIWA 2UV3A 3DUSA 4HPOL 4NKDA 5DJ0B 4F7PA 3OG6B 3EDEA 2X89D 2YWZA 3SY0B 3EOAB 3LN9A 4POZD 2VLKD 4AL8H 2CDEB 2FGWH 1I9IH 1A0QL 4PJGF 3DIFA 1HHGB 5TDPB 4DZ8A 4PJIA 2MQCA 5JOFA 5HDQL 5C08E 4CW1B 2VDOH 4JQXA 4PJDF 2HH0L 4PRID 3T0EC 2BSSB 3BOVA 4E41A 1WWWX 5DMKB 3P4NA 3MNVA 2PO6C 2PN5A 5F3BB 3V4PH 4PJDE 5CJOH 2ATPA 2ZJSL 4KFZC 2Y5EA 4R4FL 4ODHL 3BZEA 3CIQA 3MJ7A 4LAJH 1DEEA 1J05A 4GFTB 3T0XA 4P23D 3L3DB 3RY6A 1HH9A 4WJ5B 1GGIH 3P4LA 4RGNC 4G3YH 1EHLL 2VDKH 1W72A 3MGAA 3S98A 4HT1H 4LQ1A 5HGAA 4PJ8A 1AGDB 3D18A 3TVMA 1URLA 4PJ7E 4PP2B 1QHOA 5EO9A 5FA4B 4GKZA 4KQ4L 4NBZB 3ME0A 3RPIA 4EI5D 3OZ9L 5EUOE 1FAIH 1YEFH 4AEFA 5ICYB 1QBML 3L95B 2GK2A 4ZTOL 4Y19E 4OB5L 5ID1B 2IANA 4PJEA 1G0XA 2O5YH 2EDOA 2AXGB 2QEJA 4Q6IB 3TH3T 5E8EA 1DQJA 3MMEB 3DVIA 3WYRA 3STLB 2ZUXA 1P4IH 5BRZA 2P5EE 1EXUB 3HNVH 3GJEA 2E8ZA 4O2EB 4Y1AD 4JFYA 3IETB 3HHRB 4ZPTB 1UXSA 2P8LA 5E5RB 4R0LC 4HWEH 4PR5B 2FBJH 4BYHA 1J0HA 3IDGA 3KWWA 3KLDA 4MJ5B 5DHXB 2EYRB 2Z35A 3CVHB 4MXWH 3DV6A 2EIEA 1ZA6A 1MCBA 4RMQA 2EZ0C 3BP4B 4K2UL 4DCQB 3FB5A 4LDLB 4PRBA 2DYPD 1WAAF 4OZGA 2UY7A 3RWDB 1KFAH 2H1PL 1SJHB 3NIFE 2EE6A 4YE4L 4Q0XH 3DGGB 3QIWC 4R6UA 3UDWA 4O58L 5DK3A 3L1OL 1I3GL 2AXGA 4PGZA 4Q6IA 4KKBC 3BD3A 3VWJB 3W5NA 4LCWA 5IESL 4JFZL 1KCRH 2BY3A 3QI9D 1EZVY 1MQ8A 4GH7B 1SJHA 2WBJB 1IGCH 2XI9A 1KTDB 4DWHA 3GK8L 5E24E 4J8RA 4G6JL 1RJZA 3I6KA 1GH7A 4LU5H 4CMHC 2A0LC 3JWOH 4F37F 1C16B 1GC1C 5EG6C 4NKOB 1ZT1B 2W9DL 5HGAB 1A7BA 3A6CL 3ULSA 1OD9A 1I7TB 4XPHH 4KK5C 3P11L 4F7CB 3QIUC 3KPSE 2VAAA 3L9RA 1KCUH 3AB0C 5IHBA 3LVEA 3U4BL 1NDGB 3WS3A 2QKIB 3FO1B 4QOKD 3F8UB 4HGKC 4XNMB 5E2WL 5F70A 1SYSA 3O6KH 4XMKH 5IUSA 3PHQA 1CR9H 1MJ7L 3DO3A 3LQMA 4MMXC 3MLWH 3C60A 4OCSH 2C3XA 2ICWA 1G7MA 3I75B 4C59B 4CW1A 3VXOA 3WS3B 3PIQA 2FX7H 3IETA 3NCFB 3GI9L 2XACC 1ZKAA 5E1AA 1X6LA 5C0CA 1WBZB 2VDPL 2FYYB 4UINH 5DHVA 1RZKH 2N56A 5E6ZA 2HWZL 1A2YA 1UKTA 2Z31B 4M1CD 2DN7A 4YXKH 1AD0B 2P5WB 2NY4B 4OZFA 3RWCA 1OAUL 5E2VL 1RUAH 5F7DB 1U58B 1VACB 2G5BB 3BQUA 5JPMB 3WD5L 1OPGH 1WICA 1KCVH 1W0VA 1KLGB 1YY8A 3VXRE 2VXTH 4PY8J 1FAKT 5H2BB 3B4NA 4YZFF 4GAYA 1A3RL 1EO8L 4FFYH 5D7JD 1T0NB 2VZUA 4WFEE 3GBMH 4ZXBB 4RZCB 4OI8A 2XRAH 4IBLT 3THMH 4MAUL 1GSMA 2GHWB 3ETBF 2F54E 4YR6B 3VFNB 4ZSOE 1LP9F 4EN3D 1S7QB 3BJ91 4M1DH 1WCBB 1JWMB 2DI8A 2VN4A 3IGAB 3OG4B 1ULVA 3FB5B 4OUUB 4LLQA 3E6FA 1WJ3A 3N06B 4DVRH 3QDGA 4XX1E 1UXSB 5C08D 4LBEA 1GHFL 2JJSC 3S5LB 2R2EB 3U30B 5IKCA 4EI6B 3T2QA 1NAKH 3VFOA 4LHUB 3WIHA 4MA8L 1GGYA 1T0MA 1N64L 3SJVA 3TA3C 5CGYC 5E00A 4GRWB 5HHNA 1ORSB 1OSPH 3ZE1F 3EUUA 3B9VA 4WWKB 4G6KH 3VRIA 5ID1A 3E6HB 1A8JH 1ZHLA 2BXZA 2MQ0A 4JDZB 4ODBD 3WFBH 2AXJA 2X6MA 4CVXB 1FVDA 4KKAC 5F6HJ 2WLZA 5ECJE 1J5OL 5IEKB 4IMLA 1PDKA 3MV9D 4OLVH 4KDWA 4UV4L 5DRXA 1L6ZA 1RQ5A 3ARFB 3MREB 5TJWK 1OVZA 1YNKH 3FAXA 4PJ8B 4WUKL 2AI0L 2ARJQ 1S7SB 4K8RH 4FXGB 1RD6A 3ZT6A 2HYMA 2I27N 1B6DA 4HXBH 3WEXB 4Q9CA 2CLZB 3NAAH 5IF0A 1MSPA 2CLVB 4PYHA 1E4JA 5DUML 4HIIB 1CE6B 1NEZG 2KBGA 3HR5A 3KR3H 3ARDA 4LDOB 5HYSB 1NGPL 4BH7B 3FB6B 3QUZA 5IK3B 5DMYA 4NQTA 4WV1A 5HHOE 4Q9RH 4NZDA 7FABL 3DVGA 4P2OC 1F6FB 3NA4A 1MNUH 1RULL 1E0OB 1YEJL 4YHKL 4Y1AE 4DKFL 4LLUB 4MA3A 3L5XL 1Q9LA 3UO1H 1FYTE 4YHMH 2LVEA 2XZZA 3SE4C 2FO4B 4M8QA 2NY0C 2GQHA 2IPUG 3SGDH 1RZJH 3CX5K 2VXTL 4EVNB 4Z95L 1G9ML 3TBVB 4O51B 2JB6A 3EYFB 1FRGL 1CVRA 1KXVC 1DEDA 2YMXH 1WF5A 4XCEA 5EULV 5GJTH 5J9PB 4PIRF 1C16A 4QGTA 1JV5A 3FO0H 2EEBA 1JGLH 4XPGL 4OCMC 2A6IB 2FEEI 4ZFGH 4CKVX 4F58L 4HWZB 1IILE 3VMOA 4HF5H 4GAYB 4GAFB 3VGGA 5E7FA 3KNBB 2YN3A 3G6JB 1IM9B 2VR5A 4HKZA 3FN0L 3K2UH 1BD2D 2XWJB 1AD0A 4DFHA 1OGAE 2GYSA 3W82A 5DJ6A 4LCUA 2A38A 1WAAA 3FRPG 4PP2A 4C58B 4DUXA 1A9EA 5A2JH 1A4JA 4KGJA 3EJZD 3SDCA 1MHHB 5B38G 1R3LB 5ETUB 1QUNA 5KSAA 1M05A 3BKJL 5ISZB 3PQYE 2PCPA 4DAGH 1RJCA 5F71A 1XGUB 4LKXB 2J4WL 3IF1B 1FL5A 3C6SA 3BZFB 5FKPA 3SO3B 1QLEH 2HKFL 1RUAL 4NFBA 4LRNL 1UXWA 5SX5K 5BS0E 5ISZD 4O2EA 3VGEA 3KS0H 1RZJC 1RHHB 2PYED 1MFAL 3ZT5A 4Z7OF 4D0CB 1KENL 4HWZA 4I4WB 3MLYL 2R8SH 2OI9C 2Y9RT 5D2LF 4N90D 2AV1B 2XT1B 3ZYOA 3MRDA 3QQ3A 3MA7A 5C0NC 5KBNC 1Q94B 3GSXA 4Z7UE 4OLYL 4OQTH 3ZT7A 3AU1B 3FAWA 3V2AR 3C6LD 1DFBH 1WZLA 3AREA 4A6YA 2ICEB 1R3KA 1MCQA 3LZFL 3QEQA 3JV5A 1EK3A 2C1PB 1AI1L 2RJMA 4WI8A 5DVOA 5ETUA 4AM0B 5D9SA 4P5KA 4CMMA 2BVUA 3GMRA 3IYLW 1J1OH 3UTSB 5DUBA 1I8IB 2NY4D 3MRCA 2BSTB 2G2RA 4PJBF 3QAZB 4XCYA 3UC0H 4ZODA 1W0VB 3ULUH 4GS7C 1V7MH 3DVGB 3FB7A 2VDML 3V7AE 3RL1B 5HYJE 1ND0B 2YKLH 3CK0H 1UB6A 4Z7WA 3C2AH 1MCRA 2PUQT 1E6JH 4I5BA 4APQC 1FLRH 5F3HB 1ZSDB 5SWZA 4MXVF 1PG7W 4G9FA 3QFJD 4OCXH 4WUUD 1KJMB 4OIIL 5EZLB 3PWPA 3GSWB 3T0EE 1F45A 3MA7B 5D93C 4YHOL 3UZVB 2JB6B 3EYFA 1U3YA 3GSQB 5C2BH 4LHUD 1ORQB 4KJQC 2OCFD 4P2CG 1M7IA 4MS8C 1OTSD 3G04B 2RCSH 2K7QA 3OXSB 5I18L 2PETA 3VWJA 3P9MA 2HVJB 4ZDHA 3SOBH 4JFOA 4OV5B 1P84K 5IT2H 3VFGH 4P46C 3LEYH 4KMTL 1JHKL 1B0RB 1D5XB 5I19H 3HZYA 3VI3F 1BQLL 1BOGA 3DUUB 3ARDB 3IRPX 3EFFA 4HXAH 5C3TA 5FXCH 1I7TA 2GTZA 4ZQKB 1T4KA 1UQSA 4H88L 1JHTA 1CBVH 5EORH 2R15A 3WKML 3HG1B 1GZPB 2BY0A 5ACZA 1A2YB 1P7KA 1P5UA 2I24N 4GXUM 1ZEAL 2P24B 1T5WB 5GS1C 3OPZL 3ZTNH 3QT2A 3MRPA 3QDME 1JRHL 4PJXF 2EO1A 5DEFB 1DE4B 4KJPC 2A74A 1HHJB 3FL7A 1A0QH 1F6AB 4PJFA 4BQ6A 4LSTH 3E1F1 3G9AB 5IMOB 5J4MA 4M02A 1IAOA 1P4LA 3OKLA 3D39E 4F3FB 5BVPH 4RFEB 4XP9L 1YMHA 1TZHA 1FZMA 3OZ9H 1XH3B 2Z8RA 4K71B 1J5OH 2IGFL 2XZAL 1JPGA 4GO6B 5ICZA 4E9LA 3FTGA 4N0YL 5IMLB 3OKEA 1I85A 4FFYL 3KYAA 5TE4L 2F8XC 1F42A 8FABB 3ARBB 4ODTL 4MA7H 4MNHB 1NMAL 4FQ1H 5T1MB 2DQDH 2CRYA 3CH1A 1GYAA 3KGRA 1EPFA 3DX7B 1NBYB 4HDIA 1CLYL 5FYKH 2R1YA 3MNWA 1LO0L 5T3XD 1KJ2L 1CGXA 1JTPA 2GK0A 4YQXL 2V7NA 2QQQA 4PJ9D 4HH9B 1WQVT 5IR1B 2GAZA 3NBNA 3SO5A 4JPVH 1JTOA 3QUML 5HHOD 5HGDA 3BRGC 3U2SA 1SEBA 5FHBL 5CWSA 4X6DF 5FM5M 5CINL 3G5XB 2J8OA 4BZ2H 4GRLD 1KPVA 4M6AA 1G0YR 4MNQA 3RL2A 5BJTA 5LQBL 4LEOA 4KJPD 4RMVA 4YNYB 1B4JH 4QF1A 1QFUL 4HS3A 3JUYA 1CD9B 1WISA 3PV6A 3G5XA 1BBJA 2ITCB 2JELH 4FNLL 1BZ9A 2PO6D 2D0FA 3QIUB 3WCYA 4IRSA 3BPLC 4MXQD 4BM7A 3GBML 4NKMA 1OTUC 4YH6A 4WI6A 2C4FT 1MF2H 4KROC 4R26H 1XGPA 3D85D 5I17A 3R1GL 1FL6A 4FABL 3W2DL 2FRGP 3V8CA 3GBNL 1FORH 5D5MA 4OZHE 1A9BA 2DD8H 4IHOB 3BPCB 3VFSA 1U8OB 4XAWL 5AG8A 2P7TA 3BIAX 5FKPB 2DTSA 1FIGH 3FQXB 3KJ4B 2VLKB 4ELKA 5TF0A 4JG1H 1QFWM 1YMHB 3UYRL 2X4PB 5D5MB 1AR2A 3TN0A 1GGCL 5DURB 3EYVA 3BE1H 4NJAL 3QYCA 3KPOA 5GGQH 3X3FL 1WWBX 5ITFA 4I9WD 1S9XB 1HXMA 1KG0A 2G5RA 4QY8A 2OJEA 4QHUA 3ARBC 4PJDA 3U4BH 3RGHA 3ELAT 1AXTL 3S4SA 1MRDH 2FZ3B 5EWIH 2AEIT 2CR3A 2V2WA 4WW2C 3EZJB 1UB5B 1EBAA 1A3LL 1QSEA 2QR0B 1QO3B 4S1QH 1RMFH 3MRBA 3KPSB 3KYOB 4L4VD 1EHXA 4IRJC 5DO2D 3RTQA 3VXRD 1AGEB 4Y2DD 3GJFA 4PLKC 4GQ9H 3P11H 35C8L 3RZCA 4UDUB 1E28A 2BC4B 2KDGA 2DQEL 1TQCB 2HA1A 4J2XA 4L9DA 4X7EC 3BKMH 3W0WA 4PLOB 4M6NL 3GSNA 1QBBA 5IJKC 5I15H 4FQCH 2ATPB 3DXAD 2D7OA 2X7LA 1JWUA 1DE4A 4FZ8H 4XCEB 2JKXA 3V0WH 1NBYA 2IANE 4PJEE 2YA2A 4ODSH 5E4IA 3BX7C 2XWBA 2PW2A 4XC1H 1N4XL 3PHOB 3UCRA 4FQ2H 3CX5J 3GSWA 3KPRD 5GRYA 4PJDB 5BRZD 4KRMB 3HS0A 1GPOL 1UJTA 4PJGB 4FQJL 4E42B 1IEAB 4PREA 2YD7A 4IJ3B 5K9QG 3J8F7 4DKAA 1L4IA 3B2UC 4KV5F 4PJCB 5IQ9A 2VXSH 1K3ZA 4WHTA 3JTSB 2NMSA 3T0ED 4QXTA 4OT1H 3EO9H 5HPMA 4WENB 4RDQF 3JTTA 3PGDA 2UZXB 1A7PH 1LP9E 2ZUUA 2YR3A 4F2MA 3Q48A 1AI1H 5AYQA 5C0AB 1TETL 1WBYA 4HUWA 1QNZH 4AQOA 3F58H 3L5WA 4OFKA 2C1OB 3RDTC 2NY2D 1JZ3A 4QXTB 2CJUL 3SGEH 3Q6FA 3SO3C 3ZMRA 2VLMD 3MLUL 3RY6C 4OQTA 1Y6MR 4QHMA 5J89A 3GMMA 4IRSB 4MD5A 3QI9A 1U2CA 4TYUA 1IAMA 5BZWA 3SGKC 2OQJA 2VLJA 4ZS7L 3MRQB 4H20H 4BKLB 5F7LB 5JR1H 3NGBB 5I1EH 2XPGA 1QR1A 3HFML 5DHYB 3IKCA 3GB7B 5HD8C 2A1WL 5C9JB 1AHWA 1A7NH 2W91A 4BELD 4JRXA 4LLQB 5FKAB 1BZQK 4JB9H 5CIPA 4Z0BH 1K6QH 3VXNB 4UTAH 3OKEB 2BSRA 4PBVC 4P2OA 1SM3H 1UJ3B 1JPFA 4L8SA 4DEPC 2E7BA 4WTXA 3P9LA 3C8DA 4XBGB 1UYWL 2M26A 4JPIB 3TO2B 4S0SD 2BXYA 2NY2C 5CJOL 2ATKB 2XN9B 3BVNA 5I8EA 9CGTA 4GRWE 5F44A 4M7LH 4HMCA 4M6OH 5B22A 4JANB 3V52H 2RGSA 2R0ZL 4HIJA 4N8PA 1PLGL 4PJIF 4M7JH 4WCYL 1OW0A 1ZWIB 3C6LB 4MS8D 2EECA 4ZFGL 1NGQL 5LGJB 5C0CD 4HKXB 1QSVA 5I0DA 1Q72L 4PJFF 4JY5H 4FXGA 3AS2A 4ELME 4I0PA 4JFXB 1PGRB 3GKWH 3IF1A 3BESR 3BH8A 5ADPH 4PRAB 2CK0H 1HHIB 5I1AA 3WUWG 4UB0H 3VW3H 3LQAL 4M7ZB 3O6ML 5FUOH 2CO6B 2AS5M 1ODAA 2DIAA 4JFXA 4KRPB 5D7JA 2OLDA 2UWEA 3G6DL 4WHDA 4EQ3A 4XBEH 4YHZH 2H2PD 5C09A 5BQ7B 1DP0A 4KUZH 5B8CC 2RR3A 3LN5A 1NANI 5JW4N 4AMKH 3B8YA 4Y8DC 1TQCC 2QJDA 5E0QA 5B38B 4RIRA 1TPXB 1WC7A 1DBKH 3MRQA 4XPAH 4JANA 2BVOB 4Y4FA 1KN4H 2X1WL 1I3RA 3QWOB 4NQUA 4C4KT 3OXRB 3DX8A 3K80A 1BD2B 4Y5XA 4Q6YA 1KN4L 3U6RB 3RVTD 2YD4A 4N0UA 4HH8A 5J8OA 2VWEC 1LEIA 1T6WA 1XIWC 2JJTA 4I0PB 3WLBA 1C1EL 2I5YH 2VNCA 1X3DA 1MRCL 3BPNC 1QKZH 4C57C 4QRTB 1C7TA 3E3QE 5CUSL 5JZ7D 2X70A 4B7LA 5FGBC 3JTTB 3PGDB 5IHUL 5I71C 1WLHA 5BJTB 2YUWA 3LKNA 1EO8H 1ONQB 2AK4D 2AK4E 2ZCHL 1R6VA 4MCZA 1GRWA 2E9BA 1MFDH 3CDGB 2CK2A 1LGVA 4X4YB 3K4DA 4FRWA 3QB7C 5IB1B 2BVEA 4Q9RL 5C0BD 5FCUL 4L1HA 2BY1A 4W4OC 4P48A 2CRMA 3QCVL 4JHWH 5F7EL 2E6JA 1RPQA 3ZDXF 4L4VE 2NY1D 2GTWB 3MACL 3QUYA 4XMLH 5DEGB 5TDNA 1MCOL 5KG9A 3VGDA 2MCPL 3KPRE 1YEDB 3VXMD 1G9MC 5JW4R 1V3LA 2HT2C 4OCWL 4OLZL 2OR9L 1Z5LA 4L4TE 4OD1H 4DK3A 4XPFH 4M6ML 3QA3B 3QHFH 4CUCA 1HKLH 3BEVB 2MTPA 3I85A 3WMSA 3MRFB 1A5FL 1FNEA 1CQKA 5D1QB 1QPPA 4G8GE 2WAHA 1SM3L 4X9FA 3HI6H 2HTLC 5FV1L 1LVEA 1D7FA 1RK0A 5GGVL 2J88L 2VDRH 4NHCL 1O7SA 5JIKA 3BEWA 1BQLH 2JJVA 1RUKL 2IJ0C 3U0PA 3CFEA 4FQXC 1X5GA 4ZNEA 3K8LA 5D1QA 2LU7A 5I19L 5L6YH 1RZ8B 1G7JB 1WFUA 4J8RB 1KEMH 5KSBE 3RDTB 3LEYL 1IQDA 1FG2A 1BWMA 4BK4A 4Z76B 4XHJD 5D1XB 1MIEH 3BRDA 1I1AB 4DGYH 2GFBB 2NXZB 4XCNB 4ONHA 3ZKSD 1IAII 2B0SH 2C4FU 3O3BA 1HQRB 5FUZH 1I9JH 2IMNA 3HG1D 5DUPL 1WC7B 3TWCH 4EN3B 3NFSL 3L7FB 1U93A 1DVFD 1ADQA 2QKIA 3FO1A 1TETH 4D9RE 5DURD 1LMKA 1NEZA 1RFDL 4RGMC 4RMSA 2B4CL 4JRXB 5FKAA 1TNMA 2PW2B 2VABB 4XWOC 3QJHB 3RWCB 2XZQH 3OKYA 1UZ8B 4PJFE 5EPMB 1FNGB 4UTBL 3TIDB 2DDQL 3MODL 3ULUL 5GZOC 1AGEA 2NY6B 3P0VL 4OZIB 1JZ5A 1JPSH 4OJFL 5IJVB 4E0RB 2DQFB 3UJIL 3DHJA 2VDPH 5FUCC 2B2XL 3JWDC 5IEHA 2FH6A 3ARVA 3MLYH 1DQMH 3ALPA 3HNVL 5BV7B 2QQNL 1D5IL 5DD6A 5TH2B 3SGDI 1BLNA 3KDMA 1CIUA 1FZOA 1LDPL 3LPFA 3MJGX 4LSUL 5DJYB 5BVJA 3ULUC 5C07B 5I1HH 3QFJB 1FVCA 1U42A 3LMJL 4R2GD 1LEIB 2XWTA 3MBXH 1HYSC 2YD9A 4I3GA 1AO7E 2JK5A 4UIKH 1QLEL 4P3DB 1FJ1B 4H8WH 4P9HL 4TRPL 1AE6L 1K4DA 3LKQB 3PWNB 4P2RD 3T4AB 4HHAB 4K7FB 2A9NH 4PJXA 5D2NB 5GHWH 4NQSA 5FYKD 3VU2A 1P9MC 3PGCA 4B7IA 1N0XL 3O8XC 4HX1A 1TZGL 1TVDA 2CIKB 1T0MB 3SJVB 1KELL 1N0XH 2ESVD 3MGTB 1CG9A 5K9OB 5D7KD 4GRWH 5FDWA 4P4KB 4NO2B 1JTTA 4LF3B 3WLBB 3CLFL 3BGMB 3MXWH 5C9JA 4G9FD 4GRLC 5JXEA 5GSRA 5T5NG 4FP8H 1PKQE 4OM0L 1FH5L 3SQOH 5L2KB 5EOTB 3ZO0A 3WV0A 1J88A 3DUSB 2OR7A 1ZANL 3NCJH 4YC2B 3F7RA 2EE9A 3UYRH 4P4KD 1DVFB 3FB8A 3ARGD 3VDAA 2YMXL 3JXAA 4P3DA 4LLAA 2UUDH 5JQHC 3VWJD 1T20A 3FHAA 2CLZA 4OZHA 5IF0B 4G8EA 4WW2F 2EDFA 4JFDE 4ODWA 4TTDC 4UQ3A 5CJ8A 3MLZH 5FECA 1I7UB 4UDUA 5E8OA 3BI9X 3MBED 6CGTA 1JF1B 1D6VH 3ZLQC 4P5TB 4M03A 4FXKB 4NP4H 5GXBB 1QRNE 5DK2B 4E0RA 5ANMA 2C1PA 3MRJB 1S8DB 4RMUA 2Z8VC 3FZUC 4S1QL 4TNWK 2VSCA 5I8KL 4G5ZH 3CFKB 1ZAGA 5TFSL 1G1CA 1CN4A 5DD5L 4YHYC 1PKQB 4LSVH 2V2XB 3BKJH 3TESA 1EGJL 1IC7L 4YGVA 5EO0A 4JFOB 4MQXD 1DN0B 1S8DA 1CE1H 3ALXA 1DUZA 2FJFA 1LEGA 5HHOB 4L9LA 4YHKH 1GGCH 5EZJB 1G7PB 4I0KA 3GM0A 4XT1C 3VD4A 5I73C 1R24B 4HCRL 1SYSB 1KJMA 1QPXA 4PRIE 5C6PB 5L2JA 1R3JA 1P2CB 5GGSB 3MLSH 2AQ3A 3RNQB 2Y5TA 3FO2A 5KN5A 1KJ2H 4RAUB 1ZEAH 4EDWL 3DROA 1IEBB 5FYLH 2ICWI 1S7VA 1JGEA 1MCFA 2V2TB 5DJ2A 2P46B 3CFBB 4U7MA 1NMAH 1J0KA 5GGVH 1JK8A 2DM2A 4UBDD 5ICXA 4Z6AT 5FYKL 4JGUA 2BJMH 1LO4H 2CKBL 4L4TB 4RMTA 3VWKC 4EZMA 3VGAB 4K3GA 4PJEF 1YMMD 3HUJE 4CVZA 4P23B 3QIBB 1XGRA 3L95A 4AQ1B 1VA9A 3ECBA 3SDAA 1UQSB 2YD3A 4KRPC 3FZUD 1T1ZB 2ZSWA 4MSWA 5I1CH 3KAAA 5DJ0A 4WJ5A 3TA3B 4GSDH 1RV6X 5ADOL 5D1XA 4EOWL 1B88A 1KB5B 3V6FB 5GGSA 4TVSa 4PRBB 1Q9WA 4HPOH 5F7WC 2WQ8A 1NFIB 4TTDD 1EAPB 4FQXA 3VXUB 4CL7A 3VXSD 2XXCB 4GW1B 5EC2A 1BQHG 2H3NB 3RIFK 1CR9L 1MJ7H 4OUUA 2ZOKB 3PL6A 3MJ9L 4HIEB 1D3CA 1SY6H 3OKNB 4K71C 4L8BA 3RP1A 2AJYH 5EN2B 2IPTH 1RU9H 2FEDD 3CUPA 3WFBL 3WFDL 3SOBL 1CXLA 1WT5C 2AERT 3GMLB 4LHUG 4O4YL 4KMTH 3QNZB 3ULVF 3PABA 2F53E 3DX7A 5HD8D 5EOTA 1FP5A 2C3WA 5DC0A 4H1LA 3NH7L 1AKJD 2W9DH 3RL1A 4F33A 3AY4A 4OLUL 5E2VH 3TH2T 1X5YA 1SEQH 3QQ9C 1T0PB 2BRQA 2A73B 3IB4A 12E8H 1KF9B 5D71L 3VXTA 4G7VH 4DN3H 3ARFA 3GNMH 4PRDA 4DTGL 4JFPB 5KVEL 3L5HA 5D8JH 1K3IA 4RDQG 5C0CB 3U0WL 1V5JA 3RWDA 4NYLB 2W0FA 1YEGL 4OGAD 4TPRH 1GAFL 5KVDL 3BGAA 5T3ZL 3RTQD 2DRUA 3P4MB 4NPYA 4Y2DA 3VXRA 1HXYA 4S11A 2H8PA 2PR4H 3BYYA 3RZCD 2AV7A 5F21B 3F7QA 1BIHA 3WE6B 1F11A 4JQVA 4WTZG 3QHTC 3V8OA 4ORZC 1CGYA 4NWTL 2EYRA 5JW4Q 4OGYL 5JW3L 1YEGH 1T89A 1HXYB 3BP5B 4YK4B 3FFCA 3G6JA 3U0WH 5K59F 3HCVB 1IQWL 3KHQA 5I30L 2NXYB 3T2PA 3MJ7B 4ZO7A 3MA9L 4D0DB 1D5MA 4ZUWA 5GRVK 1U8LA 1K8IA 1DL7L 2IH1A 1I4FB 3TBYA 1AE6H 2X4PA 5HGHB 4I5BB 4PRDB 3PV6B 5D6DC 5J9PA 2VYRE 4CU6A 1AGBA 4UAOB 4UIKL 2XFXB 3E3QC 2R4RL 5TDOB 1PQZB 5IWLA 1CFQB 4UU9B 1VFUA 2WV3A 3ZTJH 1UADC 2XZQL 3PP3H 3L1OH 3FT4A 4U49A 2AKRA 1TZGH 1YUHB 3CU7A 3BWUC 4JZNA 5L8LB 1FNLA 1RUMH 4DFIA 1IM9A 1Z9LA 3KNBA 1LNUA 4NO0A 4DAGL 1DANT 2O5ZH 2VLKE 1IGML 4LPXA 1NL0H 1PSKL 5TPWL 3WXVH 1XF2A 2FO1A 2DTMH 4J4PC 1YN6A 5DJDB 3GI8L 4N0UE 4LP5A 2V5RA 2HN7B 4X9HA 5DDHB 5FM4A 5CBAA 5HPOA 1JYXA 3GSXB 3GMOB 3HE6D 3IFNL 2V17H 4P3CH 1ZLVK 2IBZX 3PDDA 4JFPA 4PRPB 2YSSA 3QH3A 1F6LL 3IJSB 4C83B 4OAWB 4JFZH 2R8SL 3MRMA 5T1LA 3MLXH 5ADOH 2CMRH 3IDUA 5C92A 1UXWB 1DQDH 5L7XL 3RPKA 5CZXD 5I1KL 5IOPA 1XGQB 5GGUA 4PRPD 4TVPH 5BMFH 2Y06H 5FYJU 4S10A 3DETC 4WWKC 4IRZL 2PXYD 2OI9B 5I0ZA 1PX3A 1ZHLB 2BDNL 4GRWF 4JDZA 4WIQA 4S1DD 5I74C 1HSBB 1OB1B 1QSEE 4JZOB 4P2OD 4Y2DC 2GW5A 1Z9MA 4OCYH 1OP5K 1DLHA 1NC4D 2LAGB 2W9EH 1IC7H 4OLZH 4ZFZA 5BXFB 5H94A 1TZIB 1MOEA 5ICZB 2R39A 1J7VR 3DUHA 4G8GB 3T1WA 2MCPH 2AJXH 2RFXA 2R56H 4NO3B 5DDHA 5JA9A 4P5KB 4CMMB 4OKVB 3W81A 2DLHA 5DHYA 2GI7A 2XOTA 4UMGA 3KS0J 2FGWL 3E8UL 2NW2A 2H8PB 3CFJB 3L3GB 5IB4A 1E27A 1DUYA 3TPUB 2BERA 5DQJA 5D72H 2NZIA 4JKPL 2X41A 4HWUA 4OV5A 2ZUWA 4UDTA 2Z0BA 3MLRH 4U7KA 5FGRA 3NH7H 5E8PB 2QSVA 4G9DA 3QUXA 3UTPE 2NQCA 2PTTB 3F12A 4HKZB 1FGNH 4UZGA 5LAXB 5GGTL 4NN7C 1H3PL 3B43A 1J86A 4F57L 3HLAB 3H6JA 3QWRD 5EZLA 2P4AB 4MLSA 1LK2B 5H2BA 4PG2A 1CQYA 3MOBH 1RZJL 2FO4A 4YPJA 1RU9L 5I9QC 2NTSP 3CSGA 1BBDH 5L88L 1RZGA 3B9KB 4FP8L 4D94A 1T0NA 3G6AB 3T08A 3S88L 3HNSL 3OJDA 1UB5A 4BFBD 4NNPH 1NAKL 3KPRB 5C09E 2WWKO 2GCYB 3FB6A 3DI2B 3QUZB 5IK3A 1F5WA 2DBJA 1NC2B 1VADA 3O4LA 5CP3A 2A74B 2X40A 3T2NH 3DROB 2HKHH 3WIHL 1EEQA 1YA5A 4NO0B 1FL3B 3C87A 4Y4FD 2WIMA 5E2TH 4LASL 1BVKA 3QZWA 3KPTA 2XWJA 2DOCA 3RVUC 3VD7A 1CFQA 3CFEB 3FQRB 4XCFH 1JVKA 2ZUYA 5BO1L 3WIIH 1RSFA 4KJWD 4QRPB 4YDVB 3UROR 4DUVA 3LAFA 3RJDA 1OL0A 4I2XE 3C9NA 1F3RB 4I4WA 1ZS8A 1U41A 1UENA 1B0RA 1XF2B 3VDCA 2AK4A 5IW6B 2FHBA 3ESUF 5K9JH 2H9GB 5F3BA 3U9UA 1OPGL 2DBLH 2VIRA 4X7FC 2FX8H 2A9MH 4N68A 3JTSA 3MLSL 5I8EB 3SHSA 2IAMC 2J8UF 2ILLA 3QJHA 3GK8H 4UQ2A 1QVOA 4N8CL 1AIFB 4Z8FL 3LRSB 3C5ZD