2A74B

Human complement component c3c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
183
structure length
183
Chain Sequence
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement Component C3c
publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
total genus 26
structure length 183
sequence length 183
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 2a74B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a74B02
1RIHH 4NYLA 5MEPB 4Z7WF 1FYTD 4M93C 3LQZB 2CLZB 1JV5A 4F9LC 5JHLL 3VXQA 3WNPA 3DX6B 1EMTH 1OARL 5HHPB 4ODXB 2D03H 1EFXA 1QSFA 5D1ZA 4P9MH 4MAYA 3H3PL 1PYWB 4F7PB 3BE1H 4D0DB 4NCDA 2VSCA 4JDTH 1R5WA 1C8PA 1CU4L 5JW5B 4OLWL 5CP7B 1F3JA 1F13A 2GUOA 5IEHB 3K2UL 2WWMD 1T03H 4JM2A 1ES0A 4OFDA 1D9KC 3S7GA 2XZCH 1A9BB 3QUYD 3VG9B 2E7LA 1CG9A 1T1YA 4XMLL 2BNRA 1DBJL 4QCIB 2X4NB 1JYNA 1CICB 3HMXL 4TSBH 2OP4H 4P99A 4U1JA 3JUZA 2HFFA 4HHAB 3HG1E 5ETUA 4QRUB 4NJ9H 3GGWA 4QHKI 4NO2A 4PJHE 5MENB 3KLSA 4LNVA 1FNAA 1L9MA 2FCBA 1J8HE 3IXTB 4LVNC 5DQDH 1DE4A 2Q8AH 2AV7B 4GG8B 3RWGB 2ILLA 3D69A 5CUSH 3L3KA 4WW1A 5E6IC 3AC0A 1KNOA 1VEPA 1NMCC 3MBED 1Q9OB 1PSKL 1YMHA 1CFBA 1RFDL 3PQYA 4QXUH 4IRJA 4DZ8B 5IVXF 3QQNA 3JTTB 1GL4B 2AXJA 3OB0K 1D6EA 4EI5D 2F8OA 5GGTL 3TBSA 3RJQB 3T0EA 2DKSA 2H3NA 3U9UB 3S34L 1KG0B 1KTLA 1A7RL 2W59A 4Q9BA 2X4QB 3U36A 2I9LB 3CXDL 4LPCA 1X5XA 3RL2A 3VH8A 4OZIA 5D2NA 5FUCE 3CFJA 3UTPD 5GQBA 5GS3A 2ADFL 5L6YL 3MV8E 2BXYA 1PY4A 3UTTD 2EDKA 4IJ3C 1ZWIB 3AM8C 3PWPB 1EAPB 2J4WH 5HYJA 3O3DA 4ZQKB 5IBUB 3TO2A 2WBJB 2QBWA 4MA8H 5INCA 3E6FB 1HYSC 3VFUA 1FYTE 4R4ND 3EDKA 4R8WL 4QHLA 3RA7H 4M1CD 2FL5A 1J86A 2OL3B 3SDAC 1X5ZA 3EHBD 5DD5L 2YWZA 2R0WH 1ZS8B 5AEAA 4ZNEA 4OLZL 5FHBL 4Y19A 3HI1B 1KPVB 1AIFB 5I76A 1MRCH 1U8PB 3WUWG 4CAGA 3I6LE 2YZ1A 2C3XA 2OZ4H 2AXFA 4RIRA 5D2LB 1FZMA 4HIEB 3I50L 2VDOH 2IQAB 3GJFK 3VE0B 4HH8A 5KBNC 2IH1B 2E7HA 4DKEH 4TVPL 2CKBB 2Z93A 4XP6L 3RIAK 5CSGA 1EO7A 3N1MC 4R26H 3OAZH 5I66B 3VJ6A 2HH0L 1UACL 4R7DA 5F72S 3VXRB 5I1KH 4NYLB 1HNFA 1QUNA 4U1MA 3GIZL 3WJJA 1JV5B 3M45A 3VXQB 1RUKH 1EFXB 5C09D 1QSFB 5D1ZB 2HT2C 1YZZA 4MAYB 1F4XL 5EUOE 5C0IA 4BH8A 1VGEH 3DMMC 2EXWD 4I0PC 1R5WB 4IDLA 1F3JB 2C1PB 2DOCA 2GUOB 2EICA 2FHCA 4JPWH 1JFQL 4JM2B 1JF6A 1ES0B 2W65A 1Q9KB 1I3RA 1LO3L 4XCFL 4NQSA 1DUZB 3ULUC 2JB6A 1CG9B 1T1YB 2XTJE 4NKOA 4WWKA 1PG7L 3RX5A 2X4OA 4JQXC 4OGYL 4QRSA 4U1JB 4W4NA 4BZ2H 1HK6A 1OTTC 2HFFB 1FAIH 5ETUB 1G0YR 3VI4F 3GGWB 4NO2B 4NHUB 4LSTH 5E5RB 3D0VA 1GGUA 3UTPE 1T2JA 3V4VL 1EPFA 3ULSA 2GJZA 3JTSA 3RVWC 1DE4B 3F12A 3DVGA 3IDNA 3D69B 3SJVE 5L88H 2VZVA 1AR2A 2X4SB 3L3KB 2Z91A 1IRAY 4WW1B 4HS6A 4CMHB 4PB0H 4XH2B 1KNOB 5DWUH 2ZCKH 2FEEI 5TPWH 4ZS6C 1IGML 3DX7A 1YMHB 5FHAH 2JJUA 3G5VA 3GMPA 3BRDA 3MUZ1 4FXKA 4IRJB 4D0CA 3MLSH 1IGFL 3VGAC 1BOYA 4S1RH 3NCFB 3MTRA 5IIEA 2GTZA 3V5KA 2EKSA 3T0EB 2H3NB 5HHME 5DVLA 4S2SB 4EEEA 3C5ZD 5F71A 1GGCH 4LARH 3RL2B 3VH8B 2GSIA 1JL8A 4ZUTA 4OZIB 1F6LL 3HE7C 4H0IA 5D2NB 5GGSA 4NZUH 1MCNA 5CJBA 4LPYA 5BO1L 5GJTH 3WS6A 3KJ6H 4LMQE 4ODVL 1XF2A 5IP4A 2IGFH 4NZDA 1KIRA 1L4IA 3KYMA 3O3DB 4GQPH 3KPNA 3TO2B 1HQRA 2F5BH 2K9UA 5INCB 1N4XH 4WUUB 3IU4H 4BYHA 1CT8A 1U36A 3BGAA 2DAVA 3BWUC 1CFNB 4KDVA 4QLRA 3VFUB 2LU4A 3LB6D 5IFAL 4QHLB 4KHTL 3OJ2C 4FA8A 2DI9A 5C09E 4MWFA 5KSBE 4MNQA 4BA8A 4F8TA 2P8MA 4X83A 4XHJC 4Y19B 4IDJH 2WUCH 4DEPC 5I76B 5FM4A 2WK2A 4HSQA 5IWLC 3TIDA 2AXFB 4RIRB 1FZMB 4PJ9C 4N0YH 4NNXA 1QSVA 2Y23A 1KXVC 3PV6A 1MFDL 4UT9H 2R4RH 2YSSA 3EZ8A 4O51B 2Z93B 5KW9L 1JNLH 4R7DB 1FSKC 4KKAC 3PGDA 4U1MB 4GW5A 2PYEA 1I8IA 1WQVT 3S5LA 5I1HH 5EORL 3GO1H 3O2WH 4WWID 1T1XA 4UOW0 5L2JA 5KVEH 5C0IB 4F37F 1IM9D 3QDMA 4BH8B 3VMPA 1DBKL 5MI0B 3TCXA 1HHHA 2D7OA 4P9HH 4UBDC 4YFDB 3WS3A 3EZJB 3OWEA 1V5JA 4NQSB 1LO4H 1ZHBA 3B5GA 2JB6B 3WXWL 4LLYB 4NKOB 1VADA 4KKBC 4WWKB 3LS4L 3O6FD 2X4OB 3KWWA 1SJVA 1XF5A 2QSVA 3B3IA 1QA9A 1BZ7B 4LRIC 3TBVA 1IBGH 4ENED 2R9HC 5AYQA 3D0VB 3X14A 3EYSL 2GJZB 3ULSB 3JTSB 4POZC 1OL0A 1AD0A 1A3QA 3F12B 3DVGB 3GMRA 3IDNB 3MYJA 1T7YA 5E2WL 2P5WA 1BF8A 4QEGA 2Z91B 2J1KA 4HS6B 4AG4H 2ZOKA 4X4ME 3PABA 3LH2L 4ZFOL 5I6XC 1YNLL 4Y7MA 4XXCA 2EDNA 2GHWB 3SO3C 1Q8MA 3G5VB 3GMPB 4FXKB 2AJYH 4MA1C 2X4RA 4GUPA 1Q1JH 1B6UA 5IIEB 1Z9LA 2GTZB 2EKSB 3V5KB 5LWYH 3I6GB 1G7PA 2RHEA 4UV4H 1IMHC 2K7QA 3I02A 3VXMD 5DZNA 2DMKA 1CTOA 3JWDL 2FATL 2GFBA 2GSIB 4PJAE 3DSFH 4ZUTB 1DR9A 5GGSB 1PLGL 2NXYD 4S0SD 1UM4H 4XWGL 2DQEH 1S5HA 1XF2B 2E6JA 2B0SL 2XI9A 1JUFA 1KIRB 1F8TH 1MRDH 3KYMB 3KYOA 4G80B 4LSQL 3ARGA 3KPNB 4TNWK 1B0RA 1HQRB 4OB5L 4PY8J 3IF1A 4ZFOA 4G3YH 5ESVA 3VG9C 4TPRL 2J88L 4XCCH 1BZQK 1FYHB 3O3AB 4GMTL 4UMGA 4G5ZH 5FDWA 3QI9D 3LPFA 4MNQB 3RGVC 3VFGL 5IVZA 4L4JA 1JZ3A 3RVUC 3VRLE 5JR1L 3ARZA 4J23A 1MHCB 3TIDB 5K9OB 3L9RB 2Y7QA 4M7JH 2FRGP 4DUWA 1RD6A 4NNXB 4DK3A 3PV6B 1N6UA 4AQOA 3VI3E 4PJDE 2YA2A 5JUEL 5HHXL 4UTBL 4CKVX 3JV0A 1NAMH 3CVHL 1CLZL 4M8VA 3TFKC 4Z5RA 5EO0B 4PLOB 1S9VA 4NQCD 3TVMA 3PGDB 4GW5B 2PYEB 1I8IB 3S5LB 3ARDA 2FIKA 2Z8WC 4ONOA 3L1OH 1NMBL 1T1XB 5FOJA 5L2JB 4CDHA 5CJOL 5FOBA 1I9RL 1ACYH 2X70A 5SWSD 3QDMB 4O5LL 2CO6B 3QUZC 5KSVA 2UYLA 3O6MH 1UJTA 3WS3B 3BGMA 4FS0A 3QRGH 4M7LT 2FX9L 1VADB 3S4SB 4AQ1B 2OSLA 4GKSA 3SKJH 5EO9A 1R3IL 4ZUWA 2RGSA 2DQHL 3VXME 3B3IB 4HIXL 1QA9B 1GGIL 3TBVB 2XNAA 1O0VA 5B4MD 3ZZ1A 1F3DH 2DQDH 3X14B 2QADB 4PJBF 4DAGL 3Q6FB 1D5ZB 1R5IA 2FX8L 1AD0B 2Y6SD 4Z76B 2DI8A 3GMRB 1X5KA 3MYJB 1RU9L 2P5WB 4XI5C 1YY9D 1QFUH 3PABB 1DN2A 4K9EH 1A5FL 1KC5H 4XXDA 4GUPB 4GG6F 2BRRH 2ERJC 4HDIB 4N0UE 5F6IB 3GRWH 1G7PB 1X5JA 2MNUA 4GAYA 4GKOA 2BDNL 3L5XL 2GFBB 4IM8A 1T0NA 3U9PH 5E8EA 1ZT7B 1JWSA 1V8HA 3BW9A 4WY7L 3ILPA 2CUMA 1S5HB 3HE6A 4FTVE 1JUFB 5TJWK 2NZ9C 2EC9U 3BZ4A 3KYOB 2F58H 3ARGB 3WFEH 3QXAB 3MUY1 4X6DE 5FCUH 3QIUA 4KTDH 5CBEA 3IF1B 4JRXA 5GRYA 4ZFOB 5ESVB 3WFHA 2E7LC 1FRGL 3A6CH 2H2PD 2HTLC 2DYPA 2HWZL 3MFFA 1ZANH 3V4PH 4K71C 3GDBA 1M71A 4PRHA 2A2QT 4NBYB 4GW1A 3K8KA 5FDWB 4J4PC 2E8ZA 4PJFE 5IVZB 2MCG1 4N1CA 5GZOD 1CXIA 5ALCH 3SGDH 4O2CA 4M62L 5ALBH 5F1KC 5DMIL 5DJXB 4U1IA 2Y7QB 2X44D 3VA6A 3VXSA 4OUUA 1OT2A 5F70A 2HA1A 5FGBA 4M7ZB 3T0WA 2X4TA 1QEWA 3ZKMD 3PGFH 5E2VL 1FLRL 5C6WH 4IRJC 1J1XL 4FQCL 4Z5RB 3C5SA 1S9VB 4P5TD 4FQJL 3T0EC 2R0KL 2YD8A 3TVMB 2G9HA 1K3IA 4I2XB 5SV3A 1R5VA 1BFVL 4KVCL 3BN9C 4U0RB 4HW6A 3N1PC 3ARDB 5EZOH 2FIKB 3W5MA 1CBVH 2FR4A 25C8H 3DTXA 4LASL 5FOBB 2X70B 3IFOB 5IB4A 2BVTA 5CSZB 5KSVB 5EWIH 4RFOL 3O3BA 4HUUA 3ARFD 2XKSA 2XY1A 3BGMB 3NZHH 5IW1A 3NA4A 3W9EA 2OSLB 5DD3H 3CSGA 3GI8H 4GKSB 5EO9B 2O26U 1WCBA 3HFML 1LNUA 4ZUWB 2DQFA 4NFBA 2XZQH 1EA9C 2WAHA 1RK0A 2JB5L 2XNAB 5I30L 2AJXH 5BZWA 4DTGH 1JIBA 1R5IB 5C07E 4WEBL 4ZTPL 1DBBH 1YYLH 4NZTL 3BKMH 5DT1H 2DTML 4FQHA 3TV3H 3GMLA 1KN4L 3PL6C 5C0AD 5GGQL 3O4OC 3C60C 3BEWB 5I1IH 1YJDH 2W0KA 4HJJL 3C9NB 3BPNB 4O2EA 3QDJD 2EEBA 5DJ8A 4XXDB 2VXTL 4R4BA 2KQNA 3R0MA 5BZDA 3BUTA 3O11A 4YHNB 1NFIA 4GAYB 4LKCA 2OR8A 4HIJA 1UH4A 3MLUH 4OCLC 4A6YH 4Z6AT 4X9HA 1T0NB 2D0GA 4S0TD 3QCUL 3WJJC 3ZYIA 5E8EB 1JWSB 4LSSL 3BW9B 4GJTB 1AQKL 5ITBH 3ILPB 1JPTL 2H6PA 5HHQA 5BMFH 3EDFA 1CXEA 2X1OA 3CCHA 4UB0L 3BZ4B 1KLFA 1KTDB 3HC4H 4NC1C 1A1NA 1LP9F 1XGUB 4ZUUA 4BJLA 1TJIH 3KYKH 3QIUB 5CBEB 4JRXB 2V9TA 1MCRA 5L8KB 2ZCLH 2GIYA 4WHYG 3WFHB 2DYPB 1HE7A 1QSZA 2B1HL 5JA9A 3MFFB 1M71B 5T3XL 4PRHB 4GW1B 4C83B 4KMQA 1HH9A 4Y16C 4HT1L 5DMGD 4M7KH 4OKVA 3MGTA 2CDFA 4MCYA 4ZOCA 1FGVH 4LQFL 2HN7A 2BY0A 4WGVB 5GISL 5DR5H 4PS4L 5E08H 4IRZH 4FQ2L 3U7AA 4KHXH 5BQ7A 1LO0L 5JHDD 4U1IB 3VXSB 4OUUB 1LMKA 1MPAH 5E2TH 2XT1B 5BOPA 5I2IA 4FZ8L 4KWUA 5I19L 4P23D 1QEWB 4YO0A 1KCUL 1TFHA 1TLKA 5H37G 1B0GA 1ZLUH 1NBVL 4PJ7F 2YMXL 1OD7A 4TUKH 3EOTH 3UJJH 3C5SB 4OZGF 2ICCA 2G9HB 3D3VD 5DRWA 5IHUL 2YUZA 3CSBA 1C08A 4KROC 2O5XH 2R69H 4RWYH 1P4BH 2YRLA 2FR4B 2W0PA 3DTXB 4J3UA 4DQOH 2R29H 2UVFA 1LWRA 2XZAH 4YZFE 5C0AE 2APWA 5IB4B 1DBML 1JPSH 2NXZC 4N5ED 4S1DD 3C08H 4KRNA 3O3BB 4HUUB 4D0BA 4PJIA 3VDAA 4Q0XH 4OQTA 1CGSL 1KEML 4KKLD 5IW1B 3EFDL 4LIQH 2FGWL 3CZFB 3SDCD 3TWCL 3W9EB 2CMRL 1WCBB 1LNUB 2DQFB 4UNUA 4MD5A 3NAAH 1JNNL 4U6XA 4Z0XA 3GK8H 3IVKA 4ZO7A 3K1KC 3AS0A 1QYGL 2KQMA 2VAAA 4UV7L 4JQIL 1A3LH 1H3GA 2V6HA 4WW2B 5F7MC 3FAWA 4KRPD 4NC0B 1LDPH 3K0WA 4MDIA 2G5RA 1X6NA 5B8CA 5M7QA 4FQHB 1H3XA 3WFCH 3GMLB 4HWEL 5KS9E 3E8UL 1F6AB 3W5NA 4NCC2 2Y25A 1FIGH 3N0PB 3GEWB 1TJHL 1OTUC 5C71A 1NGYA 1G9NL 4MHHI 1CN4A 3X11A 4O2EB 1KB5L 1P69B 1BBDL 3K3QA 5DJ8B 5E99L 4C56A 4R4BB 1PJ9A 3HC3H 1VKXA 5BZDB 4ODSH 2DQCH 3O11B 2EO1A 1NFIB 4YFLI 2LU7A 3V0WL 4LKCB 5H8DA 4HIJB 5SWZA 4FQQA 4I4WA 3MLVL 4PJ8B 4KZEL 2H32A 2RAMA 2HRPL 3FO2A 1GIGL 4JLRA 4YHIA 4OI8A 4M8QA 5EBGA 3KPLA 1PKQE 1MIMH 2H6PB 1DQMH 3L5IA 5HHQB 2O5YH 4ZG1A 3CFDA 3AREA 4U1HA 2ICWI 2MKWA 1Z9SA 3B9KA 3CCHB 1BFSA 1C5BL 1T5WA 5HYFA 4ZD3H 1T83C 1EEZA 3O2DA 1A1NB 1B88A 4JPVL 4ZUUB 4TULL 2J5LC 4I48A 2VDQH 3BP6A 1HHKA 1S7RA 4JKWA 5TE4H 4V1DD 3WJLC 3D3VE 1BIIA 3LEYH 4AL8H 3BWAA 1BFTA 5B38B 1NC4D 3QIBD 2W9DH 1HH9B 5GGVL 3O8XA 4DKDC 4OKVB 3MGTB 3NCJL 1RZGA 2CDFB 3X17A 4MCYB 5EU7E 2HN7B 2QADC 3T09A 4ZFFA 3FQWA 4OFPA 5IW6A 3L3HA 4G6JL 1OAXH 5BQ7B 3BP4B 4XPHL 4KI1A 3SKNA 2ZP0T 1K5NB 4GO6B 5I2IB 2QLVB 3QQ3A 4XXCC 4YO0B 1NFKA 5IUSA 2FBJL 1BHGA 1IC5H 3UC0L 2NW2A 1LE9A 1P9MA 2OJZL 3MZTA 5C70A 5DRWB 2X1WL 1FZKB 3I84A 1C08B 1CFSA 3Q6GH 3IKKA 1EHLL 2UUDK 5AD0A 2GAZA 2D4FA 3D5OF 1T80A 2YD2A 4LIQE 3TPUA 5GGVY 3P4OA 3K1DA 5CD3A 3DI3B 5EOQL 3DO7A 4GS7B 3U7WL 2D4DA 4D0BB 4PJIB 3OAUL 2BSED 3BQUA 1OGAA 3MSPA 4Q2ZB 5EBMA 3EJZC 4G8EA 2WIIA 3B83A 5T3ZL 4XX1G 3WBDA 2CJUL 5GJSL 3FONA 3IXAA 3ROOA 4U1KA 2VABA 1V7NL 4MD5B 1FP5A 1OQOA 4Z0XB 3LPGA 4YHYB 3O3EA 5DSCA 5AWNH 5H2BA 4MYWB 3C09B 1NDMA 3LIZH 4NQDE 1P53A 2BNQD 1IT9H 4ONGH 1B3JA 4HEME 4G6KL 1IZJA 4MDIB 3H7LA 2A9NH 2CR3A 3CK0H 4K3DL 4KJWD 4OJFH 4K8RH 5DO2D 5B8CB 3FN3A 2AXGA 1UG9A 3EYFA 1RJYA 1U9KA 4HXBH 2C7UA 1GOHA 4LHUA 1AO7B 3HI5H 2VL5A 3IT8D 1NGYB 2JJTA 3GMNB 3NACL 2P1YA 3X11B 4EQ3A 1NC2A 4U31A 5CEZH 4C56B 2C4XA 1RHFA 3HZMA 1VKXB 1IEHA 1ADQL 1WTGT 1HINL 2JK5A 3HNSL 5FK9A 5SWZB 2R8SL 4XVTL 4FQQB 4I4WB 3QQ4A 2H32B 5E4EB 4I3RL 4K8RD 3FO2B 3TVMC 5CZVL 1SEBA 5H35A 3MLZH 5GHWL 3K74B 1I9IL 1CXLA 2NY6B 4JLRB 4YHIB 5DQJA 5TGBA 3VRJA 4U0RC 3KPLB 3FMGL 4PRIA 1I8KB 5HPOA 4GRLD 3GMMA 1G7IA 3CFDB 1XMWA 2F53E 3AREB 4U1HB 5CEZD 3B9KB 4HPYL 2J12B 1JHKL 4P2QB 1T5WB 4QRPD 2VB5A 3TJHD 1EEZB 4WTZA 2J6EL 5DJCA 3FB5A 1MLCA 1JGVH 4PTTA 1UQSB 4I48B 3BP6B 3DRTB 3H9SA 3TPKA 4P46D 1HHKB 1S7RB 3FQXA 3NTCL 4UIKL 5T5NF 1QQDA 4WO4C 1BIIB 1WZ1L 1BD2D 2QQNH 5J89A 4ELMF 1EEYA 4YBQC 3HR6A 3BDYL 3J8F7 1AGBA 1U92B 3KNBA 1RZGB 4PGJA 5T5NG 3VDCA 3DUUB 3EJYD 4ZFFB 2IMMA 3FQWB 4Y88A 4XNXL 3BAEL 4HFUH 3EGSA 1BOGA 3SKNB 1WEJH 4PR5A 3Q0HA 1N0XH 3WIFA 2XIDA 2VLJD 5IMOA 4F7TA 1NPUA 1INDH 2OYPA 3QQ3B 4NUGL 4DN4H 5HD8D 4RMUA 5CP3A 4GRMA 1GC1L 1A1MA 2NY3B 1U0QA 4JJHA 2VAJA 2NW2B 3MXVL 1AJ7H 1LE9B 3DWTA 1XR8A 1N2RA 2BNQE 2IG2L 4OIIL 1CFSB 2QSCL 2BSSA 3DBXA 4IRSA 2ATPA 5AD0B 2VXSH 4G6MH 3TN0D 2GAZB 1RZKL 1AGEA 3ULVC 4WI8A 1QBBA 3KPSA 5CHNA 3TPUB 2VQ1A 3P4OB 5CD3B 3UZVB 3BFOA 4UT7H 3VGFA 3HE6C 3DO7B 4PUBH 2VLKE 3NZ8A 5F9AC 1TENA 4PRAB 3FOLA 1OGAB 4M1DH 5EBMB 5GS1C 4QKXB 4FFVC 4G8EB 2WIIB 2HVJA 1T1WA 3PP4L 1CICD 4RAUA 3GNMH 1P4LA 2JCCA 2LFGA 1T2QL 3LEXA 3FONB 4JO3L 3IXAB 2X5PA 3ROOB 4U1KB 2VABB 1CLYH 3QXTA 5MEND 2EXYC 2VSDA 1MJUL 1P7KA 3O3EB 2ZKHL 4YJZL 2CLRA 5DSCB 1BM3H 1G7QA 5H2BB 5DMKB 3OJMB 1NDMB 5JZ7C 4P4RB 4MQTB 3JWOH 3PUCA 1Q0XL 3ETBF 4Z7VF 2Q1EA 4MD4A 1SEQL 4KH2A 1PZUB 2ED9A 3BPOC 2WUBH 1T7VA 5JOEA 2Z8VC 3QULA 5KTEL 2M2DA 2ZG3A 4P3DA 5CEZE 2YWYA 4WDIA 2AXGB 5LGJB 3JV6A 1RJYB 4Y4KD 4G8GA 3H8NA 3DYPA 1JPGA 1YEEL 2C7UB 3BKYH 1EBAA 4LHUB 2VL5B 5L2KA 3TCLA 5C0RL 4HK0A 3KLAA 5MEQA 4Z7NE 1NC2B 5EZJB 5FGBC 4K07A 4UU9A 4DKFH 1BD2E 5E70A 3QPQD 2Y06H 3OXRA 5IBTL 3VW3L 4OCRL 2JK5B 4F33A 1XCTB 5FK9B 1GVIA 3QQ4B 3T2PA 5EO1A 5D7SL 1SEBB 1UYWL 4YDKL 3CDGA 4L4VA 1FQ9C 4JB9L 4M48H 3VRJB 3ZE0F 5DQJB 4CNIA 4PRIB 3X3GH 1U42A 5BJTA 3BGFB 3GMMB 5DJ6A 3PWPD 3P4LA 1HSBA 4CVXA 2APBA 4G7YL 4S1SL 1CE6A 5IHBA 4IMLA 5DJCB 5BRZA 3FB5B 1MLCB 1E6OL 4PTTB 3MLRL 4IIQA 4QTIL 3PNWA 2DLIA 2DM7A 3H9SB 1G7HA 4HCRL 2KL6A 5CS7A 4O58H 5D7IF 3FQXB 1OM3H 1KPRA 1QQDB 1A7QH 2FJGB 3FO0L 1QFOA 3QNZA 2XACC 4MJID 4MAUH 5FKPB 1NKRA 3ILQC 5B3JF 1AGBB 3PWJA 3VWJC 4U1SA 4I9WD 3E3QC 3FTGA 4P5KA 2IANB 2VXVH 4GXUM 4JG0L 1QHOA 3RKPA 1AKJA 1RZFH 3S3JA 1BOGB 1QKZH 4PR5B 3C8DA 4K7PL 3WIFB 4KZDH 2EDBA 5IMOB 4F7TB 2FD6H 4TOYH 4RFEA 1FC2D 3V52L 5FDYA 1T66D 1E4XH 4S1QL 3U1SH 4YC2C 5IB3A 4TNVF 4YNYA 2C3WA 4GRMB 5MENE 1CDBA 4GMSL 1A1MB 4UDUA 4YDLB 3ARBD 1J0YA 5JDSA 1XR8B 1WZMA 3QEHA 3LRHA 4DW2L 3L7EA 4HCRA 1NGPL 3LKOA 4XBGA 1U3HD 1H8NA 1IKNA 2BSSB 2NPLX 4IRSB 2ATPB 3V8OA 5AZ2L 2AEQH 4M1GL 2O93L 3L3GA 5CHNB 3ZE2F 1L9NA 2VQ1B 2VUOA 2BX5A 4HMEA 4WFFD 4YBLB 5JHLH 1KBGL 1OARH 4JFFA 4HAGA 2FX7L 1I8MA 2A77L 4F57L 1I3UA 2HVJB 1T1WB 3H3PH 4RAUB 5IQ7H 3OAZK 4RQQA 1P4LB 2JCCB 4K7PY 4OZGE 1QFWI 1ZVYA 1CU4H 4OLWH 1IC4L 4MDJA 4RGNB 3K2UH 2CLRB 4QRRA 1G7QB 1MIEL 4XMLH 1VSCA 4LAJH 1DBJH 2C9AA 4MX7A 4MD4B 3JVGA 3VDBA 3HMXH 1TZHA 3PWPE 4LCYA 1BX2A 2W9LA 5F6HI 3QULB 5I8EA 4KQ3L 3P4MA 4P3DB 4YHZL 4WDIB 3DARA 3DI2B 3JV6B 5HGDA 5J11C 1NFDA 4G8GB 4CDGC 1NLDL 5C0DA 3RWFA 1BPVA 4EN3A 4S10A 1JPGB 5HDBE 2J8UA 2XWJA 5AUMB 2ZUXA 4IOFD 5L2KB 2VISB 2X05A 3B43A 3TCLB 4HK0B 5MEQB 3DROA 4MS8D 4UU9B 3ZYOA 1EJ6A 2G60L 2E6QA 1KCRL 4KI5D 2IAMD 3OXRB 4AEEA 4XVUC 4MJIE 1QBML 1PSKH 1VFOA 5HYQA 4F33B 1RFDH 2CRZA 4RNRA 5ERWA 5GRZA 3S37X 5JMRA 2PXYA 4I9WE 3IDMB 3CDGB 4L4VB 3OKDA 3ZYJA 1QRKA 4CNIB 3MV7A 5D2LE 5GGTH 1IAII 3S34H 4OD1L 5BJTB 1RJCA 1A7RH 4HMCA 3TT3L 5DJ6B 2WSKA 5F21B 4CVXB 3EFFA 4M5YL 3HG1A 1T0MA 1CE6B 4WUUD 4IMLB 3ZTNL 2HLAA 5BRZB 5D7JA 1VERA 2MPAL 4IIQB 3PNWB 4OZHF 3VXRE 5LGHH 1TTUA 4R2GD 5F7UA 2ADFH 2WQRA 1KPRB 1I75A 3D39A 1OGTA 2NY0C 4ZS7L 4KJYA 4RX4D 4PJEF 4D9RD 1NUDA 3QNZB 4YR6A 4HWUA 3B5TA 5HSFA 1TNNA 3PWJB 5B22A 5TQ0H 1HIMH 4U1SB 3RVTC 3FTGB 4P5KB 1MUJA 2GEEA 4JREB 4R8WH 1LK3L 4XZUA 1AKJB 3QIWA 4OF3A 5E9DD 1FHGA 1NQBA 5B8CC 4OLZH 3CU1A 4QHKJ 1B6DA 1UGNA 5DVNA 4RFEB 5E00B 4BSJA 4MJ6A 4OD3L 4KUZL 1KJ2A 1MCIA 4XWOD 4YNYB 4XVSL 5DVOA 5C0EA 5IB3B 1XH3A 4JCMA 1CD0A 2NZIA 4UDUB 4HWBH 5A2KH 1RIHL 3I50H 3QEHB 3L7EB 4NIKB 3LKOB 4XBGB 4TVPH 3ZKXC 3QR2A 4XP6H 2EE6A 1N7ML 2BY1A 5J7CC 4ONFL 1UZ6E 2HH0H 4PV8A 5FO7A 4M61A 3L3GB 2VYRE 2UWEF 4NP4L 1W8OA 3GIZH 4HUVB 4JY5L 3SE3A 1FYTA 4L9LA 1T03L 1OTSD 4OZ4A 4G6AC 1W72H 1I8MB 4LDLB 4ZFZA 3RP1A 1JF5A 1F4XH 5DD1L 4KI5E 4RQQB 5J1AA 4TVPD 3S6CA 4PP2A 4JPIA 2C1OA 4TSBL 2DQUL 2OP4L 3MV01 4MDJB 5D2NE 5ID0A 2R2EA 1JFQH 4YHML 1QFHA 1J12A 4QRRB 1LO3H 4JJ5A 1KCKA 3I6KB 3ZE1F 4EJ1C 1A6WL 1U3JA 2YHGA 1PG7H 2BXZA 3QUYA 2E7MA 4MX7B 3O8XC 1YPZA 4OCSL 4PJGA 4OGYH 1TZHB 4LCYB 1BX2B 3P9MA 5BV7B 1KSRA 3P4MB 1X5GA 3I2CL 3UJTL 5EOCL 4MZ2A 5HGDB 1NFDB 3SCMC 4WUUE 1PW3A 2EIDA 4I77L 5C0DB 4EN3B 3V4VH 3UYPA 2J8UB 2XWJB 3DROB 1ZXQA 3VWKB 4H8WL 4D9RE 4LLAA 3EO1A 1I3GH 4ZNEE 2FH8A 4Y19E 2OMNA 5EUOA 1IGMH 3L3IA 5HYQB 4HLZG 3RFZC 1YN6A 4RNRB 5ERWB 3TBYA 5DMYA 1IGFH 4PLJD 2PXYB 3OKDB 3MV7B 1AXIB 3F62A 4EI5A 4WFGE 2YA0A 3RX7A 5J12B 1JHLL 4LAQL 5D71L 3EFFB 2DBLL 2J4WL 3BP7A 3HG1B 1T0MB 1S7WA 3EOBA 3TLRA 1II4E 3ROLA 5D7JB 5CGYD 2VLRD 3BQUC 2GCYA 4WU7B 2ZOLA 3ES6A 4ODVH 1WISA 3EO9L 2A6KA 4K3JL 5D1XA 3D39B 5JPNA 1OGTB 3N85L 1A6ZA 4KJYB 2CXGA 2FECI 3UTTA 1CE1H 2W1NA 1YNTA 1U41A 2R0WL 4YR6B 3VCLB 5HVFB 3EYUL 5HVGB 1Y18A 4P59L 5KSAC 3UZEA 1NCAL 4NO5A 3ULUF 5IFAH 3T1FA 4XZUB 4KHTH 1BQSA 3QIWB 2IQ9H 1SM3L 1FZOB 4Z18A 5EUKB 4LCIL 1DL7L 3LKPA 4MJ6B 3DJ9A 4TVPE 1KJ2B 1OWRM 5C0EB 3FAXA 1XH3B 4R6UA 5CFHA 4UQ2A 5IT2L 4KAQL 3NCYS 1MFDH 1P84J 3TF7C 4YDJA 5D93B 5KW9H 4FZEL 1FG2A 1JZ5A 3QDMD 4HD9A 4PV8B 4L29A 2PF6A 4M61B 1NANI 3QXVA 1VGEL 4KVNL 3BGFC 1FL6A 4L9LB 2C5DC 4BKLA 1ZEAL 2DLTA 5EORH 4IHOA 4OZ4B 1C7SA 2OZ4A 4Q6IA 4ZFZB 1J1OL 5C09A 5KSBA 1QACA 3FRPG 1G6RH 4ISVA 2F74B 3MJ7A 1ONQA 2KPNA 5J1AB 1OOAA 1JJUA 4PP2B 2B20A 4JPIB 2C1OB 1WFTA 2X1XR 3H3KA 2E3VA 1NCWL 2R2EB 5FV2A 4PJXF 1A8JH 4JJ5B 5A2FA 4X7DC 4XPFL 4W6WB 4FP8L 4LFHD 2X7LA 3LS4H 3QUYB 3OB0H 5DS8A 3RBSA 1YPZB 4PJGB 3DETD 1KF9B 3PDDA 3P9MB 4H1LH 1MCQA 2BP3A 2R56L 1G0XA 4YX2H 3AU1A 3KR3H 3U2SA 2GJ6A 4D3CL 4OI9A 3BDXA 1XIWC 5FHAL 2EE9A 2W92A 5I1CL 4AJ0A 2WWKT 5C08A 3RTQD 2Z4QA 2NY2D 4S1RL 5E2WH 3DECA 4PRNB 4WHTA 2VWEC 4U7MA 4JFPA 1FFNB 5SV4A 3EO1B 3LH2H 4MNQE 2PYFA 3NIFE 3L3IB 1ZGLM 5DUML 3AVEA 3AS1A 1MJJA 2QKIA 5KVMC 2W0FA 3B6SA 1YN6B 5DFWH 3TBYB 3OJVC 2VDLL 2JJSA 3KXFB 4HUXA 3AB0C 1EX0A 1XT5A 4EI5B 5D7KD 3WO4B 4ZTOL 1L0XA 1X4ZA 3JWDH 2FATH 3C5ZA 3OL2A 3PJSA 1K8IA 1S7WB 1I3VA 3EOBB 4YBLC 3ROLB 1PLGH 3QT2A 1N4XL 3IS1X 3ZDXE 4XWGH 1ETZA 2ZOLB 3ES6B 2GSGA 1IM3A 3ZKQD 3GM8A 1MHPL 3CGTA 2A6KB 4Z7UF 2B0SH 2X10A 2PYEE 3LQMA 1KIUA 1INQB 1ZTXL 5D1XB 3QZWG 1RY7B 2UY7A 1A6ZB 3QCVH 4LSQH 3UTTB 3GI9L 3GJFH 3MMEA 2IBZY 4RGNC 5FKAA 1QBLH 4OB5H 4ESKA 2XQYK 1Y18B 3L95A 3QDME 5JPMA 1HHJA 4JHWL 4TPRH 4HQQH 2J88H 5J3HC 4NO5B 1FNLA 3T1FB 3U0PA 4GMTH 1G9ML 3WKNA 1VACA 5AAWA 1NSNL 4N0YL 1BJ1J 1X7QA 1WZLA 5LGKA 4U6YA 3VFGH 1U8LA 4UT9L 4OT1L 3LKPB 2YXFA 1WSST 4PJAA 3O2VL 4KFZC 3DNKA 1OAZL 1U8JA 1OHQA 5CKGA 2D9QB 4UQ2B 2FB4L 1A6PA 1KUMA 1J7VR 2ADGA 3TZVD 5FF6A 5JUEH 5HHXH 4YDJB 2P5WE 4UTBH 5HYSG 2Y5TA 4YE4L 3CVHH 1CLZH 3SHSA 1FG2B 2HFGL 4LCCA 43C9A 4L29B 1FVCB 5MEOA 4JZOA 5LXGH 1Q0YL 1KYOJ 2P48B 1ZV5A 1FL6B 3F65A 4PY8I 4BKLB 3MRCA 1CVSC 4IHOB 3RNQA 1J0ZA 3AXLA 4DVRL 1WK0A 5C09B 3VFPA 3HPJA 4ISVB 5CJOH 1I9RH 3F5WB 3MJ7B 1RJZA 5F7WC 1U3YA 4O5LH 4YGAB 5HJ3A 3RDTC 1IM9A 4NO3A 1AP2A 1IBGL 3ZTJG 5JORA 4LP5A 2FX9H 2X7LB 1PVHA 5F9WC 5A2JH 1Q9WA 5DS8B 1BQHB 3BRGC 1R0AL 1R3IH 4NWUL 4PJDA 1WBZA 3O6FA 4KU1A 3SGEH 2X6MA 4HIXH 2V5SA 1GGIH 3IAPA 4NKQB 4AG4L 1FNHA 2CDEA 2KKQA 4J1UA 2RFXA 3AU1B 3U2SB 2AGJL 2JIXD 3KHOA 4DAGH 2GJ6B 4FXLA 1AC0A 3DHMA 2FX8H 3HNVL 2AJYL 5IOPB 5C08B 2Z4QB 1RU9H 1JK8A 4WHTB 3T08A 4JFPB 4MMXC 3GMOA 2PYFB 4JPKL 2MQ0A 1MJJB 2QKIB 4HFWA 2W0FB 3B6SB 4NM8L 1OW0A 1A5FH 1N59A 1QFPA 1WAAF 1D5IH 4HUXB 1HZHL 2HYMA 3EYOB 3MRPA 3VMOA 1UM4L 5IHLB 1IKNC 4KKNA 4NSKA 5B3NA 5AZEL 1I9EA 5EDXA 2J3SA 4Z7WA 3S35X 1MWAL 3RVXC 3VXMA 5EU4B 3QIUD 3UPRA 1ETZB 3MRBA 2GSGB 4I2XE 1VGKA 1GGTA 5DVKA 1IQWL 5EIVA 3GB7A 5JXEC 1A02N 1RAMA 1U8HA 3MMEB 1G7LB 2AERT 2H1PL 5FKAB 5IJKA 2CIIA 3L95B 5JPMB 1FRGH 3CFCL 1HHJB 3P9LA 3UMTA 2HWZH 5E95B 1BAFL 3NA9L 4K3EL 3U0PB 2CRYA 1VACB 4N0FA 4E9LA 4NOFA 2ZWLT 1HYSD 3MACL 4WUKL 1X7QB 3MC0A 5CWSB 3QI9A 3ZKNC 1U8LB 2QEJA 3F7QA 3BESR 1OAQL 1YEFL 2EDJA 5IBUG 5GGUA 4M62H 2OTUA 5DMIH 1U8JB 1JZ2A 4M9PA 2NLJA 4NUJA 2ADGB 3WUZA 1WITA 5FF6B 4FQIL 5IESL 4LLUB 5IVXA 5E2VH 2Y5TB 1FLRH 1J1XH 2BSTA 4FQCH 2YXMA 1FNFA 4LCCB 4RCAA 43C9B 2PXYC 2W91A 3NCBB 5MEOB 4FQJH 4JZOB 3TH4T 2R0KH 1ND0A 4KY1L 4N0CC 4NQCA 1BFVH 4JG1L 4KVCH 2P24A 4U6VL 3MRCB 1E4WH 3RNQB 4JO2L 2E27L 3AXLB 3GFUA 4LASH 3VFPB 4XP9L 3SDXF 3HPJB 1PEWA 3MLXL 5D7JC 1LD9A 1RJZB 4L8CA 4PJFA 5HJ3B 2Z31C 5SWSA 4NO3B 2WLZA 1AP2B 1NAMA 1K4DB 2BERA 1MI5A 5HI5D 3DMMD 4I0PD 1FGNL 1H9VA 4LPXA 4JFEA 1Q9WB 4PJDB 3LN9A 3HFMH 3O6FB 4XMKL 5CJ8A 2JB5H 2CDEB 4J1UB 5I30H 2RFXB 1TTGA 4HGWA 2L4OA 3MRNA 3B9AA 4K9EL 3STBA 5EC2A 4XAKD 3WIIL 32C2A 4WEBH 4ZTPH 1KC5L 4X98A 3EDEA 5BS0B 1JK8B 2DTMH 2BVQA 3B8SA 1IARB 2EH8L 5J6GA 3C5JA 1KN4H 5FUCC 1CQKA 5GGQH 4PJ8D 3TO4C 3INUH 2I07A 4HJJH 3RHWF 4HFWB 1N59B 1ZGLB 1B4JL 2VXTH 3LKNA 1MCFA 2VRAA 3MRPB 4HWZA 4DWHA 3VXSE 4XVJL 5D93C 5IM7A 3HB3C 3EYQD 4NSKB 1NGQH 4KGLA 4JY6A 2PO6C 4Z7WB 1JI2A 1K8DA 4LSRL 3WFEL 5IFJA 2AK4D 4LSSH 3UPRB 1AQKH 3CVIL 3UAJD 1AI1L 2XKNA 3CFBA 2P8PA 4QGTA 1LQSR 1W0WA 1JPTH 1X5HA 2V17L 3A6CL 3I85A 4LMQI 1QZ1A 3GB7B 4UB0H 1ZT4A 2LAAA 3EOAA 4OZIF 1U8HB 4MVBD 4HF5L 5CJ5A 1NCUA 4AYFA 3HTLX 4JRWA 3GRWA 3ARPA 3LZFL 2CIIB 1FO0L 4Y5VB 5BCAA 2R1WA 3P9LB 3VH8G 1LO5A 3DURB 2Z92A 4LCWD 2B1HH 3QUYC 2EIZB 4UZGA 4YAQA 5JOFB 4DUXA 1KIQA 5T3XH 5FUOL 4KK8C 4N0FB 4YXKH 3U7YL 1A6AA 3LY6A 4HT1H 3BSZL 2QHRH 3QI9B 4RRPA 5GISH 4PS4H 2EH7L 1Q94A 4CU6A 3SQOL 4MZ3A 5D5MF 5GGUB 2OTUB 2FLRT 1REIA 4FQ2H 5ESQB 7CGTA 1LO0H 3BEVA 1FCGA 3LSOA 2YPKB 4Y4FC 4F15B 5A16A 2NLJB 1NGXB 2DQTL 2AJUL 1CFVL 5IW6B 4FZ8H 5T3XD 3MBEC 5EZOL 1KCUH 3AS2A 1KGCD 3Q48A 4PJ9D 5IVXB 2P8LA 25C8L 3GSQA 1NBVH 3KS0H 3UTQA 1A4JA 2FDBP 3JWNC 2WANA 3RWEA 3GSNL 1ND0B 5F89A 4P5TA 2XTJC 4NQCB 2X1QA 1RVFH 2HMIC 2P24B 5IHUH 4J3XA 2FSEA 1GGYA 5LQBH 3W81A 3S3PA 2A6DA 3NZHL 3ZYZA 5FO9A 3VFVB 4J3VA 1G0DA 5C0FB 4C4KT 3ZL4L 1ZHKB 5FV1L 1A7PL 3LMJL 4L8CB 1DBMH 5SWSB 3RX8A 1NAMB 1MI5B 3ARFA 2GJJA 1ED3A 5SX4H 4DTGL 4CUCA 2OXGA 2FGWH 3TWCH 4RWHA 4JFEB 4LCUA 3MRRA 4Y5YA 3BKML 1JNNH 1YNKH 4CBPA 1YYML 3QP3A 1QYGH 1AO7D 4UV7H 5DC0A 1FH5L 4HGWB 5I71B 2AK4E 5EN2A 4LLQA 4JQIH 4R4NC 1YJDL 1WUNT 3BP5A 3GSNA 3EHBC 2PR4L 1WC7A 2MMXA 1CIDA 3C5JB 4WIQA 5HY9A 4L3CA 4G9DA 2OX5A 3MLUL 5C0AA 1TJHH 2I07B 5DEFA 4KDWA 4QNPE 1KB5H 4WFED 5IROA 1BBDH 5L7XH 5E99H 4WVRA 1A2YA 1WIUA 1QNZH 2P42B 3QDJA 4NKDA 5F7HA 4AM0A 2Y5EA 4HWZB 3VFRA 4YEFA 3B9KD 4WI5A 5I1JL 2EDYA 4P2QD 3SKUD 1JZ8A 4PG9A 3GBNL 3MLVH 4KZEH 5FYLL 2HRPH 1K8DB 5IFJB 2F8VA 1F4HA 3ZT7A 3BKJL 5JXAL 2A0LD 2YK1L 4JZNA 4A2LA 1DVFC 2I24N 2XKNB 3CFBB 4X7SL 2P8PB 1W0WB 4Q6IC 3Q5TA 4EDXA 4JN1H 4YH6A 4L8BB 2VE6A 3C6LC 1C5BH 1ZT4B 3EOAB 3L5JA 5T3XE 2Q76B 4JPVH 4TULH 3FKUS 5KS9A 3F58L 3WNLA 1EUTA 2H26A 5F1SA 5DC4B 1C7TA 2R1WB 4A6YA 1LO5B 2Z92B 1N5AA 3V0AC 3CMOL 4YAQB 4PJIE 4IRZL 3RGHA 1KIPA 1KIQB 4KHXL 1J11A 1JWMA 1Q72L 4JKKA 1A6AB 5GGVH 1XGPA 3N1GC 1MPAL 5DJAA 5F3HA 1FE8L 3NN8A 1MCWM 4XNYH 3HI6H 1Q94B 2NY3D 2XG5A 4LVEA 4G6JH 1I7ZA 3E0GA 4XPHH 3CDYA 3LSOB 5HDQL 1SMOA 5A16B 3SGJA 5JHDA 1PKQA 4AZ8A 3MLTA 2VLLA 3OKNB 4OLXL 5AYUL 1TPXB 4UILL 2V2TA 4LVOC 2P8LB 3GSQB 3CXHK 2FBJH 4X6BB 3UC0H 4YUEL 1A4JB 1J10A 1AO7E 3RWEB 2OJZH 1FO0B 3JV4A 5F89B 4M6OL 4P5TB 3MRFB 3KYAA 3D3VA 4I13B 1CDUA 1QSED 3BPCA 4QT5A 4OV5A 4E0RA 2A6DB 1EHLH 5FO9B 5SX5H 1DFBL 3C5ZC 1MFEL 3R06B 5JW4M 3QQ9D 4XBEL 1CGYA 2ATKA 3OAUH 2VITA 1Z0NA 2EYSA 4WFEE 3SE4A 3ARFB 1ED3B 2BVUA 3QUZD 4Z7OE 1N6VA 1A3LL 2CJUH 3IRPX 3S9DB 5GJSH 3SDCA 4LCUB 3S5LG 3MRRB 1LDPL 3HAEB 4P2QE 5DJ2A 1V7NH 5C6PB 3OZ9L 4BQ8A 2R1XA 3MLYL 3IDGA 1E28A 4QHUB 1I1RA 5EN2B 4LLQB 4GLRH 5FGCB 3N1QC 3HHRB 3UCRA 3BP5B 3WFBL 3GSNB 4X4YB 3KPPA 3LQAL 5DJDA 1D5MA 4G6KH 1WC7B 1P1ZA 4K3DH 1U6AL 3HC3L 1PFCA 1OB1A 4U1LA 3S4SG 3I75A 4ODSL 1T2XA 2D7PA 5HY9B 4L3CB 1EVUA 1JI1A 4JFHD 3X12A 3SDDC 3NACH 2HJLA 1A2YB 4NKDB 3QDJB 1X44A 5CLTA 4AM0B 1AY1L 4EVNA 2J2ZA 1ADQH 5IV2A 2LU3A 4NQEB 1G7JA 2O5YL 1HINH 4LCCC 3HNSH 3MRDA 4PG9B 5DTFA 4XVTH 3FN0L 4I3RH 5DMJB 4ZD3L 4HZLA 5CZVH 2LE9A 4FFZH 4JKMA 5GHWH 3LEVH 1I9IH 2Z35A 1AXSA 4JZNB 4A2MA 2VDQL 3FMGH 3H3BC 5GSVB 1UH3A 2AS5M 4EDXB 3C2SA 4LP4A 4AL8L 1MCEA 3LEYL 2VE6B 4HPYH 2Q87A 5I73C 1JHKH 4B7IA 3IU3A 2J6EH 3UYRL 4JGMA 3Q1SL 4L5FL 5I9QB 5KS9B 3RUGE 2NZ9D 2IAND 2H26B 5E5UB 4A6YB 2CH8A 3RWIA 4Y5XB 3NTCH 4UIKH 3CU7A 1WZ1H 4J3WA 4V1DA 3JUYA 1ACZA 1JWMB 4NKIL 1QSEE 4S11A 4D8PA 1R3HA 1NC4A 2HTLD 3BDYH 3KJ4B 5F3HB 1AHWA 1SHMA 3NN8B 3QIBA 1MCDA 1PBYA 5TF0A 3ARVA 3CFIC 1OPGL 1T21A 3U0TA 4XNXH 1I7ZB 2C3VA 3BAEH 1IC5L 2WP3T 1FNGA 4P9HC 4E41D 4YFLF 1OVZA 5JHDB 1PKQB 3MLTB 3FRPA 3OG4B 2VLLB 4XB8A 4Q97A 1MQKL 4IRSD 4F80A 3P2TA 4JANA 1Y6MR 3Q6GL 5I74C 4J3SA 4LSDA 5J4MA 2V2TB 1JBJA 3NVQA 1OW0C 4GG6A 1RUML 3MXVH 2AEPL 4CN6A 5I1LA 5I0ZA 3NOIA 1O7SA 3JV4B 2NY5L 2IG2H 2FHBA 4OIIH 1N5YH 3D3VB 1BF2A 3QHZL 3BPCB 1TIUA 4QT5B 4OV5B 4E0RB 5LJYH 3RZCB 4UUJA 5K9QG 1RZKH 1B2WH 5J1SC 1N8ZA 2B2XL 3T8XA 1UCTA 5T3ZE 5HYEA 2ATKB 2NXYC 3G6JF 5LVEA 3UDWC 2VITB 3LD8C 2EYSB 4PRIE 5I15H 4MXVE 5CMAA 1GOGA 3PP4H 2VKXA 1J1PL 1T2QH 2BY3A 2Q86A 4GAJH 4JO3H 3SDCB 3K2MC 2Q7YA 5DJ2B 2A9NL 1EHXA 1MJUH 2DQGL 5FYKU 2R1XB 2VDKL 4LSVH 3CD4A 1TMCB 1E28B 3IDGB 3IFLH 5DI8A 4DGIL 5C2BL 3H9SE 2BNQA 1MREL 3MRQA 3KPPB 5DJDB 1D5MB 1MNUH 1P1ZB 5D6CA 4KRPB 2W07A 1C5DA 4U1LB 1OB1B 3I75B 3ARUA 3X12B 4F15C 1IL1B 5C0RH 2IANE 4MSWA 3QZWA 2HJLB 3SDYL 3PL6D 3C60D 3CNKA 1ZLVK 5GZND 5IBTH 1AQDA 4PGDA 4XAWL 1EO8L 5IV2B 3VW3H 1G7JB 3IDXL 1MLBA 3MRDB 5DTFB 5INDA 4X5XA 5D7SH 5BRZD 1RZJL 4Y2DB 4PB9L 4Y8AA 1NCDL 1UYWH 4YDKH 4JB9H 2Z35B 1AXSB 5DK2A 2LTQC 4GW4A 1I1FA 3FB7A 2QSQA 4OBRA 4GRLA 4P3CL 3L3OB 3RPIA 5FYJU 1CLOL 1OCWH 4G7YH 4S1SH 5E03A 4J8RA 3ULVF 3IU3B 4QRPA 5EZLA 1E6OH 3UPCA 5DVMA 3FQUA 2JE8A 4HCRH 5TFSH 1FLTX 3RWIB 4P46A 1MVUA 2EO9A 1FN4A 1T7ZA 1AKJD 1OP5K 1P7QD 5HYSA 4V1DB 5ICYA 4BQ6A 4URTB 1BD2A 4HLJA 5LAXB 1R3HB 4X80L 1NC4B 2HT4D 1AHWB 2JCCE 3QIBB 1INDL 5I71C 4NQTA 4PJBB 2UUDH 5I8CA 2X9YA 3L5WA 1T21B 4M3JA 4RGNE 3U0TB 4Y16D 2WMPA 4JG0H 1VFBA 1FNGB 4M7LL 2Y6SC 1NAKL 5KVFL 4K7PH 4WI3A 2VLJA 3V52H 1F4YL 1KULA 4S1QH 4JANB 1J88A 3QUXA 2VXSL 1XGTA 4GG6B 4GMSH 4G8GE 5JIKA 1I8LA 5I1LB 1T20B 2AJ3B 2AJVL 4DW2H 2QR0A 4OLVH 1NGPH 4X0KA 4OZFA 4PUBL 3WXVL 5F7NC 5EIIB 2ZPKL 4ODXA 1EDQA 5AZ2H 4UUJB 4M1GH 4AEIL 5D7LD 1N8ZB 4N90E 4F7PA 3T8XB 3TN0A 4TSCL 1J0HA 1U8OA 3LKSA 4RGMB 4JZJA 5IJVB 4NNYB 2X40A 1OF2A 4OFVA 3B2VL 1JCKA 2A77H 5D8JL 1I9JL 4F57H 3BOVA 2NXZD 5CMAB 1IJ9A 6CGTA 3JWOL 3A0OA 3MYZA 5DEZA 2WUBL 2Q86B 1CICA 3ZO0A 2A73A 3PIQA 2Q7YB 1IC4H 4X9FA 5A2LH 5BRZE 4EN3D 5MENA 2DLGA 5EU6B 3OSKA 5DI8B 1MIEH 4OM1L 3TBWA 1IGYB 2DLHA 4JEGB 5EZIH 4WHCA 1H8OA 3RWGA 3MRQB 3VWKD 1CFQA 1JZ6A 4KQ3H 4YHZH 5ISZD 1C5DB 2DM4A 1NLDH 5GZOC 5IMMA 4Y4KA 1V7ML 3ARQA 4AY0A 3R8BB 4MSWB 4DN3L 5DZLA 2A6JA 4RFNC 4U3CA 1FC1A 3OKOA 1TPXC 1KCRH 4PJ7A 1AQDB 3CH1A 4PGDB 2X4QA 3ZKMC 1ZOXA 4JFQA 2I9LA 4OZGA 4FMKA 3SKMA 3JV5A 5INDB 5J9PB 4X5XB 4AENA 2EC8A 3MXWL 4ZUVA 3OKKA 4P5TC 4NN6B 4MLSA 1MQ8A 4NN5B 5DK2B 3PP3K 4OD1H 4GW4B 1I1FB 3TT3H 2ZG1A 3FB7B 4BFBD 4JM4L 1CF8L 2YKLL 4GRLB 1LDSA 4PLKC 4M5YH 1UZ8B 1VPOL 4JHZA 3ZTNH 4QRPB 4HJ0D 1MAJA 1PQZA 1IC1A 2MPAH 3P77B 3FFDA 2VN4A 3H7BB 1EHAA 4P46B 1MVUB 1FN4B 3G08A 4ZS7H 5ICYB 4Y5YC 1BD2B 1QKZL 2CPCA 4MJIA 4FRWA 1NLBL 5I8CB 3CUPA 3NFNA 4HKJA 1BMGA 2N7BA 2NTFA 5F9DC 3B9DA 3L5WB 4APQC 1LK3H 4QRRE 1VFBB 3BH8A 2ZJSH 1CXFA 2VLJB 3SY0A 3T3ME 4KJQC 4H26A 3B2UD 2ITDA 5B38G 4XVSH 1ULVA 3QUXB 1S7VA 1XGTB 1NFDE 5IROC 4PRPD 4ETQA 3HUJF 4AT6B 3NFPB 2J8UE 3FT4A 2QR0B 3ARBA 3ZHLA 3MZGB 4X0KB 4OZFB 2GTWA 2Z8SA 2ZSVA 3DGGA 1U3HA 1G84A 1N7MH 2I25N 4ONFH 1RIUL 3TH2T 5ISZE 5IQ7L 3TN0B 1AFVH 2NY1D 4NP4H 5HVHB 1U8OB 4RDQF 2C1PA 4FMFA 4JY5H 3NIGF 2FH6A 3LKSB 4JZJB 4OF6A 3MV7E 5K59E 1Q9KA 1OF2B 1DUZA 4LSUL 3K81A 4ODBD 3VFWA 1K9TA 3SQBA 5DD1H 4RDQG 1YEIL 1TVDA 2A73B 2DQUH 3A67L 3PIQB 4UAOC 1RZ8A 4PV9A 2X1PA 4R9HA 4YHMH 4NHUA 5DHVA 2LVCA 2DJ4A 5DHXB 3GSVA 4CMMA 4G9FD 3TBWB 1A6WH 1UM6H 3OBAA 2BNUB 4OCSH 1WLHA 3D39E 1S5IH 2X4SA 1CFQB 4JGUA 1NCCL 5ESAA 3I2CH 1UJ3C 2D9CA 3UJTH 1E4KC 5EOCH 4XH2A 1NEZA 3QDAA 4M00A 4I77H 4F7EA 3OGOE 5IMMB 4Y4KB 3KAAA 3FFCD 2V7NA 4TNVK 4X6FB 3KXFD 3SGJC 1AGFA 5BVJA 9CGTA 2CDGA 1OAUL 2A6JB 3GHEL 1UM5L 4KK5C 4H8WH 5F7DA 5E6YA 3EDJA 5F44A 2NY4B 3OKOB 4S2SA 4PJ7B 3ZSTA 1DP0A 3CH1B 4P23C 3JSSA 4EOWL 5C9JB 2IAMA 4JFQB 4OZGB 3V95A 3SKMB 5JIIA 4AENB 2YBRA 5TQ2H 3HMXA 4Z7QF 4ZUVB 3OKKB 1A3RL 3HLAB 5DJYA 5AG9A 5LGHL 1YQ2A 2DIAA 3SPVA 5D1XD 1JHLH 5DJZA 4LAQH 1L6XA 3GKWL 4AH2A 4RA0C 5D71H 5HYIA 2DBLH 5EU7C 1S78D 4Z8FL 1EZVY 3GM0A 4XNZB 1NGZA 1PQZB 4N5EC 4XTRD 4WUUA 5TQ0L 1HIML 4GRWF 1DLFL 1T7XA 3SE4C 1CFNA 2PTTA 4LGSB 3FFDB 3EO9H 4PRPE 5HGBA 4U1GB 4K3JH 3G08B 3N85H 4KKLC 1BJMA 5GGTA 1HSAB 1R3KA 4RX4A 4K23L 4UIMB 5D96B 4PJ5D 3EYUH 2YN3A 4MJIB 4WO4D 4GAGL 2GY7B 4P59H 1EHNA 3CUPB 3NFNB 4HKJB 2NTFB 4KUCF 1CS6A 4YBQD 1NCAH 4Q74A 2B4CC 4HWBL 1N6QL 1E4JA 3BH8B 3FQTA 4HS3A 1SM3H 4KRPC 5E9DA 2A9ML 1YPZE 2AW2A 4PJGE 4LCIH 3SY0B 1DL7H 4O51A 4H26B 2EECA 3ZDZE 2ITDB 1S7VB 2YC1A 5IT2H 4ETQB 4KAQH 4WNQA 3FT4B 3ARBB 3U46A 1I7TA 3MRKB 5C3TA 3QJFA 4R97B 2J7LA 2R0LL 3C87A 2DBJA 2GTWB 1W72L 2ZSVB 3DGGB 4R0LB 1U3HB 4JFDA 4TTGA 1B9ZA 2ESVD 4FZEH 1GOFA 3CLEL 3F7YB 4KVNH 3K4AA 1CFTA 5DD6A 1H3UA 5CBAA 1JTTA 3KXFE 4P2CG 3WFZA 1ZEAH 2VN7A 1H0DA 2COQA 4LLYA 2OBGA 4HWBA 1J1OH 3VFWB 1MCLA 1CD8A 3WYRA 1BVKA 2ICEA 1CDIA 4PJCE 1EEQA 1RZ8B 4PV9B 1BZ7A 1NCWH 1T0PB 4FFVD 2YZ8A 4HBCL 5DHVB 5D1QC 2GJ6D 3ZDYE 3GSVB 5L0QB 4CMMB 3P11L 5DLML 4XPFH 4ELMA 4FP8H 5C08D 2R1YA 2EXYD 2PUQT 4UNVA 3MRMA 2P45B 3SE8H 3UTTE 3G6JE 5ESAB 3SOBH 2R56H 4JVWA 4KXZH 5JZ7D 1W72A 1NEZB 1I3GL 4F7EB 1F11A 1XF4A 4ZOEA 1CDJA 2V7NB 3ARWA 4D3CH 3T3PF 3ARTA 5I1CH 3V5HA 1AGFB 5BVJB 5GRUL 4MQXC 2CDGB 5C7XL 4PIRF 5F7DB 1WGOA 4X9IA 3OAYK 3I6GA 43CAB 5T1KD 2IAMB 2XN9D 5DUMH 1RI8A 2YBRB 2I9TA 3L3DA 2VDLH 5DJYB 5DA0B 5TDNA 4LHUG 3SPVB 2MOVA 3IETA 4YK4C 4ZTOH 5DJZB 2OR7A 3U6RB 4AH2B 5D72L 5E1HB 4G80A 1CE1L 3HC0A 1NGZB 4JO4L 4LDOB 2R23A 3LDBB 4HZAA 4UT6L 1UEYA 2NX5D 1MHPH 2PTTB 5HGBB 2MCPL 2VLRA 1A6TA 4R2GB 1M4KA 1AXTH 1ZTXH 2PW1A 4ETYA 5I75B 3O3AA 4PG2A 1YC7A 3GI9H 2AABL 1I4FA 1JE6A 1R3KB 2IQ9L 4NFCA 1DQJA 5IMKA 3TH3T 4Z0BH 1B0WA 2ESVE 2A74A 3AS3A 5IBLD 1JYXA 1H15A 3CPLA 4U49A 2R4SH 4JHWH 4Z7VA 3TIEB 5FCSH 1MHCA 1YEGL 3OX8A 4WTZG 5K9OA 3ILQD 3L9RA 2MJWA 3VWJD 1G9MH 1MAML 4HS3B 3FQTB 4P2RD 2DMCA 5FXCH 1NSNH 1FZJA 4B50A 5E9DB 2ZNWA 4KJWC 4OM0L 3U48A 4CN1A 4OT1H 4OF5A 3MJ8A 4K3GA 2QQLL 4DFHA 3O2VH 5GGRA 1OLZA 1QRNA 4CJ1A 5GGRY 1OAZH 2YC1B 5EO0A 1TITA 3O41A 2FB4H 1P5VA 2GJ6E 4LOUD 1MCHA 4WNQB 3U82B 4ZAKC 3U46B 1I7TB 1HHIA 1QHPA 4GBXD 3QJFB 4X6CF 5C08E 3IGAA 2QJDA 1MJ7L 4JFDB 4YE4H 4L1HA 2HFGH 3SN6N 2FWOA 1G6RL 3PXJA 4NN6C 4K8RC 4CRPA 1Q0YH 3IDYC 1CFTB 5DD6B 3V6ZA 1TZGL 1UWEL 5CBAB 4HXAL 1UKSA 1H0DB 1CGTA 3HKFA 4DVRH 3S4SA 1J0JA 4ORGA 3HS0A 1DBAL 2AEIT 2H2SC 2ICEB 1BVKB 5E2UL 2HRLA 4OCWL 4KV5E 5IKCA 3STZA 3P30L 5I8OL 2XA8L 4JE4B 4P46C 1JGLH 4YX2L 3E2HB 3KR3L 1Q9LA 2X9WA 2VLMD 1KJMA 4ELMB 2VZ1A 3Q6FA 1D5ZA 1F90H 2R1YB 4Z76A 3W2DL 5BS0D 1R0AH 4NWUH 4BQBA 3MRMB 1YDPB 2X9XA 4HH9A 4IOIB 3PHOA 3RY5A 5JO5A 5JTWA 3BT2L 3CFKA 4U0QB 4XGZA 1W72B 2BJML 2AGJH 1F11B 1XF4B 4NQVA 1G6RA 1RV6X 3QXUA 3VXPA 5BVPL 2EYRA 3V5HB 4L8SC 4EDWL 1H3TA 3HNVH 3QA3A 4D9LL 1BQLL 4HDIA 3RTQA 4LPUA 1K4CA 1OAKL 2VZTA 1EJOL 3O4LD 4R7NA 3DX9B 4JPKH 5HPMA 5HD8C 1YMMD 4NM8H 3R4DA 1JRHL 4OLEA 2I9TB 4Q9RL 1K2DA 3L3DB 1ZT7A 4H1LA 3NCEB 1HZHH 1IAMA 4YFEA 3MREA 3KG5A 1YEHH 1WWAX 5TDNB 5JNYA 1W8NA 1U8KA 4OGZA 3IETB 5J56B 1HKFA 4B5EA 5AZEH 5LCVH 5EB9A 4QY8A 3QCVL 4PBWD 1MWAH 2YOCA 5E8DL 3S96A 3HC0B 3QXAA 3S97C 1QBLL 3QHFL 3VFMB 2R23B 4JZJC 5L8LB 3QDGB 4NGHL 5BW7A 2VLRB 4MQSB 1A6TB 1IQWH 4HQQL 2YPLD 3F7RA 3T0AA 4K7FA 2PW1B 1CICC 2EDHA 4MA7L 2MKLC 3PDOA 1I4FB 5IMKB 2VR4A 1DQJB 2VH5L 1PX4A 1D7FA 2H1PH 1YEDB 1I1AB 4FQ1L 2A74B 2XV6B 4XRCA 2NY0D 3RWJA 1JYWA 5GS0L 1LEIA 1H15B 3CFCH 3CPLB 4X5LA 3R1GL 2KZ1B 1FPTL 4Z7VB 1X4XA 3CX5K 1BAFH 4NM4L 3K46A 3OX8B 3NA9H 1E4XI 2GYSA 3MOQA 4Y0GA 4K3EH 5DJXA 5ACLA 5MP6L 4WRLA 3RVTD 3MACH 1FZJB 4WUKH 5D6DA 3DO3A 4TSAH 2PETA 3QSKB 1ODAA 2DDQL 3MJ8B 4BFIA 4FQPA 1OAQH 3RVVD 1YEFH 5JOPD 4P48A 3DUHA 5GGRB 2R2CA 4LKXB 1QRNB 3GJFA 4FOMA 4WFHD 1MCCA 3O41B 3UP1A 3G5ZA 5LXGL 4I2XA 2CO7B 4GRWH 1HHIB 3IGAB 4FQIH 3QPQC 5BS0E 5CJXA 3VGEA 5IESH 3W0WD 5I16B 3TZVA 4RBPK 1BFOA 2I60H 3SO5A 2UVEA 2FWOB 3QUML 5KVGL 1OSPL 3UBXA 1QR4A 5J0BA 1A14L 3AUVA 3IFOA 5CSZA 4KY1H 5DD0H 4RAVA 3V6ZB 4ZFGL 4JG1H 1M6OA 1MI5D 4U6VH 4JO2H 2E27H 2ZUVA 4JFED 4NOBA 4ORGB 4XP9H 4XNZC 3HS0B 5DYOB 2WBJC 3MLXH 4OZHA 3HUJE 4Z7WE 4F9LA 3U4EA 2EZ0D 4G6AD 4N5UA 5D7IB 5B39A 3QRFM 5IKCB 1YMME 2HG5A 5IK3A 3STZB 4OUOA 2D2OA 3CVHA 1I7RB 1I7UA 1IAIH 3KLHC 1NH6A 4PJEA 1Q9LB 1CI5A 1KJMB 4OF7A 1FGNH 5TDOA 1EK3A 3QXWA 1P84K 3P9WB 4KUCD 3IAQA 4XMKH 4HH9B 5GPRA 3PHOB 2X42A 5JO5B 3T4AA 1X5YA 3CFKB 4XGZB 2DB8A 1H5BB 2V9QA 4NQVB 3BEWA 1JN6A 1G6RB 2EDTA 3VXPB 2JIXA 2EYRB 3C9NA 4M4RA 5EULV 3WIIH 3QA3B 5EOTA 1D5IL 1GZQA 1F6FB 3RTQB 2V5RA 4JY4A 2NY2B 5K93A 1K4CB 1X3DA 2EH8H 1T66C 4OGAD 4R7NB 4YHNA 4HPOH 3QO0A 5HPMB 4MXQC 3S36H 2EIEA 3CSYA 4LLWB 5BXFA 1JPFA 4KJPD 1HXYA 1N3NA 4BSWB 4OCXL 1K2DB 3ARBC 4H1LB 1B4JH 2YA1A 3FOMA 3MREB 4POUB 4XVJH 2NTSP 3V8CA 5JNYB 1U3HC 1NEUA 1U8KB 5D1ZC 2MQ3A 3K8MA 4JFZH 4MAYC 4QY8B 2B5IB 5IVXE 3OF6D 3S96B 1KTDA 4LSRH 4MXWL 3PHSA 1XGUA 5JOPE 3RI5F 4JM2C 3CVIH 3OHXA 1AI1H 3IDUA 5E8OA 1EGJL 2V17H 2YUXA 4NQCE 4GT7A 1UXWA 3CSPA 1YEJL 4LVHB 1FFPA 4K7FB 4N8VA 5K33A 3DUSB 3RIFK 4C83A 4HF5H 1WF5A 2P5EA 3PDOB 4PJHF 5T1LD 2Y1VA 5DJ0A 3MJ9H 1ZVSA 5TF1H 3LZFH 1FO0H 5IB5A 4XRCB 3RWJB 4L9DA 1LEIB 5SWSE 2Q7NA 3AM8A 3QHTC 2Z0BA 4LQ1A 3GSXA 3O6KL 1MI5E 5FUOH 4L4TB 3U7YH 2H8PA 2AK1L 5EFIA 2BVPA 2VXUL 3BSZH 4CMHC 5KSAD 4JFEE 5DFVD 2VC2L 1QR1A 1HKLL 4GRWE 4UNTA 3GSRA 4M43L 4U05A 2EH7H 4FFWC 4BFIB 1DQDL 3BDBA 1V05A 1WCQA 5EOCJ 3SQOH 2AAVA 2NY7L 3GJFB 1IKFH 3FQRA 2Q3ZA 3G5ZB 4MS8C 2DQTH 2AJUH 3HAEH 4KQ4L 1CFVH 4KI5C 2IAMC 1E4WL 1M05B 3TZVB 4HKXA 1GZPB 3ULUL 4XNUL 5E2JA 1BFOB 2ZUYA 2EDWA 5D2NC 1U91A 3UBXB 1JHTB 3GSNH 2XOTA 4EUPA 4RAVB 1M6OB 4Y2OA 5FB8B 1EVTC 4U1NA 2G75A 3CAFA 3NCYP 3T2OA 2DM2A 3CZFA 1ORSA 3ZL4H 4OIBA 4OZHB 5ICZA 1A7PH 4M93B 3LMJH 3LDBC 2C4FU 3U4EB 5B39B 2HG5B 5IK3B 5I1GL 4JO1L 3CVHB 1I7UB 3FB8A 4GXVH 4LU5L 3ZHKA 4PJEB 3FHAA 1L7TL 5M95B 3DYMA 5TDOB 1RJLA 4OBSA 5SX5K 4WW2A 3DMMA 4I0PA 3DSNA 4Q6YA 2EE3A 5C8JB 1LO2H 4Q7DA 3B9VA 3T4AB 1MRFL 1NBQA 1YYMH 1RIVH 2A1WL 3GUTA 1FH5H 1F6AA 3GJEA 3INUL 1U2HA 1JN6B 1K6QL 4KKCD 3U4BL 1KYOK 2JIXB 2R0ZL 1RSFA 3GKZA 1FL5B 5EOTB 2PR4H 2AEWA 2VR5A 3D9AH 4FQXD 3LVEA 4QXWA 5KJRL 1GZQB 4JY4B 4NQED 3VI4E 1XIWD 4I8DA 4LVNB 1NGQL 1MVFA 3QO0B 4XWOC 4ZO8A 3CSYB 5BXFB 1JPFB 4PJ8A 2D7NA 1BWMA 5JDJA 1HXYB 1N3NB 3D48R 4JDZB 3LKRB 5DQ9A 3FOMB 4OGXH 2K3TA 1NMCB 1S7QA 4CVUA 3HNTL 5EUOF 5I1JH 2WW8A 3GBNH 4DGVL 5FYLH 3QWOB 5MI0C 2NQCA 1GHFL 3BKJH 5JXAH 2GT9A 2YK1H 2AK4A 3OHXB 4X7SH 2JELL 5E8OB 3SGKA 4MNGE 4WWKC 1UXWB 1QLEL 4HIIB 2E5EA 1FFPB 1B90A 3ALPA 3HE7A 4N8VB 3TJEL 5B38A 5JW3L 3S98A 4YXKL 2P5EB 2ARJQ 1QPPA 5DJ0B 4PJXA 2NMSA 1ZVSB 2QHRL 1MJ8H 2YRPA 5AG8A 1UA6L 1GAFL 3F58H 5IB5B 1FORL 4ERSH 5FYLD 1PEZA 4IJ3B 3CMOH 4PGBB 3GSXB 4LCWA 3BP4A 1Q72H 1PX3A 1K5NA 2H8PB 1MF2H 5EFIB 2DWDA 2BVPB 3HRZA 1FE8H 1RURL 1QR1B 3GBLA 3GSRB 4O02H 1SY6L 2BY2A 2IPTL 3FQRB 4UQ3A 3RHWK 1GGBL 1XGYL 5HDQH 5FGCE 1U3ZA 2IBBA 1N64L 1PGRB 4KK9D 2VOTA 1QD0A 3LRSA 3U79A 3WO3B 1RVFL 1FZKA 3RZCD 4OLXH 5LQBL 5AYUH 1WWWX 1IC7L 1CDHA 4HKXB 4UILH 5IR1A 4MJ5B 1I1CA 3BH9A 1J0KA 2FEEL 2HT3C 4PJ9A 4YUEH 1IAKA 1U91B 1MCJA 3HA0A 3ALWA 3HR5A 4PLJC 1A6UL 3LKQA 3WS6C 4M6OH 4U6HA 4EUPB 5KN5A 1EEUA 1OP9A 5CEXA 2VKWA 4NO0B 3QDJE 1DLHA 4Q2ZA 4U1NB 2G75B 1DFBH 3MA7B 2XTLA 1MFEH 3DHJA 1F00I 4N0RA 1VA9A 1ORSB 3D18A 4NQEE 3RY6A 5ICZB 3VXOA 1GCFA 4XBEH 2O61A 1YNKL 5CGYC 5C0BD 3U0WL 1RZIA 1I1YB 3FB8B 2XICA 2UY6A 5TDPA 1L6ZA 1IGIL 1P7HL 3GSOA 1FCCA 3RDTD 4BK5A 3QYCA 5KSBF 1M7DA 3IYLW 1RJLB 4BQCA 2Y36H 3DMMB 2J8HA 4I0PB 4F7CA 5FYKH 2AV1B 3OZ9H 4JRYD 1IGTB 3MLYH 3GUTB 3BI9X 2F15A 1CWVA 3GJEB 1AO7A 3W11D 2OR9L 2HJFA 3GMNA 5GSRA 3WFBH 2JJVA 3LQAH 5L7XL 4LRIA 3J7HA 1QNZL 2D0FA 5C0ND 1U6AH 1BVLA 5F3BA 3UTSD 1BQHG 2HKHH 3LHPL 4Y2DD 2NR6D 5FYKD 3DOSA 5FYLE 1BGXL 5DQ9B 1AY1H 1I8KA 5JHDE 1DQLL 1S7QB 4KRMB 1PG7X 4Z77A 1MOEA 5ANMA 5K9QI 4JN1L 4P2QA 3FN0H 1HN1A 5EU5A 4LLMA 1UQSA 2GT9B 2AK4B 4NZRL 4I18A 3DRTA 2OK0L 5HVWA 1IFHL 5FYJH 2FO4A 3HE7B 1KB5A 3QH3A 2HLFC 5T33H 2AVGA 5A3ID 5H94A 3UYRH 3Q1SH 4L5FH 4PJXB 1U92A 3QWRD 4NN7B 3DUUA 4XNYL 4UI2A 5JXED 3HI6L 2QQKL 4X4XB 3IDJB 1WV7T 1BBJA 1SVZA 2AQ1A 3MR9B 3MO1A 4LCWB 4NKIH 3REVB 4HC1H 2DWDB 3EO0A 3HRZB 3WD5H 5FYJD 2RIKA 1BWWA 2ED8A 5E0QA 1YC8A 5JIHA 4X7FC 2CUHA 1OPGH 4ZOAA 4P4KD 1FBIH 3UZQA 3P73B 1S3KL 4UQ3B 3ZKND 2RB8A 3RTQC 3RGVA 1AE6L 3AMKA 1YEKL 5F6IC 4MB5A 3LRSB 4IMKA 2KUTA 2ADIA 1MQKH 4PJAF 2E9WA 5IR1B 1S7UA 2A6IA 3BH9B 5CAYB 3P0YL 1WAAA 4PJ9B 1RUMH 4M5ZL 1IAKB 2AEPH 5DUBA 3RUGA 3HR5B 3T04D 3LKQB 1JMZA 3K4DA 5DFTA 4U6HB 2NY5H 5KN5B 5CEXB 2CGRL 4PRAA 3QHZH 1DLHB 3G6AA 1QSEA 2B5IC 1FSKB 3ARGC 4JHBA 4P49A 3D18B 2B2XH 3VXOB 1BLNA 3UTSE 4U2ZA 2P7TA 5EU6D 2O61B 5BW7C 2G5BA 1RZIB 3IRZA 3SGEI 4PBXA 5TDPB 4LVHC 5DMKA 1DSFL 3ET9F 3GSOB 1J8HD 4P4RA 2ORBH 5JMOC 1M7DB 4FQLH 4H5SA 1J1PH 3QUZA 4BFEA 2VZOA 4F7CB 3M1BA 3VRLF 2DQGH 5LGJA 4MB3A 4X6EA 2PKDA 2VDKH 3JWDC 4DGIH 2HFTA 2VDRH 1RULL 3NPSB 5C2BH 4JN2A 1ZK9A 2HJFB 5GSRB 4TUOA 3VI3F 1MREH 4X4ZA 4PJDF 5D6DC 5EZJA 4V1DE 4M7ZC 1N0LA 4ALAL 1FVDA 5IVNA 3AGVA 1BVLB 4OLUL 5F3BB 4RZCA 4PJBE 1XCTA 5GRJL 3DXAD 1S7TB 2QQQA 1IGCL 4FFZL 2DJSA 3LEVL 3SDYH 3TO4D 3HN3A 3ARDC 3TZVC 4RMQA 5I6XB 4XAWH 1EO8H 5FM8A 4Z77B 1TVHA 4ODWB 5ANMB 3IDXH 4XP4L 4DGYL 4AIXA 3MV8D 4MA1B 1RZJH 1GJIA 4PB9H 4ZO9A 1NCDH 3ARXA 2DD8L 4GG6E 5EU5B 1OY3B 4LNRA 4LLMB 3OPZL 4I18B 2BHUA 3KGRA 2PO6D 3PG2A 5KANG 2FJGA 4P3CH 3FN9A 2FO4B 1CLOH 3QH3B 1KB5B 4EBQL 5H94B 2VDML 4V2CB 5FKPA 1ADQA 1FVEA 5F9JA 3FB6A 4J6RL 4OZFH 4FG6D 2IANA 1BBJB 1H8SA 3I6LD 3MO1B 4X5WB 1F3DJ 1B4RA 4F9PA 1CVRA 4X80H 3EO0B 3RBGA 4XP1L 2EC9T 5F97E 1KENH 2FLBT 3QUXD 1AGCA 2IMNA 4WHYH 4XP5L 4KK8D 4OAWA 2FEDC 3RWCA 3BPNC 2AP2A 2IPUG 5EU6E 4LRNL 1Y0LA 3IFNL 2J6EA 4M7LH 5DDHA 2VDNL 3ME0A 1NAKH 5KVFH 4J4PA 3RGVB 4E41A 4Y1AA 1F4YH 2ADIB 1N5YL 4YXHH 4Y4FD 1S7UB 2A6IB 4KK6D 3PF2A 3V6OE 1B2WL 3DLQR 5DUBB 3RUGB 2AJVH 3MRIA 5IHZA 2IADA 2G2RA 1MCWW 1F58L 3WN5A 3WXVH 2ZPKH 1GPOH 2ITCA 3O0RL 5J57B 3G6AB 1QSEB 5I15L 5H37H 4X6DF 4AEIH 2XTJD 3ECBA 5FAAA 5ABDE 2HMID 4GAJL 4TSCH 1BLNB 1G1YA 3QIUC 1IEAB 2P4AB 1AGDB 3U83A 4PP1D 1CD1B 2P7TB 3MBXH 2G5BB 3DXAE 4LSVL 2ZUTA 3IFLL 3QEQB 2X4PA 3B2VH 4NCC1 5D8JH 1I9JH 2X2YA 4WV1A 2FZ3A 2P43B 2CD0A 4H5SB 1X5LA 3QUZB 4PJFF 3O45A 3SJVD 1MNUL 4XMPL 3M1BB 4KRLB 3W39A 2EDLA 4QRPE 4X6EB 5EA0L 4OM1H 1KCVH 1KN2H 2ZG2A 4JN2B 4H0HB 5AUMA 5IGXL 4OLYL 2VISA 3MRGA 3KVQA 4TUOB 3R0NA 4NNPH 3K7UA 2NY4D 1W0VB 5DEGA 4JFOA 2AQ2A 1FVDB 1LK2A 3D1MC 4I3SL 5D5MA 5HHMD 2HAZA 4TTDD 4ZNCD 2BSRA 4RZCB 5L9DL 2C4FT 1GYAA 1V7MH 1ZHNA 2F19H 4DN3H 3IDMA 3M07A 4IBLT 1X5IA 3UYOD 3PL6A 1TCRA 3C60A 3BD5A 3UPAA 1HNGA 1D6VL 1F2QA 1MFCL 1TVHB 2VLJE 3PWUA 1OCWL 3BYYA 3MXWH 2ERJB 1C1EL 3I3BA 5AAMA 3L7FA 5HI4D 1KPUA 4ODHL 4LNRB 1MCPH 1HOCA 1SBSH 3HZYA 1KV3A 3PE9A 5TFSL 3SDXB 4JM4H 4MD0A 1CF8H 2YKLH 2EEAA 1UWGH 1A7BA 2Q8BL 3LRGA 1DVFD 1VPOH 4WI7A 1FVEB 2BCKA 5F9JB 3FB6B 3C6LD 1JVKA 3P0VL 4NBXB 4M4PA 4JFYA 1RQ5A 3NBNA 5HI5C 4WW2C 4N1EA 3A6OA 4Y4HD 2NYYD 1ZLSH 1P7QA 5DUPH 4GAFB 1LP9E 3ZLQC 4C57C 1XGRA 5E00A 5DRXA 4UTAL 2BNRB 8CGTA 1NLBH 5ENWA 1INEL 1AGCB 4K71B 4OAWB 3K80A 3BIKA 3RWCB 5CD5D 1Y0LB 1HH6A 4Y16A 5DDHB 1NL0L 4I0CC 3F6LA 4P2YA 1X6LA 4E41B 4Y1AB 4OLVL 3WDHA 3D2UD 1YQVL 1JPST 5DHVH 2XQYG 4PJ8C 1BQUA 1T3FA 4OTXL 2WWKO 3DIFA 2F5AH 3RJDA 3VXUD 3LS5L 3IDIA 4RRPG 3MRIB 5IHZB 4HUVA 2IADB 2G2RB 8FABA 3WN5B 3RRQA 1ZA6A 3PQYB 1UFUA 2ITCB 3EYQC 3F6IA 4OKDA 1XF1A 4PJ7E 3QUKA 1ZLWK 5EBWA 1D6EB 1RIUH 1L7IL 3ECBB 3TBSB 4EI6A 3N50A 2AQ3A 2IALA 3HRPA 1KTLB 5D7LA 5F7KC 5SX4I 4HG4K 1U8MA 3P3YA 3U36B 5ECJE 3UAJC 3SGKC 1RUAL 2X4PB 3I6KA 4LSUH 1FDLH 3CFJB 2FZ3B 4WV1B 5GGSY 5EZIL 4MVBC 1YEIH 1ZLVH 3O45B 3A67H 4CVZA 4NN7C 4R3SA 2DS4A 2B1AL 5C2UB 3W39B 2XWBA 2HTKD 5HYJB 2HP4A 3UTOA 2UZYB 2CQVA 3WKMH 3I3DA 4DFIA 4NWTL 3MRGB 2EDFA 4W6YB 2EDEA 3VD5A 1HQ4A 1T6WA 2MQCA 4GSDL 4HUMB 4HULB 3VWKA 1H3WM 5DEGB 4JFOB 1NCCH 4GQ9L 1LK2B 5D5MB 3MGAA 5F96L 2FL5B 5ISZA 2BSRB 3IFPA 3HAEG 1ZHNB 4FFYL 1A6VH 1HCVA 1OAUH 2DQJL 3GHEH 4BUGA 1UM5H 3PL6B 3S88H 1KJ3L 1TCRB 3O4OB 3C60B 3MV11 3SDDD 4EOWH 1TDQA 1OP5H 4R4FL 3PWUB 4YZFF 2W38A 3O6LL 3B8YA 5F8QC 3L7FB 1A3RH 4GS7C 3PXHA 1KPUB 5K9JL 4P5MA 1HOCB 3HZYB 2XPGA 4WU7A 4N8PA 3VJ6B 3KPQA 4N9GA 3FZUD 4MD0B 5JW4R 3GKWH 2BOBA 3RY6C 4JHAL 3DPBA 4Z8FH 1AH1A 3CMGA 4L3EA 3VCLA 4ZPTA 3W82A 4YHYC 2BCKB 1DLFH 1JMXA 3C09C 1E6JH 2XZZA 3VXUE 1Z6JT 4JFYB 4WFFE 3AFLA 1T83A 4NQUA 4BUHA 5FIEA 4HKZA 4CVWA 3RNKA 1P7QB 2ZJSL 4K23H 1FZOA 2W65B 5KS9F 1XGRB 1I3RB 1ZHLA 5EUKA 5LKNA 4GAGH 5DRXB 1IVLA 2X89D 1YECL 3NPSC 3WJLA 3BPLB 5ENWB 3QNXA 4PGEA 2YPVL 3NH7L 4ZPVA 3BIKB 4QRSB 4HX1A 3H9ZA 1HH6B 4JVPA 4Y16B 1N6QH 3WNMA 1OP3H 4XPAL 2A9MH 3QCTL 3MX0A 4MGXA 4JFDD 1URLA 3TC9A 4F3FA 4TQEL 1G6VK 5E4EC 4W68A 1T3FB 3QFJA 3DIFB 3RWDA 2NY6C 1M1SA 1AFVL 1JNJA 3IDIB 1JZ7A 4MMZC 4PRPA 1C16A 1T6VN 8FABB 3DX7B 1ZA6B 2XRAH 4HKBA 4R96A 2NW3A 2R0LH 5HHOA 3AREC 2XFXA 4D0CB 3VGDA 3B9KC 3QUKB 5EBWB 2F74A 4EI6B 1H3PL 3CLEH 2IALB 5D7LB 3MGOA 1U8MB 4I18C 5CZXD 2A0LC 4KROB 4AIOA 5FGRA 1G9NC 2AJSL 3D85A 5A1AA 3VGHA 2F9BT 1UM6L 1KEGL 1KFAL 2NXZB 4GLRI 2QV2A 1S5IL 4XX1E 4XNMA 4CVZB 1R24A 4XCYA 4R3SB 1CXHA 1DANU 3JZ7A 3WE6A 2HJKA 4ZXBD 5E4IA 2XWBB 4HBCH 3FQNA 3P11H 5DLMH 3WEXA 4N68A 2XWTA 2BOCA 2V5YA 4G9FA 2ED7A 4P2OD 1CT8B 1A4KA 1HQ4B 3PP3H 4PRNA 2X41A 4LSPH 3TESA 1VDGA 1J8KA 1FFNA 1LEGA 3EUUA 1WBXA 4K94C 1X5FA 5ISZB 4X9BA 2NY3C 3IFPB 4XPBH 4MWFB 4BM7A 2APFA 1P5UA 2P8MB 5TQ2L 3FFCA 1P9MC 5GRUH 3DYOA 3KXFA 4IMKC 5C7XH 1WICA 1F97A 3KHQA 1UWXK 4QXGL 2EDQA 4LEXL 2OTPA 1QG3A 5E9DE 4Q9QL 4FTVD 1S9KC 2E9BA 4PJCA 4E42A 2ICWA 2BMKA 2YSSB 4EIGB 4CN4A 3QDGD 4P5MB 1KB9J 2XPGB 1VENA 1JGEA 4O9HL 3KPQB 4N9GB 1ITCA 1XR9A 1INQA 2BOBB