2A74B

Human complement component c3c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
183
structure length
183
Chain Sequence
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement Component C3c
total genus 26
structure length 183
sequence length 183
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 2a74B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a74B02
3W39A 4Z8FL 1YEJL 4OZFG 1ZT4B 5L7XL 4ODWA 1R0AL 3FFDA 4HXAH 4NN6B 3GMLA 3QCUH 4QO1A 3ARFB 4LLMB 4JANB 4JFFD 3NFSH 3HFML 5LG1A 5FHAL 2MJWA 4LLVA 5T3ZE 1Z9LA 4KDVA 5CGMA 2VLRA 1H3PL 1IZKA 3P9LA 2GAZA 2VDQL 4JG0H 2E5EA 1YEJH 3U46A 1N59A 4JPVH 1VKXA 4NT6B 2A83B 3TBWB 5HHNB 4TVPL 4AMKH 2CIKB 4V1DA 1K8IB 5C0BA 1QSED 4KGJA 1EHXA 1EO7A 1QLRA 5GZOC 1Q72H 5IUSA 1FBIL 4IHOB 3V6BR 1AO7A 1M4KA 3BFOA 3C6SA 4V2BA 4XWGH 1AGCA 1ZHNA 4YPJA 1D9KD 2VDLH 2CK2A 3OAYH 5HVGB 3P9WB 2WP3O 2YD8A 4KFZC 2CDFB 4MNHA 1V7MH 3FQTB 1UA6H 3V6FA 2XKNA 5C3LD 5C8JB 4LSSL 3IKKA 1IKNC 3DX9B 4RMTA 1AGEA 1T21A 2GHWB 1SM3L 1CD1A 1MCPH 4EI5C 1H15A 1M1SA 5D7SH 3WCYA 3CC5A 4PJ7A 4HUNB 3UEZA 2HJLB 5ELIA 1EJ6A 4I48A 1S5HA 4LASH 2YS4A 3MRBA 1U3JA 2VDLL 4FMKA 4PJ7B 5FYKL 1BZQK 3D3VB 5C08B 3U36A 4HX1A 3O3EB 1NUNB 4ZYKB 1MI5B 3HKFA 1T1ZA 3P0YH 1JTPA 3SDAD 2Q76B 3U1SL 5SWZE 3QCVH 2J1KA 2YOCA 4L3CB 3ARWA 3QFJB 1MPAH 5JDSB 5HHXH 2CJUH 3VWKD 1TJIH 3S96B 3SDAA 3MNWA 1NMBH 1HILA 5CBAB 2IFFH 5DD1H 5B8CC 4IDJL 5LGJB 4RWYL 2LQRA 5K9QI 4KMTH 5DK2A 2OK0L 1JUFA 2VDQH 2NTFA 3ULVH 2X89D 5F8QC 4LFHD 3LKNA 5GRVK 1GGUA 5I74C 2BMKB 3X12B 1JL8A 2Y9RT 5CSBA 3WSQL 1J0ZA 5JO5B 1HYSD 3B6SB 5DYOA 3JWDH 5EBGA 1FQ9C 4NDMB 4OI7A 5KSAD 4C4KT 1JK8A 1T66D 4O58L 5HHME 3OR6B 4LVNB 1DQDH 3V52L 4FG6D 1HHJA 3WIFA 1B9ZA 3OAZH 2YD7A 1TDQA 3KNBA 5LGHH 4LQFH 1D9KA 1JTTA 4LLVB 3D39B 4WFFD 5DJXB 1HQRA 3FT3B 3QUZD 4AENB 1KPVA 2BSRB 3D87B 2X4OB 4XWOC 4GLRH 3PHSA 5BCAA 2DM2A 4KRPB 1LO0H 3DRQB 1CLOH 5F6HI 4X6BB 1Y0LA 3C09C 4JPWH 5ACZA 2BJMH 4NZDA 1A4KB 4KUCF 3TZVD 4GT7A 3HCVA 3B9VA 4XTRC 1CR9H 4ZS6C 3L6FA 3LV3A 2DM3A 1A7OL 5HHOA 4TVSa 4NQCD 4QGTA 4PBXA 3HN3A 5D70L 3IT8D 1OWRM 4YE4H 1JYXA 2R1WB 3FHQA 1JGUL 5F7UA 3JWOL 4MWFA 5AWNL 4YHZH 5C07E 2XZCL 4R7NB 2IH1B 1RIVH 3IB4A 3LB6C 3S34H 3FQXA 1FPTH 2FJGA 2Q8BH 3MGAA 4HKXA 4CU6A 3ZE1E 3KG5A 4HIXH 2B1AH 2FZ3A 5DUBB 2JCCF 5TQ0H 5CWSB 4UV4L 1DLHB 2DIBA 5E2UH 2H9GB 3MXWH 5DT1L 3BH8B 4M6NH 4P2RE 2ZCLL 4APQB 1C08B 2C1OB 4PRNB 2VLME 5JTWA 1IAKA 3UMTA 4G8GA 4MNHB 2DQEH 2D2OA 3FO0L 2CLVA 4JO2L 1NGQH 2VN7A 5MENE 3EDJA 2KZ1B 5BV7H 4GSDL 4MJ4A 4I3GA 3L5WB 1NSNH 4ODVH 4R6UA 5DUML 3DTXB 4ONHB 3R0MA 5DJ0A 2BVPB 1OP5K 5IMKA 4PRHE 2V17L 1V5JA 3QQ3B 3LKSA 2IPTL 4KQ3H 4C83B 1EX0A 5JHDB 2VUOA 4GKNA 4QYOB 4Z7WA 4OZFB 4RMSA 5ITBH 1W72L 2FGZA 4Y4HB 5DHYA 5HHPA 3BKCL 5BMFL 3PHOA 2DTML 2EDDA 4NO0B 4MDIA 4Y16B 2R8SL 5AG9A 2AJSH 1J12A 1NDGB 1NSNL 3QUXA 4M6ML 4Z78A 1HH6B 5E6IA 5J13C 1JPGB 3L7FA 3SHSA 3DXAA 2WWMC 5EU4B 4UTBH 2FJHA 3VRIA 4OCMC 1NUFA 4OFPA 1T7XA 1G7HB 3MLYL 2IALA 2VE6A 1RJCA 4PJFE 5ALCH 1UVQA 1LP9A 1YUHB 2VZUA 3UROR 1QSVA 3RTQD 2HFEB 5AZ2L 1E6JH 1VHPA 3VXUA 4W70A 1NMCC 3OJ2C 2IBGA 3OKKB 1BM3L 2C4FT 5I1IL 1VFMA 1X9QA 4U1SA 1I7TB 2VAJA 3RWIA 3T4YB 4UTAL 3ULUF 2K9UA 2R1YA 1SJEA 4ONGL 3OL2A 4AQ1B 4XPFH 4BUGA 1X5FA 3EZ8A 4EN3D 1LK3L 4U1HB 1E4WL 2H3NA 4GFTB 1LEGB 1F45A 2HWZH 4CN4A 1ZTXL 1Q0XL 1JGVH 3CIQA 3FMGH 4FFYH 4ERSL 1LO4L 4B5EA 3KJ4B 2FNBA 1CG9A 1ZT7B 3GO1L 4UUJB 4LSUH 2J8UE 5D72L 1TZIB 2QV2A 4QXGL 3U9UB 3HG1A 4NKDA 1EAJA 4OFIA 4ODSH 5GXBB 2IANA 4JPWL 3QXUA 2VR5A 4QOKD 1HQ4A 2JJTC 1YEKH 1X7QB 2X1OA 1I7TA 5E1AA 3RWIB 3T4YA 1K4DA 1XGTA 2HAZA 4P9HC 2LU4A 4E41B 4LSUL 1LEIA 4OAWA 1MWAH 3BZDA 5SWSA 2KKQA 3BSZL 2JCCB 1A7PH 3B3IA 4AENA 12E8L 4HGKC 2BY0A 5DJXA 3GBMH 1LO2H 1UB5A 1F4HA 3QEGH 5CP3A 1QTYT 4LAJH 2JB5L 4X7SL 4UI2A 1D6VL 2EKJA 3EFDH 5A2IH 1QO3B 4L9DA 3ARFC 4RMVA 3UJJH 1YMMD 1T03L 4GRWF 4OV6F 5HDQL 5JOPE 4OLXL 3FTGB 1MREH 4K3EL 2A0LC 4P59H 5IFJB 4QOKA 4ZAKD 1NKOA 4HLZG 5D5ME 4BFBD 5D5MB 1XF5A 4MX7B 2VQTA 2B1HH 1H3GA 3SKJL 2W9LA 4UZGA 4G43B 2IPUK 3NIDE 2RGSA 1I7UB 3STLA 2E27H 1IE5A 2VB5A 3O4OC 5C0RH 1MAML 1EGJH 3UX9B 32C2A 4D9QE 4NQUA 2OLDA 5EUOB 3L5WA 2OTPA 2CLRB 2H41A 2PW2B 2PCPB 4PJ5E 4FHBD 4HMEA 4MYWB 2OJZH 3GSRB 2A9MH 2NX5E 3VFGL 4EDXB 2YZ1A 2BNRD 4OLVH 4F3FB 4HG4K 4RIRB 4MDJB 5D2NE 4I77L 1DL7H 2RQ8A 3O2DL 1NC4D 4XI5D 4ZNEE 4XHJD 3BKYL 3O2DA 3SDDC 4XB8A 4BQ9A 3UYPA 4P4KD 2GFBA 1MJ7H 5C0AD 5BO1H 1VENA 3MLRL 3DV4A 1ZLUK 3KHQA 1K4CB 1AY1L 3QDMA 1E4XH 4GBXD 2XG4A 5J7CC 5SWQB 1RJLA 5HHOB 4NC1C 3V0AC 4OKDA 3HUJA 5BS0B 3H9HB 4BZYA 3I9GL 5HYSB 4QRUB 5HJ3B 4KZDL 5EPMA 3BYYA 3LEVH 4Y19A 2IBZX 1C16A 5JXED 1M7DA 1E6OH 4XH2A 3IDIB 1GZPA 2J8UF 1GOGA 5F9OL 4L9LC 3AMKA 3TN0C 4MXVF 3SCMA 2DJ4A 3OGCA 1QLFB 2MQ3A 1WSST 5EZJA 2A83A 1HH9B 4R4BA 3NCJH 5A1AA 3MREB 3OPZH 2DM4A 2HLFD 4Y0GA 5EBMB 3QIWB 5I1EL 1PG7H 4G8GD 2XWBA 3JV4A 3RX8A 3RWGA 1AXTH 4N5UA 3QUKB 3PWLB 3FO0H 3U4EB 1DBKH 1Z0NA 3O2VH 1W8OA 4JHBA 4XBEL 3NZHL 4PRPE 1EA9C 5C0EA 1NDMA 2P24A 3RL1A 1CD9B 3I3EA 1I1CA 4ZTPL 4P2QB 3CFDA 5KOMC 5I16B 5TQ0L 4EI5A 5IR1B 2VH5L 3KXFA 5F89B 2ZP0T 4TTDC 2F9BT 3B5GA 5A43C 3CX5J 1ED3A 3MCLH 1IGCL 4NQEB 3EFFA 3QPQD 3HR5A 4CVZA 1OGAD 1BZ7A 4RFNB 1VPOH 3TC9A 2A2QT 5HD8D 4PY8I 5DFWH 5HHOD 5JR1H 4JHZA 2ORBH 4S2SB 4XRCA 5CIPA 5IT2L 1U8NA 5J6HA 1IGYA 1NAMH 5BXFA 3QI9B 1P1ZA 4PJ5D 1NFIA 4Y19D 2XRAH 4NQTA 5ID0A 1KPRA 3HC4L 4XAWL 4WENB 3TIDA 5FF6B 5IB3B 4PY8J 1ZKAA 4ZQKA 1CN4A 1CXFA 2Q8BL 4NC0B 4KRMB 3QDGB 3ZTJG 5E56A 3SGDH 5F72S 1AGDA 1IZJA 3VCLA 3HNSH 4UIMA 2FX9H 3MRCA 1JZ4A 4I3SL 1U58A 4TQEL 4ZUVA 1QACA 4G6JL 4Q2ZA 2AQ1A 4H0GA 2D31A 3KPSD 3TA3C 1A3QA 2FSEA 2I25N 4CBPA 3S35H 2D7TH 5FCUH 4JRYB 2VDRL 5B38G 4M5ZL 4FFYL 2YD3A 3T2NH 4GRLA 4ZAKA 5DEGA 5JOEA 1U3YA 4XH2B 4PRAA 1YYLL 3VFWB 2G9HA 4YEEA 4P5MA 1A7NH 1NQBA 3HI5L 4FQCL 4PD4K 5DQ9A 3WIIH 2GY5A 2QQQA 5GS1C 1QKZH 4ISVB 1F13A 5LXGL 4Y4FB 2Z35A 5EC2B 2VN4A 3P9LB 1FPTL 4L4VD 4XCCH 1U8QA 2MCG1 3WLWC 2PYFB 3EYSL 1A7RH 1UKSA 3DVFA 3VFNB 2OI9C 4JFHD 1G9MC 1XGQB 1FG2B 1AIFB 2XFXA 1KJ2H 1OARH 2X4TA 4RRPG 3KYMB 2EDYA 4HJJH 3WNKA 3TIDB 4KQ4L 5ALCL 1OD9A 2MKLC 2HT2D 4LEOA 1XMWA 1Z3GL 3I6KA 4WGVB 2Q7YA 3KYOA 1XIWA 3QDGD 5C09D 3TT1H 3U7WL 1VB9A 5IKCA 3B9EA 3PGDB 4K8RL 3RDTB 3LRGA 5TE7H 1FORH 4GG6A 1JJUA 5INDA 15C8L 1UZ6F 3UBXG 3SOBL 2X7LA 3O3UN 1L6XA 1MHCB 5GS0D 1CLCA 1NMBL 4XXCA 4PJBA 5GZNC 5GGTL 3EJYC 3KPPA 1M6OA 3RTQC 1TVBA 3LQZA 1WFNA 3EGSB 5EUOA 4I9WD 5AD0A 4PV8A 4XC1L 5GGTA 3TN0B 2Y36H 2AK4A 3P0GB 3FQUB 5F7WC 3ULVD 2ZCKH 4MX7A 3OBAA 1JF5A 2PTUA 1IEBA 3KLHC 1ZWIB 5GS1B 5F7EH 3HNVH 1P7KB 4HWZB 2B0SH 5DI8B 1UACH 1WCBB 2VABA 4P2QD 4BKLA 5GRVL 4O4YL 1FYTD 4X6CB 1JI2A 4ALAL 2ICWA 1U8IB 4FQLH 2Z35B 1H8SA 3DI2B 5AAMA 4B41A 4HK0A 4WIQA 2OL3A 3T2OA 2B1AL 1MJUH 3QI9C 4O2CA 4WI9A 4K9EH 1L9MA 5DRZB 1OVZA 1CGUA 4HCRL 4NWUH 5FGCE 2FATH 5DD1L 1LEIB 1J8HA 4LSRH 4R90L 5H8DA 1GZQA 2CJUL 4QHKI 1XF2B 3O3AB 4J3UA 2YBRB 2WINB 3O4LB 5GHWL 4CMMB 5IEKA 4Y4HC 1IL1A 3GJFK 2GITA 4PJ5B 4MB4A 3FQRA 4LVOC 5DI8A 4OZHA 2AQ3A 5EUOF 1A47A 5D8JH 3ARZA 3D18B 1LNUA 4JFPB 1KULA 4N8VA 1I1FB 2F53A 3KJ6H 1HIMH 1DN0A 3WL9B 5C9KA 3FN9A 4YHIB 3LS5H 2BNUA 1NBYB 4P9HH 4L8BA 5KAQG 2DQHH 4M7KH 1IC7L 3WHE0 4TRPH 2EH8L 4RX4D 2R69H 1U8JA 4Z7NE 4ZNEA 3KPSB 4HQQL 1KLUA 1P9MA 3BWAB 1QFPA 2A0LD 4PLJC 3O4OB 1T2QH 3RJDA 5JR1L 4M3JA 3IVKA 4YGVA 4U1SB 2YPVL 5FOJA 1UYWL 4XVTL 3ORJA 2GEEA 5F6IB 3K74B 1B3JA 4JCMA 5I1KL 4MNGB 4NYLB 3KYNA 3R06A 2IF7A 2GI7A 4PP1C 4ZNCD 1IBGL 2DKMA 2AW2A 3IFOA 2DQCH 1LE5B 3V7AE 2C3GA 5JW4M 4KAQL 4XNUH 2R23A 5FDYA 1WFTA 4PGJA 3F12A 1PKQE 3MRIB 1HH6A 3RVWD 3D1MC 5CSGA 1RUML 4LU5H 5MP6H 3VU2A 3ZT5A 4JREB 4X9BA 4LIQL 1BOYA 3C09B 4WW1B 1BFTA 4LPWA 4ZMAT 3GSVA 3RI5F 3OKNB 3IDNA 2P7TA 4I9WE 2BFVL 4EQ3A 1J0KA 3SDXA 4ETQB 2NY6D 3VXSD 4ZS6D 2OTUA 4ODTL 5HDOA 5E03A 3HE6A 5HVWA 1GVIA 3GHBH 1WAAE 4X5XB 4TTGA 2IQAB 1H5BA 1HH9A 2N1KA 4PJ9A 5E4EB 4FQIL 4U1IB 4NZRH 1FFOB 2B5IC 4UNVA 5E7BA 4PGZA 5MERB 2EIBA 4HT1L 4D0BA 4J3WA 4PP1D 3GRWL 4X6CA 3BAEL 1BD2A 4I5BB 5GS2H 5D1QD 1DLHA 2VABB 2WM0A 3D9AH 1F6AB 3DECA 3WFCL 1XIWD 3QDGA 3C60C 4M7JL 4JO4L 1WCQA 3NIDF 2GJ6D 2XTJB 4IRSA 1L7TH 5DR5L 2AK4B 1WEJL 4RFOH 2OR8A 4P49A 1ZT7A 4UUJA 4JFZH 2ID5A 5JZ7C 1A64A 5K9JL 4JJ5B 4LEXL 2VQ1B 5EIIB 4J3OC 4NCDA 1KIRB 3PDGA 4ZD3H 4JRXD 4TNVF 1ZA6B 1A7NL 4FQCH 5C0IB 1A1NB 1HWGB 3QQ4B 4ZOEA 2DMBA 3BUTA 5DD0H 5I0DA 1H9VA 4XP9L 1LMKA 1NAMA 4GG6B 1D7FA 3WNLA 4TUOB 1FFRA 2FLRT 5ACZB 4NQDD 3LIZH 4ELMB 5J12C 3MX0A 4RBPK 4U6VL 3O6KL 4TNVK 1QFWL 1MWAB 1NAML 4XBPB 4ONFH 1FNFA 4JFOB 3UTSB 4B7LA 5CBEB 5I16A 2AK1L 2AABH 1R3LA 4PJFF 1OLLA 3L3DA 2AJYL 4UDUB 3RWJB 4N90E 2R4SH 1QSFB 4JN1L 4L8DA 4HXBH 3MNVB 4H88H 3SJVA 3S98A 3CFBA 3FHAA 4RGNB 1IKFL 1JYNA 1NAKL 2B4CL 4P2YA 3IXTA 2ZCHH 1ZLUH 2W91A 4ISVA 5MEPA 4YXHL 4JQXA 4ZO9A 3AVEA 4KY1H 4FG6C 1DVFA 4HUUB 1DLFL 4FN0A 4BELD 3HAEH 2BXYA 2XTJD 2NX5D 1IC5H 4JHWL 4NQCE 1P4BL 4IOFC 2DS4A 5D1ZA 1MUJA 1CLZH 1GHFL 3EUUA 3U0WH 5C7XL 1IAIL 3HB3D 1QRND 4S1RH 5FGBA 4JFEB 2AXFA 1CGSH 5HGGS 3RKDC 3VFUA 2ZUXA 3DV6A 4OCWL 1RK0A 2YSSB 1S7TB 5F7DB 4NRYB 3VE0B 4JM4H 4Q58C 1A4JB 1YN6B 4URTB 5K9KB 4I0PA 2BOBA 5E1HB 3T09A 3ZHKA 4RAVA 4JDZB 3N85H 1NFIB 5T1KB 5T3XL 1P1ZB 3H42L 1D5MA 3CFCH 4WJ5B 2DYPA 4U1KB 2PTTA 2YA1A 1MF2H 3C9NB 2VXTH 3QNZB 2W0FB 1T66C 5K9OA 3H3PL 5ENWB 4ZUSA 4QCIB 5B38B 4QT5B 3O81A 4LVHB 3C5SB 3LV3B 4PREB 5TFSH 2OI9B 1QFWM 3L6FB 5GGSA 4E42A 5HYEA 1W0WA 4QTHB 1IGCH 2A6IA 4KK9C 5C0DA 4K9EC 4W6XB 4DJMA 2R4SL 1JHKL 2DD8H 1B4JH 5F9JB 2ATPA 5CJQL 1G1CA 5BS0D 4P2OD 3SE9H 4MXWH 3JWNC 1PQZB 2Y07H 1DL7L 4CDGC 3KPMB 4RAUA 1I8IB 1UVQB 3KHOA 5HHNA 1JHTA 2P8PA 4PRIA 3D85A 3O2VL 4TULL 2ZUSA 5EU4A 3RX5A 2UUDK 5KAQF 4DOHB 4F2MB 4GRLC 1AKJB 1T89A 1S7UA 4X9GA 2VXUH 3OHXB 3MQIA 5GGUB 3TA3D 4XVSL 1ZLVK 1WFUA 3VI4F 3MLWL 2GTWB 5J1AB 3DETC 3WE6A 4UILL 5DA4A 4OKVB 2AXGB 5DD3L 1Q9LA 4TSCH 3MR9A 3VXNB 4P2RB 2XY2A 5KVGL 1CICD 3VFTA 3I3DA 3TO4D 1EEQA 4K94H 3B3IB 1WF5A 4ENEC 2BSED 4ZPVA 8FABA 5MHSD 3PWPA 4IMKA 1J88A 1S9YA 3I84A 5E08H 4WFFE 4GRWB 2XA8L 5D1ZD 5F9OH 4ONHA 2R1XA 3A6BH 2XICA 1KEML 3UC0H 3QWRD 1R5VB 2ADGA 2ERJC 4MJ2A 2ZPKH 2FDBP 3LKRA 2EEDA 1FVEA 2UVFA 3S37H 3LH2H 4PREA 1NL0L 4WFED 4NKDB 4P2OC 4X4MA 5ENWA 2DLFL 4WNQB 3TBVB 1A7RL 1K85A 4MJIB 3EYOA 4PLNC 2WIMA 4HKZB 1MIML 1XGYL 1JPST 1FAIH 4OCRL 1ZVYA 5BO1L 2EKSB 2VL4A 1N6UA 3IFNH 4U1LB 1W8NA 4ZPTB 4Y5XB 2JK5B 1H0DA 4LLWA 2E6QA 4Y5XA 3QO1A 2IH1A 1EVTC 4U1LA 5IFAL 4X4YB 1YNLL 5I76A 1H15B 5IMLA 1B6UA 4LLQB 4PJDA 5GS0H 1KGCE 3BAEH 5IW6A 3AB0B 3QHTC 2UY6A 3WUWG 1AKJD 2VKWA 1J18A 4RBPH 2FX8L 1MFEL 4U3CA 2XZAL 1U8LB 3ULUD 5K59F 5H2BA 1G1YA 3GMNB 1JWUB 2ADFL 2HLFC 3FFCA 1T1WA 3HCVB 4U6YB 3TNNA 2I07A 2XWJA 1BQHA 1TQCC 2V5YA 1A3LH 2VDPL 4N8CH 3EDDA 4KAQH 3SGKA 3MUZ1 4R3SA 2NY5C 2R1XB 2UWEF 1KIUA 3FCTB 1JCKA 3STLB 4PJGF 3QJHB 5I1LA 1S7QA 1HNGA 5LCVH 3QO0A 3RX7A 1S9VA 3SDDD 1A5FL 1IAIM 4PJ8C 2ZKHH 1MLBA 4MD0A 1SJHB 4QWWC 3UTTB 2VXSH 1VKXB 4BFIB 4QRRB 1VDGA 3BPNB 2GW5A 4Y4HA 4E5XA 1IAIH 3SBWA 3MCKA 1P4BH 4V2CB 1KGCD 5FYJD 1MIEL 4AL8H 5BZWB 3UYRH 4PGEA 1V7NH 2LTQB 4R3SB 1JPSH 1F3JA 2DQHL 4WI4A 4DTGH 2N4IA 4JEGB 3LPFA 3MOAH 2GCYB 1A5FH 1LWRA 1QBBA 1UCTA 1TZGH 4X4ZA 1CFVH 2OK0H 1CE6A 2YR3A 1X5GA 1J05B 1KSRA 4IIQA 4HS8L 5HHVL 4FOMA 4PRNA 3QPXH 1NAKH 1DUZA 4Q7DA 2CIIA 1S7XA 3QWQB 4ZSOB 1ERNA 2P5EB 3W82A 5M94B 3BZFB 3HLAA 3KWWA 5E9DD 4E42B 4RFEA 4YE4L 3P4NB 3VGAC 1NLDH 3T2PA 2E7HA 4G6AC 1EBPA 3ULVE 5J9PA 1ACYH 4QHLB 1W2KT 1UWGL 4ZPTA 4Z95H 3FONA 4LIQH 4QWWD 1T1ZB 1YECL 3LS5L 1GGIL 1WZ1L 2X1XR 3UTQA 4A6YB 1YEDB 2QSCL 5I1JH 4H0HB 4P3WA 3CZJA 4Y2DD 4Z76A 1XAUA 3U0TA 2J12B 4OD1H 3MXWL 1BEYL 5I1CH 3LCYA 4HH9A 1A6ZA 1I1AC 3WFZA 3QHZL 2D9CA 4EOWH 3T65B 1F6AA 2ESVB 5FK9B 1OW0C 4JPKL 3U0WL 2R0ZH 4I5BA 5F3HA 3CMGA 2CKNA 3TCXA 3V6FB 4HS3A 3MRGA 2Q3ZA 3CDGA 3GSNA 3VFUB 5T3ZD 4N68A 3HMXH 3P3YA 1DQTA 1NJ9B 2IFGA 4BZ1H 5EIQA 4RX4A 5F1IA 2FATL 2L4OA 3RIAF 3PV7A 3GSNL 5J56B 2VC2H 2FJHB 3P4MA 1IC4H 5F97E 4KUCD 5GS0C 1JPGA 2VZOA 3BP5B 3DGCR 1OAKL 2HFFB 4GAYA 5ILTH 3LKQB 2IAMC 4K3HA 3STZB 1IKFH 4OD2A 3G5XA 4F8TA 1NCTA 1R3JA 4M43L 4MAUH 4TSAH 5TE6H 3EJZC 3ZDZF 2ZUTA 3KLDA 5CP7A 5IB5B 3ALPA 1MHEA 1T3FA 4XP1H 3GMPA 4XWOD 3AXLB 1M71B 3BESR 3C6LB 1JRHI 1N6QH 5FV2A 4Z7QF 2BC4A 1MH5B 3HZVB 1U3ZA 2NTFB 5F9JA 3HUJF 1PJ9A 5GZND 5DFTA 2OZ4A 5ECJE 3ESVF 1I85C 2X5PA 4NPYB 3WXWH 5E5UB 1TJGL 4MZ2A 4OZFH 1WT5C 3QH3A 1I1AB 5C0CB 4ODWB 4DEPB 1MY7A 5T1LB 2OZ4L 4QT5A 4PJIA 2XQBH 4NQSA 2W0FA 1MCQA 2PO6D 5D2LA 2VL5A 5ACMA 5I1AB 1CE1L 1KCVH 4X6EB 2OMNA 3U7YH 3MLXL 1JFQH 1G6RB 5INCA 4RZCA 4QGYA 2BVOA 2AJZA 2FJGB 5GSVA 5E7FA 4OZGB 4WFHE 3D9AL 5I1GL 4GG6E 4YBQD 1UQSB 4HCRA 1MPAL 4J2XA 4RGMB 1A4JA 5C6PB 5IBLD 3FOLA 5JHLH 1UJ3C 3JTTA 4MA7L 4Z6AT 2CMRH 3EYUH 4LSVH 4WWID 2OSLA 1U3HA 2EDFA 4F9LC 4OF5A 1T20B 3ILPA 5FYKU 3BZFA 3HLAB 2FYYB 3KWWB 5J1TC 4WWKC 4MMXC 4RMWA 2EC9T 5DRXB 2P45B 1L6ZA 2D03H 2R56H 1VESA 2B20A 3AUVA 3QZWB 1JZ6A 3RGVD 3TIEA 4YDKH 1U93B 3CCHB 5TF1H 2QQKH 3PWPB 1MAKA 1UWGH 4P48A 2XIDA 2BSRA 5FCUL 3ARRA 4WEMB 4FFVD 2IQ9L 4LRIA 3TBWA 5D7IF 5E4EC 4XXDA 1TXKA 1NANH 4I0KA 3U46B 4PRPA 5E24E 5C2UB 1NGPH 2FL5A 4F37F 2X9WA 3RBSA 2KDGA 2NY5H 3QUYA 2RCSL 1BQLH 4K7PY 2X4QB 4LSRL 2QKIB 4OZ4B 1AKJA 3HI1B 2Q6WA 2AEPH 4V1DE 3BPLB 5GS3A 4GXVH 3SJVB 4MA3A 1ZWIA 2V7HA 1U91B 5FM8A 4K07A 4LPUA 4NDMA 3RVUD 4TVPH 4AMKL 3DGGB 4DUWA 1RUPH 1TETH 3IJYB 1N5YH 4L3EB 5FDWB 3QCTH 1CL7I 4K2UH 2DQUL 2APBA 3TFKD 1MI5D 3O6MH 5IOPB 1CIDA 3WKML 1BWMA 1KB9J 2R23B 4GRMB 1WC7A 1BQUA 5DK2B 5C08D 4FFWD 4Y5YB 4HUXA 4U6YA 3AROA 3TNNB 2IFFL 3PUCA 1MEXH 4LDEB 4ODHL 1XCTA 3SDAB 1LO3H 2AXHA 3MMEB 1NC2D 3O6KH 4MQTB 3TO4A 5IVXF 1CLYH 2A38A 3L5XH 1A9EB 3CXHK 4WWKB 2V2XA 4DFIA 3KGRA 2YK1L 3NCFB 1R3IH 1OGAE 2R0LL 3ARVA 3HZKB 1T7ZA 4UB0L 3QQ9D 4U7KA 5GJSH 4PIRF 1DQJA 4S1SH 4TNWK 4FNLH 3HRZB 3GGWA 4OM1L 1D5IL 3RHWK 4OB5L 4ZFZB 2AV7A 2BDNH 5FHBL 2PXYC 5GGVL 1AXIB 4JY4A 4PG2C 2FX7H 2GT9B 3GK8L 3BRFA 4WNQA 1CU4L 1PVHA 3PDOB 3DV6B 3D39D 3GRWA 4N0CC 2A74B 2BNQB 4P5MB 3OZ9L 1JGLH 2ZCLH 4CNIB 3C6SB 1FVCB 5MHSE 1NBZA 3TVMB 4UAOB 4KTEH 1AR1D 2C9AA 3DRTA 4Q97A 1JN6B 3SDXB 5HYJA 5CD5C 3C5ZD 3QDAA 3FB8A 4CJ1A 3U4AA 1JBJA 1CI5A 4J6RH 4UNUA 4E9LA 3DLQR 5BJTA 1BIIB 1T7VA 3LH2L 3QJFA 1UH2A 3LZFL 3VJ6A 4HKBB 4LCCC 3N1QC 4XNMA 3MRCB 1VEPA 1N6QL 3PIQB 1ZA3B 3HPJA 1I9IL 1KCRL 5FO9B 4LOUD 2V5RA 4M48L 1VGKB 4P2OA 4YDIH 1CGVA 2MMXA 2C3VA 2J4WL 3IKCA 1PEWA 3RWHA 2CRYA 3GSUB 2HH0L 2JJSC 1Z2KA 3I50H 3QG7L 2NY2C 4MQSB 2NXYC 1DZBA 4WV1A 2NY3B 4U1MB 1YQVL 3CMOL 4GQ9L 3TN0A 3UTTE 4UU9A 5FIEA 2WANA 1IGYB 2F5BH 4NM8H 5J6HB 3QISA 1T83A 5ILTL 4J8RB 3RGHA 3MOBH 1HSBA 4JZJC 5JXEA 3BKMH 1CF8L 1S7VB 3U6RB 5GGSB 4PJAE 5D5MF 2NXZD 1C1EL 4ZUSB 4XHJC 3HR5B 5CCKL 1F6FB 3MBEC 5BVPL 4XX1G 1RHFA 4QY8A 1WIOA 4PJHE 1YDPB 4HJGB 1EXUB 4MXWL 4IOIA 2J8OA 4U6XA 1RZ8A 2Z0BA 5E6ZA 1RIHH 4J23A 3VWJD 1UKTA 1ROWA 3SKJH 1LNUB 2FHBA 2LV4A 5DJ2A 4XCFH 1P4LB 5IQ9B 2BOBB 2OJEB 2ZKHL 5KSAA 3KYMA 4K7FA 5JZ7D 5FM5M 5J8OA 3TNMA 3HI1A 2Q6WB 3DPBA 2GITB 3HMWH 3EAKA 3RI5K 2XY1A 3HS0B 1A0QL 2HLAA 4N90D 4Y4FA 3SDYL 3SKNA 5C0BE 1ZANL 4PRPB 3GBML 4XCNA 4OZIE 3SN6N 3BHBA 5I75C 3EDFA 3SBWC 3FL7A 4M93B 1JF1B 4R8WL 3QCVL 5A40E 4JHWH 4ZOBA 5HYJB 3IDUA 4JDTL 1U93A 1F8TH 1MUJB 3CLFH 5JIPA 3ILQD 5K9QG 3JWDC 4KXZI 2N7BA 4L1HA 5L2KA 2VLLA 4Z5RA 3BD3A 2ZUVA 1KTLA 4DAGH 1MI5E 1K8DA 4RRPA 1U8OB 4YWGL 5E2WL 3VXRA 3FQNB 5TDNB 6FABL 4JAMB 4KROC 4JRXE 3HUJB 4NWTH 5KVEH 3EO0B 3JTSB 1BBDH 1R5WB 3AC0A 3VFSB 4HIIB 3IXTB 4JRXA 5LQBL 2PYED 1D5BB 2EIEA 4PUBL 3LQZB 4JVPA 1G6RL 3AS1A 5SV4A 4FQ2H 5LAXB 3R06B 1JYWA 5JW5B 1NCWH 4JFOA 3UTSA 1RJZB 1DSFH 5HGBB 4W68A 3KR3H 3UTOA 4K3DL 4PRBB 2FBJL 5DJ8B 2NY6B 2BSTB 5IBUB 5I1AA 3HB3C 4OZHE 5CIPB 5IJVA 4LLYB 1INQB 2UZYB 4X6DE 3N06B 4NJ9L 4PP2B 1A3LL 2VDPH 3V79C 2WUCH 1OGTA 3KS0J 1GXEA 3BWAA 3CLEL 4QXUL 2I60L 2NZIA 5C0CA 3ARGA 2ADFH 4N0RA 3AS3A 4Y8AA 1MVFA 5DDHA 1V3JA 4YXKL 1AXTL 1MCOH 1N0XL 1MRCL 4GSDH 2J4WH 5GRXG 3V5DA 2BC4B 1B2WL 1UGNA 4U6VH 3WJJC 4N8VB 4NGHL 4WV1B 2HJKB 1I3GL 4IRSB 3OKDB 4JZJB 1AFVH 3IU4H 4LCYA 5F7YC 1U3HD 7FABH 5L7XH 1ZA3A 2NY3D 3IXAA 4MQ7B 3U9PH 3K81A 2CKBB 1KIPA 3CSBA 4S1QL 1N4XL 1QBMH 1P4IH 2VWEE 3PXHA 4EOWL 2VAAB 3ARBC 5FUZH 4CADB 5I1IH 4FQXD 2ARWA 5EN2B 4JRYA 2XTJC 3WO3B 4XPBL 1JF1A 2OL3L 4WUKH 2D31B 2CLZA 2X4RB 1UJ3B 2ARJQ 3CCHA 2IAMB 4XCNB 3MJ9A 3SGEH 1JPFB 1BFVH 3UPAA 3NPSB 4MZ3A 1K4DB 2OQJA 3A67L 1W0YT 5CZXC 2FYYA 3A6OA 4KDTA 2HKFH 3GHEL 4DKEH 1MJ7L 1M7XA 3O6FC 2ESVA 1O7SA 1QPPA 1NLDL 1I1RA 3TT3H 4D9RD 3WN5A 1B0RB 4I3SH 3TBTA 5MEOB 1T5WA 1NGXB 4NZRL 2R2BB 4NHUA 1W72H 3MRJB 4IDLA 2GSIA 5DMGD 2R0KL 2A6JB 3QI9A 3VH8G 1OAUH 4WHYH 2D0FA 2FBJH 3CDYA 1CICC 5HI4C 1ONQB 1T7YA 3MOAL 2DL9A 2A9ML 4U3XA 1RZFL 4LSDA 4POZC 3Q6GH 1L7IL 1MFDH 1C5DA 3VW3L 5HDLA 3IDGA 4TSBL 1WBZA 1EZVX 1MEXL 1SMAA 4YGVB 4PJ8D 4YXKH 5DD5L 4G3YH 1T22A 1VACB 1IC5L 1WWCA 5HGBA 4LOUC 5T1LA 1CZ8L 1NFDB 1TPXC 4X5WA 4Q9CA 1T6WA 1EIBA 1E4WH 4L8SC 1OY3B 1H8NA 3UPCA 3I02A 3OX8B 3ZYIA 4Q9RL 3K7UA 5E94B 3KPLB 5DMYA 2YWYA 1VGKA 4GXVL 3T77A 3EOYG 4Q9QH 5C2BH 1M71A 3PABA 4BJLA 4XNYH 5C9JB 4C56A 3AM8C 5F9WB 3PV6B 1SYVA 2AEQL 3OJDB 3GSOA 3MZGB 4L4TA 3JTSA 2OBGA 5GRJH 5IB1B 5CP7B 1JNJA 1G0YR 5BJTB 4MJ5B 4NNPL 4JO1H 3VXRB 4JFDE 3CFKA 3IJHB 3BZEA 1UM6H 2E9IA 4OZFA 4MD0B 4GMTH 4GKNB 5HVHC 4Z5RB 1BJ1J 3G5XB 5CJOL 3QQ3A 4JM4L 1BP3B 2BY2A 3CH1B 2O5ZH 2ZWLT 4RQQB 2YPKA 3ARDD 3PL6B 4DAGL 4ZUTB 3EKCA 2FSEB 4OGYL 1T1WB 2AI0L 3TBSB 4LF3A 2EDHA 3MRDA 3QZWA 3O8XB 4L9LB 2X1PA 1UACL 3VFRA 4OLZL 1XGRB 5DUMH 4H1LB 1WEJH 1NL0H 3SO3B 5KSBF 2FGWH 2FRGP 3TVMC 1RZJL 4O9HH 3WEXA 4KHTL 1FZOB 3QIWC 3O9WC 3VFOB 3VD3A 2VR4A 3QULB 5C0JA 1YEIL 3Q2CA 2UZIH 1OAXL 3D0LA 1MJUL 4IOIB 1YEDA 4F8QA 4HUKB 4N1EA 2XPGB 1PEZA 1I7ZA 2J6EH 3FONB 1UZ8B 4HIHA 1SY6H 2ZSWB 5LWYL 4C57C 5D1QC 4LARL 2W9EL 4JN1H 1MJJA 1U95A 3QUZB 3RL2A 4QXUH 3ZDZE 4OTXH 4X9HA 5FUOH 4F7TB 4RFEB 5DC0A 4HH8A 1QA9B 1IGTB 4Y5YA 2VL5B 3GSQA 5D7KE 5CCKH 4F7MA 4FS0A 1AD0B 5DC4B 3IU4L 2CSPA 1HN1A 4X6BA 5GRWA 5TDOB 1C1EH 2FEDC 3N1FC 5HGAB 1NMCB 4YR6B 4NGHH 3VXMB 3RY5A 3LZFH 1KTDB 1YY9D 3KYKL 3RKPA 3DO7A 5T3ZL 5HGHA 5D5MA 4X80L 2GCYA 3C2AL 1DFBH 2AJXH 3D0VB 2ESVE 3BIBX 5FM5O 3IYLW 2WQRA 2X4QA 4PG9A 1R3HB 1RZIA 2K7PA 2V17H 3Q48A 3RZCA 1FIEA 4ORGA 4JKWA 3FFCE 2NMSA 1NFDF 1N5YL 1D5XA 5GGUA 3VJ6B 4NJ9H 1MREL 1ZHKA 4LVHC 2DQFA 2IMMA 2XA3A 5D2NB 4K3DH 3S6CA 5EZJB 1QRNE 1ZXQA 1YMMB 3MCG1 1YMME 1NCWL 4KDWA 2DBLL 2VKXA 4YHLL 2VRAA 2C26A 3VWKC 1F8TL 1KT2B 4F58H 3KXFD 1I9RL 5ADOH 2RJMA 2XWJB 5J11C 1WGOA 4JKKA 2I07B 3GUTA 4NUJB 4S1DC 5ESAA 3GMMB 3RIAK 4POZD 2IQ9H 4HJ0C 4JKPH 1CF8H 4HFWA 2WWMD 2EECA 4D94A 3TA3A 5D96C 2H2SD 5C1MB 2P49B 5K9OB 1KCSH 2Q86B 4NWTL 3U9UA 5JXEC 4NNXA 4LLUA 1GCFA 1CG9B 1AGDB 2X10A 1MCWW 3OXRB 4KKAC 3QXTA 3T65A 1T80A 4AJ0A 3ARQA 3L3KA 3TN0D 5DD6A 5I17B 2XRAL 5AUMA 5HGDB 2E9WA 3MXVH 4KK5D 1RD6A 4AY0A 4PRHB 1CR9L 5C0CE 1JGDB 1F4AA 2R4RL 5BVJA 4O2FB 4Y4KB 2FIKA 2I27N 4ZFFA 5CD3B 3HZMA 1QSFD 4KRLB 3WD5L 5LKNA 1IEHA 2CH8A 3M8OH 3UTZB 5I1GH 4AH2A 1A0QH 1RK0B 4OQTA 5L9DL 3ZSTA 1F58H 1JHLL 1PFCA 3GSRA 4NBZB 2MFNA 3AB0C 3ZDXF 3TZVC 1LP9B 1MFBL 2DWDB 3C5ZA 3W5NA 3O9WB 3BEWB 4FZEH 2MHAB 4FQQB 1AP2B 3K4ZA 1Y18A 1FCGA 3FO1B 1A1OB 3WFEL 1BAFL 4D8PA 5D1ZB 1E6JL 3TM6A 1G7LB 2HVKB 2X4SA 1G9NL 4X8XA 2X4NA 3QUXB 4ODUB 3DVGA 2FH6A 4U6HB 1IGJB 2UVEA 4OLUL 3S3JA 1MHPL 1V3LA 3D39A 1I8KB 3AY4A 3T2QA 3IJSB 2BK8A 1SEQL 1R24B 1B90A 3LRSB 1MHHB 1CGXA 4P0DA 3VWJB 5DD0L 4F2MA 2BVPA 4XPTH 5IROC 4NZUH 4NO3A 2X40A 5J06A 5CSZA 1BFOB 4NM8L 3NA9L 1IAOB 2HT2C 1NJ9A 1R3LB 2ESVD 5D93C 1FRGH 1FYTE 5J6GB 3VXMA 3RVXD 4OF0A 4E41A 2NY3C 2ATPB 5CJ8A 4PGCB 3G6JE 5CLWA 2E6PA 1FL3B 5JIKA 4O51B 3O4LE 5LGJA 2ARJB 2FO4A 3DETD 1IM3B 4H8WC 1JWUA 2DMCA 4YFEA 2WBJA 3OAZK 3QIUC 2YRZA 1FL5A 5ISZD 1QFOA 3WS6A 3LKPA 1OM3H 4LPYA 1HINH 5J57B 5IVOA 1OTTC 4AH2B 4CW1A 5C08E 4X6DA 4M6NL 1N7MH 5SWSE 5ITFA 1T6VN 4NN6C 5JNYB 1MQKL 4G6FB 2FEDD 4ZYKA 3V9FA 1FGVL 4BSWB 2BDNL 5FHBH 3WHXA 1XF1A 5IB4A 1AC6A 4PS4H 5ITFB 5FB8B 3L3OA 4YHPA 1D5IH 3QFJE 1H0DB 4QHLA 4JFZL 2AJZB 1REIA 4DZBB 2G5BB 4JM2C 5MEQB 4CAGA 3BXNB 3HC3H 3OKYA 2ZG2A 1ACZA 4ZOCA 1AGEB 1T21B 1XF4A 2WBKA 3KLSA 1BQHG 4F9PA 2LU3A 4O51A 4LLUB 1FYHB 4D2NA 5B39A 4K94C 1GH7A 3O4LD 1EZVY 1KCKA 2VDRH 2XTLA 3MLRH 4G7YL 1J0IA 1N64H 1U92A 4GKSB 1MFAL 1B0GB 5BQ7A 4LHUB 4M9OA 1G7HA 2YPKB 3PL6A 4Z7OE 4KXZH 1PG7X 15C8H 1MFNA 2VDNL 3ECBA 4Z9KB 4YDVA 3HZVA 2PUQT 2OZ4H 3W9DB 1FIGL 4OFYD 4P23C 3BJLA 4QNPF 1OTUC 5KVFL 5I30H 3DYPA 1Z9OA 5E8NB 1HHJB 5IWLC 1IKNA 1FG9C 6CGTA 3KXFE 4OFYA 3EFDL 2DTSA 5D7JB 3VWJC 4F33A 2VR9A 3DVGB 3HNTH 4OD2B 4GKOA 1N5AB 3PV6A 4CMHC 3OHXA 1PX3A 3QJHA 1S7UB 3QSKB 1UB5B 2VLMD 3P40A 1JGEB 3SGJA 3OV6A 5JDJA 1P2CA 4TRPL 5HVHB 4M7KL 3GMNA 1WIUA 1RUPL 3MO1A 2CLVB 3D48R 1EFXA 1UENA 4P57B 1IBGH 3S8WA 2VH5H 3EOBB 1T04B 2HJFB 3X14A 5HI5D 3R1GL 1ZT1A 3H0TB 5FK9A 1FHGA 2Z31C 5DJAB 3IDGB 2XXMB 5SV3A 2BHUA 4HH9B 3CX5K 2A1WH 3KYKH 4TTDD 4MLSA 1W0VB 4NQDB 3UZEA 3ARFD 1TZIA 4KUZL 3UBXI 3L3OB 3VXSA 3LPGA 5DD6B 4M93C 1OAUL 4HUWB 1T0NB 5EU3B 2BZDA 4K23L 3IDYC 4HGWB 5TF1L 1UCBH 3HC0B 2AJ3B 1I1FA 1T5WB 3LN9A 3OB0K 3HMWL 1AE6H 2FECL 3O0RH 4RGND 1OSPL 3D18A 3MV8A 2O5XL 2W9EH 2CDFA 5JUEL 2HP4A 1H3XA 2PKDA 4E41D 3MLXH 4IBLT 5T1LD 3Q5OA 1ETZB 4JGMA 1BM3H 4ALAH 1KN4L 2VC2L 2WV3A 4JE4B 3DXAD 3DRQA 3EYVB 3O3AA 3ET9F 4M1CD 3VXUB 4KROD 4ERSH 2DLFH 1CVSC 3LEVL 5J6GA 5JHLL 2YUWA 5B3JE 1MRFH 3MA9L 5FYLD 4G7VL 1NEZG 4PJ9B 4M6MH 5EC1A 1TLKA 1HQRB 3VXNA 2X05A 4Z7VA 2VLJE 3L9RB 5IBUG 4JO3H 4RGMC 4G5ZL 5BMFH 2W1NA 1D5XB 3ZT7A 4LPTA 1FP5A 3PHOB 4YBHA 1X5AA 3DIFA 3O45B 2BSSB 3W0WA 3GJFB 2CQVA 4J4PD 1I1YB 5I18H 5BV7C 4ZXBC 1I9JH 5EOQL 2I26N 3WJLA 3T4AA 1MVUB 5I8CB 1Q8MA 4RAUB 2DRUA 3OJDA 4FTVD 5HYJE 4WU7B 1IQDB 2GUOA 1TJGH 4P5TB 4TOYL 3T0BA 3GIZH 4U33A 3W9DA 4PJBE 4OCYL 1KCRH 1L7IH 1QBAA 2XN9D 4OCSH 4R26L 3OX8A 5DSCA 3I02B 4HPOH 5DDHB 5HHMD 3VGDA 1CK0L 3BMWA 5E5MB 1I7RA 1DANU 3SDXE 4JM2B 2ZOKB 4OFVA 5CZKA 3B9KC 4ZUWB 1RFDH 4Z8FH 1MSPA 4QRSA 1WWBX 3IFNL 2ZSWA 4OF3A 1G7MB 5FUOL 4ZFGH 3KPNB 5DVLA 1KLGB 1WICA 2O93L 4A6YH 2W07A 1B4JL 3MROA 1F3DJ 5TE6L 1JVKA 5JOPD 4FQ1L 4HX1B 1YEGH 3JWOH 5AWNH 3MRNB 5DR5H 4OCXH 5EOCH 2VIRB 3RU8H 1CL7H 1FNAA 1AFVL 2IADB 2Y25A 4R7DB 2GTZB 3UJTH 3WHXB 1AIFA 4FQPA 5DJCA 3WMSA 2Y23A 4JGJA 2OM5A 3MV9D 2IJ0C 4Q6IA 1FGNL 3WXVH 5HYFA 3EYQC 1KACB 9CGTA 5KG9B 4HFWB 4AIZA 4I18A 3BEVB 3FQNA 1QVOA 2WBJB 5TDNA 3AS0A 4RGOL 2AK4D 2D4FA 1KTLB 3ZKNC 1QNZL 1RZKL 2X44D 1JMZA 3O2DH 2J3SA 3O4LA 3SJVE 5IEKB 2CUHA 2B2XH 1JGUH 3BOVA 2KZWA 4GG8B 4G80A 3SQOL 1CXHA 3KR3L 1J11A 1IAOA 3QR2A 43CAA 3LB6D 5D2NA 3V5HB 4X5XA 2JELL 4BZ2L 4NN7C 2YD4A 3FOMA 1I9EA 4HK0B 3QEQE 5T5NG 4WW2A 2GAZB 1MHHA 3AREA 5IW1B 5KANG 3GSOB 1SYVB 1FZMA 2MSPA 3IJSA 1KC5H 3IXAB 2FH8A 3C8DA 1G7QA 3QCTL 3EIFA 4HWZA 4GS7C 5D7IE 3EBAA 2A73A 3O8XD 3QPXL 4KI1A 2P44B 2YXFA 1E0OB 2H2PC 3CFJA 2CPCA 1J1OL 3DROA 2APFA 3EO9L 4U6XB 5KSBE 4NIKB 1JPTL 4QNPE 1EEYA 1X5KA 3OTTA 4HW6A 4XGZB 5C0DB 5GSRA 1PYWA 4HUMB 3RA7L 1G6RH 2X9YA 1HILB 3QIBD 1DDHB 4F7TA 4G3YL 1QSEA 2YPLD 1F02I 5JDSA 3PJSA 1C5DB 4O2EA 4NP4H 4OZGE 4DGVH 2PW1B 2W0KA 2D0HA 3V4UL 4KK9D 4NQXA 2G75A 4KV5E 1A21A 3LIZL 1YA5A 5IG7B 3IDJA 5L6YH 4NSKA 5EDXA 5A16B 1RUAL 1T1YB 5I6XB 1M05B 3MRJA 5EOQH 5CUSH 3BKCH 3VFOA 4JQIL 4YPGA 4OD3H 3NGBC 2YC1B 3L3JA 5AG8A 5K9KA 2IBZY 3ZZ1A 3PWLA 2GY7B 3B9KB 3BDYL 1YEEH 2EDOA 4RGOH 2Q7NA 2R15A 3S5LA 3T1FB 4X4XB 5C8JA 4KJPC 2OXGA 3A6CH 4RNRA 2Y5TA 5I1DB 1JPFA 3RRQA 4B50A 3QRFM 3JZ7A 3QEUA 1LK2B 3OG4B 4M7JH 4Z7VF 3VH8B 3SDCC 5KS9E 1FBIH 2Q8AH 4PRAB 2Z92B 1F6LL 5TDPA 1IL1B 3MJGX 3SO3C 5I75B 3P0VH 4H1LH 2CKBH 4X0KA 4U0RC 5KJRL 3LS4L 1DE4B 2HA1A 1KF9B 1EJOH 4BSVB 3BP4A 3W0WD 4QLRA 1BJ8A 1J1XL 3AAZA 1KEGL 2XZCH 4Y2DC 3T08A 3MLWH 4H25A 4Y5VA 4KKBC 4C56B 3NCMA 5E8DL 3CVHH 2H1PL 1O0VA 3ESUF 4LHQB 4IRZH 1UM4H 3T0ED 2IADA 5D93B 2P42B 1YEFH 4JDVA 2GFBB 1TCRA 3OKLA 1MRDL 3FQUA 4LGSB 4WTWA 2DJUA 3V7MA 5E08L 2QTEA 1CDGA 1LGVA 4XBPA 5AD0B 5EZLB 4H5SB 3IVKB 1F2XK 1KLGA 4FA8A 3DX6A 1PLGH 2V2WB 1CWVA 4N8VG 3FB6B 4S1RL 2MCPH 1G9EA 1KOAA 3HTLX 2PCPA 4KUZH 3P30H 3GNMH 4I8DA 3REWB 4NO5B 4HV8A 4L29A 1KJ3H 1V3MA 3FB7A 5GGRA 3TO2A 1UXSA 2DQUH 2XN9E 3VGAB 1J1PH 5C0JB 5SWZB 2EZ0C 4HIIA 3TVMD 4QXWA 4YK4B 4R0LC 3NZ8B 3U4EA 1CFTB 4P9MH 1ND0A 4MJID 3S88L 2YN5A 3ZSSA 5FEBA 1HHIB 5KW9L 2F54B 2FCBA 4JCLA 3BKJH 2JB6B 2YEZB 4YDLB 2E6JA 3ULUE 4OI9A 4HJ0D 4L5FL 3O8XA 1WQVT 4X7EC 4CKVX 3BH9A 3QEHB 3FOMB 2YWZA 1AR1C 5D8JL 1FV1A 4MJ6B 2G9HB 3MBEA 1F4WH 4FXGB 1KB5B 4XPAL 1CFBA 2JELH 4G9FD 4QHUB 4MJ6A 5ANME 1PD6A 5C0CD 4MVBC 4DCQA 3I6GA 4HC1A 3W11D 4ODXB 5ERWA 3UO1H 1NBZB 4G8FA 1N26A 1U8IA 4L8CA 1FL6B 3R8QA 4RA3A 1M7DB 2CXKA 1HHIA 3F62A 1UT9A 5JQ6H 1XF3A 1ZS8A 3S7GA 3L1OH 3JUYA 3JV0A 1FIGH 4HK3N 2PTVA 3X3GH 2CUIA 4XPHL 5T1MA 3FO2B 2DIAA 3ME0A 1GC1C 2NNAA 1TFHA 4NBXB 4Z77A 4PS4L 3BUYA 2XNAB 4X99A 2CMRL 3CK0L 4OZIA 2UWEE 5C71A 1V7NL 4NC1E 1EXUA 2CRIA 5I8KH 3D2UD 4L29B 4JO4H 2GJ6E 3REWA 2DQIH 2YA2A 3DX7B 2HTLD 4W4NA 4GBXB 1J7VR 1F42A 4NUGL 3VFVA 2DQJL 1DQJB 1YJDL 4KPHH 4MNGA 4ZXBD 1G6RA 2UV3A 2WK2A 3BPCA 4LCWE 3MV8E 1FYTB 4NRZB 2R56L 4X9IA 4QRSB 1JHLH 2JJWA 1A7QH 2M1KA 5JXAH 1NMAH 3MMEA 3I6KB 4G6KH 2HFEA 1J1PL 1R6VA 2ZUWA 1TCRB 4NQEA 4K7PX 3DX7A 4K7PH 4MCYA 1WT5A 2ADJB 2W59A 4U0QB 5AYUH 1UM4L 3TBYB 1WIPA 3V0VB 4XP5L 5HTSA 4C56D 4MXQC 3LQMA 3Q3GA 3BX7C 2LVCA 1G9ML 1NBVL 3UBXB 1KCUL 3DGGA 3ZDXE 3VRLE 1GIGH 5KTEH 4P46D 4MAYC 4XMLL 5D1XA 1KN2H 5DO2C 3PWJB 3FB8B 2NY4C 2VYRE 5E5RB 1SQ2N 2AERT 3BP4B 4PJCB 2PO6A 1OPGL 3P2TA 3RY6C 1CXIA 4GRLB 4QF1A 4K8RC 1T5XB 3QIUD 2YBRA 2Y4SA 5HVFB 1P53A 3LQAH 8CGTA 1Q0YH 3CD4A 3MPCA 1E6OL 3GSNH 2X6MA 3MV7E 1NH6A 4BQ6A 2NY1B 3CDFA 5JIHA 2AJVL 5ANMB 5DS8B 2Y5TB 3BDXA 1U58B 4ZUVB 3UP1A 5B8CB 4I4WB 5F9WC 4UT7L 4AQOA 3MJ9L 2P8MB 5IK3A 3M07A 1ETZA 3ARSA 1VGEH 4JJHA 2X70B 5E8EB 1A6ZB 1OTUD 1NC4B 5DJ2B 3G6JF 1A6VL 2JIXD 3GMOA 4C58B 3QDMB 4WI3A 1PGRB 4P3DA 1BLNB 1CDHA 4BSWA 2QSCH 5GGRB 3TO2B 4HHAB 1KG0B 2BOCA 3MLVH 1UCBL 2ENYA 3QUMB 4M1DL 4YHZL 3T0EA 3OB8A 1MLCA 2V2XB 5B21A 5GSVB 3HFMH 2H3NB 2E7BA 3ARGB 4XI5C 5IHBA 4WHDA 5DJZA 4YJZL 3U7AA 4JR9H 4FQXA 2XTJE 5GHWH 3RA7H 2OYPA 4HUXB 1H3WM 3OKOB 4Q6IC 1J8HE 2UZXB 2CIIB 2DBLH 5BOPA 5IT2H 4PRBA 1W72B 5F89A 5D7JC 1MELA 1YEHH 2H26B 4HWBA 5HHVH 3BQUB 5IJKC 3HUJE 4YBLB 3QH3B 4NO2B 3X13B 4LKXA 4YAQB 3S97C 1VADA 4GBXC 4M9PA 3ISWA 5J4MA 3PGFL 4GO6B 1RI8A 3IKCB 3RWHB 2X4TB 4P9ML 3SE4C 4OZIF 4G8IA 2CO6B 4RDQF 4Y19E 4GAFB 5EC2A 1UYWH 3ROLA 1BQLL 3N50A 3GJEB 4PJHB 3UZQA 4JFXA 3VW3H 5E8OA 4EUPB 5JPNB 1KJMB 4XNXL 1QD0A 5EBLB 3AREC 3UTTA 4UBDC 2EDLA 2XKSA 2FO1A 1C12B 3NZHH 1A2YB 3A6CL 1ULVA 3RBGA 3QUYC 2D7MA 4CVXA 3LKQA 1SHMA 3BP7A 4O5LL 2D0GA 2DQDH 2BMKA 3X12A 4OM0L 2VXQH 4XP6H 3X3GL 3C87A 2A77H 4OBRA 3HAEG 4MA8H 2D7QA 1UEYA 3S4SG 3QNYB 3T3ME 3ZT6A 1BEYH 4PJDF 1GGYA 4WTZG 3V6ZB 3WDHA 5DQDH 5H2BB 4KJYA 3NCEB 1TMCB 1YN7B 3GSNB 4WY7H 2FX8H 1SEBB 1T20A 2J6EL 2ITDA 5C0ND 3ARGD 5KS9B 1HHKA 3V4UH 5CMAB 2F58L 3H9YA 4MNGE 1GPOH 5DEZA 1OTSC 3WHE1 2AV7B 3RGVC 4C55A 4X4YA 4LSQH 4OIAA 1N6VA 4OCXL 2BP3A 4OZHF 1Y6NR 3U0PB 5KW9H 5EO1B 1T1YA 4RMQA 5IMOB 3S9DB 5KSVB 5INCB 4JFDA 1NC2A 3KLAB 3OXRA 1YDPA 4HJGA 4MXQD 5E00A 1Q38A 4J7RA 2OCFD 4PJ9C 1U6AH 5JNYA 1RVFH 3MFGB 1A8JH 3ZTNH 3LEYH 4N5ED 3E6FB 4ETYA 1SYSB 4MDJA 3L3GA 3VDBA 3LSOB 4XC3H 3S36L 4DN3H 4QRPD 4U1JB 4DQOH 5CEZL 2VLRE 1VFOA 1P84K 5CS7A 1S7SB 5I8EB 2NY1D 4NUJA 5ESAB 3LQAC 1KJ2B 2ARJA 2HMID 1S7XB 1FO0H 3MLYH 4MD5B 2V5TA 3UAJD 3ARXA 1XGUB 3FN0L 3HE7B 3GEWB 4E0RB 4EI5B 1PKOA 5FHAH 1CBVH 4BZ2H 3ARBB 2C4FU 3SDCA 2GUOB 2Y36L 1YEGL 4S11A 5L0QB 3FB5B 1RMFL 4X7TA 1U8MB 1OB1A 2G2RB 5GRJL 5CSZB 1WAAA 3BDYH 5IF0A 4CU8A 4DQOL 5CEZH 3MR9B 3K8KA 1OQXA 4KMQA 5FO9A 4HG4J 4HF5H 3L5HA 1UEMA 2EO1A 3SY0A 4ZD3L 1JRHH 3WS3A 1T4KB 1T1XB 3ZDYF 4Y16A 4XCCL 3TEUA 3AREB 3SY0B 4JGUA 3WS3B 1II4E 1GAFH 4Y4FD 3F7YB 4LARH 1QFWI 3N9GL 4BFIA 2H1PH 5HDBF 2AP2A 4FRWA 3BRDA 4R4BB 2WIIB 1AXSB 4P59L 4KZDH 3LOWA 4Z7WE 3THMH 5JHDA 3WUZA 5FYJE 3FB5A 2DQJH 1PQZA 2NYYD 1T03H 1DANT 5KSAC 4K3GA 1HKFA 2AGJH 4B53A 4JZNA 4OSUH 4Q6YA 5HDBE 4D8PB 5IFHH 5IESL 1ZAGA 2MHAA 3S35L 2EIZB 4PJHF 2A6IB 1W0WB 4QTHA 3ZO0A 1VPOL 4JPIA 1ZLVH 2VISB 3S37X 4XPGL 3EZJB 1PKQB 1EK3A 2R0WL 4Y2OA 2OSLB 4A6YL 1FE8H 3O9WD 1BFSA 4Z76B 2B4CC 4ZUUB 1I7ZB 1KB5H 3MJ6A 4A6YA 5DUBA 4PJDE 2YMXH 5KSVA 5T1KA 1ZGLB 4X4ME 1LE9B 5IIEA 1IGML 2X9XA 4EIGB 2C3HA 2NPLX 1W0VA 3WEXB 1FGNH 1JZ7A 3MRMB 4PBWD 2DMKA 3P9MA 1MFDL 3GO1H 1N3NB 2YRLA 2HVJB 4IMLA 4NZTH 2EDNA 4NHCL 3ZL4L 1BVLB 4KKLC 4WVRA 1OSPH 3TA3B 2I60H 5I18L 3RIFF 3FRPG 1QLEH 3MRDB 1S9KC 5T5FH 2Y06L 5C2BL 1HSAB 1F4YH 4JFEA 3RWFA 1NCBL 2WUBH 1T0PB 2G60H 1ZSDA 2DQTH 4PJEA 3MLZH 5EORL 3ETBF 3V4PL 5C92A 2VLKE 5AYQA 5I8OL 1L4IA 2FBOJ 4PJFB 2PETA 1CD8A 1X4ZA 4MDIB 5FECB 2P5WA 1A1MB 4KU1A 5DGRA 5FCSH 4DVRH 5JW3H 1KJ3L 2V7HB 1SJVA 4FXKB 1OAYH 3EW3B 3GNML 4OSUL 1C5CH 4M7LH 4JFXB 4BUHA 2AJUL 4FXKA 2VWEC 1D9KB 1KLFA 3QBTB 3QDMD 4KKCD 5E4IA 3TPUB 2FR4B 2MWCA 1A9BA 3LD8B 4UINH 3QDJA 5HD8C 3NCYS 3T77B 4XXDB 4GQ9H 3D85B 4OGAD 4CMHB 1OHQA 1I9JL 1BF2A 4PTUA 1PBYA 4JANA 3JVGA 4ZDHA 1CGSL 1FC2D 3H9SA 1N8ZA 1BJ1H 1ZHBA 3ARPA 3ZMRA 1ES0A 2ED7A 3BN3B 2Z4QA 1C5BL 4WI5A 1C7SA 2R2HB 3D3VD 1RULL 1IGMH 1HQ4B 2H8PA 5I8EA 3HI6H 2VOTA 2NY7H 3OQ3B 4WTZA 2OS7A 3HC3L 4YBQC 5B3NA 5F7NC 5MEQA 1U3HB 3QRGH 2V2TA 1FZKA 1QNZH 1BGXH 1RZKH 2VITB 1A02N 3MYZA 2RFXA 1UQSA 2FB4H 4PLJD 2A6JA 2P48B 1KTRL 4HUVB 1L0YA 3O3BB 4GAGL 1NGXA 4I48B 4DKAA 1WISA 1P4IL 3TBVA 3O6FA 1I3UA 1YC8A 3PP3H 1S7RA 2B0SL 1YN6A 2AGJL 5I71B 2J8HA 1X6NA 2R1YB 5EIVA 3BE1L 3UZVB 4K3JL 2IBBA 3VE0A 5CINL 4XWGL 1HOCA 4JFFE 4PGCA 1CFSB 1I8LC 4PJIB 2D7NA 1UJTA 4WEBL 1J05A 1OTSD 1YC7A 4Q74A 3QB7C 5I9QB 1YUHA 2PO6C 3BKML 2QR0B 1IQWL 1WAAF 4M4RA 2JJVA 4FQIH 2WBWB 2F5AH 5GGSY 2VZ1A 2BNRB 1HEZA 5E6IC 1JGEA 3Q6FB 4OLEA 4PJAB 1CDJA 1RFDL 3HE6B 2VAAA 3QT2A 6FABH 5E2VL 5DURB 4FQJL 2E7LA 5KVGH 3ROOB 1R3IL 3L95A 1CDCA 1T4KA 1MHEB 2VNCA 5DUPH 2WW8A 4WUUD 1FDLH 3IDNB 5EBLA 3PQYE 1N59B 4G7YH 1A3RL 5HHPB 4GMTL 1IGJA 5GS2D 3OB0H 4LCYB 4U6HA 3G5VB 3HG1D 2P5WB 1I8IA 3QO0B 2A6KA 3LKSB 2I24N 4ZFOA 1FRGL 2KPNA 4LAQH 5BS0E 1KJ2L 1OARL 1LO2L 5DVKA 1AP2A 1XGUA 2FEEI 1DLFH 3KPTA 4L8DB 1ZSDB 4ZFOL 1VADB 1KJ2A 4LKXB 1EEZA 3MNWB 1Q1JL 4ZOAA 4YC2B 3MFFA 5IBLC 4HS6B 1C08A 2C1OA 2D9QB 5J13B 2F5BL 3WKNA 3NBNA 3E6FA 1VEMA 3WIHH 1JGLL 5IEHA 1CGYA 4YFLI 1EVUA 5EO0A 4JRYE 1HKLL 4FQXB 5GGQL 2F8VA 2AJUH 4OJFH 1C5CL 4KK6D 4M7LL 3E8UH 5AZEH 3KPSA 3E6HB 1BX2A 5L2JB 1PY4A 3VXPA 4KC3B 5IJKA 1IARB 4N0CD 4JRXB 2DI8A 4WO4C 1UZ6E 4NRYA 2BVTA 5ICXB 3N1MC 3C08H 2F19L 3G5YB 3G04A 5CJBA 3NA4A 4PJ7F 5D71H 4AYFA 4LK4A 1UM5L 3NAAL 3MLTB 1IGIH 4KJYB 3ZYJA 2VXQL 3H9SD 1RZ7H 3BVNB 4JY5L 5F96H 1MQ8A 1AH1A 4Z0XA 3GUTB 3PWPD 2P8MA 2BFVH 1UB6B 3QXAA 5CHNA 3EHBC 4N1HB 3VG0H 3NCYP 5CGYC 1WUNT 1DQML 1OGAB 4QHKJ 1ZLWH 5C0BB 1CS6A 4Y89A 1KB5A 3EOAA 4FXGA 2H32A 5E95B 5JLZA 1F3JB 1BAFH 4HIEB 2AXGA 4K2UL 4OKVA 1KB5L 1EO5A 1QG3A 2C3WA 2ZZUT 4DK6A 2NY1C 1E4XI 4I3RL 4GXUM 1URLA 5EA0L 5J1AA 3KNBB 3MCLL 4PV9B 4MNQB 4LHJB 2VLJA 2P7TB 4HIXL 4LPCA 5F1OB 2HRPH 1DBAL 5D1XB 1LHZA 2F53E 4KTEL 2YKLL 4XVJH 1QSFA 4LNVA 2B4CH 1PZ5B 4MGXA 3VDCA 1MCKA 1P4LA 4FZ8H 5CKGA 3GMLB 3ZKXB 4GW1A 3LDBB 4M7ZB 7FABL 1YQ2A 3SKMB 4IRJB 4NOFA 4XMLH 5KBNC 4XC1H 3HE7A 4E0RA 5LJYH 2ADJA 3BIAX 1OWWA 3BZ4A 3O9WA 3PQYD 5I1EH 4P4RA 1QA9A 2D7PA 2DM7A 2BVUA 1YZZA 2GK0B 3RIFK 3WYRA 1KPUA 4MSWB 5IVXA 3H3BC 3B2VH 3CJJA 3B5TA 3OF6A 1TVHA 2FJFB 1ZMYA 3ULVL 3QZWG 1RUQL 1CDBA 2ENSA 4EQ2A 1G9NH 3QFJD 4R4FH 4MAUL 4TSAL 1KXTB 4KMTL 1HHGA 1U8PB 2NW3B 2KH2B 4HBQA 1FYTA 4MJIE 1HSBB 5TE7L 1DFBL 2BSTA 5EIIA 5E9DA 3FZUD 3KPOB 4X8JA 1E27B 4WJ5A 4S0SD 2VXVH 3EOTL 5I76B 1VGEL 1IFHH 5CEZE 4HAFA 4JZOA 1F97A 5IV2B 3DMMA 1VSCA 5I74B 3MV9E 4RGNC 4YHYB 5LGHL 1NBYA 1QR1A 3MRHA 3GMQB 3UTSD 3EYOB 2DBJA 2W92A 1HCVA 2XKNB 3G08B 4PJXE 3M45A 5DTFB 4DUXA 2AV1B 1S3KL 1CXLA 1YN7A 3RVXC 3CX2A 2H32H 3SJVD 2PYEA 3EDKA 4MNQD 5E2UL 2R2CA 2M8XA 1K8DB 3WFBL 4P9HL 3FT4B 5SX5H 4JQIH 1XCQB 4BH8B 3ZKXC 4O4YH 3ZTNL 1H5BB 4OB5H 1HIML 4QXTB 4IHOA 3MA7B 2APWA 1I75A 2X89A 4MHHI 2Z91A 3VXRD 1DQLH 4K8RH 5BOZG 4S1SL 3I3BA 1TJIL 3G6AA 4F37K 4PY7A 1FNHA 4Y16D 2YN3A 3F7VA 2XN9B 1RPQA 1X5XA 3CFKB 3IJHA 4R9HA 4XP4L 1DVFB 2Q1EA 3BZEB 3QIBA 3RUGB 3NABH 2W0PA 1H3TA 5T1DL 5MEPB 4I13B 3EYFB 1MNUL 4UAOC 4YQXL 2ZG3A 2GT9A 4RDQG 1MAMH 1AQKL 2ILLA 4JVUA 1V05A 2FHCA 3E2HC 4KK6C 3SOBH 4XPTL 3MC0A 5CJXC 1JHTB 2OJEA 1ORSA 5D7SL 5FF6A 2O61A 1NCCL 2DWEA 3WIIL 1JV5B 5ETUB 3RWEA 1CE1H 1NGWB 3ES6B 1WBXB 2X4PA 1HHHA 4P2QE 2XQYG 4NSKB 4OM0H 1R5IB 3IDJB 2DJSA 3MUGB 5F8RC 1RIHL 5CIPH 1CDUA 4S0TD 1MCCA 1N0LA 3GSQB 2MOVA 4R0LB 1M6OB 1I9RH 1LD9A 5C07B 1JWSB 1Q9WB 1VFBA 1NCAL 3ILQC 5D6DA 3PJSB 4P2CG 1Q9WA 1VFBB 2XI9A 3HG1E 1MCEA 5ALBL 1I4FA 1A6AA 1MFBH 1DBAH 5A3IC 3B43A 2BNQD 2BNUB 1ZGLM 2YUXA 5IR1A 2DLIA 4P3DB 4GW1B 2F19H 2EDQA 1SJXA 3B2UC 4LCWA 4HIJB 3WDIA 5EBWA 1SVCP 1MCPL 4NBYB 2AEWA 4P2OB 1FG2A 3V6OC 1IM9D 4EZMA 3V0WH 4DZ8B 2XWBB 5CEXA 1LVEA 3ALXA 2UZIL 3D2UB 5FKAA 4N9OB 3AAZB 2FL5B 4Y1AD 4WEBH 1JNHA 1RZGB 1BPVA 1INDH 5FYJH 1K2DA 2AEQH 4U1IA 4GUPB 3OGCB 4M6OH 3SEPA 3G6AB 4LQ1A 4NM4L 4LPXA 4KTDL 1BVKB 2MNUA 4GOSA 3TH3T 5H94A 3BH9B 3QEHA 3MA7A 3OKEA 3MLSL 2EE3A 5EB9A 4O02L 1KIPB 5HI3D 3M17B 5E99L 4XAWH 1EV2E 1EUUA 1XR9B 3MYJA 5ESQA 3OKNA 4FQLL 3BPOB 2FB4L 3FO9B 3QAZC 4UMGA 3G6JA 3HE6C 4RNRB 1OM3L 1FVDA 3MJ9H 1AY1H 5E6ID 5MENB 2EDEA 2H2PD 1SBBA 3QUXD 5I9QC 4Z95L 4OGZA 3DX8A 2EDKA 5C09B 3GIZL 3RVVC 1OSZB 5DZNA 1NPUA 5GRUH 4NKOA 4UBDD 1QR4A 3KDMA 4IS6B 3O3DA 3V95A 4U7MA 2NCMA 3EOTH 1FN4B 3V4VH 4WGWB 1S7WA 4NN5B 3SKUD 4JPVL 2JTDA 1OPGH 4TUOA 2NW3A 2OP4H 1A9EA 1RJYA 4XZUB 1EAPA 4JO3L 2LAAA 4BFEA 5E5MA 4Y2DA 5ICZA 4PJCE 1DDHA 1DVFD 3P4LA 1CTOA 3QUZC 3P4OA 4YX2L 1PG7L 5DA0B 5L2KE 1S5IL 3QXDB 2ICES 4RAHA 4H26A 5D7JD 1S8DA 5DMJB 3WNOA 5F7HA 1QFUL 3DX8B 3T1WA 2JJSA 1QRNA 3MGTB 4YC2C 4FQJH 5CD5D 4WU7A 5IB5A 4KZEH 4OIIL 5D1XD 1JPTH 1NMAL 3VFMB 3RWGB 1YY9C 3RWCB 5I1HH 4PV9A 3NAAH 4L8CB 4ZAKB 4WV1C 1MCJA 4XNQB 3BWUC 3CLFL 4QTIH 4P3CL 3QEQD 1J8HB 4K3JH 2I9TB 4P5TD 3VFGH 4CVUA 5JLZB 3QUYD 1QUNA 4NZTL 2EO9A 1MCRA 5F1NB 3CXDL 3H7BA 1F4XH 4TPRH 3TIEB 3TCLA 5IMMB 3SKNB 1OT1A 3MTRA 3K1DA 2QQKL 4QHNB 3DXAE 2JB6A 2YEZA 1B4RA 5DRXA 4WWKD 2QADD 4XAKE 3V5KB 4GLRI 4Z0XB 3HZYB 1ND0B 3NTCL 4LHUG 4YHOL 2WZPD 3H9HA 3HNSL 3QRGL 4I0CC 3MV8B 3VGHA 3O11B 4CDHA 1FE8L 4NO0D 4Q6IB 4NKMA 4NQED 4OQTL 1WZKA 5DJ6B 2HTKC 1FSKC 2WMPA 4XPGH 1LO4H 5B22A 4TULH 4P4KB 1S8DB 1DQQB 1JPSL 3HNTL 4L4VA 3RPIB 4PJBB 1OP5H 3F58L 3FB6A 4ZXBA 5B3JF 1JI1A 1EAPB 4PJ9D 3RVUC 1YNKL 4YHKL 3NIFF 2BVYA 3I85A 1F4YL 5GSRB 1JWMA 4KZEL 1MCOL 3KXFB 4GKZA 1FN4A 2BVQA 4ZUWA 1FZJA 4M7ZC 3BKYH 3CFDB 1JV5A 5ETUA 1RUKL 4QHMB 5T3XD 3RWEB 1WVZA 4LDLB 1NDMB 1K5NA 4EUPG 3ZTJH 1XFPA 1B0WA 2C3VB 32C2B 4M8VA 3QEGL 2OXHA 4M48H 5E6IB 5MEND 4P5TA 3D3VE 3GMPB 3QPQC 1H3UA 1MVUA 1JGVL 1AQDA 2XG5A 4QOKB 4J4PC 3FO9A 3FQRB 3GJFA 1JYVA 3QXVA 5C0NC 5E8NA 3B8SA 3W0WE 1YEKL 3MBED 2DLEA 4GAYB 3ZKSD 1D9KC 4ODSL 3T04D 1IILE 5KVEL 4PJEB 3VD7A 4BQCA 1IMHC 4POYA 2PR4H 3SE8H 3FT4A 1HSAA 4CGTA 1L0XA 1QVOB 3JV6B 3W81A 4L4TE 1BJMA 5HYSA 4IRZL 2J8UA 3N0PB 4TUKL 5HXMA 3HS0A 4M5YH 4XXCC 4CU7A 5BVPH 1RAMA 3MA9H 2GJ6B 3DVNB 4QRQA 4X4XA 4DKFH 5IVXE 2H9GA 4B7IA 4HFUH 3CUPA 4RSVA 3NIFE 3LVEA 2H6PB 1QYGL 4YO0A 5C0BD 1I1AD 4FQ1H 3CGTA 4NCC1 5GGVH 4P23B 4I2XB 4XX1E 2FIRT 4R4NC 4FTVE 2QQNH 1IFHL 1YEEL 4IRJC 3GGWB 3HRZA 3MNZA 3MRNA 3JWOC 1X4YA 4XTRD 5DJYA 1N7ML 3V4VL 3GHBL 43C9B 1OQOA 3CMOH 5DHVA 4GS7B 4W6YB 5IG7A 3MLUL 2VITA 5I1JL 1RMFH 4LNRA 1SEQH 3O2WH 1WWWX 4UILH 1J8HD 3TO4B 3RDTC 5CZVL 1MHCA 1UH4A 1QBLL 2JF1A 2X7LB 4OCYH 1GJIA 3E0GA 2VTFA 3D6GA 1NGYB 2R29H 3HPLB 5INDB 3RVWC 1EDQA 4FQHB 1FL3A 1RK1B 4JFQB 2OJZL 4GRMA 5SX4H 2PYEE 4WFGE 4HZLA 3ES6A 4UV4H 4U1MA 1CE6B 3MLPA 3RL1B 2X4OA 3DO3A 3NFPB 3T4AB 4HWBL 4Z7NF 4PTUB 3KJ4C 4GRWH 4HWEH 4MD4A 2WUBL 1I1YA 1ZV5A 3CFEA 4YXLH 3HPJB 1EMTH 4LVOB 5K93A 5J3HC 1U8QB 2KUTA 4LSPL 4XBGB 5IW1A 1KC5L 3WIFB 1Q9KB 5F7KC 3KVQA 3CZFA 4HWNA 5T5NF 1ODAA 3QIBB 1H5BC 1UWXH 1AHWA 2YPLB 1I85A 2DDQH 1Z9SA 3RZCD 1KELL 2DLTA 2GYSA 3DRTB 5I1LB 4ELKA 1Y6KR 4KRPC 5C0FB 1LILA 1FLRH 3CSYB 3PWNA 4M62H 1XCQA 2DN7A 3MOBL 2K1MA 3H8NA 2A74A 2BNQA 3FFCB 4IOFD 5TQ2L 3OSKA 1A6TB 4QRUA 1TJHH 2ZUUA 1UXWA 2CGRH 5IQ7L 4H88L 3I2CL 3WD5H 4L3CA 3LSOA 1NGPL 2YK1H 4UIMB 3TF7C 1CQYA 1CTNA 5FA4B 4HGWA 5JW4R 5ISZE 3JXAA 5CWSA 3MRQB 4GAJL 4JM2D 4O2FA 1FNEB 1GYAA 4RISH 3RTQB 4PGDA 2J88H 5D96B 2HJLA 4NQDA 4HSQA 1DCLA 4PGDB 4BH7A 1Z9MA 3DHJA 5FO8A 1CD1B 5J0BA 1DBJH 4H1LG 4HT1H 2J2ZA 5IEHB 4R96A 5D2LB 4LSSH 4FFVC 5K33A 2UWEA 3F5WB 5CFHA 4EDXA 1SEBA 2J8UB 1TVHB 2FJFA 2JLLA 2LE9A 3MO1B 1MCNA 5ALBH 4HF5L 4UQ3B 4H8WH 2YD6A 1FCCA 4PPTA 2IALB 3BISA 3QG6A 1XR8B 4R2GC 3BP6A 3NABL 5FO7A 3FKUS 3SKMA 5DJDB 4ELKB 3NOIA 1MFCH 4Z7UA 3VXME 3ARDA 5GGTH 4OT1H 1RZJC 4MA3B 2DQFB 4LGRB 4NO3B 1NCDL 3FTGA 4OZGF 3HAEB 3J8F7 2COQA 2QKIA 3WE6B 5E2VH 1WV7T 5HY9A 4RWYH 1BF8A 5SWSD 5EBMA 2H45A 3GDBA 2VDML 1J8KA 5MI0B 5HBBA 1KENH 5C6TH 3L9RA 2K3TA 3UJIL 1YEFL 2ATKB 4ELME 3NFPA 5TPWH 3FFDB 1NKRA 1OGAA 2YPVH 1B0GA 1TENA 5TE4H 1EHLL 1JP5A 3LKNB 3IDXH 5DZLA 2AJVH 4WFHD 3BE1H 4RMRA 4ODHH 3BH8A 3MV9A 4PJ8B 5IVNA 4HCRH 4Y4FC 3WO4B 1X44A 3JUZA 4X6DF 3QHZH 2RBLA 3QQ4A 5BS0A 2BX5A 4KVNH 3QFJA 4QCIA 2E9BA 3G5YA 1YYLH 5HYQB 5E99H 4U2ZA 3PE9A 3HC0A 1OAXH 4PJBF 2D03L 3HMXA 3H3PH 1BMGA 4NN7B 5JPMA 2FIKB 3B2VL 1FJ1A 2LTQC 1IJ9A 1XZ0A 3IF1B 2BRRH 4LCIL 5DO2D 3DNKA 1FNSH 1S5HB 4KVCH 2DQDL 5KSUA 2P8LB 2EC8A 4YDJA 4L4TD 3RJQB 1T2QL 2X70A 1MCBA 1ITBB 3TPKA 2VDKL 3IRPX 5A2KH 2RR3A 3CUPB 1CVRA 3C6LD 1DVFC 1NUGA 1Q0YL 1XGRA 3F65A 4PJ8A 5SX4I 3V5KA 3BI9X 1RY7B 4OM1H 3ZKMD 5DWUL 4HLZH 4RIRA 4G8EA 1Y0LB 4P57A 4L9LA 3MRKB 4JN2A 4J3VA 2E8ZA 3NIGE 4EDWL 3FT2A 4K9EL 4AG4H 2XQYK 2PW2A 3RZWA 3JV5A 4ELMF 3MV8D 1FH5H 2BY1A 4Z7UF 4CVWA 1MH5A 3UYRL 1QLRB 4IJ3B 2OTWB 4ODBD 1KCUH 4XNQA 4Z78B 3BP7B 4UNTA 2QQLL 5DLMH 2YD2A 2LAGB 4F15C 2JJTA 4PJCA 1KYOK 3AMLA 4N0FB 4ZTOH 5C0AA 5GGQH 4LQFL 3RNQA 4HBCH 3AGVA 4K7PL 4XT1C 3CZFB 1TNMA 5DHYB 4WW1A 5MI0C 1AQDB 4GW5A 1T89C 3R8BB 4D0CA 1A1MA 4YHNA 3BN9C 4WUUE 3K8LA 4JFED 5IHZB 3MLZL 5EORH 3MV7A 2HFFA 4EJ1C 5DJ0B 1JFQL 3D0VA 3WNPA 3WJJA 4OGXH 5T5FL 1P5VA 1BQHB 2XZQL 5F1IB 4YAQA 3ARFA 1YQVH 3QWOA 4HPYH 3GBLA 3EJZD 1KB9K 5DQJB 1F5WA 4AK1A 1DR9A 4P5KA 2HH0H 1RJYB 1AD0A 1G0XA 5IW6B 2AK1H 3A67H 5HHMB 4LLQA 5HYIA 2VXSL 5FYJU 4F7EA 3NFSL 1NGYA 4XP5H 1EBAA 4HXAL 4XB7A 1HZHL 2ITCB 4XCYB 4QRTA 2YXMA 4HIHB 1CXEA 2JK5A 1QSEE 4LBEA 1UZ8A 5FB8A 1DQQA 1FNEA 2Y6SD 1IC1A 1A6UH 4YHIA 4IJ3C 3OAUL 3UDWA 3ULUC 4ZUUA 2ADIB 1TZGL 1UWXK 5L0QC 3GMOB 4X6DB 3U9PL 2NY2D 2EXYC 4CW1B 1B0RA 3MUJA 3GKWH 3HI5H 5E6YA 1TVDA 2FD6H 3FAWA 4JPIB 1K6QL 1GGCL 3X3FH 1F3DH 1KN2L 5D7IA 1ZEAL 4ZSOA 2EIZA 4HWUA 2ZJSL 2GJ6A 3DUSA 4QRQB 3QXWA 1KT2A 5FOBA 1CU4H 4LCUB 4OF8A 2ZUYA 3J7HA 2PXYA 3AFLA 4ZAKC 3VGGA 4X5LA 4GUPA 4OV5B 1KPVB 8FABB 1F00I 1MIMH 4G6JH 3VRIB 4X6FB 4GRWE 3WUWA 5IM7A 5DD3H 1IGIL 3RVVD 3BQUC 3BGMA 4NJAL 2GTWA 5ICYB 4PB9H 2MQCA 2EE6A 3GI8L 3B2UD 1RUAH 4DTGL 3NZ8A 1VEOA 3VXUE 1IEBB 4RFNC 4QYOA 5CJOH 4L8SB 4ODUA 4X7TB 2DDQL 3OKDA 4OLYL 3T3PE 3UBXA 2F74A 4KK8D 5DJDA 3SKOB 4G9FA 4Y5XC 1A14L 4G42B 4PUBH 3F12B 4OJFL 3KPLA 4PJGE 5LQBH 4K94L 3MBXL 3BT2H 3BEWA 4G6MH 1A6AB 2FX9L 3P11L 3RWFB 1IGTA 5CP3H 3WNMA 1QPXA 4QHMA 4FZEL 3Q0HA 1NFDA 2EDWA 3PNWA 2DKSA 3RVTD 3C6LC 2UY7A 5CKAA 4IMLB 3DUHA 1YPZA 4MQXC 4N9GB 4F9LA 2SEBB 3EYQD 3MJ7A 1F90L 3H7LA 3BPCB 1NC2B 3I9GH 3R0NA 1N2RA 1JGDA 2Y07L 4TUKH 4LSQL 3LN5B 2C7UA 2QHRL 1DJSA 4LLWB 1S9XA 3GKZA 1VERA 4YZFF 3MUY1 3RTQA 4NKOB 4MWFB 4XVUD 2C3XA 4ORZC 3MODH 5B4MC 3SQBA 3I75A 5EG6C 3O2WL 3VFSA 2CK0H 1BREA 4HC1L 5FKPB 3EO0A 1X5LA 3GIVA 1UXWB 3ALWA 5E8PB 5T33H 3HZYA 1ZHLA 3VFWA 4I77H 1IQWH 2AXJA 2VSCA 4LKCA 1JZ5A 4TN9A 1DBKL 4XBEH 2IAMA 3KPQA 1UJ3A 5GIRA 1G7JB 5LBSH 1AXSA 3S37L 1AD9B 4P4KC 3S5LG 1E28B 3WN5C 5E8OB 5I8OH 1XH3A 1CGWA 3F8UB 2NW2A 3S35X 1RUKH 2R39A 2GSGB 1Q9OB 5HHQA 2ICWB 2HLAB 4MHHG 5C86A 1T0MA 2CKBA 3DOSA 4DZ8A 3PGFH 5CEXB 3C60B 4G8IB 3EHBD 3H6JA 4UT9L 3H3KA 1S9WA 4M03A 4UV7H 1F3RB 4X7DC 3MGOA 3SCMD 1P7QD 2YC1A 4DGVL 1OB1B 3L7EB 4UDUA 4UIKH 3RWJA 4PJAF 3V6OE 4DW2L 4EI6B 3ZHDA 3Q5TA 3A0OA 4HZLB 1FC1A 5ESVA 1AJ7H 3IDXL 2H26A 4PV8B 4CL7A 4X8JB 3LMJL 1TVBB 1KIQA 4N5EC 4WI8A 3QXDA 2G75B 3B8YA 3FQWB 3OR7A 3C5JB 2ZPKL 3S4SA 1WBZB 2ZUQC 2DQTL 3V4PH 2G60L 2VLKB 3OJMB 4PTTB 1PG7W 3BMVA 1GRWA 3CAFA 5HYJD 2VLKA 1X6LA 1DUYA 5DUPL 2HMIC 2I5YH 5F70A 2Q76A 4U7SA 1PY9A 3V2AR 4JJ5A 5F7MC 2ZOLA 1TIUA 1NCDH 1QQDB 2HN7A 2WUCL 2AABL 3DROB 4WO4D 3MNZB 4IRSC 2EC9U 3ABZA 4J12A 1NC4A 4AEHL 4U05A 1UADC 3PG2A 3G9AB 3HRPA 4QRRD 1R3KA 3T8XA 2HTKD 5C09A