4Y1AD

Immune complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
205
Chain Sequence
MQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASSSAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 32
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD02
1B6UA 2GAZB 1P9MA 4FQIH 1YEEH 1LWRA 5GISH 5GSRA 4OUUA 3HC0A 2Z4QA 3MA9L 5FA4A 3MBEC 3O4LB 1MFCL 3N9GH 4UTBL 4JLRA 2DQTL 4YH6A 1V7MH 5KOMC 2HFFB 2IANE 5DZNA 5LGHH 3ROLA 1DE4A 3MV8E 2EKSB 3MLZH 2X2YA 1U2HA 3F7QA 1CE6B 3ULUL 3TZVA 1BVKA 1G0XA 1GAFL 1XFPA 4IOIB 1KCUL 3TO4B 4LHUG 5HDBF 5GXBB 4WEUD 3I02A 1B6DA 3BHBA 1J0YA 1RK1B 2DD8H 3QO0A 5KSBF 5D1XD 1S8DB 4K94L 1HXMA 5CD5D 6CGTA 1HXMB 3O3DB 1JNHB 1A9BB 5GGSB 5J7CC 1DQQA 4YXHL 4HXAH 5I2IB 5DD3L 3G6JB 1FFNB 3PHQB 4U6HA 5IROC 2Q8AL 5L8LB 4L3ED 1I1AD 3K8LA 3SKOB 3RA7L 4CNIB 1JWUA 2YPLB 4FFYL 4DAGL 3ZE2F 3SQBA 4XPTH 2KL6A 3GSNB 1MUJA 1S7UB 4MNHA 2ARJQ 4WUKL 1P53A 3TH3T 1KGCE 3LEVH 3TA3B 1N6QH 4NO5B 2F74A 3MR9A 4ZO7A 1BVLB 3U79A 4LEOB 5C8JB 2DLHA 1YEEL 2EZ0D 4RIRA 5IHUH 4C83A 5L2KD 1RUAL 1JZ4A 4YIQA 2VDRH 4O2EB 3B83A 1S7QA 4XCNB 1FNAA 2GUOB 3NPZB 4OZFH 1OAUL 4NQCE 3UTPD 1I9JL 1KPRA 4AM0B 3AS1A 1VEOA 1RIUL 1I4FB 5ENWB 4PS4H 4GW1A 4ZFGL 4RGOL 1KIPA 4P9ML 3RI5F 3LOWA 3QFJE 5DEGA 4PRBA 1WEJH 2OJEB 4KZEH 4ZQKB 4NP4L 4NN5B 5EU7E 4WI6A 3UJJH 1R24A 2ADFL 2E7HA 2NQCA 1IAIM 4LLWB 4K7PX 1HH9B 1OW0C 2SEBB 5F8RC 4JDVB 4LSTL 1JPSH 3DARA 4LQ1A 4ZPTA 1LE9A 1ORSA 5LBSL 1A6PA 2FGZA 4KJWD 5FM4A 4JPIA 1J8KA 2PCPA 2DWEB 1T0MB 3BE1H 4KGLA 4P3WA 3ZYJA 4HWNA 4MNGB 1FYTA 4OGXH 4ODWA 1VPOH 1YEFH 1S7XB 3GI9H 3VH8A 1E4XL 1NEZB 1Q38A 1A6AA 2HRLA 3CGTA 3DX8B 3O2WH 3NCJL 4GMTH 5C86A 2GHWB 4ZOCA 1F3DH 4JFEA 2DM7A 4XVSL 1FGNL 4BQCA 2VDNL 5IVOA 2CR3A 3WO3B 4OQTH 4MZ2A 3VFNB 4CVZB 1DQTA 4JG0L 4U1NB 4GH7B 1JE6A 4K55A 3MRRA 4NUJA 3LKNA 1QFWI 5KSBE 2DAVA 1O7SA 3RY4A 4PJ5E 3SO3B 3IETB 1KJ2B 1DZBA 1I9JH 1Z9SA 4LLWA 5K9KA 1KJ2A 4FFVD 2VE6B 1IE5A 3MLUH 1MRDH 4GBXC 4KY1H 4KI5D 3QBTB 1L0XA 3ARQA 3BEVB 4M03A 4NKQB 5SV3A 1CLCA 4NQUA 5DURD 1HHJB 1R0AL 3QFJB 5EORH 5D2NA 4WEMB 4DTGH 1NGPL 2Y6SC 4MJ4A 4TUOA 1LO5B 1SM3L 3P4NA 3TPUA 1IM9B 4XMKL 2YK1L 1LO5A 2KQNA 1GZPB 2YMXH 4JFDB 4JPWL 4ORZC 1C16B 3HRZB 3ARSA 5D1XA 4YHPA 1TCRA 3RVWD 32C2B 2X4NB 1MWAL 3KJ4C 5FV1L 4JHAH 4F57L 3T3MF 1YEHH 1I3RB 4OF8A 4XPFL 3HE7D 4U1HA 4Z7OF 5JHDE 4GKNB 3NZHH 4TVSa 2L7UA 4F58H 5CWSB 3ZDXF 3D85D 5I1JH 5J0BA 1JHLH 1E28A 3MRPA 5I6XB 4L3CB 1DN0A 1H8SA 5F88A 3WN5B 3RTQA 4ZMAT 4ONOA 5E24E 4JHBA 5DFVC 3K2UL 1QRKA 1SJHB 1A3RH 3NPSC 3HE6C 3HE7B 1DN2A 1IC1A 4KKAC 1YJDC 2IJ0C 4IM8A 4G6KH 1QQDB 4XPHL 3CU1A 3VMOA 5I1IH 4J3XA 2HH0L 3DMMC 5ERWA 5HVGB 3KPSE 4X7CC 2AV7A 5HY9B 1PKQA 3STLA 4PJGB 1H15A 4F9PC 5ICYB 1WBZB 3KYAA 4D3CH 5DDHA 3D25B 5BS0E 1LK2B 2X4RA 5L88H 3D69A 5EOQH 5AD0B 1AD9A 3QEUA 5E1HB 4HXBH 1DQLL 1QEWB 1SEBB 2R0KL 4JHWL 5IV2A 4U2YA 2BOBA 3MRQB 5ESAA 3HZKA 4Y4HB 1PG7X 1KCRH 1YY9C 5EZJB 5CJQH 4P9HL 5C70A 2AW2A 4Z9KB 4YR6A 3GSWA 4P5TA 5HGDB 4H8WC 3OKNB 5C0CA 5EBLB 4N1CA 1F6FB 5F21B 4YPJA 3SGJC 5DC4B 3BWAA 3CVIH 4HC1H 4NNYB 2P8LA 1V8HA 4H20L 5GJSL 2DTSA 3GRWA 1MFAH 1WJ3A 5I1JL 2R56H 4XWOD 3SGKC 2FECL 5E6IB 4H0GA 3VXQA 5JXED 4OD3H 5CSZA 5EC2B 3QO1A 4LGPB 4NCDA 4P4RB 5ALCL 1EBPA 1F2QA 4KAQL 3EDEA 4JPVH 1A7OH 5LGHL 3OR7B 4NBZB 3CH8A 4KRPB 4L4TA 4GMSL 3MV8D 1IC5L 2RFXB 2VH5H 3MLWH 3FQWA 5HYQB 2NY4D 1I1CA 3ARBA 1GPOH 4ZD3L 4DGVL 4NUGH 4Z7WE 1QR4A 2DQTH 2DB8A 3MLYL 2Q76B 2MNUA 2AEIT 1W0VB 2XA3A 2YA0A 1N64L 2KBGA 5JOFB 1T7ZA 4OCSL 5KANG 5DI8B 2J4WH 5B38G 3KPRD 5DK0B 4LF3A 5GQBA 4JHWH 4JEGB 4JFFB 3C6LC 2DI7A 5C0IB 3KPMB 1W72A 4FQHB 4JKLA 1M1SA 3VFRB 4Y2DA 3GSQA 1OAKL 4DGYH 4WU5A 3V0WL 2JIXA 3QJFA 1X5GA 4W6YB 2WZPD 3DO3A 5TE7L 2YD4A 3TBSB 2PXYC 4WJ5A 3KPNB 2VQ1A 4L9LA 1YC8A 3KPRB 4L4TE 4Z8FL 2EDQA 3DIFA 5SWSD 4PRIA 1G9NH 2YPKB 2PF6A 5BW7C 4XP4L 4JPKH 3T0EB 4XT1C 5TF1L 1DVFB 2H9GB 3FQWB 5HYQA 3PNWB 2XXMB 1TVHB 3MRBA 4MMZC 3D18B 5CJ5A 2V17L 1C7TA 1T7XA 3K2MC 4R7NA 3U46B 4R3SB 4G9FB 2I5YH 4HS6A 4RA3A 4Y4FD 5HXMA 5JW4N 5HGAB 4C58B 4XXCA 4HCRL 4P5MA 2BNUA 1ZT7A 4H5SA 1K2DA 4PJ8B 2XN9E 4JFPA 3FFDA 1JWSA 4U1IA 2V2XB 4ZUTB 2WWKO 3HE6D 3LVEA 5E99L 2L7JA 1W72B 3QFJD 5DMJB 2B1AL 4P3CL 4PJFE 5DO2C 2ZCLL 1CL7I 2A74B 4KV5E 1EMTH 4U6VL 3UJJL 2X6MA 1KXTB 4JM2B 4KJPC 4FTVD 1RJYA 1BAFL 5H94A 3ZYIA 3ARYA 2XZQL 5C0JB 4HIHB 3HI1B 3GKWL 2VR4A 1FPTH 2XNAA 4PRHA 3TO4D 3EDDA 2Z91B 3I85A 1FL6A 4OLXL 1I8LC 1CLZH 5HVHC 1ZLUH 4FFZH 1FGVH 4XCFH 5JDSA 5D96B 3NCBB 4Z18A 1E4XH 2X9WA 4Z0XB 4L8SB 2EIZA 1QFWM 1ZWIA 2CMRL 1N0XH 4XBPA 1MREL 3LDBB 1OM3L 5I17B 2AI0H 1JWSB 3PGCB 2R2HA 2ZUTA 2WW8A 4OLEA 3CFCL 3DUSB 3T0XA 2QBWA 5HVHB 1T1ZA 2E7MA 5AAWA 3E8UL 5KZCD 2JE8A 3EJZD 4RAVA 2H2SD 2AJSL 4OV6F 1K4DA 5E2VL 5LGJB 3IAGC 1JBJA 2AXFB 3RWCB 1HH6B 1QNZL 3QDJE 4Y88A 4B5EA 1CG9B 1MRDL 3IXTA 1ZGLB 1EHXA 4ZAKD 1RZIB 5K9JL 3JTTA 3WHE0 2BFVH 4ZSOE 6FABL 1DBBH 3A0OA 1FL6B 1ZHNB 5DMKA 1A3QA 4C59B 3ULVH 1VFUA 1NBVH 1B2WH 3A6CL 4OLUL 5D1ZD 3HS0B 5JIPA 3ZHDA 1NAMB 5D8JH 4NZDA 4OCYL 3LIZL 5BMFH 1FVDB 5E8EB 4JANB 1X5AA 1NCDH 1U8QA 3VXPB 2LE9A 1U8NA 1OP5K 3MXVL 5I8EB 2X4QB 3UTTD 3VFVB 1KN4L 4FQQB 1N6VA 2R9HD 2V6HA 3KPOA 5DJ8A 4M1DL 1JNHA 1MF2L 3DURA 4GRMB 1YEIH 1FSKC 3C60B 3DX6B 5JHDD 3BISA 1OTUD 5H2BA 2IGFH 1L0QA 4W68A 2V7NA 5K9QG 1G84A 1CGTA 2BSTA 5CD5C 2X5PA 4XMLL 5FDWA 1MCOL 3RIFF 1EX0A 4MXQC 2ZJSL 4QO1A 2XY1A 1VGKB 3OV6A 2Q1EA 5E8OB 1MREH 1CG9A 1ZGLA 3P4LA 2D7QA 1MPAL 3B5GA 3V5HB 2QQNH 5EUOE 4D2NA 4LIQE 1BBDL 2VR9A 1RJZA 1YQVH 2JCCF 4QNPE 1CT8A 3BQUD 3VGFA 1Q9OA 3DV6B 4YC2C 2KKQA 2YC1B 4NWTL 5TDPA 3VMPA 4LVEA 1MNUL 3RHWF 5HBBA 3N9GL 4J2XA 8FABA 2UUDK 5KBNC 1XGPB 4P3DB 1UQSB 5BS0D 4C55A 4V2CB 4MNQE 1V3LA 2XA8H 4LEXH 4Q58C 3QUKA 3VXUE 2NY5H 2X10A 2FO1A 2FEDC 5FM5M 5E6ZA 3C5ZB 2XTJD 4XCNA 5I73C 3K81A 2ICWB 2CKBA 5ID0A 4DGIH 8CGTA 3FFCE 4D3CL 2XQBL 2YZ1A 5L88L 4LSRL 4X6DA 2DD8L 3OKOA 3U9PL 1T1WB 5KS9B 1FP5A 2D4DA 4XBGB 3RWGA 5DVLA 1HINH 3H9SA 4LKCB 4XHJD 3QNXB 1I8IB 4QNPF 3HC4L 2Z8RA 3DTXA 3EHBD 3C5ZD 3U30C 4NHUB 3LD8C 1IAKA 1YDPB 1F02I 3OXSA 2FDBP 4X5XA 2QQKH 3B3IB 2D9CA 4PRNA 3EO1B 3O6ML 1NANI 1B0RA 2ADGB 1TVBB 3LEVL 1JK8A 4HBCL 2FATL 4L8DB 3UPRB 5ALBH 4NC1C 1H3PH 1BBDH 5DQDH 5EH1A 2VQUA 3QXDA 2BSSA 4L29B 3HE6B 5BVPL 1E6JL 2ZOLB 3V0VB 1BQSA 2F8VA 1NEZA 3MV01 2B1HL 2AEWA 2YOCA 5ALCH 3UX9B 3ULVC 4PUBH 4OD1H 1QUNA 5E8NA 1NAKL 4IDJH 5EU6B 5DQJA 5C09D 1DSFL 5DQJB 3BKCH 1FO0B 4M6ML 5T3ZH 3GJFB 3DUUA 1NPUA 3KPRE 4K23L 1TTUA 1QTYT 5C2BH 5FOJA 5JPMA 2Z31A 4EDXB 4JR9H 5T1MB 2XTLA 4PJCE 4K9EL 2VZOA 3UEZA 5HI4D 5DVKA 5FGSA 3PDOB 3ECBA 2JKXA 1NFDB 5EFIB 4GLRH 1JPSL 3M1BB 5IB1A 5F9DC 4FQCL 4P5TC 4L4TD 4P9HC 1LE5A 5JMRA 1T20B 1TJHL 3ZE2E 1P4LB 4FXKA 2NTSP 5HHQA 2OJZL 3IJSB 4P2CG 4S2SA 4ZUSB 4RMSA 1A1NB 2MFNA 4DWHA 1AP2A 3TV3H 3D48R 1JTOA 4PJ5A 5T3ZE 1TNNA 1QBAA 4HCRH 4FA8A 2HTKC 4EOWH 2Q3ZA 3V6FB 1V7NH 4Q6IB 1MFCH 4UTBH 3MPCA 1KLGB 2L0DA 3W5NA 3MRRB 1LDPH 1GGYA 3WN5C 4PGZA 2I25N 1PKOA 2EDLA 3MNWA 5KVFH 3WFZA 4YHNB 2UY6A 3CMGA 1FZJB 1JI2A 2R1YA 4UV7L 3RUGB 4LRNH 4LLMA 4GXUM 1HHJA 4PGDB 3PL6C 2VB5A 1MIML 1BF2A 4N1EA 3HG1E 4J1UA 1SEQL 4G3YH 3G5ZA 2J5LC 1I7ZB 3VW3L 4O02H 2VXQH 4F3FB 4YDJB 5ILTH 5JHDB 1JCKA 2XZQH 2BC4B 2R15A 3KPPB 4S2SB 1QEWA 2FO4A 1JNLL 1KJ3L 4NO2B 3RJQB 4F37K 4U1HB 4ZODA 1JGDA 4PJAA 4FFYH 4DAGH 5C0EA 5EO1A 3QWQB 5EC1A 1NC2D 2AJXH 4U1MB 1CI5A 5INDA 5KG9A 2CMRH 1F3RB 3KLAA 2EE3A 4NQDB 5L0QC 1VFBA 4YBQC 2AXJA 1YY9D 3B9KB 4F33B 3TC9A 3J8F7 4JG1H 3H3KA 4LCIL 1Q9KB 3VXOB 5GS1B 4OZGE 5HHPA 4AL8L 5GRJH 1HWGB 1I75A 1Q9KA 3RJDA 1PBYA 4NNYA 2OX5A 4OLVH 5ISZA 1IKNC 2H1PL 2OR8A 1YZZA 3UDWC 4U1LA 1QNZH 4O58L 5BS0B 2XKNA 3ARFC 1P4IL 4NFCA 5EB9A 3TBVA 1ZA6B 4PBVC 2VNCA 4P4KB 5KSAA 4QRRA 3NIGE 3Q5YA 3GSOA 3DX9B 1AXSA 3VRIB 7FABH 3VG0H 5DUMH 4F3FA 1MJJB 1NUFA 5J12B 5J1AB 5BZDB 1DQML 4JKPL 4OTXL 4QEGA 2EXWC 4KRPD 5GZND 5EU3A 2BCKA 5HI3D 1ZA3B 2YD9A 1WITA 3OKYA 4PJCA 4TSCH 3MRQA 4PB0H 5ESAB 1LO4H 4RGND 2P42B 1QSZA 3VDCA 4UT7L 3T8XB 3ULVD 5C0CE 2HT2C 3QWOB 1EA9C 1E4WL 3MGTA 3UTTE 1CXEA 1W72L 5TH2A 3LN9A 4LPTA 4LSUH 3SDAB 4HIJB 5I1HH 3GUTA 4Y2DB 3G5YB 1J05A 4DKEL 5GGTH 4FNLH 3GGWA 1A21A 2X4SA 3L3GB 1INDH 3KVQA 1YEIL 5C7XL 1OW0A 3UO1L 2HRPL 3L3OB 3STBA 3CX5J 3PXJA 4R4BB 1ZGLM 5FB8B 4PJXA 1DQJA 5A43C 3X14A 2E6JA 2OCFD 1DQJB 5E2WL 4DQOL 1EAPB 5KSBA 5BV7C 2G5BB 1U3ZA 4Y5VA 4JZOA 5F7LB 4ALAH 4LCYA 4JQIL 1IGCL 2XACC 3DETC 3L9RB 5HHOD 3FT2A 3I6KA 2ZUUA 1XGRB 2NY1B 2NMSA 3U83A 2VZ1A 3BT2L 4G7VH 4FABH 2YUWA 1UENA 4G8EB 2Z93B 3UBXA 4MB3A 4D8PA 1IQWL 2QKIB 4MCYB 1FL5B 4OTXH 2C1PB 3PL6D 3MLYH 3LRSB 4RWYH 1HXYA 5I1LB 5DK0A 3U1SH 4U0QB 5HYEA 2V2WA 2CDGA 3ELAT 3MLTA 4YDLC 3CAFA 1N2RA 1A0QL 4A6YB 1LO4L 1RHHA 3MV11 5DR5H 1KT2B 3OAUL 3I75A 3TNNB 5ICXB 1FE8H 4O51B 3OGCA 1W72H 1MHEB 1FAIH 2ENYA 3C08H 5MEOB 5HHNA 2RAMA 3HI1A 4CVWA 1BQLH 1OAKH 3L3DA 1UH2A 5T33H 3DI3B 1GVIA 5KW9H 1J8HD 3DNKA 1AFVH 3IF1A 4P5KB 2CK2A 4PP2B 4YDIL 5D71H 5EU6E 3NZHL 3EDFA 4YGVB 1KJVB 3D3VB 4KJWC 1A6ZB 2CXGA 3DGCR 4GRWH 3LD8B 5DQDL 1T4KA 5I1EH 1A6ZA 1W8OA 3OKEA 4NGHH 5B39G 5SWZE 3LEYH 4DKAA 5IKCB 3O6MH 3TT1L 4KI5F 4G6JL 2B8OT 2GW5A 2YSSB 5F3BA 4AIZB 4WO4A 1U41A 4G9DB 1ZT7B 3G08A 3GIVB 4X0KA 4FQIL 3EFFA 1D5XA 5C09E 5ACZB 4FABL 4XPHH 1A7PH 4N68A 3W0WD 1AGEB 1BEYH 1LD9A 2BVTA 3OGCB 1HH6A 5E5RB 4MJIE 3GSUB 1HOCB 3L3KB 1ZOXA 1U3JA 1JYWA 5MEOA 4JR9L 1H3VA 4APQD 2AKRA 3RIFK 2V5TA 1FNSH 5IW1B 1XH3A 1FHGA 1P84K 4TUJB 1TMCB 1EFQA 1WWAX 5KVDH 4HKXA 4RA0C 5KS9E 4M48H 4N8PA 3AXLB 2VSDA 1KB5B 3MZTA 1HNGA 4DZ8B 5FCUL 1JV5A 3BYYA 1CXHA 5JNYB 3B9KD 3BPCB 1UZ8B 3EOBB 3MJ8B 3HR5B 2VZVA 3MODH 4E5XB 1AFVL 4JFDE 5GGSY 4I4WB 4OM1L 2CLZB 3LY6A 2FB4H 3EYQD 4HIXL 4MQTB 4X6CB 5C0BD 3BFOA 4LK4A 2MPAH 1T5WA 2P48B 3LRHA 5EZOH 4M6AA 2MHAB 1JWMB 2F58L 1HIML 2BRRH 2PTUA 4QRQA 1IGTA 1M05A 2AEPL 4KC3B 4M61B 1T7WA 5GRVK 4U1SB 2JF1A 5J6HB 4LOUC 1JVKA 3CFCH 1NUGA 2CRYA 1GGCL 1KCSH 3QR2A 5CBEA 4YHIA 5TQ0H 5DUPH 4UIKH 5CMAA 4RAVB 4FOMA 1R3LA 1IGYB 1CK0H 3LEXB 3S98A 1SBSH 2A6KB 3GJEA 4FMFA 4JFOA 4R0LB 1XGQA 5HPOA 5L9DL 4UB0H 2BFVL 5DHYB 4NBYB 5MHSD 4XAKD 1IM3B 4Q9BA 4PJDB 4PLJD 1D6VH 3AMLA 1UQSA 5BJTB 4EDWL 5E6IC 4K3EH 3PG2A 3MJ9L 5EBMA 1KB5L 4MQXC 4LAQH 5E6ID 4BZ1H 4OLUH 1GSMA 1CS6A 4OT1L 5GHWL 4EI5A 1IMHC 4NZTL 4CW1B 5F6IB 3SDAC 4HK3J 4DN3H 4P2RE 1NFIB 1UM6L 2KZWA 2XKSA 2V9QA 4O9HH 3V0WH 3WNMA 3UAJC 4EVNA 5E2JA 1RJLA 5ILTL 1CFSA 5B3JE 1T03H 5C9JB 2IBGA 2XFXB 2DQCL 2Q6WA 3BESR 3PIQA 2LU4A 5EUKA 5MEQB 3INUL 4JG1L 4LCIH 3SJVE 4HH9A 15C8H 4JFZL 2YPLA 2FWOA 3GKZA 3F6LA 5CZVH 1Q1JL 5I16A 1TDQA 4TOYH 4HUKB 4DVBA 3VXMA 4WHTB 4HIEB 1S7WA 1F90H 1II4E 2H8PA 3LN4B 1U8JB 3U82B 1KCLA 2WBWB 3BGAA 5DTFA 4U31A 5ISZD 2BNQA 2BY0A 5A3ID 1I9RL 1U3HB 3K8MA 3QI9C 5INCB 2C1OA 4UV4H 1BOGA 4YHKH 4IRJC 3WE6B 4YXKH 4PRPD 2I07B 4MJIA 5FUZH 3SDDA 3O9WD 2Q86A 5CJBA 2XOTA 3CMOH 3LH2H 5DJZB 3DV4B 1EDQA 3HZVB 1JTTA 3G04A 4XNZC 5E8NB 4HF5H 2ED9A 5J6GB 5KS9A 1BAFH 3RL2A 3O6FB 4JFQA 1JI1A 4JQVC 2AK4E 2OTUB 3U9PH 3QI9D 1T3FB 1NSNL 4KI1A 5GJTH 1NGQH 4HQQL 4M6NH 3LCYA 5EO9B 2RJMA 1SM3H 25C8H 3G6JF 5CEZL 2HG5A 3HRPA 3UTZB 4XCFL 1ZXQA 4LSUL 4KMTH 3UTTA 4XNMB 5B3NA 3LQAC 1FFOB 3QAZB 4C54A 3DROB 1MWAH 5F7EH 4JRYA 3BRFA 3GHEL 1MI5A 3RWJB 2HN7A 2IAMC 4AYFA 5BV7H 3OXRA 1MWAB 5DRNB 4XXCC 2OXGA 5DK2A 2G5RA 1Q9WA 5J56B 4WO4C 4GFTB 4JQIH 4N0UE 5EA0L 2APTA 2R0WH 5FECA 3PHOA 3WLWC 2AJSH 4IIQC 5C6PB 3FQXA 5GS0H 3LB6D 4TULL 3TNMB 2ICEB 4AEIL 3QG6B 1NCUA 4QHNA 1Z0NA 2YR3A 1GGIH 3VFMB 2CUIA 4ZAKC 4H1LH 3DO7B 1L6XA 2ED8A 3CD4A 4MDIA 3MV9D 4IRJD 1GL4B 2AJZB 1AO7B 3DO7A 2E7CA 2HT3D 4HGWB 1ACYH 1CFBA 3MREA 5J4MA 3EYVA 4JAMB 5CEYA 2FX8L 4N5EC 4XNXL 3OHXA 2DM2A 5C2UB 3QFJA 1JGEB 5F7HA 1AQDB 4WGVB 5C0AD 2PO6B 3MRGB 5EU7C 4P2QE 3KPLB 1ZK9A 4ONGL 3NGBB 1SQ2N 1H3TA 5EUOF 1HZHL 2VDPH 4EZMA 3FO9A 2N56A 2G75A 4M93B 3QUZC 3TYGL 1YEJH 3KYKH 4Y89A 4CVXB 3JWDL 4WU7A 3W82A 3GIZH 4Q7DA 1QBML 2YKLL 5E00A 1GXEA 1BJMA 5I76B 5E8PB 4X4MA 2NY0C 4I3RH 1C5BH 3VXOA 1HHKA 2W65B 4P5TB 4Y5YA 2BNRD 4NWTH 4PJBE 3W0WE 1FORL 4PB9H 3WXVH 1H8NA 3CFEB 3ROOB 1NANH 2AV1B 4OFKA 5IVZB 2FJGA 3B9VA 2X40A 4U2ZA 4NQCA 2EXYC 3N1GC 4HUVA 3SDCD 4J4PA 3ULUH 3DRTB 1YNLH 4NKIL 5AZ2L 5I1AB 1ACYL 1WBZA 1N5YL 2DIJA 3QRGH 4XP9H 1AD0A 3BDYL 1XIWC 3QCUH 4PFEA 4PBXA 1IGIH 3WEXB 4WTXA 1U8IB 3WEXA 2WBJD 1GOFA 1F8TH 3AUVA 1B0GB 1HSAA 4IIQA 1ND0A 1Q0XL 5IVXA 1NCAH 5DWUH 2JLLA 3QIBA 4NHCH 1K4CA 3UC0H 5I19H 3EYSH 2VLJA 3Q5OA 4HUWA 2D31A 2BVEA 4N0YL 1EHLH 3VRJA 1BLNA 4LNVA 5CGMA 1N7MH 1MCBA 4XXDB 1CBVL 2EDDA 3BIKA 1URLA 4WUUE 2H6PA 1OY3B 3F12A 1BQHG 43C9B 1N6QL 2BY3A 4UAOB 4Y16B 4U0RC 4U4BA 4XNUH 1U3HC 2DKSA 1UWXH 5D7IA 4X7TA 1EHNA 4FQXD 2V17H 3KPNA 3GMRB 1MY5A 2BNRB 1OGAD 4MA3B 4M4RA 4TUKL 1IAII 2V5RA 4P99A 2JK5B 4JB9H 3STLB 4UIKL 1CDCA 2D9QB 3FOLB 3QAZC 1AGDA 3W39A 4GW4B 3FRUB 4JDTH 5HGHB 5IJKA 3DSFH 2NY4C 1MCKA 1MCWW 2HJKB 4KFZC 3U6RA 4BQ8A 1XGRA 1KB9J 1S9XB 1XZ0B 5L7XL 4R3SA 4JE4B 1P5UA 1MFDH 1KIQB 4KQ4H 3U4EA 9CGTA 3KJ4B 3RZCA 2E9WA 2CPCA 1U8PB 3HG1A 4NRZA 4P46D 2CIIB 2Z8VC 1IGIL 3HC3H 3HCVB 1BF8A 3FO2A 3GSWB 4ZSOB 4GAYB 2DF3A 5EPMB 4LSTH 3SQOH 3GBML 2W0PA 3FO1B 3TO4C 2NY6C 2V5SA 3IVKA 4NHCL 3GFUA 4X6CF 5I19L 3L3GA 4KRMB 4JJ5A 3L5IA 2OXHA 3SJVD 3C9NB 1NMAL 1ZVHA 1FIGL 5F9WC 3K4AA 1L0YA 2PXYD 1ZEAL 2X7LB 1RZKC 2PYEE 1NCCH 3RZCD 5DO2D 2GFBB 3H0TB 2I9TA 2CXKA 3GEWB 3BP6B 5E08H 4GMTL 4I9WD 2X42A 1X7QB 1JPGB 2YUZA 4OZFA 3MROB 3QEHA 2BHUA 3MUGB 2ARJA 3FHQA 5IQ9A 1WWBX 3CX5K 4GKSB 4AT6A 3MUZ1 5CCKL 4F37F 3RY5A 2VLMD 3FO2B 3L7FB 4XH2B 5SWZA 2BVQA 3GMQB 1PYWA 3GIVA 2ENSA 1LD9B 4QCIA 2OTWB 3D0LA 3I75B 3TNNA 5DHXB 3O6LL 5GIRB 4KQ4L 2C5DC 5HHVH 5TPWH 1KYOK 1MHEA 1SYSA 2DL9A 3G5VA 3SKMA 1S7RB 3I3EA 1K4DB 3FQRB 2EDWA 1UWGL 4HFUL 1KF9B 4GAFB 1XF2B 3EO9L 4ERSL 2CIKB 4MNQB 3PDDA 1T7VA 1WC7A 3QI9A 4XMKH 1SHMA 3VXUB 4LVHB 1NCDL 3C6LD 2RCSL 3IFNH 2YUVA 4KK9D 4WV1A 5AWNL 4M7LH 5KAQG 3AS3A 4X5LA 1XCQA 4F7EB 1CFTB 2WBJA 3MJ7A 3ARVA 3TJHD 5IB5B 5D2LE 1HKLL 1T04B 4NRXA 2GJ6B 1OTSC 4ZUVB 3X11B 1VACA 4G42A 4Z0XA 1IAOA 3IU3B 4WHDA 3MQIA 4CU7A 5ADOH 4BJLA 2HLAB 4RAUB 4XI5C 1ZANH 3PWJA 3FN0L 3ULSA 4JRYD 1RMFH 4AT6B 3Q6FA 2GITB 2I26N 2IAMB 4S1SL 1UXWA 2HFEB 3T2NH 3WHXB 3EFFB 4Z6AT 5JXEA 2ATPA 3D0VB 4M1GL 4G9DA 4IRJB 4JY4A 5IQ7H 2QQNL 3DX6A 2J2ZA 3QDMA 3AY4A 4OIIL 2H32H 4D9RE 4UINL 1EO5A 4KZDL 4YAQA 1Y0LA 2BY1A 3IFPB 3MV9E 4OZHA 4KROB 4RBPH 3N1MC 3TWCL 3BP4A 3IFPA 3NCFB 4OZHB 3F58L 5FA3B 5I1DB 2EYSA 2YD8A 5JOPE 3MLUL 1QSEE 3DX7B 2A6KA 1LK3H 5C0BA 1D5BB 2J6EL 2VXUH 3QA3B 1KULA 5H35A 3U48A 4TSCL 5DGQA 4LASH 2YC1A 2CLRB 4HFUH 3CK0L 4UMGA 1Z3GL 1FYHB 1ZSDA 4O2FB 3GSNL 1J9CT 4Y1AB 1JRHI 4DGIL 1SVCP 3OKDB 4K8RD 1A1MA 1QRNA 4J6RL 3KYNB 4EI5B 4D0DB 2DIBA 1XGYH 5C08D 1DQDL 1Z9OA 1VENA 3PWJB 4L1HA 3ULSB 2D0HA 4EN3A 4JN1H 4OQTA 4YDKL 2DWDA 3VXRA 1FCGA 3KYKL 1SYVA 4N8VA 3CC5A 4N9GA 4HIXH 5H2BB 2C3GA 1MH5B 3WV0A 2VDPL 1RHFA 4GRMA 2BMKB 2P8MA 5MENA 1D5ZB 1QYGL 3IGAB 3NCYP 4NQXA 5H37G 3GNML 3RGVB 1RFDL 5DEZA 2DQIH 1OD9A 4KJQC 3FT4B 1ODAA 5TDOA 1T66D 3RHWK 2VLRD 4K9EC 2WLZA 1I7RA 3ABZA 5J12C 2VYRE 5BVPH 1X9QA 2XWTA 4Z76A 1U8LB 1FDLL 4MMXC 2QEJA 3FB6A 3Q2CA 4X4ME 3MLWL 3QEQE 4TRPL 1ZSDB 4O2FA 4LEOA 4QRTA 4NJ9H 3ROLB 3TBTA 3OG6B 5F7MC 2H41A 1QRNB 3U4AA 3LB6C 3QDJA 1QG3A 1EFXA 4LLDB 3QCUL 5EZIH 5DZOA 5ADPL 5IOPB 2CKBB 5ID0B 1F4HA 1MFEH 4H88H 4AH2A 3ARGC 5DWUL 4J6RH 3BGMB 3CH1A 1VGEL 2A0LD 3O3DA 4DFHA 5MEQA 2OTUA 5E5MB 1AJ7H 5FK9B 5DMGD 4HV8A 2RQ8A 2XWJA 4LMQE 4HC1L 1RZ8A 3MXWL 4MCZA 3V5HA 5IMLB 2BNQE 5SWQB 4WUUD 4XGZA 4RFNC 4BSVA 4OFYD 2J5LB 4U6YB 3V8OA 1MI5D 4HH8A 4YZFF 4QXUH 1MWAA 3IDXH 2P24B 5K9OB 3RWJA 2F54D 4RZCA 2I07A 5CSGA 1I3GH 3WJJC 4JDTL 2EICA 4XZUB 3QUKB 4JHZA 1V7NL 5EUOA 1QPXA 2IPTL 2E9JA 5DJAA 3B9AA 1AGBB 1QSEA 1U9KA 1NQBA 4I0CC 3UTQB 2HMIC 4LHUD 1I4FA 1R5WA 3TH2T 4P46B 1M4KA 2GT9B 1CICC 4MHHG 5HJ3B 1BBJB 3X13A 4LFHG 1GHFL 3WIHL 2V5MA 4M43L 4IOFD 1UEMA 4HWEL 4APQC 1V3JA 4RGOH 2M2DA 4JO4L 2XICA 4S0SD 4Y4FC 2JB6B 4GAGH 2Z31B 4DOHE 5EU4A 3B2UD 1EAJA 3EDJA 3K0WA 3FQNB 3ZT6A 5C0RH 2E3VA 1IKNA 5IR1A 3UTSB 4DZBB 5IK3B 1HCVA 5CFHA 5BVJA 3BPLB 1UWXK 4YO0A 3PGFL 5HGBA 1G9NL 1LVEA 4WW1B 2QADC 3G5ZB 2F58H 2VXTH 1RURL 1R5IA 2BRRL 3QCVH 3DX8A 4I9WE 1SY6A 1OQOA 2X9XA 4LLAA 2DQJH 1N0XL 3PL6A 3LMJH 4FQ1H 2X1WL 5HYSA 3FQXB 3BUTA 4HX1A 4P46A 5TQ0L 5D93C 2CRIA 3MACL 2DYPB 3QULB 5HHOB 3QSKB 4I8DA 4PRIE 2VDKL 5CBAB 4X6DF 5ITBL 2ESVA 3JVGC 3QUMH 5JW3H 5K59E 4MSWB 3SGEI 5EU5A 4M5ZL 2Q7YB 5A2JH 2JB6A 1QOKA 1QSFB 2EH8L 1DLFH 1DBBL 3H9YA 1XR8B 2AP2A 5CAYB 3EJJX 1MLCB 4HPYH 4BQ6A 3T0DA 3OB0K 2EKJA 4K7FB 4NZTH 1G7HA 4PGDA 4CMHC 1JNJA 5I8CB 1VADA 3DVNB 3NIFF 3FCTA 3NA4A 2YXMA 1MEXL 3MLRH 3MOBL 2Y07L 2JTDA 4NNPH 4NPYB 3EO9H 1MLBA 1OL0A 2GJJA 4M8QA 4ONGH 3GBNH 1YN7A 2QTEA 4V1DA 4QHLA 3KR3L 1ZANL 4HLZH 3G6AB 4XMLH 5DHVA 3KNBA 1Q1JH 4KU1A 4JY5L 5D1ZC 1YNKL 4XPFH 1FNLA 5DYOB 4MSWA 1F6AA 2HRPH 2D31B 1YPZF 3QP3A 4HUXB 5ANMA 4Z7VE 4RRPG 1ONQB 2GY7B 1E28B 1NBYB 3CFEA 5EIVA 2PTVA 2P7TB 3TGXA 3SCMD 2VDML 2NPLX 2E8YA 5F3HB 3TF7C 5A1AA 4KK9C 3N1FC 1D5MA 4ZAKA 3OAYK 1U92A 3TN0A 5D7JD 1KNOA 5K9JH 5DHVH 2J6EH 2R2BB 2B4CC 1F4AA 2C7UB 4RDQF 1I1FA 4YHPB 2AK4A 1CU4H 1FVEA 2IH1A 3IFLL 3PWPE 4XC3H 5F7DB 2WINA 2NY5L 2MKLC 3S96A 4R2GB 3CK0H 2DKMA 1YN6A 3JV4B 4KJQD 4QHMA 3P9WB 1OB1A 5B39B 3GO1L 3RNQB 4OKVA 2YPVL 4YFDB 5JLZA 3NACL 4NNXA 4X7DC 1GJIA 2CO6B 2GK0B 3HCVA 4L3CA 4XRCA 1DLHA 1HILB 3LS4L 1JGVH 5DYOA 1REIA 3TBWB 3BDXA 4P4KD 4PRPB 4OBRA 2W9LA 3U7WL 5M94B 1UM5L 3P0GB 1A7BA 1NMCC 4GSDH 5AUMA 3TP4A 3VRJB 5D7IE 4YUEL 4GS7B 1EV2E 3QNZB 1K85A 1BJ1H 4LQFH 3K1DA 3VXTA 2R2BA 1PKQB 3AMKA 4MA3A 2C7UA 1V5JA 2Y5EA 4Z7VB 4P2OA 5C0FB 3WFDL 3H0TA 4NN7C 2I9TB 3CUPA 5GS0L 4RCAA 1ZAGA 4GKZA 5CEZD 3DLQR 3BGFB 1KGCD 3OKMA 1UB5A 3WNNA 3I6KB 4KAQH 2FD6H 2H2PC 2R0ZL 5FM5O 3FN3A 3D18A 1DSFH 3KDMB 1GZQB 4MXQD 4KMQA 3RY6C 2R0LH 1GPOL 1JPFB 3QEHB 1QVOB 4QRRE 4WNQB 4XP1H 3S36L 3PF2A 1CGUA 2Q76A 3ULUE 1F97A 3PWUA 4EEEA 1ZLVK 4OCWH 3G5XA 4GAYA 4WO4B 5HDLA 5ITFB 2AK1L 1HXYB 1T21A 1PGRB 4Y1AE 3UTPE 4JN2A 2CDGB 1TETH 2MQ0A 4Q2ZA 1QBLL 5FIEA 3DJ9A 3LZFL 1FLTX 3NFNA 4LCCB 1XF2A 3QO1B 4P4RA 4UT6L 4L5FH 5D96C 4GXVH 1N26A 4J3OC 3QDGD 1XAUA 5SX4I 3WIFA 1PD6A 2LTQC 3X14B 4O00A 3ILPB 5TE7H 2NY2B 2FR4B 3VJ6B 1H5BC 2Z91A 4G8GD 3RIAK 4L8BB 3VFTA 1OPGH 5LG1A 3TV3L 4OZGA 4TVPL 1FFQA 2XWBA 4QOKA 1PSKL 4RGNB 2W0KA 5IFAH 2HLAA 4MGXA 1TVHA 1J8HB 3SCMA 2CLVA 4UIMB 4X9IA 3EYOB 3QDGB 1ZT4B 4N0UB 1X4XA 1K6QL 5HDOA 1HYSC 4LARH 5EZLA 4U33A 2ID5A 4JKMA 4IDJL 4ZUTA 3FB7B 2WV3A 3QHZL 3AVEA 3REVB 2UVFA 1WBYB 5HI3C 5DA0B 1Y6NR 2Y06H 3K4ZA 3I6LD 4U3HA 4WI5A 4GJTB 1B88A 2FH8A 5E70A 3WS3B 1MCLA 1KACB 4GG6F 3VXSB 4M4PA 3QDME 1BD2B 1E4KA 3DMMD 3I84A 4LVOC 2FHBA 5CJXA 1Q9LB 2N4IA 4HWBL 4HAFA 3MYJA 3JUYA 2VXQL 5ESVB 3DRQA 1W0YT 1F8TL 4UOW1 4HUMB 1E4KC 5C07A 1IFHL 4LPWA 3KPSB 1JNLH 1KJ3H 3VFTB 1UM6H 3O45A 3QIUA 1JPTH 3OWEA 1G7MB 3H9HA 5F93C 1INQA 4XVUD 2EDKA 3TVMB 2AJXL 3BWUC 1VACB 4OF7A 1XF3A 4LKXB 4U3CA 2OP4L 1RK0A 4OLWH 1H3UA 5BQ7A 1Y6KR 4YQXL 3VFVA 3I50L 1PG7L 1NFKA 3KPOB 3MV9A 4OZHE 4W6XB 5CZKA 5DJ8B 1CE1L 2K3TA 4G6AC 2D7PA 4OV5B 4L4VA 1MH5A 2EH7L 4K8RH 1IRAY 3SDCC 4P2OD 5JA9A 3QUML 2VZ3A 3S34H 1D5ZA 4FXLA 3WHE1 5CMAB 2B2XL 4NWUH 4M7JH 4N0CC 5HYIA 3FO0H 2RIKA 3E8UH 1VKXA 4H1LG 2ZCHL 2D3VA 1OGAA 4OFVA 3NCYS 4AY0A 4EI5C 1J1XL 2P8PA 4HPOL 3BH8A 3BZFB 4PIRF 1MHCA 3O9WB 3U4BL 1CQYA 4XNZB 2GSIB 1MJ7H 1J10A 3CU7A 5L7XH 4QXGH 4E41E 3KLHC 3GHBH 3VFSA 4Y1AA 4X6FA 3U9UA 1EHAA 5D72H 3VXSD 5JR1H 1IAIL 3GMOA 1WZKA 3QHFL 5INCA 4O02L 3VXRE 1LO3L 1U91A 3AU1B 3T65A 2QR0A 3GSNH 1ZLVH 3EO0A 1CD8A 3S7GA 2EZ0C 3LIZH 1U8QB 5JPNA 1XEDA 2A1WH 4FTVA 1BWMA 4LLVB 3VFUB 2EDJA 3KR3H 4RFEA 3KAAA 4XVUC 1FIGH 2GSGA 25C8L 2EIEA 1H9VA 2XFXA 4ACPA 2A9ML 4Q6YA 5D2LA 3IDJB 4M1DH 2FEEL 5DQ9A 1INDL 2DI9A 2J7LA 4MXVE 3OX8B 3S4SG 5HYFA 5CIPA 4YQXH 3VD4A 2ZUVA 4CADA 1NDGA 4M7ZB 1M71A 1PG7H 4YPGA 5F7EL 3DI2B 3QNXA 2YWYA 4NQSB 4ELMA 2W60B 1HH9A 3H6JA 1MHCB 1RZ8B 2BHYA 4MCZB 4ELMB 2H1PH 3NA9L 4KKCD 1RFDH 5T1DH 4LSSH 2NXYC 1UACH 1C08A 3MFFA 5C0DA 3GMLA 1QHOA 1A3RL 1MFBH 3CFIC 4Y2DC 2GQHA 3IU4L 1YUHB 4Z76B 3EYQC 5T3XD 5C0GB 3C6LA 1DDHB 1JL8A 3BP5A 3ARED 3AAZB 4L8DA 5D6DA 4X9HA 2ZOLA 2X4QA 1DDHA 3AY4C 1ITBB 1C5DB 4Z5RB 4WTZG 2DQUL 2MCPL 3RGHA 3QXTA 1GGIL 3SE4C 3ZKXB 3O6LH 1YEDB 1HSBB 1MCDA 1RZGB 2BERA 5IHLB 5I74B 1DFBH 4PJHA 4RNRA 4UU9B 5I66B 4XC3L 1G7JA 1FO0A 1E4WH 4HXBL 1X4YA 4ZO9A 4R2GC 3WKNA 3GMMB 3LQZB 4ERSH 4LCCC 1QFWH 3GRWL 4Z7UE 2FX8H 4XNXH 2XQBH 3QJHB 5F1IA 4FFWC 1WK0A 2DDQL 1BQLL 4M7LL 3NACH 1CLOL 1GIGH 2HFGL 1KJMB 4JDVA 4X4YA 2IADB 2QSVA 5A3IC 3VI3E 4Y4KD 3EYFB 5DJYB 3IRPX 4DK3A 2X4TA 4GRWB 1NGYB 3CFDB 4ZPVB 1AGCA 3L1OH 4PREB 4OJFL 4LIQL 5BW7A 3JV5A 3M1BA 2A0LC 1NGZB 5E03A 5D7LA 4X8JB 3NTCL 3DYMA 2YEZB 4L8SC 1FYTB 4PY7A 4HUUB 4LSVL 5FOBB 5CZXD 1GC1H 3DXAE 1JZ7A 1RD6A 5IWLA 1C5BL 4ZUWB 2ICEA 3OJDB 1OQXA 4PV8B 1QLFB 1DUYA 5I1KL 2MMXA 4PUBL 4JRXD 5E94A 3ARDA 4GO6B 2IBBA 4U49A 3UDWA 3G6DL 3IETA 3OZ9L 3MRMB 5GGTA 4BK4A 4L4VD 3W11C 3GI8L 4GAJL 3W9EB 4WI8A 3O3AB 5DD0H 1MCHA 3EYVB 1G6RB 1FNGB 3PV6A 3QQNA 2OMBA 1FE8L 2JIXD 1IGJB 3VWJC 3P9MA 2YBRB 5E5UB 1M6OB 1FAIL 2D0GA 3C08L 5JUEL 2FIKB 4L5FL 3QRGL 3NPSB 1G6RH 3KPQB 3VXNB 4EI6A 3PDOA 2QADD 4NYLA 1SJEA 1CDBA 3RUGA 4RGMB 3QDGE 5E8DH 5C0RL 5LXGL 4UUJA 1IKFL 1GZPA 3ZE0E 1P7QA 4X4XA 1VADB 5CKGA 3VCLB 1NCAL 5DJDB 2UWEF 3W9DA 2YHGA 4X5WA 5C6TH 4GRWE 1FV1B 2ZP0T 5L8KB 4UAOC 3B6SB 3KPPA 1MCNA 3OMZA 5DRXA 4D0CB 1FZOB 5IFAL 3QCVL 3P4MA 3SGJA 4NGHL 1EHLL 4NO2A 1A1NA 1UEYA 2B5IC 3HKFA 4MQXD 5E94B 1MVUB 1I3RA 3ARFB 1RULL 3C8DA 5IBUG 2H32A 1B4JL 1NC4B 1HWHB 5IM7A 1S5IH 2PYEB 1I1RA 2JB5H 4JM4L 5IJKC 2FGWL 5D9SB 1U8HA 3WLWD 4U7KA 2A83A 4QOKE 1MQKL 1A2YA 2MOVA 1JZ3A 3BO8A 3AS0A 3D9AL 3UZQA 1EERB 3BD3A 4JFEE 4U1LB 5MI0B 4HBQA 4PGEA 4APQA 3U0WL 3WO4C 1A8JH 3QWRA 1RU9H 3D39D 3ZTJG 2YUXA 3MYZA 1CICA 1X5YA 5D7IB 1OT2A 4LOUD 1KB5H 4XPBH 1GAFH 3MRGA 1KXVC 3LKPB 2V5YA 1OTUC 4MVBD 1AD0B 1I8KB 2PUQT 3S3PA 2CKNA 4PJ5B 3CVHB 1Z9LA 3PWNA 3CFKA 2VWEE 1IKFH 3O8XB 4PTTB 1ZLUK 4MDJA 1IFHH 1SEBA 4XNQB 3MOQA 4QHLB 4NDMA 2I9LB 2C9AA 1Y18B 3SDYL 3HG1B 5F7NC 3JTSA 3S35L 5I1GH 1GGUA 3Q3GB 4K07A 3S88L 5FYKE 2X4UB 5DMGC 3FOMA 3T0AA 3AREB 1KCSL 4APQB 4S1RL 3QG7H 4DKFH 2KDGA 5GRJL 2MQ3A 1P2CA 4OIBA 4YNYA 3DWTA 3VWJD 4R8WH 5DJXB 2R2EA 3ULUF 4Y8AA 2APXA 2ZSWA 5IF0A 4HW6A 2A77H 1UWEH 4LPVA 2MSPA 5BZDA 2YD6A 3ZKXC 3ZSSA 5IMOB 1I8KA 1NCNA 2VTFA 1BWWA 1IC4L 4I13B 3UJIH 1IBGL 3SY0B 3PXHA 5IV2B 1T66C 2NY3D 3VXSE 3BQUA 5DD6B 3VXRD 4QXWA 4RAHA 4NSKB 4PJGF 4G80B 4Y5XB 2ZSVA 3OF6A 3ES6A 2BDNH 2OZ4L 3B4NA 3MUGA 3QIBB 4JJHA 4Z7QF 4F7CB 5I1LA 3ARGA 5LJYH 2IMNA 2CH8A 4AG4H 1MY7A 3H7LA 2C1PA 1J18A 1WFNA 4RMVA 3VXME 1F2XK 2HLFC 2V2XA 3QUXA 1GRWA 3TLRA 3IDIB 1BFTA 4HDIA 1RZFH 3SDYH 1SYSB 3G5VB 4QGTA 3LSOB 1OF2A 1A4KA 4M02A 5IHZA 1ZHLA 3BKML 1MCFA 3WJJA 4S11A 1TQCB 3PABA 2Z31C 1NFDE 3RU8H 5FO9A 1UACL 4S1QL 2XNAB 5CEXA 4GG6E 1X3DA 3SKJH 1QFUH 4PV9A 3M17A 5GRUH 2EE9A 2O61A 3TIDB 4BK5A 2DLGA 3CUPB 5T3XE 2P5WD 4IRZH 5K93A 4PJBA 3K3QA 1UB5B 4WEBL 1WIUA 1HI6B 1EXUB 5FYLE 1F45A 1JUFB 4G8EA 2QADB 2EH8H 4C56B 4JKWA 2GJZB 1VFOA 1HK6A 4NM8L 4NQCD 2R0LL 3U36B 3KPMA 2WWKT 5AZEH 4ZOBA 5FYJU 1I1YB 1KTDB 2VXUL 1QFWL 1HHHA 3QDHA 4FQXC 4PRAB 3ZDYF 3S4SB 5I74C 4I5BB 3EAKA 4IRSC 2V2TA 2BXZA 4X83A 5E56A 4UZGA 1A4KB 1G0DA 1HINL 2ZCKH 2NY5C 3GMPB 4BUGA 1J5OL 1A9EB 3FHAA 1ZS8B 5CD3A 2H9GA 1XCQB 4ZOEA 4JY6A 3QPXL 2DIAA 4WV1B 2FR4A 5DUBA 1LP9E 1FYTD 4GRWF 4E5XA 1OTSD 1K8DB 4ZS7L 3ZKNC 3SDXA 4PGJA 3H3BC 3EOBA 4KUCF 2CLZA 1W0WA 4ZO8A 5E8EA 1A7RH 1J0KA 3NAAH 4S1QH 1MJ8H 2CJUH 2WBJC 4HT1L 3BMWA 3SKJL 2A38A 2R0WL 2GJZA 3FFDB 3L5XH 3JWOC 1XIWD 1CGVA 1K2DB 5L2KB 4NQEB 4B7LA 1FORH 3FONB 4BH8A 4H1LB 4JRXE 4LARL 5CBEB 1LO2L 4IRJA 4JY4B 5T3ZD 3ULUC 3MNZA 4MXWL 2CKBL 4PJ5D 2IG2H 1A7PL 1BP3B 3T4AB 2OL3H 1KLUA 1S5HA 3C8KB 4Y2OA 4ODVL 1V7ML 1HQ4A 3CXDL 2JJSA 3P77A 5IIEA 4PGBA 5ESVA 4EI5D 5JUEH 3GSXB 2HFFA 3IKCA 5SX5K 3GSVB 1BFOB 2EDTA 3LN5B 3GB7A 2P43B 1IM3A 4XP6H 5IEKB 3EYUL 3WXWL 3CDGB 5IB5A 1AHWB 5J11B 2FHFA 3P2TA 4ZOAA 2ZCKL 1IEHA 4PJDA 1N8ZB 3T65B 1E4JA 3ARRA 4P3DA 1CGXA 1ACZA 3NCEB 1ZWIB 5C6TL 1J1OH 3GMNA 1UADC 4LLDA 4DUXA 3BHBB 4JKKA 1QA9A 5E8DL 3TVMA 4HFWA 4KRNA 5D7JB 2DKUA 3PP4H 3VE0A 4R9HA 5HTSA 3HUJF 3HI6H 2VN7A 3D3VD 1QLRB 3BJ91 1Z0MA 2D2OA 1MOEA 2LAGB 4M00A 2NX5B 1CN4A 3GSUA 5FDWB 3PJSB 3VGAB 3QQ9D 1WT5A 4JCMA 1CE1H 4U1GB 1EK3A 1VGKA 5H37H 3I6GA 3FFCA 2FGWH 1P6FA 2IQ9L 4MHHI 1LEKA 1T89A 3BAEH 2C3WA 4EOWL 1WAAF 1DTUA 5MP6L 3V7MA 1S7UA 4MNHB 3BW9A 3QDAA 2C3VA 5IJVA 1GGCH 1CFNA 3HNVL 3VA6A 3GSNA 3JZ7A 4N8CL 4JPVL 3FO0L 5TDOB 1WCQA 2O5XH 1D9KB 3GJFK 4OSUH 4MXWH 4KDVA 5KVFL 2FH6A 5IHUL 3S36H 4GRLA 3QPQC 3R1GL 3KPSD 4NUGL 2IBZY 3AB0B 3WDIA 4UB0L 2H2PD 3AAZA 2X4OA 4XP9L 3TO4A 2QL1A 3TZVB 1PZUB 1UH4A 3P73B 1S7VB 4QRQB 4BZ1L 5KTEH 4OT1H 5CJXC 1EUTA 2Y4SA 3SQOL 5J6HA 2NY0D 3VRLF 3O9WC 4GAGL 3RWIB 3UZVB 1J1OL 4RGNE 5IBUB 4MWFA 1U95B 1ROWA 3NZ8B 4P5TD 4CNIA 1U8MB 1NMAH 4ZO6A 5GSRB 1NEZG 3G6JA 2A9MH 4HGMA 3MRIA 1M7IA 4OGXL 1L4IA 5DRZA 1JWUB 1NC2B 3V6BR 2DYPD 4PJ8C 4GOSA 2W0LA 4JFFE 4C56D 1ZVSB 5SWSB 5ACLA 3GMLB 1P7KB 1UG9A 2VDNH 2IQ9H 3VGHA 4R8WL 3HFMH 1J0HA 5C0GA 3VRLE 4O58H 3REWB 3LKSB 4I0PA 4PJHE 1S9WB 5TGBB 4MX7A 1XIWA 5KSUA 4M62L 4NKOB 1NLDL 2VSCA 2WP3T 5IG7B 1X5XA 5JW5A 4Q9CA 3MOAH 1DP0A 3LS5H 3EIFA 5DJ0A 3UTSE 2WBKA 4F7TB 2DMBA 3CNKA 5ID1B 2COQA 1ZLWH 4X7EC 3KG5A 1QFHA 4A2LA 3NMEA 3B8SA 1JTPA 4GW1B 2OLDA 2DQDH 2OI9B 2IH3A 1BQHA 1UXSB 2CK0L 4ZTPH 1IQDA 3LKOA 2XPGB 4YWGL 3TIEA 3BKYL 4HIEA 5EIIB 1VHPA 1FO0L 1OTTC 1AR2A 3MNVB 1IAKB 1YDPA 2F53D 4H0IA 4NM4L 4URTB 3TBYA 5HSFA 3LKRA 3MLXL 4OCXL 3QXWA 4EN3D 4NQDE 1ZHBA 5HPMA 1HKLH 4FFZL 3B2VH 1YEHL 5D2NB 2P5EB 2DWEA 3BH9B 4WHYG 1AQDA 2AXHA 1Z5LB 1B3JA 1LDSA 1XIWB 5CINH 1RMFL 2OSLB 5GGVL 4KK5D 4OM0H 3P4MB 4V1DD 2OSLA 5DK2B 1TZHB 3Q1SL 2IQAA 1I1AA 3FB5B 4GKNA 5HYSB 4K8RC 3VI4E 2E7LA 3IJYA 4JREB 1BBJA 4MD0B 4CAGA 3BUYA 3WS6C 5F1OB 4G6KL 1J1XH 1K8IA 3IFOB 4LLYA 3NFPB 4WEBH 4X80H 5TJWK 4JRWA 2HAZA 1AO7A 1TPXB 3MOAL 4X7FC 5J13C 5BV7B 5DXWA 3BO8B 1HCFX 3OPZH 2YD2A 2CDFA 4PJEB 3BQUC 5KANI 3B9KC 5FV2A 2B39A 1MHHA 4Y5XC 4FZ8L 3BSZL 5D72L 4WO4D 4LASL 3IDMB 1UB6A 1A5FL 3WL9A 5LWYL 3FQNA 3HZYB 5ECJE 3SDDD 1WTLA 4GQ9L 3ZZ1A 3I2CL 2PN5A 4FTVE 4OF6A 3FMGL 4ONFL 3VU2A 4MJID 1IEAB 3VFPB 2NXZD 3DRTA 2KZ1B 2EEAA 3NABL 5DJ2B 5BMFL 1FJ1B 4XX1G 3QNYB 3KPLA 1AXSB 3VRIA 3WLBB 5FDYA 1T6WA 2H2SC 3KYOA 2WQRA 4K3GA 2FJHA 5D1XC 1FRGH 5DRXB 4D0CA 4DK6A 3C6SB 4ODTH 5I1CL 3HRZA 1Q72H 4G5ZL 5F96H 1MF2H 3X17A 3HUJE 5CIPH 5T1KA 5CINL 1FZMB 5E8PA 1KTLB 4JFDD 4K3DL 3VDBA 4ZS7H 3LEYL 4LQFL 3SE9L 1CFQB 5T1DL 2R1XA 3FT3A 2DQIL 1U8HB 5IQ7L 4ZG1A 4YR6B 3C2SA 1OSZA 2IAND 1EVTC 1BREA 2Q8BH 1D5MB 4IJ3B 4ZAKB 4GMSH 2FX9L 3ZKMC 3HAEB 3KJ6H 3L5WB 4DGVH 2HJFA 2J88L 4YHLH 4A2MA 4HWBA 1IILE 1I85C 5HI5D 1ZA6A 2P1YA 3LKPA 3D69B 1W2KT 2ZSWB 3GSOB 1X5HA 1UCBH 4N90D 1OCWL 3VGDA 3DMMB 4GUPB 5CP7A 3RWFA 3V9FA 2NY0B 1MLBB 4ONFH 4WRLA 4U7SA 4LGSB 5IBLC 5T1KB 3NBNA 5F9JB 3P3YA 2J6EA 3ZE1E 3W2DL 1RIVH 4I18C 2A2QT 1U42A 4QRUA 3BN9C 3T8XA 2X1OA 3PWUB 1F4XL 2E9IA 4PJ7B 1LEIB 3D3VE 3OKNA 5C0CB 4P59L 1F42A 4HWZB 2YZ8A 2ICCA 1CD1B 2NYYD 4N0YH 2OI9C 4PJFF 3K1KC 1RVFL 3IDXL 5L2KE 5HHNB 4S1RH 2VITB 4LNRB 1ES0A 1NBZA 4QRSA 3T0EA 1PX3A 5EC2A 5SX5H 2D7NA 4E42B 5LQBH 5GISL 4Z7VA 2P5WA 2Z0BA 4YXLL 1ORQB 1UC6A 1X7QA 2BVUA 2BZDA 1DBKL 5E99H 3X12A 1IBGH 1I9EA 4OGYH 1EEUA 3UYPA 1TJGH 2XZCH 4YFEA 1P7QD 3S3JA 2PTTB 4R7NB 2YD3A 3U46A 4M6MH 1QPPA 1UZ6E 5T3ZL 4TVPE 4PRPE 5DI8A 2H45A 2A6IB 4NZUL 5DEFA 4QWWD 3T3PE 1OHQA 5J8OA 5GRWA 3BIKB 2WIIB 1FFPB 3FO1A 2Q3AA 2APVA 2NXZB 2GTZA 1MCPH 2ED7A 3D85B 5IMKB 1QO3B 1R5VB 2IAMD 2EYTA 4JDZA 4F8TA 1RQ5A 1HHHB 1RHHB 1PZ5A 5LXGH 1Z2KA 1TXKA 5C09A 3OAZK 1ZHKA 4PYGA 1A47A 2I60H 3QUYB 5DD3H 3T0WA 5F44A 4HUNB 4X6BB 1SJVA 3PDGA 3WIFB 2EDHA 2W9EL 3S97C 1QR1A 3OR7A 4JFFD 2VXTL 3VGAC 3E0GA 1U93A 3VFWB 3BZEA 2UZYB 2OJZH 4P2OB 5DD5L 5C0FA 3MJ7B 3T77B 5TE6L 3U7YL 3RL1B 4OLWL 4M93C 4A6YH 1A1OB 4R6UA 5DUBB 3TCLA 1BQUA 3OKEB 4P2QB 3W0WA 2EO9A 5GS0D 4J4PD 1FZKB 4BQBA 1A14H 3Q6FB 4IMKA 4D9QD 4AQ1B 5IB4B 4WWKB 3MV8B 5D7LD 3L3HB 4YXKL 3OB8A 1ZT4A 4JZNA 3BXNA 3RNKB 3WHXA 2H3NB 5SWZB 4WTWA 2WIMA 1MVFA 3U0WH 1OP9A 3MBEA 3N1PC 1YPZA 5MEPA 2GTZB 4O51A 4L9DA 3LHPH 3STZB 3GMQA 1RZJH 3L6FB 1A7NL 1N4XH 1KTDA 2A74A 2VZUA 2A9NL 5FHBH 3ZLQC 5E2UL 2V9RA 2NXYB 3DIFB 3QA3A 5D7KE 2VLKB 4HIIB 1WC7B 1Y6MR 2K1MA 4HIIA 5JR1L 5F1NB 1MCRA 3BZEB 2HVKA 2O26U 4UDTA 2FIRT 1XGQB 2X4PA 4R0LC 3BKYH 3AFLA 1PG7W 4M1CD 4YE4L 2UWEA 3IDNB 2X70A 5EIQA 4KJYB 4PG9A 4LU5L 1KPVB 1BZ7A 5C0AE 3S88H 1A1MB 3QFDA 1XF5B 1YNKH 2HP4A 2GIYA 4ONHB 3BRGC 1MPAH 3P9LB 4BELD 4XNYH 3FONA 5FGRA 1EEZA 3QH3A 3E3QE 1TQBC 2EC9U 4X6EA 2AJUL 4S1SH 3KLSA 5LGJA 1QKZL 5HVFB 1S9VB 4OQTL 4JG0H 4L4JA 4KK6D 3SKOA 2HLFD 5EWIL 3VXSA 2YD5A 3MRNA 3SN6N 1T0PB 1UYWL 1XGUB 2VO5A 3DX7A 5C0BB 4BKLB 1JF1A 4ENEC 4HKXB 2GAZA 2CRMA 3GSXA 3TVMD 4J3UA 1A7NH 1CFNB 4LEXL 5IMMA 1HQ4B 2XN9A 5HI4C 2FBJH 3MCG1 1C5CL 3WFEL 3CDYA 4JANA 4JO2L 3DV6A 4FZ8H 3IDGA 5F9WB 1RUPH 2V7HA 2BVOA 5FYKL 3TEUA 3U0PA 3QIWB 4P49A 3RWDA 1BVKB 3EYUH 3WXWH 2A73B 3HA0A 1WIOA 5DVOA 1FVCB 4O5LL 4XPGH 2A73A 1RUKH 3ET9F 5I9QC 3SDCA 1WCBA 1IZJA 4DJMA 3BIBX 2ZZUT 5HI5C 5FGCB 4ELKA 2DQEH 4G6MH 1AIFB 1CR9H 2BSTB 1GIGL 4Y19B 4EIZC 4X6DB 2WWMC 5F9OL 4U6HB 4QTHB 2EYSB 4I2XB 2NY7H 3LEXA 4LIQH 4U7MA 2PW2A 5ALBL 3MRIB 4I3RL 2QQKL 3H2WA 3ZKSD 3MA9H 2EIDA 3WFDH 2F19L 5IJVB 2J8UA 5MP6H 2X4TB 1UA6H 5E2WH 3O4OB 4G43B 4JVPA 5EN2A 1CE6A 1KIRA 2ZWLT 1C08B 3CLEH 3EJYC 4NT6B 2FHCA 4QRTB 3KWWA 2BY2A 2VDLL 1SBBA 4N90E 3ESUF 4XP1L 5CGYC 4HJJH 1OGAE 1PFCA 4AEHH 3V6ZA 4MX7B 3WIHA 4DVRH 5CS7A 2X4OB 3RVXC 5T1KD 1YY8A 4NC1E 2AERT 1HE7A 1UKSA 4JFEB 1J0JA 2NXZC 1RZGA 3H42L 3RQ3A 4E41A 2GSGB 2KUTA 2QQLL 3ULVE 5DEGB 2VL5A 3LS4H 4QHNB 5GGVY 4WWKC 5HJ3A 2UYLA 1KIPB 4W4OA 3CH1B 3MFGB 1IGFH 3MV7D 4KUZH 5IGXH 5SWSE 3E6HB 3RA7H 3LKOB 4MA1B 4HEME 1TJHH 1S7SA 4KDTC 4LVHC 4I18B 4X4YB 4EBQL 1DBJH 2Y5TA 3MRKB 3T0EC 5A2IH 3ME0A 3TBTB 2AGJL 1MI5B 4BSVB 1F11A 4YBLC 1T5XA 5C8JA 3KWWB 5HPMB 1UKTA 5HYJB 1F11B 1DEEA 4I0PB 3SBWA 2D03L 1OAXH 3U0TB 4PY7B 4FHBD 1F58L 1GC1C 3QXDB 4TNWK 1RUQH 3TPKA 3FTGA 1NJ9A 2DBLH 4G6JH 3UMTA 2WLYA 1K6QH 3C5SA 2XV6B 2GUOA 4RQQB 4NC2B 2F53A 2NNAA 3SJVB 5JMOC 4LVNC 4J8RB 2XI9A 3RAJL 1BEYL 5I30H 5IFJB 4JCLA 5D5MB 3IJYB 4ODVH 3FRPA 4G8IB 3U2SB 1C12B 3V5KB 1BQHB 2H32B 4OF0A 3KGRA 3IFOA 4ESKA 2AK1H 4KZEL 3CZFA 4HWEH 1AH1A 3WN5A 3BEVA 1E6OL 4JO4H 4U3XA 4WFGE 1PJ9A 5EU4B 1KTRL 2HN7B 3WL9B 2QHRL 4J3WA 2B0SH 3ZYZA 4HG4J 4G3YL 1SEQH 2B5IB 2QQQA 3V7AG 4LBEA 2ADFH 5F97E 3OHXB 1AKJD 1E4XI 3MODL 3MRJA 1Z5LA 5E9DA 1NCBH 5C3LD 2WK2A 2Z8WC 1FL3A 3BD5A 4LP5A 5F7FA 5ABDE 5D1XB 5FUCC 5DZLA 1LP9B 3I50H 1R5IB 5DFTA 5TQ2L 3QG6A 3SO3C 1PAMA 4AL8H 3HHRB 1OP3H 3QISA 3VFMA 2NY2C 2FL5A 5D70H 1RPQA 3KS0H 1VCAA 4MD0A 4PRHD 5HHME 4CUCA 3NVQA 3QDJD 3OQ3B 1ZT1B 2I9LA 2C3HA 3GZKA 2ZCHH 1KCKA 1VEPA 2YN5A 5EU5B 4WGWB 3MBED 4UILH 4PJIA 4IOFC 1QSFA 4Q6IC 4JM2F 1FN4A 4D9RD 2ZCLH 4YFLF 1UKQA 3RDTD 4PTUB 2R29L 2R1YB 2HMID 2EYRA 4JFDA 1LO3H 5FHBL 1P7QB 4X4XB 4PJXF 3D25A 4ELMF 3ZT5A 1IEBB 5BXFA 1R0AH 1IEBA 2B0SL 3FCTB 4XTRD 2W9DH 4GW4A 1JPTL 5EOTA 5SV4A 4NQEE 2IEPA 4LU5H 3BQUB 3S3SA 4XNQA 1MRFL 4PJAB 5C0EB 4NQDA 3OKLA 3TYFA 1L7IH 3O8XA 1Y18A 5EBLA 4WDIA 5EOCJ 2FECI 1MJUL 2DQFA 2R69H 3K4DA 3PWVB 4XNYL 2GJ6D 3RTQB 4HWZA 3FN0H 2BSRA 4AJ0A 5ANMB 5F70A 1G7PA 4JY5H 2AV1A 1TTFA 4NFDA 2VC2H 4TOYL 4MB5A 2X1QA 1CD9B 3CDCA 4DQOH 2WP3O 1BLNB 4WFEE 1CGSH 1JFQH 5ISZB 1EUUA 2FJGB 4M7JL 4XCYB 2R4RH 4LPCA 3C87A 3TBVB 4WU5B 2YS4A 3V95A 3NIDF 2WSKA 3X3GL 3LV3A 2JCCA 3UAJD 1QKZH 1DL7H 3O3UN 1Q0YH 3AC0A 2E7LC 1QRNE 1JGUL 3TO2A 2FEDD 2J88H 1X6NA 1GH7A 4GUPA 1LMKA 1CQKA 4P2RA 5BXFB 1KIUA 1YYML 2HJKA 3RGVD 2XRAL 3CMOL 3LH2L 5IBTL 1EAPA 4UT9H 3BX7C 2FZ3A 2DMKA 2ZUWA 3L9RA 3KDMA 2JELH 5EC1B 1CGWA 3KLHD 1DQLH 2VLLB 35C8L 4PJCB 2GK0A 5F7UA 5GSVA 4UTAH 1G1YA 3O11B 3TJEL 4MA1C 5FUCE 1C1EL 4U6XB 4XRCB 5DR5L 1JHTB 5HVWA 2M1KA 4K3JH 4YDKH 3SKNA 1T6VN 4KTYA 4N0CD 1CD1A 5GPRA 1J5OH 4JREC 5J3HD 2A6JA 4BZ2H 3PWLA 1WICA 4JFXA 4LDOB 3U7WH 4HDIB 4R90L 1J05B 5J06A 1MJUH 1OTTD 4H20H 4P9HH 3KXFB 4TYUA 3HUJB 4PJFA 4HJGB 4YDIH 2GFBA 3F7PC 1HN1A 1YMHB 1RVFH 4LMQI 1SY6H 1NLBH 1NBZB 3ARXA 5CD3B 2BNQD 1XR9B 2YA2A 1U93B 2DLFH 2BCKB 2IWGA 2R4RL 2FRGP 3BZDA 4Y5VB 4PRDB 3IU4H 2XWBB 4OGAD 3M17B 3O41B 2QSCH 3FT2B 3PHSA 2PR4H 1DVFA 4PJ9D 4NNXB 4XP5H 1XT5A 1YMMD 4PLJC 2WWMD 5JOFA 4ELME 3MRBB 3SE3C 4GW5A 1QVOA 1W0VA 3FAWA 1LO2H 3MROA 1U8PA 1R3HA 3G08B 1FNSL 2IG2L 3Q48A 3RBGA 4B0MM 4KTEH 4M6OL 4Q9RH 3LRSA 4HJJL 4A6YA 2R2HB 4AZ8A 5B22A 1P1ZA 1MCWM 2AK4D 4POYA 4OZGF 1JN6B 5F1SA 4OCSH 3OAYH 1JGLH 2EECA 4Y4KC 5GRYA 2NXYD 4Z7NF 3SPVB 3QB7C 4MD4A 1QR1B 2X7LA 5DF0A 2E8ZA 5E7FA 1HEZB 3DXAA 4I48A 1KBGL 4LCYB 1A9EA 2VLJE 4G8FB 5JDSB 5C9KA 4GQPH 4PP2A 5HGGS 3VFOA 5D6CA 1S7TB 1VERA 4XMPH 5BZWB 4OZIE 3NTCH 4S1DD 4G42B 5A16B 1RUQL 2X70B 4AEFA 4NRXB 1UFUA 4OZGB 3BP7A 4OQ1A 1JNNL 3SE8H 3IU3A 4JQXA 3L3HA 4IDLA 3MLTB 5IKCA 1NBQA 4FRWA 3U36A 2YSSA 2DJUA 2IPTH 4I0KA 4U1IB 4PB9L 4RRPA 4WVRA 3MUHL 2M26A 5BRZD 5JZ7C 4OV5A 3CFBA 5EG6C 3AB0C 2P46B 3QHZH 5FXCH 4PRID 5F6HJ 1CCZA 4MA7H 5FA3A 5I1DA 2EE2A 1EMTL 4U6VH 1MSPA 1L9NA 4N0FB 2P49B 3QUYD 4BFBD 3GMPA 2OS7A 4BSWA 4W70A 1D5IH 1ZMYA 2B1AH 1F5WA 1JZ6A 1EO8L 3OR6A 1CT8B 4TQEH 2ORBH 1DE4B 3V0AC 3IDGB 2R4SL 4I77H 2BSED 2VDQL 5C07B 4ZDHA 3NN8A 1LEGB 4ZUVA 2BVOB 4XB8A 3U0PB 4CU6A 3PWPB 3IDNA 4I4WA 2GYSA 3HNTL 1PLGL 1X4ZA 2B7DT 4PG9B 2VERN 4HKBB 1BD2E 2X09A 4K7PY 4JO3H 3MLSL 2CD0A 1ZKAA 2ZNWA 4JFZH 4YDLB 1NCBL 5L2KA 1G7IA 3DURB 1PX4A 4QRPD 3RUGE 1B90A 3PGCA 4FN0A 4Z7WB 1T03L 4LLVA 4NZRH 4HMEA 4QTHA 4CMMA 3ZDZE 3JSSA 4NFBA 4EQ2A 2FJFA 3JV6B 2BP3A 2AKRB 1X44A 2EEBA 2E6QA 2AJUH 5EO0B 1MQKH 4YPGB 4KGJA 1C7SA 4F2MA 3DRQB 1RJZB 4OF3A 5GZNC 1DBKH 1OVZA 1MAML 5IHBA 3UJIL 1U8LA 3ULVF 1FC1A 5L2JA 1CXFA 3O2DA 2YPLE 4NZJA 4U6YA 3TA3A 4YHKL 5C0CD 4PS4L 4PJBF 3O3BA 4ISVA 4NBXB 1A4JB 1CLYH 3OB0H 4FQQA 3GHBL 2BDNL 2OZ4H 1KC5L 5BJTA 2ICWA 3EO0B 4PY8I 1U8NB 4PJIE 2QV2A 1QSFE 1S78C 2FX7L 2VAAB 1U91B 2R4SH 4I77L 4POUB 4S10A 2P5ED 1S8DA 1KFAH 4PBWD 5I2IA 3DYPA 4Z7WA 5CEZH 5JXEC 1OP3K 5J6GA 1J12A 1OSPH 5EUKB 4WI9A 4E41B 3SGKA 2F8XC 2X1PA 3O3EB 1ETZB 4BYHA 4MA8H 1FH5L 4LKCA 4HQQH 4M6NL 2GJ6E 3OTTA 1FNEB 1LEKB 3HB3C 3RWGB 2Q6WB 5TE6H 3QUZD 4H0HB 4Z95L 1BVZA 3SEPA 4ZPTB 3RWEB 2WUCH 4NZRL 5SWQA 3RVWC 1MUJB 3SOBL 4Z7UA 4NO5A 3RU8L 2Z35B 4OZ4A 3EHBC 5HHOE 1VA9A 3F7RA 2EDYA 4FQ2H 5EN2B 3T2PA 3ZMRA 1ORSB 4HMCA 3X3GH 5FO7B 4LCWE 3FB6B 3UTTB 4NRYB 2BSSB 4L29A 1DJSA 1CF8H 2Z8SA 2O93L 1OWRM 1WISA 1UWEL 4TNVK 5GRZA 2BVPA 4LVOB 1MAJA 4X8JA 5AYUH 5JPNB 4OI8A 1N5AA 1KXQE 2YEZA 3I02B 3RVUC 1N5AB 4OCLC 2FSEB 5DJAB 4O2EA 1Q0YL 4FFVC 1A6AB 3O8XD 2X89A 3UTQA 2HT3C 2RBLA 3ARZA 1OP5H 4R7DA 5K59F 1JYVA 3VI4F 4RQQA 5D2NE 3GJFA 3RWIA 1E27A 3G04B 1DFBL 5D1ZA 3R8BB 1U95A 1I8IA 3DETD 5DLML 4EUPA 3V6FA 4GS7C 3DTXB 4HCRA 2W60A 3UP1A 1R24B 5D1QA 5HHMB 4LL9A 1SMOA 2YK1H 4MLSA 1IC7H 3ISWA 5D1QB 4YE4H 4YLQT 4Y16C 4MXVF 1WF5A 4UI2A 3WNOA 1CLOH 4XGZB 5B38B 4DW2L 1FFOA 4YBHA 5GGTL 2AEQL 2HVJB 4NN7B 4DCQA 4JGJA 1BFVH 5SWZD 1A3LL 1B0RB 4LLMB 4MS8C 2VIRB 1DBJL 3P4NB 2CQVA 1HHGB 4ZXBA 5CJ8A 1CGYA 2AGJH 3CZJA 2RR3A 1NGZA 1S7XA 4GG8B 3MO1B 3TPUB 3HR6A 1S7QB 2VOTA 4MNGA 1YA5A 3WD5H 1JHLL 4QRPA 2QSCL 5EUOB 1HHIA 5E1AB 1NJ9B 3UJTH 1YMME 4Z7UF 5DC9B 4MJ6B 3V4PH 4PGCA 3ARDB 3HNSH 4G8GB 5DFWH 5CWSA 1QLFA 2GTWA 1DN0B 2VLME 3VGBA 2HH0H 3OJMB 5I30L 5AZEL 3KYMA 43CAB 1YNLL 4NKIH 1LE9B 4GBXA 3LKNB 2OR7A 3K8KA 2QSQA 4OCMC 3WUWA 1UB6B 5I6XC 3TBYB 2WUBL 4K9EH 1KOAA 1QSVA 2Y23A 1H8OA 2HYMA 3AM8C 4OZIB 3VXNA 1YYLH 3GI8H 1GOHA 4FXGA 4UBDD 3OAUH 1CICD 2YBRA 1CWVA 1KCUH 2VIRA 1MCSA 1AI1L 2HJLA 3FB8B 5HGBB 1OAZH 4FQCH 4RMRA 1PY4A 1JGLL 3ARUA 3BN9D 4BUHA 3DMMA 2VABA 2APFA 4OAWB 1INEH 2VMFA 2LVEA 2IANB 3QUMB 5ELIA 4OZIF 2YRLA 3ARFA 2BOBB 1WTGT 1QYGH 3PWVA 5I1EL 4JRYE 4XNUL 3WD5L 1NAMH 3UBXI 4WDIB 4HUWB 4XVTL 3MBXL 1T83C 1T2QL 1CBVH 1OSZB 4XBEH 3BZ4A 1UVQB 2OQJB 5CEYB 5BRZE 1N0LA 2W65A 3T09A 1NMCB 2R56L 4BFEA 1CDHA 4NYLB 3VD3A 3BIAX 2P8LB 4FXGB 4K7FA 1U6AL 1RSFA 1OAQH 5FF6A 4IJ3C 4TRPH 4UILL 1PW3A 3DVNA 4RMUA 3RVVC 3L5JA 4RDQG 1FN4B 1U58B 3BPNB 3MUJA 5LVEA 1A7OL 1WV7T 2JK5A 3SDAD 5CLWA 1EO8H 4P2RD 2ORBL 4KXZH 1KCVL 1AQKH 4UV7H 2G5BA 3SY0A 1TIUA 4E41D 3L7EB 2BOCA 3KNBB 1OAZL 3SBWC 3HNTH 2WNGA 1N64H 3CVHA 2W0FA 4WI7A 3ZDZF 1BD2D 2X89D 2F15A 2PKDA 3G5YA 4MAUL 3S37L 1BJ1J 2A6IA 1CFQA 3H9ZA 3GGWB 3VWJA 1D7FA 2EIBA 5KZCB 5C0IA 2HA1A 3Q3GA 4PJDE 1DUZA 2QSTA 3QUXB 3GSQB 5D93B 3GUTB 3SO5A 4I2XE 1WZMA 3PWLB 5IROA 2D7TH 1KG0A 4K8RL 2JCCB 2BNRA 1H0DA 3S34L 4CN6A 4FG6D 1D3CA 4X6BA 1IJ9A 3NCJH 2VLRE 3OJ2C 4JZOB 1QHPA 3VWKD 4KI5C 3WIIH 4LRIA 4P5KA 1A14L 2YPLD 1OAQL 2H26A 4U1KA 1DQMH 4JKPH 3EW3B 3RIAF 4GKZB 3R8QA 2O5ZL 4U1KB 1MJ7L 1KPUB 1WIPA 1KSRA 2RFXA 4B41A 4P3CH 1S9XA 1XZ0A 5JLZB 1I8MA 4EDWH 2AJVL 4OLZL 5EOCH 2A9NH 5TH2B 1NKRA 2P5EE 4YWGH 1BIHA 3P4OB 4FQHA 4IHOB 4UTAL 4XAWL 4JFFA 2C4XA 3D39A 4HSQA 3REVA 3RRQA 4DTGL 4EN3C 5HHXL 2Y1VA 5D7IF 3N50A 1UWGH 5I75B 1S7RA 3D87B 3T04D 4ODSH 5DS8A 5D6DC 5JA8B 3LQAL 3IXAA 4U05A 1RZFL 4UQ3A 2OR9L 2VITA 4LNRA 2EDNA 3C9NA 3F7VA 5KSBB 3L95A 4PPTA 3T0VA 2YPKA 1AXTL 1VSCA 3PNWA 3TA3C 1MAKA 2EO1A 5KJRH 1WZ1H 3E1F1 4H8WL 2D7TL 4PJAF 4Y19E 1SY6L 1OM3H 1P9MC 3Q1SH 2GJ6A 5E95B 4NKMB 3ZE1F 1AC6A 1I9IH 3QQ9C 4KVNH 4CVUA 4R97C 5JXAL 2G9HA 1ZLSL 4KJYA 3RZCB 3W0WB 3ILQD 4LFHD 3RVXD 4FQXA 2PR4L 4MB4A 1HI6A 5ITBH 3F58H 5I17A 3A67H 4PJXE 3UYOD 1ED3B 1TZIA 5EWIH 4EUPG 4Q2ZB 3LQMA 1L9MA 2F9BT 4Y2DD 3FB7A 3BSZH 4KTEL 5B4MC 5KSVB 2WM0A 1CIUA 3RDTA 4HKJB 5I8KH 1WGOA 2JJWA 4PP1D 4OD2A 4PRHB 3JTTB 4BH7A 3BN3B 3NABH 1MFNA 1A0QH 3F7VB 4K94C 1T1XA 4DW2H 3R06B 1FRGL 4ORGA 1A3LH 1TQBB 4UDTB 1K5NA 1UH3A 2K7PA 4KTDL 3F65A 2NZ9D 3HLAB 4LGRB 5DD1L 4F7EA 4X6CA 5GGRB 3C5JB 1K8DA 4ZUUA 3MRLA 2ADIB 4MAYB 4HKZB 1FVDA 4FQXB 1BFVL 3FAXA 3KXFE 3MRLB 2VC2L 1W0WB 5BQ7B 3QXAA 3TM6A 4GLRI 4HKBA 4JFPB 3FJTA 2D7MA 2EDRA 3RWHB 3O0RL 5JXAH 2ZKHH 1MFAL 4Z78B 4N8VB 3HNSL 2IPKA 2IFFL 4LP4A 3EFDH 4AK1A 3TT1H 5C9JA 4HKJA 1XH3B 4EQ3A 4F9LA 2VLKE 4C4KO 3A67L 1VKXB 2AXFA 3RWCA 4XCCL 4HK3N 4OCNC 3IYLW 3D6GA 1H3XA 1Q9LA 1YMMA 2ICWI 3K74B 2WUBH 4GBXD 2HWZL 4M3JA 2WBJB 3S5LA 3DECA 4G43A 5KVGH 3MJ8A 5I8KL 4RGNC 5LAXB 4GRLB 4F7PB 3OJVC 4CDGC 3H9SE 3D39E 4TQEL 3HR5A 4LSPL 2YXFA 4XCEA 3W2DH 2ERJC 4PJHF 4NJAL 4WV1C 1AJ7L 2LTQB 5I8EA 4OM1H 4N9GB 1RK0B 2MTPA 2PYFB 2GKIA 1IGFL 4KUZL 5IGXL 1INEL 3VXRB 12E8H 5L6YH 3MA7B 4Y4KB 1EEZB 3QH3B 3O4OC 3RPIB 3F5WB 4XWOC 1AIFA 1U3HD 1SYVB 1PQZA 4YHIB 4GG6A 1FNEA 2AEPH 4EBQH 2NLJB 3OKOB 4WW2B 1P84J 1OGAB 4OCRL 1NDGB 3PJSA 4ZQKA 3V2AR 3VFGL 2R39A 2Z4QB 5FA4B 3T0BA 3R0NA 2VZSA 4F2MB 5HYSG 4JLRB 4HV8B 2CR6A 2D03H 5EDXA 2FX9H 1RJCA 2J12B 1CK0L 2XXCB 4M9OA 3FT4A 1CVSC 1GOGA 1F6LL 1YEKL 4XBEL 3ZO0A 1BPVA 4WHYH 3C6LB 4FS0A 4RISH 1CZ8L 3NFSL 1UJ3C 4ENED 3BP5B 4KRPC 4ISVB 3PWPD 2IC2A 3QO0B 4HD9A 2FYYA 3GSRA 5T5NF 4C83B 3FZUD 5C2BL 5L9DH 3TESA 1XF4B 2LU7A 3PGDB 1T22A 1T1WA 5GRVL 2PXYB 3DV4A 2W91A 3HZVA 5D1ZB 2JJSC 2LU3A 1TJIL 3H9SB 2G60L 4EUPB 3LZFH 1KFAL 4U1NA 5E8OA 5DSCB 2ESVD 2DQCH 3MMEB 2ITCA 3E2HC 3CZFB 3MNVA 4F7MB 3WJLC 4L9LC 2H8PB 3LN4A 2GI7A 2HG5B 5J3HC 3KPQA 1MIEL 4EI6B 3VFGH 4AEEA 3CFDA 3V5DB 3VH8B 5FO7A 2X1XR 3QG7L 4DKFL 4LBEB 4M7KL 5IK3A 1PSKH 4PRNB 3U0TA 4TUOB 3S9DB 5D70L 5HD8D 1DEEB 2P24A 1CXLA 3QUYC 2WAHA 1J11A 1B9ZA 1F3DJ 4YHOL 2WANA 3V8CA 4HS3A 3WSQL 4F7TA 3K80A 2PXYA 3OF6D 1DUYB 4NUJB 2V9TA 2VKWA 1TCMA 1I85A 1G7JB 2OJEA 1OAYL 4K71C 3QJHA 2AJVH 4OLZH 4G8IA 3U2SA 5D4QA 3ARDC 4ZS6C 3LQZA 4PP1C 2C4FU 4M5ZH 4PJ9A 1D5IL 5CBAA 2CDFB 1T3FA 2OL3B 3UTZA 1TTGA 1EO7A 4LHUB 1MHPL 1NFDA 1NGQL 1FZJA 2CK0H 3OXSB 1XCTA 4HPYL 4X5XB 5T1LA 1M6OA 4KKLD 3ZKND 4X99A 1WAAE 4S1DC 4NN6B 5E0QA 3MNWB 1RZ7H 3EO1A 1FNGA 2EDXA 1IC7L 2ZG2A 5LGKA 1NGXB 3WFCL 1OGTA 1JPST 2Y7QB 3P0YL 3QNYA 1EEYB 2W07A 3MLSH 2YWZA 1AY1L 2AEQH 4YK4B 1BIIB 3PHOB 2BC4A 2VL4A 4R96B 4Y19D 3PE9A 3EOAA 4A6YL 5DJDA 5KVEH 1AO7D 4FXKB 4YFLI 3BE1L 1P4BL 3B5HA 4CKVX 5GGVH 2BHZA 2FL5B 4OM0L 3QCTL 5DHVB 3V6OE 1S78D 1BECA 1HHKB 3WMSA 1VPOL 1YEFL 5D5MA 1U36A 4PJ7F 1QSED 2DBJA 2Y72A 3NFPA 4ZTOH 2MQCA 4OI7A 2C26A 2CUMA 3BUYB 5CJOL 3KLAB 1UYWH 2OL3A 4QHKJ 2XTJC 1A2YB 4KV5F 5I0ZA 1G7LB 4TN9A 5F7KC 4F9PA 3B9KA 1A6WH 4X80L 4F33A 1OAYH 3ECBB 3SE4A 5TF0A 1P4IH 2P7TA 4KY1L 1JIBA 3ALWA 5DT1L 3WUWB 5GGQL 5FM8A 3WFEH 1AE6L 2FCBA 5IESL 1KC5H 5JQHC 3UCRA 5KN5B 2ZUQB 4NCC2 4FQJL 3QUZA 5DUML 1NGPH 1DCLA 3PQYE 4ODBD