4Y1AD

Immune complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
205
Chain Sequence
MQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASSSAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD02
1TZHB 2D2OA 2H26A 3J8F7 5DI8B 4XWGL 3RTQB 3QUXC 2Y9RT 3PG2A 4NHCL 1LK2A 3O9WC 4I3RL 4PB9L 2J7LA 2A1WL 1VADA 5F96L 2WP3T 1D3CA 1Z6JT 2D0GA 3QDME 2XY2A 3G5VA 5KVFL 2P7TA 3H0TB 3LN4A 2GJ6A 4YFLF 5JUEL 3F7QA 4YBLC 3UYOD 5AAWA 3MLSL 3I6LD 2L0DA 5E9DA 5DYOB 4JY6B 3WFZA 3CZFA 3ZE2F 1C7SA 3TWCL 3IAGC 1S7UB 4CAGA 1PJ9A 4KK9C 1B0RA 4M5YL 4MSWB 4X8XA 2D0FA 3W9DA 4PRHB 1TPXC 2WINB 5E8EA 1B6UA 1X7QA 4G80A 3IRZA 5F72S 4OGYH 1DL7H 4JZNA 4QRTB 4F15C 2NY3D 4LL9A 5J1TC 2X1WL 3AM8C 1DVFB 2BX5A 3MMEA 3K0WA 3SDYL 2VLRA 3HZMA 5SWZA 2C3VA 2ORBH 4LMQI 4ENEC 3REWA 1FL6B 5BW7A 3C60D 4XC1L 3VGAC 5BVJB 1OTSC 2B4CL 4NQCD 4EUPH 2YD9A 3CFJA 1A14H 1R24B 4H1LB 1I7ZB 1EXUB 1WWBX 3VWKB 3PP4L 5HDBF 3X17A 1W72L 4AEHL 2C1OA 4WFEE 1DP0A 4S2SA 1O5DT 1K4CB 4EI5B 3QAZB 3V7AG 1P7QA 3O2WH 1ZA6B 4C56D 3S88L 2IPTH 1EK3A 3TP4A 2GFBB 3ZE0F 1OLLA 2R23B 3LEXB 1AGEB 1ETZB 1WT5A 1JK8A 3JWOL 4PRBA 2O5XL 1WFNA 3ZDXE 4LLUB 4K3JL 1TQCB 4Q9BA 1MI5D 3H3BC 3GI9H 1CXEA 2AJUL 2XN9D 2ERJB 3EYOA 2BVTA 4YO0A 3DUUB 2BNUB 2X2YA 2VDQH 4NO3B 3QXAB 3O45B 1J7VR 5JIKA 3RGVA 4HF5H 3WEXB 1OAQH 2W0LA 4JZOA 4YBQC 1N4XL 3W0WA 1CE1H 2FEDD 2F19L 3KXFE 4YC2B 3SEPA 4G8EB 5A43C 2ENYA 2B0SL 4GG8A 2X7LB 2HG5A 3GMRB 4LCYB 4M48H 5DGQA 4WEUD 4U1LA 4PY7A 2XWTB 2F58L 4GW1A 4EN3C 3QUZB 5T33L 3MLSH 1UQSA 4H8WL 1BIIA 2FX7L 5HY9B 3F7PC 4JPIB 4ORZC 5J6HA 4B0MM 3QDJE 3UJTL 5L2KB 3V5HB 2JLLA 4OLWL 3EOTL 4BELD 4E42B 4XPTH 3VD7A 3MZGB 1VFMA 4GAJH 5MEOB 2YKLH 2NW3A 1TVHA 3GM0A 2Q7YB 1JNHA 6FABL 1Y18A 3OWEA 4MDIA 3O2VL 4HUUB 5HHOD 4Y16B 3NA4A 4F9PA 1CXFA 3MLRH 1X3DA 1A2YA 4PJ8D 2BRRL 1LK2B 5IFJA 4U1GB 5SX5H 4ZSOE 1SJEB 1VADB 3EUUA 4XX1E 4LLWB 1QUNA 3G5VB 5DDHA 2BC4A 4OJFH 1NFDE 1PYWA 4Q6YA 1E28A 4J6RH 5B4MD 2IFFL 1OGAB 4NKMA 1KOAA 5GJTH 3CLFL 1FN4A 1M71A 3IKKA 1EMTL 5DVKA 1BD2E 1F90H 2OQJA 3BP7A 3LHPH 3P9WB 2DAVA 2WIMA 4YHKH 3W9DB 5IB1A 2O61B 5E8EB 1NAKL 1UYWL 4GRWB 5FYJL 3PQYA 1OP9A 2I07A 4G80B 2DQFA 1OM3L 1B2WH 1T2JA 2F53A 1UM5L 3WJLA 1TJGH 1UB5B 4BFIB 3KLHD 2R1XA 3EO9H 3JWOH 1KCLA 1JRHL 2VLRB 2O5XH 5C0BA 1LDPL 1HNFA 3MV7A 2IJ0C 3REWB 2KKQA 3EOAB 5J6GB 1YQVL 3TBSB 2BNQB 3PL6D 4YFLI 4H26A 4Y4FA 4ODSH 1IGCH 2BSSA 2NY0C 2HT2C 3NIGF 5I16B 1N4XH 3I3BA 2YEZA 1G7PA 4XBPA 4S2SB 4CDGC 2Q86A 1CXIA 1NL0L 4JM4L 4MXVF 4NNPL 3UTOA 4U0RB 2Q76A 2LTQB 2W9LA 4UI2A 3PDOA 4D9RD 1A7PL 5C0AA 3CFBA 3ARVA 2DQIH 2F58H 3L9RA 2YD7A 2Z92A 4NQVB 1ZGLB 5CSBA 3K1DA 4PRBB 2VZOA 3H9SB 3U4AA 2FX9L 3MCG1 4FHBD 4WUKL 3PWPA 4WO4D 4M6MH 4OV5A 1J9CT 2MPAH 4UAOC 3VWJA 3EOTH 1KG0B 1JWSB 1FO0A 3NPZB 4LSPH 1FGVL 4YO0B 3UTTD 1TCMA 3KPRE 3VU2A 5IG7A 3KPLB 1ZA3A 3L5IA 1VEPA 4LKCB 2W9EL 3RGVB 5AEAA 1FFOA 1P84K 1IBGH 4KJPC 3BDXA 2E7LA 2J4WL 3W0WB 1EUTA 2G60L 2A0LD 2GK2A 2PO6A 4PJIF 5ESAB 1Z0MA 4NNYB 3BWAA 4GG8B 2HG5B 2P47B 2JCCF 2CMRH 4KKLC 4B7IA 5D2NB 4X80H 5F7MC 4YHYB 4JFXB 4PY7B 4MYWB 4GW1B 4JFZL 2X44D 3PGDA 4NWTH 3CLFH 1R3IL 5DJCB 1FZOB 4MNGB 1J11A 4XP9L 3HUJE 5E6ZA 2DJ4A 3CVHL 2QADB 5HHPA 5DA4A 4ZUVB 4PGCB 5TE7H 3S34H 4X99B 5EWIH 2Y5TA 4M8VA 1Y18B 5C86A 4WFHE 3TVMD 3ULVF 4WWKA 1NAKH 1UYWH 2YD4A 1OM3H 2KQNA 1X5XA 1XIWA 3T3PF 3JV4A 5FA4A 4RA0C 1QFUH 5I76A 5KS9A 1AXSA 3MA7B 3OG6B 2D3VA 5ECJE 4JFOA 1IZKA 3G5XA 5GRVL 1WC7A 2PYEB 2IH3A 3CLEL 4CN1A 1E28B 4UOJA 4WI7A 5F7DA 5DC9B 4NKMB 3FQUB 2A9MH 2K1MA 2VDKH 5ID0A 5IF0B 2LFGA 5SWSD 1KBGL 5D9SA 3SCMD 1SEQH 3GMOA 1KTLA 4Y1AA 3VXME 4HGMA 3ZDYF 4BH8B 4OUUA 1A9EA 4QRRA 3CFDA 1IM9A 4H5SB 4P46C 4UTBL 5EU7E 1MREH 2N7BA 5FYKU 5IK3B 1XGTA 4ORGA 4LARL 2V7HA 4YH6A 5FYKE 2VLME 1QFWI 4OBRA 4C57C 1CR9H 3MJ8B 1T66D 2CIKA 2ZUQB 4WFGD 1DQQA 1U8KA 2XZCL 4BA8A 5HHME 2ESVB 2K3TA 3G6DH 2XQYK 1RIVH 1JF1B 1JGEA 4Y19A 4G42A 3H3PH 4X5WA 3UZVB 1J1PL 3CDCA 1YC7A 3O6FD 4J23A 5E03A 4YDJB 1GPOL 1U93A 2JJTA 4YEFA 3NAAL 1DBML 4TRPL 4YHNB 1IAIH 1EO7A 1BOGA 4YXHL 2V5SA 4Y4FB 4LCUA 1UENA 4LPYA 3TYGH 2YEZB 15C8H 3CXDH 4U1NA 3GMNB 4XBPB 1RZIB 3RKPA 1AJ7L 2Q86B 4G9FA 1JL8A 3RRQA 2B7DT 4HLJA 1WAAA 3JTSA 4R0LC 1QSED 4ZDHA 1KLUA 3P4LA 1CVSC 5C0AB 2BY1A 3CFBB 1TNNA 3LMJH 4K7FA 2FL5A 2YBRB 4HS8L 5C0IB 2X70A 1ACYH 3DXAA 3B2UC 1L7IH 4OV5B 5D6CA 1JN6B 4XP9H 3KR3L 5DTFA 1FO0B 3VFMA 1M6OB 1ORSA 2VDMH 1FC1A 3MRMA 3WS6A 5J13C 1D5IL 4Z77A 1FFOB 4OIBA 4G7VH 5IBUG 3SJVB 2P5WD 2D7OA 4K2UL 1KIPA 1UVQA 2YPVL 1KELL 4S10A 2GKIA 3QCVL 5DUPL 2BOCA 4IOIB 4Z7VA 3BWAB 3GIZH 4GBXB 5ALCH 2RB8A 3L95A 1YQ2A 1N7MH 4MA7H 5EU6D 2EO1A 3ARFD 4UV4L 3TCXA 4RIRB 3RWHB 2O5YH 2WWMC 4L29B 3Q3GB 1CD8A 2ZPKL 3AS0A 1IT9H 4L8CA 3HPJA 1QVOB 1U8MA 4ODTH 4F8TA 1MHPH 5HD8C 4JRYA 5E5RB 4ZXBD 2G5RA 3QYCA 3BRFA 1WWWX 2RHEA 3M8OH 4DZ8B 3WFDL 4QOKD 1FAIL 4PY8I 3P4MA 4FFYL 4LCIL 2Z31B 2ILLA 1QYGL 1FH5L 3QNYA 2X40A 3SDXE 4WWKB 1R5WA 4NO2A 4OTXL 4O2CB 4LLQB 4K9EH 2CDFA 3OG4B 4UBDC 1XIWB 5FA4B 1VKXA 5JQHC 3GDBA 2EEBA 5GZOC 1PZ5A 1AXSB 3HAEH 4KU1A 3LQAH 4R96B 2ARWA 1BZ9A 2VUYA 3RTQD 1WC7B 2PXYA 2ZCKL 2XFXA 2IH3B 3CU7A 5JTWA 1OQXA 3GSOA 1OPGH 3FRPA 3K3QA 2A9NL 1JV5B 1N59A 5F7DB 3IAPA 2B1AL 4P49A 5I1EH 4M61B 2H6PA 1FLRH 1A5FL 4TRPH 2Z4QA 4TNVF 5D9SB 1I1YA 2HWZH 4YXHH 3GMOB 1KTLB 3QSKB 4NCC1 1BIHA 2EIZA 5D7LE 5IVXF 5ESVA 3MRIA 2M2DA 4GLRI 1IM9B 5BQ7A 1IAIM 4Z95L 4BH7A 3NH7H 1TLKA 1WEJL 1NLDL 1XGTB 2GK0A 4ORGB 2C3XA 4DTGL 2V7HB 2Z8RA 2WK2A 1W0VA 3EDFA 5E1HB 1E4XH 4JKLA 3NBNA 2CIKB 2VXQH 4GG6A 5IHUL 1PG7W 1EPFA 4OIIL 2CSPA 3WFHA 5B8CA 1LO5A 1OQOA 2VNCA 5I8EA 4Y19B 4G42B 4PRHD 4X5WB 5JOPD 5E8PA 1CFNA 2DQEL 3BE1L 1T89A 1RUAH 4IOSD 5DFTA 5E99L 1SVCP 1PG7H 1U93B 2BXZA 4RFEA 1OB1B 1DVFD 5FV1L 1LE9A 3N85L 4POZD 2E7BA 5E95B 3OKEA 1ND0B 1ZKAA 2D9QB 4JGUA 2H2SC 4C4KT 3I02A 1Y0LB 4OLUH 5J11B 4EUPA 1WGOA 4M43L 3V6OA 2QHRH 4G9FB 4D0BA 4JJHA 5CSGA 3B5HA 3QCVH 4JCLA 3HR5A 5EG6C 4IHOB 1CDCA 1WICA 4L9DA 4YDIL 4MZ3A 3ULUH 4ZDHB 1I3UA 1QQDA 3VWKD 2F15A 5E2WL 1MFAH 3SE3C 2VDRL 2B39A 3H3KA 4RNRB 1KLUB 2V5YA 4MAYC 2OTUA 5FGCB 3WIHL 2NY2D 5KSAC 4XXDA 5C71A 4JJ5B 2H3NA 4JVWA 3QFJA 4EI5D 5GS0C 4F57L 1NJ9A 2X70B 3CC5B 3DXAB 1C5DB 3MLVL 5DD3H 5DTFB 2Y5EA 8CGTA 5MHSE 1AFVL 4Z78B 1EV2E 1OP5H 4LCCA 1NCWL 3L3JB 5IJVA 3MRMB 3FJTA 3W5NA 5TQ0L 4BQBA 4Z77B 5DJAA 4JFQB 5T3XD 5EDXA 1JWUB 2BNRB 2ZSWA 1ZS8A 4QHMA 4W68A 4MJIE 5H37G 2HVKB 1KIPB 4XMPL 3QQ4A 5E8NB 1UVQB 1BFSA 1EGJL 4NFBA 4X6DB 2NZ9C 5EO9A 2BOCB 3SDCC 3HI6L 1BJ8A 3RVVC 2IANA 2UUDK 4JFDA 5CCKH 3U7WH 1FL5A 2P42B 2R56L 1GHFL 4NHUA 5I9QC 1N26A 4Y2OA 3FQRB 1A5FH 5B38B 1GGTA 3HPJB 1U8MB 5J12C 5E6IC 1EZVX 3TIDA 3QUZD 3WS3B 3TV3H 1BOYA 3C8DA 3RUGF 4ZD3H 1F2XK 4RAUB 1WEJH 4PD4K 5I74B 3UROR 2R15A 3SOBH 3IF1B 3GSVA 5DRNA 5TE4L 2O5ZH 5L2KD 1R5WB 4KDVA 5JOFB 2VITA 3UP1A 2ZSVA 3EJZC 1JZ4A 3SDAA 3TJHC 1VGKB 1A9BA 1PZ5B 2Q6WA 3WV0A 3MJ9H 1YY9C 4XCEA 4ZS6C 1BZ9B 1F4HA 4F7TA 1EEYB 3SE9H 1QBML 3GSOB 1KV3A 5EOQH 1Q9LA 2H9GA 2YOCA 2VQTA 1I1YB 1QBLL 2CXKA 4P3WA 4Y5VA 5EFIB 2EIZB 3TO4B 3S8WA 3L5XL 5ESVB 2GJ6D 4NIKB 4OUOA 2FHCA 4HKZB 5KN5A 3V4UH 1OGAD 3NIFF 3ME0A 5BS0B 3KAAA 4WW2B 2X1OA 5F9OL 4OD1H 4O5LH 4HAFA 3GZKA 3UYRL 4R97B 3V8OA 3FN9A 4HCRL 5GJSL 4MA8H 1F3JA 3QXVA 4GG6B 4I3GA 2VDRH 4XP1L 4PBWD 1A4JB 4M1DL 3WFHB 3WIHH 1UADC 5B8CB 4IRSC 5I8EB 3ABZA 4KUZL 4YNYA 4JO4L 4LVOB 5BCAA 1HH6B 4JFYA 1N5AB 1ZHKA 2NTFA 4WCYL 2OK0L 4XBGA 2R69H 5EORL 1AFVH 5F88B 5HHXL 3TESA 3CDYA 1C12A 3F7VB 1UKQA 1LE9B 4DOHE 4MAUL 2VLRD 5HYEA 3OKEB 4HK3J 3C2AL 3B5GA 1S7TB 2DLIA 3EZJB 4ZAKC 3I02B 2FLBT 1YMMB 2IEPA 4U1MB 1P2CA 2CDGA 3QI9C 2BNQD 4D0BB 3F5WA 3KYOA 3WNLA 2DS4A 2O93L 2NY7H 3HI6H 3HR5B 4MQSB 1LGVA 1ROWA 4OLYL 4ZQKB 5KOVC 2FGWL 1G7LB 2R56H 2OTUB 5HGBA 2X5PA 4XP4L 3PNWB 4H88L 3LS4H 1AP2A 3TM6A 1P7QD 5CZXD 1NJ9B 5ICZA 2DDQL 2CLZA 1M1SA 4O4YL 5BV7C 3O41A 3MRCA 4Z18A 1NMCC 1TTFA 2BY2A 4C59B 2IMNA 3OKYA 1KTDA 1Z0NA 3IGAA 5IJVB 1RFDL 4OCSL 1U95B 5DMKA 2HAZA 3P9LB 4U1IB 2YK1H 1ZS8B 1N64L 4WUUE 1JZ7A 4OB5L 4KKCC 1NFDF 2YRLA 3FQTA 3B83A 5EUOB 1AR2A 3OZ9H 5EBLB 1U3HC 4HIXH 3RGVD 4EQ2A 4ZUUA 3B8YA 4NCDA 3AREB 4JFDB 4JHWL 3W0WD 3TZVA 4PGDB 3OR6A 43C9A 4PJBE 2R4RL 4NHUB 5ERWA 3O3EB 2NY1D 1MCOL 1RK1A 3KYNB 3DSFL 1NUNB 2XPGA 4CMMA 3L5XH 1KEGL 4FFZH 4Y2DC 4HUNB 3TIDB 4UOW0 3R8BB 4L1HA 3LB6C 3SKJH 3KNBB 2X4RB 5SX5K 1A6WL 3QXDA 3V95A 5DRNB 3KPSB 4NWUL 3CDGA 1ORQA 2HRPL 2QADD 3TBYA 2UWEB 5CEZL 3H8NA 1NLBL 3SDAB 1MFBH 5I75C 1A9BB 4QRPA 3ZDZF 5T5FL 1VFBA 4PGBA 2Q6WB 5CJQH 1LO2H 2R2BA 4JO4H 3FO0H 2YD3A 3D9AL 4F7TB 4WCYH 3PXJA 1OLZA 2ARJQ 1FNGB 4PJAE 2EDFA 2ZOKA 5CJOL 2HJFA 4UUJB 5D5MB 1F6AB 3GKZA 3V52L 1EBAA 3X14B 5IW1A 2FEEL 4XCFL 3REVA 4MAUH 4Y5VB 1XGQB 4TVPE 2PYED 1U58B 4KV5F 4UT6H 3C09C 4KQ4L 4NUGL 3BEWA 4Q7DA 4JO3H 4X0KA 4YHPA 4FQIH 3S5LG 2MTPA 5J56B 5JORB 5L0QC 4EBQL 1KB9K 3C5JA 3F65A 4FN0A 2H1PL 4NKIH 3ALPA 1F3JB 1KN2H 2CLVB 3DI3B 3T0BA 4OD2B 2F54A 1WCQA 3T4YA 5JR1H 1S9XA 4RGMB 2QQNL 4JFYB 1N0LA 4MVBC 1ZHKB 3L7EA 5ADOL 1G9NC 4O4YH 2A6JA 8FABB 4G6MH 1VFOA 3GUTA 2ESVD 1Q94A 4LFHD 4LDOB 3MRQA 4L4VB 1NCUA 4N0CC 4Y5YC 5I18H 1J1OH 1RFDH 2VN7A 5FUZL 2OCFD 4OCSH 4LSVL 4QYOA 1AI1H 3MCLH 1JHKH 4K3DL 1D5MA 4XMLL 1KCUH 1WIOA 4PTUB 5HGGS 5T3ZH 3F5WB 4MD5B 4PJ9C 5CIPH 2AABL 4HUXB 4Y4FD 3CFIC 5A2LH 1SEBA 4OBSA 1MVUA 3KJ4B 1CFTA 3UPAA 2BZDA 1DBAL 5SX4I 1CFVL 2J8UB 1CLYH 1ED3B 3QHTC 5ICZB 4LLMB 2CLZB 1S5HB 2SEBA 1CN4A 2Z91A 4KRLB 4X6FB 2YS4A 4I9WE 4JPVH 2DKSA 3MRCB 5EU5B 4HUVA 1F00I 4L4TB 5DD5H 1KEGH 5C0AD 2MKWA 1WQVT 4MNQE 1D5XA 3IGAB 5ENWA 7CGTA 4IIQC 3ARUA 5CSZB 4N8CH 5DMKB 1KJ2L 3CVHA 3BDYH 5D2LF 1HOCA 1OAZH 1J8HA 4QTIL 4TUKH 3EW3B 2OTWA 3N0PB 4JQXC 5TDNA 3FMGH 2XWBA 2A77H 3FQTB 7FABL 1BM3H 2OSLB 4YHIB 1IGML 3HHRB 1TQBC 5TF0A 1PQZA 1CF8L 1AR1D 1CXLA 3N9GL 4NFCA 4OZGE 2YD8A 2APFA 5IVNA 5ELIA 4LCWB 1FL3A 2R39A 2RFXA 2P5EE 2CR6A 3SJVD 3HC0A 2NXYC 2QL1A 1AIFB 3AC0A 3TZVB 3OR6B 2YPLE 3GJFA 2BCKA 2PO6D 2DF3A 2DQGL 5ERWB 1N8ZA 4K3HA 3V52H 4GBXD 5BOPA 1NGPH 4E0RA 3VXSE 4D3CL 2XPGB 2KDGA 5LKNA 2DWDB 4HKXA 3C6LB 3ESUF 3BKML 1KJ3L 3BZFB 4BUHA 4FP8L 2EICA 1MRCL 1QSFB 1KJVB 4HF5L 3IDYC 4NPYB 2NY3C 4ETYA 5KVMC 3DX7A 2EYSA 4PGBB 1YEGH 2F5BH 2EE6A 2D9CA 1F4YL 1JUFB 3QULB 4LVNB 2R2BB 4LF3A 5IBTL 1HYRC 4IMKC 2QQNH 3LH2H 4WWKD 3PWVA 1VACA 3HAEA 4DFHA 3C60C 4LU5L 4P48A 1XIWD 4NCC2 3IAQA 3FO2A 3F58L 3RZCB 5IW1B 3ARBA 4P57A 1KEML 1NKRA 1EHLL 1M7DB 3I6LE 1BQUA 1YEHL 5D1XA 4APQA 4F7MA 3QWOB 5GS0L 4OZHA 5GGUA 3ZKXB 2R8SH 3MUGA 1F4AA 2BERA 5EIIB 5IKCB 3GI8L 4UDUB 4GT7A 4P3DB 3VFGL 1QTYT 1HWGB 1RK0A 5DFVD 4D0DB 2Z35A 3DV6A 2FO4B 4PRDA 5CGYD 1UB6B 4PLKD 3NFSL 4JM2B 1IM9D 1I8MA 5HYJE 4I0CC 3JVGC 2VDPH 5I8CB 1YNTA 1G6RB 2FBOJ 2F54B 2V2WA 3LN9A 3IU3A 2ZKHL 2F74B 4ZYKB 4W4OC 2HTLD 4JY5L 3L7EB 3QCTL 5KSUB 2A6JB 1BAFH 4RMWA 3O9WA 1DQMH 1T0PB 2PTTB 5I15H 5FB8A 3O0RH 2DWEA 2IPKA 1IRAY 4Y19D 3ILPA 1IC4L 1CGVA 2APVA 4NQCE 4X9BA 1I9RL 1D5MB 2AJYL 2X9XA 3E8UH 4G6JL 1BBDL 1IKNC 2HJKB 4NSKA 4ODXB 4C56E 2PUQT 5F7EL 3R8QA 3UZEA 1IC7L 3SHSA 5D7JB 4G9FD 3DMMB 3BKCL 3RWJB 5F8QC 4L5FL 5HYSB 5KANG 2ICES 3ARGC 5C8JB 1DE4B 1MI5E 1TJHH 4QRQB 1ONQA 4X6CA 3AM8A 4U0QB 5ENWB 1KPUB 5D96C 5ISZA 2DQHL 3DXAD 2FB4L 2BSRA 3QJHB 3V6ZA 5KVDL 5TDNB 2IADA 3LIZL 5IMKB 1OTTD 4RZCB 2B2XH 1JFQH 5JHDB 4Q9RL 2AEIT 2GSGA 4NP4L 4NZUL 3U2SB 5EOCH 4TTDD 1F4YH 1KCKA 3L6FB 4WV1B 2WWKT 3H6JA 2RFXB 1HHKA 4LLVB 4OLXH 3RWFB 3HC0B 5B4MC 3AGVA 5A16B 1GL4B 3EYUH 2BCKB 5I73B 1EEQA 3VXQB 1D7FA 1C1EL 3L7FB 1JPSL 1FFNB 3JZ7A 3RA7H 4M62L 2ICEA 1ZAGA 4WTZA 3RVXD 1FE8L 1JVKA 5D93B 3K4AA 1IJ9A 5K9JL 2CUIA 4M7LL 1F45A 2VJXA 4RQQA 4BM7A 1H3WM 1ZHLA 2CUHA 3GMPA 4KK6D 1FP5A 3P4OA 5HHOE 1CL7H 4J3WA 3IDNA 5CUSH 3NFSH 4YIQB 3KLHC 2X4SB 1MLBA 2HTKC 3O6MH 1VENA 2X1XR 4QHNA 2Q20A 5TH2B 4LF3B 3KWWB 3U0PA 4OT1H 4U1HA 4CBPA 5IB5A 4PLJD 3PWVB 1L7TH 2B5IB 2FJFB 3C5SA 4CKVX 1T6WA 3LS5L 1HZHL 2VB5A 4PJCE 3WMSA 5C2UB 3U1SL 4APQB 2HN7A 3SBWC 1Z3GL 3MXVH 3U4BL 5FKAB 4LSQL 1BD2A 1MRFH 5HJ3A 4FABH 4DAGL 4ODHL 4XVTL 1FFPA 5ANMA 1KCRH 4EN3A 5BV7L 3M1BB 5GXBB 4DUXA 1A64A 1F4XL 3QXWA 1RK0B 4XNZC 3BYTA 2E5EA 3TO4D 5ACLA 2Z35B 3DV6B 3Q6GH 3QHFL 1FYTA 4I8DA 4NDMA 4M7JL 5TGBB 3WXVL 2FJHB 3C9NB 5IMOB 3M17A 4CN4A 4WO4C 1NKOA 1FSKB 4O2EA 4TYUA 3WIHA 3E1F1 4ODVH 5E0QA 3TNMA 5D7IA 4HGKC 1TCRB 1KNOB 4Z7QF 2VIRB 5T1MA 5FB8B 3IFOA 3S35L 2IPKB 3IETA 3TT1L 2VAJA 4Y4HA 4GMSH 3RI5K 4XPHL 1QFWM 3C87A 2ZUSA 4U6VL 2XQBH 4JQIL 1OAUL 2BVOA 2DMKA 4PRIA 3RPKA 1FVEA 4LLYA 4PGJA 2EIBA 3QIUA 5DK0B 1YMMD 1LEGB 4D9RE 1RU9L 4HWBL 1CGYA 1F6LL 1JPSH 1OP5K 1AD9A 2VL5B 1Y6NR 1EO5A 5FO8A 4XAWH 1FE8H 2OZ4L 2I5YH 2YRPA 1MJ7H 4F15B 4X6CB 2W65B 3G08B 1P4BL 1MCEA 2X4TB 3TVMC 5ITFA 1WITA 2YWZA 4JKPH 3ULVH 5ISZB 5CILL 3VG0H 4U49A 4ZO8A 3GMQA 3BT2H 3X13B 3FQNB 4TTGA 1GOGA 1T4KA 5E1AA 3MUZ1 2IADB 3UJJL 3EIFA 2DLFL 3BP6B 2GSGB 4FZEL 4HQQL 1RUML 5I1HL 5DEFA 3ZYJA 3CSBA 1DSFL 4DQOL 3QP3A 3HZKA 3L3DA 1CLZH 5DURB 2VC2L 4N8VG 1OSZA 4YEEA 3TLRA 4AYFA 1JHLH 5DJ6B 3QHZL 4BSJA 1J0HA 3JV0A 2LU7A 4KKBD 1FFRA 1R5IA 4JGJA 1A7QL 1BVKA 1DFBL 3ARED 4JFDD 1WZ1H 2EIDA 4KMTL 3OPZH 4LSQH 5C0DA 1I7RA 3OGOE 4WHYH 2JK5B 5DXWA 4P3CH 3MLZH 5AYUL 5GGQH 1TZIA 3S35X 3IDNB 1T04A 2R0LL 4U1KA 5IFAH 1A6TA 3BFOA 5C3TA 1V7NH 1LE5B 1MLBB 3BGFB 2QQKL 3MLYH 3QH3A 1WK0A 4QHNB 5BO1H 3LY6A 4JG1H 2WUCH 4HCRA 1DQJA 3KPSD 4MD0B 6CGTA 3PWJB 1AGBB 3FCTA 3KGRA 5IGXL 1LO0L 3ARZA 4ZO9A 3WKMH 2MNUA 4WI8A 3C5SB 2E7CA 3R1GH 4GW5B 3SDAD 5DJZB 4GKSA 1T1ZA 2NY6B 3WFBL 1UA6L 1AHWC 2GJJA 5SWSE 1KLGA 1YNLH 1BF2A 3PUCA 5DS8A 4U6VH 4HLZH 3KLDA 3IFLL 2EDOA 2XRAL 4BUGA 5IOPB 2UYLB 3MR9B 3HMXL 4WEBL 2UZIL 3V8CA 4NO0B 1NDGA 1MCBA 1DLHA 4ONHB 5JW3H 1FYTB 1QA9A 2HLAA 5EH1A 5DJXB 3G6AA 4BSWA 3EYSH 3DUSB 4AJ0A 35C8H 4WFGE 4NRXA 2VABB 2MCPL 1DUYA 1I1CA 1XF4A 3TNMB 1CLOH 3DECA 1P7KA 2FYYA 3HFMH 2VDOL 1P4BH 3IETB 3WXWL 4Y4HB 1RJZA 5IESL 1ZEAH 1Q72L 4LNRA 1D6VH 5SV4A 1I75A 1I3GH 3BH8A 1PGRB 1G7IB 1V3JA 1YY8B 2YZ8A 2AEWA 3DI2B 3MJ7A 3QNXA 5DJDA 5FDWA 4LIQL 2QQQA 3WLBA 2DLFH 4L4VD 5EULV 5ITBH 4PRIB 5CEXB 1F3RB 1X6NA 1RUMH 4LLYB 5JIHA 3ARFC 4R4FH 4XB7A 5K9OB 3MJ6A 5I1CH 3BVNA 1NGWB 4AG4L 3GHEL 1HEZB 3QIUB 4P46A 5C0RL 5CIPA 3IDXL 5FOBA 5BVPH 2DIJA 4WHDA 3T2OA 5L7XL 1R5VB 3OX8A 4YX2L 4GMTL 3CMOL 3WBDA 2J5LB 2VKXA 4ZXBC 3ZHKA 3RPIA 1G7JB 4NGHH 4YR6A 3MODL 1SYVA 5F6IC 3G04A 1G9NH 3GSNL 5FYLE 3V0WH 1OP3H 1E27A 1QRNA 1MUJA 5ITFB 2Q87A 4HXBL 3VXNA 3MBEB 3LSOB 4TQEH 3SKOB 3BWUC 5E1AB 1OW0C 2ARJB 5C0FB 4U3XA 3SQBA 5IB2A 4PJAF 4KKAD 2P5WE 2YN3A 2YZ1A 3B9VA 5DEFB 3HG1A 3S96A 1ODAA 2ZOLB 2R0ZL 3HZKB 1CDBA 3B9AA 5I8OL 3L5JA 4KGJA 5EU6E 3G5ZA 4EZMA 1FCGA 2YSSB 3CH1A 1I7UA 4HXAH 1KB5H 2D31A 5IM7A 4DZBB 1YEFL 2NR6D 1MRDH 1R3KA 3P3YA 4R0LA 1L6XA 1INDL 3STZA 5HPMA 5LXGH 4PP1D 3K8KA 2ZP0T 3TZVD 2IQAB 2PYFB 3HMXH 2WBWB 1KGCD 2DQTH 4QOKE 3NCJL 1S3KH 3OV6A 1IILE 1YPZE 3C6LD 4U1KB 1GZQA 1MCNA 5GGTL 3SKNB 1I9IL 2OR9L 1L6ZA 5BZWA 2MCPH 3MRHB 2R1YB 4RGNB 1QG3A 3IJYA 4FZ8H 4HC1H 1DVFC 3WKNA 2AK4B 1XCQA 1K5NA 2BY0A 1KIRB 1T1ZB 4X6EB 5D1QC 5FYJD 2WSKA 3QRGH 2HFGL 1JNLH 2EXYD 4JN2A 1NEZB 5DS8B 4K7PL 4RAVB 1AE6H 3IDGB 2QJDA 3RZCD 2E6JA 2ICWA 4KY1L 2HRLA 1NDGB 1HCFX 1DDHA 1FNEA 4JO1L 4I77L 4MJ6B 4YZFE 3VWKC 5F3HA 1CG9A 3I84A 4PJEA 4N0UB 4AG4H 3SGEI 1FJ1A 4BSWB 3QAZC 1T83C 5L7XH 4NNXB 4KH2A 4XBEL 4P59H 3BD4A 4GXVL 3QWRD 1S5IH 1UCBL 4NM8L 4PRHE 1EHAA 1YMHA 4JM2D 2XT1B 3T0AA 3UBXA 3TYFB 4ISVB 4I2XA 2FYYB 2E6QA 3MREA 1CI5A 1G7QB 2F54D 5MP6H 1JGLL 2C3WA 3BISA 2DYPA 2VAAA 1TQCC 2V17H 2ERJC 2E3VA 2VDLL 5DJDB 4MZ2A 3EDKA 4JANB 4RBPH 3B9KB 1KJ2A 3O6KH 1CD1B 2XIDA 5CEYB 3NACL 1ZWIA 4F3FB 5TDPA 4OZFG 2AJZB 2GUOA 3IKCA 3MRKA 1YJDC 3BVNB 3FT3B 3GK8L 1UZ6E 3BD5A 3DNKA 4R4ND 2FX8L 4YC2C 4ZUTA 5CIPB 1CICA 4NN7B 5FOBB 1N3NA 4U6XB 2EDRA 4JR9H 1FZKA 4LAJH 1EFQA 5DUMH 3BXNA 4MMZC 1AH1A 2P49B 3VJ6B 3RPIB 4DEPB 4EDXB 5F9AC 5J57B 2RCSH 5KVGH 5TFSH 3QUZC 3IDIA 5E8DH 3G04B 1E27B 3DX6A 3ULSA 4YQXL 3OR7A 5BRZB 1EVTC 3DMMD 3U48A 1H9VA 1QP1A 3QEGL 3VXNB 5FKPB 1NMBL 3MJGX 2D7TH 1FDLL 2GCYA 3CK0L 5IB2B 5E56A 4ZNCD 3HTLX 3GGWB 4Y16C 4HFWA 3HG1B 4OLZH 2OR9H 3DBXA 4PJXB 4OGXH 1RMFH 5IEKA 1J8HD 4U1GC 4L8SA 2ITDA 2H32H 3LN5B 3PHOA 2BMKB 1Z9MA 5JHDD 5DVOA 2UV3A 3CPLB 4O51B 12E8L 1R3KB 4UT7H 2VERN 3OB0H 2VXSL 3SE3A 3HC3L 4PTTB 4MAYA 3L3OA 5C0CB 4M1GH 3DV4A 4XCYB 3QQNA 3ARDA 4KY1H 2ITCA 3OHXA 2VZSA 4ZFOL 1XF2B 5HI4D 4K94C 5L2KE 1GZQB 4P9ML 4GQ9L 5I1LA 3VFRB 1UACL 1HXMB 3O3UN 2IPUK 4QCIA 4ZUSA 5AWNL 4LASL 4GXVH 1U2HA 5CAYB 4N1EA 1KC5L 2N56A 3ZKND 2MQ3A 1H15A 3IJYB 1XCQB 1F02I 2FWOA 1GZPA 2E8YA 3SDCA 3EGSA 1HILA 1VFAA 3B6SA 3EJJX 4HS6B 3W39B 5E2TH 2VDLH 1DBKL 2GJ6E 2GT9A 2E6PA 1B0GA 2J88H 4URTB 1N6QH 1YEDB 3VCLA 1OGAE 5HXMA 1IC5H 5FGBA 5E9DE 1MQKH 4HUWA 4APQD 1AXTL 5LWYH 1FNEB 3SDDB 5F3HB 1DANU 1CG9B 1QLFA 2P8LB 1M7IA 5E6IA 1B4JL 2FSEB 1HSBB 1JGVL 1T21B 5CZXC 2ADFH 3VI3E 4U0RC 5GGSA 2LTQC 2XZZA 5KG9A 4J8RB 2ED8A 3EAKA 3LEVL 3VFSB 5CZVH 4GRWE 5T5NG 3O3DB 4GRMB 3UBXB 4I2XB 4ZTOH 1A6ZB 5HGAA 3MREB 3HNSH 1HHHA 3TIEB 1F11B 5D6DA 2DI9A 3DVIA 1X5FA 2VLRE 3PGFH 3VD3A 4PRPB 5FECA 4LEXL 4NBXB 2DOCA 4UILL 4ODWA 4LSTL 2KQMA 1RZGA 4F58H 3LV3A 3VRLE 2DN7A 1VSCA 5DRXA 3DTXB 2BNQE 2EDLA 1ZOXA 3IKCB 3MRKB 1VPOL 3QJFB 3JV6A 1CICB 1J0ZA 4R4BB 1G9MH 2JCCA 2VXVH 3CUPB 5FIEA 1RIHL 1M05B 3PIQA 3WUWA 5C2BL 2OXHA 3BXNB 3QIBA 4ZMAT 5D2NC 3DVGB 1BFTA 1HINL 3MBXL 4YHYC 5INDA 3GSQA 1IEBA 4QY8A 4KK9D 3KG5A 3MGTB 3ZE1E 2HKHH 1IFHL 4IRSA 5E8OA 3QZWB 3ULUD 1HHJB 3OJVC 5JOEA 4BK5A 4JB9L 4P5MA 2QADC 3BO8A 3VH8B 4OZIF 3QO1B 4L3EB 1ZVSB 2GCYB 3V5KB 1MLCB 4YHML 5GRJL 4XAKD 5EO1B 1GOHA 4ZFFA 4WUUA 4U6HB 5ISZD 1GGCH 1EERB 2DKMA 4G7YH 4LASH 4MXWL 3ZL4H 4L8SB 2FHFA 4ZAKA 1KC5H 4UT9L 5J3HD 5TPWL 3W0WE 3P73B 3RAJL 3QI9A 3O4LB 3QXTA 3MRJB 2XTJB 2AJSH 3A6CL 4DGVL 3KYMA 3CCHB 3NN8A 4JDTL 4UINH 5DURD 1QLEH 3H9HB 1DQLL 4BSVA 1I9JH 5HPOA 2A73A 1XF5B 3WDHA 5HHQA 5FK9B 3V79C 3AFLA 5LG1A 3ARDB 4QT5B 1A1NA 4MNGE 3WNOA 1GGIH 2L4OA 3S4SB 3OF6A 5F89B 1B4JH 1J88A 4I0KA 4HWZB 3T09A 1HI6B 2Q1EA 4ONGL 3RX7A 1BQHA 2DLEA 2AQ1A 4Y8DC 5HDQL 2ZUQC 4KTDL 1DLFH 1IC1A 3BZ4B 3WJLC 1FRGH 1JNNL 1WTGT 1IGYA 1H15B 2FD6L 4FQ1H 5L9DH 2FWOB 4TSCH 1L0QA 1WJ3A 5IT2H 1HILB 4Z7WF 4NN5B 4EI6B 3B6SB 3MXWL 2E9WA 4YBQD 5LCVL 2IBZX 2M26A 5JMOC 1IGFL 2PYEE 1VEOA 1JZ8A 2GT9B 3MRGA 4UILH 3FB7B 4M8QA 3VCLB 1TVBA 3IFPB 4JHBA 5I30H 5B39A 4HUWB 4XNUH 5TF1L 3WIFA 1QLFB 4R7DB 4Y2DA 1LEIB 4G6KH 3F8UB 1RSFA 4YGVB 1CD0A 4S0TD 1A7OH 1YYLH 1DBBH 4NO0D 4NT6A 5C2BH 5KG9B 2CD0A 3BIBX 1HINH 4XNXL 1FYTD 3N1QC 1MCPL 4X4YA 4HWBA 5IQ7L 1TVDA 2YXMA 4DK6A 5HGAB 3ZTNL 1ADQH 1S9YA 2ESVE 1HHHB 1LP9F 2ATPB 3VFPA 5F9JB 1MIMH 5L88H 3D3VA 4MB3A 2IWGA 4IDJL 5E00A 1P4LA 1D5ZA 3BMVA 4XI5D 1WCBA 1AR1C 1YNKH 4DN4H 4Y4HD 5DK3A 4ETQB 4K8RH 1DQTA 4MS8D 4LBEB 4PJIB 3D85A 2E7LC 2DL2A 4MXWH 1UGNA 3GM8A 3JV6B 4Z6AT 1U8HA 2JCCB 4AMKL 5I8KL 2CLRB 4K23H 4GBXC 1QR4A 4PRID 1JTOA 5F3BB 1XCTA 3QG6A 1JI1A 3QIBB 4JPKH 3I2CL 3OAUL 5FCUL 3MV9B 2AXFB 2I25N 3QIUD 2PR4H 4QY8B 3HS0A 1IQWH 5D70L 4NM4L 1CFQA 5C0AE 3X12B 3VW3H 4LHUB 2EYRB 5KW9H 3L3HA 3BO8B 4Z8FL 2I60L 3PWPE 4JHZA 3WO4B 4JG0L 2NYYD 2Z31C 4HUKB 4HEME 4WDIB 4Y5YA 1T0NB 4F7PA 4WWKC 3MBED 2VH5L 2CRYA 2AI0H 3FRUA 5C1MB 4NKDA 5KSBF 4TPRL 4OZGA 3MNZB 1XIWC 3MV8B 3SJVE 4L8BA 1KIQA 4CN6A 4WU5B 2V2TA 3P0YL 4TSBL 3KYMB 3NN8B 3I75B 3BP4A 3DWTA 3GHBL 5HVGB 2DQUL 3WLWD 4ODUA 1KB5A 2HT2D 5EPMA 2A73B 4JFPB 3C08L 3S36L 1ULVA 5H35A 5E5MA 3V5DA 3VXSA 3LD8B 3C5ZB 3T3MF 5CGYC 1ZT4B 5C70A 4PLKC 4U31A 4NZJA 4JFHE 5DVNA 5T3XL 3CX5J 3HMXA 1RJLA 3HB3D 1LK3H 3NIDF 4CUCA 3BZEA 4WI9A 2R1WB 1I7TB 4IIQA 2ZG1A 1KCSL 2HTLC 3U6RA 1RZKH 5K9KA 1IEHA 1JYXA 3CFEB 4MQ7B 4JQXA 3P0VH 3FRPG 2R29L 1YJDL 3FB8A 3MRBB 4NRZA 1U8JA 4LSUH 5K93A 1MPAL 4BYHA 2VTFA 5KS9E 4LPCA 3LKRA 3SQOH 4KJPD 2L7UA 2OP4L 1IGJB 4RGND 1E4WL 3LDBB 3BSZL 1CT8A 1E6OH 5GGRY 1JGDA 4HPOL 4EEEA 4XRCB 1JWMA 1TVBB 2XYCA 5ICYA 2AVGA 1TJIH 4QRSB 4KKLD 3L5WB 5J11C 2LVEA 2X4OA 3NPSB 3MLTA 4Y1AE 3U9UA 2XTLA 1VHPA 4Z0XA 1MNUH 4KI5F 4OFDA 4ELMF 3DLQR 3VXPA 1NAMH 3A6OA 4AT6A 5JLZB 3EO1B 1GAFH 4QHLB 3UTQB 4Z0BH 5D1ZC 5ID1B 3V2AR 3BAEL 3P11H 2N7AA 4M7ZB 3T0EC 1Q9OA 2JF1A 4DW2L 3NZ8A 5D70H 4P2RA 1S9YB 3WIIH 2CQVA 4ZFZB 5JXAL 4Y19E 1ZLVH 2P45B 1YECL 4IMKA 4X9IA 3D0VA 1OTTC 4PS4H 3GSNA 1KENL 3D3VB 4RDQG 3ROOA 3WE6B 4Z8FH 5E00B 1P4LB 3C60A 1D5ZB 1WCBB 1H8NA 2AQ3A 4EUPG 1U8OB 1E6JH 4W6XB 2DD8H 5J1AB 4NQCA 2XA3A 4JO2H 1Z5LB 4U4BA 4ZUWA 4IMLB 3S36X 3D85B 4G3YL 4MHHG 1R3JA 3FKUS 4BZ1L 1U8HB 1L9NA 3B9KD 4ONFL 2BSTA 3PABA 4K94L 3QG6B 3RVXC 3WDIA 4G9FE 5DHVA 1OP3K 3TT3L 5T3ZD 5D72H 4WWID 5INCA 1YPZF 3JVGA 5T1KA 3HC4L 5EA0H 4KK6C 4W4OA 1CQYA 4LEOB 1MI5A 3L3HB 3RUGA 2XN9A 1NMAL 1QNZL 3DXAE 1YEKH 1A3QA 3TBWA 5IEHA 1IL1A 1OF2B 2W60A 5I74C 4Z7UA 5BRZD 4HG4K 4Y5YB 5IB3B 3IYLW 3ARSA 4F7PB 1EDQA 4NZRH 1DZBA 1MCKA 5TJWK 1MCWW 5F44A 5GGTA 4NKDB 2C1PA 4XP6H 4YWGH 4UMGA 3MUHL 1MAKA 1KIQB 1JMZA 2YA1A 1SYSA 4ZTPL 3KPOA 5EZOL 3HG1D 1IKNA 5CMAA 2AK1H 5E4IA 5H94B 2H32A 4GAGH 4XP5H 4MCZA 1T6VN 4YZFF 4YJZL 1KB5B 5DRZB 5EPMB 3GKWH 3KDMA 3MOAL 4NQEB 5IVXB 1RJYB 5IUSA 4K55A 5H35B 2HKFH 3QNZA 5CBEA 3TO4C 3LKNB 3HI1B 1MJJB 2BVQA 4N90D 3F6IA 1NDMB 4KAQH 1OCWH 4HDIA 2DRUA 3ARGA 4HK3N 5D8JL 3TBVA 4JRYE 1HN1A 4KDTC 4WW2C 3CDFA 3PJSB 5C0CD 2Z9TA 3DVFA 1E0OB 5IFHH 4S1DD 3U6RB 2QSQA 3LAFA 4HZLA 3B2UD 4R97C 5K9KB 1JCKA 4NO5A 4KVNL 9CGTA 3OXRB 2PW1A 5F93C 5B8CC 3BN9C 1NBZA 5IMLA 2OJZH 3D18A 3HI5H 4LVOC 2VXTL 2JIXA 5JDJA 3LKRB 5JXAH 1A3RH 3TNNB 1T89C 5K33A 5ACMA 2UZXB 5CWSB 2R0KL 3MFFB 3VDAA 1UZ6F 1QR1A 4L9LB 2X4PA 3ARWA 3ZT6A 4LLDA 4D94A 3ESVF 1JGDB 3MGOA 4N8PA 5D7SL 1BWWA 1JWMB 2GTZB 1OAKL 3QUMH 3U30B 3NCBB 1ZHBA 1X5AA 3MLTB 3ILQD 1ZMYA 2W59A 1F42A 4HUMB 4NUJB 3VA2C 5JNYA 4Q2ZA 1NCBH 2OJEB 4BJLA 1RUPH 2XKNA 1Q9WB 1MH5A 3VDBA 5DJ8A 4MQXD 3SDDD 5I1IL 2AW2A 1KCVH 3VI4F 4R7NB 5LQBL 1RQ5A 5CD3B 1T1WA 2R2HA 1MIEL 5D71L 1HKLL 3DHMA 4TOYL 4P2RB 2NW2A 4GG6E 2ZJSH 4KC3B 5C07A 3VXRA 3E6HA 1W8NA 4TUJA 4X7CC 4XZUB 5CINH 2GAZA 1KPVB 5GHWH 3TJEL 1TTGA 4YPGA 1WBZA 3QG7L 1JGUL 3C8HA 5DSCA 4JFEA 2Y07L 3AAZB 3X3FL 1JNJA 1H0DB 3SBWA 2BVYA 1R3JB 4OSUH 4X8JA 1B3JA 2H45A 4PRPD 1CK0L 4OI8A 2A2QT 2D4DA 2VZTA 4HT1L 5GGRB 2BOBB 1RZ7L 4HWUA 1YMME 5GQBA 3IJSB 2DTSA 3V6OE 3MROB 2P24A 4R6UA 1PAMA 3AREC 5MEPA 1AC0A 1U42A 1JZ5A 1UKSA 5C09A 4UU9B 1CICD 3MACL 1U8LA 5DD6B 4Z76A 1YN7A 2QHLA 1KPRB 1RURH 4IOFD 3WSQL 3W9EA 4WO4A 2I24N 3G6JF 3U82B 1G7HA 3BPCB 4YE4L 3RUGB 4XC3H 2C3HA 4XPGH 5FEBA 1EO8H 2ICWJ 2XA8H 1FGNL 3UTTA 1IL1B 1TZGH 3KS0J 1HH9A 2W60B 5EOTB 4YBHA 4KVCL 2DTMH 3ARQA 5LBSL 4ZFOA 5BZDA 4PV9B 3LKSB 5DZOA 3VFOB 5AD0A 3DVNA 3F12A 4XMKL 1LO3L 5LJYH 5E2VL 4GRLC 4L3ED 5GS2D 1HCVA 1RAMA 2EDXA 4P4KC 5I1GL 3KPOB 1XGYL 2YUXA 5EUOE 1QFPA 1FVDA 2CJUH 5DZNA 4MCZB 4S1SH 1K8IA 3QQ9D 3S3JA 2J3SA 2IANE 4JFDE 3V4PL 3AS3A 3U0TB 5FOJA 4QKXB 3U36A 4KZEH 3QNZB 4FA8A 2XTJD 4LP4A 5CBEB 4HBCH 1J12A 2G9HB 4U1JB 2BVQB 3F7YB 4U2ZA 1DUZA 1F5WA 4PREA 1INQB 2OL3H 1C5BL 4Z7OF 5L8LB 5B3JF 4UV7H 1FO0L 4JVPA 1UG9A 1MHHA 4LQ1A 1DQDL 1L9MA 3TVMA 2AJ3B 3CFCH 3ARDD 4HZLB 1IKFL 1PLGH 5I1IH 1I8LC 4DVBA 3KPSE 2HH0L 1NBZB 3TH3T 4YDLC 3G5YA 3D18B 2Z0BA 4QRUA 1MVFA 4TOYH 4ZPTA 4RGMC 3OJDA 1P9MC 4HKBA 3FO1B 3CFKB 3KXFB 2EDYA 4G9DA 1FFQA 2EH8H 1J0KA 5M7QA 1RV6X 1EVUA 4BFEA 1JP5A 5SWSA 5H37H 1A3LL 2NZ9D 5F7YC 3RWDA 3SDCD 1A6VH 3KPNB 4P5KA 5D5ME 1XR8A 1U92B 4BZ2L 3X3FH 2R2EA 3H7BB 4GKNB 1A4KA 3GSWA 1WZMA 1CK0H 3RU8L 3ZE1F 5EUKA 5JQ6L 5JO5A 2XKNB 3WNPA 4XVSH 3BKYH 3KJ4C 1XGUB 4Y4KB 4MNHB 2AJVH 5T1DH 3EO0B 4KHTL 3DARA 5I1JH 1HHIB 4HJJL 4WY7H 1T1WB 5ESQB 2VZVA 3WHE0 4CGTA 3FOMA 1J0IA 1AKJB 1CS6A 1X9QA 4KTEH 4Q58C 5C07B 2MHAB 3SKUD 3LEYL 3VXRB 3E6HB 3H42L 5L8JB 3V4VL 1KN4H 1PFCA 4PRAB 1ADQA 3WUZA 4KKAC 2GAZB 5D2LA 4ZPVB 4F80A 4W6YB 1CD9B 4PG9B 5DSCB 4JFEB 1BFVL 1NFDB 2QSCL 4L4VE 1AHWA 4R90H 3OL2A 1T03H 4M02A 2J6EL 1QRKA 4HK0A 4KPHH 3NCMA 3P0GB 3NZHL 2ADJA 5I1GH 1ZLSL 1QSEA 5F1OB 3ZO0A 4HWNA 4XNZB 1XGYH 5KSVB 1JZ6A 3TZVC 4JZJB 5C09B 3MRDA 2W9DL 4D9LH 1ZANH 2VLKA 1A0QL 5FO9A 4Z76B 3MYJB 5BJTA 3ZT7A 1GH7A 5ACZB 1Z2KA 1F58L 5EZJB 3QIBD 5AZ2L 3P30H 3P77A 4OQ1A 3MV9D 3C6LC 4PJFF 1C5CL 2B1HH 1K9TA 1YEIH 4P2QA 2ATKB 1H3VA 4IRSD 3HMWL 3V0VA 1L4IA 3HRPA 1LWRA 3FN0H 2R0WL 4LHUD 1J1XL 1KYOJ 3O6LL 3PWLB 3JUYA 3EBAA 4WENB 3F12B 5J1SC 1H8SA 4IBLT 4UQ2B 2NMSA 3OAZH 5DK2A 3ULVD 2HT3D 4GJTB 4PJDF 3BPOC 3T0DA 4LVNC 2EXYC 3GSUB 4DGIH 1ZSDA 3CVIH 3ARFA 4R2GC 3CXHK 5DMIH 1FZJA 1IZJA 3OB8A 1FG2A 3U0WL 2G5BB 3RZCC 2AXHA 1AC6A 1NSNH 5HVWA 5CJXC 4UDTA 4M6OH 4ZXBA 3ZKXC 4CNIA 4QXUH 1KGCE 1CBVL 1MFEL 1FVCA 5JIPA 4AK1A 2E7HA 1C08B 1R0AL 5DC0A 1BGXL 1MEXL 3C5ZD 1CIUA 1SY6H 4HX1B 2YMXL 1ZHNA 4JM2C 3D0LA 3KPRB 4DVBB 4A6YL 1OW0A 4XCCH 4PFEA 1NFIB 3GRWL 2FR4A 3QEQA 4QRUB 2YD6A 5T5NF 4ZPTB 4HKBB 5DI8A 4M7KH 5FYJE 4G9DB 1CDHA 4NZTH 1NGZB 4CVXA 1P53A 1H3TA 1LD9B 1BLNB 4DWHA 3O2DL 4QTHB 5EC2B 3RWDB 4P5KB 1D9KC 4LSDA 1P5UA 3MA9L 4MJ4A 3H0TA 3PGCA 3BESR 1EJOL 1OAXL 3PWUA 4G6FB 4IJ3C 3DIFB 5DYOA 4JY6A 5C6TH 1AY1H 4HS3A 4OCYL 5EUKB 4QXWA 1S7UA 2DI7A 1NAMA 4NYLB 2IG2H 4MSWA 4Y5XB 5D7JC 4ZFGH 4POYA 3DMMC 4E41B 1YUHB 5C0JB 1FCCA 3LB6D 4YPJA 2WINA 5EZLB 5AZ2H 2F54E 4N0YH 1U8NB 1UJ3B 2JJUA 3QXUA 2FBJH 1T7YA 2QKIB 2AAVA 5D2LB 1DVFA 1WSST 2IC2A 4X7SL 5D1QA 2CKBH 1HHGB 1AHWB 1PKQB 3N1GC 5JW4M 5EBGA 1FL6A 43CAA 4HK0B 3D3VD 3IVKB 3EDJA 2XWJB 5BVJA 4Q6IB 2C4FT 4F8QA 4WV1C 1EJ6A 4FNLH 4DKEH 1R24A 4H1LA 1EXUA 3D85D 1AQKH 1NFKA 3GO1H 2A74B 1IAKA 2PETA 5KJRH 5I73C 2VLKB 1K4CA 1WIPA 2VO5A 4NJAL 1T83A 3PHSA 3C8KB 5IVOA 3ZKMC 2GFBA 5D93C 5HHMB 2EIEA 1RUKH 4OGYL 1CBVH 1AGEA 1MCIA 3QUKB 2X05A 2W1NA 3AY4C 1GCFA 3EHBD 1EUUA 1JHTA 5C9JA 1PEWA 2ORBL 2DM2A 1AGFB 1MEXH 1DN0B 5KS9F 3DYPA 3ZKNC 1J8HE 4IDLA 4A6YH 3DUUA 2BNUA 3O4OB 3WFEH 3GRWH 1U6AH 3RWIA 1A14L 3WEXA 4WTZG 1FZJB 3LQAC 2APTA 1S7WB 4G8EA 3KJ6H 3O2WL 3RX8A 4X7TB 3GIVB 2IPTL 1HWHB 3BH9B 5GRYA 3GMRA 3HCVB 4LCYA 3UTPD 1K6QH 4NQDB 5JDSA 4CNIB 3E2HB 1S7SA 3QUZA 2COQA 4R3SB 4NQED 5EC1A 3I6KB 3MLPA 2GITB 5HY9A 4JPIA 1P6AB 4AL8H 2A6DB 5L2KA 3V5HA 3GI9L 3BUYB 4E42A 1ZHNB 3D0LB 5MEOA 1UT9A 2Q7YA 1ZT7B 2FR4B 4HUUA 4Y16A 3D2UA 1OAQL 1FSKC 4X83A 1UEYA 5I1DB 5F7UA 1CE1L 3OKDB 4CVXB 4RMQA 3X11A 4NKOA 4PJXF 4UIMB 1SJEA 4X7SH 4LLWA 5E2JA 4M48L 5GS1A 2HFEB 2HFFB 3QISA 1UM4H 3PGCB 2NXYD 5E08H 3K8LA 1OGAA 1WAAF 3PWUB 3R06B 4OZHE 4MJ5A 1FG9C 5DR5H 5AG8A 1GC1H 4HS3B 3VA6A 1S7RB 4XPTL 1GRWA 4GAJL 2YKLL 3O3AA 1NAMB 1UWXH 3K81A 1ZLVK 3ULUC 4NJAH 1BF8A 3C6SA 3MLRL 4LPTA 4S11A 1EA9C 2O61A 2V5TA 4KRPB 4NOBA 5CGMA 4XVJH 5DD1H 4BFIA 1UB5A 1JPTH 5D1QB 4P2RD 3JWDH 4ZOEA 1A1MB 1JYNA 4FQ2H 2FZ3A 4PPTA 1EHXA 3K2MC 4OJFL 5A3ID 1IE5A 1T3FA 4HIJA 4J6RL 3EOAA 5J6GA 4PYGA 3TCLB 2G75A 2VLLA 4Z7VF 43CAB 5J3HC 5GJTL 1ZK9A 3TBSA 2BNQA 1QACA 4HJ0D 3WN5B 1F90L 5D7LB 1BJMA 2HMID 3GSRA 5M95B 3LHPL 4KMLB 4UQ3A 4OCXH 2YR3A 4GAYB 5I16A 1MJUH 1IAKB 3W82A 4AIZA 4YHKL 2WMPA 5TQ2H 1MY5A 3OAYH 1B4RA 1B2WL 1TJGL 1DCLA 3EO9L 4NQVA 5DQ9B 5T1KD 1ZGLA 3FB5A 2VDNH 1KT2B 3H9SA 4X6CE 1JHTB 5C9JB 2E9JA 3P40A 3PP3H 4XAKE 2IGFH 1LQSR 1KG0A 4NQUA 1JWSA 5ISZE 3WDJA 1DJSA 2QLVB 1QZ1A 4KDWA 3BGFC 1AD0B 3KPLA 2GEEA 1MCDA 3RWIB 4LKCA 3RDTC 4ODSL 4MDJB 2VWEC 4TSAH 1IGCL 4LP5A 2DICA 3DO3A 1T22B 2AV7B 1RZJH 5ESAA 4MCYA 4PJHF 2NY6C 5GISH 4NNYA 3DURB 5GGVY 5J89A 5D2NA 4WFED 3UXFA 5JDSB 4JFXA 1S7SB 5IJKC 2DQIL 5K59E 5EC1B 2JE8A 3GBNH 5DJCA 1FZOA 1MOEA 4M6ML 1NCDH 4MNGA 1U0QA 2MPAL 3O8XB 5CS7A 5E70A 5C0EB 3IS1X 1IMHC 3OKOA 1T80A 4LSPL 1FAKT 4ZUVA 4PGCA 4X99A 3ARGD 2P4AB 1JBJA 4KQ3H 1BJ1H 4MA3B 1REIA 4M9PA 3D2UB 3GFUA 4GSDH 1IBGL 1FZMB 4LVEA 2Q3AA 2E27H 4DVRH 2ZCLH 4PJ7F 4O02H 3X11B 4NKOB 4XI5C 4PRNB 4Y4HC 2AERT 1BZ7A 2RQ8A 2VSCA 3MA7A 4RDQF 4MS8C 1HIML 4G6AD 2CMRL 3D87B 2JIXD 3AXLA 3TN0A 5GS1B 1S7XB 2PYEA 4X80L 4FMKA 3KXFD 3IU4H 5IBUB 3RBSA 1RULL 2R4SH 1ZLWK 1JPFB 2FGZA 3R4DA 4NWTL 3FQUA 3QUMB 4MJ5B 5IF0A 1OOAA 3FTGA 4WTWA 5LAXB 5ANME 4UNVA 4BH8A 1N0XH 1XFPA 3EKCA 3O81A 3QIUC 3O3AB 4H5SA 5TE7L 3S34L 5EWIL 2VKWA 5IK3A 1FIGH 4DN3H 2VXUH 3PE9A 1FYTE 3C6SB 2J5LC 4M6NH 1UEMA 4Y4KD 3MJ8A 1KUMA 1X5JA 2ESVA 1QFUL 3VE0B 2C3GA 2NYYC 4H25B 5EZIH 1JF1A 3U7YH 2HTKD 4N9GB 1B0WA 5D7IE 3VGDA 4X5XB 2YPKB 2AV1B 3DX8B 3MBEC 2FZ3B 5C07D 4J4PA 4AEIH 3VXRD 1T3FB 1K3ZA 4HIJB 4YDJA 5IHZB 2G75B 2VLLB 2A9ML 2Q8AL 2VDKL 3Q0HA 4YHNA 3VXOA 1SEQL 4JFED 1NCCH 4PUBL 4WHTA 2BRQA 5E7BA 1Q0YH 3GSRB 3WLWC 4PRIE 5BMFH 4UQ3B 2YC1B 4WGVB 1MREL 5FUCC 4AIZB 3GMNA 1RZIA 5AZEH 3FHAA 4P2OA 3SGKC 1G6RL 1CR9L 3BPNB 2F5AH 3GMMA 2QTEA 3QCUL 3HB3C 5C09D 4HIEA 4OFKA 3G6DL 1RIVL 2YBRA 5HGDB 3H3PL 3FB5B 5C0IA 4Q74A 3VFUB 4FQHB 1JN6A 3BJ91 4HMDA 3MRRB 1SBBA 4M4PA 2CIIB 4KZDH 1BP3B 1M6OA 3PWNA 1MCJA 1TMCB 4DOHB 1NGQH 1IAIL 1RVFH 4O9HL 1EEUA 3RNKA 4ZOCA 4HPYL 4KJQC 3SJVA 4NRYB 2NY5H 4MB5A 2XZAH 3TYGL 1NBYA 15C8L 4RGNC 3CXDL 1J8KA 1MCSA 1HQRB 4MCYB 1QKZH 3VFNB 2IH1A 4IOIA 5FUCE 3RWGA 1YEEH 4GBXA 1DBJH 3VXTB 1HIMH 4RIRA 2ZNXA 3RWHA 1Q1JH 4L29A 1RULH 3LMJL 5MI0B 3Q3GA 5EU4B 5FM4A 4EXPX 3ARRA 1UM6L 5FYLH 1ACYL 2YUVA 1QVOA 1BBJA 1L7IL 4M6AA 2WUBH 4KWUA 1KF9B 4TNWF 2OL3B 3ROLB 4ZNEA 1VB9A 3OKOB 2VDML 1FORH 2C26A 1A7BA 4DZ8A 3NCEB 3L1OL 1H5BB 2QQLL 3UPCA 2Z31A 3U9PH 4G7VL 4MJ2A 3S97C 1QPPA 4YUEH 3P9MA 4O2CA 4LLQA 3UJIH 1G84A 3QA3B 5FHAH 3MOQA 1BZ7B 3GIZL 4RGNE 5ALCL 4MA7L 5F70A 1N7ML 4R96A 2IQ9H 3LPWA 4DKFH 3AXLB 3TN0B 2O5YL 2OMNA 3VMOA 1JV5A 2J8OA 3B9KC 1G1CA 4M61A 4Z7NE 2Q8AH 1IT9L 4RGOH 3FTGB 4ODTL 3ARXA 3I3EA 1MHPL 2W91A 2J6EA 4NC1C 4PUBH 1G0DA 3VFVA 1CGSL 2Z8VC 4PJGF 3PDDA 3M8OL 4NN7C 3E3QC 3L5HA 4B41A 4GKOA 3A6BH 4DEPC 1G6RH 3MQIA 2DM4A 4K9EL 5M94B 2I9TA 1BQSA 3QCUH 4AENB 2WQRA 3B5TA 3LQAL 4E41D 4FXLA 3S3PA 2DQJH 1X5ZA 5ICXB 5IP4A 1MWAH 4PJAB 2JB5H 4J1UB 5DMGD 1RY7B 1OPGL 5I1EL 3QPXH 1OB1A 1FLRL 4AH2A 3K2UH 1XT5A 3VXOB 2HWZL 2ZUWA 4O9HH 1G1YA 5C0GB 4WHTB 1ND0A 4MHHI 4HPYH 2OI9B 1S8DB 4AEEA 2DQDH 1Y0LA 1O7SA 3NH7L 3LKPB 4NC1E 4K8RD 3ZKSD 4P2OB 1I8KB 5FCSH 1J0YA 1WWCA 4R8WL 4IHOA 2Y7QA 4LOUC 1RHHA 2AXGB 1E4XL 4HSQA 2VXQL 3GMMB 5HHVH 1NBVH 5BXFA 5D1ZA 4RNRA 4HIEB 1OL0A 2VLKD 3INUH 4HD9A 4JJ5A 1CFSB 3S5LA 2KH2B 3T0EA 3D39A 1UM6H 4S1DC 3CC5A 5FFLA 3OAZK 3DX9A 1C5DA 4RRPA 4HHAA 3BN3B 1QRNE 5HHMD 5BRZE 4EOWH 1QEWB 1RUAL 3Q6FB 4J7RA 3ZKQD 1T7ZA 4Z78A 1PG7L 3DO7B 3PWNB 1S9VA 1U9KA 5KOMC 4P2QD 2W0FB 3L3JA 3L1OH 3T08A 4NQXA 3RNKB 2QQLH 4JFQA 4A6YA 1LO4H 1JWUA 2BNRA 4LHJB 2XZQH 3IFNH 3ARYA 3RNQB 3RWCB 3GRWA 4OLUL 1NBYB 3HG1E 4RFOH 5DQDH 2HVKA 3DHJA 5E8NA 5CEZE 2QHRL 4X6DA 1HQ4A 3BQUB 2IH1B 3SN6N 3RWGB 5I71B 3MO1A 1QBBA 3ULUL 5FM5M 4K7PY 1A21A 1MFAL 3ILQC 3HZYB 3O2DA 4N90E 3RIAF 4RISH 3FQRA 2K7PA 3PHQB 1URLA 5B38A 1MF2H 2K7QA 3OMZA 1NUDA 1BBJB 5TDOB 4MQXC 5C0CE 5DD3L 3SDDC 2DQCH 5C6PB 4NQDD 3I50H 4MNQB 1CGSH 5EIIA 3WS3A 2WBJC 4RAUA 5HYQB 3IF1A 2X4NB 3TA3B 3UTZB 2Y06H 5JOFA 3P9MB 5DHYA 2P44B 3VGFA 4L3AA 5IWLC 1VGKA 4G43A 5FF6B 5EIVA 2EXWD 2DBLH 3QEQD 2P5EB 1CZ8H 1PD6A 5CCKL 1EEYA 2YPLB 3U7WL 4FQLH 5FM8A 3CGTA 4JDZB 4F7EB 4S1RL 4FTVA 4HIIA 5EFIA 5I2IB 2F8VA 4A2LA 2X4UB 3TO4A 4YHLH 5HDBE 3VFVB 2W38A 4HULB 4HKZA 1CICC 3F62A 3TV3L 3KHQA 3BP5B 4ZD3L 5BS0A 1BMGA 4KDTA 4IOFC 4PJEE 4WW2A 1PG7X 4MLIA 3SOBL 2NLJB 5F9DC 2O5ZL 3OKLA 4R8WH 4AM0B 3ZE0E 2WAHA 3GMLA 2I9TB 1A4JA 4XPBL 3GJEB 3MJ9L 4OZIA 2FCBA 2X6MA 2ZUTA 4HMCA 4I2XE 1HH6A 1N5AA 4KRPD 3SE9L 5CP7A 5EOQL 2WBKA 1I1RA 5F88A 2CKBB 3F7VA 5TE6H 3FO9A 4AH2B 1J5OH 1HSAB 5D1QD 4JN1L 3WUWG 1S7TA 4L8SC 3QQ9C 4F9LC 1BECA 3V4UL 3PV7A 4RWHA 1YMMA 4LDEB 4U1MA 2FJGB 1DN2A 4OD1L 3MNVA 5D7LD 2XTJC 4O5LL 1A7RH 1S7VB 1D5BB 4UNUA 2Y7QB 1RHHB 5HYJB 3T0VA 4E9LA 5A40E 4MA8L 4HWEH 4CVZB 4ALAL 4ZQKA 5BXFB 5D1ZB 1G7LA 5J4MA 3PNWA 1INEH 3T0EB 3S5LB 3D39B 1PEZA 2D03H 3ARDC 4YDVB 1D6EB 3DX9B 2APXA 2R69L 4HHAB 4KJWD 1UWGH 5DMYA 5GS3A 1UH2A 3IRPX 1S9VB 4L3EE 1FPTH 4NQXB 2X1QA 1U95A 3EYFA 5DJ2A 4YHOL 4A6YB 4QHUA 5FUOL 3P9LA 4U1IA 1NCTA 3O3BB 3NGBB 3WD5H 1CTOA 3JTTA 4OZHF 5GSRB 5EUOA 2VYRE 1HQ4B 4XNMB 5EBLA 2NY7L 3QB7C 2MWCA 3NFPA 4DK3A 5HI5C 3MO1B 1X44A 1MCCA 4NN5C 3CH8A 4FG6C 3AREA 2EO9A 1ZLUH 1OHQA 2XTJE 4OZFH 4PGDA 4JHAL 3LS4L 1NCAH 3O3EA 5GRUH 3VRJA 4S1RH 4JAMA 4ZS7H 5FGBC 3KYNA 1BQHG 5MEQB 2VR4A 5BOZG 5F1IB 5ABDE 1FNAA 4KJYB 2OM5A 2OXGA 1V7ML 3KNBA 1ITCA 2X4RA 5H8DA 1RZFH 3KPSA 3MLWH 4LQFL 5DWUH 3O8XD 2YK1L 4C83B 1IGTA 4GUPB 5DHYB 2UWEA 1C16B 4GRLA 2D4FA 1EAPB 1LP9A 5I6XB 3TGXA 3KLSA 4G43B 1JRHI 3OZ9L 4HIXL 4XPBH 4P4KA 4Y16D 3TFKD 3D2UD 5D6DC 5KTEH 5B39G 4HIHB 3LRSB 1FNGA 2K9UA 2NX5A 2EH7H 4JPWH 4UUJA 5D5MA 1F6AA 2LQRA 1DEEB 3B9EA 4FTVB 2Y6SD 3GNMH 4HIIB 3X14A 2FH6A 3ZT5A 2VMFA 3I6GB 4P99A 1UWXK 4JN1H 4JE4B 1OGTA 1XGQA 3RL1B 5L2JA 1U58A 3NIGE 4J3UA 1BQLH 4FFZL 5JORA 3SKJL 4MXVE 4WJ5A 5EU3B 3QO0B 5HHOB 2VE6B 3E0GA 1L0YA 3QIBC 3OKLB 4ELKB 4O2FA 4AY0A 3ZDXF 2G2RA 3GMLB 4TVSa 1I8LA 2CLVA 4ALAH 1MFBL 3JUZA 4EDWH 4OD2A 2ZUVA 2HJLB 5CJQL 1LO2L 4OZIB 3FO0L 3W11C 4OD3H 1P9MA 1MCRA 1G9EA 1OSPH 5CGTA 1LNUB 4Q97A 5E4EB 8FABA 3K80A 5CP7B 4OZ4A 5FV2A 5L6YH 3ULVC 4MQTB 3H9ZA 2HT3C 3HA0A 3GBLA 3WO4C 2PW2B 4PJCB 1QFHA 2R2CA 4L4VA 3FO9B 3KLAA 3Q1SH 1SM3H 4L8DB 4FRWA 1T1XB 1P4IH 4YHOH 4UT6L 5FUOH 3SPVB 1X5LA 4HH9A 4PJIE 3OAYK 4JO3L 1BEYH 4FQIL 4PTUA 2VR9A 2YN5A 4Q0XH 3MNVB 4MD5A 4J3TA 4NKIL 2JCCE 3STBA 4HUXA 4BKLB 1XGRA 4OM1H 1MAJA 1KN2L 2JELL 3PP3K 4JHAH 4N5UA 2J8UA 3MV9E 5FHBL 5JR1L 3LD8C 1MJ8H 2EDNA 3C5ZC 1I4FA 1ED3A 2ZCHH 3N1FC 4LLMA 4FQJH 1S5HA 4X6FA 4CVUA 4PLNC 3OKMB 4G6ML 5EU5A 4L4TA 2FATH 1TFHA 3B43A 3HRZB 5I18L 3PL6B 3T2PA 1J1OL 1ZGLM 5CSZA 3H9SD 1V7MH 3EYFB 2XI9A 4IRJB 1AI1L 5DJ2B 3MCLL 4LQFH 4QHUB 1JHKL 1YN6A 3QDAA 4HKJA 1S9KC 1HDMB 1KCUL 2OSLA 4YHIA 3BGMA 5T3ZL 3JTTB 1UWEH 1CCZA 4Z7WB 1K8DA 1L0XA 3WYRA 5DJYB 3RBGA 3WNNA 3NFPB 1F4WH 2WLZA 4LCWA 3E6FB 3LZFH 4FXGA 4KUCF 2WM0A 3OKKB 1AIFA 3AMLA 3LDBC 5I17B 5E94B 3I9GH 1YDPA 3VRJB 1CLYL 4JAMB 2EKJA 3ZDYE 4JPVL 5JW5B 4ELMA 1XF3B 3NPSC 3FOLB 5DD5L 2DWDA 3C6LA 1EBPA 3BZFA 2DMBA 5AG9A 4I3SH 4N8CL 1U2CA 3BDYL 2EZ0D 5D7IF 1OAZL 3MLXH 4TUKL 5T1LB 1QSFA 1H3XA 3FMGL 4I48B 4KRMB 2PCPB 1KJVA 1IGTB 4NPYA 2A77L 1BM3L 4M7ZC 4S1QH 4GRLB 1LP9B 3EYQD 1K85A 2I27N 3QEUB 2A38A 4L1DA 3QULA 4P4KB 1JUFA 4BFGA 1N6UA 5DA0B 5EB9A 2V2XB 2PN5A 1TETL 4OV6F 3BOVA 2KZWA 4NJ9H 2NX5B 1Q8MA 3RZCA 4GOSA 4HMEA 1M7DA 1NGPL 2LV4A 5CJXA 1OGTB 3QWOA 1MFNA 3TN0D 5L2JB 1ITBB 4N8VA 5HDLA 2UZYB 3BIKA 3B4NA 5IKCA 4H20H 4UDUA 4J12A 4WJ5B 4P3DA 4W70A 3SGJC 1WBXB 3KYKH 4D0DA 3QWRA 5IVZB 2FO4A 4O2FB 5CFHA 2G2RB 3B2VH 1UB6A 5CKAA 4JM2A 4EXKA 5I8CA 2JELH 5CZKA 4YDLB 1YEGL 1G6RA 1P84J 2F5BL 3EHBC 4M3KB 5FHBH 4PYHA 2F74A 4ZYKA 1E4KC 3ZLQC 2ZG2A 3LH2L 4RX4D 5KSUA 2MQ0A 2WV3A 4OZ4B 2PTTA 3KLAB 3D3VE 2AGJH 1T5WA 5JXED 5KSBB 3VFTA 4WW1B 1D9KA 4J4PD 2R8SL 4A2MA 3IDJB 3NVQA 4HH9B 2GY5A 5GSVB 1WISA 4PV8A 4M5ZH 2MSPA 4K3GA 4OF8A 2HJKA 5DLMH 4ODXA 1Q0XH 1XGRB 3HUJF 3AS1A 2VDPL 4W4NA 4S0SD 4I18B 5SWQA 1J05B 4F2MB 32C2B 5D7JA 3QIWB 4P2OD 3DMMA 4YDKH 1I4FB 1XR9B 3RWJA 4U6YB 4JRXA 2X09A 1TIUA 1BAFL 5HYSA 1DQML 4OM0H 3VFWB 5C8JA 5I15L 1DE4A 4QRQA 3O0RL 1RZ8A 4V2BA 1KPUA 1DTUA 3HNTH 3WNMA 3QJHA 1YN6B 4HKJB 5IMKA 4PJ5A 4RZCA 3THML 4BQ6A 3BGMB 5JHDA 4M93B 1K8DB 3E8UL 5CLTA 3U2SA 4Z7NF 1E4JA 3L6FA 1A6AB 4WV1A 4P9HH 1MY7A 3CNKA 4FXGB 2WIIA 1TETH 4LLVA 3RWFA 1NANI 5A16A 4L9LC 1X5HA 3UTPE 3UYPA 1U3ZA 2Q3ZA 3VXQA 1RUQH 1YDPB 1AGDA 3L7FA 3BQUD 1FFNA 3UTSA 2HT4C 5K9QI 4NQEE 3U30C 2P46B 2AEPH 3ELAT 5CJ5A 4ELMB 1QFWL 4UTAH 1TJHL 4FFWC 4QGTA 5JW4R 2GSIA 3ZZ1A 3AY4A 3EFDH 4UIKH 2QV2A 4MNQD 4YIQA 2B2XL 1WVZA 1JFQL 2X4SA 4MLSA 5EOCL 3BPOB 2DLTA 3TF7C 1M7XA 3MOBH 2Z31D 3RJDA 5J0BA 2ADGA 5TH2A 1JPST 3KWWA 5A3IC 2MKLC 4OLXL 4R2GB 4XVUD 1UZ8B 4G8IB 2FJFA 4NQSB 3EYUL 4FQXB 1MFDL 4IRZL 4HJ0C 5J8OA 3T2QA 4M7LT 3WFCH 3RA7L 3T2NH 3MC0A 2HMIC 5AUMA 4K07A 4YXKH 3A0OA 3RX5A 5EN2A 4N8VB 4QF1B 5L8KB 3BIKB 5FKAA 5HHNB 1SVZA 2D7QA 4LIQE 3M1BA 4OF3A 3WNKA 3JXAA 1XF1A 5I66B 1CL7L 3BD3A 1YPZB 5CUSL 2JJSA 1CGWA 4GXUM 5TGBA 3O6ML 2FJHA 4XNQA 3G6JA 3C9NA 3K4ZA 5IMOA 2AEQH 2A6IA 1FNSH 4OT1L 4P5TB 1JMXA 5ADPH 4P2RE 3IXAB 1L7TL 1MFCH 5IW6B 3DRQB 2Y36L 3EZ8A 1X5KA 4JVUA 3VD9A 1K2DB 1SHMA 1TCRA 1KNOA 1TTUA 2VIRA 4IM8A 4LGSB 4KROB 3SE4C 4N1HB 5I1KL 1MWAB 2VRAA 3MRLA 3HZVB 4AQOA 1N5YH 1T5WB 1V3LA 2NQCA 2EECA 3WL9B 3VFTB 1VGEH 3MXVL 1D9KB 3D5OF 4Z9KB 5EO0B 5JZ7C 1T2QH 1IGIH 1MRFL 4FABL 1GGBH 1UH3A 1KCRL 3EYVB 3THMH 3BW9B 4OIAA 4IJ3B 2Q8BH 3T77A 4PV8B 4UB0H 4QXGH 1CE6B 2D0HA 3J7HA 1F6FB 4OFPA 2P8MB 3Q6GL 2RBLA 3UMTA 5E2UH 3L3KA 5F7KC 5DK0A 3AMKA 1G7MA 2F8OA 1LEGA 1GIGH 5SWQB 3RKDD 4GO6B 3T04D 4WU7B 5DQJA 2VL5A 4JRXB 5HYJD 1SBSH 4ODVL 3SDXF 5DEGB 3TO2B 1QFWH 5D1ZD 2VN4A 1J0JA 4XB8A 2VUOA 2W65A 3G08A 2XN9E 3RUGE 4CJ0A 3T0ED 5MENA 2E8ZA 2X4TA 1RZ8B 3BGAA 4GMSL 2WANA 5F1NB 3AU1B 3D69A 3D39D 4E5XA 1NCNA 3HN3A 3X13A 3FQNA 3HPLB 4Z7UE 2XQBL 3OSKA 5ALBL 4OGAC 4PJ5B 5HVFB 3K8MA 3BP6A 4G6AC 1S9WA 4V1DA 2VLJA 2BNRD 2WIIB 3BPLB 5DJ6A 1OD7A 2NY2B 1MFDH 4IRZH 4D8PB 2A6KB 1AGDB 4I5BA 4B50A 1NEUA 4PJEF 3UTSB 1NQBA 4OZFA 4BQ9A 5FDYA 4I0PB 4XAWL 2OTPA 2BDNH 2I5YL 3LQMA 1MJ7L 4FXKB 3NIFE 2CGRH 3ALWA 1MHEB 2GSIB 4JKPL 1ZT1B 5FO7B 3ULVL 5IQ9A 2JK5A 1CU4H 3DJ9A 3UAJC 3VG0L 4X6BB 2HLFC 3BT2L 4Y4KC 3EFFB 5JPNA 4XGZB 4C55A 2DBJA 3X3GH 2R9HD 2JJWA 1LE5A 4I4WB 1K4DA 4WHCA 1C7TA 3FHQA 3IB4A 4P0DA 3RDTA 2ADGB 1SJVA 4MD0A 4JLRB 1CLZL 3PWJA 1AGBA 1P7HL 4XWGH 4EIZC 1JHLL 2J2ZA 3DGCR 4NHCH 1AO7B 2Y36H 3ZTJH 4GW5A 3MJ9A 5DJZA 4I3RH 4PB9H 5DD0L 3D25B 2A1WH 3MRNB 3T4AB 5I1KH 2DIAA 3QFDA 5F96H 5AUMB 1BHGA 2W0PA 5KVFH 2JB6A 5EN2B 4PBVC 1WZ1L 3OPZL 5JUEH 5IJKA 1T2XA 5J9PA 5IOPA 3AROA 2UYLA 3MR9A 3ORJA 4FTVD 3WCYA 4P3CL 4HZAA 5F1KC 3MLZL 3NCFB 4NO0A 3NABL 5GGQL 1G9MC 4ONHA 5DZLA 3TWCH 4JZJC 1I1AA 1HXYA 5DJXA 3VG9B 5IFAL 1V7NL 3DUSA 4XNQB 3G6JB 3MLYL 2DMCA 5BS0D 5BO1L 4GKZB 4JG1L 2VABA 3K46A 2A6IB 4M5YH 2WUCL 4X4MA 4PJFA 2H26B 1K3IA 3L3IA 3WKML 3VGHA 3R1GL 5C07E 3VXRE 4MXQD 3BN9D 2H2PD 4WFFD 3MRLB 4OCWL 3SDYH 1I3RA 1YNLL 4PJDA 4JFEE 2EDTA 2P7TB 1G7IA 1YY8A 1AXIB 3LN4B 2GJ6B 5ALBH 5GRZA 2J12B 5JPMA 2CH8A 3T77B 5E9DB 5CEXA 4XC1H 3CZFB 2B4CH 5K9OA 5JW3L 5AAMA 4DGYL 1NGWA 2X10A 3L3KB 1HEZA 4AEFA 3EYSL 3PP4H 3WJJA 1G7MB 3MGAA 4PD4J 35C8L 1B0RB 1W72H 4AEHH 1UFUA 5C09E 1GYAA 4GLRH 5B21A 1ZVYA 4EVNA 2D7PA 1R5VA 3B3IA 2Y1VA 5DQJB 3S88H 1G7JA 1X7QB 1CLOL 4JZNB 4RFNC 1X5YA 3HFML 5MENB 4P2CG 3MMEB 1ZEAL 3D69B 1U8PA 4E5XB 3UTTE 3OBAA 1D6VL 1KTKE 1I3GL 3HZMB 3LSOA 3MBEA 5SWZB 2C3VB 4TUOA 3SKOA 3QRFM 2APWA 5FA3A 4K3JH 1SQ2N 3CSGA 2ARJA 3LPFA 5C0FA 5JHLL 5KVEL 2AJUH 4U33A 3ZDZE 5ITBL 3FL7A 1ZLUK 5DMJB 1S9WB 4MD4A 4V1DB 4R4FL 2N4IA 4IRJD 2EE3A 2ZOLA 5I1CL 3CFJB 2VLJB 1FC2D 1PVHA 5BVPL 2FEEI 5CKGA 2C1OB 2YSSA 2F19H 3QDGA 4I5BB 5DD0H 1P7QB 3SGKA 3UZQA 4DZBA 2B0SH 4OZFB 5LGJA 4NGHL 4KV5E 4YAQA 1AQDA 2WZPD 3OTTA 1G9NL 1DR9A 3V0WL 5T33H 2IQAA 2PYFA 1XEDA 1JK8B 5IQ9B 1A7NL 3H9YA 4H8WH 2FX7H 4TQEL 3V7AE 3NABH 3UJTH 5JPNB 4OLWH 3EYOB 4Y5XC 4ERSL 1K4DB 5HBBA 3SKNA 2C5DC 6FABH 5DRWA 1WF5A 3O2VH 1B88A 3RDTB 5T1LD 5DMGC 4B53A 3MRHA 2R1YA 1UJ3C 1Q38A 4JZOB 2BRRH 4GRLD 4HXAL 2AK4A 1KB5L 1KIRA 4X6EA 4LGRB 1X5IA 2ICWI 4P4KD 1MRDL 3QFDB 2NY1B 4OCWH 4XPFL 5LXGL 4LKXA 4OLVL 1NEZA 2JB6B 4RAVA 4U1LB 2LU3A 2NX5D 4K8RC 5F1SA 2LE9A 1SMAA 2ID5A 5J9PB 3IDGA 4Q6IC 2IFFH 4YK4B 1UQSB 5IBLC 4XXCC 4U7MA 2DQTL 1BIIB 1EMTH 1S3KL 5J6HB 5EU7C 4MJ6A 3MZTA 2AP2A 4DGYH 1I1AB 4N0UA 1HXYB 4GQPH 1I8IA 2NW3B 1TVHB 3UBXI 1NGYA 3V9FA 1JNHB 2C7UA 4MDIB 4NNXA 4PJFB 4U05A 5JW4N 4OF6A 3PDGA 3L3IB 4E41E 5JIIA 3TH4T 1A2YB 5FYJH 4GH7B 4HC1L 4FZ8L 5IFJB 2PNDA 1WFTA 3TYFA 4ISVA 1I1FA 1SJXA 1UM5H 1G7QA 3QRGL 5D2LE 1JNLL 5IHLB 2GY7B 5GRXG 1I3RB 5DDHB 1F8TL 1JRHH 4PJDB 4H1LG 1LDPH 2BC4B 5LGKA 1PYWB 1PKQE 3O4OC 5JHLH 1Z9SA 1AE6L 4JANA 4ZO7A 5KVEH 3B9KA 5JPMB 4PJBF 1CD1A 1FN4B 1YQVH 5CEYA 1BJ1J 1M71B 3NCYS 4LPVA 4F3FA 5F97E 2AJZA 3MX0A 2OQJB 3ZMRA 3BP7B 3LVEA 3FT3A 1P6FA 1QSEE 2UY6A 4U6XA 5IHBA 4EVNB 4P59L 4HGWA 1NL0H 2VLKE 4JM4H 3B3IB 4G5ZL 5IB1B 4NNPH 1S5IL 3VJ6A 3E2HC 4EDXA 3PQYB 5DC4B 2I07B 2DQFB 3QBTB 1A7PH 2F53B 5MP6L 2DB8A 2R1XB 3QIWD 5BRZA 1U8PB 3QT2A 1A7NH 2V17L 4P2QE 2FX9H 4WUKH 5FKPA 4TUOB 5C0BB 3MV7B 1B90A 1W2KT 5FA3B 3SO5A 4L4TD 2EXWC 1RZKC 3O6KL 1FGVH 3GGWA 4ERSH 3CMGA 1U91A 4MD4B 4H26B 2W9EH 4PJXA 4GFTB 2BSSB 3JBG7 2J4WH 3LN5A 2BMKA 1G7PB 4JR9L 1KB9J 2G60H 1FQ9C 2QR0A 3BUTA 3QDGB 3RZWA 5JA9A 5DUML 3CPLA 4O51A 5LGJB 5DGRA 4CADA 2Q76B 4XPFH 4LCWD 1X4ZA 2RCSL 4YAQB 5LGHL 5KVGL 5TFSL 3PDOB 4OLVH 4PTTA 1AQDB 5E8DL 5IB4A 4NQDE 3MTRA 5C0CA 3L9RB 4JFZH 2FIRT 2Z92B 1CL7I 4XCYA 1R3IH 3PWPB 5GIRA 4KI5D 2D7TL 4OCLC 1XF2A 3VWJB 4CW1A 5FYLD 3D48R 3CVHH 1WZKA 3VFRA 4OFYD 5IG7B 1CFBA 3S7GA