4Y1AD

Immune complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
205
Chain Sequence
MQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASSSAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 32
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aD02
3ZT7A 4KUZL 3TO2A 5KW9L 3HC3L 4M3JA 1N7ML 1NLDL 5CILH 3QIBB 1EXUA 2VSDA 4X6CA 1JZ3A 1MPAL 2AQ1A 3NTCH 4KV5F 4WTXA 5FGRA 1SJVA 1OP3H 2CR3A 3SY0B 1NSNH 4R2GD 4NO0B 4JGJA 2X4QB 1SYSA 1A6UL 3D25B 4PJ7B 3QWOA 2VXQH 4M1GL 4X7SL 4F9PC 4JQVC 1I3UA 1RVFH 3BIBX 4QEGA 4NRYB 3RZCB 4OCNC 5D9SB 5K33A 1R5VB 1ZV5A 3S36X 5EZJA 5HDQH 5CLTA 4DOHE 4LOUD 1H5BC 4A6YL 2K3TA 3BKCH 1HHHB 5CJOH 5AAMA 1RMFH 1U6AL 3LV3A 1A4KA 4Q9BA 3GJEB 3U4BH 1LDPH 5D2LE 5GS3A 4M9OA 3DRTA 5DD3L 3BMVA 5BVJB 1AC0A 1NGYB 1KB9K 5DHVH 2EXYD 3OKDA 4ZS7L 3WKMH 3D2UD 2I9TB 1FL3B 2ID5A 3U36B 1JZ8A 3BPOC 4UAOC 2EE3A 3CFEA 3GB7B 1RULH 2M26A 4OLXH 1A9BB 1XF3B 3NCBB 4KHXH 4RGNC 1V8HA 2RFXB 5C0CB 1K6QL 2VLLB 1M7XA 5L7XH 3TYGL 1WT5A 2JK5B 2NX5D 2DQGH 5C0IA 4PJCE 4PJ9D 4Q2ZA 1W72H 1L6XA 5IGXL 2P49B 3MXVH 3CPLA 1KV3A 2C7UA 3RVXD 4LARH 2XKNA 4HK0B 2BNQD 5IEKA 5DZNA 1VEPA 3BP5B 1PX3A 1FL6B 1K3ZA 4I2XB 3EYFA 4LLDB 3DUUA 5IESL 1P7QB 5LBSH 4CDGC 2W0PA 5DQ9B 3NZ8B 3G08A 5HVWA 2F19L 4PJBB 4S0TD 3RUGB 3RVTC 5JPMA 3RJDA 4F8TA 5CP7A 2I5YH 5E08L 3PF2A 1CTOA 3MRBA 4EN3A 1IC5H 1PY4A 2NNAA 3GSXA 4MNGA 3SE3C 5K59F 4XNUL 5INCA 5DJZA 4FFVC 5GSRB 4ETYA 4FABL 4Z8FH 3FONB 3IKCA 2AKRA 4KMTL 1YUHB 3S5LB 4CVWA 3JTSB 3RWCA 2Q87A 5IIEA 4LSSL 2LU3A 3IFPA 1OGTA 1XGTB 1T22B 4P3DA 4GKSA 3U1SL 1EHXA 1BIIA 1CDUA 1A1OA 1R3LB 1M05A 3OKEB 2BK8A 1G7MB 2DQIL 3PGCA 2EH8H 5TDNB 3CLEL 1S7QB 4XHJD 3QCUH 2F74B 3LRSA 4QHUA 2VR9A 1FSKC 5GRWA 2J8UF 3OBAA 1CFVL 2F53E 1F6LL 1JNHA 2EDYA 2H32H 5DJYA 4AQOA 4OKVA 2Z31A 5IFJA 2W91A 5FYJD 5ESAA 4GBXD 3DSNA 3VXRE 3UTQB 3SGEH 1FRGL 1EIBA 1O7SA 5AYUL 2YUXA 5FUOL 4X7DC 4I0PC 4JY4B 3TVMD 5EC1B 1J5OH 1CFVH 4ZAKC 2EEAA 5EB9A 1HILA 2VZ3A 3PQYD 1BZ7A 3SDDC 5I73B 1XH3B 1CICD 4NHUA 3FB7B 2ZG3A 1JIBA 3GSQA 3JV4A 3P4MB 3RP1A 1QLEL 4GAJL 3UTPD 4JN2B 1NEZA 5GRJL 4I0CC 3BVNB 1LK2B 4ESKA 4ERSL 4X4XA 2VISB 4LCYA 3MUY1 1EZVX 1I8KB 1LEGB 3FOMA 3ARBB 2V5YA 2EE2A 1BEYH 4PRDA 5K9OB 1KPRA 3EGSB 1UGNA 1DBMH 3NCJL 3P4OB 1I8LC 2WINB 1U92A 2DJ4A 2FLRT 4UV7H 5DA4A 1AXSB 5DD6A 4U6XB 4Q9RL 3MO1A 4JEGB 1MAMH 3TCXA 5J13C 4JJ5A 3BGAA 4KROB 2NY2D 1KB5L 3EW3B 5HYJA 4GRLB 4RX4D 5ISZD 3QA3B 1EO8L 1GSMA 1ZANH 1UACH 2QSCH 4TSCH 4RAHA 4ORZC 2B4CL 2W65A 3BZFB 3U46A 3KYOB 4YHNB 2JELH 3QWQB 1MQKH 4EI5A 1YEGL 4Y4KC 2WSKA 5I0DA 4WCYH 4P0DA 4ODSH 4Y4HC 5E2WH 5E6YA 4YXLH 1JNJA 4JRYA 5HDBF 2VXTL 3HMXA 4NBXB 1I3GH 3CLFL 2E27H 4U31A 1RUMH 2ZNXA 4W6YB 5BZDA 4WENB 3OHXA 2GAZB 5IW1B 4I3RH 4HEPG 5KVEH 4M93C 5E2WL 4YO0A 2IEPA 3S8WA 2D03L 5JW3H 4MDJA 5DXWA 4NQTA 3QHTC 4M6NH 1A7BA 1ITBB 3L6FA 1IGJB 2JJVA 1DQQB 2ICES 4LQFL 3U7WL 1F3JB 3UDWA 2FR4A 5FGBC 3C9NB 1I1YA 4UILL 3T8XA 5E4EC 4HLZH 5ITBL 4WU7A 2GSIA 2FO4A 1JHKL 3VDCA 2WIMA 2PETA 3QXVA 1WZ1H 4HS6B 4UV7L 3I02A 1Z0NA 3CZFB 4HSQA 1A14H 2JJSC 3OJDA 2R0ZH 3KPPA 3MCKB 4HC1A 1KB5H 2BNRA 2EC8A 3PV6A 4OCXH 4K7FA 3PL6A 4KDVA 2BY1A 4PV9A 5FDWA 2CXKA 5F7UA 3LOWA 1N2RA 1CE6B 4GRLD 1L7TH 3DMMC 2XFXB 4WY7H 5JXAH 5ISZB 2AJUH 3VCLA 3FHQA 2YC1B 4AH2A 4WUUD 4GXVH 1HI6B 4Y16B 3AXLA 3ZKXB 4XTRD 3HR5A 1A22B 5IB3A 1MWAH 2Y23A 3GBNL 1HXMA 3RNQB 4Z0BL 2ICCA 4PB9L 3IYLW 4LPCA 3OGCB 4HFWB 3LD8B 3QUXA 1WSST 4U6YA 2PTTB 3K2UH 3KPQA 1YMHB 1RHHB 4KKAC 4OLYL 5BZDB 4UB0L 3SEPA 5IT2H 4LSRH 4JVWA 5KVEL 2YK1H 4ORGA 1UWXK 4YO0B 1H3UA 3CU1A 4PJ5E 3FFCB 1P2CA 1NGWA 3ARDA 4IEFB 2APVA 2VABA 3MLVL 4WU5A 5I76A 4OFDA 1I3GL 4PGEB 1UADC 3B9AA 2HT2C 2DMKA 1ZHKA 5I8CA 3DX6A 3FO0H 2E7LC 3PHOB 4KHXL 3MBEA 4XNQB 3TVMB 2XG5A 1KJ2L 3BKML 4LP5A 4TTDD 4M7LH 3W9EB 2V5MA 1R5VA 2P5WE 2UWEB 5EOTB 3QDMA 5E99L 4X5XA 2H1PH 4F3FA 2CXGA 3OKOB 2XZCH 5F7NC 3MMEA 5E1AA 3X3GL 2X1OA 3NZHH 4PJAE 2DYPA 3WLBB 2DTML 4P5TB 5E4IA 2R56H 2DRUA 5F7KC 4PJDF 4EN3B 2R9HD 4KK6C 3C60B 5E7FA 3BEWA 4OV6F 3S37H 1A9EB 43C9B 2NYYC 1Q9LA 5DFTA 5B39G 3CSGA 4FFWD 1Y0LA 2MQCA 5SWSE 1TFHA 3KWWB 5F1NB 5J3HC 4OF6A 3LEXA 4HPOH 4HFWA 3VH8A 5KBNC 3NGBB 5D6CB 1OGTB 4NQCA 2CDEB 3T77B 1NLDH 2A6DB 3KLAB 4JM2F 4CW1A 3GJFH 5CWSA 4WHYH 1HWHB 2WBJD 2B0SH 2WK2A 1TVHA 3AM8C 4JRWA 4GG6E 1BBDH 3W9DB 3EDJA 3Q6FB 3RZCD 4I77H 2VYRE 1IM9A 3LH2L 1U8LA 5CEZE 5DTFB 4XBEH 1OPGL 1FJ1B 4JFED 3F7VA 5D93C 2WUBL 1ZHKB 1D9KB 5I8CB 4PJXB 1OGAE 4DW2L 2FD6H 1CYGA 4FTVE 3V9FA 2VLKD 4NRZB 3V0WH 3N06B 3NFNB 4DK3A 1QPPA 4DGVL 4OD3L 1T7ZA 3MACH 5C0AA 3UTTD 1Z5LA 4P5KA 3D39E 4DAGL 3VFGL 4PRNB 3B4NA 2CGRL 4N8VB 5DJXB 5J1AB 1N3NB 2NYYD 3IS1X 4HUWA 1AP2A 1MFAL 4ZUWA 1PZUB 1AHWC 2LU7A 1E4XH 4OD2B 4U4BA 5T3XE 4MWFB 1G9NL 5KZCB 1JFQH 1F2QA 5HDLA 5C0CE 2JB5L 2H8PB 1IKNC 1S5IL 3IU4L 4FABH 4Z8FL 2UZIL 4LNVA 4O51A 1FO0H 1HH6A 1M05B 3OKEA 4YPJA 3KJ4B 3VI3E 4M8QA 3WL9A 4MS8D 3SDAC 2IBZY 4WI6A 1AFVH 3S37L 5E5MB 2XY1A 1QSEB 4I2XE 1BQHA 1MVUA 4G8GD 4WY7L 3N85L 1VA9A 3MRQA 5E2VH 3JWDH 3UYOD 3ZHKA 5IEHA 1Y18B 1ZK9A 3UTTB 4TNWF 1OARH 3RDTD 4JFYA 5F7WC 1CGWA 5I75C 1LP9B 3MV9B 1NAMB 5FO9B 3OZ9H 4Y2DC 5A43C 3QIUC 1PX4A 3GSUB 3NCYS 3QI9D 4MX7A 2ZOLB 1HILB 5IG7B 2VMFA 4Q6IC 4MXWH 4C59B 2YKLH 1NJ9B 1B3JA 1YNTB 4D0CA 1JN6A 4S1RH 3RZCA 1BD2E 2VXVH 1GL4B 2BSTA 1W72L 1I85C 3NIFF 4NWTL 3OPZL 4YUEH 4JO2L 1A3QA 5J3HD 2GCYA 3MLVH 2HTLC 3GMLA 4XPHH 5KN5A 4M7LT 1IE5A 3CFBB 5C0DA 4CAGA 1TTFA 3ARBA 4TN9A 3D9AL 2LV4A 4LASL 3I2CH 3N1QC 1MRFH 1G1YA 2GJ6D 4WWID 3WNKA 4Q0XH 3VFTA 1A4JA 4PRHE 3V6ZA 3IDIB 1QRNB 4MA8L 4AIXA 3BP6A 3QUZC 2J8UB 1KPVA 3MACL 2ATPB 1AHWA 1DVFA 1ETZA 4KKBC 4X8JB 3MODH 4GFTB 3BI9X 3CH8A 5K9QI 4S1RL 4K3EL 3M1BB 2V17L 5ECJE 3V7AG 1NANI 4AL8H 3ZDZE 1OTSC 1MQKL 1FYTA 2HJKB 1NBZB 4L3ED 4QTIL 3CXHJ 3QFDA 1CFTB 1CLZL 3OJDB 2VC2H 2DLTA 2FZ3A 4R4ND 3G6JA 3BP5A 1BBDL 1OWRM 3S36L 3EYSH 2ADJA 4KH2A 3QDJD 3GDBA 2H2PC 4GG8A 4TTGA 2IF7A 2KBGA 3B9KA 5C07E 1HHGA 1MWAB 4A6YH 1YA5A 1FE8L 1D5IL 4LLQB 4OCMC 4XWOC 3VCLB 5T33H 3D0LA 3HC0B 4X6EA 2F8OA 5CJXC 5T1KB 5IVNA 4KUZH 5C92A 5E9DD 3MLYL 1ZHLB 5IW1A 1DBML 3NCJH 1T1WB 1IKFH 4HWBA 4OM1L 4TVSa 2QQNH 1F42A 5BOZG 3TCLA 3GSRA 1P7KB 4J6RL 4ZOCA 1G7HA 1X5ZA 3T0EA 4KDTC 3K8MA 1X7QB 5TQ0L 1I4FB 2HN7A 2VDLH 3RVWD 5B8CC 5D7JA 3QXUA 4L8CA 3K1KC 1RZIA 3TYFA 1QSFD 5C0AE 1GGTA 4JFFA 4X4MA 1MFAH 32C2B 4HH8A 2IH3B 3FAXA 3GBLA 3EO1A 2F54B 3BPNB 1FVEA 1KEMH 4X6BB 1MFCH 2CMRH 4NQDA 3BAEH 1OD9A 4NNYB 3TZVC 4OLWH 5BRZA 5I8KH 3TH2T 1C16B 5A3ID 4FFYL 3MRPA 2PO6C 1MFEL 4LK4A 3C08H 4MQXC 4QYOB 3NCEB 4PYHA 1N0XL 1WBYA 1OTUC 1F3DH 3RY6C 5CCKL 3V52H 3KPSE 2H2SC 3MRDA 3JV6A 4JFDA 3PWPD 4PJEF 5ESVB 1JWSB 5JORA 4NNXA 4ACPA 4S1QL 5GGQL 3DYOA 1EUTA 1ORQA 1MCDA 2VTFA 5CZKA 2BVOA 4GG8B 4M6ML 2VZUA 1RFDL 5FK9A 4GS7B 4DKAA 3UO1L 4X6CF 4AEIH 4U6YB 1T89C 2GSGA 2IANB 2EE9A 1EHAA 1MFNA 4XWGL 1W8NA 3LKNB 1S9XA 3RWIB 5INCB 3HPJB 3WN5C 1D6EA 3EZJB 3VXOB 3AAZB 4M5YL 4ZAKD 2I24N 5EOQH 3WDHA 3O3BB 4FMKA 3CC5A 5H2BB 1QUNA 3N9GL 5C0BA 3U82B 4PGEA 4O2CA 1ONQA 2R2EA 1M1SA 1E28A 1PYWA 2GJJA 2HLFD 3GSOA 4CW1B 1C08A 3DX8A 4NCDA 1FDLL 4NZRH 2HFGH 1UWXH 5T3XL 4OV5A 4NUJA 2R0LL 3R06A 1X5IA 1FFRA 4GBXA 3DMMB 1XR8A 5MERA 1JYVA 3L1OL 4EUPG 3LQAL 1FO0B 1HHIB 3BFOA 2BSSB 4HFUL 3HAEG 5EU3B 4K2UL 1QQDA 1AKJB 1HHKA 3TZVA 2DQDL 5CSBA 5D7SH 3RUGE 1JNNH 2H26B 1CGSL 1MH5B 2X4SB 3LD8C 2DM3A 4HGMA 5CP3A 4AZ8A 2W9LA 4GKZA 4MDIA 1QNZH 3GJEA 3WLWD 3QIWA 1MHEB 2FL5A 2FWOB 1FORL 2KZWA 4O2EB 3QNXA 4YXKH 3SKNB 7FABH 1D6VH 2IPUG 3P4MA 4OIIH 3U36A 5DQJA 5E6IA 2IAMB 5DFWH 3CUPA 4N5UA 4GW1B 1Q9WB 4LFHG 1UZ8A 1GCFA 1WIUA 2R8SH 5E70A 4FQHA 1EO8H 3WNPA 2ZKHL 5F9OH 2A6DA 4AEFA 1KN4L 2AJ3B 2YD7A 2XWJA 3TVMC 3OGOE 3TWCL 3VFWA 4RFEA 4AIOA 2X6MA 3H3BC 3QIBA 4NQED 1AXSA 1KBGL 4NO0A 3MODL 4KQ3L 1SYSB 1ZANL 1NGXA 5F7YC 3SOBL 5HI4D 1NBVH 5HI5C 4GRLA 3FOLB 5EZJB 1R3HB 4XHJC 4XBPA 3VD4A 4F37K 3B2VH 1FGNL 1TJHL 1I3RB 4ELME 1EK3A 4GBXB 5DMJB 2A2QT 1V3JA 4LLWA 4D0CB 1U8JA 2ARJQ 5DI8B 5GS0L 2XA3A 5AG9A 5SWSB 3LIZH 2V7HB 2IPKB 3D69A 3MOBH 4KK5C 4NKDB 2DQGL 3CFIC 3JV0A 4X6DE 4ZS7H 3OB8A 2NY5H 5E8EB 5DJDA 2H6PB 3V0VB 4YWGL 1CS6A 1I8LA 4QT5A 4BUGA 2HWZH 3VRJB 2N4IA 4DN4L 2D9CA 3UPRA 3LEYH 1JPGB 3O8XC 5GJSH 4OTXL 2BCKA 3ULUF 1TLKA 3HI6H 5DHVB 1QR1A 1SY6H 4KJYA 1A7RH 4L8DB 3DUSA 3WKML 2FO1A 3L3JB 5JIIA 1F3JA 4ODVL 1X5HA 3VI3F 1G7IB 3DV4B 4U6HA 1INDL 2XRAH 3MRGA 4LFHD 2DQUH 2QADB 2Z31B 3RHWK 4M43H 2HKHL 5MEQA 4IRZH 5IMOB 4N0CC 2DQFB 1Z0MA 5FEBA 1MCOH 3Q48A 2E6JA 3QCUL 5E6ZA 5E2TL 3RGVD 5TE7L 1RZJH 1RIVH 4HJJL 4P48A 4PFEA 5D2LF 3B8YA 1L4IA 3NIGF 4F9LA 1JGUH 1AGCA 2R0KL 1JFQL 1B0GB 4B0MM 4PV9B 3C09B 5FDWB 5J7CC 2G9HB 1UA6L 2ZNWA 3QIWD 4MQXD 2NNAB 1ZWIA 2JKXA 4MNGB 3OKOA 3HC3H 3VXMA 4YPGA 3D85D 3IKCB 2Y72A 3QBTB 5GSRA 4K71C 3NN8B 2RIKA 4Y19A 3HI5H 3KJ4C 4JFXB 4PJGB 3T2NL 3SDAB 4H88L 4Y5VA 3FO2B 1QSEE 1HYSC 1T1XB 2F58L 3BP6B 1ACYL 2AEIT 3NPSB 1IC5L 3EKCA 2HJLB 4WWKB 3DO3A 3E1F1 3RA7H 1D3CA 5F70A 5TDNA 3Q5YA 3VWKD 1R0AL 1OPGH 3P0VL 2BVQA 1IGTA 4Z7VA 3PL6C 4ZFOB 5TFSH 1LP9F 1NGWB 2P43B 5KS9F 5FGCB 1V3MA 1UJTA 3DUSB 1S8DB 3P73B 1KN2L 1YY8A 1S7SA 3MRFA 4LCIH 4R2GC 5TE4H 5FECB 3HA0A 5TDPA 4E5XB 1AC6A 4PG2C 5C8JB 1BLNA 5E95B 1WFTA 2YRZA 1U8IA 3KG5A 1AD0B 2Z4QA 3QEGL 1WQVT 3MUGB 3OXRB 2VAJA 4LSTL 4GMSL 4UI2A 3OPZH 4YQXH 4XXCC 5C0BD 3DWTA 2Z31D 3I3DA 2VXVL 4P46A 4LBEB 4HT1L 5L8JB 5J11B 1IT9L 3PNWB 3RJQB 4MD0B 5FK9B 4OFYA 3GJFA 5F1IB 4PRHB 4TVPE 1HNGA 3G5YA 4JPIA 2VUYA 2MFNA 4RRPA 4RMRA 1PZ5A 2ENYA 4G6AC 4DUWA 1CT8A 1FZOA 5F97E 1T89A 3DNKA 1XF1A 3ARGC 1AGFB 4YFEA 3TFKD 4M7KH 3DYMA 1I1RA 4MA7L 4QOKE 5DDHB 4L3AA 4BH8B 5DHYB 4JKLA 3MCLL 1T0MA 1JVKA 4NNPH 4LPUA 5GJTL 3GMOA 3MZGB 4UNUA 2FIRT 2VUOA 3ZYIA 4M00A 4AM0B 2DDQL 4IHOA 4OLZH 1OT2A 1FO0A 2QHRL 4PJHA 4X0KB 4WVRA 1CXKA 5BVJA 3NIFE 1H3GA 2W07A 3UYRH 1EHLL 2OTUB 3QIUD 1T83A 1KIPB 4RX4A 5ISZA 4ZMAT 2QV2A 3QJFA 3S3SA 3VRIB 3MGOB 2A83B 1A3RH 4PJAB 5IBLC 3IS0X 2E6QA 4NT6B 3VW3L 3RDTC 1DQLL 4HUMB 1OAUH 4ODWA 4YAQA 3D18A 1KIRA 4ZQKB 3UDWC 4O2EA 1FV1A 3BH8A 4JVPA 4I9WE 3B6SA 2VR4A 4ZAKB 1YPZE 4JQIH 4XC3H 3SPVB 4GKNA 5JHLL 3KR3L 4JZOA 4PB0H 4KHTH 1X44A 4XVTH 2R2HB 4HIIA 3WNNA 2F5AL 4G8IA 1HKLL 2R2CA 1D5BA 2XI9A 2OXGA 4G9DB 4L4TD 4N68A 2E6PA 1K5NA 1F13A 4XRCB 2NXZD 3T1FA 4B7IA 5FFLA 4KRNA 5BW7A 4HXBL 1J0JA 12E8H 1UZ6E 4DKEL 2JF1A 4S1DC 1UWEH 3OJ2C 4HPOL 2ARJB 1N59A 4WNQB 3DX9A 1CWVA 3RWJB 4HIJB 4EDWH 4JDVA 4GAGH 5IK3A 4MMZC 2DJUA 4MNQB 1OAZH 2PTVA 8CGTA 2JIXB 1PSKH 4W6XB 3TGXA 1A6UH 5ENWB 5D1ZD 3TC9A 4PRPE 1BX2B 5EOTA 1LP9A 5JXEA 1NFKA 5FYKH 3E2HC 2FZ3B 5T3ZL 5DJAB 1A6VL 1ZGLB 1CDHA 4HLZG 3WLBA 1EEYA 2A73B 3QG7L 1CZ8H 3ZDZF 1MY5A 2P44B 5F3BA 5IUSA 4EZMA 4JO4L 5LWYH 3GI8L 4U1NA 5HD8D 3I6GA 2CLZB 3GKWH 2YA2A 2NY6D 3UEZA 3CFBA 4HWNA 1RJZB 3KXFD 1KFAH 2HT4C 3KYAA 5I18H 1NUGA 2JELL 3LKRA 4LEXH 3GMNB 4PGDB 1YN7A 5IMKB 1DCLA 1JPST 2YBRA 2D7NA 4WO4D 4TQEL 2W9DH 1NKOA 1C7SA 2EYTB 2VRAA 4DCQB 5IW6B 3O3UN 1RK0A 1D5BB 1A1OB 1DR9A 1R3LA 1Y6NR 4KI5D 1ZA3A 4FZEL 1A7NL 4KK6D 3CGTA 1F58L 3KPPB 5KVDH 4P57A 4FXKA 5CUSH 1P1ZB 4GXUN 4HKBA 1BVLB 3FQTB 4JFDD 4NJ9L 4NNYA 1YEFH 3QSKB 2Q6WB 4AEHL 2D3VA 3MV9E 4PJDA 4KAQH 5DRXA 1CE6A 2J88H 3FB7A 4U6TA 4XPBH 1MHCA 3P4NB 1WCBB 1M7DA 1J18A 1A6PA 4P23B 3K4AA 2ZUYA 3T0XA 1HI6A 4Y16A 2X09A 3H3KA 2HKHH 1AGCB 4PV8A 3MREA 2O93L 2ERJC 3TBTB 4ERSH 5DUBB 4P2QE 2EDWA 2BOBA 1GPOL 1IAMA 1VACB 2HT2D 4WV1C 1FLTX 4ZS6C 4X7TB 2IGFL 3T0ED 4JZJA 1VFUA 1A14L 2ICEB 4ELMA 4BQ8A 4G6FD 1IAIL 1QSFB 2GY5A 2NY1B 2CH8A 3T3PF 3OAZK 3TO2B 4YXHH 3OKNA 5EOCH 1I75A 1WBZA 3ROLB 4NC1E 1PG7W 2OMNA 2AJSL 4H25B 4WFHD 4G42B 1XGQB 5D7LE 2W0FB 5KG9B 2YPLB 1UC6A 2EIZB 3B5GA 4H88H 1EXUB 2BVQB 4G6AD 1E4WL 4U6HB 2OK0L 1A3RL 1XGYL 4O2CB 3HE6C 4OM0L 3LKSB 4PRAB 4ZO9A 4XTRC 3CLEH 3PP4L 1WV7T 3LS4H 1S7RA 4ZPVB 2AGJL 3F7VB 1EVTC 4ZO6A 1HSAB 1DZBA 4KJQC 3WHXB 1GHFH 5EFIB 4OSUH 1MFBH 1Z9SA 7CGTA 1BF8A 3B2VL 3VD3A 3HRZB 3IDNA 4YHNA 4EOWL 2IALB 4HQQH 1HHHA 2VE6A 2XN9E 2Z92A 2AJYH 1JZ2A 4FXGA 4JFEE 4XNZB 1GOHA 1MCKA 4M8VA 2NW2A 3SKJL 4XCCL 1BVKB 1OTTC 4MB4A 2IPTL 4Y19E 1XGRB 5C6WH 1MHHA 4Y88A 2XZQH 1FFNA 1P9MC 4MJ2A 2XTJC 1BREA 3LN9A 3L95B 1QRND 4U1JB 2CDEA 1MCIA 4WUKH 4OAWB 4LPWA 2J5LB 3HRPA 4EIGB 1M6OB 2JK5A 1MCNA 1EBAA 5EH1A 3RX8A 4AG4L 2X4RA 4LSQH 3IAPA 1MLCB 2Y06H 5L9DL 3MLWH 1YY8B 1KT2B 3M1BA 2DLFH 4WHDA 1ZEAH 1FJ1A 5C9JB 4KI1A 4BZ2H 3QDGA 3EYOA 5IGXH 1C08B 4RFEB 4N8CL 1CGSH 5CEZL 1T20B 2FYYA 4F7PB 5FXCH 4A2LA 3HNVL 1YJDL 2QQLL 3LZFL 5IFHH 5CJ5A 3FKUS 1D9KD 3GNML 3BZEA 3VXTA 5D2NC 3CDGB 1S7RB 2YXMA 1G7LB 4ZPVA 4EI6B 5FYLL 1AIFB 4Z0XA 1FQ9C 3D3VA 3MZTA 4CMMB 3NA9H 4HUVB 2VLJB 4Y4FD 3CVHL 1DL7H 1I1FA 4R4FL 4EI5C 1I7RB 5BVPL 3F62A 2R0WH 2KL6A 4HUUA 4BFGA 4HH9A 3TJHD 1BOGB 3QUKA 3P9MB 3KJ6L 4MJIA 1JCKA 1NEUA 1SM3H 1BVKA 1INEL 1UYWL 3T2NH 5JDJA 4CN1A 2UY7A 2D7TL 2RCSH 4Z95H 5C0JA 1T22A 5C3TA 5DVMA 2W0LA 2YPVL 3F6LA 3HG1B 4XPBL 3MNWB 1NPUA 1G7MA 5BV7C 3ZDYE 5HVFB 1OP5H 1DUYA 3DURA 4P5TD 3UTTA 5I1EH 2WLYA 4FQ2L 4RAUA 3RGVA 3I3BA 2IC2A 1FORH 4JR9H 3T1WA 3IAGC 4NZTL 1X5KA 4QHLA 5I15H 4CGTA 1UJ3A 1UQSA 5GRXG 3W9EA 1PQZA 2AABH 2AJXL 2CKBL 4NZJA 2DQFA 3L5HA 5IR1B 1TENA 4I9WD 3ULVE 1UWGL 1R3KB 3ULVC 1JNLH 3ARPA 4XMPL 4HGKC 4M6AA 2AJZB 2OM5A 3TO4B 4N0FB 4OZHA 4QHKI 5FHBL 3IJYB 1T1WA 5EORL 4FQXC 2R2BB 2CMRL 5HI3C 2XTLA 2VXSH 1BM3H 5TDOB 3LSOB 4FQJH 5L6YH 3IFPB 4LIQH 1SJEB 2X42A 4Y5YA 5BRZE 3HMWH 4JLRB 5B3NA 1JPFA 1NDMB 4PJ8A 4P2RA 3C8HA 1BOGA 1S7UB 4LARL 1IC7L 2X9YA 3UPRB 2W59A 3JXAA 3LKRB 1FIGH 4JZJC 5DTFA 1AE6L 5H35B 2COQA 4BZ2L 1TQBC 4MCZB 3B5HA 3EUUA 1MQ8A 1BJ8A 1JGEB 5C3LD 4DEPB 1CDGA 3KYOA 4W6WB 5EDXA 4HXBH 4NQDE 3QUZB 4NC1C 1KLUA 1PKQB 1MCSA 1T5XA 3QUML 2CDFB 1U91A 5HHVL 4ONFH 2C3VA 4AK1A 5GS1A 1CF8L 5MEQB 5E8OA 4BSVA 3PJSA 1E27B 4M5ZH 1NC2D 5DJAA 4KV5E 4JFDB 2ADIB 3HZKB 4DJMA 3GMQA 4WEBL 3K7UA 1B9ZA 4JVUA 3OXRA 1N0XH 1Z5LB 1IRAY 3F7YB 2YUVA 3DROB 1FVDB 4ZFZB 3X3FH 4MA1C 1JBJA 1II4E 4PRDB 1J1XH 2GJ6A 1VGEL 3WD5H 5F6IB 4JFOA 4ZUSB 4OF3A 4Q97A 3BUYB 2B1HL 5IV2B 1K8IA 2PR4L 4JO4H 2W9DL 5ID1A 3KXFB 1QBBA 1IGCH 3QWRD 4NO3B 4LGRB 4QTHB 4C58B 1DLHB 3ZYOA 5D5ME 1HQRB 2GSIB 1KJMA 2FHFA 3GSNH 4DOHB 1OAUL 5IJKA 3UJTH 3KPSA 1WWAX 1IQWH 1J1PL 4F80A 1QOKA 2Q1EA 2XKUA 5IBLD 1U0QA 3PIQB 4UT7L 3MCLH 1FZMB 4PJEE 2EO9A 3X3FL 4QNPE 3B2UD 3F6IA 3GMMA 1VHPA 3T2OA 4OCRH 5EZOL 3WIFB 4FNLH 3WE6B 3BESR 1Q0YH 5IJVB 3SCMD 4WW2A 2HTKD 4ONGL 4I13B 5HYQB 1JTTA 4QXUL 4OCYH 1A6AA 1IEAB 4U3CA 5DSCB 4Y1AB 4IRSD 2DQHH 2X89D 3OGCA 3O2VH 3BGMB 5IB3B 5EZIL 2A0LC 4Y5XC 1U8HA 4RGOL 3RIFK 5LVEA 1QSFA 1FFPB 2Q20A 4YBLB 3TFKC 4X8JA 5FDYA 4WFED 4JPIB 5GS0C 3VG9B 4XH2A 3VFVB 4Z77A 3O6FB 5FA4B 5EU6E 4C56B 4C56D 4DKEH 4H8WH 5C07A 3W0WE 3R1GH 3ARGB 4KZDL 2HRPH 1J9CT 4FZEH 4JY5L 4KK8C 4PJBE 1KCVH 1ETZB 5FCUL 1ZSDA 1IILE 1ZVYA 1UCTA 4L4VD 5JW4R 1IGFL 1T1ZA 1WAAF 2BRRL 4P23C 3KPSB 4RWHA 2CIIB 2DI7A 1IQWL 3M45A 4I5BA 4ZUUA 2CRYA 4BQCA 1RZ7L 4U6VH 3ARWA 4IHOB 1LVEA 4EEEA 2NLJA 1IGIH 3GMMB 4JM2A 2V5SA 2PXYD 4ZNEA 2CKBH 3U6RB 5DJ6B 1CFQA 1QSFE 5C0AD 3TA3D 2MPAH 3S97C 1FC1A 1FVCB 5IVOA 4HUUB 3IDJB 1C5BH 4KK8D 5DQDL 1KCVL 4WW2C 5JLZB 1NDGA 4PJGA 4HZLA 4Y5VB 5D7LB 4YE4H 3MGAA 4KKBD 1PD6A 4QRTA 3W81A 1SY6A 2YUWA 4RBPK 4OFKA 4ZXBD 3GSNA 1VGEH 2MCG1 4D9LH 4FTVA 1W8OA 3A6CL 2EDTA 4R26H 5C07D 1DBAH 2CO7B 2YWZA 3TNMB 3QJHA 4DZ8B 4UIKH 2PW1B 5GZOD 1KENH 2BDNL 3BQUB 5FUZL 12E8L 4XB8A 2IG2H 5T3ZH 5DGRA 5BJTB 3PV7A 4NKOA 3GHBH 3NCFB 4R4BA 1DQMH 4X9BA 3TH3T 1AO7B 4LKXA 5GISH 3IF1A 3BMWA 1OP3K 3PGDA 2CGRH 3V4PL 1N5YL 5E6ID 2XQBH 4LSPH 3VFSA 3RGVC 1FZJA 1XF4A 4HV8A 5D72H 2DM4A 5D9SA 1FC2D 1UM6L 4N0CD 3PP3K 1R5WB 1DN2A 3HNTL 2PKDA 4N5ED 4IRSA 3QI9C 1INDH 3TO4A 1Q9LB 5HHMD 5D1QA 1YY9C 1KJ3H 3I9GH 2CIKB 4Z7NF 3SCMA 3DVFA 4MLSA 3O3AA 3C6SB 5TQ2L 1EEYB 1H9VA 1KCRL 1A1NA 4YEEA 3ARRA 3RTQC 1MNUL 5I71C 3AM8A 3WO4B 2LQRA 4NOBA 1GC1H 4WWKD 3GHEL 3RAJH 4MD5A 4KRLB 5FGSA 2GTZA 2X4TA 3SDCA 3ZTJG 4MXVE 3SDAD 2EDOA 3HPJA 5IVXF 1GGBH 5D7IA 4M48H 2ZJSH 3C5ZC 4P46D 1EH9A 2BXYA 5IF0A 5D7LA 3T65A 4DKFH 3LZFH 3ARFC 2IMNA 1BD2D 5KSVA 2BSSA 2OJEA 5JXEC 5EO0A 4KK5D 1DQDH 1IC7H 1S78C 5AZEL 1QVOB 3VXSD 1MCRA 3N50A 5L2KD 3ABZA 3MRJA 4R7DA 2VDRH 2MOVA 2C3VB 4ZNCD 4PRPB 4YC2C 1RQ5A 4U3HA 1HHIA 4XPGH 3V6BR 2HP4A 2AEWA 4OLUL 5DWUH 2QADD 4XP5H 2AI0H 3BH9A 3V7AE 5E9DA 4M62L 2ADIA 1A7RL 3RBSA 4NRXA 5GQBA 4HV8B 2G5BA 3O45B 1F4YH 1EGJL 5LGHH 4WEUD 3W11C 4PP2B 2OL3L 3QEQE 4FXGB 3GJFB 3OKMA 1KG0B 2OLDA 3FONA 3HFML 5BV7B 3DJ9A 1AE6H 1BGXL 3MRKA 2IAMA 1UCBL 1KGCE 4PY8I 3V6FA 1BFSA 4UDTB 5FO7A 4NQSA 3IRZA 5HJ3A 5TF0A 1MVUB 4L8SC 3CFDB 3P0GB 4NQDD 4OSUL 4QCIA 5FKPA 2J12B 5I1HH 5ICZB 3G5ZA 5ISZE 5BVPH 1MAJA 3U30C 3GNMH 5TDPB 4N9OB 1ROWA 3SGDH 4JAMB 4JB9L 5SWSD 4NO5A 4FQCL 3H42H 4PJAF 5BQ7B 1IZKA 3BO8B 1AR1C 4ZG1A 2VLJD 4Y4FB 4Y19D 1JE6A 4GSDL 3G6AA 4H20H 1UWGH 3ZKSD 3LQAH 4JCLA 4QRPB 4BK4A 3RX5A 4FQXB 4X6EB 5T1KA 2VR5A 3UYPA 1BQLL 2GCYB 1D5ZA 4Y4HB 1ZVSA 1H5BA 3QZWB 5T3XH 4HX1A 1XH3A 4OI9A 4XWGH 3O81A 1U9KA 5JQHC 1OAKL 2A6KA 3P0YH 4PS4H 4LHUD 1U42A 4YIQB 5TGBA 5D1XD 2YD3A 1TNNA 4YXKL 4HDIB 4LLVB 4JRYE 2P5EE 3V5HA 3NH7L 5BS0D 5C0GA 5A2JH 3UJJL 3H9SB 4U1JA 2Y5TB 3HS0B 2J5LC 5DT1L 1NCUA 2D0FA 4NKIH 2A6JB 1UXSB 3E0GA 3KPRE 4KKAD 3GRWH 3HKFA 4OB5L 2D7OA 4XVJL 4Z76B 5LJYH 4N5EC 4J3WA 3BKJH 4OCSH 4P9ML 4EOWH 3UPCA 4ZD3L 1VFAA 3P30L 4TUJA 4OZGB 1NFDF 4R90L 2KQMA 1JWSA 2UVEA 1AY1H 3BEWB 3NACH 2Q8AH 3SHSA 5JORB 3DXAD 3CU7A 4NWUH 3WJJC 4PYGA 3FT4A 1WBXA 1P9MA 2NX5E 2V2XA 4YXHL 3EYUL 1W2KT 3FT2B 1MJ7H 2WWKT 4PGZA 1A7PL 4JB9H 2VLJA 4O58L 3VE0B 1MCJA 1U8PA 2B20A 1H5BB 3QZWA 4J4PD 3CMOL 5ABDE 5D5MB 2BC4B 4X7FC 2YPLD 1OW0C 4XCYA 5H2BA 1FG2B 1RY7B 2F54A 3SO3C 3PP4H 5KS9A 1T04A 3ILPA 5C08A 3GSVA 3MRCB 1OGAB 3SQOH 1U8LB 5IBUB 5H37H 1AXTH 5DO2D 2IGFH 1JZ6A 4FQLH 2DD8H 5HYJB 2BOCB 2XTJD 5JHDD 2FR4B 3TEUA 1G6RB 1KBGH 3ZZ1A 1QACA 4PJEB 4TUOA 2MJWA 2ZCLL 4NKMB 1QFWL 2YRPA 1ZHNA 3ARYA 2Y5TA 4PUBH 1A5FL 5LGHL 5CKAA 4TULL 4R4BB 4Z7UB 1NGZA 2FJHA 4Z76A 3L3HB 2Q76A 2W9EH 4D2NA 5K59E 3FQNB 4ZUVA 1P84J 2NY7L 4DZBA 3MBEC 1U8MA 2IH1B 1UM5L 3HE7D 1ZHBA 1NBQA 3ZTNH 2IALA 5DJ0B 1NC2A 3EO9H 2AXHA 4ZNEE 4BKLB 1EHLH 3LN5B 2EYRA 4FZ8H 2ITCA 5D2LA 2H8PA 2NW2B 4ODTL 2ZSWB 1YPZB 1WICA 1NDGB 1KJ2B 4RSVA 4UT7H 1EERB 3QWRA 2AAVA 3IDXH 3VRLF 1S9YA 1RV6X 1JV5B 3BWAB 4HKZA 5L2KA 3E2HB 2R15A 2OI9C 3OKNB 1P6AB 1NCAL 4LRNH 5HGBA 4G8EB 1IFHH 2VDMH 4Q0XL 1YN7B 2ITDA 3GSNL 3PXHA 3O41A 4WO4B 4AJ0A 5IHUH 1SJEA 4X6DA 4PRIE 4JLRA 4UV4L 1NMAL 1ES0B 4OZGF 5FYKL 3GO1H 3S96B 1NAMA 1UG9A 1I9RH 1Q94B 1IAIM 5CMAA 5C0ND 1UJ3C 4J4PA 4NKOB 3OTTA 3QG6A 5FYKE 1VFMA 2OJEB 1NJ9A 1U6AH 5DDHA 3KLHD 1HOCA 3VMPA 1UFUA 1WCQA 3VFNB 3QDJB 2C1PB 3MOAH 3HPLA 1CN4A 3HE6A 3HB3C 3PIQA 1IT9H 3QQ3B 3B5TA 5CAYB 2CQVA 4D8PA 4JDTL 5C0BE 1I9JL 3O4OB 4OUUA 3WNOA 1J87A 4LIQE 3K2MC 3FQNA 3ZO0A 2DF3A 3MMEB 5E1AB 1MJUL 2BVTA 4GKNB 1V7NH 4U05A 3WFEL 2HJFA 3VRJA 1A1NB 4QTIH 2EC9T 2OS7A 1IGML 5FYJE 4ETQB 1F02I 4JKWA 1UXWB 3TBSA 4KI5C 4E41D 3C5JA 4YX2H 2UY6A 4XBGA 3UAJC 1AHWB 3BE1H 2HVKB 4R26L 4D9RD 3MSPA 4QRSB 4CBPA 4JRXA 3UJIH 2WUCL 2GJ6B 2NXZB 4LKCB 2EIDA 4L4TB 3SDXB 4YHLH 5ERWA 3BQUC 4GW4A 1ADQA 3WFDL 1ED3A 5JHDA 3U0TA 2ARWA 3IDMB 4U33A 3MRRA 1OGAD 4PGJA 1LO5B 1P69B 2XXMB 3DETD 1KTDB 1NGXB 2E9JA 5HD8C 3HMWL 3U83A 2CLRB 4DUVA 1NFDB 4FFVD 1IBGH 4R7DB 5JDSA 4OCYL 1K9TA 4LRIC 3U4EA 1K4CA 4HWEH 1SYVA 1IMHC 1XFPA 4NZUL 4P4KB 3ARED 1J11A 4X4YB 3QI9B 4C4KT 3TPUB 2DIBA 3RU8H 1DUZA 1RZKL 4TUKH 4ZPTA 3CDGA 1ZLWH 4UMGA 2FX8H 4KROC 3U2SA 2DDQH 2G9HA 3JV4B 4QRPD 3T2QA 4CMMA 1YECH 4LLYA 4Q6IB 1MFDL 3BAEL 4JHZA 4QXTB 3JBG7 4NNPL 5F1NA 4U1KB 1U8NA 3ARXA 2YPKA 1BJMA 1X5XA 2P48B 3Q1SH 1WVZA 5EUOE 1TCRA 2D7MA 3RY4A 3BHBB 5DJCB 4ENED 5E8DL 3ARFB 4U6XA 5EBMB 5EUKA 2AXGA 1QO3B 3DUHA 4YBLC 5EZLA 1P4LA 4H1LB 4QYOA 3S7GA 3U7YL 1YECL 4YDKH 4S1SL 1EAPB 3FQUB 2A6JA 2Z8WC 4HGWA 1GOGA 5I6XB 3WO3B 5C7XH 4DVRH 4EVNB 4PG9A 1MHCB 3P4NA 2F19H 3PQYA 2JJTA 4ZSOB 2DIJA 3OR6B 4FFZL 4DN4H 1FO0L 5IMLA 3FO0L 2XA8L 5JW5B 4QHLB 2A38A 2ZUUA 5E4EB 4YDJB 3H6JA 3AS3A 3D0VB 3RBGA 2VLKB 1WC7B 4TNWK 3ZSTA 4K94H 4JFEB 2RGSA 1L0XA 3RUGA 5FM8A 3MQIA 4R0LC 4KGLA 4PJ8C 2MCPH 4YBHA 2NXYD 2UV3A 2VH5L 3IXAA 4RDQG 4Y19B 3RKDC 5IB4B 1R0AH 2EE6A 5D1QB 3LSOA 2J6EL 3ROLA 2BNUB 2Z8RA 3OKLA 4IRJD 3MNZA 2BJML 4Z7QF 4OLXL 3BUYA 4F7TA 5IB2A 1UB5A 1MCQA 2RBLA 2R4SL 5TE4L 4PP1D 2R1XB 2ICEA 2AK1H 3QQ4A 4Y5VC 3TJHC 1OGAA 4LLUA 1LK3L 4JO2H 2AXFA 2B1HH 3QCVL 2AXGB 4EI5D 1SHMA 2NTFB 1H3WM 4UIMB 4PJEA 5CKGA 4Y4FC 3ULUC 1Q9KA 2UWEF 1D5MA 1F2XK 1HHJA 3U7YH 5J6HB 3DBXA 3MLXH 4HGWB 1RIHL 4APQD 1NBZA 4OQTL 1NL0L 5D1QD 3UZEA 1PQZB 4GMTH 4L5FL 3RWFB 2Z92B 4OD1H 2C4FU 3VFRA 5DRNA 4E41E 2E3VA 2QSTA 1IEBA 5T1LA 1FAKT 4B50A 1NSNL 5B38G 1W0VB 5IM7A 1BPVA 1FZKB 5DQJB 5E6IB 1HK6A 4GRWE 4JG1H 4PLKC 3HI6L 3M8OL 5MEPA 1KSRA 5CIPH 1QD0A 1KB5B 3RWEB 4ELKB 4I3RL 3F7YA 2RQ8A 2VDQH 2F8XC 1M6OA 3WIIL 1TZHB 1PFCA 1RIVL 3B83A 2HWZL 2AEQL 2J3SA 3H9SE 3VXSB 1S9YB 5KAQG 4QO1A 4YDLB 3QEGH 4LVHB 5ALBL 2AK4E 3L3DB 1INQA 5D8JH 3WO4C 2BNQA 4G80B 2YK1L 3BPLC 4Z18A 3F58H 4HFUH 5D7LD 2FIKA 3MX0A 1R3HA 4I48A 4Z7OE 1F4XH 4QRQB 4PY8J 5EPMA 1H8NA 2BZDA 3WV0A 2Q8BH 4NRYA 1FCCA 5SWSA 4MAUH 3X11A 2FGWL 4RMVA 4IS6A 2W65B 3EBAA 1WGOA 3BZEB 5E8EA 3DVNB 4YNYB 5DZLA 4HLJA 1ZHLA 1RK1B 5I1AB 5SWZD 2GTWB 4KDWA 4ZDHB 1KLFA 3DRTB 2R1YB 3FCTB 5F9OL 4F58H 2NY2C 4K7PL 4M6NL 4YK4C 4KK9C 4HF5L 2J6EA 1U8HB 1YMME 2BVOB 1NMBH 3ARDD 4ZUSA 1NCTA 5HHQB 1NEZB 3LMJH 2YN3A 1WISA 2C4XA 5MENB 5ELIA 3RWEA 1SVZA 2ITDB 2DM7A 3IDYC 4QRSA 3QRGL 3IFOB 8FABB 3DSFH 1KEML 2L4OA 4MDJB 5IKCA 5CBAB 2J2ZA 1XF5B 5C0IB 4NGHH 4U1MA 2C3GA 4RZCB 2ZUWA 2P5WB 5FUCE 5ICYB 4R97B 4D0DA 4JFZH 1I7UA 4K9EC 1RUKH 2EEDA 4LF3B 1MFCL 3U30B 1GRWA 1G7JA 1SQ2N 3BRGC 3AS1A 2DQIH 4JN1L 1U36A 3NCCB 1A7QH 3TBWB 2EH7L 1ZGLA 2CK0H 1FIEA 3I50L 3AS0A 2PXYB 1Z9LA 3A6OA 4XP6H 3VI4F 1WITA 1ZT1B 1FG9C 1JTOA 5H94B 2IBGA 4JE4B 2C4FT 3ORJA 2H26A 5HI4C 4YJZL 3EDFA 5JR1L 4MJ4A 4Q9CA 2GTWA 2QBWA 4ODTH 1RZ8A 4WO4C 1FFPA 5KVFL 1HXMB 1S9WA 3RNQA 5HHNB 4XNUH 3S5LA 1L0YA 3JTSA 3RWCB 4YFDB 2ED8A 2ATKA 4RMTA 4YFLI 3QXDB 1TTGA 2L0DA 4KKCD 4RQQB 1J0KA 1Y6KR 3ARBD 2P8MA 2FHCA 4HS3A 1JWUB 4HDIA 2HFFA 3EYVB 3TNMA 3MLTB 2A74B 1T04B 3ILPB 4FTVB 4BSWB 3QUZA 5AUMB 4P49A 1WT5C 1J0HA 3STLB 4IMLB 3MLPA 1WJ3A 1DVFC 5BCAA 1DVFD 4P4KA 4NPYA 1N6QL 3GIZH 2X7LA 1N8ZA 3PQYB 5IMLB 5DQ9A 4MD4A 3G6JE 1DBJL 4H0HB 1IAKA 4FFYH 2YD2A 3HI1A 3O4OC 2F9BT 4OCXL 1V3LA 3TVMA 5J06A 2AJYL 1X5AA 1TETL 3PHSA 4LF3A 1F4XL 5T5NF 5CCKH 4IRSB 2EH8L 4Y2OA 3PWPB 1UEMA 3RY6A 4DVBA 5I1JL 3WFZA 1FNFA 5JA9A 5CFHA 3I2CL 2Y07L 3QNXB 1TDQA 3VFPB 3SCMB 2DLHA 4XPFL 1OLZA 4JPWH 3MV7B 4NQEE 4ZO7A 1QTYT 2NXZC 3L7EA 4MJID 1VPOH 1WFUA 4L29A 5DJCA 2GKIA 3V5KB 5D96B 2VXTH 3SDCB 5FUOH 4HUXA 5EU6B 4C56E 5J1SC 1JJUA 3EJYC 1ZTXL 4GOSA 2EXWD 5K9KB 5EBLB 2CK0L 1EBPA 3N9GH 3DVIA 3HCVB 4X83A 5ADOH 1JGDA 1YQVL 1JRHH 3QDGD 5HGBB 5JZ7C 2GK2A 5IVZA 4WWKC 4OKVB 3SO3B 3GMPB 4QCIB 5A16B 1DN0B 3ARUA 5CWSB 3U9UB 5HHOD 5GGSB 1YPZF 5HDBE 1T0NB 4G7YH 3RI5F 3WHXA 1H3TA 3SDYL 3RL2B 4OCLC 1KPUA 3UBXA 4OGZA 3QG6B 5J12B 4ELMF 4XNXH 1C1EL 2CRIA 3O2DL 5FM4A 3B9KB 4Y4FA 1U8JB 5DI8A 1MELA 3FB5A 4TSCL 4ISVB 3FAWA 2QQNL 2W1NA 1PLGL 3IU3A 4X80L 3HE7A 3TYGH 1HDMB 4NYLB 4OZFB 2OJZL 2QQKH 2P8PB 3L3OA 3GK8H 4HUKB 3DECA 3PWUB 3PWPA 3I6KA 3H2WA 1IAOB 1YJDC 1CXEA 1KB5A 5GZOC 1FFNB 3HUJF 4GRMA 4D9QE 4PJ7E 5GGQH 1KNOB 3TZVD 3B43A 4LCIL 2FJFB 1WFOA 4CDHA 4D3CH 3ROOB 3FJTA 1DQJA 4OUOA 4ZXBC 4RNRB 1UXWA 4LLVA 3BGFC 4Y8DC 5B38A 5DR5H 1MVFA 2DL2A 4X5LA 4B41A 3S35X 5KSAC 4HIEB 4H20L 2CO6B 5DEGA 1T1ZB 4ZSOE 4JDZA 4Z77B 1OLLA 1I3VA 5E5MA 1MF2H 3X12B 1T20A 1U2HA 5EN2B 4OJFL 3RVUC 1EFXD 2OX5A 1OAQL 4I2XA 3LS5L 4PRPA 2LAGB 3G6DH 4TOYL 3I6LD 5M95B 1CDYA 1B0GA 3M8OH 1JGLH 4NC2B 4RWYH 3WYRA 4UT9H 1X4XA 5FF6B 4R96B 4R3SB 2ZOLA 4UIKL 1N5AB 1UVQB 3DGCR 3TO4D 4WFHE 3ET9F 5FM5O 1RJLA 3BSZL 3MV8D 1NKRA 1KC5L 3CAFA 1A6ZB 4P5KB 1IKFL 1G84A 1T7YA 1RJZA 2BY2A 4WFFE 5JIHA 1BBJA 1EA9C 1G7QB 1C1EH 3O2DH 1FP5A 4HPYL 1T1XA 5HHQA 4N0UE 4I4WB 5I1DB 3T0WA 5CILL 3EFDH 2XT1B 3VGBA 2BRQA 3Q1SL 2GITA 4BQBA 1QSED 2UZIH 4DGIH 1CLYH 3QDAA 3FFDB 1IM9D 1RZFL 1VGKB 4XGZB 1S3KH 3FQXA 4UU9B 1VPOL 5E8NB 1QFPA 5FCSH 4MA8H 3ROOA 4HAFA 3QQ9C 3N85H 1HN1A 4XHQA 4QRQA 4D9QD 3HZVB 5BO1L 4U1GB 1H3VA 3WSQH 4JANA 3BDXA 1Z9OA 4D0DB 2QKIA 4MLIA 2IADA 2GFBA 4R7NA 5DR5L 2NY4C 5ESAB 4NZUH 2BP3A 2CLRA 2HT3C 4S2SB 3HC4L 5DF0A 5KTEH 3MLZL 1IGFH 2XWBA 4FQXA 2VDQL 4PTTB 3TBWA 2HMID 2HG5B 2G60H 3MBXL 3JWOC 2JCCE 2R1YA 3FCTA 5F96H 3VDBA 2NY5C 3TN0A 3T0BA 3CXDL 4RFOH 4QWWD 5CGTA 3G5YB 5TDOA 4G43B 4FHBD 1J8HA 4PRPD 3RWDB 3U7AA 5TE6H 2AK4B 3MJ7A 1N6UA 1ZGLP 2YPLE 1A2YB 4JFHD 5D7IB 1MRDH 2CIKA 5JW4N 1U93B 4OQTH 5BW7C 1JV5A 5L2KB 3GMRB 4EKXA 1RSFA 2NY3D 5CBEA 3LKQA 4NP4H 4PY7A 2MWCA 4MS8C 3H9ZA 3DVGB 3EJYD 2APBA 3TYFB 4BFIA 2XQYG 2JE8A 3QUYD 4HEME 3DX6B 3KYMA 2NY1D 2P5WA 3G04A 3Q0HA 3W9DA 3BSZH 1XCTB 3CZFA 1BFTA 4J12A 4GLRH 4J8RA 1I8MB 2F74A 3LRSB 5JOFA 4LLUB 3S4SB 1LNUA 3K81A 3NIDE 3VD7A 3GFUA 5GRVL 1HOCB 1HINL 1VFAB 3L3HA 4ZOAA 3MRPB 3PJSB 1Q9KB 3Q6GH 2I60H 1ZLVK 2EDKA 4FQIL 1A7PH 3FB6B 2JCCA 4M1GH 2ZOKB 4HHAB 5IJVA 1DEEB 5JW4Q 5HHMB 2GI7A 2JCCF 5JPNA 4YXLL 4ALAH 1IEAA 1NMAH 1CD9B 1YEIL 2EYRB 4TOYH 3KPQB 1PGRB 3NACL 3BP4B 1MCEA 1JPTH 2K7QA 4P59H 2I27N 4OGAD 2R23B 2R69L 1B4RA 4DAGH 2DM2A 1MEXL 1QSVA 3RQ3A 1MUJA 4PP2A 2OSLB 5D71L 2HVKA 4OF7A 2V9TA 3D85A 2QR0B 4MQTB 3ES6A 5I66B 3UP1A 2VITB 4HS8L 2HN7B 2XYCA 4HG4J 4R97C 1JTPA 4FTVD 5F9AC 3WDIA 3O3BA 2B5IC 2CR6A 3BW9A 2EDFA 2AJUL 3QFJE 2X41A 3MPCA 2UVFA 4DN3H 3U0WH 4P9HC 5FYKD 3TT1L 2NY6B 4HUNB 4NKMA 2P42B 2WIIA 1N59B 4WNQA 3UJIL 4OCWH 3RWJA 3ZL4H 5T1LD 5KSUA 3BRDA 3LIZL 4Z7UA 1DE4A 4YHIB 4HC1H 3HI1B 5HTSA 2NTFA 3C5ZA 3HE6B 4JRXD 3N1GC 4UB0H 2WLZA 1TJHH 1I1FB 5JOPE 2OQJB 4OLVL 1X6NA 4UOW0 2VLKE 4NUGL 3CCHA 4LHUG 5CINL 4J3UA 5B8CA 5JR1H 1N64H 1H0DA 1CIDA 3NIDF 3CFEB 3MLSH 4JO3H 3HG1E 4U1LB 3MOAL 3AGVA 4NKQB 1QLRA 4XNZC 5DJ2A 3F58L 1TQCB 3SDDA 1XIWB 2R56L 1T2QL 5D70H 5DD5L 3OV6A 1NCNA 4LIQL 5EA0H 4XH2B 3VFVA 2P5EA 1ZAGA 1A4JB 1I9JH 4O58H 2R23A 3V6ZB 3O4LA 4EDXA 1OSZB 2EYTA 4DCQA 1MEXH 5DMYA 2XTJB 2PYFA 5JHDB 3EYUH 1NCDL 5HYJD 2P5WD 2D03H 1HCVA 1ZLUK 4GW4B 1DVFB 3S96A 2DWDB 4JFZL 5CD3A 2E5EA 1P2CB 2I07A 2X4QA 4OB5H 1ZTXH 1ND0A 1MIEL 3FO9B 1IFHL 2VDML 3BPLB 3SE4C 2ZUQB 5IQ9A 3BJ91 3ELAT 2OTWB 4L8SA 1YNTA 3UTZB 4FQIH 2FJGA 3MOBL 2AJZA 3HUJE 2BVPB 5ADPH 1H3XA 4K2UH 4F57H 3BDYL 2R2BA 2XG4A 1CBVH 1NGYA 5DUBA 1OQOA 5SWZB 5GRYA 2HJFB 4HMEA 3BN3B 3GB7A 4QHNA 4F58L 4QGYA 1EMTH 6FABH 1MCFA 4OFIA 4W70A 1KULA 5C09B 3TLRA 2FWOA 1CGVA 1FNLA 3V5DA 2DTSA 2DQTH 4M7ZB 5GGVL 2O26U 4WUUE 1QBAA 3WS3A 2QSVA 3O6MH 4GSDH 1UM5H 5T5NG 4PRIB 1KCSH 3EJJX 2DI9A 1XGQA 5IB5A 5D6CA 3QQ4B 5LBSL 1U8KA 5HHOE 3BPOB 4UAOB 3H9SD 3S3JA 1C5CH 5CJQL 4WRLA 1UH4A 1YQ2A 1S9KC 5JDSB 3L3JA 1VKXB 2APXA 5FV1L 3VXQA 3HR6A 4XWOD 1J8KA 1FH5H 1DSFL 4PLKD 3QISA 2AW2A 4M6OH 3MRGB 2WM0A 3D0VA 4WIQA 5I8OL 2BSTB 4NRZA 1YDPB 4PLOB 4J23A 3E6FA 3MA7B 5IOPB 4Y4HD 4PLJC 1PW3A 5CIPB 5FO8B 1KELL 4O9HH 5D1XC 4J1UB 1JHLH 2ICWB 5C7XL 1HXYB 3JWNC 1KIRB 3TT3H 3MLSL 4JO3L 2L7JA 5C2BH 3LRGA 4FQQA 1KEGL 4YHYB 4AEEA 2GW5A 3V6OA 1NC2B 4OFVA 3GGWA 3C60C 5F7EL 4L4VE 4ODUB 3ZT6A 3OKMB 3VXMB 3L95A 3VFTB 2AK4A 3MJ7B 5FV2A 5KSAB 2HFGL 1Y0LB 5DFVD 3P4OA 3WXVL 1YPZA 4PJXE 1CGUA 4KI5E 4LVOC 4YHPB 2VDPH 2BVUA 4L4TE 5DRWB 3SDXE 3IFLL 3SGJC 1MJ8H 1YYMH 1LQSR 3BZ4B 5CBEB 15C8L 3LEXB 3VH8G 1LO3H 2JJSA 5DT1H 1FBIH 2UYLA 4IOFC 4OZHE 5KW9H 1JNHB 1RUAL 3QXDA 1ORSB 4I0PA 2VB5A 3VD9A 3MRLB 1RUQL 3BP7A 5EWIL 1BECA 3LKPB 1AH1A 1QP1A 1XCTA 4XPGL 1AXTL 4BK5A 4KXZH 1OW0A 3MRJB 2X70B 3DV4A 4KY1L 5CMAB 1YMMD 1NGQL 3OG6B 3T2PA 4K7PH 4PBXA 3X11B 3VU2A 3JTTA 4IS6B 5JMRA 3QUXC 3CFJA 3GSQB 3BISA 3UZQA 1BEYL 3IT8D 2X1XR 4HKJA 3HC4H 3DVNA 4YNYA 2MTPA 4Z5RA 4LEOB 3WKNA 1NGPL 3EOTH 3LQZB 3OAUH 4X4XB 4POUB 2BVEA 3O3DB 4XNMA 3VXUE 4WI4A 3TJEL 1P7KA 5CIPA 5FO8A 3NVQA 5K9QG 3WXWL 3W0WB 4YDKL 3RNKA 3MNZB 4NN7B 2FEEL 1KYOK 2ZG2A 2ZPKL 3EDEA 3THMH 3ULVH 1EV2E 4HIHB 3K80A 3K4DA 4MA1B 4NQVB 1F5WA 5DD6B 4CUCA 3TIDA 1F6FB 1MRFL 4PJ9A 3T0VA 4X6DF 5D96C 5IW6A 3UZVB 4XVJH 3H9SA 1FRGH 5T3XD 1JP5A 3MA9L 3VWKB 2O61A 3MXVL 1NH6A 1E6OH 3L5XH 4I18C 1Q9OA 1LNUB 4Z78B 3GJFK 2YMXL 1IGTB 3PV6B 4Z7VB 3SBWC 4OF0A 2NY1C 4P4RA 3FN0H 3N1MC 4XPTL 5T3ZD 4JKKA 4K7PX 1J86A 5JQ6L 1KF9B 5DRNB 4GAYA 4Q9QL 1BFOA 5CUSL 3LEVH 3S4SG 3IKKA 5GS2D 4JPKH 5A2LH 5TH2B 3VXMD 1QRNE 1U91B 5BOPA 1V5JA 2YUZA 4LGPB 2J8UE 3G6DL 4W68A 5CZVH 1FVCA 4P2YA 4PJBA 2NXYB 4X98A 2XZAL 3MJ9L 2A6KB 1M71B 3QNZB 4JDTH 4LLYB 1H0DB 2C3XA 5J8OA 3EFDL 5IVXE 1MUJB 4MD0A 4ORGB 3KLSA 4OGXL 1B4JH 4AY0A 3DRQA 4UBDD 4XPAH 4XP5L 3VGFA 3GSVB 3DIFB 4WU5B 3BPCB 4JZOB 3CFKA 2XWTA 3VXUD 5KG9A 5GRZA 1S5HB 2MCPL 3RVVD 4Z7NE 1RJCA 4NQVA 1CZ8L 4ZXBB 1A1MA 4HK3N 2GT9B 5F9JA 1RIUH 3O6FC 4HCRL 5DC0A 1VEOA 4LKXB 1MCWM 1GZQA 2I25N 4FP8L 1HSAA 1S78D 4BH8A 1IQDA 4YDLC 2E7CA 1WTLA 4XVUD 1I7UB 2EXYC 2NY7H 3HZVA 4HZAA 4PB9H 4HIJA 1S7WA 3MV11 3JVGA 4CRPA 2DLEA 1XEDA 3QO1A 1MHPH 1GGBL 2M8XA 4DVRL 1AKJD 1GIGH 4JM2D 5CHNB 5KJRH 1IAIH 3L3IA 3C2SA 4YGVA 1TNMA 3MV8A 5B39A 4H8WL 2FSEB 4KU1A 3BXNB 4RISL 3TPKA 5LQBL 1E4XI 1RZFH 3RTQD 3SQBA 1GPOH 3FMGL 3CH1B 5F7MC 1YC8A 5KJRL 3T77A 1J8HB 1XGUA 4AMKL 5IB4A 1JHKH 3UBXG 3LEVL 4PUBL 4HUXB 5EU6A 2OJZH 3ARGD 1FNGB 5M94B 4IOSD 2R2HA 4QY8A 2DMCA 3ULUL 2VDOH 3V4PH 3VFUB 3VXUA 4KMQA 1QFHA 4PJ7A 1CFNB 1YZZA 2Z9TA 2F8VA 5E03A 4KQ4H 1K2DA 3P73A 5IMOA 2A77H 1JYXA 4MD4B 4RGMC 3MR9A 4XPFH 4BELD 3NFNA 4C4KO 4EUPH 1ZA3B 1VSCA 3VFNA 3A6CH 2PO6B 3R06B 2XN9B 3P2TA 2VERN 3MBED 5ACZB 1L7IL 5FA3A 2DQEH 4Y1AD 4GG6B 4WFFD 3IDXL 1OF2B 2VH5H 1RUKL 4NKDA 1FL3A 4XX1E 3GUTA 3HE7B 5GSVB 2NLJB 1DEEA 5SX5H 5IB1B 1BZQK 5F1KC 4ZFGH 3BEVB 2NQCA 1K3IA 1SJHB 4KJWD 1NGPH 3LCYA 3LB6D 4L29B 4P2OB 4Z7VF 4GS7C 2IQAB 5DJ6A 2XTJE 5JHDE 1ZXQA 2HJLA 4WWKA 1FHGA 4YFLF 2FJFA 4FQLL 4KJPD 4LDOB 4X7TA 2C3HA 2VZSA 5GISL 3TO4C 4YHPA 4JRXB 4LU5L 1AGFA 3PWJA 5SX4I 3VXSA 3QDME 2VQ1B 2ED9A 3R1GL 1CGYA 3ZTNL 2DQJL 1QG3A 2ZUQC 1HYSD 1A0QL 3WS6C 3RTQA 1EJOH 5D4QA 4PD4J 1YN6A 1BD2A 2BSRA 1TETH 1Q38A 5JIPA 3SJVB 5FUCC 1BFVL 1T0NA 1BWMA 3L5XL 2XQYK 2OZ4L 4PRAA 3TN0C 5DD1L 3QQ3A 5BZWA 4M1DL 4QOKA 1P1ZA 4HKBB 1BVLA 3FQTA 4GLRI 1ZVSB 3RUGF 2PYEB 3MUZ1 4ODXA 5B21A 2F5BH 4G7VH 1P7QA 1QRKA 1NC4A 1AY1L 2FBJH 3MV01 3QUMA 4J1UA 3QO0B 2N56A 2H41A 3MGOA 4HBCL 4LLWB 5JPMB 1QHPA 3I6KB 3UTTE 4M7ZC 4GH7B 4HBQA 1A6ZA 5GGRY 3L7EB 1YNLH 4RGOH 1RZ7H 4U6VL 1CFSA 1JHLL 5MHSE 1SJXA 3MRHB 2VQUA 3CNKA 5IKCB 2RFXA 1I1AD 2B8OT 1TCRB 5EBMA 2QL1A 2B1AH 4CJ0A 4HIIB 3EOAA 5ETUB 1I9RL 3E6HA 3RGHA 1AGDA 2JTDA 4ELMB 1ZEAL 2H3NB 1HH9B 5DMIH 4P3DB 4F33A 4O00A 2KKQA 4P3CL 4NZDA 1M4KA 4U7MA 2EICA 1FYHB 4KY1H 5I1JH 1IGCL 5I1EL 5KSBE 3UXFA 5EU7E 1UEYA 3SDCC 4WI9A 1RUML 3G6JB 4Y16C 4YHOL 5EWIH 3WIHH 1MLBB 2E7HA 1AJ7H 4XNQA 3MXWH 4I18A 1JF6A 3KYKL 4HMDA 2BMKA 3FT4B 2RCSL 4Z95L 5FF6A 3ULSA 2LVEA 5AD0A 2PTUA 4K23H 2VKWA 3BOVA 4WI5A 3KLDA 1FL5B 1DFBL 2FGWH 4GBXC 1C5DB 5E94B 4F7MA 1DQDL 4XAKD 3WFHA 2QSQA 3CCHB 1CTNA 5J12C 3IXAB 4FG6D 1BBJB 2FX9L 2E8ZA 3FB8B 3WFBL 2CLZA 2FBOJ 3QT2A 1XGTA 2AK1L 4XP6L 1CK0H 3MC0A 1LEIB 5I8EA 4LCWE 3T0EE 3TIDB 1I1AA 1G6RA 4YWGH 2IH3A 3CFCH 2A6IA 4GG6F 3MRKB 4XGZA 5A2FA 3HG1D 1ZT4B 4X6BA 3DO7B 5HVHC 4MJIE 4NQDB 3GO1L 5EO0B 5EOCJ 2H3NA 4JHAH 2WP3O 4APQA 1MIEH 1CLCA 1SBSH 3MLTA 3ULVF 2YS4A 2Q8BL 1TPXB 1PJ9A 3A67L 1IM9B 3BDBA 4LPTA 1D5MB 4OQ1A 2X4NA 3WLWC 1S7SB 3MRFB 3RVTD 1UKSA 1I9IH 2VN4A 2XWBB 2QADC 1WEJL 1IEBB 4NO5B 4S2SA 3U46B 4OLUH 3QJFB 1S7XA 3VFRB 3BIKB 3FB6A 1ORQB 3PWNB 2XNAB 3QUYA 3U9PL 1P4BH 3S5LG 3UX9B 4L5FH 2BVPA 1MIML 2HG5A 2G5BB 3O45A 1HEZB 3WUWA 5HDQL 1XZ0B 1ZLWK 3P30H 3C09C 4PJ5A 3HI5L 3MV8B 5B39B 5FGBA 1PG7L 2E8YA 5E2JA 1AJ7L 1OSPL 1CD8A 4XMKH 5C08D 1REIA 3SPVA 4CNIB 5HPMB 1P5VA 3OHXB 3OXSB 5DWUL 4FQXD 5FHBH 1TZHA 4Z7WA 3DRQB 2K1MA 1QZ1A 4MWFA 2HLFC 4JHWH 1KCKA 4BUHA 1EGJH 3QZWG 3P9MA 4NO2B 3TN0D 1KCUH 3ULVD 5HHOA 1D9KC 3NPZB 3SE8L 3SKJH 4N90E 4NCC2 3MYJB 1T2JA 3L3GA 3DI3B 4GUPA 4NC0B 3WJLA 4UIMA 1T21A 2AJVH 1KPUB 3HG1A 2B1AL 4P57B 4JFQA 3D39B 4LLMB 5H35A 3PL6B 5J6HA 4B5EA 3B9DA 3IB4A 4CN6A 2AJSH 4CMHB 5EU3A 4P3CH 3JV6B 3QYCA 3QO1B 1NCDH 4Y1AE 4NFBA 1JZ5A 5FHAH 3OAYH 3QPQC 1OP9A 1BM3L 3NFPB 3VJ6A 3TZVB 3HZMA 4TUJB 1MHEA 2FL5B 3UC0L 4O2FB 3Q3GB 5IVXB 1KOAA 5IHZB 5A40E 4YHKL 2C1OB 5SWZE 2FB4H 4N0RA 2EDDA 2PTTA 4JHAL 2CRZA 1YMHA 5I30H 3ARDC 3N1FC 4YHMH 1GC1L 1B2WH 5GGUA 4ZTOL 3PE9A 3GMLB 4QF1B 3NAAL 5F1IA 3RPIB 3JWOH 1G6RL 4PY7B 5I66A 1KJ3L 1ONQB 2X10A 2ZCHH 1LP9E 2IFFL 1U3HB 5HGHB 3ZKND 1VENA 3F7RA 1R3IH 2V2WA 3VWJA 5ID1B 3GSWA 4YE4L 2VQ1A 4OV5B 1RFDH 2AVGA 2WBJB 4YR6B 4DZ8A 1IGMH 4UOJA 1JHTA 4G5ZL 2FH8A 5HHOB 3TBYB 4YDIL 1BAFL 1BD2B 1QSZA 4X4YA 3ZHLA 2VN7A 4YEFA 4MSWB 5J57B 3QDGB 2MHAB 1LDPL 3SKOB 2XZQL 4G9FB 3PGDB 2PCPA 4ONGH 5J9PB 3C5ZB 3EJZD 1HHKB 4PP1C 4NN5B 1RJLB 4NBZB 2BFVL 5IK3B 1CD0A 4K3HA 2H2PD 3U48A 3RZWA 1BOYA 4GKZB 4L9LB 4MDIB 5I8KL 2FDBP 4D94A 4LAQH 2YPKB 4FQ1H 4MJ6B 4IJ3C 2R8SL 3OKYA 1F4AA 4XP9L 5IB1A 4P23D 2FATL 4V1DD 5AZ2H 2H32A 2IQ9H 3ESUF 1UVQA 4PJ8D 5E8DH 1J05A 2ESVA 5FAAA 4GW1A 1K8DB 3EHBC 4LEOA 5DUPL 4ODWB 1LE5B 1M71A 3QNZA 5L2KE 2OSLA 4CL7A 4OZHF 3ESVF 3O4LB 4MNQE 1G7HB 4HQQL 2XPGA 4HKXA 5ETUA 3WMSA 5GJTH 1H15B 3BT2H 1EAPA 3FQUA 4XX1G 4D0BB 4KMLB 1TZIA 1MFBL 4FFZH 3AMKA 4NO3A 3BE1L 3KHQA 2IAMC 5C9JA 1LEKB 4IMLA 5HGAA 1JK8A 5I9QB 1BVZA 2B4CC 5C07B 5ANME 4L4JA 1SVCP 2A0LD 5GRVK 3STZA 4O5LH 1WC7A 2AEPL 1CLOL 3WNLA 1PVHA 2FJGB 3VMOA 1TTUA 4OZ4A 2HT4D 2B5IB 2Q6WA 4PJCA 4ENEC 4UT6H 5J9PA 2VE6B 3GI9L 1AGBB 3REVA 3WIFA 1AQKL 5C0AB 5I1KL 1MHPL 3T08A 1WK0A 4OD2A 2OTPA 1T4KB 5I16B 5TE6L 4OBRA 4MNHA 2F54E 1YC7A 3SDAA 5F6HI 2Z93B 2NXYC 1A0QH 5F3BB 4HWZA 3GBML 4CU7A 2W60B 4L1HA 2Q7NA 3CSBA 3I85A 4X6FA 3NABL 1ZS8B 4KTEH 1OB1B 1YEDB 2BX5A 5FYJU 4G8FB 4IDJH 4UV4H 5DQDH 5DUPH 1A21A 2CDGA 3HCVA 3VXOA 3KPSD 3MRQB 1MCPH 4F33B 2MSPA 3SJVE 4K3GA 4MNGE 3K4ZA 1DN0A 1GGCH 1ZT4A 1G9ML 5LG1A 1MFDH 1N6VA 3R8BB 3DETC 4E5XA 1GYAA 4RCAA 2VSCA 2YPLA 2M1KA 1YEHL 2BY3A 5DURD 4OZIA 3MLUL 4Z7VE 5IG7A 1Q1JL 3KPNA 3RAJL 3JWDC 3FT3A 2XICA 1XR8B 4L8BB 2FECL 1SYVB 2DQCL 4KPHL 4OKDA 3V6OC 5DJXA 1HIMH 4FQ1L 3UAJD 2YD9A 4XPAL 4OCSL 1KJVB 3WN5B 1QQDB 3MLUH 1IGIL 3DHJA 5EBWB 4P23A 5B3JE 5D6DA 3QUMH 3MNVA 5FGCE 1HZHL 4QHNB 1QPXA 4Q6YA 4KUCD 4ETQA 3PUCA 3GI9H 3TBSB 3OSKA 5I1GH 4HT1H 2ERJB 4UNVA 5IHLB 4Z6AT 2VDKL 3MRIB 1OAZL 4F8QA 4HJGA 4I3SL 4XVSL 4V1DB 1VACA 4GQ9H 1QEWA 4WV1B 1EJOL 3IDJA 1Q8MA 5IWLC 4R0LA 1SBBA 5HHVH 2A6IB 3GHBL 1E4XL 4MCYA 5C1MB 5M7QA 1UZ8B 4KROD 2MQ0A 1XGPB 2ICWJ 4NHCL 5EZIH 1PG7X 4MZ3A 1Y18A 3LDBB 3CMOH 4KRPC 1HIML 4DFIA 1X5JA 5GGRA 2F54D 1HKLH 2X4RB 3DUUB 4EDWL 4LSTH 1I9IL 2D2OA 4G9FD 5HVGB 4O5LL 4XCEA 1YN6B 4JG0H 4PGBB 4JO1L 3H7LA 5IEKB 1TVDA 3FO1B 2APWA 5DJ8A 4TPRH 5F8RC 1BQUA 1DE4B 4R3SA 4OT1L 3HNVH 5AYQA 3C8KB 3U4AA 4YDJA 3T09A 2YOCA 4QOKB 2G5RA 2AEPH 3L7FB 5HYQA 5MENE 4EI6A 1P7QD 2X89A 3KR3H 4PB0L 4KTDH 3V4VL 3D9AH 3LRHA 3B6SB 4XNMB 4PJIE 2P5EB 2YEZB 4JPKL 3O4LD 1CK0L 5TJWK 3HE7C 1WIPA 4L8CB 4P2RB 3RL1B 1RZIB 4PLJD 3RNKB 5AZ2L 4NKIL 4RMSA 4OZFG 5T1DH 5CJXA 4U1MB 3W82A 3FN0L 4MB5A 4GKOA 4P2OC 1S7QA 3DIFA 2J1KA 3MJ6A 2UUDK 4C56A 4P5MB 3UTOA 4P3WA 1MREH 1OL0A 1BIIB 4NCC1 5BS0E 3NCYP 3VWKA 4ZXBA 3W5NA 4AIZB 4CU6A 4R90H 3MO1B 4ONHB 3KYKH 3OR6A 5F72S 3VGEA 1T83C 2PR4H 2OI9B 1MLCA 2HVJB 3VRLE 1GGUA 4LVOB 3P11L 3QA3A 2MHAA 5C6TL 1MRCH 2GFBB 4G5ZH 1VESA 2YA1A 4J2XA 2X1PA 2D0HA 4JKPH 6CGTA 4IOFD 4Q9QH 5ESQA 1N4XL 1GHFL 2GK0A 5FYLE 3EJZC 3MV8E 4PTTA 4C55A 5D2NB 1UJ3B 1UQSB 3VGGA 4WEMB 3LHPH 1IJ9A 5F89A 3ZE2E 4J7RA 5IFHL 3B3IA 4MMXC 1RHFA 1T3FB 4JZNB 1RJYB 4NHUB 5C71A 4TVPL 3JUYA 4DTGL 1U95A 1VFBB 4M6OL 2AK4D 3S3PA 1SM3L 5MI0C 4HKZB 1WAAA 3A67H 4CVZB 2A9ML 3D1MC 3TT3L 2ZJSL 3NFSL 1X4YA 5JO5B 5D7JD 3UROR 5DHXB 2CJUL 5DUML 2Q8AL 2O5XH 2Z31C 5L6YL 2DL9A 1VADB 4RIRA 3H7BB 2AJVL 2NR6D 4JJHA 3BKJL 4G7VL 4RMQA 4UTBH 3D25A 1F45A 4J8RB 4RFNB 5I19L 4K94C 1DBBL 5SX4H 4JANB 1GZQB 4JDVB 1FNEB 4LSQL 1L7TL 3IAQA 3AUVA 4HW6A 4NUJB 1MJ8L 5DC4B 1RURH 5E2UL 1EEZA 1IVLA 2NR6C 3PL6D 5TPWH 3RIAK 3WEXB 2EYSA 3CIQA 3EIFA 3SE8H 2NTSP 5FA3B 5GIRA 3BWUC 1DQML 3BN9D 1NEZG 5MEPB 4I3GA 4BSJA 5IR1A 4F57L 1ZA6B 3BIKA 4F7EA 1ZT7A 1DANU 3TIEA 3ALPA 4IMKA 4AENB 4MXQD 1GAFL 1Q9WA 2WBWB 3NAAH 4HX1B 4M5ZL 5EULV 2BHYA 2QR0A 3SKNA 1JL8A 4WHCA 4KC3B 5E7BA 3OQ3B 1G9NC 4NFCA 3QIWC 1PKQE 4PJCF 1TZGH 4R2GB 3T8XB 3D3VE 4HMCA 5IV2A 4P4KD 3QH3B 4CVUA 5ITFA 5BXFB 1MAKA 5DRWA 2XKNB 3UC0H 3FRPA 5TE7H 4FQCH 2DQEL 5JOEA 5FIEA 2VABB 2R39A 4PJXF 4OI8A 3R0NA 3O2WH 1ZVHA 3GRWA 2C5DC 1MIMH 2VLME 5E8PB 1I3RA 3AFLA 4NSKA 2OR8A 2XFXA 4ZPTB 5ACZA 1T7XA 3KPNB 4IJ3B 3BIAX 1HDMA 2A1WH 3WFBH 3ARVA 5EO1A 5HYEA 2JJTC 2F53B 2CDFA 3HRZA 3IDNB 1G0YR 5CHNA 1Q72H 4DKFL 2G75A 3MFFA 2YSSB 2VL5A 3ZKQD 3JUZA 3W0WA 3EFFA 4EN3D 3CFJB 1KNOA 1QKZL 5A1AA 4WFGD 2IH1A 2A83A 4IIQB 4KFZC 4JKPL 4KZDH 5KVDL 2GJZA 2Z93A 1MCBA 1FGNH 4E42A 3LQZA 5BS0A 5HHXL 3BGMA 1BMGA 1XZ0A 3PABA 1DBAL 3BD3A 3SDDB 1YEDA 3FFCA 2BNQE 1OHQA 3O11A 4M4PA 3A0OA 5I74B 1VB9A 1DFBH 4L3EE 4G8GE 3CSYA 4BM7A 1K8IB 3BW9B 5ANMB 4Z78A 2MKLC 4N1EA 2HKFL 1QLEH 3IFLH 5EN2A 4KJYB 5GZNC 1JYWA 4FG6C 5I1LA 2KDGA 4M62H 1P4IL 3ECBA 2ZKHH 1QVOA 4YHZL 1GXEA 3VW3H 2LAAA 2R4RH 3MJ8A 5ACMA 3SJVD 1GGCL 3IF1B 2DQCH 4KPHH 3QUYC 1NBYB 1NAML 3DXAA 2XN9A 5ID0A 1E6JL 4M48L 2YRLA 4DUXA 2VLKA 4IOIB 5AEAA 5J13B 2NZIA 1S7TA 4Z7OF 1OF2A 3VXNB 3D2UA 2IPKA 2KZ1B 3GBMH 1BX2A 5AAWA 4GAYB 4F9PA 1WTGT 3MFGB 3CDFA 1I7TB 5EU6D 1E4WH 5LAXB 4Y16D 4ZUVB 2H6PA 4JKMA 4CADB 4RGMB 2O5YL 1MOEA 5DVLA 4XXDA 3KNBB 4QWWC 3MFFB 4IDLA 4LDEB 1JYNA 7FABL 4BKLA 5L0QB 3VFPA 5DA0B 3HNTH 3OWEA 3V4UH 4Y5XB 3AC0A 1LEIA 3N0PB 3E6HB 4J6RH 1O7VA 5GRUL 4WDIA 5E6IC 5CEZH 1OARL 1KCRH 4NZRL 4OCWL 5HGDB 3I6LE 3T4YB 3MCG1 3K8KA 2DB8A 4ZODA 5I1KH 5KVMC 1YNLL 3FN3A 3GSNB 2SEBA 3MROB 5K9JL 4MQSB 4P2QA 4PGBA 3TV3H 4UTAL 3ARSA 1LHZA 4LVHC 3EYSL 3TBYA 2PW1A 2BMKB 4YHOH 3EOBA 3ZLQC 3MUGA 5K93A 2AERT 2PYEA 4ODXB 1LO0H 1J88A 3O0RH 1AO7A 1XAUA 4P59L 5C86A 1UZ6F 5E9DB 4XC3L 3LQMA 2EKSA 2EDJA 1KENL 5DK0A 4NN5C 2Y5EA 5D2NA 3I75A 4FS0A 3A6BL 1KCLA 3HN3A 5F89B 1HXYA 2AV7A 1G6RH 1CFSB 2FATH 2ILLA 5D7SL 3M17B 5I1GL 1YEEL 3U6RA 1FSKB 1IGJA 3L6FB 2FEEI 5GGTA 1FNGA 2N7AA 5KANG 3HZYA 4K9EH 1NDMA 1JPFB 1IC4H 1AO7E 1K8DA 4JRXE 43CAA 1INQB 1LD9A 4XCYB 1KXTB 5C0CA 3KYNA 3QAZB 3HS0A 4R4NC 1G9MC 1ORSA 1I8MA 1FGVH 5DK3A 1HYRC 1P6FA 5ICZA 1EO7A 2UYLB 3RIFF 1KYOJ 4HKXB 3QPXH 2FBJL 3L3GB 5ERWB 1Q1JH 2BY0A 4ZTPH 1T0PB 4TVPD 4UUJA 5I73C 1A6VH 1I1CA 4XNYL 3QEUA 5HHME 1KLUB 2HRPL 3D39A 2PO6D 2X4NB 4NP4L 3FFCE 4U7SA 5IFJB 4M7KL 5CP3H 3ZKNC 4GG6A 3EZ8A 4P2QB 3JTTB 4QRRB 2BNRD 2DWEB 5AD0B 1RZJL 5GS0D 1ODAA 4BSVB 2YMXH 1F97A 4Z5RB 3AU1A 4WW1B 4PJHB 2X4UB 4X0KA 2VDNH 2DQUL 4NDMB 3P9LA 4KTEL 5CP7B 4M6MH 1CXLA 4ZO8A 3REVB 4CNIA 4KUCF 4F15B 5HPMA 4Y5YB 1CDJA 3MNVB 2VJXA 1M7IA 2QLVB 2AKRB 1KACB 4LCUB 3VFOA 2FH6A 5I16A 1CI5A 1QRNA 1CDBA 1A6TA 1L0QA 1WZMA 4PR5A 2PXYC 1AR2A 1Z2KA 3RTQB 3KPOB 2IQAA 3FL7A 2W92A 1JGLL 5IIEB 2BNUA 4PJFE 2FD6L 4ZFFA 2DS4A 1G9EA 4DGYH 4YQXL 1FLRL 3X12A 1OCWH 2Y7QB 4JFQB 3K3QA 4UU9A 5IF0B 2Y9RT 3QFDB 5B4MD 4XVTL 3CXDH 4RFOL 4PGCA 1PKQA 1FAIH 2B0SL 1KT2A 1RI8A 5KSVB 4A6YA 4WFEE 2OL3A 3K0WA 4JY4A 3V8CA 2OTUA 3OL2A 4X6CE 4M93B 2FYYB 4H26B 4F7PA 5GIRB 3BO8A 2PUQT 2XOTA 4YC2B 3VXUB 3OKKB 1ZT7B 4DEPC 3WSQL 3W5MA 1MCPL 4RMUA 1KCSL 4JR9L 2H45A 2ZG1A 3QCTH 2Q3AA 2FEDD 3INUH 3TWCH 3DOSA 2ESVB 4N90D 4MQ7B 3X3GH 3QNYB 1MJJB 4PJFF 1KN4H 3GSRB 4XBGB 3ZTJH 4IRSC 4MB3A 2R29H 4ODBD 4KQ3H 3O11B 4XRCA 4RFNC 2CK2A 1ND0B 5ITFB 2Z35B 1PG7H 4NQCE 4L4TA 3SBWA 3SDXA 3KS0J 1A6TB 3SCMC 4EXPX 3WUWG 3MGTB 4WV1A 5H8DA 4IBLT 1NMCB 1NLBL 4NQSB 4HJ0D 2WBJA 1ZSDB 1JHTB 2AABL 2AJXH 3OJMB 2NX5A 2HLAB 1MLBA 3HMXH 4UILH 4U1HB 1V3KA 3NZHL 3QHFL 1IQDB 5I19H 1AXIB 5C0CD 1KC5H 1CXHA 3JWOL 3LKOB 4MSWA 1B0RB 2DKSA 1ITCA 1OAYL 5I1CL 4EI5B 3NA9L 4S0SD 3HLAA 5JHLH 5ESVA 4HIXL 1HHJB 1U8OB 1U8MB 4LSRL 4M7JH 1QKZH 5DRXB 1A6AB 2EXWC 5DJ8B 5DK2A 3RWGA 4MJ6A 5I1IH 3D2UB 4RA0C 3G6AB 3GK8L 2DN7A 2WWMD 5I75B 3BT2L 3O3EA 5L8LB 1JNNL 5GGUB 3V0WL 5EC2B 4LL9A 3QIWB 4OTXH 3Q2CA 3KPRB 3RA7L 1I7ZB 2ORBL 4R8WL 5MEOA 2LTQB 4ZUTA 4P2RD 3MRNA 3CJJA 3EO9L 4ELKA 3CC5B 4LKCA 4Y5XA 2P5ED 1T66D 3K2UL 2OR9L 1D6EB 4G6KL 3MJGX 1UB6B 3IXTB 4YR6A 4MA3A 1KXVC 3SOBH 2ESVD 2VLRE 4OLVH 2J4WL 1DDHB 3UCRA 5L2JB 1YQVH 3Q5TA 5L8KB 3MJ8B 4PJ7F 4LDLB 5ICYA 1BFVH 4HJJH 3PWPE 4IOIA 3WXVH 3TNNA 3X14A 4LHQB 5J4MA 2DLFL 4OZFH 4YDIH 2WBJC 3UTSE 2WP3T 4ZYKB 3CSPA 4LRIA 1LO3L 4IIQC 4PJCB 4PJ5B 2MKWA 1YYML