5GHWL

Crystal structure of broad neutralizing antibody 10e8 with long epitope bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 10E8 HEAVY CHAIN
total genus 48
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwL01
3BVNA 1VGEH 4HS6A 3BE1L 1WZLA 2FHFA 3VXRA 2VQ1B 3GSRA 3MMEA 4AIOA 1NGPL 2YEZA 5AG9A 4FQCH 3OKEB 5ALCL 4S0SD 3MRCA 1S7XB 1W0VA 1DEDA 5D1QB 1DEEB 4XMPH 1MJJA 2NY0B 1H8OA 1QBMH 3T3PF 1IM9D 4JPIA 2HKHH 4ZOEA 2D7NA 1G7QA 3QYCA 1M05A 1XGUB 3KPQA 3LD8B 4M5YH 1JV5B 4JY5L 1T6WA 2PXYB 3CDCA 2RCSL 2A9MH 1IGIH 3HE6A 4U6HB 1W2KT 4K3EH 5HI3D 1SJEB 4M1CC 4G6FD 5IT2H 3P77B 1G84A 2G75A 4HPYH 2ZUSA 5INDA 5TGBA 3O3UN 3T65A 1CFSA 4NOBA 5F6IC 3TO4C 2MHAA 4I0PD 1Z9OA 3KPQB 2A0LD 2NW3B 1T2XA 2EE6A 1FG2B 4H26A 4MJ5A 3T0EC 1FNSH 5C0FA 3G5XA 3HE6D 5D1ZC 3MPCA 5LGJA 5DO2C 3RTQA 4C55A 5IVZB 5E6ZA 4LEXL 1GZQB 4V1DE 2P5WB 4PJGF 2UWEB 4ESKA 2OL3L 1F6FB 4HG4K 2ZSWA 2DM2A 5C0DB 2JELH 3CVIH 5HHQA 2BVYA 4QOKB 2I9LA 1IKFL 4N1EA 3PWLB 1HDMA 5D9SB 2QQNH 3BP4B 4WJ5A 1LK2B 3H0TB 2J6EH 4MD5A 1IEAB 3MRRA 5EFIB 3GI8L 5D8JL 3S36H 4F7MA 4PJAE 2B1HL 2HTLC 3VH8G 2W07A 4TSAL 3B9KA 3OXSB 4FXLA 4DKAA 5GIRB 5DHXB 4NQXB 1WLHA 4Y4HB 4EXKA 3BH9B 5L0QC 4HUVB 3BKCH 2Q8AL 4HULB 4H25A 4CU6A 2X4NB 2UZIH 3TBVA 1D5XA 2IPTH 1BX2A 4NQVB 4ELMB 4Z7QE 5FYLH 5D7LA 5CZKA 3DYMA 2XICA 2MPAH 4KK5C 5EOQL 4Y88A 4XVUC 1Q38A 3BKCL 2DM4A 1DBKL 3WIHL 3QI9D 4EQ3A 1Q1JL 1EMTH 3O8XA 1CD8A 4MD5B 5JUEL 3DO7B 3BSZH 2CDFB 3NFSL 2NZIA 4RISL 4CU8A 4PP2B 4GMSH 3DV6A 3U4EB 5CD5D 5T3ZE 3TV3L 3MRMB 2DDQL 1EUTA 1OAQH 3ARED 4JY4A 4N0YL 5DTFA 5C09A 1XR9B 3ETBF 4NBYB 2A74B 1R5IA 4UQ3A 2BY2A 3BISA 4JFZL 3KPRD 5FYLL 2OJEA 1E4KA 1VFAB 3C5ZC 2ICEB 3RIAF 5T3XH 2RR3A 5ELIA 3T0ED 4RMTA 4GXUN 3UYRH 1U3HA 4Z7VF 4LLDB 3HRPA 1NCDH 4WTXA 3N06B 2CGRH 4Z7WE 4I77L 3IFNH 1UQSA 4WHYG 1HXYB 4Z6AT 5KVFH 5FYLD 1FL5A 4HS3B 1IGMH 4YX2L 3S35L 3TVMA 1G9MH 3QQ3B 3WO3B 2J4WL 3FTGA 3IAPA 5A16A 2MCG1 4PRID 1AIFA 3KPTA 4U3CA 2BY1A 2SEBA 1LO3L 3BKJL 3RNQB 4NUJB 1T4KA 1GOGA 3GBML 3L1OH 1KIQB 4HBQA 4K8RH 1DVFA 1D9KC 3MXWL 4YHYB 3PHQB 1QFWI 2GJ6B 4KZDL 1L6ZA 5I6XB 1ADQL 1A3LL 1QA9B 4LCCB 5IBLC 4H5SA 4WI7A 1AKJB 1G7LA 3RAJH 3N50A 3VWKC 1Y6NR 1JGDA 2NY7L 3WHXA 4Z7QF 4KVCL 4PRNA 1FYTE 1MLBB 1MAJA 3KLAB 4PLJD 5F7YC 5FM4A 2GJZB 3ARRA 1C12A 1Z5LA 2XTLA 5SWQB 4NO0D 5IBUG 3UCRA 1MRDH 1RUPL 4F80A 3UJTL 1CL7L 1EVTC 1ZTXL 1A1OB 2X4OB 3NPSB 1I1YB 3MV7E 4UQ2B 4R26L 3Q3GB 2CDFA 1H5BA 4UTAL 4IDJH 3D9AL 1BM3H 2DD8L 5DJCA 3GSNH 4ONHA 3G6JF 4LQ1A 2MNUA 2O5XH 4FQJL 1FFPA 1ZAGA 3N9GL 3UJJL 4PG9B 4Y5XB 1CGYA 3REWB 2D2OA 1PEZA 4KRPD 4PJFE 4YDJA 1OAXL 4K7PL 5JXEA 1IAKB 4WV1A 5IVNA 5JXAH 1FCGA 2JK5B 2ZNWA 4IOSD 4U6XB 5JLZB 2Y36L 1II4E 2OXGA 3T0AA 3OR7A 1BMGA 1FE8L 3BXNB 1UACL 2Y6SD 1JFQH 3CMOL 4G7VL 1WVZA 1UEYA 1KJ2H 5CFHA 1M7IA 3O6FD 8FABA 1JI2A 1S5IH 1T3FA 1DSFH 4D0DB 4MX7B 5GXBB 1FH5L 1EX0A 3W0WE 4UV7L 2DYPD 4L9LA 5MEPB 4U3XA 3KNBB 1HH9A 4HPOH 3T1FB 5EDXA 1MRCL 3STBA 3ET9F 5ERWB 4JFDD 2J88H 4K07A 2BVEA 2ESVB 3I3DA 4R0LC 1KSRA 5E00A 1AGBB 5I30L 2Z31D 2E9IA 5JIHA 2IPUK 3MZTA 3NCJH 3QUZD 2W9DL 5C6TL 4FXKB 1YMHB 2CKNA 2A2QT 2Z91B 5DFWH 4H1LB 5BW7C 3FN0L 5FYJD 4DN4L 1U8LB 4WVRA 4Y5VA 5DHYA 3GMQB 3H9HB 5J13B 1A7RH 1LD9A 2Q3ZA 3ZDXE 2YC1B 4G8GD 4IEFB 3AS1A 4X7FC 4JO4L 2L4OA 3MGOA 3SOBL 5CWSA 4LCWD 4M1DL 4OSUH 4JRXA 2NY0D 1NC2A 5B22A 4LRNH 3DUUA 4PGEB 5ALBH 3MRGA 1ZA6A 1V3JA 3DVNB 3X3FL 3FB7B 3FT4A 4WU5B 1B6DA 3L7EA 3MV9D 1FGNL 3WKML 1CDHA 4NDMA 4HXAH 4M1DH 4HHAB 1J7VR 2DICA 3G04B 3VFSB 2J8UB 3LQAC 2QR0A 3WUWG 3VJ6A 5INCA 4UTAH 5E94A 3VFNB 2EKSA 2YEZB 2WBJD 3G5ZA 1U8PA 3VXPB 3L3IA 4UIMB 1NC2B 4JHBA 2NNAA 3RA7H 3IJYA 4GW1B 2HJLA 1YMMD 1UWGH 4MCZA 2R0LH 1OY3B 5C08A 1Q0YL 5CP7A 4N8VB 3FOMA 4GQ9H 1OT1A 2AK1H 2O61A 3H0TA 5K9KA 3TP4A 4Q97A 4X6CE 1YQVL 2H9GA 2BP3A 1FFOB 1WZ1L 3V5HA 1OTSC 3QIBD 4FQJH 5I1LA 4P2OB 2EEBA 4WI2A 1P53A 4BH7A 2EXYC 5CLWA 3X14A 1T5XA 5DMIH 4LNVA 1B4JH 2OZ4L 4S0TD 1S5HA 5K9JL 2W65A 1G7MB 3CH1B 4U05A 4QOKD 3MLSL 4QYOA 2OLDA 2Q8AH 3MV7D 1NKOA 3KJ4C 4YDKL 5C0CB 4LCUB 4G7YH 5IWLA 1KJMA 1KV3A 3RGVD 2YR3A 3TJHC 4Q9RH 1NANH 1T5WA 2MMXA 4PJXB 3CMOH 1JK8A 5AD0B 3VI4E 1FFNB 4JM4H 3VMOA 4I2XA 4YGVB 2ZJSH 4GG6A 4HJGA 5GS2D 4S2SA 5BMFH 2D7TH 4ZFOA 2VR4A 5C3LD 2X05A 2NY3C 4U1GC 2PW2A 1E0OB 3KXFB 3E8UH 3UYRL 5EBMB 4QHMA 3S6CA 5BVPH 1OLLA 3HPLB 1MJ7H 1NEZG 2YD1A 2C3WA 4KRLB 4NQCB 5IEHB 3LAFA 1T20B 4X4XA 4XPGH 4RAVB 1NAKL 3ZSSA 4FQXC 2DWDB 4NQXA 1FSKC 3HHRB 3L7FA 4QXWA 3BZ4A 4RNRA 5EIVA 4PY8I 3VXQA 3LMJH 3SDDA 2YD5A 2VDLL 4N5EC 3W0WD 2B4CC 3P4LA 1CT8B 2WWMD 1NC4A 5FGSA 5E2TL 1XCTB 2MPAL 5EOQH 4HW6A 5F9AC 4GQPH 1QACA 4RQQB 4HCRL 4J3WA 5DDHB 3LQAL 2YD4A 5FO8B 4GRLC 3TEUA 3NIDE 1WWAX 5CUSL 5DI8B 3D69A 5HGAB 3HE7A 4W81A 3HUJB 4XCEA 1VADA 4R2GC 5T1MA 1KCSL 2APBA 1YY9C 2IH1B 3ZE0E 5E9DA 5HYQA 5IKCA 4OCMC 3NBNA 3VFTB 3TM6A 4WW1A 1Q0XL 1XT5A 1ZWIA 4OTXH 1ZA6B 3EDKA 2P8PA 3S5LA 2JIXB 1HHGA 4XCEB 4HKXA 4EOWH 1LO0L 3WYRA 2YBRA 4ONFH 1T1ZA 3LKNA 4IDJL 4M8QA 3WS3B 4JB9H 3B9KC 4MZ2A 1E6OL 3BZFA 3QHFL 5HHNA 1JF6A 3U2SA 3HMXL 1CBVH 1QD0A 3QEGL 1CL7H 1ZTXH 3C60D 1PZUB 1NEZB 1MHEA 2F9BT 4Q9CA 1ZGLP 3QO1B 2VXTL 4Y2DD 4U1SA 2GTZA 4GW1A 5F88A 2EEAA 4XCCH 4P23A 3FOLB 5K9OA 4ZUSB 3LKPA 4V1DB 3U7AA 3EJJX 2UWEE 3VD4A 2VXVL 4XWOC 5GGRA 5HYJB 4PV8A 3RVXD 4HXAL 4C4KT 1C1EL 3G5YB 4HK3N 2X4TA 3UO1L 5I1LB 1ACYH 2ORBH 5DD6B 4OZGE 1B0GA 4IOIB 4J6RH 4PRDA 4JO1H 5FECA 2EDTA 1HOCA 3IDGB 5J12C 4D3CH 3KYMA 4QHLB 1BOYA 3H6JA 5MEQA 4LASH 5GZOC 1X4ZA 2OL3B 3OJDB 2D7TL 3LRSA 2AAVA 5I8CA 3WN5A 3D25B 2Z8SA 1NAKH 5FAAA 3QJHA 5T3XD 4AENA 2ITCB 4POZD 3TO4B 4PJ9B 5F6IB 3GJFK 1DQLL 1MJ7L 2NLJA 4S1QL 5D96B 4PLOB 1KELL 4NJAH 3T3MF 3GJFA 1MHCB 4K2UL 3TIEA 2LFGA 1OB1A 5FHAH 3VXMD 2IH3A 3OKNA 1A6ZB 1EHLL 1NDGA 2PNDA 5E7BA 2AQ1A 2ZCKL 2AP2A 3TLRA 2NXZD 4L5FL 3REVA 5K9JH 1RFDH 4OFVA 1F2XK 4OCWL 4WWKC 4G6JH 1F11B 1IBGH 1J8HD 5FB8B 3WBDA 4PJ8A 5J89A 2DQHH 1WBZB 2Y25A 3B2UC 3ROOA 1N3NA 3D85B 2Z4QA 4ETQB 1ZS8B 2Y06L 3GEWB 1O7SA 4HQQH 4NZDA 2V2WA 4Y1AD 1INEH 2ATPB 1VKXB 2AGJH 4U6XA 1MWAB 5BRZE 4O9HH 2HFTA 4RX4D 5F9WC 5ESVA 5GGUB 4ZFZA 4RGOH 4DUWA 3CAFA 3TVMD 4LLVA 1HYSD 4F7CA 4X7SL 4JFDB 2FBJL 2XWTB 3CGTA 5D2LB 3SY0A 4JDTL 5DJDB 2Y06H 3MRPB 3V52L 5I1GL 2BERA 1NGQH 1X5ZA 5C0DA 3EOAB 4JFOA 1AQDA 1QHOA 1NC4B 1MHPL 4WW2F 4FTVA 1F4XL 3K7UA 4GBXA 4R3SB 1YNTB 4R7DB 3QUXD 3SE9L 2HG5A 3S96B 4QXTB 4XP5L 3T4YB 2ZNXA 3QDGD 4FN0A 5GGUA 1SM3H 4PGZA 5C9JA 5DFTA 2Y5TB 4KDTC 3VDBA 3PWVB 5D7IF 2F54E 5AYUL 3OX8A 5LBSL 3OJ2C 5D5MA 2RBLA 5CCKL 3HZVA 4K23H 2X9XA 1O0VA 3T4AA 1QO3B 2QKIB 1DP0A 4ZSOB 2B1AL 5C86A 2R69H 1WISA 4PJ7B 3F58L 3OHXB 3AREA 4YLQT 3V5DB 1B9ZA 4EJ1C 1KN4L 1EVUA 4C56A 1WEJH 1XIWB 1HHIA 4JO2L 3U9UB 3EYFB 1OGAD 5TF1L 4F7PA 1KFAH 2JELL 4FG6D 3GDBA 4YQXL 4U0QB 1ZV5A 4OKVA 3ZL4H 3T0EA 4HUUA 2X4PB 1GGBH 2OZ4H 4BSWA 2HMIC 3HUJF 4PFEA 4PJ9A 4IJ3C 1OT2A 3LPWA 1X5XA 2AJVH 2VXQL 4KXZI 1HSBB 1T6VN 4B41A 2CIIA 3KLAA 3MRDA 3U0PB 3IDXH 4YFDB 3O2DA 4RCAA 4OF7A 1HHKA 3U7WL 3VFMA 3F58H 2CJUH 2AJZB 4RDQG 2PTUA 4ZD3H 3ULVD 1TZGL 4DOHB 3IF1A 4PJBF 3QQ9D 1SJXA 3SKNA 2FZ3A 3WD5H 2MCPH 2V17L 2X4PA 2R0WL 1UQSB 2NY1B 2WK2A 1QSFE 1H8SA 1MJUH 5EZJA 1SJEA 3JBG7 4MGXA 4GRMB 3KYAA 5C09D 2VSDA 2CPCA 4L4VA 1IEHA 2WNGA 4Y89A 1I3UA 2XTJE 2XZCL 4DQOL 5F7EH 3NPZB 4JFOB 1BAFL 4IIQA 4MB4A 4XPFL 3ARGB 3MNVB 5D5MF 5C0GA 4ZOAA 3U0WH 4PJDA 3T2NL 4R0LB 5JW4N 2CKBH 3KHOA 4OIBA 3PV7A 1SEBB 3AM8A 3NACL 4P99A 4L4VB 1ZT7B 3GSOB 1LEKB 3NN8A 5IMKB 5EC2A 3EFFB 4X7SH 3RI5F 1K8IB 3SKJL 4UTBL 1FZKA 1EZVY 1F6AB 1Q9KB 2ADIA 1BZ7B 2F54A 2RJMA 2EC9U 4WO4B 3IB4A 1UCBH 3KYNA 5JPNA 4ZO7A 2VJXA 1P4BL 4OLEA 1CDJA 3PWNA 4IRSC 4J4PC 4LP4A 2NY5H 1S7UB 1UT9A 1KIRB 5IHUH 4AT6B 3WHE0 4L5FH 4AEIL 1FAIH 1EAPA 1PJ9A 4M5ZL 4X6BB 5FYKH 1S5IL 2Z8RA 5EIIA 3UXFA 3RY4A 1F4WH 3O6MH 4N9OB 4NQEB 5E2VL 5KSUB 1NLDH 4YDIH 1D9KA 2YD3A 3TH3T 1KOAA 4XAKE 4R2GB 1J05B 1J87A 1MVFA 1SYSB 3I9GL 4OGAD 4NN7C 4JDZA 1R24B 4NP4L 5I73C 1AE6L 5I0DA 4J3VA 4OZFG 3KS0H 3CNKA 1YEDA 1IAOB 4O5LH 2O5YH 4KUZH 4LHJB 5GSVB 2CUMA 5SWZB 1M6OB 4QTIH 1TZHA 1S9KC 3A6BL 3WV0A 5EIIB 3FB8B 4PRHD 5EU6E 3O4LA 5TDPA 3MSPA 1FBIL 5ABDE 3H7LA 3QJFA 1KEGH 5B38B 2NX5A 1OP9A 4OBRA 3MROA 4YK4C 4LNRB 4ODHL 1JBJA 4YHML 3TBSA 3I75A 4RBPH 4OCSH 2R0ZL 5J7CC 4ZUUA 3BKYH 4OCLC 3X3FH 5C0IA 2MHAB 2ZCHL 4XPBH 1S3KL 3PWPA 3VGAB 4L3EB 1J8HA 4QRQB 4L4JA 4ONGH 4WEMB 4HWZA 1A7OH 5E8DH 1NGYA 2C1PA 4EDWL 5KS9A 3I6GA 1YECL 1SHMA 2NY6C 2JJWA 5MP6L 3RDTD 1GL4B 1UM4L 3IFPA 1U8LA 5CEXA 1K3ZA 5FGBA 2VL5A 2P8LA 5SWSD 1PQZA 1YEKL 2XWBB 3QFDA 1IBGL 3ZKMD 5DD3L 4UV7H 2PYEE 4L3EA 1J0IA 4JPIB 5HYSA 1SJHB 2BVPB 3R8QA 1NLBH 4JRXD 1U58B 1LEIB 3FQTA 4N8PA 2AGJL 3KLHD 1KJ2L 4XP9H 4PJ9C 4TNVK 1ZS8A 5AZ2H 4NNXA 2AKRB 1YEGL 3EYOA 3MLRH 2BSED 4KKBC 1DQMH 2IANE 4FS0A 4TUKL 5ENWB 3DRQA 4K71C 1ODAA 3B9VA 4P2OD 3X3GL 3N1GC 3DX9B 3AS3A 5E1AA 4E0RB 4WFED 3C5SA 4WWKB 4U1NA 4JKWA 3F6IA 2X89A 3NA4A 3UTSE 4KY1H 3NGBB 4OZHB 3U1SL 3PUCA 4QHMB 4Z7UE 4JG1L 4J2XA 2BNRA 3L3GB 2YMXL 4K94C 4XCYB 4OZ4B 2BNUA 4P4KA 3G5XB 3WO4B 4JQVC 1EO8L 2H1PH 2JJTC 2FHCA 4QTHA 4EI5A 4NO3A 2EYTA 5IVXB 5CIPA 3OKNB 5BVPL 5I2IA 2GSIB 1U8KB 3KPOB 4JR9H 4TVPE 4KMLB 1BJ1H 4XCYA 4PJBA 3SBWC 1P7QD 2FIRT 2IAND 4NC2B 5D7JD 4P3CH 1JZ4A 1I1FB 1RULL 3HNSL 1YDPB 5MENB 5CSGA 2YRLA 4FQHA 2RIKA 3CD4A 4RMWA 4GG8A 4KMQA 2GCYA 1A3LH 1G6RL 3V0VA 2GITB 1EGJA 1BD2E 1YQVH 3TBVB 2VZ1A 1K9TA 2F58L 5HHOD 3WS6A 3VFTA 4HFUL 4KGLA 4TOYH 5JZ7C 5J6GB 3NH7H 1BOGB 4QHNB 3LHPL 5CBEA 4JN1L 3WNNA 5B3JE 4TTDC 1KTDB 5EH1A 1A6AA 2ITCA 5CBAA 2W0KA 3MLTA 4PGDB 4OCYH 3ARSA 3N1PC 1JPGB 1NL0L 5I73B 2WBJC 4UIKH 5TJWK 5I1KL 4HIEA 1K85A 3ARDB 2NY2B 5HHME 1VSCA 2ZSWB 5HI4C 1UG9A 3B2UD 1BFTA 2R9HD 1WEJL 5BV7L 3AMLA 4EI6B 2AK4A 2E9JA 1XGRB 3QXAA 4M1GL 4Y19A 4ZTPH 3ZKXB 1MCSA 4NQCD 3QG6A 4QRRE 4XGZA 2DL2A 4UT9H 1RIHL 5DFVC 5DZLA 4FXGA 1ITBB 1U41A 4OFYA 4ZUVB 4PY8J 5CS7A 1KPUB 3H3KA 4OUOA 4PJAF 5D7IA 4KKCD 3TN0D 3VGAC 4KKAD 4PLKC 2FEDD 2DWEB 1LQSR 5TQ2L 2QHRL 4PD4K 3DARA 1NFKA 2F5AH 1PBYA 5J9PB 1Q72H 3RNKA 3IDYC 5J56B 3SQOL 2H1PL 2ZOLA 4FP8L 5T33H 1G7JB 2YN5A 2EKJA 4NOFA 5ICZB 3IU3B 4WEBH 1DQDL 1HHGB 2A77L 5IHLB 1OCWL 3FO1A 1HK6A 4OF5A 1A64A 3O45A 4JZJB 3BI9X 2VDQL 5E8EB 1MCIA 4NWUH 4A2MA 5JXEC 3IFNL 2E27L 1QYGL 1SVCP 3QIWB 2R4RL 2VXSL 4KQ3L 1JF1B 2DTSA 3KR3H 4L8BB 3AB0C 1ZEAL 5C08D 5DJYB 1QRNE 3KPRB 3T08A 1QLEH 1VFMA 1IGYB 2JJSA 1J05A 1SYSA 1EHXA 2H8PB 4OQTA 2FL5A 4JVUA 4C83A 5EO9A 1HINH 1GHFL 3L3KB 3AY4A 4LLDA 4JRYB 5GJSL 1P4IH 1HXMA 4WI3A 3QHZH 2EEDA 1RZKL 1NGXB 5CIPB 1JGVL 2B5IC 1I7UB 4L9LC 3WNLA 3UTQB 4KV5E 5JDJA 1S7QA 3QT2A 5A3IC 4OF8A 4NQUA 5D96C 3TO2A 1XF3B 2FHBA 4PRIA 4POUB 5CAYB 2X44D 4CBPA 1E4JA 2IQAA 1GCFA 4X98B 1N2RA 2VUYA 4HGMA 2EXWD 5I17A 4QRUA 3RIFK 3ECBB 1QFPA 4Z8FL 4HPYL 5F9DC 4XGZB 1INQA 4PY7A 4YE4H 4Z18A 2BVTA 1NUDA 2LABA 1D5ZA 1MAML 4XBEH 5HGDA 1LHZA 3T4AB 4YXHL 4NSKB 1JN6A 1ZGLM 3D9AH 2GJZA 2QV2A 4HUXB 3LN9A 5DR5L 2AJUL 5ISZA 5KSUA 3ULVH 5I17B 3MRBA 1WK0A 1FZOB 4U0RB 1QNZH 3MLSH 2X4RA 4Z9KB 4EUPH 4PJCB 4ZDHA 3RU8H 2ZSVA 1TZGH 3VE0B 1NQBA 1IEAA 2DQTH 5HYEA 1IRAY 2HTKC 1CXLA 5LAXA 4HCRA 3HG1A 4X7CC 2AJXL 1QNZL 1JL8A 1NGZA 3H42L 3L5HA 3VFWB 4ONHB 4I3RL 1A3RH 1YNKL 5DUMH 4MAUH 5B8CB 4E42B 1VEPA 1IGCH 4LLYB 1G9ML 1QSFB 4OT1L 4PJIE 3RWCB 2CKBA 5A2LH 4DAGL 5DHYB 3TESA 3BRGC 5CZVL 4WGVB 1M4KA 2V2TB 2GJ6A 2ICES 3SE3A 7FABL 3IDJB 3W39B 2AQ2A 1JNNH 3K2UL 3JZ7A 5D2LF 3SKJH 4DJMA 1IC7L 2RCSH 3K1KC 3MV9E 4PB0H 2CLVB 4QRRD 1XCQB 2WINA 1MCKA 3DRTB 5F7WC 1NBYA 2DTMH 4ORGB 2VABB 4OM0H 1OSZB 4U1SB 3DHMA 5L2KB 3W9DB 5GJTL 4OZHA 5EO0A 5I75B 2Q76A 1HKLL 1M7DA 3QQNA 3TT1L 1N5AB 2J5LC 4GMSL 5HYIA 4YHIA 5I8OL 1FL6A 1HILA 1YEJH 1P4IL 4HX1B 4WIQA 1FIGH 1RIUL 4DGVH 4HC1H 4TNWF 1J0YA 1MI5B 2WINB 3DRTA 1EO8H 5DRZB 4LHUD 3T8XB 3U30C 3NN8B 1LEKA 1BF8A 4BZ1H 1ORSB 1DBAL 3UTOA 3S36X 3LKSA 4NKOA 5JW5B 3K2MC 3FN0H 5GS0L 1FV1A 2GQHA 4WI6A 5K9KB 3I02B 2NYYC 1BZ7A 4WO4A 1HSAA 4O00A 4ORZC 4EKXA 5C0JA 4HT1L 4AY0A 4K2UH 3W2DL 1EPFA 3ARUA 1PG7W 1K5NB 2X1XR 4HS6B 1CICA 4TUKH 2H2SC 4C58B 4O2FA 5EOCL 4HKBA 4XP6L 1EEYB 4G6JL 3MRIB 3MODL 3L5IA 3V0AC 3DGGB 2WWKO 3BOVA 3PJSB 3RP1A 4M9PA 5DVMA 2VYRE 3F7YB 1T0NB 4P9HH 1P84J 1ITCA 4FQ2H 1XAUA 2LAGB 5AZEL 1MCFA 2BFVL 3IJHB 4WFGD 4AH2A 4NRYB 1WBZA 3DUUB 3OF6A 2X41A 4HWEL 1IGFL 3ROLB 5BQ7B 4L4TA 2NXYD 4XCNA 5C0NC 3MBXH 4QHUA 4ODHH 3EUUA 1CG9B 4M7JL 4TPRH 1AQKL 4GRLD 1ZVYA 3FTGB 5A16B 5EBMA 1FNGB 3D18B 4ORGA 3EOTL 2O5XL 2X7LB 2UUDH 1A6TB 2Z31C 4FXKA 2R23B 5EO0B 1AGEB 3ARDC 1L6XA 4S11A 1E27B 3RTQB 4L29A 3AU1A 1AY1L 1C16A 2DIAA 3QSKB 4ODVL 3V6BR 1A7BA 2VDPL 3FQNB 1AJ7L 3AS0A 2DLEA 2BNQE 1QO3A 2QKIA 1NCTA 3QEUA 1MEXH 4QWWC 5CIPH 15C8H 2OP4L 2IWGA 1QTYT 3QFJB 2DJUA 4Z77B 4U1HA 5JW4R 3WIIH 1RZFH 5ICXB 1D7FA 2VR9A 1T89C 3BSZL 4L8CB 2FBOJ 1BBDL 1RJCA 1NFDF 5HGBB 2DQIH 4IS6A 1OAUH 3EDDA 3UROR 4NQEE 5D1XC 2RFXB 1T7XA 4U31A 1TNNA 5IMLB 1CFSB 1GGYA 3HFMH 4K8RD 4U1MB 2M8XA 1KCLA 3OGCA 1YMMB 1KJ3H 2HT3C 2GUOB 5D5ME 3Q1SL 1F13A 3GKWL 2VLRE 1RUQL 1FAKT 4PJEE 3IVKA 2QADD 4NN6B 3TZVB 1OW0C 3BO8B 2WWKT 2KL6A 1KULA 3D0LB 4HQQL 2JB6B 2VIRB 4OZFA 1UWXH 1T1ZB 4YBLC 5L8KB 1YJDC 3C5JB 3INUL 3KYNB 1FNFA 1VFOA 1FN4A 1RSFA 5JORA 1DLHB 3QDHA 3EYUL 1F00I 2GUOA 3QH3A 3WIHA 5HDBF 1QPXA 2P5EE 3QRGH 5C07B 4YR6A 3DXAE 3HC3L 3OTTA 5DJZA 4KU1A 3OSKA 1WCBA 3GBLA 3G08B 4MD0A 1IM9A 1P7QA 2JKXA 4KQ4L 3WXVL 2BHUA 5ANME 3MRRB 1WC7A 5DDHA 3HUJA 2CR6A 5E0QA 3IKCA 4AQ1B 1MVUB 4M62H 4QGYA 4L3EE 4M7LH 3BIKA 5H37G 4HIEB 1MRFL 4JZNA 4O4YL 3I85A 3B2VH 4LHQB 2HFEA 1I7ZB 2AJSL 2FX9L 2ADGB 2CUHA 4UDUB 2FECI 1DVFC 2AV1B 3JV0A 2E3VA 3DVFA 3EDFA 1TQCB 3QRGL 3ULUE 2DKMA 4XB8A 3Q6FA 2XKNB 2IPUG 3LN4A 4W6XB 5IT2L 5F96L 1KIQA 1ZANH 4AENB 1MCQA 4JKMA 2JIXA 1UYWH 1ZGLB 1Z6JT 2CXGA 5DJ2A 4LF3B 5DWUH 4KVNH 4YWGL 3VFOA 3MFFA 4APQD 1XGYL 3RIAK 3PF2A 3W9EA 4WU7A 3GB7A 2ZUUA 3WD5L 5TH2B 1NBVL 3MLZL 2DQDL 4GAYB 4OT1H 4I0PB 4DVRL 2IC2A 1W0YT 4M48L 1J1XH 1HHIB 4PB9H 2XN9D 5C0BB 1I1AD 3AREC 5HHMB 1FORL 3SDXB 1ZLUH 4NQDB 1XGUA 3CSGA 3ILQD 3LS5H 5B3NA 5LGHL 4OM1H 4PY7B 3KXFE 2XWTA 3HG1D 3QIUC 4PB9L 4QTHB 3SGDH 4EI5B 5D2NC 3IDUA 4FQQA 5FGBC 3GSXA 4XCFH 2IPTL 5C0AD 5L9DL 1IVLA 1HIML 4KK5D 5FHAL 1A7NH 4X99B 3SE4C 5IVXE 3FQUB 4X4YA 4JFPB 1WBXB 3GMMB 1IM3B 5DJZB 5D93C 3T0WA 5MHSE 2J7LA 1YPZA 3BPCB 2AXHA 4BQ9A 4H26B 1LO4H 3MBEB 1DBBL 2IBGA 3IKCB 3ME0A 3TIEB 2XRAH 2W9EH 3HN3A 3L3HB 3O2VL 3BZFB 4TNVF 2R1YB 1ORSA 2OSLB 3UC0H 5K93A 3VH8A 4NM8L 3R06B 3VXUE 2QSTA 5E03A 5E99H 2ICWB 3GHBH 3HUJE 4WHTA 1J1OH 3P30L 5JNYB 1ZLUK 3GJEB 5IW6A 3CVHA 4M62L 1OAQL 2IANA 1F4YL 2J88L 2Q1EA 2GT9A 4Y8DC 3TNMA 2D7OA 4Y0GA 1CFTB 4RGNC 3WCYA 3AAZB 1B0GB 1AR1C 4IOIA 2V2WB 1UXWB 2VWEE 2X4UB 3KAAA 1KCSH 4JZJA 4OLXH 4LLQA 5IV2B 2XWBA 3QFDB 1GGTA 4XXDB 1P9MA 4BFBD 4Z7UA 1X5YA 3QEHA 5I1AA 2HP4A 1KJ3L 5SWZD 2SEBB 4PGBA 1FPTL 4Y4KB 1DBJL 4XMLH 5H37H 4CAGA 1B4JL 3BP6B 2AXFA 3GMRA 3TFKD 3QULA 1T22B 4IMLA 3P30H 5J11B 1IAIH 2DB8A 5D72L 3IAQA 4MHHI 4WUUD 4JQIL 4LP5A 3CZFA 2XTJD 1BFVH 5LWYH 1E4XL 1E28A 4AEEA 2XA8H 2VZSA 4LLWA 1PFCA 4JY6B 1MPAH 3BZEA 3CLFL 3CH8A 4Q0XH 4UQ3B 5DK0B 1UJ3C 2BY3A 3WLBA 3QEHB 1ZLVK 1U92B 4JVPA 1A22B 2HRLA 4U1NB 4GG6E 1CI5A 2A6IB 5JO5A 4LLAA 3HC0B 1YN6A 4JFXB 4OFKA 43C9A 3ZYZA 3BIBX 4N0RA 4FFYL 4IRJC 1ZGLA 4POYA 5F21B 2X6MA 3JV6A 1OP5H 2VXTH 1RUAL 2B2XH 4JDZB 3W5MA 3R0MA 4C57C 3MFFB 5L9DH 3H7BA 5EU6A 3MUGB 3UBXG 5HYFA 3C09B 4MS8C 2R1WA 2JF1A 1ZXQA 4JY6A 4FFYH 3EJZC 4P5TD 1ZMYA 1ETZA 1CXKA 3P0YL 1GOHA 3VG0H 2EICA 4QRPB 3WIFA 1K2DB 2EDFA 2ICWI 5ACMA 3F65A 1ZSDB 3MO1A 3GMLB 3PWJA 3BJLA 3VA6A 1DLFL 4DN3L 4YUEL 3QUXA 2V17H 4F7TA 2VLLB 2HFGL 3D3VA 4ODTH 5HJ3B 4K3JH 1AHWA 1OP3K 3U6RA 1I3GH 4GJTB 4O2CA 1TZIB 4V2CB 3O9WC 1PKQA 1OGTA 5IFJA 3DNKA 3V4PL 1GZQA 2HYMA 5GGVL 1AD0B 5TDNA 2BX5A 4PP2A 4OV6F 4TUOB 1BECA 2LVEA 3AGVA 4YO0A 2FDBP 5HGHA 2X70A 5KANG 5IQ7L 4C56B 5LCVH 4HK0A 1CLYH 3O41A 5TF0A 4ISVB 2P1YA 2P46B 4GW4A 5BJTA 1HNFA 3OKMB 4FFZH 4OLXL 3MLYL 3MV11 1EFXD 1CXFA 1BQLL 3BUTA 2ED7A 2YD7A 3BAEH 4PJDF 1WFNA 2P7TB 4I18A 3WFBL 3P77A 1TDQA 4ZAKA 4XPGL 1IT9H 5ILTL 5CSBA 2X9YA 3BIAX 4P9HC 3RWFA 1YEHL 1MRCH 5LQBL 1Z0MA 2ZKHL 5IB2A 1W0WB 5DD5L 2EYRA 1ZVHA 3OWEA 1CFNA 1EBPA 3QUYC 3JWOH 3REWA 2DQUL 3OG4B 3BT2L 1AXSA 1IMHC 5E2WL 1MWAL 3RNQA 4RFNB 5IW1A 5HGBA 2FNBA 3VXSB 3VU2A 3F12A 3MRFB 3MNZB 3RKPA 1VPOH 5HHVH 1D3CA 5EO9B 2ADGA 2QSCL 1FJ1B 5JHDA 1PKOA 1Y18B 1RUKL 2YC1A 2ITDA 4XWGH 5GZOD 2VITB 3LEYH 5K9QI 1PW3A 3FFCB 3SEPA 4X4ZA 3TFKC 4AT6A 4U4BA 3RQ3A 5KVEL 2GJJA 5I1DB 4HH9A 1WGOA 2HAZA 1WBYA 1JGUH 3RVXC 3C60C 3P11H 5HYJD 3RIFF 3IDJA 3T04D 4NM4H 3HR5A 1FGVL 4OFDA 1ZOXA 3E6FB 2L0DA 1ZA3B 5E94B 5GS3A 3KG5A 1WWCA 2G75B 4HV8B 1BVLA 5F3HB 1J18A 5EC2B 3FQRB 3QQ4B 4PBVC 2HFFB 2K3TA 2P4AB 5CJXC 1AD0A 5CP7B 4IRSB 3GNML 3EOBA 3QCUH 5EOTA 5FUZL 5TDNB 1C08A 3MV9B 4QXGL 3WFDH 5F8QC 4RGND 4WO4D 3QUML 4ZD3L 5E6ID 2Y23A 4XVTH 3RU8L 2BMKB 2DI7A 4HUWA 5E70A 4JFFD 5KG9B 1MFAL 5EU5B 4F3FA 1YY9D 2Y07L 5FUZH 4YHIB 4TTDD 4YUEH 3MOAL 3MGTA 5D6DC 2OX5A 3QQ4A 1B90A 5CZXC 1S7XA 3LKRB 1A7PH 3SDCD 3H3PL 1QR1B 2F5BH 5FO9A 4PJDE 5GS2H 4MQXD 3T0EE 5C8JB 4HDIA 4OIAA 1HIMH 3WFCL 2UVFA 1I1AB 3MACL 5DMGC 3GMPB 1CWVA 1EGJL 3CIQA 4OM0L 2IAMB 5DK2B 2VE6A 4R97B 1Z0NA 3P4MB 2H6PA 2DYPA 3C6LB 1CICB 4M7ZC 4NHCL 1F90H 4L4TD 2NTFB 3WSQH 1MI5D 1QRND 2R2EA 4Q74A 4GS7B 3ZT5A 3MLYH 3TVMB 2VR5A 3MV7B 1M6OA 3NTCL 2ICWJ 3SCMA 5CCKH 1IZJA 3QPXL 1BQHA 3AXLA 3PDGA 3WL9A 2AJZA 3IDYB 4ODWB 5E4IA 1N5AA 4H0IA 5C7XH 1FYTA 2J8UF 3PGCA 3MBED 3WIHH 2NX5D 3JVGC 1NCWH 2VLRB 1QLEL 4HWBL 1AC6A 3V0VB 1I7TB 3RTQD 5IMLA 3SJVD 5T5FL 3DX8B 3UTPD 4DKEL 1F02I 5KSAD 1DANT 4J1UB 2VISB 3QHZL 3DPBA 4HIIA 5DXWA 3MJGX 5GS0D 4YXLL 6FABH 4Z7NE 4ZXBC 1QSZA 2DQJH 1C08B 2UY6A 3GM8A 4P3DA 2JB6A 4F15C 1C5CH 3IDIA 4R90H 4ZYKA 2V2XA 1MFNA 3MC0A 4FHBD 4BFIB 1F58H 5KAQF 2APVA 2ZOKA 1JNJA 4A6YH 4EDXA 1SM3L 1I9IL 1PLGL 3PJSA 2X40A 4D3CL 5KN5B 4QHKI 2XNAA 3N9GH 1VGKA 3UJJH 4R7DA 2ADFL 1P7QB 3C6SA 3WNPA 3ZTJG 4APQA 3BUYB 2F19H 5DVKA 1AR2A 4NRZA 5EC1A 4LSTH 5I9QB 3ZE0F 4TVPH 2WP3T 3LKNB 1I9EA 4MSWA 1NEZA 2V2XB 2BXYA 4PP1C 2X4SA 3FT3A 2FO1A 4QHUB 4E41E 4JLRB 1GGCH 5BRZA 2D4FA 5AAMA 1J0HA 3MACH 4HIHB 2ZCHH 3V5DA 4YHLL 4YAQB 2FB4L 3TA3C 1QSFD 4DCQB 3QEGH 5C92A 2IG2H 4OCWH 4WJ5B 4QYOB 3HA0A 4OZHF 5FYKE 5DUML 2AS5M 4Z0XB 1A5FL 5I0ZA 1GGIL 3GRWH 4P46B 5DEZA 1LO5B 1NBQA 4HS3A 1EGJH 2VAAA 1U8JB 2R4SH 1S8DB 7FABH 1MCJA 3MRIA 5TGBB 2DBLH 4U1IA 4YGVA 5ID0B 2FBJH 2BSSA 4N0FB 5EU3A 2DL9A 3O0RL 5D1XD 4MAUL 1VEOA 32C2B 2FLRT 3MYJB 4V1DD 3CC5B 5F6HI 2ARJA 1X5FA 4MJ5B 2QHRH 3QFJA 1TLKA 4JHAL 4OGAC 3T0XA 4X7TB 2NW3A 4M3JA 1U3HD 3LB6C 3RFZC 4H88H 2FL5B 3IJSA 4IOFD 5KVDL 3O3AB 5I19H 2YOCA 5IVXF 1T7VA 3DX7A 5L6YL 2GY5A 4Z7UB 3K46A 2H3NA 2WIIB 1QYGH 5F88B 3MRKA 4L9DA 4PJGA 5I75C 5C07D 3MJ9H 1VCAA 5GS1C 4Y5YB 5FF6A 1UVQA 2J4WH 1XF4B 4JO4H 4S1SL 4UU9B 2XN9B 3PP4H 4PBXA 4PJIF 1GAFL 5CINL 3L5WB 4KC3B 1FH5H 5CJOL 5GRJH 2FJFB 5GIRA 5EUOE 3S37L 2NY4B 1S9WB 2H26B 2ATPA 2B39A 1HI6A 4HJGB 5DS8A 5TE6L 3W0WA 3JWDC 4YHOH 4MQ7B 1UB6A 1UVQB 3ZTNH 5FDYA 1V3MA 1YMHA 4FTVD 5SX5K 1DANU 1BX2B 4NQVA 4ELMA 5L88L 2PW1B 3MQIA 5IW6B 1WQVT 4OD2B 5F1KC 1CXEA 3SN6N 2CR3A 4MZ3A 3E0GA 2HJKB 4ODBD 1J86A 4FQ1L 2VH5L 2NLJB 4HWBA 2ZUWA 3CUPB 1X4YA 4P4RA 1RVFH 3DUHA 2C3XA 1L9NA 2ZKHH 4PTTB 4M4RA 4X5WA 3OB8A 3EDEA 3REVB 1M7IB 4KTDH 1Y6MR 1HSAB 1WFTA 1XZ0A 4U1JB 3MYJA 1BD2D 4JKLA 4MXVE 3TF7C 5SWQA 4YHLH 3SDDC 2DS4A 1P5VA 4XVJH 5FUCE 1U8MB 1FG9C 3AB0B 2IF7A 5DJ0A 2EKSB 1SEBA 1Y18A 2BSTA 4GSDH 3O0RH 1U8PB 1DQDH 3GBNL 1XGTB 3QIWD 4NRXB 1UACH 5HDBE 3O3AA 4XX1E 1JWSB 5DUPL 1R3IH 4XPBL 1UH4A 2DMCA 4ZXBA 2HVJB 5LGKA 4MAYB 4UZGA 3RA7L 3CFKA 5MEQB 4I3RH 5SWZA 5HDQH 1AH1A 2CUIA 4QHLA 4E9LA 1CD0A 3RUGA 2XIDA 1YN6B 2CQVA 2DQTL 1KPVA 4JFXA 3WDHA 4YIQB 1U2CA 4PIRF 4OUUA 2Z35B 3QJHB 5DJ8A 2R0KL 1ZA3A 3NVQA 1JGEB 3FN9A 2K1MA 3VXRB 1JUFB 4MNQE 3ULVC 4OIIH 3VGDA 4DKFH 1J0KA 2K9UA 3CH1A 4JFHD 3GSWA 1IAMA 1NMBL 1P5UA 1MJUL 3MRJB 2C9AA 2EE2A 1AI1H 4HS8L 4R97C 4ODWA 2Z35A 2E6PA 2ICEA 2AXFB 3GMRB 1UM6L 3C8KB 2DM3A 1KPVB 3MRFA 3LEVH 4S1DD 4YDIL 1OAKH 2FIKA 1WIUA 2PXYA 3QHTC 4N0CD 5TE7L 3NIGF 1VADB 3IJSB 4KXZH 4OCRL 2HMID 2HJKA 2R4SL 4GS7C 1XEDA 4Z78B 1TZIA 3H3PH 1T7ZA 3JUZA 5D1ZB 5LG1A 1KCKA 3QI9C 2Q7NA 1RD6A 4X0KA 5D2LA 1KNOB 3OZ9H 1FFQA 5L2KD 3UAJD 2Y4SA 4RFOL 3BRFA 4G8IA 1CLOL 3F7PC 3HI1B 5ISZB 1DDHB 2P5WE 4BA8A 4U1LB 4NNXB 3QXVA 4LPUA 1VHPA 1RZJC 3P4NA 1LP9B 1IEBA 3ZL4L 2YBRB 1X9QA 1OOAA 4TUJA 4PRIE 2NW2B 4OD3H 3SJVB 1FAIL 4Q6IC 2CD0A 4M93C 4O4YH 5GS0H 1FO0A 3MRQB 1J5OH 3QDME 1NEUA 4JFPA 5DUBA 4OV5A 3V52H 4OLUL 1BHGA 2HTLD 1R5IB 5A3ID 3V8OA 3STZB 4DTGL 4TTGA 1OARH 5ICZA 4PRPB 1X5LA 3HE7B 5CEXB 4OD2A 2I07A 1FVCB 5CJOH 5GRJL 4J8RA 3PGFL 1EEZB 4D9QD 4OLUH 1KCVH 4PV9B 3MLPA 2OTUB 5DO2D 4P9MH 5TFSL 2BOBA 3U82B 4JPWL 2Z93B 1U8KA 4R8WL 1TVDA 1ZT7A 3GSOA 1MREL 5D70L 1PVHA 4AIZA 3OBAA 4P2RE 5E00B 3V6OA 1PX3A 1MFCL 1KCRH 5D7LB 3ZLQC 3HG1E 4JM2D 5ICXA 1WBYB 2E7CA 4WW2B 3ZDZF 3MRJA 1UA6L 5E2JA 4BSVA 3FRPA 5C0AE 2E8YA 4NO2A 4EI5D 3RHWK 2ZWLT 5JXED 1QFHA 4NUGH 1HKLH 2W60B 1LO5A 1H15B 2QQKL 1FZMA 3IF1B 2IBBA 1BGXL 2NXYB 2MWCA 4I8DA 3LKSB 4NKOB 5JW5A 2HRPL 3VWKA 3NCMA 2J3SA 1MCEA 3QO1A 1LE9B 5BV7H 2GY7B 2G2RB 3GGWA 4Z7WB 4MAYA 3MNWA 5CJBA 1U91A 3ARZA 3AREB 5KSBF 3A67L 4K9EH 5EZLB 3TPUB 1CE1L 3EAKA 5L2JB 1JV5A 3DIFB 1V5JA 3MLTB 1FFNA 4QLRA 1H15A 4LSSL 4Y4FA 1Q9WB 1ZT1B 3BDXA 1AO7A 2W0FA 4X6DE 3F5WA 4HK3J 4PJDB 3OR6B 3MLUH 4P46D 3T0EB 3GIZL 4Y8AA 3VXUD 3TGXA 4U7MA 2XKUA 1H3PH 3GI9H 1FZMB 2YA2A 1F90L 1DTUA 1B2WH 5FOBA 5DUPH 3LZFH 3R4DA 1BWMA 2X42A 2PKDA 4NO5A 3IU4L 2Q8BH 3GMPA 2BCKA 1RMFL 4FQCL 4JO3H 3HZMB 1NMAL 1Q94B 4N0UE 4M6OL 2XPGB 2Y7QA 1GGIH 3TWCL 4XXCC 1AXTH 4WI8A 5SWSB 5KS9F 1OWRM 1CGTA 3I50L 2FZ3B 2Q3AA 3WUZA 2DQGL 3P0YH 1FVEA 3ZO0A 3V95A 1CL7I 1UENA 4DOHE 4CJ1A 4FQPA 5IHZA 5FYJL 1UZ8B 3FAWA 3KPSD 5JDSB 5E5MA 3MRGB 1MCDA 2E7HA 1U3YA 4MLSA 5IMMB 3TC9A 5KW9L 4PP1D 1G7QB 3OR7B 5E8PA 4XH2B 3QPQD 2JCCB 4NQTA 2MSPA 3VJ6B 1MWAH 4F7TB 2XTJB 3CSYA 3I6LE 5ADOL 4JY5H 2XWJB 4QO1A 5D71L 3UMTA 2LV4A 2E7MA 1I7TA 1LP9A 5E9DB 3GO1L 3LKOA 3L5JA 5EU5A 4MJIA 1ZLWH 2I9TB 4Y4HA 4O2FB 1K4DB 2X1PA 1G1CA 3P11L 3O6ML 2I24N 1IAOA 1JHKH 3EO9L 3QO0A 2BOCA 5C6TH 1FLRL 4PTUB 4LU5H 2X5PA 3DLQR 1MJ8H 3U4AA 3BN3B 1TENA 4Z7OF 2AKRA 5A2IH 1GAFH 4U1HB 1CN4A 1MREH 5IF0A 5FXCH 3VRIB 3LKOB 2OM5A 2B1AH 1F3DH 4CDHA 4MNQA 1IGCL 5GRUL 4P59H 5JOFA 1L4IA 4PRAA 2F74B 4KFZC 1A6VH 5JIPA 3OKEA 1KC5H 4R4BB 2OR7A 1B0RA 1WF5A 4JPKL 4OCXH 2B2XL 4YDKH 2BOCB 5T1KA 1IFHL 4ZODA 2FWOB 3MYZA 2YWZA 1JWMB 1MCLA 3W81A 3WKNA 2OJEB 1CFNB 4ONOA 1S78D 1WT5C 2JJVA 1HHHA 1UKSA 5IM7A 5BXFA 3BP7A 3QIBC 4FNLH 4XNUH 2X7LA 4KKNA 2AABH 4MXVF 3UTTA 1A0QL 2C4XA 3HC4L 1A7QH 3NCYS 4WUUA 1QKZL 5IB3B 5CD3B 1UXSA 5HGGS 3RVUC 3U30B 1JGEA 4UUJA 1OM3H 3R1GH 5JORB 4P2YA 5HGDB 4GH7B 2H32H 5DHVA 5ETUA 2ZP0T 3SBWA 1LE9A 1XF5A 3EBAA 4X8JA 1YEIL 3SO3B 1QR1A 4PJAA 3O3BB 2BY0A 5I19L 2GT9B 4E5XA 5SWZE 3BPOC 2P42B 4TYUA 5HTSA 3EYSH 4ENEC 3FO0H 4OQTL 1BJ8A 4UDUA 4JFED 2MCPL 4ZFFB 2DQCH 1F4AA 2QJDA 1NGQL 1IJ9A 4P2OA 2YD8A 4I3GA 1D5IL 4HIXH 1OGAE 1GPOH 3LIZL 4DN4H 5DMKA 1A3QA 4W70A 4PJHA 2ARJB 3WNMA 2D0HA 1KB9K 4NHUA 4Z7UF 1J8HB 3MOAH 3VXSD 3CK0H 3GRWL 3EFDH 1YYLH 1Q94A 1R3HB 4HJJH 4NKQB 4P57B 5CBAB 1J0JA 1YPZF 3MXVH 2V5TA 4QCIB 4UILL 2R39A 1UYWL 5DD0L 5M94B 1HSBA 1T04B 3GRWA 3S35X 3TN0B 3MXWH 1F3DJ 3OKDB 4LU5L 4JANA 1H3TA 3CSBA 2HH0H 3G9AB 2EDDA 1MFDL 1LO3H 5E56A 1T66D 4OSUL 1P1ZB 2JCCF 4LCIH 4E41B 3TO4A 2UZYB 5AEAA 5DD1L 2G5BA 5L0QB 5D7SH 4M93B 4XNZB 2WV3A 4IMKA 3H8NA 4WV1C 3N1MC 4K7PY 5IGXH 1RZ7L 3DO7A 4TULH 4C83B 1BVKA 1JWUA 3CU1A 4JB9L 4MNGE 1KPRB 4YBLB 2APFA 4F9LC 3W5NA 3L95A 43CAB 1KPUA 5BRZD 1W0WA 2A74A 4KJPC 4I18C 3SDDB 3M17B 5D1QA 1IAIL 3CJJA 3L3OB 4JY4B 2MQCA 5FCUL 3GMMA 3NCYP 2I25N 3VXOB 3HE7C 3SDAA 5B39B 3RNKB 5EZIL 4OZHE 4APQC 4XB7A 4JFQA 4I5BB 4ZPVB 3H3BC 4J3TA 3DETC 2Y9RT 3U6RB 3TYGH 4PJHF 2FR4A 1YEEH 3RUGE 4GRWE 4N1HB 2KZ1B 5D8JH 3S36L 3VFRB 5A2FA 3EOAA 4M7KL 1NLBL 4HIJA 4RZCB 1DUYA 1R3KA 2EDOA 2DTML 1OP5K 1RHHB 1DN0B 4MMZC 2Y72A 1Q72L 1A8JH 1DJSA 2BHYA 4WHTB 4LSQL 1HQRB 3QFJD 1I4FB 5IK3B 1WC7B 4Y4KC 3OKMA 3O3EB 1N26A 4QEGA 4L4TB 4Z0XA 4FFVC 2Q20A 1KXTB 3BPLB 3HNVH 3FO2A 3BGMB 4FXGB 2XN9E 3DOSA 3OKLB 1KYOK 1P4LB 4FQQB 4FRWA 1HEZB 1JVKA 1T04A 3TN0A 5KTEH 1AC0A 3T77B 5FFLA 5T3XE 2VNCA 2ILLA 3RWIB 4PGEA 2Z92B 1TJIL 3QDJD 5E8NA 4Q9QL 4XC1H 5CILH 5T1LA 3TBWA 3FCTB 1I3GL 1I9RH 2OS7A 4ODUB 1MNUH 3EYFA 3QEQE 1EDQA 2QR0B 3QWRD 3VXUB 1T0MB 3MOQA 3ILPA 2NY4D 5MHSD 4LLVB 1WUNT 1RZJL 2Q7YB 4LCIL 3L3JB 1HOCB 3IDGA 2BJMH 3HZYB 4JFZH 2ZCLL 5KSAC 1DR9A 5JOPE 5I1DA 3IFLL 5EG6C 1PYWB 4UT7H 5H8DA 4LKXB 1BD2A 4RAHA 3UDWA 2NY6B 3QQ9C 4GKZB 3V4UH 2LAAA 4I77H 4W68A 5EZOL 2V5RA 4Z8FH 3QDMA 5B39A 1HNGA 1G0XA 1MNUL 4YJZL 3BW9B 1FO0H 5ALCH 5T5FH 5KZCD 4XNXL 1HILB 4QRRB 4O5LL 5IMOB 3QCVL 1I9JL 4R4FH 2NY2C 1A9EA 1RUKH 2OR9H 3IRZA 4NP4H 3MR9B 3RZWA 5CD5C 4F7PB 4JKKA 3BO8A 1TETL 1FZJB 4NKIL 1TVHB 2X9WA 4UNVA 1NCAL 3F62A 4WDIB 3ULSB 5EBLB 4RWYL 1IKNC 3GUTA 1UCBL 2G5BB 3V6OE 2PN5A 5FYJH 1M7XA 2FX9H 1A21A 5H94A 1CXHA 1XF1A 4ODVH 4JGMA 4F2MB 3CDGA 1P2CA 1VEMA 1PY9A 3SJVA 3Q5OA 3CXDH 1AFVH 4HUVA 2ENSA 4YBQD 4GBXC 3B9EA 2VSCA 3R8BB 1OAYL 3EKCA 4XNYH 1RJYB 2UYLA 3DYPA 4H8WH 1T1WA 2NZ9D 2NXYC 3MA9H 4TNWK 5ADOH 1AGCA 2CH8A 4OI7A 4JO1L 4PRHB 3BVNB 1ACZA 1L7TL 3IRPX 3P4MA 4LSVH 3J8F7 1F6AA 3RDTA 4RSVA 1WJ3A 2AERT 4P5KA 4RIRA 2I07B 3M45A 1A0QH 2Y07H 1NAMH 3HG1B 1T0MA 2XZCH 1KIRA 4JRYA 5DGQA 3BXNA 2AXGB 3KXFD 2BVUA 1L7TH 1N4XH 1EFQA 2A73A 3CXDL 1TJGH 3DI3B 1OAZL 1MLBA 3RWFB 1A6TA 3OKOA 3WFBH 2VDNL 3I6GB 4G7YL 2ZUTA 1Z9MA 2VB5A 5B38G 2NXZC 2XV6B 1Z2KA 4GBXD 3D0VA 4RGNB 1AO7D 1PYWA 4KMTL 1FYHB 3EO0B 5INCB 4LSUL 4H1LG 1INDH 4HS8H 3ECBA 1DQLH 1FLTX 2P8LB 1IEBB 5JOEA 2VQTA 5E4EB 5JHDD 1YEDB 1INQB 5DYOA 5DSCA 4C56E 4HIHA 3LKQA 4X6DB 4ZNCD 4RAUB 3G9VA 5E08H 4AH2B 2FYYB 1UJTA 1SVZA 3I3BA 1MQKL 2NCMA 3H9HA 5FGCE 1FO0L 4AMKL 4WFFE 4ELMF 5FUOL 3QXDA 3VMPA 4YDVB 1I7ZA 4M6MH 3AY4C 1F5WA 3ISWA 1CG9A 1N0XH 2XYCA 3HR5B 3TJEL 3P73B 1JHLL 3OPZL 5CUSH 2HKFH 1U93B 4KKAC 4KZEL 2W65B 4NYLB 1Q9OB 5FK9B 1X5HA 3P9LA 3RWJA 5SWSE 2CDGB 2EECA 3VRJA 5D1XA 4ZNEA 3VI4F 3VD9A 3Q6GL 1KLFA 4UBDD 12E8H 5HGAA 5K33A 3N85H 1XIWD 1NUFA 4NZTL 8FABB 1JF5A 2QBWA 3P3YA 2NY4C 3OAYK 3AU1B 3VGEA 5FYKD 4ZFOB 1EEYA 2JCCE 3TA3D 5FCUH 3VWKB 3NABH 4Y2DB 3HI5H 5I1HH 3IXAA 5KSAB 4XP4H 5F1IA 3RL1A 1N7ML 3L6FB 5DJ6B 4EXPX 1WT5A 5C07A 1K6QH 2EDQA 4M8VA 5BO1H 4LSVL 2WLYA 4MQTB 3DV4A 3O6FB 4RGMB 4RMQA 3X11A 1S7SB 1MCCA 4YC2C 2QTEA 4NQCA 4TSCL 4XNYL 4M4PA 3QNZA 2VQ1A 3KPPA 2WLZA 3FHAA 3HMWL 1DFBH 1RZ8B 3MA7A 5DHVB 2O26U 4YBQC 5IQ9B 2XXMB 4O02L 3LQZA 3BEWB 1WBXA 4OFIA 4YFEA 4GAGH 4ZUWB 3BKMH 3PWPB 4PJFB 1YPZB 2YZ8A 3BGAA 2O5ZH 5EU4A 2EDRA 3BHBA 4XVJL 1T1WB 2GYSA 1MUJA 4EEEA 2Y7QB 1V3LA 4F7MB 4JGJA 3S34L 2D31A 5DHVH 1D6EA 3ESUF 2E9BA 2O5ZL 3K8MA 2PR4L 3O4LE 4NO3B 5ERWA 1D5XB 4A6YA 1N5YL 5JNYA 4OGXH 4PG2C 4JFFE 4MAYC 3QEUB 2K7PA 1M7DB 4PUBL 2QEJA 1GGBL 4DQOH 3HPLA 5LGHH 1IGYA 5GRWA 3EDJA 1HHJB 1NGWA 1X5KA 1U8QA 3WXWL 5GRYA 4X6EA 3PIQA 1MHHA 3SGJC 4K9EC 5ENWA 1UXSB 2EDNA 5DZOA 3RY6A 4KROC 4OIIL 3KPSB 3CFKB 1BVLB 1NC2D 2GTZB 3T3ME 5C0BD 5A43C 3LRHA 3WE6B 1P1ZA 2BXZA 2YS4A 3K80A 5HHMD 5LCVL 5B8CA 1DQJA 1DEEA 4E5XB 1KACB 1KGCE 3FO1B 1QBBA 2WP3O 1PX4A 3RPIA 3IGAA 4U6VH 4RRPG 3I6KA 4GKSB 3MRPA 3T1WA 3HCVA 5E2VH 2GSGB 2V7HA 5JDSA 5DJCB 4WFGE 3WJLC 4NHUB 1F4YH 5HGHB 3LQZB 5CZXD 3LEXA 1VACA 4GKNB 5DJYA 1KJ2A 5F7LB 1WAAA 4HGKC 5C08B 3CVIL 4M8QB 3ULUL 4Y19B 2VAAB 5E6IC 4HKXB 1CU4L 4R90L 4R96B 2Z9TA 1R0AH 4KPHH 1WITA 5KZCB 1QBML 5C0FB 4PJIA 3FO9B 1IC5H 1TCRB 3MV8D 3ALXA 2GW5A 3ZDYF 4H5SB 1QBLH 3CU7A 4F2MA 4LVNC 1BEYL 2DQDH 3MRHA 2R4RH 4BFIA 1G9NL 1JGDB 4K8RL 1UB6B 4D9LL 9CGTA 3EO9H 4TSAH 4U3HA 3MO1B 1ZSDA 1CT8A 3DURA 2ZOLB 1PZ5A 4WNQA 4OZIF 1XF5B 3TT3L 3ROOB 1MCPH 3RWGA 3DVIA 5DMJB 1F2QA 1H0DA 5ICYA 1K5NA 4K7FB 5DI8A 1RIVH 25C8H 2DQFA 4JDTH 2OTPA 1L0XA 2BNQD 2CDEB 2EH7L 3HMXH 4RX4A 1CBVL 3QQ3A 3W11D 1FVEB 2CO6B 1T0PB 3ESVF 4CW1B 2VDNH 1NL0H 1IL1A 3PNWB 5E8EA 3GKZA 1BQUA 2WZPD 1JTOA 3C2SA 4OB5H 2A6IA 5JO5B 3KPRA 4EN3C 2P5EB 5F89A 3GO1H 4N0YH 1FRGH 4CVZA 4YDJB 4HH9B 2O93L 3TZVC 5IG7B 3UBXB 2F8XC 3OB0H 1A14H 2WUBH 2BC4B 1UWEH 2FGWL 2R0WH 2UV3A 3SDXA 5D7IB 1AKJA 1T66C 2H8PA 2ERJC 3BE1H 2XQYG 4NN7B 4U1GB 4S1QH 3OAZK 1CZ8H 1XR9A 3HZKA 3ULUC 1P6FA 4CVXA 4X6DA 5T1DH 5I15L 3NIFE 3D18A 4L4TE 3MRMA 4ZXBD 3E1F1 4DKEH 1D5MA 1T1YA 1T2QL 2Z4QB 4OM1L 4PJ7A 1MCRA 1J0ZA 3IDMA 4ZUSA 3RVVD 4PJ8B 2BNRB 3L3GA 1XIWA 1KT2A 1C5DB 3MCG1 3S98A 1D6VH 2EO9A 4LF3A 4AMKH 2JB5H 4XAWL 2VLLA 4NZUH 3RVWC 3SGEI 2D7PA 2VLKD 3LKRA 2HFGH 3LN5A 4FFWD 1BF2A 3FO2B 1QLFB 2JJUA 1FO0B 3WEXB 4P48A 1FL5B 3VI3F 3FB5A 2FX7H 1XMWA 3CX2A 4MA7L 4X9BA 2MKLC 4FNLL 4XNUL 4R3SA 2VXUL 3CFIC 1YEFL 4NSKA 2ICWA 3WXVH 3RZCC 4QXTA 3T4YA 2AK4B 4EBQH 4ENED 1LP9F 1YNTA 5IB1A 3LRSB 4KK9D 1NUGA 3PQYB 3H7BB 3GK8L 5F9JA 3S3SA 2IEPA 5I1HL 5F9OL 2CRIA 4NJ9H 1EEZA 4NQDE 1FDLL 4QT5B 2AEWA 4MA3A 4FZ8H 1CU4H 4Z78A 5I1AB 4CJ0A 5F44A 3STLA 2Q6WA 2H32B 2KPNA 3B2VL 2BK8A 2VXUH 4X4YB 5E8OA 2YPKB 4Z95H 1G9NH 1R3IL 5IFHH 2D3VA 3LCYA 4HHAA 2CRZA 5T1LD 5I16A 3QUXB 2C26A 2EXWC 3S4SG 1S9YB 4C59B 1RZIA 2GEEA 3E6HB 1IGTA 3KPPB 5J57B 3P4OB 3O3EA 3VXRD 1QRNA 4RFEB 2NNAB 1T21B 2CK0L 4K55A 4RWHA 1CCZA 4P9ML 4OTXL 3OKYA 2OSLA 1ZEAH 5DJAA 5HHVL 3MNWB 3NH7L 1MIML 5IP4A 2C3VA 4DGIH 4CN6A 2XACC 1C5BH 2M2DA 4FG6C 4L1DA 3DMMC 4NO0A 2Y1VA 1KT2B 4UBDC 4ZPVA 4G6MH 3V4VH 4DGIL 2EDHA 5KVGH 4MXQD 3KJ6L 3U46B 1F8TL 3C5ZD 1YY8A 5J12B 1KB5H 4WWID 1UA6H 3LN4B 3MUHL 3ZDXF 5DLML 4JFEE 4AIXA 5KSVA 3VXRE 2QSQA 3QXDB 1X44A 3DI2B 3GSVB 1UZ6E 4L29B 5BS0D 1T3FB 3RPKA 1FNEA 4BSWB 3QPQC 5HPMA 2EH7H 2VDKH 4JDVA 1RIHH 2I5YH 3WXWH 2ZJSL 3KPRE 3SQOH 2HLAB 2DRUA 1KB5B 1JPTL 3CUPA 3JTSA 1BBJB 5FKAA 5E99L 5EA0H 3MRNB 2FJGA 1UCTA 5CEZE 3RWEB 3UEZA 1KJVA 5DQJA 3CSYB 2DQUH 4Q9BA 1EEUA 2A1WL 1S7WA 2FO4A 2YPKA 1NMAH 4O58H 1OL0A 4QOKE 1IQDA 1F97A 3N1FC 4KDWA 4NPYB 3M8OH 1T5XB 3QIBA 1IGIL 4BH7B 3U9PH 4AL8L 4XTRC 2R2CA 2BZDA 5CJXA 3WNKA 5ISZE 1RZJH 4JRYD 3OPZH 5IVOA 3U79A 1E4KC 1BOGA 4QHNA 3TZVA 4RZCA 1FDLH 1PG7H 4NKDB 1M71A 2VDMH 5C9KA 2FJGB 4WU5A 1CLOH 4P46C 2XPGA 3FRPG 2QADB 1KXQE 4POZC 4UINH 4XP4L 1GC1C 4WU7B 2J1KA 3ZKXC 2A6DB 4I13B 2I26N 4Z5RB 1WAAE 5DD6A 4M43H 3VFNA 3HNSH 3X13B 1U36A 1WTGT 1ONQB 1CVSC 5E2WH 1AIFB 1CDIA 3FB8A 4RMSA 3TT1H 3ARQA 4NIKB 4M3KB 4KRMB 1IGML 4YX2H 4P2QE 4Y4FB 1MOEA 1SBSH 4KJQC 2QL1A 4NQDA 5LQBH 5F71A 2IMMA 4N8VA 3VXME 4XBGB 4XWOD 5DC9B 2IQ9L 3FRUB 1U95B 1DCLA 3VXUA 3CFBA 4KI1A 4M7LT 5EZIH 2H26A 2V9RA 1J8KA 3JTTA 1TIUA 1MHCA 1NFDA 1S9XA 3KYOB 1DBAH 2IADB 4YNYB 5D7LE 2NMSA 4GW5A 2DLTA 1IZKA 1N6VA 3RWHB 4QTIL 5HI3C 4JKPL 4MQSB 2VH5H 3S37X 1HZHH 2FRGP 3U7WH 4A6YL 4G6AC 4LSRL 3QDGA 5JR1L 3JTTB 4M7LL 1R3LA 2VXQH 4LARL 3BX7C 5IKCB 3QXTA 3GBNH 2IH1A 3QUYA 4FMKA 4HPOL 2XTJC 2ADJA 4JLRA 4G80B 5J6HA 1H5BB 1FJ1A 5JHDB 2GHWB 2B5IB 4L8DA 4MSWB 1N6QH 3VCLA 2FEEL 4F9LA 2VQUA 1OTTC 2XN9A 1H0DB 4GLRH 1I1AA 3PP3K 4ODSL 3EYOB 1C5BL 5EA0L 2HRPH 3DUSA 4H20H 1D5BB 4NN5C 5ACZB 5CP3A 2XZAH 4XPHL 4S1SH 1DFBL 3IGAB 4AL8H 5FEBA 1M1SA 2N1KA 5AWNL 1INDL 4LLMB 3MROB 5AZ2L 1S8DA 1ZHLA 3MFGB 5JPNB 5T33L 4G8EA 5E6YA 3H9SB 3ZE2E 3AVEA 2HN7A 2AXJA 1F3RB 3DO3A 3RJQB 4JCLA 1YEJL 4LHUB 2IALB 3C2AH 4HUKB 2Z31A 1FC1A 4JRXB 3DVNA 5CGTA 1NAML 4YH6A 5DVLA 5FDWB 1NGWB 1J12A 3FQXB 4FFVD 5HYQB 1HYRC 4U6TA 5EO1B 3DX6A 3TA3A 4HKZA 4P5TC 2NY3D 3IS0X 2VERN 5C2BL 2M26A 4JHWH 3FQNA 1G7IB 1HHHB 5INDB 2VRAA 3P9LB 4I9WD 3ULUF 4WY7L 2V5MA 5D6DA 4PJGB 1TVBB 5LGJB 4ZO8A 1A4KB 3MJ9L 3OZ9L 3N1QC 4IJ3B 3HE7D 1MUJB 2VDOH 3F5WB 4C54A 4H8WC 2FJHA 3I9GH 1NANI 3D87B 3QG7H 5ITBL 1IC5L 3LVEA 1YQ2A 3ZYJA 2OK0L 3SCMD 5GS1B 1CIDA 4LRNL 4WEBL 3MCLH 1OWWA 4Q6YA 4YZFE 3TBYB 2ZUQC 1OW0A 3ARVA 5L88H 3WS6C 2F58H 4RAUA 1U3JA 2A9ML 5F89B 5J6GA 4AQOA 2OYPA 4JO2H 3BWUC 1A6UL 1LO0H 4LPWA 5EIQA 1AGEA 4LCCC 3INUH 5GRUH 4JG0H 2R8SH 5CEZL 2KZWA 4M48H 4DFIA 5I18L 3FONB 5ANMA 1JNLH 4H25B 4LEOA 1DLHA 1S9XB 1HWHB 3KYOA 1H3UA 1KIUA 3B9KB 1AO7E 4XVSL 4Y2DC 5FGRA 3MJ6A 1MSPA 3ULVF 3VH8B 1UKTA 4GBXB 3KPMA 2GSIA 4ISVA 3LS4L 1CDCA 3ARBA 2OL3A 4HJ0C 1FVDA 1FRGL 4JREB 3DBXA 5D5MB 5KANI 1V7ML 1IKFH 3V6OC 3OXRA 4OZFH 5BVJA 1OM3L 2GKIA 1RURL 4LLQB 5IV2A 1U2HA 3ARYA 4N9GB 1FIEA 1Z9LA 2AABL 2NR6C 3VI3E 1NCCL 1NH6A 3QBTB 1I4FA 2NY5C 5I1GH 1RIVL 2NX5E 3WSQL 4R2GD 2KDGA 1PD6A 2VN4A 4P4KD 1HDMB 1RHHA 5D9SA 4XC3L 3PQYA 4H0HB 5D7JB 1TJHH 5C0RL 4NWTH 3M1BB 3AMKA 3K2UH 5GRVL 4QF1A 4R7NB 3MV8A 3MGTB 5FOJA 1VKXA 4X6CB 2B1HH 1YA5A 5F7EL 3TYFB 1OSZA 1FSKB 5DJ8B 1J8HE 1JN6B 3BRDA 1TJHL 5C0RH 2G2RA 3GGWB 5C1MB 2Z92A 3HFML 1R5WB 1RZGB 2EDLA 5F6HJ 3MRHB 4XNMB 4PLNC 4KZEH 4FP8H 1QFWM 3IXTA 5D7JA 1OTTD 4KQ3H 5GS0C 1DVFB 4QRSB 4HX1A 1UH3A 1XF4A 4JN2A 1JZ7A 3Q6GH 2VDQH 5HVWA 5TPWL 1ED3A 3L9RA 1EFXA 2CLZA 3RTQC 5CD3A 4U6YA 5HHOA 2GCYB 2BRRH 3JTSB 5IVZA 2VZUA 2FJFA 4F58H 4GXVH 4IBLT 4L3ED 4PGCA 4KVCH 1RJLA 4OF0A 3TYFA 3EYVB 4GUPA 4RMRA 4G6AD 2OI9C 2VLME 3CVHH 4YXKL 2DWEA 4R6UA 4KI5F 2V6HA 2CMRH 2R2HB 3DXAA 3CZFB 5IG7A 2ED8A 3S8WA 1HH9B 1JZ2A 4L8SA 4HZLB 1JNLL 4QRUB 5GGVY 2MKWA 1ZLSL 2APTA 2CGRL 1JYXA 2V9TA 4U6HA 2CLZB 4KI5C 4OZIE 1MCHA 3KYKH 4DZ8B 3SO3C 3VGHA 5IFJB 1I8IA 1NC4D 2DJSA 4Q6IA 3U0TB 3VD7A 3HB3D 3HAEG 5HDQL 4TVSa 1Q9KA 2ADIB 4KTYA 5D7KD 3CZJA 1DQTA 3EO0A 3LHPH 4UOW0 1MFAH 2PYEA 3LV3A 4DVRH 3SDCC 1BJMA 2IBZY 1K8DA 3MX0A 2EIEA 2YD2A 5DJ0B 2I9TA 2DQFB 1CFVL 2VLMD 3MBXL 3HC3H 1ETZB 5DLMH 3BGFC 1KB5A 2GK0B 2LQRA 1MI5A 1RUML 5CMAB 5EUOB 4LIQE 1FHGA 1SMAA 1KNOA 3ULVE 1DDHA 2RGSA 1E6JH 5HHQB 1RFDL 3ARGA 4ONGL 3C08L 3O6LL 3PG2A 4PRHA 5EOCH 1EEQA 2DBLL 1URLA 4RA3A 2ATKB 1D9KD 1V7NH 3IFPB 5KSBA 3VGFA 3FT2B 3O11B 2FGWH 2ZPKL 4OD1H 2CSPA 2CLVA 4G9DB 4K94H 3HPJA 5GGRY 5C09E 5GQBA 3IDNA 4I48A 4JFEB 2HT3D 1KGCD 5CGYC 3EFFA 2XY1A 2YKLH 3D48R 1NSNH 3QEQB 4C4KO 5DA0B 2O61B 5IBUB 3FFCA 3GUTB 3DVGB 4UDTB 3CX5J 3TCXA 3S88H 3D2UA 3T2NH 4I3SL 5HHOE 1DZBA 5B38A 3UJIL 4M7JH 1CLYL 1QPPA 3DIFA 2G60H 5C0EA 2NY1D 1NBZB 2EYSA 1JPFA 2BRQA 5AYQA 1QHPA 3B6SB 4MVBD 3B83A 3RL2A 4G9DA 1T21A 1N59B 4HC1L 1EHAA 1QRNB 3NOIA 3QIWC 3O3BA 4NM8H 4OAWB 1V8HA 4OBSA 2XZQL 5FHBH 2XY2A 2DIJA 1M05B 2C3VB 4Y19D 5I8OH 1LE5B 5H35A 3BZDA 3VFOB 3X3GH 4E41D 2CO7B 3UPRB 3ARDD 1P7HL 3A6BH 4GG6B 3O9WA 1NPUA 1RMFH 5DD0H 4NC1E 2E7LA 4U33A 5FA3B 5BS0B 2ZCLH 3RX5A 1Z3GH 5JA9A 3PP3H 5AUMA 1A6UH 3RWJB 4FZEH 1S7TB 3HTLX 4H1LA 1U8NA 4TUOA 4NKIH 1ES0B 1TCMA 4MCZB 2VZVA 3DROA 2FX8L 3TBWB 1R0AL 2WBJB 4D9RD 4FZEL 5F3BB 3NFNA 4R4FL 2W9LA 1NCWL 1OF2A 3QIUA 1H8NA 2ZOKB 3ZSTA 3VDAA 4U2YA 3L3DA 4DZBB 2DM7A 2DMBA 2F53A 4HD9A 4XMPL 5BO1L 4N8VG 3GSNA 2IG2L 4PTUA 3FQWB 2EC8A 4MJ6A 3WIFB 2AV7A 1OTUC 3WJLA 1J88A 2H2SD 5ALBL 1GGCL 2AJUH 5F97E 1S7SA 1CQYA 3IVKB 3GSNL 1Z5LB 5IVXA 1NCUA 1U6AH 5SV4A 5I71B 4JFFA 4D0BB 5I8EB 1MAMH 1QQDB 1K8DB 3QISA 2J8UA 4PJXA 1QSEB 2J12B 4NBZB 5GISH 3BN9D 3L3DB 2YK1L 4OB5L 3EGSB 4KK9C 4MVBC 2VWEC 3RGVB 1LK3H 1TPXB 2B0SL 4OGXL 4X8XA 4WEUD 3GIVB 2BNRD 3EO1A 3WJJA 3C9NB 1LWRA 4G43A 1BFVL 3MV01 4GXUM 3ZHLA 1U91B 5LWYL 1G0YR 3G5VB 4LLUB 4QCIA 5GGVH 3MUZ1 4Y4HC 1I3RB 2VLJA 4FFWC 4BZ2L 5I1EL 2ADJB 2YPLE 3IDIB 4ZYKB 1T83A 3L5XH 4LASL 5F7DB 3ZT7A 4MA8H 1CE1H 2VZTA 3X13A 1IC7H 3DX9A 3QCUL 3BWAB 2GAZA 3BP6A 5E08L 1S5HB 3B5HA 4GT7A 1UJ3B 3X12A 4M5ZH 5FYKL 3ZZ1A 4X6BA 5IESH 1WCQA 3PQYD 1LMKA 5MERA 4P4KB 1MCWM 3N0PB 2A83A 3SDXF 1QFOA 1JK8B 5AD0A 4XZUB 4O2EA 1MI5E 4B7LA 1OCWH 2DLGA 3VDCA 1WAAF 4Q9RL 1BLNB 3NACH 1QP1A 2UY7A 2ZPKH 4L9LB 4YDVA 3BDYH 4F8QA 5IESL 4NWUL 5KVMC 3V7MA 3QZWB 2F5AL 3KPSA 2MJWA 4QRTA 1U95A 3B6SA 3VWJC 3SE3C 2W0PA 4PJ7F 4JHZA 1I7RB 5GHWH 1L0YA 5KSBE 4LSPH 3GJEA 2A77H 3SPVA 5IMMA 4GFTB 4NUJA 4XRCB 4J3XA 5SX4I 5JPMA 4MJ6B 3LRGA 4ONFL 4WUUB 1X7QA 4WW2C 3PWVA 1S9WA 3VFGL 2APWA 1UKQA 2BSTB 4LVOB 1KLUA 3OMZA 1AXTL 1QBAA 5EU7E 4LK4A 1DUYB 12E8L 1IC1A 8CGTA 3SE8H 3L3JA 5DT1L 3C6SB 1WZMA 2YRZA 3IXAB 4JAMB 1XH3B 5FYLE 4PREB 2XNAB 5LJYH 1CDGA 2EE3A 1HQ4B 4RQQA 2Q86A 5EWIL 1WFUA 1MWAA 3IS1X 3DGCR 4KUCF 5FO7B 3MGAA 3EHBC 4F7CB 3CLEH 4HUWB 4OFYD 1X3DA 4MJID 4TSBH 4NKMA 2W0LA 3MLVL 5K59E 4JHWL 3SQBA 1L9MA 2FJHB 2M1KA 3ES6A 5AZEH 5C0BA 3PXJA 3D39B 1JWUB 4TPRL 2VDRL 4PS4H 3RPIB 1T1XA 4Y16B 3M17A 1ORQA 1ND0A 2VC2H 3NPSC 5BXFB 3MJ7A 4Y4FC 3EZ8A 1NFDE 1FG2A 4KDTA 2XQBH 1KTKE 1XGPA 4XBEL 1AO7B 4UU9A 3PHOA 1J11A 2BNQB 1K3IA 1NBVH 2WAHA 5I8EA 2IPKB 4IS6B 3DV6B 4TSBL 3B8YA 3E8UL 1S7QB 2ZCKH 1I9IH 2L7UA 3MOBH 4MDIA 4BYHA 3DRQB 3DMMD 4UOW1 1N5YH 1R5WA 1RZGA 1T1XB 3V7AE 1P7KA 3SCMB 1PKQE 5D7JC 3VFRA 4M1GH 1DL7H 4N90D 2I9LB 4JG0L 4LCUA 4BZ1L 3O8XD 3JWDL 3Q0HA 3WUWA 2X4TB 3QULB 4OJFH 5FM5O 3I3EA 3B8SA 4QKXB 4Q0XL 5EOCJ 5DMGD 2DKUA 2A1WH 4LVHC 4G8GA 3NFSH 5ACLA 1BFSA 1KB9J 4M61B 3DGGA 3U0PA 4BZYA 5MI0C 3O2VH 1Y6KR 5DUBB 4OV5B 1MHPH 4N9GA 5GJTH 1AD9A 3NABL 4QY8A 1RI8A 3CPLA 4L8SC 2CLRB 3BPNC 4WCYL 3P0GB 4Z76A 5ICYB 4OD1L 2FATL 2P44B 4WY7H 2VN7A 5FA3A 5BS0A 2E27H 5C07E 2GFBB 4XXDA 4XPAL 3WDIA 4OLYL 4GRLB 3RX7A 3U83A 1RUQH 2DLHA 5C08E 2OQJB 2WWMC 4P5TA 4WCYH 4WUKL 3LN5B 5ILTH 5T3ZH 4H20L 4ZMAT 2KH2B 4Q2ZA 4ZS6C 4D94A 3QWQB 4W6WB 4MNHA 2IMNA 2AQ3A 3FFDB 2R23A 4W4OA 1S7WB 1ZVSB 3RVTD 4GAGL 1CGSH 4K3GA 3BUYA 3BQUD 4X98A 4N68A 4PGJA 3V0WL 5TE7H 4LIQL 1S78C 3ZDZE 4BQ6A 5EPMA 3QG7L 2HT4D 4AEFA 2VABA 1U93A 4OI9A 2OK0H 1KFAL 3MRDB 3OXRB 1QZ1A 3IDXL 2HLFC 4KJWD 4UT6L 2A6JA 3SY0B 2ID5A 1K4CA 2C3HA 3H42H 5DURD 2R2HA 3DXAB 5DJXB 5IOPA 1CFVH 1CDBA 2PYED 2OJZH 1G7HB 1MFDH 4XP6H 4JKPH 4XVSH 3T2PA 2FIKB 2AK1L 3MUGA 3VXOA 1F4WL 2YHGA 2WQ8A 5CEZD 2R29H 1DE4B 4UT9L 4CN4A 1CXIA 3K4ZA 1A6WL 2RAMA 3OHXA 3TNNB 3LDBC 5J06A 1CD9B 1OPGL 5H94B 1RPQA 3U7YH 3H9ZA 4OQ1A 1EUUA 2Q7YA 3KWWB 1I8IB 3SDXE 1CLZH 3VG9C 1X4XA 5FA4A 1K4CB 1JZ3A 5I1EH 2AK4D 4NO2B 4DKDC 3IXTB 2GTWB 5JIKA 4OKVB 4ZS7L 2R0KH 5IB2B 4KKLD 4TRPH 5H2BB 5IEKA 1DE4A 1PGRB 3UTSD 1R24A 2AEQH 3IU3A 1CICD 3CFBB 4YIQA 1WFOA 1B2WL 3K3QA 1JFQL 3NA9L 4EBQL 3MLVH 1BAFH 4XPFH 1AHWC 4HEME 1DBKH 3GSNB 2FSEB 4JPKH 4R9HA 3SDYH 1U58A 1LEIA 4YZFF 4JFYB 4EDWH 5GRZA 1T2JA 4ZFGL 3O41B 2X4NA 1HEZA 5HHPB 4PTTA 3KR3L 3STLB 3HNVL 4ZO6A 4HIXL 1D5IH 1YZZA 1IGJA 2H6PB 5C0BE 5MI0B 2X1QA 1NFIA 3QG6B 1AJ7H 4S1RL 2YXFA 3ABZA 4HT1H 2YPVH 3RKDD 2J8OA 1JYVA 4L8SB 4LPYA 1T2QH 4JDVB 1LGVA 2F8VA 5DEFA 3QO0B 2QQNL 1F3JB 3VCLB 1U8IB 1NDGB 1OTUD 2FSEA 4NBXB 3I02A 3SDYL 1XCTA 1P4BH 2VKXA 2YPVL 1HKFA 4F9PA 3P4NB 5DRWA 3RDTC 4QRPA 1JMZA 4LLYA 2FD6L 4IRJD 2BMKA 1FIGL 2V5YA 4JVWA 1TQBB 1AE6H 5TQ0H 3U46A 1T7WA 5DEFB 1EFXB 5TH2A 2H2PD 3O4OC 3GSQB 1A1NB 3QUZC 5DD1H 4AYFA 3OKLA 5A40E 5I1IL 2R1XB 4P5TB 1OARL 3LH2H 5DK0A 5GGQL 3Q48A 4YXHH 3TCLA 4D0CA 4NQED 4CMHC 4NGHH 1RZ7H 4Z7WA 4MJ4A 5DF0A 1TVHA 2OTWA 1JHKL 1J9CT 4FQHB 1SBSL 1VDGA 4HUNB 1JHTB 4MD4B 3E2HB 5ITFA 3E6FA 5FM5M 4UIKL 1FNEB 2QQLH 3S34H 3TH2T 1XF2A 5IIEB 2IQ9H 4GKSA 2F8OA 3EYQD 1QG3A 4I0PC 4JE4B 3HI6H 3P4OA 1GC1L 3ILPB 5GGTH 1QVOB 3WDJA 1VGKB 2Q87A 3IDNB 3VMNA 4RWYH 3CC5A 1LO2H 4MWFA 1A7OL 4M7ZB 5J1AA 3O6FA 1CGVA 4MNQB 5IFAL 4D9QE 3VRIA 4YBHA 2CJUL 1VA9A 2BHZA 4EUPA 3PV6B 4FQ2L 4D0DA 3RRQA 3EHBD 5JQHC 3CVHL 4FQIH 1WIOA 4LSQH 4BK4A 1P4LA 4KKCC 3TN0C 1OAXH 4K7PH 4NKDA 2PW2B 3KXFA 2R69L 1ZHKA 3GMNB 1RZ8A 2ZZUT 3D39D 4HZAA 4DGYH 4LSDA 4X9IA 1FNHA 1C8PA 3QEQD 2IFFH 3ZHKA 1PEWA 4ZUTB 4FQLL 4TQEL 4XT1C 2YUZA 4NJAL 4NRYA 4FQ1H 4LFHD 4G6KH 1AQKH 1QQDA 4JFHE 1PY4A 4DKFL 3KYKL 1MQ8A 4G7VH 1EO5A 2C1OA 5FYJU 3U36A 2RFXA 1BIIA 3C8HA 4JEGB 4WV1B 5D2NE 2E6QA 3MLUL 1SMOA 2VLKB 4YPGA 1CYGA 4JO3L 3D39A 4PJAB 3PWPD 1A4JB 2GIYA 4X0KB 1G7IA 3QWOA 3GMNA 1BBJA 4Q6IB 5FKAB 4XRCA 4J7RA 4G3YH 3LSOA 1JJUA 3BP4A 3RZCD 5F7FA 4M02A 1N4XL 1H3XA 2A6KA 2DMKA 4G8FA 3EOBB 1ZK9A 1BPVA 1PSKL 4NRZB 4DFHA 4J3UA 4CGTA 4ZQKA 3O9WD 3NFNB 1E28B 1T5WB 2Y5EA 3GSUA 5SWSA 3IFLH 4XBPB 1I1YA 5FECB 4P5MB 1A4JA 2FGZA 1QLRA 3UC0L 3QA3A 4ZO9A 5LKNA 1TQBC 3P73A 1CGSL 1DQJB 1YUHA 4HIIB 4LGPB 4MS8D 1DBBH 4WWKD 2IGFH 2D4DA 1T20A 3MLWL 4OJFL 4Y1AA 1NCBH 1MY7A 5F9WB 4JM4L 1IKNA 3S5LG 4F8TA 4ZTOL 3T0VA 4LL9A 3L5XL 5KSBB 5TDPB 1MCBA 1SEQH 4Y4HD 5ETUB 4E0RA 5DRZA 4P2QB 5D7KE 3FB6B 1OD7A 5I76B 2QSVA 2ICCA 2OI9B 3NCBB 4B7IA 3MGOB 4GO6B 4QOKA 1BQHB 1EAJA 2DF3A 4EN3D 3MREA 1HHJA 2XKNA 1G6RA 4Z76B 1AFVL 1VPOL 4OZIA 2JE8A 1GZPA 3PGCB 3H9SA 4NDMB 4XP1L 3VXSE 4DVBA 4NZTH 2DI9A 2XZZA 2EYTB 4G5ZL 4MDIB 1K6QL 4BM7A 1B0RB 4ZAKD 4KH2A 1AQDB 2GJ6E 4ZS7H 3ZYIA 1PQZB 2IFFL 1YNLL 3V2AR 1BFOB 4LHUG 4IRZH 4LKCB 5GISL 4CNIA 2R0ZH 3QR2A 2OXHA 2YZ1A 3FQWA 4X9FA 4HK0B 5F1NA 3SKMB 3AAZA 4OF6A 4PJCF 4HZLA 3WNOA