5GHWL

Crystal structure of broad neutralizing antibody 10e8 with long epitope bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB 10E8 HEAVY CHAIN
publication title Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwL01
1DVFA 3H9SA 2UWEF 1UCTA 2X9YA 4H8WH 4W6WB 4DCQA 1TJHL 3F7YB 5FHAL 3T4AB 3DGGA 3FRPA 4L29B 3QUXC 3MJ9A 3OR6B 1HIML 1MCSA 2V5YA 1CG9B 5EBMA 5CP3A 1YEDA 1C1EH 4NNXA 4HKJB 3B9AA 3GSWA 3GSUA 4PPTA 4L3EA 4D2NA 1RJLA 3MFFB 3VD7A 4XPFL 4F7TA 3O6LH 4PYGA 5C0CB 2V9RA 4WI9A 5C09E 4O2CA 3MNVB 3DO7B 2OL3B 5D2LF 3S37X 1U8HA 2FD6L 4MNHA 5JHDB 4R97C 3SKMA 4HUUA 5A1AA 5ITBL 4LEOB 2EDHA 2N7BA 1F6FB 2NY2C 1SYVA 5I19H 4OQTH 3HG1D 5JORA 3PHSA 2OQJB 4U1SA 3GRWH 2Z4QB 1XZ0A 3F7VA 1CGXA 1QVOA 1QG3A 4NJ9L 4Y19D 4OIAA 1T4KB 3DX8B 3VE0B 4YBQC 5AWNH 2VXUH 2VLRE 2NY6C 4QRRB 1EMTL 3S96A 3GI9L 2VKXA 3MBED 1W72H 2X1XR 5I1AA 3MR9A 1ZXQA 3DMMC 3DSFH 1OP5K 3VXOB 3DYPA 4JQVA 2DF3A 1CBVL 2NY0C 3HPLA 3MACL 1NGYB 5SX4I 2EO9A 4Q74A 2PYEA 1I9RH 2B8OT 3LQAL 3O2DA 5DZOA 4LAJH 2Y07H 4YXKL 3WNPA 3FQRA 1QRKA 5A40E 1T3FA 2D0HA 5IM7B 4M4RA 4LKXA 3ILPB 4G8EA 5E00B 1CR9L 3F58L 2C1PB 1MCRA 4M6ML 4WI2A 4EOWL 5E94B 1LP9E 2PW1B 3DHMA 5D5MB 1HOCB 3N9GL 3VH8A 1T03L 1JPSH 1OD7A 1T04B 1OM3H 3HB3C 4XNQB 4MQTB 5DA4A 2K3TA 2CQVA 5D6CA 3P9WB 4QHNB 1OF2A 2DL9A 4QRQB 1IKNA 5AUMB 4UTAL 1ES0B 5HGBB 4NQUA 4RGOH 1H3WM 3D39A 1TCRA 1HZHL 4N0UB 4WVRA 5DSCB 3OKMA 1KN2H 1A4JA 1OAXH 1EEYA 4B41A 2A9MH 3O2WL 3P2TA 5ID0A 4FXGA 1U91A 3CGTA 1MUJA 1PYWA 4OD3H 3OXSB 1AGDB 2VL5A 5C0IA 5IMKB 4QXTB 4L4VE 5EBGA 4MX7A 1TLKA 1CXKA 1H8NA 1F00I 1P7QB 3V0VA 2CDGB 3QH3A 4ZFOB 1CICD 1IC1A 5GGTA 32C2A 1KIPA 3I02B 2V7NA 5EU6B 3RVWC 4CU7A 3CMGA 1RVFH 3HPJB 1CDUA 2Y25A 3AS3A 1AY1L 1U93B 5E7FA 1NGPL 4JY4B 5F7NC 5J13B 3U4BL 3REVA 1FZJB 4JQIL 5KSVB 1S7VA 4G6FB 3E2HC 5DJDB 4KRLB 1MHEA 2Q8BL 1X7QA 2ZCLH 4ETQB 3HI6H 3QEHA 3WBDA 5C6TL 4RMRA 3BYYA 3PGFL 5ICXB 3QIWD 4QWWD 4PGEB 3VFVB 5FO8A 2APWA 4UDTA 1SJEB 5C08B 2PN5A 4I4WA 4YBLB 1YEGH 2R1WB 3BEVA 5DRNA 4Y16B 2IPUK 2P49B 4DGVL 4Y2DC 2ZUTA 5HYEA 1FDLL 4GUPB 5H94B 3F7RA 3SPVA 4N68A 5DRWA 2BNQA 4P46D 4L8DB 2YHGA 1X9QA 4MSWB 4U0QB 1I9JL 1F4WH 1V3MA 3KR3H 3LPFA 3MLSH 4XZUA 4XP1L 1AFVH 3U0PB 4RGMB 4M6NH 3GI8H 4YBHA 4LSVH 3QEQE 3MA9L 4M1GL 3KPNA 4YUEL 1WIPA 4PJBF 1KEMH 2LVCA 3FB8B 3QDGE 2R1XB 3TJEH 4LLVA 1BGXH 2HFFA 3VXMD 1G84A 3I6LE 1RFDH 2R0KH 4JRWA 1C16B 1GGTA 3I75B 3IDNB 1TJIH 5C0RH 4KFZC 4H26A 1MQKH 3RFZC 2A6DB 5JA8B 1WBXA 2ZSVB 4O9HL 5DJXA 5LGJA 2BFVL 1EAPB 2CLZA 5E5MA 5ESQB 2VR4A 5I8OL 3GJFA 3ULUC 4M1DL 1S9KC 5IVOA 4N5EC 5DD5L 2Q8AL 3TJHD 4LLWB 2NY7H 3OZ9H 4TUKL 5FYJU 1FFNA 2OZ4L 1IGJB 1RJYB 2ZPKH 3VRLF 3GKWH 3WFEL 1A14L 3QXTA 4EDXB 2JE8A 2ITDB 3VFMB 4LBEB 4YZFE 2W0PA 4QT5A 5FCSH 4KUCF 2ARWA 5FYLE 3DROA 3JWOC 4HIIA 2XA8H 5F9WB 2VDQL 1G6RB 4F9PC 5GJSL 5CEXA 3BMWA 2DJ4A 2NXZB 5HYQB 2DYPB 1UJ3C 1I9EA 4JHBA 2P24B 3LRSA 1T20A 3BP6B 4LDLB 1J0JA 4WHYG 3BXNB 1NFIA 4XGZA 2FECL 2OP4L 3ARGA 2Z93A 3WN5C 1S5IL 2NTFA 1OLLA 4P23B 1KN4L 5E6ZA 3IFLH 2EKSB 2E5EA 1U3YA 3IB4A 4QRPD 4ELME 1TENA 4RNRB 4PJHE 4WHTA 1BECA 1MNUL 2NXYB 3VFNA 3S34H 3EW3B 3QDMB 3FRUB 3MJGX 4L8SB 4XXDB 3Q5OA 4KRPB 4JKMA 2VABB 1JNJA 4KI5E 4CADA 4JRYE 4PY7A 2H2SD 5E2VH 1CFVH 3VXSE 4GXVL 1Q1JH 2MHAA 4ZXBB 1J0ZA 5CKAA 4OCMC 5A2FA 3UPCA 3HHRB 4F37K 3PNWB 3MV9B 1LDPH 1AIFB 4Z7OE 4IDJL 5JO5B 4NM8H 1MJ8H 4JPKH 1JGLH 1QBBA 3NFPA 4RCAA 1OB1B 1AJ7H 5DR5H 5HXMA 2R0WL 3SE9H 1KLFA 2H32H 5IB1B 4Y5YB 5IW1B 2BERA 4NJAH 1U42A 3DX9A 1ACZA 4JFDD 5J11C 1A1NA 3OGCB 5IGXH 2E9WA 2GTZA 4V1DB 3THMH 4U1GB 2E9JA 4MMZC 3UX9B 5DFVC 2XN9A 1K2DB 4JZNA 3FQNA 4XBGB 3CD4A 4F7EB 2D3VA 1AQDB 4KXZH 2ZKHL 3B6SB 3V5KA 5ILTL 5LCVH 2JCCE 2IF7A 4X5WA 5HHOA 1ZT7A 3U48A 5KS9E 2GK0A 2R8SL 3QWQB 5J9PB 2PYFB 3CZFA 1D5ZA 5EZJA 4YDLC 1M6OB 1QPXA 1KPVA 2J88L 3VGFA 4BFBD 3FQUA 2NR6C 1I8LC 4XXCA 3DUUA 4LKCA 2L7UA 5E95B 1F97A 1CLZL 2KZ1B 1N59B 2IALA 5DYOB 3Q3GA 4OCWL 3AY4A 2R4RL 3CPLB 4NZTL 3VWJA 2F54B 5F7HA 4RIRA 4M7LH 5ANMB 1PKQB 3BT2H 5HHMD 1JGUH 2P45B 2A9NH 4J12A 4M9PA 1NFDF 4G8GA 1IAKA 3KNBA 2AK4D 5TFSH 1WCBA 2FYYB 2WP3O 4GAJH 5JR1L 1CGVA 5E99H 3NOIA 2JK5A 3OF6A 1ORSB 5INDA 2I5YH 3U4EB 4OFDA 3O8XC 4K23H 5D70H 5DEFB 4MQ7B 4XVSL 2MOVA 5HHVH 2WQ8A 1FLRL 4K71B 3E0GA 1CD1B 4PV8B 5ERWA 4POZC 1CDJA 1XF3B 3OG4B 5L9DH 5I15H 3KJ6H 5IEHA 3MUGA 4C59B 3BN9D 4JKPL 1I85A 5DUML 4OZHB 5JW4Q 3HG1E 1KFAL 5IK3A 3C60B 3RY5A 2IBBA 3I9GL 4OCXH 3WHE0 4BSJA 3C6LD 3HC3H 1BMGA 2ESVA 3IJHA 4Y19E 3QA3B 4G6KL 1T1XB 1SM3L 1BLNA 2HJKB 3KXFE 4GW5B 2YA2A 3TLRA 1VACB 4H0GA 3GIZH 2BC4B 3CAFA 1S7XB 2FEDC 4FG6D 4QXGL 4OLEA 1XGQB 4H88H 3IXTA 2DTMH 5HPMB 2MKWA 4DGYH 2FHBA 4WU5B 2DBJA 4YHML 5B38G 1NEZG 3HUJA 5CJXA 4GG6E 2IMMA 2GT9B 2VZOA 2Q6WB 1B0RB 4MJ4A 3QG6A 1A7NH 3ISWA 1FYTB 2CLVA 1B4JL 3VFSA 4F2MA 3PQYB 4J8RA 2R9HD 4N9OB 5ENWA 1LO3L 4HWBA 4Y4HA 1JTTA 4ZS7H 3F7PC 1NC2A 2XTJC 3EDJA 1IT9L 1NGXA 1T89A 3U2SB 3T0EA 3WCYA 1INDH 4NOFA 5CINL 5JNYA 4MAUL 2YC1B 3AMKA 5D4QA 2X4UA 1YEKL 3S7GA 3ZYIA 4HUKB 2WZPD 4XCEA 1ZAGA 2VZ1A 4N0FA 4PJ9D 1I1AB 4YK4B 5DMGD 5T1MA 4RQQB 4GKSB 1BZQK 3MQIA 5AD0B 4K7FA 4MXVE 3BKYL 1A3RH 3OQ3B 4LDEB 2XZQL 2O5ZH 4PS4H 2Y23A 4QOKD 3KS0J 3GSNH 4WWKA 8FABB 1FZKA 2VJXA 4XWOC 4NHUA 4F3FA 3H9SD 3TZVC 1M4KA 1AR2A 3KYKL 5KSUB 4BUGA 1BEYH 2Y06L 1KIRB 1A02N 5LXGH 4OZFA 4AZ8A 2WQRA 3SDCC 4BKLB 3JWNC 1Q0XH 2J6EL 1DBAH 1S7UB 1YJDC 4R4FL 3D1MC 2HWZL 5LAXA 5DS8B 3O3DA 4FQJL 3RWEB 5GXBB 5TQ0H 4L3ED 2XKNB 2Y5TB 3P73A 1OY3B 1FNEB 4MD4A 3O45A 1IM9B 3D69A 4FHBD 4ZS6D 5FXCH 3CFCL 2CGRH 3CC5A 3M1BA 3CDFA 2ENYA 3VGAB 3VD3A 4RBPH 4RDQG 2B1AL 1HH6A 3C5SB 5IBTL 3VXNA 3W39A 4I3SL 4QLRA 4NPYA 4I3RL 3VMPA 1CIDA 3DYMA 4X4MA 1QO3A 3MRMB 1A6ZB 1ZA6A 3FCTA 2ZCHL 5E70A 5D1ZD 3VXRE 2VITA 4BZ1H 3BEWB 2VLLB 1BQHA 5D7KD 3G04B 2Y72A 4GMTL 3RX7A 1DUYB 4I1NB 1RZFH 1QR4A 5MERA 3MJ7B 2E27H 1BQLH 3IRZA 1LD9B 1I8MB 3HUJF 2AI0H 3VXME 1Q0YL 1TQBC 2VL4A 3O4LB 2CRYA 2QL1A 4DVRL 35C8L 4HWBL 4Y1AB 1BREA 2PYED 4YNYA 5EO9A 3MGOA 4KTEL 2FJFB 3MXVL 5GPRA 4NO0D 1W0WA 2HA1A 2N1KA 4LPWA 1U8MB 5F9OH 1ADQA 3VD5A 3CSYB 2HTKD 4L3CA 1N0XL 1QFOA 1R5WA 5C0DA 1BQUA 2Y1VA 1TITA 3MYJA 1HQRB 3WEXB 2VDNH 2D9QB 3G08A 5EBWB 4OZ4A 2F8XC 3QBTB 5I1DA 1MCOL 2XI9A 1KNOB 2QQKL 3UJJL 3RDTA 4WV1B 3F6LA 2Q3ZA 8CGTA 4XCYB 3ULSA 3I6KA 2C5DC 4QXUH 1AE6L 1D5BB 1WBYB 4NFBA 3RVTC 3F7YA 4ZAKC 3D0VB 1BVKB 3VFGH 1NEUA 1BJ1J 5HDLA 4L29A 2EXYD 3S5LG 3OR6A 5D7IB 1A22B 4QRPE 1CG9A 5IESL 5CILL 2DL2A 5DZLA 1A6UH 4HKJA 2DQGH 1KC5H 1DUZA 1HQ4B 4OZGE 3VG0H 3EO0B 5CJOH 2H2PD 2EYSB 2APFA 1D7FA 4R8WH 1JF6A 1UKQA 4ZD3H 5C0CA 2DLFL 4Y4FC 5DXWA 5IFHL 3MNVA 1NCAL 1JWMA 2OL3A 3M07A 5HVFB 2YSSB 5DJ8B 5AG8A 5JHDA 1AI1L 1MAJA 1R3IH 3CXHK 2ATPB 3QZWG 5I18L 4EI6B 4P49A 3TCLA 2P5ED 2IANB 5FFLA 4LGSB 3PUCA 1TPXC 4R0LB 4A6YH 2OQJA 5E1HB 2VC2H 2Z4QA 3EHBC 1WJ3A 5DHXB 4MWFB 1KF9B 1LNUB 2C3XA 2FECI 1T4KA 2WBKA 3DX8A 3VE0A 3U30B 1DEEB 1T66C 2UZYB 3SDXE 1GGCH 2BRRL 3MUHL 2M1KA 4UOW1 4YHNB 2DQTH 4E41E 4QRRA 4FZEL 4JFDE 1B4RA 4KK9D 4I9WE 2Q3AA 3BIKB 3MV11 3FQWB 3LMJH 3VRIB 4JCLA 1MJUH 4OUUB 1N8ZB 2BNQD 2HH0L 4NN6B 4DJMA 4N0CD 3H0TB 3VXOA 5CJQH 3WO4B 3ETBF 5HI3C 5IWLA 2DLEA 4LSDA 1NGYA 2JJTC 1G7PA 1FH5L 2BOBB 2HVJB 4BZ2L 5F7MC 4LCIL 2F5AH 3JBG7 2GEEA 3TF7C 3O3EA 4F7MB 1EIBA 1YEJL 3CDGB 3SGJA 5IM7A 3QIBC 3ILPA 5E00A 4PJAE 4F37F 2C1PA 4OF8A 5CIPB 5E94A 3GHBH 3GO1H 3OPZL 5D5MA 1HOCA 5T3ZD 1T04A 2UYLB 1EHLH 1LDSA 1QEWB 4MDIB 3PG2A 4XNQA 1MFAH 4YHYC 5HHME 4JCMA 4BJLA 1Z3GH 1MY5A 4QHNA 4YHIB 2AK4E 5CAYB 1BF8A 4NM4L 3V0WH 2Z31B 3EYSH 1ES0A 5HGBA 3GHEH 4HJJH 4N0UA 5DSCA 3TWCL 4I2XE 1UXWB 4UV4L 4K7PH 4XPAL 1RHHB 1MHCA 3AM8A 3WKNA 1AXIB 4WHYH 3WS6C 3OXSA 1AGDA 4IRSD 5I9QC 5IMKA 3TFKD 4AQOA 4MA8L 4QXTA 4Q97A 2DIAA 3LOWA 5D2LE 3ARDC 3MODL 3TN0D 1A9EB 2CDGA 4ZFOA 5K9JH 1V7MH 3HNVL 3QDAA 4MB4A 3CCHB 1INQB 4IJ3B 5TF0A 2FJHB 3DIFB 1T22A 2VXSH 3P9LA 3I02A 5EU6A 4OCRH 4WW2B 1IC5L 3LY6A 3HPJA 4HGWB 1JZ8A 4XWGH 3RTQC 1U93A 1AGCA 4JY4A 4OZIB 4HC1L 4RFOL 5EA0H 5HBBA 1FZJA 4CVUA 2QEJA 4LPYA 5KSVA 2EDTA 5DJDA 3VFPA 3PDOB 3EYUL 4ETQA 3BP4B 2RCSL 2G60H 4M1CC 4PJ7B 5IW3A 4OKDA 2ICEB 1RUAH 4KVCH 5ICXA 4AEHH 4JFQB 3V4VL 3VFVA 2COQA 1WWWX 2EYRB 4PGEA 2DI9A 1FZOB 1SJEA 5C08A 2YZ1A 4JDZB 1QACA 1V7NL 4DGIH 1S9WB 3O9WB 1OVZA 2BX5A 1PZUB 2R1WA 1U8LB 4H5SB 4Y16A 1E0OB 2P42B 1IC4H 3ARBC 4GUPA 5H94A 5B22A 5KJRL 1H5BC 4L8DA 3L1OL 4MSWA 4CJ1A 2EZ0D 4Q7DA 2XY2A 5C0FB 1J18A 1YQ2A 5DHVB 4N1CA 3JWDL 4KRMB 5FF6A 1ZVHA 1IEAB 2WAHA 3NIFF 1JZ4A 4MB5A 2JIXD 3F6IA 3FB8A 1YPZE 5FUZH 2ZOLB 1EEUA 4J3VA 3RY4A 2CO7B 4OI7A 3IF1B 3RVUC 3I75A 3IDNA 4FQXD 2A6DA 5DWUL 3QAZC 3V8CA 5DMYA 3PL6C 3WUZA 4ZFGH 1EAPA 5D5MF 5ESQA 1EGJL 3NIDF 4EN3B 1Z9MA 3IFOB 3TVMB 3H9SE 1CQKA 4LLWA 5IHUL 1F8TL 5JW4M 1IGJA 1RJYA 5FOBB 3VWJD 3CX2A 4G43A 3R8QA 5E56A 2VDML 4EDXA 2ITDA 4JDTH 4LBEA 3EFDH 4K9EC 4G8GD 4XBEH 4M93C 3PHOB 5D8JL 3ZMRA 5E08H 4UT9H 4L3EE 4E5XB 5LJYH 1UM6H 4L9LC 5HYQA 5ACLA 2M2DA 2DYPA 1RIVH 2P24A 3NCJL 4N8CL 4PV9B 3BP6A 3BXNA 3D85B 4U3XA 2ERJB 5IHZB 3FAXA 5IKCB 3Q6GH 3MRDB 5DVKA 4XAKD 4V2CB 3QWOB 1PX4A 4P23A 5ICZB 4J3WA 3VI4F 4NWUH 4U33A 4J6RL 1W8NA 4RNRA 5KZCB 1EA9C 5E8EB 4YPGB 4KZDL 2ESVD 3FRUA 3QDMA 3VWKC 4L8SA 2GK2A 3BESR 4XXDA 5JMOC 4NDMB 5D7KE 4C4KO 2H26B 2JJWA 1FORL 1I1CA 5MENB 4ZXBA 4XI5D 3T2PA 4X7EC 2X44D 3G6DH 4X8XA 1NFKA 1YNLL 3PNWA 3MV9A 2GIYA 2ICES 1AIFA 1HH9B 1NCDH 1T6WA 3PWJB 3DHJA 3UXFA 3P9MB 2G9HA 1MCDA 1WICA 4HEME 5KSBB 2PYEE 2B39A 2VXVH 4HXAH 2WUCH 1OB1A 2HP4A 1OTTD 3VFRA 1OPGH 4KROC 2VDKH 5SWSD 4HPOL 2J4WH 4GS7C 5IB1A 2Y5EA 4IOIB 4Y5YA 2DICA 5IW1A 3VW3H 3BMVA 4LF3B 3NH7H 1MAML 4I0KA 1F3DJ 1P53A 4PUBL 4V1DA 3OKEA 1HHIB 3LN5B 1NC2D 3BKCL 5KSAB 1UB5B 1YEIH 1K2DA 1FIEA 4XBGA 5B4MD 1RZJH 4F7EA 1AQDA 1Q9KB 3WFCH 3B6SA 1XR9B 4L3AA 4WO4C 2JELL 4B0MM 5J9PA 2PYFA 5E7BA 5I1IH 4TOYL 2OTUB 2W65B 5BJTB 3D39E 1RK0B 2VDPH 1A5FH 1B0WA 3LZFL 5EPMB 4JY6B 3WNMA 1ADQH 1N59A 1CT8B 2D9CA 5DYOA 3VXQB 5SX4H 3CPLA 1WIUA 2E6QA 4NZJA 5HY9A 4GRLA 5ANMA 4NOBA 3MRLA 4FS0A 1AKJA 2DQIL 4K8RC 3QUYB 2ZUWA 1TXKA 5DD1L 1EERB 5D71H 4TYUA 1ORSA 3LPWA 3U4EA 2E7HA 5BV7B 3KLAB 1GIGL 4KJPC 4JFXA 4JVPA 5I8KL 5GSRB 5DEFA 4MQ7A 3IGAB 1FHGA 5E8PB 1J1OH 5BW7C 3K74B 1CD1A 4PV8A 2EDDA 5FGCE 1SJVA 1F6LL 1XF3A 4OJFL 2HAZA 3UTQA 3V5HB 3W11C 2GTWB 4JN1H 5DI8B 4OM1H 1AR1D 5DQDL 4P4KC 2OJZL 3NMEA 7FABL 1QNZH 2P5EE 4OZHA 5F7UA 3UCRA 2D7TH 3T2QA 2HVKB 3BGAA 3C60A 1UJTA 4J2XA 5FCUL 3NZHH 1IKFL 1T1XA 2K7QA 2GJ6B 5E6YA 4FXKB 2HJKA 4YR6B 4GW5A 4HSQA 1VACA 4HGKC 2BC4A 2DQHL 2HJFB 4OM0L 1CF8L 1S7XA 2A6IB 4IM8A 1J5OL 4TUOA 2BNQE 2GITB 3X17A 3NCMA 5HPMA 3UBXI 1T83A 1BFOB 5DFTA 1NBVH 4PGBB 1KBGL 2GT9A 2Q6WA 3V2AR 1B0RA 3HLAB 4HJ0D 4NZDA 3BZFB 1QBMH 2X4OB 5ICYB 3BDYL 3T0BA 1FYTA 1EXUB 5J0BA 4PJ8C 2DQUL 3WFHA 5DEZA 1DLFL 4PB0H 5DD0H 1TDQA 6CGTA 4PD4K 3OX8B 2OI9C 1W0YT 1I8KB 5T3ZE 4X5XB 2EH7H 3W9EB 1JFQH 3U2SA 3EJYD 4LLDB 2OTPA 5C0EB 5C2UB 1DQLH 3KPPB 2XICA 4NN7C 3BE1L 2YC1A 4HWZB 5EIQA 1KJ2H 1TQCB 4WUKH 3TA3C 2WWKT 2GSGB 3OAUH 3EDKA 5GGVY 1C5DB 4CN6A 1FRGH 4GAGL 2AKRB 4X80H 5MI0B 4NHCL 1IQWH 4QGTA 4BH7B 5GS0H 1NMAH 3RBGA 1I1AA 4S1QL 1FO0L 1OT2A 4HUVB 3DTXB 4GKSA 3OKOB 5AD0A 4KQ3H 5EB9A 1P6AB 4DAGH 5J6HB 4WJ5B 2X40A 3AFLA 4P4RA 5GGQL 2HT4C 3P0YL 5IQ7L 3EOTL 1XGPB 3HC0B 3DJ9A 1E6JH 5IB4B 3MCLH 3QPQD 1FAKT 1KIRA 4TULL 4RFNB 3ARUA 3G6JB 3NABL 5CKGA 4PP2A 4BKLA 4J3UA 1S7UA 1CLOH 1OAKH 4QTHB 2W9EH 4ODHL 4MAYA 1K8IB 3RWEA 5J3HD 2YD4A 1CE1H 3CSGA 4FQLH 2XKNA 2Y5TA 4F58H 1FNEA 1PEWA 2YD5A 1IM9A 5D96B 1RI8A 2F9BT 2QQLH 1GH7A 3FN0L 1MCQA 5C0CD 4D9QD 2FHCA 1EBAA 5TE7L 3DRTB 5KVDL 3C5SA 5IMOB 1Q9OB 1KCVL 3EGSB 3V0AC 3WIHA 1A6ZA 1RZKL 3W81A 5I1JH 3JVGC 2YMXL 3ARQA 3BEWA 4FXLA 2VLLA 3KPSB 4L1DA 5CUSH 3CXDL 4YX2H 3U79A 5FHBL 1DUYA 1KELL 3GMLB 4QRRD 5AEAA 5BOZG 4HXBL 4LRIA 4R4BA 3WL9B 1RIUL 5AG9A 1LD9A 2VOTA 1I8MA 2VN7A 2XN9E 5FYKH 3GBML 3S3SA 4OTXH 4L4TB 1JHKL 4KI5C 2RBLA 3O4LA 1CK0L 4P5TC 1MREL 5HHOE 5SX5H 12E8H 3SQOH 5E6IA 4Y1AA 4DQOH 4Q9RH 4JHAH 2FJFA 1HKFA 1RD6A 2GJZB 4WENB 3TM6A 4N8VB 2OR7A 4PB9L 5CZKA 1SY6A 1GPOH 2DMKA 3EYQD 1PVHA 1U8MA 1KB5B 2NX5B 2NY1B 1WWBX 4MHHG 4P3CL 5BQ7B 2GUOA 3IU3B 4C55A 1U9KA 3QCTL 3IDUA 2AEIT 1E4WH 4AENB 4Z76B 4M7LT 5J1TC 3CSYA 4GT7A 3U1SL 2BHZA 4HFUL 1HQRA 3WEXA 1WEJH 3RX5A 4CU6A 4G8GE 2X4TB 4J4PC 3ZKMC 3JTSB 4ZNEA 3RPIB 3V4PH 1KNOA 1RUQH 4KUZL 2DJUA 5EO0B 3ET9F 4WV1A 1S9VB 4G7YH 4JY5H 4EIZC 4XCYA 4DW2H 2E7MA 4N5UA 1D5BA 4F15C 4YQXL 3CVHH 3QPXL 4KKLC 4MNQB 2D7PA 5I73C 1CFSB 3D0VA 1BVKA 4TSAL 4XAKE 1YEFL 3EDFA 2XZZA 4JHWH 5D7IA 1P7QD 3ULUL 1DL7L 4WTZG 3VXUB 4X9GA 3SE8L 4UNUA 4E9LA 3EO1B 1HQ4A 1F4XH 2MMXA 2YOCA 2ESVE 3EO0A 1G6RH 5EU6D 3VFOB 2HKFH 2GI7A 4CU8A 2EYSA 2ED9A 4Y5XB 2VLMD 3N1QC 1HE7A 3HTLX 4OLUL 2IQ9H 4G6FD 1P84K 3GMRB 2YSSA 3N1GC 5DJ8A 5EOQL 1FGNL 1IAOA 2ATPA 1F2QA 5HSFA 5IF0B 4EI6A 4IRJB 2NW3B 4XNZC 2BMKB 2IANA 3GKZA 1MF2H 4GXUN 3HUJE 4R0LA 4KHXL 5FYKD 1XCTB 5EWIH 4MWFA 5J1AB 1JNNH 2ZJSL 1CD8A 1JGDB 4M43L 5CFHA 5SWSE 3QEGL 3AB0B 3IS1X 3C8HA 4YHNA 3NA9H 3L3HB 4Y16D 5AYUH 4APQA 5KVFH 5A3IC 4XVJL 4M62H 1BF2A 1J8HB 1ZVSA 3BIKA 3VRIA 3FQWA 1TTFA 4OUUA 1N8ZA 4D9LH 1HINL 2K1MA 2FZ3B 1QFHA 3KGRA 3T0EE 3WDHA 1XT5A 3FFDB 1TJHH 5FHAH 7CGTA 3MUZ1 2JJVA 3T0DA 1QHPA 1OW0C 3MBEC 3EDDA 3FQXB 2BOBA 2HVJA 4MS8C 2N56A 4KH2A 2X1PA 4WFHE 4F7MA 2I9LB 3QUXB 1YY9C 3AC0A 2LU4A 5CIPA 3ORJA 3PGDB 3C09C 4OCYL 5L0QB 2D7NA 3V6OE 5FUCE 4UILL 3TP4A 1QEWA 1G9NL 4JJ5B 2QQNL 4MDIA 2FD6H 4FMFA 1NMCC 4POYA 4JG1L 4OAWB 4YHIA 5ITBH 1NL0L 3RGVA 3RX8A 2Z31A 1DSFH 2N4IA 5GS1C 1WT5A 3MRIB 1TZGL 1UXWA 5FB8B 4NJ9H 3FFCB 2X4RB 2NY2B 3GSRB 2P44B 1EMTH 3FONB 2DQEL 2NXZD 5H35B 2DYPD 4GW4B 3GI9H 5K9QI 1A9EA 1OGAB 3CCHA 1INQA 3DIFA 1CBVH 3MACH 3SOBH 4WW2A 4HGWA 4P23D 3MJ8B 3L3JA 1CICC 2DBLL 1FNFA 2JTDA 3DMMB 3LQAH 3GNML 4M7ZC 4WFFD 4X4ME 3RKDC 4LHJB 4NQCB 1VEPA 2NXYD 4FQ1L 1YEHL 1CQYA 3PDOA 3QDMD 1CR9H 3BP4A 3F58H 3PHQB 4M6MH 4PJ7A 5F1SA 4KRPD 4EOWH 2QADB 1JTOA 2Z9TA 2ICEA 5DD3L 4S1SH 2ZUVA 1G9MC 3SKUD 2ICWB 1T03H 1TVBB 2X4QB 4JFQA 2EYRA 1YNTB 1FZOA 2PR4H 4JDZA 1IGIL 4W6XB 3MV9D 3C5JB 3X12B 5C1MB 1S9WA 3O9WA 4ENED 4PRIB 1OQXA 3QI9C 1U8LA 4H5SA 3MRRA 4QWWC 4F8TA 4UTAH 1A6WL 5FOJA 3AXLB 5I71C 3QFDA 1HZHH 1MWAL 1AGFB 3QXWA 4HV8B 3O2WH 2EE6A 3SGKA 1TCMA 2FL5B 5C0FA 2VYRE 2FGZA 3CX5J 3P4MA 5DHVA 5ADPL 3B5TA 1IEAA 4V1DD 4P46C 3GM0A 3IDGB 3QP3A 1I8IB 1BJ8A 2ZOLA 3H2WA 5FGSA 2P8MB 3REWB 1JWUB 3IF1A 3U46B 1DQMH 1NGPH 3W5NA 3RWGB 3U4BH 4EI5B 3NCEB 2CMRH 2W59A 2XG4A 3UBXG 1MEXH 4EN3A 2Q8BH 1BQSA 3TVMA 2VR9A 3UZVB 4K55A 3Q0HA 4HWEL 1DFBH 3QG7L 4YHLL 2ARJQ 1DBBL 5FOBA 3PGFH 1D9KB 3KHOA 2F54D 1VADB 1S78D 3MLZL 1G7LA 5CD3B 2H8PB 3O4OB 3TJHC 3ZKXB 3QDJB 4JFFB 1LHZA 4LCYB 3UAJD 2GJJA 3PHOA 4DN3L 1I3GL 1L9MA 5I1HL 4DGVH 4E5XA 1I9IL 1FDLH 1FG2A 1VHPA 4PV9A 5C0CE 3VFWB 1P7KB 4D9QE 3AUVA 3D85A 1U8KB 2BVOB 4IMLB 5E03A 4EQ2A 1I9JH 3MLTB 4NFCA 5GJTH 2IGFL 5IBLD 5JHDE 2AJZB 5IKCA 4XP1H 3MRDA 3RKPA 3QWOA 5ICZA 4F57L 4M1GH 1QHOA 4YUEH 4WW2F 4UB0L 3N50A 4BSVB 1CU4L 5E8EA 4YPGA 1ETZB 5J06A 2AJXL 3S3PA 5GGRY 2Z8SA 4JEGB 2OM5A 3BUYB 4DZ8B 2YN3A 4NDMA 2HRPL 5KTEL 2H26A 1QPPA 5C92A 4DK6A 1BPVA 4QRRE 5MENA 1TNNA 3L6FB 1EVUA 2BFVH 1QLRB 2ED7A 1NUGA 5I8OH 4U7SA 4M1DH 4PJCF 1HH9A 5C2BL 5DD5H 4Y0GA 4TUKH 3EUUA 5A2IH 3P9MA 2XTLA 3RJDA 5E8DL 3NFNB 5KSBA 2ZUUA 1A14H 4LSRL 4U6XB 1G0DA 3ZYOA 1NAMB 2GCYB 5EOCJ 1FYTD 4ESKA 2VDQH 1R0AL 4IOIA 5GJSH 3OB8A 3E6FB 3PQYD 1ZLSL 5E2WL 2OYPA 3DLQR 4PRPB 1HHIA 5D5ME 3LN5A 2EKJA 5KSAA 3NIDE 1PG7X 1FV1A 1K3ZA 5B8CC 1Q9KA 4NCDA 1LE9B 1XR9A 2NMSA 3FN9A 1NAKL 4BQ8A 2OP4H 1UJ3B 2PXYC 1NKRA 2X4SB 4X9IA 1S5IH 4Z7VB 1KN4H 5D1QC 3ESUF 4X6FB 3ULVL 2W65A 5BJTA 1FC1A 2V17L 1RK0A 2VDRL 4N0UE 1MNUH 1L6XA 3ULVF 1HHHB 5F89B 5TF1H 5EPMA 4JY6A 3ZDZE 3MGTB 3SDAB 1CT8A 1U95B 3VXQA 2X09A 3UMTA 2VDOH 4GXVH 1MI5B 4DOHB 4HUXB 4Y8DC 1DQDH 2RFXB 5ALCL 3B4NA 3QXAB 4D0BB 3QUYA 3I3DA 15C8L 3KAAA 4XP6L 5IB2B 4DKEL 1T7ZA 4NQSB 2M26A 4IDJH 3UZQA 4P9HC 5GZND 3OJ2C 1ZLVK 3VI4E 1HSAA 5E5RB 4JFPA 5EU6E 3SDDC 4CDGC 3SBWA 3DI3B 3KLAA 3RY6C 2ZZUT 1FNLA 1JCKA 4HX1B 5GSRA 1XCQB 3IGAA 5IVNA 5E8PA 5FV2A 2FWOB 5GGSY 4ZFFB 4TNWK 4PJGB 5HGDB 3JUYA 3WXWL 5IFAL 2X41A 3CNKA 4TN9A 3V5HA 1IM9D 4JM2F 1BFSA 1MH5B 3C08L 2QHLA 4O00A 3VD4A 2YA1A 2A2QT 3UC0L 2HVKA 5DO2D 2ARJB 2ZKHH 5FYKE 1VDGA 3LS5H 5C08E 4OGXL 2R8SH 1RUKL 2VMFA 3BN9C 4Z8FL 1NCBL 2JLLA 4FXKA 2LTQB 4YR6A 1QFWL 1Q94B 2OS7A 2J88H 5IV2A 2HJFA 1MLBA 1FNSH 3C6LC 3KWWB 2A6IA 1ITCA 4TVPL 2GITA 5DK3A 4RAUB 1BFOA 1CLZH 2YK1L 4PGBA 4LLAA 2CRMA 4P59H 1AO7A 2R4RH 3CFBB 4NZTH 1G6VK 4PREB 4RRPG 4XBPB 3HLAA 4HPYL 3BZFA 2X4NB 2X4OA 5ICYA 4UNTA 3M8OL 1EXUA 1J1PL 4LVNC 3MPCA 1J0KA 3QUML 1DLHB 3O4LD 5JR1H 2EYTB 5I66B 3HCVA 1OD9A 4H25B 5I74B 1I3RB 4Y1AD 3OX8A 3FT3B 2Z8VC 1E4JA 3FN3A 4Y5VC 2YWYA 3L95B 4X5XA 5HVHC 4XRCB 1VFOA 5B21A 4LLDA 1KXTB 5C0EA 1ZS8B 2R9HC 4CVWA 3KPPA 1RJCA 1W72B 1OAYL 1BOGB 5T1KB 2EIZA 4HWZA 2L7JA 3MRKB 2GSGA 2XIDA 5LGHH 1C5DA 1J87A 2W9DH 2AKRA 1KFAH 2VUOA 2C3WA 3DPBA 3BKJH 3MUY1 5ESAA 4BH7A 3U82B 1FAIL 4G6KH 2W60B 3FTGB 4JVWA 3OKOA 2YRPA 4KKCC 2DD8L 1RUPL 1QFUL 5CD5D 3HI1B 5J6HA 4WJ5A 4N8VG 2A73B 4AIZB 5JXAH 4PJ9C 4QXGH 5TH2B 3HC0A 5DMGC 1INEH 4MNGB 5IB4A 3WLBB 4AK1A 1X3DA 4YHMH 1QKZL 5KW9L 4TPRL 3G6JA 1ONQB 1NSNL 4R4NC 4NP4L 2FX7L 4X4ZA 3MCG1 5JOPD 1DVFC 3L3IB 4QTHA 1RZIB 4WFFE 1K8IA 4LFHG 3HR5B 1B4JH 2QLVB 4KKNA 4TSCL 3QDME 2YD6A 5K93A 2J8OA 1LO3H 1H9VA 4NNYB 5GRJL 4DK3A 4W4OA 1ZGLB 3MLVL 5L88L 5EC2B 5GIRB 3UPRA 2WNGA 5KVGL 1IT9H 1MRCL 1HWHB 2ZUQB 3ILQD 4Q6YA 3DRTA 2J8HA 5IMOA 3MV9E 1WAAA 5CINH 2HT3D 1Q9OA 2L0DA 2YS4A 5ISZB 1UG9A 3EGSA 4MAUH 4ZS6C 3MLXL 5JW4R 1LEKB 3LCYA 2P46B 4KK6D 1YEKH 3V6FB 4LU5L 2IAND 5GS2H 5J12B 4KAQL 3KPSA 2C26A 5GRUL 3I3EA 3X3GL 1JYVA 3V7MA 3HFML 4OSUL 5K9QG 2DLTA 4ZUVB 4AQ1B 4OD1L 2XZQH 3MOBL 4U4BA 3EYVA 1TZIB 5F97E 1FSKB 3H9ZA 4V1DE 4TQEH 3WL9A 5LVEA 1JMZA 3T4YB 4L4TA 5DQJB 3KYKH 3OAZH 2EDBA 1RK1B 3QHFL 4M00A 4ZNCD 4GG8B 4Z0BL 1OAUL 3B2UD 4H1LG 2IG2H 4R4FH 2J6EH 2HWZH 2GJZA 4N8VA 2BRQA 4XMKH 4JQVC 3HZMB 1D5MB 2WV3A 3U7YL 1KB5A 2NX5A 4I77L 3QT2A 1CL7L 2FDBP 2X70B 3DNKA 3IU3A 5DHVH 4ODWA 5JDJA 3CFCH 4Z76A 2IH3B 3AVEA 1FL6B 2F54E 4WY7L 5ANME 3CXHJ 4JQXA 3CVIL 3BZ4B 4I3SH 4NKMB 1AD0A 1RHFA 4I3RH 2X4TA 1R3JA 3BPOC 3MV8D 3JTSA 4XNXL 5TPWL 2Z31D 2HTKC 1J9CT 5FM5M 1S9VA 2VLRA 3D3VB 3BRGC 5E2TL 2ZCHH 1PDKA 2E6PA 5T33L 4KDTA 2FJGA 4MNQA 4LLUB 1IKNC 4GMTH 2ADJB 3BOVA 3OAYK 5L2JA 4M5YL 1BIIA 1IVLA 2Z8RA 1FP5A 1ZTXH 4ELKA 4OZHE 3VXUA 3NPZB 3G6JF 1S7TB 2VSDA 4U6VL 3BKML 2LABA 3O41B 1Q0YH 2VQTA 3EO1A 1PSKL 5FO7B 1NBYB 4S0TD 4GH7B 4DVRH 1IAIM 4PRBB 1I7TB 1JMXA 2F53A 3CDCA 5HTSA 3RU8L 2J5LB 1DP0A 5JDSB 3QQ9C 4R90H 5EU7E 1Z5LB 4KTEH 5IJVB 3H7BB 2QHRL 3MXVH 4K9EL 5CEZD 3GMRA 3I2CL 4KK5C 3FOMB 4AEFA 2X1OA 5IF0A 3HAEG 4IRJA 2NW3A 2BMKA 1WAAF 2NZIA 3WNKA 1IILE 3WV0A 1N0XH 1XCTA 4JKLA 2UV3A 5J1AA 3BJLA 1JGDA 4G6ML 2F8VA 2RB8A 4R96B 3O9WD 1FYTE 4X6DB 1X5IA 4Y7MA 4NQTA 1MCOH 3L3HA 2WWMC 2QQKH 3UJJH 1J8HA 3WJJA 1CZ8L 2NY5C 3IDYB 2G75B 2VH5L 1QSVA 3DVIA 1AE6H 2FZ3A 1MFCL 4MJ6B 3PJSB 1A0QH 4K7PY 4EUPA 5IR1B 3F65A 1AXTL 1MLCB 4HIXL 3L9RA 1UM5L 3B9EA 5IB5A 3IT8D 5IESH 4N0CC 5CILH 4LNRB 3VI3E 5DRZB 2I9LA 3HRZB 5IBUB 3IDXL 1GRWA 3H42L 2DI8A 4MJ5B 5BZWB 1U8NB 1EO8L 4WCYL 3PGDA 4WI4A 2H32B 5H37G 5CBEB 1OAZL 1NCAH 4IRZL 4JJ5A 1W0VB 2CXKA 3VCLB 4EN3D 1AI1H 3TVMD 5GGRB 5I18H 4WGVB 1N64L 4OAWA 3Q2CA 4DEPC 3C6SB 3MLPA 4QYOB 3HMXA 4P2QB 2PO6B 5F1IA 4NUJA 2X2YA 3MRIA 3UTPE 3T77B 3MZTA 4WEMB 5F44A 3LIZL 5JIHA 3FFCA 1UH2A 2UZIL 1MCKA 2BRRH 3GSRA 2R4SL 3TEUA 3B5HA 4GXUM 1C7TA 4FZEH 3W2DH 3FONA 5JHLL 5H35A 4RWYH 4GW4A 1OGAA 3QEQA 2HH0H 3WLWD 3D85D 3NVQA 2WW8A 3EIFA 1F4YH 3RVVD 5CWSB 4MYWB 4UUJB 1N0LA 3MJ8A 1MFDL 1FH5H 3BQUB 4BZ2H 1WFUA 4HS6B 4LCIH 2H3NB 5KZCD 4CGTA 4RGND 1YEJH 3ARGC 3EDEA 4YDJB 5IW6B 3I6GB 5I2IB 1LP9F 4QOKB 3PHQA 4S2SA 4AEIL 4ETYA 3OPZH 3TYFB 2ICWA 3RA7L 2EDYA 2X4QA 5JPNB 4UT7L 1YNTA 4KKBD 1F13A 3C5JA 3WFBL 3X12A 1II4E 4PRIA 2ADGA 4NM4H 4XC3L 3O4LE 5GRZA 4G6AC 1ZGLM 3LD8B 3JXAA 3UTSB 3C2SA 4Y1AE 5HYIA 1RZ7L 2MCPH 2X05A 1P2CB 4UV4H 4XPAH 1AGFA 3WKML 2EDXA 4HV8A 2AAVA 3HC4L 3QCVH 5C07A 3RP1A 2FL5A 2YUXA 2ZOKB 4PLKD 1QFWI 2FX8L 3MBXH 2R23B 5CJ5A 4LDOB 3MODH 3IDGA 3ARWA 1LVEA 1I8IA 3SGDI 3X11B 1RUML 1A7OL 1ITBB 3HNVH 5T1LB 2P8MA 5EORL 4LHUB 3REWA 1JWUA 1JHTB 3P77B 1IC5H 3U46A 2MWCA 3CFDB 1KG0B 4ZNEE 4W6YB 3RWGA 4RFOH 4EI5A 5IJKA 2AEPL 4S1RL 3NAAH 4MA7L 1PD6A 3L5IA 4HHAB 3EYUH 4GQ9H 2RCSH 3ZKND 4YHPB 1ROWA 1D9KA 3HN3A 3QDHA 1VADA 1T1ZB 3V4VH 4XXCC 5D7IE 2X1QA 2H8PA 1MSPA 1QSED 4HH8A 4LL9A 3QDJA 4TRPH 3TV3L 4JFFA 1V7NH 3QUYD 4LCYA 2Q7NA 5BOPA 1XGUB 1LK2B 4D8PB 3AY4C 3VWJC 2D2OA 1IQDA 2NY3B 3QWRA 1URLA 1MRDL 5KJRH 4OF3A 2O5YL 3L1OH 3VFWA 1U8KA 2BVOA 2W1NA 4IMLA 3MLTA 3ARBB 3GSXB 2AJZA 3GB7B 3JWDH 3LB6D 1W8OA 1B90A 1N5YL 2JCCA 5BCAA 1MIML 3ARXA 2Y9RT 2IANE 4S0SD 3RWIB 4BSVA 4L5FL 1ETZA 3L3OB 4KVNL 3WNNA 2GQHA 3BUYA 4DZ8A 5TDPB 2GJ6D 1I1FB 1I85C 1YYML 2APXA 5DWUH 2E8YA 2V2XB 2JB5H 3WUWG 3L6FA 1FG9C 3SJVD 1SBSH 3A0OA 1QLRA 4K3JL 1EGJH 3HZKA 3HNSL 3T2OA 1XH3B 3NCCB 4P57B 3L7FB 5IHUH 1F8TH 3QAZB 3PL6B 2CUIA 5FYLL 2ITCA 1ND0A 3QUKB 5INCB 1MCBA 4I3GA 2CKBL 3NFNA 2VUYA 1YECL 2VDMH 4NUGL 4U6XA 1VGEL 1BBDL 1NAMA 4JREB 4ZOBA 4KWUA 3VGHA 1L7TL 2RHEA 4HG4J 5D8JH 3E6FA 5CJXC 3RWDB 4G6JL 4BQ9A 4JAMA 1UFUA 4KMTL 4PRPA 2V5MA 1KV3A 3NCJH 4N8CH 3PWNB 2UY7A 1W2KT 1DN2A 1LE9A 4L9LB 4OLVL 4P9ML 2X89A 3HG1A 1KTRL 2X4SA 4A2LA 4Y4HC 1IRAY 4Z7VA 3ZHLA 4ELMF 1HILB 5B4MC 1T89C 2PKDA 4GRWH 4J6RH 4NN5B 4X6FA 3T0EC 3VFUB 2P4AB 2M8XA 4X6BB 4BYHA 3SEPA 4KZDH 1RV6X 1S7WB 1HHHA 1RZGB 4KI5F 4M7JH 5F89A 3ZKQD 1UXSB 1OLZA 4Q9QH 3MGTA 5F7WC 3SDAA 2QV2A 1U95A 1FORH 1MI5A 5I1CH 4HUXA 1JNLL 3VWKB 1LO2L 1YNLH 1X5HA 2RFXA 4YGVB 3D9AH 4UT6L 4D0BA 3LKSA 1C5CL 5IB2A 4ODTL 1FVCB 1CL7I 4NQSA 1G7IA 3IXAB 5FUCC 4DUXA 4Z7UB 2XWTB 4UBDC 3HR6A 1I3UA 2VISB 4ODVL 4WWKC 4L8CA 4M5ZL 1WWCA 1HYSD 4HX1A 4OZIE 3PWPD 5A2LH 3C87A 1G0XA 5C09B 3FKUS 5CEZE 2FWOA 4HPOH 4HIEB 4QTIL 1VGKA 4OBSA 4PJGA 5HGDA 4ZFFA 1MVFA 4X7TB 1JIBA 5EZOH 3NTCL 1MAMH 4PJ7E 4PUBH 3FZUD 1I4FB 4ZDHB 1MH5A 1XIWB 4PRAB 4XT1C 1KPRA 3HE7C 5JPMB 2JCCF 4ZO7A 5KS9F 3GUTB 5DUBB 3BAEL 5FA4B 2JELH 2D0GA 3RIFK 1AR1C 2NY4B 1SEQL 2HFGL 2ID5A 4TOYH 1Q94A 1WZMA 3WHXB 3QXDB 3V4UH 2DAVA 3AAZB 4JO3L 1JV5B 3KWWA 4IRSB 5GISL 2W0LA 3SGEH 1CFQB 1FL3A 3KPSD 4RAUA 2BXZA 3LZFH 1WF5A 4S10A 4FFWD 4GOSA 1EFXB 3CFBA 4LMQE 3G9AB 4XBPA 4U7MA 2CJUL 2X4NA 3L5XH 1KEGL 4H1LH 2DQIH 1MCIA 3ZE1F 4OQTA 5H8DA 4A6YB 5DD1H 3GRWA 3DVGA 1DLHA 2IBZY 4OIIL 2EYTA 5I66A 1T21B 5AAWA 1PW3A 4H25A 3PGCB 1I3RA 4QHKJ 3FT3A 5EO1B 3ARRA 1GIGH 4Q9BA 3L95A 5I8KH 5I17B 1PQZB 4X9HA 4XRCA 5I75B 4QO1A 6FABL 1HXYB 2LFGA 1J1XH 3ARTA 1ZS8A 4JPIB 1L7IL 1W72A 2NX5D 2WBJC 3LSOB 1BOGA 2NY1D 4OJFH 5T1KA 2DM4A 4Z9KB 2D0FA 2OMBA 5F72S 3T0WA 3MRKA 4C54A 1KCUL 3STBA 2AXGB 5CGYD 4M48H 5KANI 5J1SC 1NMBL 3QO1B 4N1HB 1IKFH 1UKSA 3T2NL 2W60A 3C9NB 1NDMB 5EU3A 4LFHD 1FFPB 1VKXA 2DQHH 3HI1A 5IEKB 2A73A 4AIZA 4KC3B 1J5OH 1N2RB 2XQYG 5TH2A 3DVNB 4MNGA 4MNQD 4ONOA 3WLBA 1KBGH 3BPNB 3IDIB 3RDTC 1ONQA 2HJLB 1Z6JT 3VXMA 1IGCL 3P3YA 1S5HA 43C9B 2BNRB 3L3IA 1UB6B 3BDYH 1RZIA 4FQXB 3VXUD 4PGZA 3QPQC 3OR7B 3HNTL 2DQUH 3HR5A 5CGTA 1DLFH 3UJTL 1CFTB 2Q86B 4LHQB 4MDJB 4V2BA 3BD4A 4AY0A 1ZGLA 3GMPB 5EC2A 5GIRA 4LGPB 2BNUB 4OCSL 1MAKA 4EBQH 1XGTB 3HAEH 3DVFA 5MENE 4F9LA 5J3HC 5HVWA 2V2WA 5DTFB 3KPRD 4HKXB 4X9BA 1LEKA 3V6FA 4IRJD 2B4CC 2K7PA 1HEZB 4ZMAT 4GAGH 5GZOC 5KSBE 4C56B 1N3NA 1UWGL 4NHCH 3RJQB 3O6LL 3TA3B 4E42B 1CLYL 2DLHA 4PP1C 3K0WA 2YPLB 4MXVF 5BO1L 1MFBL 5T5FL 4JDVB 4ZUVA 1LQSR 1ZMYA 1J8HD 1TZIA 1NGQH 5GGQH 3MRPB 2A77L 3P0YH 5IQ7H 1PKOA 2BDNH 5MEQB 3T4YA 5DQJA 4OQTL 4PJEB 4K2UL 1RK1A 1IGFL 4TULH 1MHHB 1YY8A 1Z0NA 2PTVA 3JTTB 4GG8A 3NABH 4UDUB 4NKIL 3RL1A 1UKTA 2GHWB 4G7VH 3T0AA 1F6AB 2HT2D 4U1NA 5HDOA 4ODHH 5F1NB 5F6IB 5H37H 3U0WL 1UZ8B 3HZMA 4IEFB 5IWLC 1D5MA 3MLYH 3QUXD 2J1KA 4FA8A 1VFBB 2WIIB 3FN0H 4LLMB 2IH3A 3U7WH 3VD9A 3EYQC 3SGJC 2IC2A 4L4JA 4OF5A 3L3DB 5TE7H 4ZPTB 1I9RL 2H6PB 5KVDH 3BZ4A 1FL5A 4NKMA 1KCVH 1KSRA 4PJ5B 4YDIL 3VG9B 5JXEA 4G5ZH 1HNFA 5D7SL 1J11A 2FR4B 3SDXA 3D3VA 1XFPA 5DUPL 1P1ZA 5TE4H 1EHNA 4RMUA 2YMXH 3NGBC 1JPSL 4MA1C 2Z35A 1OM3L 1IM3B 2FEEL 4LLUA 3CXDH 1IZKA 4OFKA 2NY2D 4NWTL 5FHBH 2CR6A 4O4YL 2BSTB 4HXBH 2KPNA 3MRHB 1QA9B 3A6OA 1RIUH 1YEEL 4YBQD 1JPFA 4QHLB 1OGAD 3AM8C 3GBMH 1S7TA 1JHKH 4LPXA 2NY6D 2AQ3A 4NO5B 1I7ZB 2YD7A 3O41A 2CDFB 1EDQA 3DI2B 1NBYA 4RBPK 1MREH 5DT1L 5FO7A 4PRBA 1I7TA 2R1YB 3RAJL 1BJMA 5JDSA 1T0NB 5L8LB 1A8JH 3DMMD 4BM7A 4OD3L 1Z5LA 5IJVA 3H7BA 1OQOA 4PB9H 4NQCD 5M7QA 3OKNB 1TTGA 2J8UB 3FOMA 4P3CH 4KQ4L 3RIAK 2VIRB 3QCTH 2APTA 2QADD 5J13C 2EIEA 1Q8MA 5DQ9B 3FB5B 3TNNB 2AK4A 1RULH 4LASL 3CDYA 1RVFL 3BI9X 3U1SH 4G8FB 3LKPB 4HFUH 4OLXL 1KENH 4R96A 5E8OB 3VMNA 3STLB 4PRID 2VZVA 4O2EB 5D1XB 4P3WA 3HB3D 2C3VB 2G5BB 2QQQA 1IC7L 2BVYA 2L4OA 2C1OB 3HI6L 3AROA 2G75A 1T80A 5GGVH 4U7KA 4YBLC 2Q76A 4MJ6A 3PJSA 1HSBB 4YQXH 1HK6A 4BELD 1NEZB 4R6UA 4Y16C 3VFTB 3HE6B 5IR1A 1A6PA 3ECBB 3KG5A 4TSAH 2NZ9D 3QQ3B 4X99B 1MLCA 1EZVX 1YEFH 1B6UA 1YMHB 1B6DA 4IOSD 3ULUH 1DL7H 2YXFA 4LK4A 3SE8H 4OZGF 5DRZA 3HRZA 1NAMH 4RGMC 5BZWA 1U8NA 4BFEA 3DETD 4JLRB 4BQBA 4XNYL 5BXFB 2H32A 4LRNL 4LSQH 5CBEA 4KJYB 4EI5D 3JWOH 1LE5A 2QSQA 1SQ2N 4LSVL 1W0VA 3RVWD 3ZT6A 1YYLH 4TSBL 3RVXD 4Z7QF 3VCLA 2DQFB 5GGRA 3RHWK 5CZVL 3C6SA 1BGXL 4JFYB 3J8F7 4R3SB 2PO6A 3IETA 1D9KD 4RISL 3G6JE 2PETA 3BGFB 5DURB 4KHXH 4M9OA 3G6AB 4M8QB 5L7XH 5SV3A 3T77A 1MQKL 3SDXF 2ZJSH 4LHUG 1IEBB 4BQCA 4JFFD 4JFZH 3QEGH 3PV6B 2AJSL 5K9OB 4NKOB 4XVJH 3QWRD 2NY7L 3OZ9L 5CSZA 5DK0A 1AHWB 1YUHB 4OGYL 5F9WC 1HINH 2OX5A 3B8YA 2VXTL 4UU9B 3MLUL 4Y2DD 3I3BA 3N85H 1GXEA 5KAQF 1YPZA 1JWSA 1WAAE 5CWSA 1TJGH 5C3TA 5B3NA 1S7QB 4UUJA 4KTDL 5MHSD 2G2RB 2XA8L 1F5WA 3BQUA 1U6AL 3P4NB 4NCC2 5IROA 2H3NA 2V5SA 1FLTX 4JN2B 4YDJA 5IW6A 2H1PH 5I2IA 4PLNC 4QOKA 4P23C 3KPSE 3KHQA 2OCFD 3B43A 4OCYH 2O5XL 3TYFA 4N0YL 4YXLL 1FNAA 4UILH 2NXYC 1CI5A 3RZWA 2RJMA 3IFLL 3KYMB 4L8SC 4YC2B 1OAQL 2NTSP 4KRPC 4L4TE 4ZTOL 4JG1H 3S34L 1NL0H 2RAMA 4ZXBC 1HHJB 4MJIB 1D3CA 4XP4L 3UTSA 4PG2A 1WLHA 3SCMB 3OJDA 1TZGH 1P2CA 4ENEC 5E2VL 4K94C 3FQTB 4JM4L 5F88B 4X5LA 3ZHDA 5CJ8A 5J89A 2NX5E 4K3DH 3MA7B 4NC2B 1LO5B 2DQEH 3RIFF 5LQBL 2KDGA 2R23A 1T7VA 5F9AC 4PRPD 1MRFL 3X11A 2Z91A 2ADFL 3NCYP 4Y5YC 4AMKL 2FHFA 4KV5F 5T1LA 3Q1SL 5GRVK 2X89D 1FFOB 4PYHA 5J8OA 1CXFA 1JHTA 1UA6H 3P77A 4U1GC 1NCCH 5D1ZA 4XB7A 3CFDA 1KG0A 1T0PB 1YN7B 3GNMH 1QRND 2EO1A 1T6VN 3NPSC 4NQVB 5IGXL 2FH6A 3THML 3FO0L 4FQ1H 1MCWW 3E6HA 1YEHH 4MLIA 1FBIL 5DVLA 4HHAA 4M7ZB 4MNQE 3TBSB 5DD3H 3SDAD 4YHPA 4NC1E 1MI5D 1LGVA 2UVEA 3NN8B 1KJ2B 5ETUB 1IGIH 4PRNB 4FQIH 3VXUE 5E24E 1XGUA 1LK2A 4D8PA 2DDQL 4NO0A 1S78C 1CGSL 3O11A 1A6WH 4GRLC 3E1F1 2F53E 1DJSA 1MWAH 1GL4B 1P4LB 2WK2A 3A6CL 3MRJB 3UAJC 1V3LA 3QO0B 3LEVL 1OCWH 5DJ6B 2WIMA 3RWHB 1IAII 3GSNA 3ARBA 3GSXA 3S5LB 2BHYA 3GB7A 5ADPH 3KPTA 2ZWLT 1NCTA 1YPZF 4GAJL 3QYCA 4PGJA 4K71C 5KANG 3IRPX 1KTLB 3SE4A 2IAMB 3RWIA 5IBLC 2I5YL 5DJCB 1GYAA 4LVOB 1T7XA 3L3OA 2AV1B 1ORQB 2DLIA 4QY8A 5TDPA 2OK0L 1I1FA 3SN6N 3K46A 1ZA3B 4IOFD 4KGJA 3C60C 1J8HE 5I15L 3QZWB 2I26N 43CAB 1Y0LB 3PP3K 3MJ9L 4RAHA 3RUGB 4LSSL 4HWEH 3L7FA 2OJEB 3QG7H 5EU7C 1R5IB 4OCXL 4YHLH 4FN0A 5INCA 1DBBH 4I13B 2XZCL 1U8JB 1RZKC 5HYSG 4LSPL 1IL1B 1RIHH 1T83C 4IIQB 3GIZL 2YUZA 2V5RA 1IGYB 5JW4N 4WU7B 1RURH 3CIQA 5HGAA 4DN3H 1I3GH 5I1HH 3IFNL 1I9IH 1NBZB 4WI6A 3RWDA 4X7SL 3VMOA 2DKMA 4JKWA 4U49A 4OD2B 1EJOL 3JV0A 1WFNA 5EC1B 3PWNA 1MFNA 2AV7B 2P5EA 5I8EB 5D7LB 4NQXB 2A83B 4F7CB 3LDBB 3HA0A 1A7NL 5T1KD 4F57H 1HILA 3IJSB 1P9MA 4UB0H 4POZD 4X6BA 1CU4H 4MD5B 2AJXH 3CFEB 1EPFA 1S7WA 1RZGA 4NRXA 3FFCE 1K5NA 1UXSA 3LN9A 4DKFL 1YJDH 3V6ZB 2PNDA 3ROLB 4PRDB 3VWKA 1Q72L 4LCWD 5KG9B 4YGVA 4POUB 5J7CC 1I1AC 1OGAE 3OKLB 4YK4C 5FM5O 5F7EL 3PWLB 2UZXB 5I1KL 3O2DL 3R0NA 4Z7UA 5BVJB 2XWTA 2K9UA 2DWDB 4UMGA 5E8DH 2VISA 1EEQA 3HS0B 4LSRH 2E7LA 4XVTL 1OTUC 5GSVA 5F93C 1M71A 5GZNC 4HIEA 1R0AH 4F33A 4X7TA 2EH8L 4XC1H 1ZLSH 1WFTA 1H0DB 3CVHB 5E2WH 1MFEL 2FATL 4J23A 1XIWA 4ZO9A 4PRAA 3QUZC 4MAYC 3ARFC 2P5WB 3ZYZA 3OB0H 3GUTA 2FEEI 4D9RD 5DUBA 4DN4L 5FA4A 5ISZD 4E0RB 3K8KA 2XTJD 4PRIE 5DK2B 5DJZB 4HKBB 5FYJH 3WHXA 4LLQB 3QXDA 1LEGB 2PXYB 3AAZA 2VDRH 1JV5A 4IRSA 5I1GH 2CGRL 4CN4A 3ES6B 2AXJA 2YPVH 5D1QB 1CFQA 4Z78B 3FMGL 3TN0A 5C07E 1RY7B 5F96L 3QRGL 4PTUB 1KB9J 1JPTL 5HHXL 5GGTL 5K9KB 2CUHA 5F7YC 15C8H 3GIVB 4XP6H 4DKEH 4A6YA 1K4CB 4WTWA 1T21A 3PGCA 2ICWJ 4LRIC 4XWOD 4YO0B 1YNKL 2WLZA 4P2YA 3C5ZB 5TQ2H 3LKQB 5I17A 1PQZA 3RI5K 2ZCKL 3V8OA 3ZKSD 5IIEB 3H6JA 2UWEB 4JPIA 3WXWH 1QSFB 1DZBA 3A67L 4MA3A 5E6IC 3MYZA 3DX6B 2NY5L 3V79C 1BM3H 4WWID 2YRLA 3C08H 3P40A 1NJ9B 4JO2H 4MVBC 1X5ZA 3UC0H 1FN4B 2AXGA 3ROOB 4UI2A 3RWJB 3ZL4H 1RPQA 4OGXH 2ZSWA 1WIOA 3QO1A 3UZEA 3WE6A 4OF7A 3QDJE 4JFFE 3C9NA 1NDMA 1NCBH 4Z8FH 1FFPA 5JXED 1QFWH 3HZYB 4KZEH 1G9NC 1KCLA 1FGVL 3D3VD 2VB5A 3T65B 4TVPH 2F58L 3SGDH 4NGHL 1N2RA 3NFSL 1U8OB 4QRSB 3DVNA 4YDVB 1IFHH 2JIXA 2YK1H 5CD5C 3IDIA 4WV1C 1K4DB 4NSKB 2HJLA 4FQHB 4WEBL 5IMLB 5MHSE 2X9XA 43C9A 2BNRA 4Z7UF 1H15A 1UB6A 4XMLL 4FQXA 3M8OH 1HHKB 1MCPL 2DWEB 1J1PH 1JF5A 3OR7A 1JRHL 2BSRB 3QUMH 5T3ZL 3ALPA 1CGYA 1VEOA 2Q86A 5CCKL 4MDJA 5D6DA 1ZOXA 5FYJD 1MIEH 2DTSA 3RHWF 3CSPA 2X9WA 4HCRH 2BNUA 3GGWB 1XGTA 3IKKA 3UO1L 3VFGL 5DTFA 1D6VH 1OAYH 3QHZH 5ITFB 2IMNA 5HVHB 3S8WA 2DQGL 3S37L 4TTGA 1BVLB 2MTPA 2KKQA 1HEZA 4B7LA 1IBGL 3ILQC 3ZE1E 4C56A 3UYRL 2HT3C 4P5KB 2D7MA 2HN7B 4E42A 4Z95L 1UZ6F 1FAIH 5JW3L 5I30L 3BJ91 4R7DB 1O0VA 2YPLA 4KK6C 1U36A 2B5IB 3B8SA 4JDVA 1Y6NR 2DD8H 1ZHKB 4R0LC 4KHTL 5EZLA 5FECA 1RUPH 1QFUH 3P0VL 2R0LL 3BO8B 4PRPE 2LVEA 5MEQA 3MNWB 2YR3A 4PJEA 4APQC 1R3HB 1MHHA 2Z92A 1QKZH 3JTTA 5KW9H 4XHJC 3ZDXF 4UDUA 3GMOB 5CZXC 5FDWB 4Z7VE 4NP4H 3SE3A 4FQQB 5JTWA 4NN6C 1F6AA 5F1NA 3RVTD 5EIIB 2PF6A 1Q9WB 3MRNA 3WO4C 1UZ8A 5JA9A 4TSCH 3B2UC 3SKNB 1CIUA 1VFBA 1DVFB 2G5RA 2WIIA 5IVXA 1OWRM 3MLVH 3OSKA 5L88H 2BSSB 5LBSL 4JANA 1MI5E 1MRCH 4TVPD 3BSZL 4DOHE 1R3LB 4LIQE 3L3DA 4ZPTA 2H6PA 4FRWA 5SWQB 5KOMC 1DANU 1E28B 4PJ5A 2F5AL 4ZODA 3STZB 3TBYB 2HLFD 3MLXH 1DCLA 5IP4A 5I76B 2HFTA 4LU5H 4P2QD 4JE4B 5SWSA 1H3UA 1TZHB 2FR4A 2PO6D 2D4FA 4IMKA 2YA0A 3LPGA 1PG7W 4KAQH 4F7TB 4UV7L 1CFBA 1IM3A 4O2CB 5GRUH 2MFNA 4KY1L 3RGVC 4PJGE 3HFMH 4OSUH 2I60L 3MX0A 3G5XA 4OD1H 2BSTA 3WIFB 3MRHA 1GSMA 3RNKB 4ERSL 1UEYA 4QHLA 4UINH 3FOLB 2X7LB 3B9KB 5JORB 1JGEA 2PW2A 2ZUXA 4KXZI 1QVOB 3LS4L 2VLJB 3DBXB 4Z0BH 1OAUH 3D2UB 2R1YA 5FK9A 4KU1A 1T0NA 4WFGD 3BQUD 3KJ4B 1D6EB 5HI3D 3V6OA 4IJ3C 4YFLF 3T04D 4AT6B 2VAJA 3OKNA 2J8UA 4WW2C 4I77H 3R06B 3N1FC 1IAMA 2VIRA 2NCMA 3KLHD 3MR9B 3GSQA 4LOUD 4D94A 4JZJB 5DQ9A 3FB5A 2VXSL 2DRUA 2HLAB 3HPLB 4MXWL 5T3XH 4PJBB 4KKAC 1SBBA 4WY7H 4G8FA 2BY2A 3LKPA 1KUMA 2AABL 4K07A 3CVIH 5LG1A 1M7DA 4XPTL 5EULV 5GRYA 1JUFA 2WWKO 2NLJB 4O2EA 5D1XA 4XNXH 2G5BA 2R29L 1JL8A 5TPWH 4RX4D 4MD0A 4AM0B 2C1OA 3UTSD 2DMBA 3QQ4B 2G60L 1JK8B 5SX5K 1RUAL 3O9WC 4M6OL 1ZGLP 5T33H 1HSBA 4XAWL 5B38A 1X4YA 1NEZA 1NUDA 3HE6A 3OTTA 1K8DB 3ECBA 2P1YA 1QYGL 3F12B 3QQ3A 4H0IA 4X99A 3QIUB 2HKHL 1YMHA 4PJEF 2GFBB 2AERT 1MCEA 3IDJB 3O81A 3BZEB 1ZANL 4FP8L 4UAOB 1YN6B 4U6VH 2GY7B 3BKMH 3D39B 4YHOL 3OKMB 5T1LD 1PSKH 2LE9A 3BW9B 1EEYB 4JLRA 4LHUD 3BH8B 4JR9H 1LO4H 4LPVA 3RU8H 4FXGB 5BXFA 4N90D 1U91B 1F42A 5EUKB 2EXWD 4HWUA 4KJYA 3T3PE 1FIGL 1UQSB 4K9EH 5IVXF 2YD8A 4MX7B 3I2CH 4U3HA 2DQFA 1MCCA 2BJML 2FIKB 4MNGE 5FUZL 1Y6MR 1ACYL 4WGWB 4JFYA 4R3SA 3ULVC 1KIPB 1T2JA 3P11H 2XQBL 3G6AA 1MPAL 4EN3C 2Y36L 2XZAL 4LARL 2VN4A 3TVMC 1ZHNB 3VJ6B 4G6MH 1IEBA 5E2UL 3FT2B 4ODBD 4NFDA 1B2WH 3EJZD 5JLZB 5J57B 1UACH 4RMWA 5I16A 5K9OA 3T8XB 4LP5A 1CZ8H 2NY3D 3ARYA 1AHWA 3AGVA 4X9FA 4YWGH 1MFCH 4CVXB 5EZIH 1F11B 4UDTB 4D9RE 2XACC 3ARBD 4JDTL 3GK8L 5ISZE 1S7QA 1AXTH 2G2RA 4O58L 1BOYA 3VDAA 5J56B 5T3XD 1UM5H 3RL2B 1I1YB 1UM6L 3KYOB 4JM2C 1CDHA 2IBGA 1HCFX 4FTVB 4XPBL 3IDXH 3VGGA 3LV3B 4JN2A 3H42H 3SPVB 3AS1A 1EO8H 4P2CG 1RMFL 1F3JB 4WCYH 4YHKL 4WEUD 1UCBH 4CRPA 5B39B 5T1DL 1OAZH 4IRZH 4KJQD 4KGLA 2P48B 3T4AA 3KYMA 1KCRL 4NWUL 2EDJA 4OI8A 1CLCA 1N64H 5IFJB 1JNHB 3PL6D 4XNUL 3S36X 1HHJA 4MJIA 1MCNA 4ZOEA 4X4XB 1CDCA 3NIGF 3SCMA 4KKBC 4DEPB 2CD0A 3MFFA 3LIZH 4DKAA 3G6DL 3I50L 4UOW0 2UZIH 2ICCA 2R4SH 5F7LB 1WZ1L 3P30L 3T0XA 3DO7A 3GJFB 2E7BA 4LPTA 3MA7A 5DVNA 1LO5A 3DURB 4WIQA 4HMEA 4MQXC 4Z7QE 1MJJB 3EO9L 3KPMB 4AH2B 3EOYG 5BVPL 4LEOA 1NDGB 1NFDB 2F15A 4PLKC 2B0SL 2R39A 4JZOB 4YXHL 1FFOA 1JZ2A 3DROB 1E4KA 2HMID 3MLWH 5KSAC 1MFDH 1BX2B 4K8RH 3VW3L 5CP7B 1TTUA 4NQVA 3D3VE 4P2OB 3GEWB 2IPKB 1HDMB 1NCWH 1D5IH 5DC9B 4AEIH 4G80B 3TBSA 4XX1E 1WCQA 3VWKD 3NN8A 4UT7H 1KJ2A 5ETUA 3PDGA 1IGTB 4LVEA 4PRNA 3WFBH 4I5BB 3RI5F 3ZKNC 3U6RB 4XC3H 2VDPL 5EU5B 4U1LB 2XKUA 2VO5A 5FYJE 2D03H 1DBML 1RZ7H 1ADQL 3S4SG 3QUYC 4PY7B 3WKMH 2H45A 5GQBA 3MRJA 3HC4H 2PW1A 4HFWB 3QO0A 2LQRA 3V95A 5C09D 4ODSH 5DJ6A 4Q58C 5FDYA 4PR5B 3S5LA 4D0DB 1MQ8A 3SBWC 5DVMA 5BV7C 4RWHA 3O3BB 4CMMB 2A0LD 1AD9B 1XIWD 1KTLA 3MV8B 5F70A 2IAMA 1A7OH 2CPCA 2NQCA 4QRQA 5DJCA 5AUMA 2AV1A 1ORQA 5EORH 1UYWL 3V7AG 3WIIL 2NY4D 1Z9LA 4WUUB 5JZ7D 3MRQB 1ZA3A 3MV7B 2AEPH 3PP4L 2KL6A 4WO4D 3M45A 3L3GB 3QZWA 4MA7H 1JRHI 43CAA 4BFIB 3DWTA 1DDHB 4OFYD 1Y0LA 3WDIA 4RDQF 1P7QA 3RUGA 1DQQB 2OJEA 4AEEA 1R5IA 4M3KB 3TBTB 1EFXD 4M6AA 1U8JA 1JZ7A 5EZJB 1AH1A 4HZLB 4KV5E 5HDQH 1FZMB 1IL1A 2FRGP 4I0PB 4IIQA 2BY3A 3TV3H 1IGYA 4PBWD 4WU7A 2Q20A 2B4CL 1JYNA 1NBZA 2OL3L 3DUUB 4K8RD 4PBXA 1LK3L 4OD2A 5EOCL 1MRDH 5T5NG 2O5YH 4HUNB 2AV7A 2BK8A 2DQCL 5I8EA 3WFDL 5D7LA 3PXJA 4H20L 4NQXA 2A83A 4F7CA 1MCHA 4KJPD 3UTZB 2EDOA 2VR5A 1D5XB 1FE8L 3IJSA 5DD0L 5FGBA 3PE9A 1X5KA 3QNYB 2JK5B 4L5FH 3QJHB 4MD5A 2XY1A 3PP3H 4J1UB 1AP2B 4XMPL 2FCBA 1OP3H 2EH7L 1TQCC 2IFFL 1H3PH 4ONFL 1O7SA 3V6ZA 1YYMH 1DQLL 4BK4A 1KYOK 1KXQE 1ZSDB 3ROLA 5MI0C 2IJ0C 4D3CL 5KG9A 3U0PA 4K3JH 3LEXB 3OKLA 3HNSH 3OAUL 1O7VA 2IH1B 3OGOE 1FRGL 3CU1A 5BVJA 4HK3J 2R1XA 2CKBH 5AZEL 1NQBA 1YECH 5JOEA 4KPHL 3HS0A 2BNRD 4WFGE 1VGEH 1C16A 1BBDH 5E4EB 3SO3C 5J6GB 2ZSVA 1EHXA 1YZZA 4QOKE 1H0DA 3CVHA 5EBLB 1MHPL 4KMTH 4PJ8D 3WMSA 4ZTPH 2P5WA 2DQJL 4OLVH 4LSUL 4P9MH 1S8DB 2NYYC 5D96C 3K2UL 4GW1B 4E0RA 4PJIB 1GGYA 4W4OC 3VFMA 5DK2A 4Q6IB 4HKBA 5D93B 5HGHB 1KJ3H 3VFSB 1G6RA 2FO1A 3UTSE 4C56D 4Y4HB 3C8DA 3TA3D 3ES6A 3ZDZF 1NGZB 4Z78A 1NGXB 2VZ3A 3W0WB 2YPLD 4ZFOL 1MJ7L 3LAFA 4PTUA 2HRLA 3V6BR 4YFLI 3TT3H 3VXPB 1K9TA 3RUGF 3ZDYF 3D0LB 5K9KA 1LO2H 1U3ZA 25C8L 1NLBL 5JIKA 4UT6H 1C5CH 3GIVA 4ODTH 2EKSA 2H9GB 2XWJB 1DBKL 1N5AB 3UJIH 1K4CA 1G7HB 4RGNB 2HT4D 3VGDA 3BWUC 2VLKB 5GHWL 2LAAA 4ODVH 1L6ZA 4M5ZH 4N90E 3C5ZA 3LKQA 5DF0A 4NQEB 2VABA 2OXHA 4O02L 5IIEA 9CGTA 4QTIH 1YMMB 4CMHC 4M61B 1NANI 4DFIA 4WWKB 1XR8B 3NTCH 4G9FB 2R2EB 1FZKB 3QXUA 4W68A 3DX6A 5FYKL 2F19L 1IZJA 1NJ9A 1CS6A 4UIMB 5JO5A 1FN4A 3SQOL 5A43C 3RWJA 2V9QA 3U9PL 3NCFB 3ZO0A 4Q9RL 3BP5B 5IHBA 4JHAL 4PJ5D 4O2FB 1SEQH 3GMMB 3HE7B 4YH6A 2HFGH 1A64A 1FFQA 3HZYA 3UBXB 4C57C 4BSWB 4JO3H 4JQXC 3T65A 3OGCA 5I1EL 1PEZA 4QF1B 2W07A 4GBXB 4YDVA 1E4XL 3O0RL 1UM4L 5SWZB 1CGWA 1ZLUH 4Y4KB 3VXNB 4NSKA 5IMLA 1OARL 4FQHA 4HLZG 5ADOL 1WEJL 3FRPG 2CJUH 5T3XE 5DLML 4KDTC 1KEGH 1CDBA 1M6OA 2EICA 3ARPA 2DWEA 5EU4B 1I7UB 4ZUWB 4OIIH 4NC1C 4LVHC 3OV6A 2WINB 3V5DB 2AJVL 3EZJB 3MGAA 3S36L 3GGWA 3P4OB 1EEZB 1S7SB 4OGAD 4XCFL 6FABH 4EVNB 5MERB 3FO1B 2F54A 3TO4B 3RGHA 1PKQA 5TJWK 1DQJB 5ITFA 3O6FB 1QSEB 3GJFK 1BVLA 1WBZB 1UADC 1F4XL 3NACL 3WYRA 2FYYA 3VGEA 2WBJB 5I6XC 2DI7A 3H9HB 4P5KA 1I7RB 2HN7A 1NMBH 5EO9B 1KCSL 4HWNA 5HYFA 1RZ8B 4R7DA 5D2NB 4IRJC 5D1XD 1NC4B 1ZHKA 2R56H 4XNMB 3BO8A 4J4PD 3IFPB 1FQ9C 1U8IB 2D7OA 3MNWA 2AS5M 3AB0C 4J3TA 4PJFB 1R3HA 3HE6D 1KGCD 4HT1L 5F3BB 3WJJC 1JNNL 3KS0H 2YRZA 1A3LH 3MYJB 1IGCH 3GMOA 5FDWA 5HD8C 3QA3A 4PRHB 3TBVB 4FQQA 5ACZB 1N4XL 5AYUL 4NZUL 1BZ9B 5EIIA 1Q9WA 2YKLL 2FBJL 3HNTH 3UJTH 3SJVB 3SKNA 4JO1L 1XGQA 2HT2C 2BSSA 4DTGL 1HXMB 4K94L 2WUBL 4OCSH 5IG7B 3VH8G 5AZ2L 1CDYA 2OSLB 4WU5A 2BVTA 1R3LA 5SWQA 4PJDB 4NNPL 1E28A 4GSDL 4OCLC 3STZA 3TBYA 3MNZB 5L0QC 3BN3B 5I76A 1C5BL 4OI9A 4Z7UE 1DUZB 1MCWM 1TZHA 2GYSA 3E3QE 4R26L 5DURD 1UWGH 3PQYA 4YEEA 1CLYH 2A6JB 5BO1H 1JWMB 3U36B 1MFBH 1T2XA 2YEZB 5T5FH 3WIFA 2B20A 3RNKA 2A77H 1EBPA 2IWGA 3TCLB 3FOLA 2X7LA 3B9KA 5L6YH 1DSFL 2KUTA 4LEXH 5A3ID 4K2UH 5A2KH 2LV4A 3QCUL 1JZ3A 1IGFH 1G9MH 2VLJA 3DBXA 4I18B 5KVMC 3H3BC 4HQQL 3D2UA 5DGRA 4NKIH 2B2XL 1ZK9A 4P2RB 3KXFD 1D6EA 1UZ6E 2AJUL 4UQ3B 1GC1C 4RQQA 3O3UN 1CTNA 3U0WH 4AT6A 1CN4A 1MCLA 3R06A 1IGML 4MS8D 8FABA 4CW1B 2CLRB 4LGRB 4JZJA 2HLAA 5KSUA 3SOBL 3A6BL 4PJBA 1JP5A 1LMKA 1YY9D 1G7PB 4FQ2L 4HW6A 2XFXB 1OHQA 2QADC 3ZDXE 3O3EB 4YDIH 3PWPB 2NLJA 5DS8A 2UUDH 5D7SH 5DFWH 4XPHL 4EDWH 2AGJL 2VNCA 4MJID 4AM0A 2KQNA 5IB3B 3Q6FB 3OAZK 3OMZA 3QQ4A 5DUPH 1JK8A 3SCMD 4QNPF 4FFYL 4S1SL 5JQHC 1WQVT 1KCKA 1F90L 2R2HB 4NWTH 3DV4B 4JHZA 1K8DA 3BPLB 2PR4L 1LO0L 2BOCB 3GMNB 3F12A 4MQSB 4O4YH 5B39G 3QIUA 3NGBB 2GFBA 4OZHF 4MA1B 1MELA 2OZ4A 1YEEH 3IDJA 4GAFB 3U83A 3BZEA 1YN6A 4X8JB 1CXLA 1SMOA 2FLBT 1BJ1H 3E8UL 1B88A 2NZ9C 5DT1H 3MRMA 3BW9A 4BUHA 3BH8A 1MHCB 4U0RB 5DC4B 3RAJH 2GSIB 5HHNB 2XA3A 1DBJL 5EUKA 4WW1B 3G04A 1UQSA 4GFTB 2CRIA 4UNVA 3PDDA 4Q9CA 3DETC 2LU7A 3MJ7A 4KQ4H 2FIKA 4U1IB 1FNHA 5IT2L 1ZHLB 1QP1A 3RKDD 3S35X 4EI5C 5IJKC 1T22B 2A74B 3P9LB 4LASH 4R2GB 3RVXC 1L0QA 2P7TB 1DQML 2BNRE 3QFJB 4ZYKB 5C71A 1ZHNA 3VJ6A 1AGCB 4OLXH 4GRWB 5KOVC 3FT2A 2CMRL 5JLZA 1D9KC 1MEXL 3GJEB 3T8XA 3VFPB 3B5GA 1IC7H 3GZKA 5GS0D 3BRDA 2O26U 1DFBL 2FBOJ 1QFPA 3O4OC 5D7JC 3X13B 3ZKXC 3QI9D 4FZ8L 2QR0B 4CVXA 3PXHA 5TE6H 1F11A 1YQVL 4TTDC 2W0FB 2FX9L 2RGSA 1J12A 4R7NB 2YD1A 1G7MB 3RZCB 3RL2A 3VI3F 1I1YA 4JJHA 3KYOA 5EBWA 2HG5B 2IAMD 4KDWA 4C56E 4IDLA 4FTVA 3LV3A 3VXRD 2DLGA 1F3JA 4XNYH 2CK2A 2YPLE 4EJ1C 5GJTL 3MJ6A 4LRNH 4PGDB 4LCCB 1WBYA 4KK8C 5B39A 2OR9L 3LRGA 5DMIL 5FF6B 4TSBH 3ZYJA 1V5JA 5C6PB 5CZVH 2EC9U 2Z8WC 4PJEE 5IFJA 1JNHA 3SKJL 1PX3A 1UWEL 4RISH 4X4XA 3MV01 4LCUB 4UOJA 5CMAB 3I84A 3N1PC 4YGAB 1JJUA 1SVCP 1GGBL 2AJSH 4OLYL 4HULB 3DURA 3AREB 3KPRB 5IVXE 3RBSA 4OGYH 1MJJA 4PGCB 3KPMA 4AH2A 2VXTH 1NDGA 1NFDA 4G43B 5CLTA 3MLUH 1XAUA 3WIHL 2ZP0T 5D7LD 4JZOA 4K3HA 2AJYH 4H1LB 1J10A 1N7ML 2V5TA 4PJ5E 4KTDH 4CL7A 1LNUA 1BX2A 1F45A 1U6AH 1DEEA 2PUQT 5CP7A 1JN6B 3CX5K 1DANT 4WNQB 4P2OA 1J88A 4YHZL 5FA3B 2IPKA 1HDMA 4P9HH 2QSCL 2BVPB 4G80A 2V7HB 2O5XH 4YXLH 4N0YH 1U3HB 4NBXB 3H0TA 2VDLL 3EKCA 1A6VL 2FLRT 2I9TB 1WITA 1JHLL 1J86A 3D18B 1IGTA 1OAQH 1I75A 4I5BA 4ZTOH 1HIMH 3U6RA 3SDAC 3LHPL 5EU5A 3O2VL 4U1LA 1FPTL 4HS8L 1SY6L 3CDGA 3DSNA 4XP4H 2LAGB 5TF1L 1KTKE 2J12B 5C0BB 1B9ZA 3GSOB 4HFWA 2VDOL 1V3KA 4JM4H 4XPFH 1DTUA 1P4BL 2UYLA 4J3XA 1DQDL 4PR5A 4D0DA 2J8UE 4Y8AA 5LQBH 3O3BA 4GAYB 3OBAA 4WTZA 4XCNB 5C0GB 5DGQA 4OLWL 4CMMA 1AD9A 1GVIA 1MRFH 2HTLD 2G9HB 2FO4B 4NYLB 3MV8A 2ADFH 2P5WD 1E4XI 4AMKH 1P5VA 4ZPVB 1SEBB 3Q1SH 3VA2C 1F4HA 2WSKA 4R97B 3VFRB 3D5OF 4H8WC 3NIGE 4WUUA 1RHHA 1TFHA 3MRQA 4RMQA 4E41D 3MV7A 1S9XB 2PXYD 2Y4SA 3ZE0E 3L3GA 4I9WD 1U2CA 4BFIA 3FO0H 1DDHA 3OKEB 2H41A 1FBIH 1QD0A 5D1QD 3HAEB 1G7JB 2LTQC 1DQQA 5ACMA 1TVDA 4IOFC 3NPSB 3TBTA 1KGCE 3LS5L 2NY6B 2IADB 3NZ8B 1SHMA 5D7IF 3MSPA 4X6CB 1QLEL 3FAWA 2FJHA 4UTBL 2AEWA 4HZLA 4L9DA 1FZMA 4I0PA 4OZIA 3T1WA 1FNSL 2DDQH 3H3PL 4YXKH 2NY0B 5HI4D 1CGSH 4N9GB 1FO0B 2GY5A 3QB7C 3K7UA 4ORGB 3IKCB 3C5ZD 4XP5L 4Z6AT 5B3JF 4P59L 3A6CH 3LEVH 5HY9B 3N9GH 4GRLB 5HJ3B 3SDDD 3MRLB 5IVZB 5I74C 1QSFD 1AKJB 1OTSD 3UTZA 2IPUG 1D5XA 4P48A 3KPQB 2C3GA 2VXQL 3QNYA 4M7KL 3QIWC 3QULB 3QJHA 2J6EA 3RWCB 4J1UA 1AP2A 4JFXB 2XV6B 2DIJA 4BK5A 1XF2B 1EVTC 2OK0H 5FKPB 4TUJB 1ZSDA 5D72L 1J0YA 5A2JH 4U3CA 3UTQB 1OOAA 4HLZH 4OGZA 3LEXA 3WD5L 5LGHL 5BMFL 4JPVL 3MJ9H 2IH1A 4HAGA 4LSSH 2W9DL 4XH2B 1HKLL 2B1HL 5IMMB 3BKJL 3MO1B 5CP3H 2XZCH 1PY9A 4OZFG 3TCXA 5CS7A 1NPUA 4LSPH 3TESA 1EAJA 5I1LB 1AY1H 2VRAA 1P6FA 5JXAL 5J6GA 3IFNH 4JQIH 4TUOB 2I24N 4QRTB 1INEL 4RMTA 4X7SH 5EBLA 3IFOA 1EJOH 1UEMA 3IVKB 5C6TH 2R2CA 3E2HB 3WHE1 5TGBB 1TETL 1F3DH 3NBNA 1S8DA 4XTRD 1YC8A 4GW1A 4PJIA 3UTTB 2PTTB 2BP3A 1FNGB 2BSED 4Q6IA 3WFHB 1AQKL 5HGHA 3TIDB 2ZUQC 2AQ2A 4FFVD 4MJIE 4F9LC 4NZRL 2UY6A 4QRUB 1KJMB 2JJSA 1GAFL 3PWUB 4PLOB 1NGZA 4XP9L 4ZUUB 3W0WA 5CSBA 4DKFH 1BQHG 3OKKB 3S3JA 5JIPA 4Y2DB 3VXPA 4DZBB 1KIQB 5J12C 5IHZA 4CJ0A 3D0LA 1A6AB 4D0CB 1Q72H 4U6TA 3MA9H 3B83A 5L2KB 5F7EH 3DUSB 4KKCD 1GOHA 3DXAB 1C08B 3O2DH 5DD6B 2H9GA 3C8KB 1U41A 2XWJA 3BIBX 1N5AA 1G7HA 3DV6B 5C8JB 5CEZL 2VLKA 1FSKC 3BZDA 3S35L 4OZIF 4WI8A 1LILA