2GIYA

Crystal structure of the c-terminal domain of the hsv-1 ge ectodomain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
179
structure length
179
Chain Sequence
b'HVRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPPPRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLDIEGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoprotein E
publication title Crystal Structure of the HSV-1 Fc Receptor Bound to Fc Reveals a Mechanism for Antibody Bipolar Bridging.
pubmed doi rcsb
source organism Human herpesvirus 1
molecule tags Viral protein
total genus 38
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2giyA00
4Q74A 3CNKA 1T80A 3HRZB 4G6FB 5I8OL 5FGCB 4XNXL 4F9PA 5FK9A 5EC2B 5C08E 3WMSA 1MNUH 1PY9A 4OF0A 5IT2H 1NSNL 3REVA 2WWMD 2YEZA 4RMSA 1C7SA 5CZXC 5DMKA 1GGBL 3RJDA 1N7ML 5DC4B 4HG4J 1DUZB 5E4EB 3E6HB 1P7KB 2FX7H 3ME0A 3HZYA 5EU7E 2CO7B 4MVBC 1TZHB 3N50A 3WDHA 5BRZA 4ALAL 4OGAD 4Y4FA 5DD3L 4C4KO 3S97C 3V0AC 1QBBA 1I7UB 1NCWL 1I7RB 3I50L 1JFQL 1NGZB 2R0LH 1A47A 5F9JA 5F6IB 3BQUB 4KQ3H 3PGCA 4CKVX 1G7HA 3W82A 3RTQD 4PD4J 5GS2D 3S37X 4BFIB 5C6TL 4UTBH 4MX7B 4EOWH 1S9XA 2O61A 3DRQA 3OPZH 1YNLH 3QZWB 1NLDL 4OGYL 2FCBA 5JPMB 2WINB 4ZDHA 1IT9L 1AQDA 3MUHL 2EEBA 2YRPA 3H9SD 1XGPA 2F5AH 3QDJD 3BESR 1XIWB 3L3GA 4NGHH 1H15A 1JGEA 4H88H 2OQJB 1G9NH 4K55A 1J10A 1UXSA 2BP3A 1IILE 2R0WL 4LCCC 1DEEB 1IBGL 5LXGL 4MD0B 5TE7L 4HWEL 4XHQA 1SJHA 1SJEA 3HPJB 3E6FB 5E8OB 4S1DC 5IW1B 1DBMH 3KPSB 2ATPA 3B2VL 4JPVL 5DLML 4LVNB 1QSFE 4PJ8B 1YNKH 3FN9A 4H8WL 3CK0H 3DUSB 4X5LA 3IFPB 3U36B 5IIEB 2R56L 3MRLA 4Y5YB 3CFCH 4L3AA 5DJAA 3BDBA 2G75A 4KI5E 2FWOB 4Y1AE 3G5XA 1N0LA 5DZNA 1LE9B 1RFDH 2R2HA 4CRPA 3ZDZE 5I9QC 5SWSD 3GSVB 3V5HB 1H3VA 4LSSH 1HNFA 5EUOF 4WUKL 3VFOA 4TSBH 2N7BA 4EIGB 4Y4KC 2FDBP 3BP5A 1N6UA 5C09B 4O2EA 1C1EL 4NQCB 4PJGE 2MWCA 3BPNC 1K2DB 1U6AH 4MXQC 5E8PA 1MCEA 1LDSA 5J0BA 4PGDA 1LE5A 1WGOA 1SMOA 4PRID 4QRQB 4IRJB 5I8KH 1FNGA 4XP1L 2M8XA 4TRPH 1QFUL 4H0GA 3SKNA 4KKCD 3GK8L 1F00I 3SE3C 1C5BL 3A6OA 2H2SC 3MBXL 4X4MA 3LD8C 1YNTB 3TBSA 1NDMA 1I8IA 1TXKA 3O41B 1VEOA 3ARYA 2NZIA 2Y06H 4KJWC 3L3OB 4O9HL 4QWWD 1RJLA 3B9KC 5EPMB 5T3XH 4PJDB 5IB5A 4YDVB 1BQSA 3VWKB 3HNSL 5K9QG 5ERWA 2BK8A 4NBYB 4WEBH 3TPUB 4XWGH 1KFAH 4NO0B 3JTSB 5KVGH 4OBSA 4OUUB 4QNPF 4X7SL 4E0RA 5EULV 3PQYD 3U1SL 5IGXL 4Q6IA 2BRRH 1IC5H 3QFJA 4F15C 3HB3D 1MVUA 1N2RA 1BVKA 5FKPB 3WKML 1K4DA 4XAKD 5GGRA 4JREC 2XY1A 4YE4H 3UXFA 1ED3B 3QJFB 2BC4A 3WIHH 3HTLX 1BD2E 2P4AB 3P30L 4LPYA 5CD3A 3C08L 2NYYD 1WEJH 1RZFH 2M1KA 4ZAKD 5F7DA 3DUUA 4MXVE 1JNHA 5H35B 2WANA 2P1YA 3N1MC 4IJ3C 1ZGLB 2RFXA 1F2QA 2NY1D 4FG6D 1I8LA 1IGCL 3TNNA 2PF6A 2Q76B 3QWOB 5GQBA 3I84A 4WI7A 5DYOA 4D3CH 1EBAA 2W0FB 3TA3A 2APXA 1S7UA 3MCKA 2MQCA 3V4VL 1LEGA 3IGAA 4KK9D 5E1HB 4G7YL 1LNUB 1TQBB 1UM5L 3RVUC 4JRYE 5KTEL 2CK0L 2G9HB 1IC7L 1D5BB 3FO2B 1Y0LA 3KPNB 4QRPD 3VDCA 43C9A 3HR5A 3CMOH 4JM2C 4U1MA 4I18C 3AREC 1DBAH 4OIBA 1LO0H 1EMTH 1T0MA 2VABA 2YPKB 4XCNA 1BX2A 2BVOB 3MRKA 5GGUB 1SEQH 1LK2B 3HMXL 1DUYB 2X1PA 3S96A 3ZYIA 5D2NC 4UIMA 1RULH 4P3CH 2ADFL 3QQ3B 4XCCH 3DTXA 1UFUA 1GGYA 3T4YB 2XKNB 1A0QL 3VDAA 1CK0H 4PJIE 3VU2A 3ARXA 1DSFL 3X3FH 3NN8A 1Z9LA 5GS0D 1X44A 2XZCL 5CWSA 4G6AD 1T1YA 5JXAH 2F54E 1OB1A 4ODWB 3HAEA 2FATL 3FTGA 5AAWA 2VQTA 2E27L 2I24N 2XPGA 4FQ1H 1N26A 3MCLH 4OLYL 1S8DB 4OZGF 1CU4L 2NZ9C 2CIKB 3KPRB 1KB9J 1EGJA 2Y4SA 2OM5A 5IW6B 4Z76A 1AQKL 1UA6L 3MFGB 3H42L 4J23A 3TT1H 3PWPD 4WW2B 4KAQH 4ODVL 4FA8A 5D1XD 3FAWA 1BP3B 5CSZB 2QQQA 1WK0A 5JLZB 4E42A 3PDOA 2PYEB 4Z8FH 1K3IA 1BFOA 1WBXA 3WFBL 2GJZA 3D69B 1KN4L 5J13B 3FO0H 2PTTA 2OXHA 3CAFA 3CVHA 4JFOB 3KPOA 1XGUA 4DAGL 3VFNB 2AJXH 2VLJB 3U30C 2V7HA 1BQHA 1LQSR 3L95B 3SJVD 2AABH 1J8HA 1AP2A 4QHUB 4KHXH 4LSTH 4KKBD 4EJ1C 4MSWB 1MPAH 4CADA 1UM6L 1QBLL 2QSVA 5C6PB 3RDTB 5F6HI 4ZXBD 1IRAY 3PWVA 5C08B 1L0XA 1Z5LB 5LGJB 2VKWA 3MLUL 4FQLL 4OQTA 1CICA 4UB0H 1V7ML 3FB6A 3U4EA 2BSRB 4UT9H 2LAGB 4G9FE 2FBJH 3TN0D 4JO1H 4WVRA 15C8H 5FM5O 4C4KT 3ZKMC 1DVFC 4QGYA 1UKSA 2B1HL 5E9DE 5A16B 3ILQC 2W60B 5TDNB 2FO1A 2FZ3A 5IOPB 4PTUB 5D7KD 2BOBA 4GRLA 5C0JA 4Y16C 3DO7A 2J12B 1M7DB 1MJ7H 1BOGA 1R3JB 2XQBH 5FYJD 2O5XL 1H3TA 5EU3A 4NZUH 4OZIA 2VLRD 4M6OL 4YHKL 4FQJL 2MQ3A 3W0WD 5JDSB 2I26N 5F8RC 5T1MA 2DBLH 1OP5H 5ALBL 5CEXB 4HW6A 1MCHA 4PBXA 4ZFZB 5FO9B 5HYQB 5ITFA 5F9WB 3W5NA 4KZDL 5EZOL 2XWJB 4TVSa 4WW1B 32C2B 1G6RL 2AJUL 1CLOL 1MCBA 2I25N 3QIBB 5F44A 2F58H 3B3IB 3BN9C 1A21A 2YBRB 3HAEG 3GSWB 3AS3A 1KCVH 1RUAL 1GIGL 1PZ5A 1M7IB 4R8WH 5T5FH 3TJEL 2WBJA 1FGNH 4OZGA 1F3JA 4MNQA 2NY4B 1QSFB 4IRSC 1T2QL 2HFGL 3PGFL 2CUIA 4I0PC 3B8YA 3FB5B 3CVIH 3CFEA 1YEDB 3WFEH 3W11C 2A6DB 2RIKA 1U8MB 3U48A 2APFA 1HXYA 2E6JA 4BFGA 35C8L 4Y1AB 3QFDB 2OZ4L 2X4OA 2Y7QB 3FFDB 2ZSWA 2VDKH 3DGGA 4JVUA 2J8HA 4KDVA 1MELA 5D6DA 5E7BA 5CSGA 1O0VA 4H26B 3KXFE 2VR4A 5C0CE 4LLVA 2XZQL 4F7CA 3P0VL 4D9LH 2YD3A 3NZ8A 4HZLB 3BGMA 1U2CA 3MODL 4KRPB 4LF3A 4NFDA 3UBXI 1J1OL 5T3XE 2QL1A 1U8JB 4XBEH 1MF2L 4KKAD 1BQHG 3LOWA 4TUKH 3UPRA 3KGRA 3DX6B 3IDGA 2DTSA 1RU9H 2FJFA 3HE6A 4FQIL 3LKQA 5ESAB 2UYLB 5FDYA 1P4IH 3RWGA 3Q6GH 5FYLD 3BKCL 4ZUTB 5GS1C 3O45B 1E4XI 5IM7A 1INQB 3JV4B 4FXGA 4L3ED 3K4ZA 4JFFD 5BO1L 5DEFA 5FHAH 2EDEA 4G8IB 4XBGA 3QI9A 1RHHB 1JK8B 3ZDYF 4GUPB 3TIDA 1FC1A 5C1MB 5E2WL 1JE6A 4Z7UE 1C5CH 3ILPB 4NRXB 5CJXC 3RHWF 4U0QB 2KZ1B 1G6RB 1NC2B 1RZGA 3C8HA 3GEWB 3VD5A 1U8KB 4KTDL 4AEEA 5BVPH 1E28B 1HYRC 4EIZC 2X4SA 1NH6A 4U7MA 1GZQA 1UM4L 5ISZA 3FFCA 1F6LL 1BLNB 2FH6A 2QQLH 4JZOB 3IJHA 2DQDH 3MRGA 5DMIL 3T77B 3BHBB 3N1GC 1KIPB 3I9GL 4LLMB 3I2CL 1BBDH 1NLBH 4WI9A 4FABL 3I3EA 2MSPA 4YHMH 1BD2B 1CGWA 2LVCA 2VL5B 4KUZL 2AKRA 1SEBB 1KJ3L 5LBSL 3MCG1 2Y36H 2BNQE 1FL6B 3ARGC 3FQWA 4YHYB 4C59B 4EVNA 2WBKA 1MCSA 1JCKA 4U1NB 3ZYZA 1OAKH 2EE2A 5B3JE 2R0KH 1R0AH 3OJ2C 1RVFH 1PX4A 3OJVC 3RBSA 1BAFH 1A02N 1GAFH 1YPZB 4KFZC 2CLVA 4QRTA 2E5EA 1CGXA 4M5YH 5HGDA 3WO4C 5BZDA 1IEAA 4O58L 5I76A 4X4YB 5B38B 4R26H 4JG1H 5DFVD 5HGBB 4ZPTB 3LRGA 3QUXD 1T89C 2GCYB 5IT2L 3ZMRA 1XF5A 1QZ1A 3LKOB 4P5MB 4JFHD 1V5JA 2AEIT 1IKFH 1AXSA 2D0GA 2XQYG 2YC1A 1VFMA 2CJUH 2PO6B 3GSNH 4CU6A 4GKNB 5IK3B 4UV7H 1JWUA 4OLZH 3HKFA 1WCBB 5IBTH 4R4ND 4P46A 5K9OA 1XZ0B 4WUUD 1ZAGA 2FX7L 1JNNH 1OSPH 4PJCF 5E1AA 1IAOB 4H1LG 1KJMB 3K7UA 1OAZH 1XF3A 2CLZA 4U0RB 3VXUA 1DCLA 4FFYH 2CKNA 1CN4A 4WU7A 3AM8C 4WTXA 5F88B 2QEJA 5BVJB 1LO5A 2R0LL 3G04B 1XCTB 4KQ3L 4NQSA 2EIZA 3JVGC 2V5MA 4N5UA 5SV4A 1UB6A 3PABA 4DN3H 2XIDA 1T0NA 2F54B 1GHFH 1X6NA 2OMNA 4UTBL 5JXEA 4I2XE 5F7KC 4JGJA 3OPZL 1YNLL 4EI6A 4F58L 2R39A 5CEYA 3UAJD 1ITBB 1GH7A 3U9PH 5DJ6A 4WI8A 5I1DA 4QYOA 3LDBC 2NY2C 2Z35B 4LSUH 4BSVB 3V5KA 2HYMA 4WFHE 1V7NH 4ZUWB 1U8PA 5FA3B 1G9NL 3RY6C 3VW3H 1N5AB 4PJBA 4YUEH 4ZMAT 4XTRD 2DQGH 4K94C 2ZOLB 1DBML 1AR2A 2BSTB 5EZIL 2JIXA 2EYSB 1GL4B 3CK0L 1L9NA 1NGYA 3HG1A 1TVBA 3D39E 3BKMH 3NCBB 3G6JE 3NZHH 1MRFH 4MHHG 3CFCL 4L29A 1OQXA 1QHPA 1TLKA 5ICXB 3SDCD 1F3RB 4R0LA 1VA9A 3WS6C 6FABH 5JW4N 1A7RH 2IAMB 1I3UA 4P57A 1RFDL 4HD9A 4WHCA 3IJYA 3EFDH 3MA7B 2K1MA 3OKMA 5DDHB 3HI1A 1FFRA 1R3HB 2XWBB 4TSBL 4W4OC 4HXBH 1DBJH 4IMKC 3GI8L 4LVOB 1S7TB 3QCTH 4MB4A 3W9DA 1KIQB 4F2MA 4JFPA 2FL5B 4KU1A 4G43B 1ZA3B 5I8KL 2QKIB 2N1KA 3H3PH 1R5IA 3NBNA 5MI0C 4OIAA 2XG5A 3KDMA 1FVCB 2FX8H 5IJVA 2V2WB 1JZ7A 2C26A 5KAQG 4U1IB 1NMCC 1Q9LB 5BRZD 3GIVA 1G7MA 1M7XA 1VACB 4Y4FD 3DVNA 3TBWA 2DI9A 2QSCH 4WIQA 1T6VN 2Y06L 5IQ9B 4AEIL 3OKOB 4LSRH 2X09A 5T3XL 1N59A 1DQDH 4CVZB 4M93C 4XWGL 1KFAL 4PRDB 2FIRT 3MYZA 4WDIB 1TCRA 3CC5B 3ES6A 3MRCA 2EO1A 4NJ9H 2VLLB 1EEZB 2UZIH 4HKBA 4ESKA 2GKIA 4JM4H 2H8PA 3MRQA 2BRRL 1IC5L 2EDOA 3BRFA 2Z91B 1U9KA 2RGSA 2R8SH 4WY7L 4X9FA 2PKDA 2RB8A 3C5JA 5IFJB 5IEKA 2FJHB 4I3RL 4RMWA 1ORQB 4D0BA 3E2HB 5TF1H 1WEJL 2J4WL 3ZYOA 1RUKL 5IVXA 3BZEA 1ZLSL 2WQ8A 3QUZA 5D2NE 1VGEH 2VKXA 3K8LA 3EYQC 4BELD 3MRIB 4YFDB 5AZ2L 3CDGB 5IMMA 4A2LA 4GW4A 1U95B 2X6MA 4OFPA 1AIFA 2VSCA 3N1PC 2W65B 2CDEA 4Z0XB 4D3CL 5MEPB 3C6LA 3RWIA 5A2IH 3CLFH 2OXGA 4OCRH 1OAUL 5DMJB 2PETA 5E2UH 5TDOA 4CVXA 1X5IA 3MV9B 3FCTA 1BVZA 1R5VA 3OR7A 4O2CA 2VN4A 4TSAH 1F6AB 1TVHB 1FSKB 4JFZH 3KXFB 5C0CB 1SYVA 4R7DB 1L0YA 4HT1H 3EGSA 1DBAL 4Y4HB 1DEDA 1LO0L 3KR3H 1EMTL 2Y6SC 4YIQA 3BGFC 1SEQL 1PGRB 3OKLA 4HH8A 4OFDA 1QFWI 2GY7B 3E1F1 5IBLC 3HNVL 3OR6A 4P3CL 5CILH 1DQJB 5GRWA 4XCCL 5JOFA 3OHXA 2FO4A 2KUTA 3LN9A 3T2PA 5EB9A 1TQCB 5IHUH 1W72L 2EO9A 4MAYC 5GRVL 3X3FL 3C09C 2Z4QB 4MQSB 1FDLH 3KLAB 5CGMA 3V8CA 3V6OA 1YMMA 1GZPB 2FJGA 4X7DC 4LKXB 5JXAL 1SVZA 4B5EA 3DVFA 4GFTB 3T0EB 2AJZA 4OF7A 5MERA 1X6LA 2P7TA 4K94H 2R23B 3VCLA 3MCLL 1WIPA 2OTUB 2IPKB 4K7PX 4FTVE 3DGCR 3GMPA 3BIBX 4OM1L 5JIHA 3QFJD 1EHXA 4JLRB 4KC3B 1XH3A 3QO1B 4YFLF 3REWA 3KYOA 5LQBL 5D1QC 1AO7E 3TT1L 4P2RA 2ADGB 5JHDA 3HZKB 4N0CD 1FFPB 4URTB 1FFOB 2NXYD 3MLZH 1Q9OB 1JGUH 3QH3B 4Z8FL 4LAQH 4CN1A 5HI5C 2P49B 4L1DA 2AK4B 2BNQB 4YHOH 3L3DB 1S7WB 3FO0L 4NYLA 5E94B 4EN3A 1U8OA 5SWZE 1CR9L 1S7VA 2XWTB 3TA3D 1U8HB 5CJBA 1HSAA 3P0GB 4J4PA 1F90H 1WBYA 2DM7A 3GMMA 4YQXH 2V6HA 5ICYB 4MQ7A 2AABL 2D3VA 5DS8B 4KHXL 4BQ6A 5BS0E 4LSTL 3NABH 5L8KB 3ET9F 5DQ9A 5CBAB 3VXSE 1K5NB 1MPAL 2VSDA 3MUGB 2P8LA 3FN0H 3HC3H 4JHAH 4KMQA 5CEZD 2AS5M 4ZO6A 4OZHF 3CSYB 2ICWB 2XZZA 4PLNC 5IB4A 5E24E 4MNGA 1WLHA 1W72B 2VXTH 4Z0BH 2FBJL 4JO1L 3OKYA 4G8FA 1F58H 15C8L 3HI6H 3VGAB 4XRCA 3TVMA 3UJTL 3WFCH 5A43C 4TVPH 3U83A 5HPOA 1EHAA 2OMBA 1UJ3A 1VADB 1ZHNB 3SQBA 4LCYA 1T4KA 3IXAB 1UWXH 1FO0A 3G9VA 1XEDA 1FZKB 3JUZA 5DRWA 2V2TA 3CZFA 3LY6A 1MQKH 4UAOB 3STZA 2XQBL 3SPVA 2HLFC 2EKSB 3KYNB 3Q0HA 1ZSDB 4KROD 1ZT1B 5DJ2A 4NZUL 1W0VB 3SKOB 1Z9MA 3B9VA 4KQ4H 3BPCA 2A74A 1FBIH 1NFDF 4I2XB 1QEWA 2V5RA 4XX1G 2DBLL 5I9QB 1AR1D 2X1WL 1A6WL 1GC1L 1FG9C 4P0DA 3QQ9C 4OGXH 1CFNB 4PJHF 4AQOA 3Q2CA 4GKZB 1P1ZA 2HG5A 2F58L 2Z8SA 4D0CB 3N85H 4KH2A 5ETUB 1B0GA 2YWYA 3PL6C 1N0XH 2VUYA 1KCVL 3D0LA 4KV5E 1WICA 4R8WL 1RPQA 5T5FL 5FYJU 1OGAE 4D0DA 1FGNL 5I73C 1BF8A 3OB0K 4K9EC 4LLWB 4XP4H 1SY6A 5CD5D 3CVIL 3VJ6A 3G6JB 1A9BA 4MMZC 3WFEL 3LD8B 4NM4H 5F6HJ 1U8IA 4P3DA 4P5TA 3SDAA 2AJ3A 1J8HD 4LSQL 4X9HA 3T2QA 4MNHA 2NR6D 5GSRB 5J6HB 2EH7H 2PW1A 2WP3O 4LKCA 1BF2A 3G5ZB 3QG6B 1CI5A 4LLDB 2P5EA 4NJAH 2BHZA 3HZMB 2J2ZA 5IMOA 1CICD 1MH5B 4ZUSB 2R4RH 2W38A 3BEWA 5ITBH 5E2TH 1Y18A 2E7MA 2P8MA 4ZSOE 3WLWC 3ZE0E 4AK1A 3H7BA 4TUKL 2A38A 4L8BA 2RJMA 5CINH 2P48B 4KHTH 5DHVA 2D7TH 1RU9L 1NUNB 4MDJA 3AROA 2D2OA 2Y72A 4GLRH 1ZWIA 5F1SA 4P4KB 4IJ3B 4Y0GA 5KVFL 1CL7H 4OV5B 1YDPA 3DROA 1MY7A 1T2XA 3CD4A 4X6EB 4MJ5B 3I6KA 1L9MA 1BJ8A 1C5CL 3C60C 1FL5A 3DO3A 3MLPA 2CH8A 4J6RH 1JZ2A 2VC2L 1J0KA 3O4OC 3TO4B 1XF2A 1UCTA 4NRZB 2OJZH 4CVWA 2MKWA 3IRPX 5BVPL 3EDJA 3VRIB 4JDZA 1UZ6F 2QQLL 5EO1A 2RQ8A 4ZOBA 5DJCA 2DQDL 4HUMB 1T5WA 4XVUD 5B22A 4X8XA 3O6FC 5KSAA 2IADB 1BBDL 4I18B 5AG9A 3AREB 4FS0A 4YHML 2ZOKB 4UNVA 1MCOL 4OKVA 2XN9A 3L7FA 2NX5E 2Y36L 2WBJD 3MREB 5JORB 2YXMA 4MNQD 5D2NB 3S3PA 2FGZA 1MCRA 1OAKL 1FYHB 1ZS8B 2R0KL 5EUKB 1FORL 3ABZA 4MS8C 5I30H 1R0AL 1RVFL 1T1ZA 1ADQH 4YGAB 5D1ZA 4N9OB 3SDDA 4XP5H 1BAFL 5E99H 1GAFL 3HHRB 3HRZA 1CGVA 1WBZB 4M5YL 2DIAA 2QSQA 5L7XH 1ZLUK 4PJDF 4CUCA 3K46A 5HI4C 4R26L 2X1QA 3NIGF 4JG1L 3MBEC 2OCFD 4DOHE 4WJ5B 1BJ1J 2C3GA 3UYPA 5DO2D 1DUZA 3IAGC 7FABL 3HPLB 4AZ8A 5AD0B 1IGJB 1IKFL 1JF1B 3E6HA 1BOYA 1P7KA 4G42B 4J3WA 1IZKA 2CJUL 3GSNL 4PJXE 3AMLA 4UV7L 4OLZL 1S7XB 1TZHA 2IBZY 4PG2A 5IBTL 3NA9H 3S3JA 3DVGB 3VMOA 2CIIB 1DJSA 3HE6D 1OSPL 1QHOA 1I7UA 1OAZL 1I7RA 1NGZA 2L4OA 2YZ8A 3BQUA 4JHBA 2EIEA 4Z7OE 1X5JA 3X12B 1ZK9A 4WFEE 5CIPB 2X9WA 3QI9D 3FZUC 4BFIA 4Y7MA 4UUJB 4LSVH 4MX7A 5IFAH 3S5LB 4XWOD 4RAUB 2VRAA 4DN3L 1TETH 2Q6WB 2PTUA 5JPMA 2HRPL 2WINA 1GHFL 2IGFH 4J3OC 3ZZ1A 4MJ2A 4M6NH 2NY3D 3EOTL 1OAYH 2EZ0D 3IJSB 4HC1A 3IKCB 3U9PL 3UTTA 1MAKA 1XIWA 4FTVB 3SGEI 5ISZD 3WJLC 4K9EH 5JMRA 3FFCD 3LPFA 2OQJA 5FAAA 4U6YB 4MD0A 2EH8H 1V7NL 3IS0X 1EDQA 4XMLL 1EEUA 3HPJA 4OCYH 3E6FA 2VDML 5E8OA 2YD8A 5IW1A 3KPSA 1CGYA 1AO7B 2A6IB 4HBQA 4HK0B 3VW3L 2DQGL 3T0WA 1T66C 3IFPA 4JR9H 3U36A 3AS2A 3VXTB 5IIEA 4Y5YA 3T65B 3EYSL 4BQ9A 1D5IH 3ULSB 4CDGC 5J11C 3DYMA 2FWOA 3ULVC 3BKML 4K8RC 3NZHL 1BHGA 1GGCH 2Z92B 4KJPC 3PIQB 3MRFB 1DVFB 3QUYC 4JY5H 1LE9A 1JGDB 2J88H 5SWZB 5C0FB 1RZ8B 1IGFH 3IDYC 3GSVA 1RZKC 1A7RL 3M1BB 4Y16B 3V5HA 1MRDH 1DE4B 2CXGA 5I1HH 4WO4C 1I1FB 3GUTB 1I7ZB 5C09A 1N5YH 3GSNB 2HFEB 4HUVB 2A1WH 4YK4C 3GRWH 5C0EA 4NQCA 2WIMA 1K2DA 4X8JB 4HXBL 4DKDC 5BS0B 4OLEA 1J05B 1DBJL 4LU5L 1IKNC 1EK3A 4TVPE 5J8OA 1T0PB 2ARJQ 3MR9B 1PSKL 3CX2A 4IRJA 4QRQA 3UJJH 3O6ML 4CNIB 1TFHA 3WNLA 4PV8B 3MNWB 1XT5A 1XGTB 4C56B 4LGSB 4P46D 3H3PL 4F9LC 4JY6B 6CGTA 4XZUB 1YNTA 5CGYD 3O41A 2FX8L 3L3OA 1WISA 3VXUD 2GTZA 3L3HB 2CMRH 5EPMA 4PJDA 4YDVA 3K8KA 3VWKA 5IEHB 2BXYA 1WVZA 2QSCL 4IOFC 5T1KB 1WWWX 4LSRL 3TPUA 1W8NA 4NO0A 4NPYB 3FQXB 5DC9B 4Z18A 5T33H 4JFEE 4PJFE 5HDBF 3RA7L 3JTSA 4RBPH 1DQDL 5JZ7C 1U3HB 5EBLB 2DAVA 1JHLH 1G7IB 4OUUA 1DANU 3KS0J 5JXED 1PZUB 1YY9D 2W9EH 2YA1A 4HF5H 5C92A 4AENB 4QHMB 3OJMB 4JM4L 5JIIA 3RJQB 4WFFE 1ED3A 3QJFA 4X6FB 1F8TH 4RIRB 4ZUUB 3MFFB 4WEUD 3H2WA 2R8SL 1RMFH 5IR1B 2X4PB 1X4YA 3EO9H 1NCUA 1QLFB 5H35A 1VFBB 3RWEB 1ZGLA 5CJ8A 5DQJB 4V1DE 1QO3A 2XKUA 5KVMC 2JIXD 1P5VA 2Q76A 3QWOA 3HG1D 5J89A 1FPTH 2CRMA 1QPPA 1PBYA 3AAZB 2W0FA 3TNMB 4QTHB 1OGAB 3L1OH 2ENYA 1T03H 4QXGH 4YWGH 3MJ9H 1LNUA 5HHOE 1TNMA 3RTQC 1N6QL 5KOVC 1H3WM 2WP3T 3WN5C 4TNWK 5GRVK 1BBJA 3CXHK 3R1GH 3CLFL 5HHPB 4P2QE 4OCRL 2G9HA 1BZ7A 1D5BA 3FO2A 5E2UL 3KPNA 1NL0H 3UDWA 3C2AH 5CZKA 2DLGA 1XGRB 3AB0B 2VZ3A 2YPKA 5ADOH 1JMXA 4JRXE 4TSAL 2BVOA 4U2ZA 5GGUA 5TFSH 1LK2A 1DUYA 4HT1L 1JTOA 1YEKH 2OR9H 3LS5H 4JKMA 2A83B 1KPVB 1T1XB 1KULA 2DD8H 3QQ3A 4RFNC 3DX8B 1BIIB 3T4YA 4ZSOB 2XKNA 1WT5A 4GKOA 3RKDD 5CILL 4N5EC 4KWUA 3J8F7 3QEGH 5IHUL 2EECA 4Z7WF 5BV7C 4ODWA 3LKPB 1AD0B 3ARGB 1FDLL 3H9ZA 3GBMH 3QDGE 3VFWB 1S8DA 4DFIA 2CIKA 3KPRA 4WWKB 2L7JA 2WWKO 5I1CH 3WFHB 5IW6A 2ZSVB 2DDQH 4YDIH 4CJ1A 4H25B 4BYHA 1CS6A 3ULVH 4K8RH 1YC7A 2ESVB 3VXRE 1RY7B 4WW2A 3S98A 4X4XB 5BXFB 1Y6KR 4OIIH 2UVFA 3VI4E 5CSZA 5E6YA 5ID0B 5JLZA 3RZCB 1RZKH 4F7PB 4IOSD 3EO0A 1R3LB 1HE7A 2DIJA 4JVWA 3OL2A 1JVKA 3QUZD 4HKXB 4ELME 3MLZL 3UTPD 3RUGF 3D69A 2GJJA 3BPLC 1JGUL 3GGWB 3CFBB 4JFOA 4WGVB 1RK0B 4LAQL 2NX5B 4YHOL 4AMKH 3L5JA 3SE8H 3ZDXE 2VLJA 1INEH 2Z8VC 3FQTB 5IBUB 3L95A 3QHTC 3C6LD 4JN1H 1DN0B 4QHUA 1Z9SA 5C3LD 1F90L 2GFBB 2FEEL 3VFUB 4YQXL 4MSWA 1NFKA 3JUYA 1TZIB 2X7LB 5C0AE 3RDTA 3DI3B 3NABL 5CUSL 5DRXB 5C08A 1Z5LA 4LCWE 3KLSA 5LGJA 3L5IA 1NAMH 3FN0L 1DQMH 1F13A 3HC3L 2R9HD 2BSRA 1J5OH 2W91A 5BW7C 4HWZB 1PQZB 3MRMB 1WFNA 3UJIL 2N4IA 4EUPB 2NYYC 2X1XR 5C0BE 3U9UB 1NFIB 1OP5K 1R3IH 2E7LA 2VXTL 3LB6D 3LDBB 4HJJL 2NY2B 2VH5H 5A16A 2W60A 5TDNA 3HI6L 4GAJH 5IOPA 1TPXB 4J3SA 3U82B 2NY1C 4PTUA 3KHOA 4PJ5E 3MROB 4JZNB 3QAZC 5EO0B 4WHYH 5MHSE 1AH1A 4UT7H 2P5WE 1R3JA 3CGTA 4LDEB 3D87B 3MRPA 2BY2A 3DJ9A 4Q6YA 1YMMD 5DF0A 4HLZH 3VWJC 1MJUL 3O8XB 4TSCH 4DGYH 1CWVA 3KWWB 3ZKQD 3VGGA 3U7WH 2JJUA 3WUWB 5JDSA 1QRKA 4KQ4L 4NQEE 5CEXA 4ZFZA 5FO9A 5HYQA 3OXRB 2XWJA 5D71H 4UI2A 5LKNA 32C2A 4XCEB 2FR4B 3QIBA 1YPZF 4U6VH 3B3IA 4OGXL 4QRRD 3M07A 2YBRA 4NN5C 3GSWA 4P2RD 2F8XC 5HHMD 4M4PA 4KVCL 4B50A 2Z93B 5JPNB 1M7IA 1YEEL 1ZLVK 3N85L 5AYQA 5DD6B 2MCPL 1CDBA 3RVXD 1QSFA 1JRHI 1N8ZB 2QBWA 3FB5A 4QHLB 3BWAB 1YEDA 5GS0C 1XR8B 2A6DA 5MI0B 1OTTC 1U8MA 5MEOB 4J3VA 4XP4L 3QFDA 1MHPL 4HDIB 2Y7QA 4NM4L 4EI5B 4NWTH 3FFDA 1WCQA 1AHWA 5J6GB 1BQLL 4H26A 4HQQH 2DMBA 2EH7L 2VDPL 2IG2H 1EUTA 3H3KA 5IP4A 4MDIB 1WFTA 2VAJA 4AT6B 4RWHA 4M61B 2H45A 5IG7B 4PY7B 5BV7H 1JPTH 1U8JA 4PJ7E 2EXWD 4XMPL 5D1XC 3RZWA 5ITBL 2R4RL 3DX6A 5E2TL 1P4BH 4UOW1 1OM3H 2UUDH 1RZIB 5ESAA 2UYLA 4ZFOL 5TE4H 3TVMD 4ZUTA 3QRFM 3O45A 5CINL 2R0ZH 4DVRL 2FHCA 2OLDA 1INQA 3CLEH 3JV4A 4PBWD 3EUUA 5HXMA 4Z77B 4G8IA 1U93B 4RSVA 1RHHA 1JK8A 3BUTA 2ICES 4GUPA 3SE4C 3WNPA 1CL7L 3ILPA 4NRXA 1I3GH 3S9DB 4I3SH 4M3JA 3P4OB 4L4TE 1G6RA 2HP4A 4PB0H 1NC2A 3MJ7B 1AJ7H 3OGCB 4NSKB 4PJFB 3EKCA 3GSQB 1U8KA 4KKBC 4JE4B 3MJ8B 4XGZB 5GGTH 4J6RL 1E28A 1KC5H 1ZKAA 4HUWB 2A73B 4XCFL 1P53A 4Q0XH 4NBXB 2D7PA 2AJSH 2DKUA 1BLNA 4JGMA 4ZXBC 2OJZL 4JZOA 5LWYH 2E7CA 3MZTA 1JI2A 4QT5B 3BHBA 1KIPA 4LLMA 1Q0XH 4HIJB 1S9WB 4HG4K 1CYGA 3TN0C 2VL5A 1OTSD 1SEBA 1ZLWH 1EHNA 4NUJB 4ACPA 1FL6A 4ORGA 1NGWB 5T3ZH 2W1NA 3T2NH 3I3DA 4U1NA 2OZ4A 5MENE 4YFEA 1NBZB 2ZZUT 3BGFB 3IDIB 4V1DB 2OK0H 5I1IH 1AY1H 2OX5A 4PGEA 1GRWA 5F7HA 2EDWA 2G60L 2OSLB 4ZNCD 1S78D 1YPZA 2XZAL 4HXAH 2IAND 5I30L 4PRHE 3UO1L 4LARH 4P5TD 1ADQL 3SDAD 2F19H 4MAYB 2GEEA 3ISWA 4L5FH 4X4YA 2EDJA 5SX5H 5B38A 1EHLH 5HGBA 4ZPTA 1QYGH 4P2QB 2GCYA 3BDYH 5DR5H 4I1NB 3X13B 2WQRA 5L7XL 3C8DA 3VG0L 1C12B 1KEGH 1I3VA 1CF8H 2Q86B 3LKOA 4P5MA 4ZFOB 4F7TB 4HWBH 5L0QC 5JNYB 5E5MB 2PO6A 4GT7A 1DQTA 1GGUA 4GKNA 4N9GB 5IK3A 1JMZA 4JRXB 4RZCB 4X6BB 1WCBA 5HY9B 5CMAA 4LHUB 1IAOA 1T7ZA 1KJMA 4RNRB 2MQ0A 2Y5TB 5KZCB 2XV6B 5D1QB 2IFGA 3FONB 1IGYA 5BVJA 3G04A 1TVDA 1D6EB 1XCTA 4HKZB 1U8QB 5KSBE 5FECB 3ULVE 2WWKT 3VGFA 1UADC 2F54A 5TJWK 4TPRH 1YEJH 4X6CF 4LSVL 4G8EB 1QOKA 2J5LC 3QDGB 5D7LB 2IGFL 3EW3B 2X2YA 1B88A 4M6NL 3Q48A 2VN7A 2Z35A 4S11A 4BSVA 2OL3H 1I1YB 4ZUWA 5GS0H 1V3KA 4K9EL 1GXEA 3PHQB 1CFQB 5FA3A 1B0WA 4KZEH 1N5AA 2EH8L 3VXRB 5ACZA 4KKAC 4DVBB 5KSAD 2ZOLA 1ONQB 4OCYL 3MV7E 4BSWB 5CCKH 3UC0H 2BSTA 1KG0A 3H0TB 3O3DB 2J8UF 3IF1B 5GGSY 2EYSA 5F7NC 5IFHH 2XN9D 4JR9L 1IGIH 2HJKB 1UENA 4ODSH 5EFIB 1QPXA 2YZ1A 1D5MB 5ICXA 4OCXL 5L2KB 1D5IL 4BFBD 4KUCD 1NAKH 2VWEC 3O2VL 2IAMA 3NTCH 5BZWB 1TJGH 4MD5B 4JY5L 2J88L 1IGMH 5D1ZD 3SDDD 5TH2B 2YK1H 3Q1SH 1IGFL 1FNEB 3MNZB 5E03A 4G6FD 3MA7A 5E00B 1JZ5A 3JWOC 5DDHA 4X9GA 1MRDL 3OV6A 1R3HA 2XWBA 1J9CT 1N5YL 3MA9L 1S7TA 3GRWL 2X4QB 2DKMA 2QADC 5C0AB 3QHZH 1KIQA 1VPOL 2FL5A 4G43A 4A6YH 1KCRH 4DKEH 3EAKA 3HC4H 3UJJL 2QKIA 4Q9QH 1FVCA 2IQAB 2R2CA 2GTWB 4U1IA 1Q9LA 3HLAB 4FMFA 1CFSB 5B38G 2WAHA 1T5XB 3DV6B 2FD6H 5IQ9A 3OKOA 2DBJA 3D85B 4IDJH 3BQUD 3KS0H 1R6VA 2CMRL 4PJ5B 4GXVH 1RUQH 4GAFB 3PL6B 3UROR 4CVZA 5K9KB 3FT4B 4U1JB 2P5WB 3HC0B 5T33L 2UWEF 4YHPB 5INDB 5AUMB 5J1AB 4WDIA 3U2SB 1A9EB 3CC5A 1MLBB 3AU1B 1JHLL 2LE9A 1I1AC 1EEZA 3NCEB 4BM7A 2R2EB 1FLTX 1EJOL 4FQCH 2Z91A 3MLSL 2F8OA 2MPAH 2BVEA 5B4MD 1XIWD 3L3KB 3EO1B 4NQEB 2YD2A 5IFJA 3BH9B 2FJHA 5FYJH 1ORQA 5KANI 1R3KA 1RMFL 3EO9L 3KPSD 4ZOAA 4PJ8D 2ICWI 2KZWA 3MRIA 3CDGA 3DSFH 1UEYA 2PYFB 3HA0A 1U95A 2AQ3A 2J1KA 2ZJSL 5EZLB 1KB5A 2W65A 4Z0XA 1FPTL 5F96H 3P4LA 5MEPA 3TBYB 1IC1A 4TNWF 4NNYB 4U33A 3L1OL 1T03L 1KT2B 4YWGL 3MJ9L 2ERJC 4HFUH 2ATKB 2B39A 3MV9A 3R1GL 3FRUB 3OWEA 5CJQL 1EO5A 3ARPA 5DJXB 5C09D 1KB9K 1F6AA 4NQCD 5J12C 1TVHA 3KXFA 5C0CA 3EBAA 4R7DA 1ZA6B 2AXFB 1I1RA 3GKWH 5ADOL 3LKSB 1U3JA 4IRJD 5ANMB 4B7LA 1YEKL 5C9JB 1YEGH 4JVPA 4XXCA 3IKKA 4RMRA 4PJ7B 4PRIE 1DQJA 2DD8L 5K59E 2JCCE 4ODUB 1CDJA 4K3DL 1MRCH 5K93A 3V8OA 5FUOH 1NMAH 2Z4QA 1A2YB 1CFBA 3QEGL 3VWKD 3KLAA 1LWRA 2W0KA 3VDBA 3CZJA 1GZPA 1P9MA 2YD5A 3O81A 4NO0D 4W6YB 4L3CB 5KW9L 3ULUC 3LHPH 5DK3A 3BXNB 4MA7H 3T0EA 3CJJA 3ARDC 2R23A 3GBML 3PWJB 5AZEL 2OTUA 4MA1C 2IPKA 4JKPH 5TQ0L 1LEKB 2C4XA 4MCZB 1X4XA 2BOCB 3QPQD 5C07E 4JLRA 5I1CL 3RBGA 2CDGB 1NMBL 3PQYE 4F57L 3QO1A 4WGWB 2DWDB 2QQNH 4GJTB 3QDMB 5T3ZE 1CDIA 2DDQL 4TNVK 2DJUA 4YDIL 1A7PH 2CDFB 3HZVA 3ULVL 4DUWA 5HHVL 4K8RL 2ADGA 3HZKA 5AYUH 2XTJB 3FKUS 1KF9B 1HI6B 4KK5D 4N8PA 1FFPA 4R90H 4OIIL 1FFOA 2QHRH 3AY4A 1Q9OA 3LAFA 1PVHA 4KI1A 2VE6B 3QH3A 1PG7X 3JWOH 4JFDB 2ADJB 1ZTXH 2AK4A 2BNQA 2J6EH 3B2UD 3L3DA 1S7WA 5E94A 4JO4L 4LHQB 3S36H 5MENB 2XWTA 3CFKB 1U8HA 4AMKL 3ZE1E 3SE8L 3O4LE 5KS9B 2LAAA 3L5XH 4AH2B 4RDQG 4JN1L 5ICYA 1HZHH 3ZSTA 5DRNB 2J3SA 3TESA 4AIOA 1UWXK 1RIVL 4JHWH 3DPBA 4PRHB 5CBAA 3K1DA 2D03H 3MUGA 1VEMA 3PDDA 1VB9A 3FT2B 2XY2A 1LO3H 2XI9A 2IC2A 2ICWA 3CSYA 4M00A 1LK3H 4HX1A 2VLMD 5J7CC 4QOKB 2LQRA 3T3PF 1W72A 1BEYH 2HT2D 3RVTC 3CSPA 1G9EA 2PUQT 4J3XA 2I9LB 4NZRH 1R3IL 4GG6F 2CR3A 1FVEB 2X9YA 2VZTA 3VFMB 3E8UH 3BX7C 4Q9CA 2FNBA 4HWNA 1VADA 2ZUXA 1L7TH 4GW5A 3MRDB 3SEPA 1QBMH 3BKYL 3IXAA 1KTLB 1FFNB 1ZVSB 2CPCA 2IPTL 2X1OA 4HAGA 1JPFB 3WKNA 1FZKA 4NC1C 4ODBD 1I4FB 1KLUB 2M2DA 4MQTB 4UT7L 5GRUH 4BH7B 4FQXC 2EKSA 1YN7B 4YHIB 3KYNA 5DD0L 1ZSDA 4FZEH 1ZT1A 2W0PA 3Q3GB 1W0VA 3MRHB 3SKOA 5J11B 5IWLC 1EZVX 2BNRE 4DGYL 3SDXE 3V0WL 3KPRD 3U7WL 4I2XA 1W0WB 2G5BB 1NCBH 1KXVC 3IDYB 5I15H 1RIUL 3LPGA 4KRLB 3UX9B 1DLHB 4ZG1A 5D71L 1FCGA 2QV2A 1I9IH 3BAEH 3L5HA 4DKFL 4GKZA 4U6VL 4D0CA 4Q58C 3PWPE 5ETUA 3QB7C 2EDNA 4ZO7A 2PYED 3R0MA 4XBPB 3KG5A 2BVQB 4WI3A 5I16B 4OLVH 4V2BA 4LLWA 2B5IC 8FABB 3K3QA 4ORZC 4CU8A 3SE3A 5GGVY 1BVLB 3G6JA 2VLJD 3OQ3B 5I66B 3IYLW 1WSST 1H8SA 5IKCB 2Y9RT 3R06B 5J6HA 4NWTL 3IFOB 1GCFA 3G5ZA 4Z7VE 3SJVE 2HTLD 4HHAB 4XCYA 3RDTD 4HQQL 5JDJA 3I6GB 5C08D 2IG2L 3HZMA 4YXLL 5FUZH 5HD8D 1MH5A 4ZUSA 2DQEH 3MLWL 1D9KC 3ULUH 1F97A 1FL3B 2Q87A 1CE1L 1JPTL 4N0CC 5I19L 1HNGA 3VD9A 2CKBH 1P4BL 4OD3H 4B41A 3FB7B 1OAXL 4HMEA 2ZUVA 4GG8B 5TE4L 1I8LC 3ZL4H 3OJDB 5M94B 2R0ZL 5DEZA 2BDNH 4POZC 3CLEL 4P4KA 4OV5A 3EJZD 2CR6A 4NQDB 5E8DH 1KACB 3TA3C 4X6EA 4MJ5A 5EOCJ 5GSVB 1XFPA 1E4KC 1G0DA 4TN9A 3ZE2F 4I3SL 5FYJE 1C08B 5I8EB 4PB0L 5GHWH 4PR5B 4NZTH 5C0NC 3TO4A 4NRZA 4UTAH 3CFIC 1U42A 5GGTL 3INUH 1I8MB 1G7PB 3VRIA 5HYIA 3W0WE 3K8MA 1NUGA 4WFGE 3V7MA 2AJSL 5LWYL 3QIBD 1TTFA 4LLUB 1FQ9C 2IADA 5HDOA 3WXWH 3AREA 4DEPB 4AM0B 2ZOKA 2HJLB 3NFSH 4M6MH 5FGRA 2F9BT 4XPBH 1JGLL 3MREA 3P0YL 4DQOH 5D2NA 2Z8RA 5D7SH 3THMH 3NACH 1QSFD 2NY4D 1P4LB 4M5ZL 5T3ZL 3T2NL 1EX0A 5LAXB 1HN1A 4RFNB 5F3BB 2OK0L 1ZS8A 1CXEA 4PLKC 5EUKA 1KNOB 5I1IL 1AY1L 4PBVC 4WHTB 2GJ6B 3PWLB 4ZD3H 1HCFX 3ARZA 4Y1AD 1Y6MR 3QHFH 4U1KA 1U3ZA 4KROC 2WMPA 4NC2B 3IU4H 1MHCB 4LARL 2CGRH 1WBZA 3O2DA 1YY8B 1CD0A 2F19L 4WHDA 3VD3A 4L5FL 4NM8H 4I48B 5EBGA 2YMXH 4D9QD 4JO3H 1EHLL 4R7NB 4HJ0D 1QYGL 1E4XL 4WJ5A 3I6LD 4HKJB 4YNYB 3BDYL 5DR5L 1H3XA 5BCAA 3KYAA 4KRPD 1KEGL 4E41B 3KJ4B 3HPLA 4HWBL 5F89B 5AD0A 1IGJA 1JF1A 4G42A 5SWSA 4JZJB 3U4BH 1GJIA 3BZ4B 1G6VK 2YHGA 3GSUB 1S7XA 3NIFE 3DVGA 2CIIA 4NWUH 3LIZL 2VZSA 3WJJA 1WFOA 3DHMA 4NC0B 1CG9B 3NVQA 3I02B 3UTOA 4ZO9A 2JCCB 2EDHA 1IZJA 2HN7B 3X12A 5CIPA 4OF5A 4HWUA 4UUJA 2IALB 3BPLB 4R2GB 3S5LA 4L3EE 4RAUA 4JFFE 2Q6WA 2X4TB 1NC2D 2VWEE 3WV0A 1CGSH 5EIVA 2BFVH 4TPRL 5T5NF 5IMKB 3IKCA 4FTVA 4Z7QF 5DJYA 5C07B 4L9LC 3HI5H 1LILA 2OL3L 4RQQB 2F53E 1CICC 3P2TA 2OBGA 1AO7A 2A6IA 1BD2D 4KZEL 4HK0A 3S88L 4ZS6C 3T0VA 1E4WL 1F4XL 3QDAA 3UYRH 1AC0A 4XMKL 3UBXB 4LVHC 1J1PH 1NGXB 3VXTA 5CCKL 3T65A 3RWCB 1E6OH 3VFTB 1HDMB 4P59H 4PRPB 1CVRA 4GRLC 2Z92A 4ODSL 3DNKA 3PIQA 3MRFA 1UH4A 1DVFA 2AJYH 1JGDA 3VFGL 4PJEE 2OTWB 5SWZA 5C0FA 1RZ8A 1CDYA 1NAKL 4KPHH 4ZQKB 3NIDE 3M1BA 4Z5RB 3NTCL 1TJGL 3QAZB 3GMLA 3O4LB 1IGML 1DE4A 2WUBH 2YK1L 5EWIL 3Q1SL 4RFEB 3GUTA 1I1FA 1I7ZA 1H8OA 2VQUA 1G1YA 4QF1B 3GSNA 2HFEA 4HUVA 5D6CB 2EDYA 5DURB 4X8JA 3PUCA 5BS0A 3VWJB 1J05A 3QIUC 2CRZA 3MR9A 5EU6B 3QHZL 3LVEA 2PO6D 4G8GB 3TT3H 4PV8A 3MNWA 4A6YL 1XGTA 1KCRL 4XVUC 4C56A 1BWWA 3HC4L 4DKEL 3LEVH 4JFHE 4Q9QL 4DUVA 3FJTA 4JY6A 2Z31C 4QRPA 4UT6H 4XZUA 3RGVC 2EDKA 4PGBB 5L6YL 3QXAB 4LCUB 2B1AH 3CH1A 4J3UA 1YUHB 3BJ91 3L3HA 4NN5B 5IEHA 5L8JB 1BQUA 1KCUH 3QWQB 5GJSL 5T1KA 1M6OB 4OCSH 4NPYA 4GXVL 1RUQL 4F7EB 3DWTA 2E7BA 1PX3A 1U3HA 5EBLA 1G7IA 1BWMA 2AXHA 3RP1A 4X83A 1IGTB 4WI4A 2F54D 4OSUH 1RZJC 2OL3B 5ID1B 4A2MA 3U0PB 4AENA 5D6DC 2A0LC 4QHMA 5I17B 4NN6B 2BNRB 1VGKB 1BM3L 3WS3B 4ZFFA 2VZUA 4X6FA 4RIRA 1Y6NR 4ZUUA 3MFFA 2MPAL 3KPMB 4TTDC 4KY1H 2LV4A 2EYRB 5IR1A 2X4PA 5DO2C 1A1OB 1WC7A 5IJKC 5FO7B 1QLFA 4Q7DA 1VFBA 3HAEH 2Q8BH 3RWEA 3W9EB 3S5LG 3QUMH 4U1LB 4O02H 5HVWA 5DGRA 4P9MH 3HE6C 3PHOB 3ZTJG 2GITB 4APQB 2DLTA 1RURH 3QCVH 3TNMA 1EFXB 4QTHA 1WAAE 5L8LB 1OGAA 4YEEA 4ZUVB 4NO3B 1EERB 5F96L 1O7VA 4LP5A 1GOHA 1MSPA 2IAMD 5SX4H 2QLVB 5HHPA 1MWAH 4OT1L 4BFEA 4C83B 3A6CH 4HMDA 2D7QA 4M7ZC 4A6YB 1MIMH 2R69H 3BD3A 3QEHB 2NY3C 3HFML 1A3LH 1XGRA 5CJXA 4OTXL 1PAMA 2VXUL 2ZUQC 1FH5H 4Z7OF 5D7JC 4BK4A 5DVLA 3GSOA 5FKAB 1VHPA 1KJ2L 3GKWL 4NKDB 4O5LH 4YHNB 1BFTA 1UVQB 1VFUA 4OB5H 3L6FB 4RGOL 2A83A 1KPVA 3WE6B 1T1XA 4ZPVB 3KPLB 2A9ML 3DX8A 1BIIA 3MC0A 4ZSOA 1YEGL 1FYTE 2CK2A 1HWGB 2HJFB 1Z3GH 4JG0H 1MRCL 5JW4M 1NMAL 5BRZE 4K3HA 3O2WH 3ARBC 3DETD 3U79A 3LKPA 1AD0A 3ARGA 1NCAH 1K85A 1DFBL 3BISA 4OQTH 5H94B 1A1NB 3VFWA 3LHPL 2FEEI 2BZDA 5EOTB 4MA7L 2OS7A 4WWKA 5C0IB 2FYYB 1U0QA 1SM3H 5DJDB 4JKPL 3UMTA 3WFHA 2ZPKH 5JOPE 1YYLH 2ZSVA 1CBVH 3AXLB 4H25A 3WSQH 2ICWJ 2ESVA 5DQDH 4P9HC 4X4XA 2DKSA 5BXFA 1A7PL 2VLRA 4FQQB 4J2XA 2YA2A 5ID0A 1G1CA 1QFHA 3RZCA 1KYOJ 1T89A 1TTGA 4F7PA 1A6UH 5AYUL 4XVSL 1KENH 5EZJB 4HKXA 2OP4H 2QHRL 3WXVH 3ZT5A 5L0QB 4I5BB 3RIFF 3GGWA 3UPCA 3CFBA 3JWOL 1I1CA 1RK0A 2NX5A 4L9DA 4MA8H 2MNUA 5D7IB 3S36L 5D4QA 3FQTA 4P2OC 4JFXB 3WFDH 4HUXB 3GJEB 4XPTH 1DN0A 4NC1E 1QFWL 2GFBA 3VFUA 5GGQH 3MV9D 1KJ2B 1HOCA 5JXEC 2X7LA 1HZHL 1JYNA 5C3TA 3ZT6A 2X40A 2EDQA 4JHWL 5D96B 2D03L 2UZXB 1QSVA 3KXFD 3G08B 5C0CD 5H8DA 4Y4HD 1ES0B 2YPVH 3QEQE 1FNLA 1LO3L 2NXZB 5I18H 2J5LB 4M4RA 1J86A 1PQZA 3MRMA 1LK3L 4EUPA 3G5VB 4LP4A 3U9UA 1NFIA 3FQRB 4X7FC 4UZGA 3FAXA 1JTTA 4U05A 5T3XD 5DFWH 1RZJH 3MRRB 4LEOB 1YQ2A 3QISA 3TJHD 3JSSA 4WNQB 2GT9B 4P3WA 5JQ6H 3MROA 4JZNA 5EO0A 1QRNE 4I4WB 1L7TL 3N1QC 1QBML 3M17B 4X4ME 4QHKI 4YBQD 3ORJA 4KJQD 4CMMB 3HE7B 4PPTA 1IQWH 12E8H 4MAUL 3O8XA 4JJ5B 3T0ED 3DI2B 3MJ6A 4FZEL 3KWWA 4U7KA 1G84A 3DECA 4YDKH 3WUWA 3LKNB 3N9GH 1HIMH 3PWUB 2NLJB 2C7UB 3GBLA 3WS6A 4U6XB 1A8JH 2O5ZH 2D7MA 3OXRA 4LRNH 3TV3L 1NCBL 5K33A 1CLYL 4XCEA 2FR4A 2HVKB 3P73B 1YYML 3NCJL 3TYGH 2Z93A 5JPNA 2F53B 4KKLC 5A2JH 5MEQB 1JYXA 2QADB 5DD6A 3HRPA 4HIXH 1F02I 4P99A 3DRTB 2AK4D 2BNQD 3MXVH 4QHLA 3BWAA 1XR8A 3F5WB 4MVBD 4GLRI 4F8QA 2UUDK 5MEOA 4BQCA 1CL7I 4OCMC 4MMXC 3QNXB 5DVOA 4X9IA 1A5FL 4HDIA 4EI5A 4X7TB 3ROLB 3OB8A 4PJEB 5J6GA 3MOBH 5JR1L 3U6RB 1Z6JT 2G5RA 1KPRA 4PJ9C 5BOZG 4GO6B 3O6KH 3VXMB 1YN6B 3GB7B 4MDIA 1N4XH 2P47B 5FV2A 1J1XH 3SKMB 3O3AB 4F33A 4AT6A 4M61A 5ELIA 5IG7A 4PY7A 1I1AB 4NO2B 5FUZL 3MRBB 2HWZH 1OW0C 3RKPA 5IBUG 4DZ8B 2DQEL 5JIPA 1JN6B 1RZIA 3ULUL 1A7OH 4X6DB 1NGPH 3QUXA 3QUZC 4HK3J 2CKBL 5EOCH 3IDNB 5EBMB 2EDTA 5BQ7B 4S10A 4OD3L 2DQUH 4BZ2H 1NDGB 4Z77A 2AEWA 4S1DD 4JFQB 3ZL4L 1U93A 4P23C 4HCRH 1ZLWK 5EUOE 4R9HA 4P9HH 4NZDA 3SCMC 3K2UH 5JQHC 5E8DL 5FCUL 1YEIH 3C6LC 4EUPG 5C2BH 3P4OA 4WCYH 1AGDB 3MJ7A 4NSKA 3T3MF 1MCQA 4PJFA 3GSQA 1WIUA 1M71B 3MJ8A 4XGZA 4NKQB 3MLTB 4HUWA 2A73A 3GMQB 4P5KB 2W07A 3GI9L 1S3KH 3V95A 2ERJB 4HPOH 1UKQA 3INUL 2CXKA 3D48R 2GSGB 2R9HC 3T2OA 3SE9H 3BIKB 1S9WA 4HIJA 5SX5K 2NY6C 2FEDD 4WFHD 2AGJH 1B9ZA 5GGVH 5J12B 5DJ0A 5KBNC 1SYSB 3WXWL 2C1PB 4MXQD 1NGWA 3NFSL 3WUWG 4M6ML 2BMKB 2X4RB 4ODHH 1HILB 1NBZA 3IDIA 1MFAL 4XHJD 4DQOL 5D7SL 3LZFH 3BPOC 3NACL 1LD9B 4QNPE 4FN0A 4XVTH 5I6XB 5JHLL 2OSLA 2H2SD 3O9WB 3VXNB 2V7NB 3V6OC 4KJWD 5D93C 3SQOH 4GMSL 3QHFL 1JWMB 4MAYA 5F7YC 3S35L 3IU4L 3RNKB 3VI3F 3FRPA 2CGRL 5FHBH 1Q72H 3MLRH 2O5YH 3X13A 1D6VH 1J8HE 1C12A 1H0DB 3I75A 3MXWL 1OOAA 2YMXL 2Q86A 4JO3L 4ZFOA 1RAMA 2YN3A 4F7TA 3ARDB 3PWNB 5JNYA 2CKBB 1JV5B 4MA1B 5E5MA 2WLYA 4N9GA 4FFVD 4JRXA 3NFPB 4RZCA 4X6BA 4CMHB 2VLKE 5I0DA 3S8WA 5HY9A 4LHUA 3U4BL 2E9JA 3ARFB 4RNRA 2Y5TA 3LEYL 4NDMB 2E8ZA 3EYOB 1DLFH 3BT2L 4NWUL 3FONA 4Y19B 2H6PB 3RVXC 1WF5A 1FYTB 4JKKA 1D6EA 4HKZA 4M7KH 1U8QA 4P4KD 4EN3C 1WTLA 2E3VA 5B3NA 5FECA 3T0DA 1MAMH 1ZV5A 2R29H 4Q2ZB 2XA3A 3WEXB 5H2BB 4J4PC 3S6CA 5A1AA 3WL9B 4G8EA 4R97C 3DMMC 2YSSB 3QDGA 2H2PC 5D7LA 1CGSL 3X3GL 5DI8B 1BZQK 3TO4D 3BDXA 3HNTH 5CJOH 1I1YA 3RVUD 4XH2B 4NNXB 1YEHH 5FDWB 1S9XB 4ONOA 4NHCH 1EA9C 3PHQA 1CFQA 2WSKA 1FAKT 3HI5L 5FOBB 4LQ1A 3VXRA 4XC1H 4DVBA 2EXWC 1ONQA 3ARED 1F42A 4BSWA 1KEMH 3O3DA 3QA3B 3IF1A 1Q0YL 2V5TA 4MZ2A 3UYRL 1UACH 1ADQA 2HJKA 4RMVA 1FZMB 5EFIA 1D5MA 1E6OL 5L2KA 3SKJH 4ONFH 3W39B 4P59L 4W68A 4KMTH 3W2DH 1HHKB 4OZGE 1I8KB 2PR4L 4NIKB 5BZWA 4MD5A 1PYWA 2AJYL 3L7EB 5TH2A 1FNEA 2ZUWA 3MNZA 4HIIB 4KPHL 4LSPH 5E00A 5DUMH 1T20A 2COQA 1EIBA 4FQXB 1IEBA 2X4QA 4RA0C 1ZVYA 5C0AA 5SWQA 1ORSB 4LLQB 3MOAH 1G7QB 2NZ9D 4YXHH 3V5DB 3VFOB 1PY4A 5DSCB 4NRYB 3U0WL 3QEQB 3TT3L 3OKKB 1BECA 2IQAA 3LEVL 1HYSC 2GTWA 3QULB 5GIRB 3HLAA 4R4FH 3NCYP 2BVTA 1CFSA 4UT6L 4PGDB 1OGTB 1T5XA 4Y5VB 1FNHA 3DV6A 3FRPG 4LEXL 5D5MB 2B1AL 3D85A 1JPSH 1OARH 3PL6A 1FRGH 5EA0H 1KCUL 2DQCL 1QRNB 4UDUB 5K9KA 3FT4A 4MCYB 4JQXC 4U1JA 3HC0A 2ZG2A 5E6ZA 5L9DH 5J1AA 4YHPA 5INDA 5AUMA 2EDBA 5F1NB 3TBSB 1A9EA 3U2SA 1MLBA 1AD9B 3AU1A 1X5HA 4P5TC 2B5IB 4LHUG 1CD9B 3SDAC 4YJZL 3NPSC 4HAFA 4OSUL 2R2EA 3O3EB 2HKFH 1KXQE 4O2FB 4FTVD 3L3KA 2XKSA 4PRBB 5TE6H 3EO1A 4NQEA 2EXYD 5ENWB 5F7MC 5KS9F 3BH9A 3PJSB 2IEPA 1AGCB 4U6HB 1EO8L 5LG1A 5ISZE 5DD1H 3EHBD 3FFCE 5KVDH 2IQ9H 1AO7D 2VDNH 1AE6H 3DYOA 2Q8BL 3VFVB 5ESVA 3QUML 5K9JH 2PYFA 1LO2H 4K71C 5EZLA 4GRMA 1D9KB 2JE8A 1ZHKB 5CJ5A 4GXUN 5F7DB 3NFNB 4I77H 1RURL 3QCVL 1LP9B 3TBYA 3ZKMD 3MLVL 4KK8D 1DVFD 4NNYA 2X05A 1KT2A 3ILQD 3T0AA 5SWZD 2ATKA 3PXJA 2Y1VA 2YS4A 5T1DL 4Y16D 3TNNB 4O51B 4JANB 4OJFH 1MWAL 5DJXA 1TIUA 5CHNB 3A6CL 1MIML 3P9WB 1ZA6A 1IAIM 1IAIH 3RIAF 4IRZH 1WQVT 2AXFA 5BS0D 1A3LL 4ETYA 4R4BB 3LKSA 5ANMA 1X7QB 1RUPH 1DR9A 4N0UA 5C9JA 4O5LL 4OB5L 4C56D 2H3NB 2GK2A 3OKDB 1NJ9B 4PJ7A 5KSAC 4NKOB 3DXAE 2BSSB 5F1IB 1R5WB 4ODUA 5C8JB 4PLJD 1T0MB 4G6JH 1KN2H 1Z3GL 4JG0L 5IB3B 4OZIF 1OTUD 5IHZB 2JTDA 2L0DA 5T1KD 4BUHA 3VXUE 1QQDB 4PUBL 4PS4L 3O2WL 3BXNA 2HKHL 4HUUB 1U3HD 3H3BC 1NCAL 5EUOB 4ETQA 4OQTL 5C0DB 3PWJA 4JFYB 1UC6A 4MZ3A 1KLFA 5D1ZC 2C9AA 1LEKA 5GGSB 4MCZA 2BOCA 5DMGD 1A3RH 1SM3L 2CDGA 3N06B 1YYLL 2DWDA 3GMOB 3QDMA 3G6AB 1G7LA 1RJYA 3QUMB 1KJVB 4PTTB 2CDFA 3A6BL 1S9VA 5DQDL 1HI6A 2YKLL 1ND0B 3HUJB 5E4EC 2JJTA 3OX8B 2FGWH 5FOJA 4Y5XB 1A6UL 4KTEH 2VE6A 3CU7A 1FAIH 1KENL 1MEXH 2Y07H 4JFDA 2Z0BA 3MJ9A 2ADJA 4X0KB 5MP6H 4NP4H 1JZ4A 1FNFA 3WXVL 1MFDL 3ZDYE 4JEGB 5JOEA 1QFPA 2VIRB 5MENA 1MWAB 3BQUC 3MV8E 1OGAD 3CFKA 1EEQA 3LQZB 4MA8L 3DBXA 5KS9A 5F70A 3HG1E 1BFSA 4AH2A 3WFDL 2GJZB 4XPTL 4IIQC 4U4BA 5DRNA 3M45A 3VGEA 2VYRE 4YO0B 1A22B 2C3WA 1V3JA 3KLHD 1OSZB 5J3HC 1QFOA 3QPXH 3FT2A 2IF7A 3CIQA 5B4MC 1XIWC 2DQIH 4QOKA 1AP2B 4NT6B 1SY6H 2YPVL 4IM8A 1T83C 2WIIB 3QCUH 3FQUB 3BFOA 3MTRA 1IJ9A 4M9OA 2I9LA 1FVEA 2VLKB 4GSDL 2P42B 4L9LB 1BIHA 4LVNC 3VFMA 3TF7C 1GVIA 1RZJL 2DQJH 3ZTNH 5EO9B 4JY4B 2C1OA 3EZ8A 1KTLA 1FFNA 1ZVSA 5ICZB 5JQ6L 1JPFA 3RWDB 4MQXC 2VDRL 1M05B 1I4FA 1KLUA 3EDKA 3UTZB 4BH7A 1YN7A 1NANH 3LQMA 4YBLB 4YHIA 3ARGD 1HWHB 4S0TD 3Q3GA 1NC4B 3MRHA 1IQWL 3QWRA 4GRLB 1IVLA 4HH9B 3SGKA 2MFNA 3WIFB 4WWKD 4UIKH 4YDKL 3N9GL 1W0WA 2G5BA 3C5ZB 1HIML 1J87A 3T4AB 1JBJA 4LBEB 4LRNL 1DLHA 3MSPA 2ESVD 4PJCE 3MLXH 4KRNA 2GAZB 1CD1B 2BJML 3RZCD 1UCBH 1TJHH 3CX5J 3MACH 4XBPA 3TYGL 3QIUB 2BVQA 1C16B 1H9VA 1JUFB 2OTPA 5I16A 1ZE3C 4HIXL 4HFWA 3PF2A 4X5WB 8FABA 2O26U 2NX5D 4R96B 1BVLA 3CPLB 3MXVL 2D4FA 2Z31B 3RGVB 1A4KA 5I66A 2UV3A 1F4AA 5JA8B 4TOYH 5KAQF 4ZOCA 3HS0B 2FECI 1X5YA 4RWYH 4WI2A 1MCFA 5IKCA 3R06A 3CXDH 3IFOA 3MRJB 2IFFH 5DJ8B 2RHEA 4RAVB 4OF6A 3QPQC 3VRLF 4HHAA 4NHUB 4GRWF 2EC9U 3TCLB 3I6GA 3JWNC 4OZFB 3O6KL 1N64H 1N4XL 1J1XL 3S7GA 2H32H 2PW2B 5L88H 2FSEB 2ITCB 4N8VB 4XB8A 4WU5B 5EORL 1FL3A 3CMGA 4H1LA 1S9KC 4DJMA 5IB1B 4NOBA 2NY2D 4QHKJ 1A7OL 3NZ8B 3FB7A 3VA6A 3MV01 2BNUB 4GG8A 1CVSC 4PGJA 1NGPL 4J7RA 4LCIL 3OJDA 5EOCL 4ONHB 3B2UC 2DQUL 4BZ2L 3IDUA 5E08H 43CAB 4PJGB 4LOUD 4NQDA 2DI8A 1YQVL 4YC2C 4XX1E 4HCRL 5GSVA 3AUVA 3SO5A 3MMEB 1TQBC 3K2UL 2VXQH 3D2UB 1YEIL 5D72H 3O8XD 4PV9B 1LEIB 5I8EA 2GW5A 2I60H 3DYPA 4MA3B 4PR5A 4WTZA 3V6OE 1YMME 1J18A 4DTGL 3LN4B 3BVNB 4YXKH 1JRHL 4XVJH 1I8MA 1G7PA 3K4DA 3KNBB 4LVEA 4RMQA 1S3KL 2JK5B 5E2JA 3X11B 4HPOL 5CP7B 4LDLB 4PJBF 2NY0C 1B3JA 2BVUA 1YEFL 5JW5A 4M7ZB 2K9UA 4LLUA 3SE9L 1NBQA 4AM0A 2HJLA 2NY5L 2AGJL 5GGVL 4LDOB 2B4CC 1IC4H 5D7JB 5JHDE 3GFUA 5HHME 5HVHC 2ZKHH 1WT5C 1HK6A 1P4LA 2FLBT 5D2LF 4HGWB 1ZT4B 5LAXA 5F3BA 1WITA 4K3EH 3BYTA 3LZFL 1HSBB 1KNOA 4M02A 5JO5B 3BZFB 4WHTA 4XVTL 2GJ6A 3PWLA 1ULVA 3F62A 5FYKU 2UY7A 4GH7B 4ZFGH 3IDMB 2VERN 4EI5D 2GI7A 3S34H 5LCVH 5EN2B 1YC8A 1CLZH 3SQOL 3H6JA 1YY8A 5IF0B 4NQVB 5GRXG 4I48A 3ARBB 2FHFA 4I0CC 4R7NA 1U8NB 2QTEA 4HKJA 5FHBL 1Q72L 4YNYA 3MLRL 2O5YL 1D6VL 1U2HA 3NAAH 1OCWL 4E41A 1Q9WB 5E0QA 5F89A 4OZ4B 2YUZA 3P9LA 4JZJA 3B9DA 3BZ4A 1NSNH 3GSUA 4WI6A 3V4UL 1P5UA 1ZVHA 3SGDH 4CN6A 1KELH 1U58B 5C7XH 4JRYB 4MNGE 1CG9A 5E56A 1OWWA 4OF8A 1MNUL 2HVJB 3I02A 2UY6A 4M8VA 3DXAB 1DLFL 5J13C 3EOAB 2VTFA 3PXHA 2HN7A 3WDJA 4UBDC 4LGRB 2R15A 3QUKB 4BZ1H 1MCDA 4RCAA 4YEFA 4M7KL 5GGTA 3K0WA 2IALA 4ZNEA 2CLZB 3RX5A 1TNNA 2X4TA 2MHAB 2R29L 5IB2B 2YA0A 4NQXB 5GRYA 4LLYA 5IMKA 4HS3B 3NPZB 4P2OB 1Q9KB 2HTLC 1OLLA 4YZFF 3RDTC 1MUJB 4PJIB 3RVVD 1KBGH 1QLRB 2EIZB 5C07A 1UB6B 3HNTL 4OCWH 4OGYH 3T09A 5CJOL 4RQQA 1QP1A 1YEHL 2CLRB 4JDVB 4NHCL 5IVXF 4U3XA 4LRIA 4GKSB 3QXTA 5ESQB 4EOWL 4XC1L 3WNNA 2E7LC 3UBXA 1PKQE 1NGXA 4ZTOH 1KEML 2FLRT 4WTZG 4Z95H 3RWCA 5BW7A 2XXCB 4MJIE 5HPMA 5TE7H 3VFTA 2Y6SD 4PRPA 4V1DD 2F5AL 1UACL 4JPVH 4NGHL 3SKJL 2YUWA 4H88L 4ONFL 2OTWA 5DHXB 5BMFH 2ZCLH 3W2DL 4ZQKA 4Z5RA 3MV8B 5I8CB 1NGYB 4LHJB 3W81A 3TP4A 3GMRB 4MAYD 4HWBA 4RFEA 1SJXA 1MCJA 1YNKL 4QF1A 2HFTA 1ZGLM 5D6CA 3KHQA 5DUML 1JTPA 2E7HA 2Y5EA 4P2QD 1RJZB 1I9EA 3VWJA 4WRLA 1EH9A 3UEZA 5D2LA 5EU6A 5C9KA 1P69B 4G8GA 3QIBC 1J0JA 4JRXD 2P5EE 3MOAL 4ZS7H 1C1EH 2Q3AA 1F4YH 4LHUD 3FO9B 4RGMC 4BQBA 3CH8A 2PCPA 4LSSL 4PGBA 3QXAA 4EDWH 5KZCD 4LCUA 2OR8A 5D1QD 3KLDA 1KPUB 1YUHA 3WBDA 4R4FL 4Z7NF 1TTUA 3D25B 1QFUH 1BMGA 2GUOB 1NPUA 4XNYH 3GK8H 4JKLA 4WENB 1U6AL 1M6OA 1JPSL 1OARL 2VL4A 4LPVA 2XG4A 3LEXA 1FRGL 5EA0L 4TRPL 1IGTA 4YDLC 4G9FB 5L9DL 2OL3A 5ID1A 3HNSH 5HVGB 1AHWC 4OZHE 3U0PA 2HMIC 3QDGD 2B4CH 5I17A 3LMJH 5D7LD 5E9DB 2BNRA 1VGKA 1PFCA 2VDLH 3WS3A 5D7IF 2HKFL 1DANT 3RX7A 5IGXH 5TE6L 2EYRA 1RQ5A 2CRIA 1A1OA 1FVDB 3BGAA 4WEBL 2HTKD 2WNGA 5FO7A 4PJ9B 4OUOA 4W6WB 3V4PH 3WKMH 3VXRD 4PJCB 3W9EA 5KVGL 5DD1L 3D18B 5KVDL 1KCSH 2CUMA 2IQ9L 4EQ2A 1AE6L 5E8EB 1DZBA 3PHOA 2GITA 3JWDC 3C08H 4APQA 2WK2A 3C8KB 3GNMH 1EFXA 4DKAA 4NCC2 3IU3B 1URLA 5D9SB 5L2KD 4YE4L 4ZUVA 2XN9E 3WIHL 4I77L 3GIZH 2XTLA 3BW9B 1IGCH 3PP3H 4K3GA 1RZFL 1NFDE 3V9FA 1T04B 4GS7B 4C83A 3ARUA 2AXJA 3RRQA 4P23B 4A6YA 3UBXG 1S5IH 2CDEB 4OJFL 2A6KB 4JN2B 4G7YH 3SCMB 4PJHE 1HHJB 3ZYJA 5FGCE 5E6IC 5C0AD 5DVMA 2AI0H 4IRZL 2CK0H 5AEAA 5FKAA 4NKDA 4YHNA 4AL8H 1UVQA 3L6FA 4WV1B 4LIQH 3WE6A 1PEZA 4ZPVA 3KPLA 3OR7B 5C0GB 1QUNA 4M43H 3BJLA 3QQ9D 2HJFA 1WWAX 4XNZB 1VFAB 3CMOL 1XCQB 4YHYC 2NY6B 4NCDA 2HT3D 3Q6FB 4U7SA 3D85D 4CJ0A 2E9BA 2Z8WC 4G6JL 4PJ5D 3OAYK 4UQ2B 3PL6D 4DCQB 5J1SC 3TZVB 5H94A 4UQ3B 1A1NA 5MHSD 5AG8A 1CTOA 2P5WD 3OHXB 1RULL 4FQ2H 2C3HA 5EOTA 3BPOB 5C0IA 3SGJC 3MZGB 5DJDA 1CK0L 3WNOA 1RIHH 3DHJA 2E27H 1A3RL 1OF2B 5F3HA 2PXYC 3D6GA 5D93B 4PJAF 3R8QA 4NQED 1CU4H 1MIEH 1FZOB 5C0RH 2V2XB 4L8DB 3VCLB 2P7TB 2IPUK 2N7AA 3ECBB 4FQQA 3UTTE 4U3HA 4FQ1L 1AQKH 4OI9A 4W70A 4OGZA 4Z7UB 5EZJA 3S37H 1JNLH 1X5FA 1D5XB 4MD4A 4I5BA 2Q7YB 4OFKA 1KTDA 4IEFB 4KTEL 4ODVH 1FAIL 4U0RC 2Y07L 5MP6L 4NP4L 4K3JH 3BMVA 2WW8A 2AQ2A 3WLWD 5JHDB 5D7IA 4YGVA 3RNQB 4QRRA 4JFXA 3WFBH 4HUXA 3GJEA 4YX2H 4KAQL 1CE6A 4D9RD 3QIWC 4X6DF 1KJ2A 2ILLA 4EN3B 2ZG3A 1UZ6E 4M6AA 2HT4D 3EYUH 4XPAH 3G08A 4JPKH 3QPXL 5IHLB 1ES0A 3EDDA 4UU9A 4R97B 5C09E 2AJXL 3DMMB 4FZ8H 1UM6H 1JI1A 2ED8A 1QSEE 3FQRA 3MO1B 1JZ6A 3TBTB 4QHNB 2X41A 3MGOB 1CXHA 1RV6X 3QCUL 4ONGH 2V9QA 4LEOA 5J4MA 4JCMA 1HXMB 4WNQA 3CCHB 3WO3B 2DQJL 1OD7A 4HV8B 3RWJB 3M17A 2I9TB 1VKXB 2B1HH 1NCCH 5FUCC 4UB0L 3JTTB 3P11H 4CMMA 3HE7A 4CU7A 5F7LB 4UT9L 2IAMC 4JJ5A 4PJDE 5E5RB 3NIGE 4YBHA 2HLAB 3LKNA 5DK2B 3PWUA 2NLJA 1CXKA 1DQQB 2C7UA 4LCCB 3JWDH 3QBTB 5DRWB 3MUY1 4Y2DC 3EZJB 2AJVH 4M6OH 3QDMD 5T1LB 4YHKH 3KPQB 4FQJH 1MJ7L 2HVKA 1U8LB 3P73A 2RCSH 3V0VB 1Z0MA 2XTJD 5ALBH 4G6KH 3BMWA 2F53A 4KZDH 5HI4D 3MLXL 4BKLB 5MEQA 4TUOB 1G6RH 1TJHL 5DHYB 3ULUF 3UP1A 3O11B 4JFDD 4K2UH 3VRJB 3MNVB 4KGJA 3DRTA 4OQ1A 1PKQB 4KUCF 2ZNXA 4FFWD 4LPXA 3F5WA 4OF3A 4MJIB 2ZWLT 3HCVB 5MEND 4PY8I 1HCVA 4PJAA 5K9QI 3QNXA 3DETC 4Y4KB 4Z78B 3D0LB 4X7TA 1T2QH 3ROLA 1EUUA 3T04D 5LGKA 3BPNB 1OT1A 5GZNC 4PJEA 3MJGX 1J0IA 4TOYL 4K7PY 1ZGLP 3U6RA 4RWYL 3CXDL 5IROC 4PRHD 2HAZA 1PJ9A 3VXMA 1YN6A 2GQHA 3VJ6B 3OKEB 4JRWA 2OZ4H 3O3AA 3SKMA 4ODTH 3D39B 1I1AA 4NO2A 3KAAA 4QOKD 3MRBA 3NPSB 2P46B 2ITDB 5IVNA 2IANA 4DZ8A 2APWA 1AGFB 5L88L 4LKCB 5CP3A 1JPGB 3B9KB 1LGVA 3MODH 4X6DA 2P5EB 2VDKL 5I75C 3LV3B 3IDNA 5EBMA 1HHGB 1KIRB 5BQ7A 1J1OH 3C6SB 5C70A 5LVEA 1NDGA 1GYAA 1CTNA 2ZNWA 3BEWB 4JFQA 4U31A 4D9LL 3OB0H 2R1YB 3D3VE 1LDPH 2P44B 4F15B 3H7BB 1ITCA 4RGNC 3BKCH 4NNPH 1AGDA 4XBEL 3DV4B 1S7QB 4JREB 2YRZA 1AKJB 4MDJB 2VXQL 1M71A 3QWRD 5ILTH 3ULVD 5D72L 4K8RD 4HS6B 2I60L 1P4IL 3GMQA 3Q6GL 4HUKB 1LO4H 3I3BA 3DARA 4P5KA 3P4MB 2NY7H 4OZHB 1MLCB 4YXKL 1ZHLB 2AXGB 4XVJL 4Y2OA 1FSKC 3KPRE 5F21B 4RX4A 1L4IA 3BIKA 3O3BB 5FHAL 4KTDH 2APBA 4XXDB 3RHWK 2EDLA 3GMNB 1SYSA 2C1PA 4S1SH 4P2CG 4F7MB 1WFUA 4XXCC 1A7NH 3N1FC 1ERNA 2X4RA 1HILA 4N0FB 3UZEA 1IC4L 4CVUA 5HDBE 2ZKHL 4J3TA 4KUZH 1LD9A 5GZOC 2YWZA 3O9WA 4G7VH 4K3EL 3VXNA 2V7NA 4X80H 4JM2B 1T1WB 2JJSC 1IARB 3F58H 1NLBL 3V79C 3L7FB 4ZFGL 1JWMA 3GJFH 2F74B 2QHLA 3GSRB 4LIQE 3T0EC 2VLJE 3HR6A 3S34L 5LCVL 3RNKA 1NFDB 2BERA 4IOFD 1AGBB 2H32B 1CLZL 5D5MF 2W92A 4RA3A 2JF1A 1F11B 2C4FU 1H0DA 1MJ8H 3FQNB 3ZHKA 5JZ7D 3ARDA 3PWNA 2CKBA 1JV5A 4PJHB 3RPIA 3QXUA 4O58H 3NAAL 3NFPA 3FL7A 3TEUA 4OD1H 5EC2A 1T7XA 3ARFA 2DMCA 3AY4C 4NDMA 5HI3D 3WD5H 2F5BH 3EYOA 1JNJA 1KELL 5C7XL 4Y19A 2H6PA 1FYTA 2E6PA 1V3LA 1I75A 1GOGA 4M1DH 4NQDD 4M7LH 5HSFA 4N68A 4BZ1L 4Q2ZA 3WEXA 5H2BA 1J11A 1K9TA 3WL9A 1P2CB 2YSSA 4EXPX 1JNNL 3B43A 5DI8A 1QKZH 4HS8H 2XYCA 4FFYL 1LP9F 1ZLUH 2O93L 4XH2A 4NNXA 3IAQA 4IIQB 5FDWA 4OLUH 1KBGL 4F58H 4HJGB 1EV2E 4OCWL 5FOBA 3TO2B 1JZ3A 1WUNT 2WM0A 3QZWA 1FE8H 4L8SC 3QA3A 4GBXC 3UTTB 3VGAC 5FB8B 1JYVA 1AXTH 4Z7WE 1PEWA 3ZKND 3U30B 3IVKB 1II4E 1I7TB 4ZTOL 1FZMA 4O00A 3LPWA 4Z95L 2P24B 5DTFB 3W39A 4LSUL 1HHKA 3VXPB 1DEEA 1I8KA 3G6DH 5EZIH 2GJ6D 2P8PB 3L7EA 3F8UB 3P77B 3H8NA 4UAOC 5EU4B 5BMFL 4N5ED 2ZCLL 4NKMB 4HIIA 4PJ8A 4YUEL 3DUSA 3N0PB 1MI5E 1ZOXA 1DQLH 4FQXA 3VGDA 3X17A 1MRFL 1ORSA 4LLQA 5IWLA 1KB5H 3UTSE 1G7QA 4OM0H 4E41D 4D9QE 3V5DA 1BPVA 3RUGE 5DSCA 1IAMA 4NRYA 2DJ4A 3I6LE 6FABL 3QEQA 2FEDC 3OKKA 3WLBB 3GI8H 4ZS7L 5JMOC 4G3YH 5C0EB 1QR4A 1QSEB 3QULA 1F4YL 3EFDL 5GIRA 5F97E 2AQ1A 1OGTA 4Y5VA 4EDWL 4H0IA 5D5MA 1JZ8A 1EBPA 4XHJC 3VXSB 1S5HB 4XNYL 3QCTL 1QRNA 4UDUA 3HUJF 1XR9B 3ARQA 4MCYA 3KPPB 4RISH 1FIGH 1WZKA 3KPTA 2FIKB 4MYWB 4R2GD 5F1NA 5SX4I 1AD9A 4XI5D 1OD9A 1F5WA 4AEIH 2GTZB 2DF3A 4M62H 2DM3A 3O3EA 4O2FA 4BH8B 2B4CL 4X98B 4S2SB 3LMJL 4I9WD 1K6QH 4WW2F 4PRBA 5ENWA 4ENED 2VDLL 5C07D 3PJSA 1MHEB 4G5ZH 1IL1B 1XGQB 1MCPH 1AGCA 5H37G 4FFVC 1E6JH 4U6HA 4IRSB 5T3ZD 1OLZA 4AJ0A 2E8YA 1CLCA 4I0PB 3V4PL 3VFVA 4WY7H 1CXLA 4NJ9L 1EO7A 1KCSL 2UZIL 5FKPA 4I3RH 1JP5A 1D9KA 1A3QA 1ZHKA 2WWMC 2J4WH 4PRPD 3NFNA 1LP9A 1RUKH 3GNML 4NQTA 1ZLSH 3K2MC 2Q3ZA 4W6XB 4P4KC 1UG9A 5AZ2H 1IEHA 3BI9X 3GIZL 1QO3B 3TFKD 4JO2H 1BZ9B 4M1GH 5TF1L 3QZWG 4O51A 4JANA 4Z9KB 5IW3A 1GC1C 1ACYH 3O4LD 1KLGB 3RFZC 1VGEL 4DWHA 1G0XA 5CHNA 4OGAC 4RFOH 1YPZE 4YC2B 3VFSB 5DURD 3RL2B 3TO4C 1S5IL 1U91B 3HMWH 1OAUH 3VWJD 1E4KA 1L0QA 1WIOA 1A6ZB 4H0HB 4R4BA 5EU6D 1FLRH 1BBJB 1NBVH 1X7QA 4KDWA 3GZKA 2AI0L 4P48A 3SDYH 5GS1B 4G8GD 1BZ7B 2AP2A 4AL8L 2H3NA 4BQ8A 3OKDA 4LIQL 1NJ9A 5DD5H 3OAUH 4NKOA 1KYOK 4MWFB 2BSSA 5F1IA 1R5WA 5C8JA 3TIEB 5JW3H 1X5XA 2NY0B 2W0LA 4M43L 4JQVC 2A6JB 4JFZL 1UH2A 1TCMA 5IB3A 3HNVH 5IHZA 4U1SB 4AEHH 1QQDA 1H3PH 3KR3L 3NCCB 3WDIA 4HUUA 3D3VB 5HVHB 5EUOA 2X70B 5C0DA 4JFYA 5I0ZA 1W72H 2KH2B 5GGSA 3PNWB 3UYOD 3D0VB 4FQ2L 5AWNH 2PTVA 1OTTD 2B2XH 2BNRD 2X42A 3ZKSD 3GMOA 3G6AA 3SBWA 1RIHL 2L7UA 1HQ4B 3QUMA 1KJVA 4PTTA 5F9OH 4OM1H 3PGDB 4TYUA 1MIEL 3HUJA 1ND0A 2IJ0C 2IWGA 3RX8A 5C0RL 1DDHB 3VMNA 3OX8A 3LQAC 4Y5XA 4K94L 2YPLE 3IT8D 5LQBH 3F6LA 4X0KA 3S37L 1KSRA 1JNLL 5FYKH 5C86A 4APQD 3WJJC 1CCZA 1UB5B 1NEZB 2VIRA 4ODXB 1EFXD 4FXKB 1MWAA 1HHHB 4KI5F 3WO4B 4K3JL 3LQZA 4EZMA 3EO0B 1H3UA 3TPKA 1Q94B 2JKXA 4KKCC 3ZDZF 4YX2L 2PYEA 3H9YA 5FUCE 4HBCH 1CR9H 4YO0A 1H3GA 1OSZA 2NMSA 4LMQE 4QWWC 4PJGF 5GXBB 1MOEA 2APVA 2CD0A 3EYUL 3VFNA 2EC8A 4XPAL 4PB9H 4JPKL 2EXYC 3FN3A 4NT6A 3QXDB 2WIIA 4FZ8L 3FQUA 3Q5OA 5BJTB 4IHOB 3HMXA 4OD2B 3EHBC 3WNMA 2VLKA 4DW2H 1MQ8A 4L9LA 4R3SB 3BP4B 5GRJH 4ONGL 3HB3C 1J0HA 1A14H 4NBZB 1I9JH 5EO9A 4JY4A 5FF6B 5ICZA 3RWDA 2XT1B 4JHAL 4MHHI 1M05A 3UTZA 4DOHB 3JV6B 4JPIB 1KCLA 3UJTH 5EH1A 4DGIH 4KK8C 1IMHC 1NCCL 4ZAKC 3OAZH 2NTFB 4UV4H 1NC4A 3P11L 5HYFA 4Z0BL 5IUSA 3RVWD 1A7BA 4HH9A 3WIFA 4PJXB 1F58L 4GW1B 4FG6C 1OP3H 3WFCL 3C5ZA 4TVPL 2H41A 1M7DA 3MRPB 3T4AA 2PN5A 3JWDL 4B0MM 2NQCA 1JPST 4LBEA 4UDTB 2VDOH 5F7EH 1B0RB 2AJVL 3B9EA 3LRHA 1B6DA 4KK9C 1MQKL 3P4NB 2GAZA 2G2RB 1CD1A 4WFGD 1FZJB 2RCSL 5FV1L 3VD7A 4MXVF 4WTWA 3QIUA 1A6WH 1GC1H 4G6KL 3VXOB 3F7RA 1C16A 1JUFA 1FBIL 4POYA 4PLJC 4XAWH 4X5WA 4K2UL 4X5XB 4Z7WB 3FOMB 4WW1A 4R96A 3CPLA 1UKTA 4X6CE 2Z31A 3WHE0 4RGMB 2HRLA 3RGVA 1OTUC 3V6ZB 2DQTH 5GS2H 3HS0A 1JWSB 1I9RH <