2GIYA

Crystal structure of the c-terminal domain of the hsv-1 ge ectodomain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
179
structure length
179
Chain Sequence
HVRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPPPRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLDIEGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoprotein E
publication title Crystal Structure of the HSV-1 Fc Receptor Bound to Fc Reveals a Mechanism for Antibody Bipolar Bridging.
pubmed doi rcsb
source organism Human herpesvirus 1
molecule tags Viral protein
total genus 38
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2giyA00
2JK5A 1NCBH 5IGXL 3IETB 4L29A 5D1XC 4HIHA 5L6YH 2CK0L 3PWUA 4HHAA 1CGWA 4I2XA 1R24B 1SYVA 4I48B 4Q0XL 3UTTD 3HRZB 4PB0H 5F7KC 1D9KD 4KVCH 2BVPB 1J9CT 3QDAA 1U58B 4X5XB 1ND0A 3MZTA 5FO7A 3RWFB 3U79A 5HI5D 4CRPA 5EIIB 4ZSOE 1YPZA 4BK5A 1Q0YL 3CSGA 2D4DA 3U0PA 2HT3C 2Y06H 1WWWX 1KFAH 3O41B 4NM8L 4Y1AD 1WUNT 3N06B 3DMMB 3MCG1 3ZTJH 1CLOL 3QA3B 2BFVH 5HXMA 5I30L 4ZO7A 5SWSB 2PR4L 2XN9B 3W11C 4XBEH 1RI8A 1NL0H 4AK1A 2AW2A 4X98B 5AUMA 1KB9J 3MRGA 4LBEB 5EU6E 2XZAL 1HYRC 4NUJB 4H26B 3BFOA 3OR6A 3NIGE 2OL3A 2XQYG 3VFUA 2P5WE 1A6UH 4YX2L 5MEND 3KVQA 4IOFC 1ZANL 4XWGH 5CWSB 4J12A 2CKNA 1LD9B 2DQCL 2EE3A 3GMOA 3MLWH 3OPZL 4H88H 4D2NA 5JOFA 1J0YA 4ODVL 5KN5A 4XB8A 1FVEB 2H1PH 4DKFL 2VLLA 3TO4D 5DI8B 1VESA 3T2NH 4PP2A 1MFEH 1LK3L 1H15A 2FEEI 2H9GB 2Y6SC 4XPAH 1JWUA 3IAPA 5FGCE 2AQ1A 1AY1H 4U0QB 3PQYB 1EIBA 3QQ3B 4JRXD 3NIGF 4JHWL 5HYSB 1YEIL 4GW4A 3S34H 5CEXA 3PP3H 5A3ID 1KIPA 5SWZD 4KROD 4Z77B 3ZSTA 4N90D 1DANT 5IK3B 1KT2A 3FN9A 4XNQB 1R3KA 5F7FA 4AH2B 3S36H 2A6IB 3OKMA 1IQDA 2VERN 2VXUH 5ITFA 3DUHA 1EGJH 5AZEL 4WI7A 4U7KA 4Z76A 2DJSA 1C16B 1ZT1B 4HXBH 3NACH 3BGFC 1MRDH 4X7SH 1JCKA 4KY1L 4KJYB 1T22A 2P48B 5C08D 3QT2A 1NC2B 4OZHA 1T83C 3T2QA 4X4XA 3RBGA 3AROA 3FRPG 4PJ8C 4ZXBD 2X4RB 4KZDH 3QXAB 1HKLL 2X4UB 5FO9B 3PGDB 3VFNA 2R69L 1E6OL 4PRHE 5CP3A 4X5WA 4KPHL 1MRCH 5FYJE 5DGRA 2C4XA 3TFKC 3B3IB 3X3FL 4KDTC 5E1HB 5C70A 3F5WA 5F7UA 2WP3T 2A73A 1NGZA 1XF1A 2P5EA 4LRIA 1I1RA 3IJYA 1D3CA 4LCCA 1T1WB 1OAUL 5TPWL 3SCMB 3WKML 5CJXC 4WCYH 5FM5O 1S9XA 2MWCA 3Q1SH 1DQLH 3RL2B 3KPMB 5E2WL 3TP4A 1XGUB 1Z3GH 1J8HD 5JZ7D 1IKNC 3H3BC 3D3VE 3NCJH 1XR9B 4NQVB 4Z7NE 5GS2H 5IVXA 1SJHA 4NRYA 2JB6B 2E9JA 3BQUB 3PWLA 4L9LB 4TRPL 1Y18A 3VH8A 2O61B 5T3XH 1RK0B 1UM6H 1FLTX 3BESR 1I9JH 3ORJA 1FAKT 3UO1H 4WUUE 3BKCL 5CD5C 4IRJA 1ADQL 2BNRA 1ZA3A 2CIIB 3QCTL 4DTGH 1QSFB 4JFYB 3RPKA 4APQD 3RVUC 4OM0H 2AXGA 3GGWB 4BA8A 5F1NA 2NZIA 5FM8A 2X4SA 2IWGA 2DI8A 3G5VA 5D7LD 2HVJB 4Z8FH 4HSQA 5B38A 3VWJC 2BP3A 4Z7NF 2X1WL 2XKUA 4PY8J 1SY6L 3SO3B 1NGWB 1YEGL 2FH6A 4WTZA 2AGJH 2HRPH 4EN3C 3T0DA 4QYOB 1VGKA 4NCDA 1JP5A 5DJ0B 5CKGA 3T4AA 2NW2B 4JVPA 1HEZA 2YPLB 3GO1L 3TYGH 3DGGA 2VDPL 4ELKA 4MS8D 2EXYD 2J88H 2CQVA 4ZAKC 4O5LL 2Q20A 2I9LA 4RFOH 4ONGH 4HH9B 1HYSC 1B9ZA 1KTRL 2EDBA 4XTRD 4MA3A 2OL3H 2VLKE 4TTDD 1HHIB 5C6PB 2MMXA 3VU2A 4S2SB 2P7TB 4LSQH 1UJ3B 2DM7A 3VXME 3WLWC 2W0PA 5DJZB 4O2CB 3IJHA 2Q7YA 3Q2CA 1YC7A 2Y7QA 2X4NB 2N56A 3BSZL 2NX5D 3U30B 3CMGA 1X3DA 4GRLC 5GS1B 1NGYA 3KR3H 4F57H 5TH2A 3TBVB 3IYLW 1M7IA 4FMFA 4P9HH 2FX9H 5GZOD 3OGCA 2A6KB 1M71A 1IC5H 1YMHB 1FVCB 5KSAC 2AJUH 5K93A 8FABB 3V5KB 4ZOAA 2IQ9L 3OG6B 1IGCH 5TQ2H 1EX0A 1VFMA 3WJJA 4MJIB 1RURL 5TQ0H 1G9EA 4WTWA 3WLBA 3U82B 4QXGH 4BSWB 3QFJD 1BVKB 4I0KA 1IZJA 3RVXD 2PTUA 5DC0A 4LP5A 1KCVH 2BSSA 5TE7H 5C0ND 3RZCB 3HNTL 3FO9A 4NDMA 1TPXC 4MZ3A 3CDCA 1JZ2A 4IMKA 3HI5L 3K74B 3T09A 2BSRA 1A21A 1UZ8A 5M95B 1EZVX 2BZDA 5JHDA 1HXYB 4P3CL 5CP3H 3EJYC 4KVNL 4PJ9A 3F58L 2DF3A 1HSBA 1OAXH 4IOSD 4UUJA 2CKBA 1GZQB 3C8HA 1LWRA 4L8SA 5ESVB 5DJ6B 3ULUH 1NMCC 5K9QG 4XMPL 2V5RA 4RRPG 3UP1A 3ARQA 4UT9L 1E4JA 3SJVA 2LTQB 2R0ZL 3DMMD 5T1MA 1FBIL 5DS8B 4BYHA 4M48L 4DCQA 1MI5B 2X7LA 4ZNEA 4GSDH 5D1QA 3S6CA 3K4DA 4P2QE 4FG6D 5SWSD 2XN9D 1G7PB 5GHWL 5AWNH 5F3BB 1I4FA 2AJVL 2VR9A 3CPLA 4WFFD 3GMLB 2GJ6B 5I15L 3FOLB 3UDWC 3PIQA 3VWKB 4LDLB 3FOMA 4OV5B 3EFFA 3T0EC 3GBMH 8CGTA 4YIQB 1W8NA 1XF3A 4Z18A 1RZ7L 1IGMH 2EDLA 4KJQD 2A6DB 2VQUA 2HRLA 2DQDH 4QCIA 1KCSL 3CXDH 3IDIB 4NM4L 3R0NA 3D48R 4LKXA 4RMSA 1QLEL 1CR9L 2GCYB 2EDTA 1U8HA 1OM3H 5E1AA 4QHUA 1JIBA 4Z7VE 1HHKA 4XC1H 3OTTA 3G6AB 5B4MC 3QIBC 3QH3B 3FONA 3PQYD 3U7WH 3MV7A 3RWJA 1VCAA 4N0UE 2R39A 1T03L 4NP4H 4ZYKA 2D2OA 4G8GE 4R2GB 2YUXA 1X5HA 3KJ6H 4HWZA 2Q1EA 4JFPB 1SEBB 4PJBE 2DLHA 3AM8C 1I8MA 3CFBA 5DEFB 5ALCL 1S7VB 1G0DA 2D7TL 1PX4A 2MCPL 5E8EA 3EOAA 4Z7VF 3TNNA 1HOCA 1EEYA 4MJ6A 3ARBA 4K3DL 5C09E 4CBPA 2ARJQ 3ARYA 3BPLB 5GSVB 5JR1H 1JTOA 4D9RD 1NC2D 4P5KA 2J12B 1ODAA 1VERA 3LEXA 1QFWM 4M7LH 4XB7A 5H2BA 1T3FB 5FO8B 3GSUA 2XQYK 1NLDL 4D9LL 1OOAA 1C12A 2Q76A 1QP1A 1RJLA 4HUKB 3KLHD 3TM6A 1MCQA 2F54E 4PG2C 4RGNC 4PJBF 1UXWA 1DQDH 2C7UB 1A3QA 1F42A 5E94B 2GEEA 3MV8E 1HDMA 2VZTA 3AS0A 4WGWB 2GFBB 2EC8A 3SCMD 3PDGA 1HXMB 2CUHA 3RNKA 4JDZB 1FZKB 4MXVE 1TJGH 1CICC 4XPHL 2ZUYA 4U6XB 4HXAL 2HP4A 1OTUD 3FB6B 3O6ML 3KLSA 2HN7B 3BQUD 4KJPC 2EXWD 1X5GA 1RSFA 3LOWA 2WWKO 4HQQH 4TUOA 2CK2A 2WANA 4NKMB 1I7ZB 4U1KB 1DUYB 43C9A 5I1JL 2B1HH 2ADGA 1QSFD 5HYIA 4JHAH 5FXCH 3CK0H 1HINL 3T0EE 3IFLH 3RHWK 5IROA 1OY3B 2HG5B 1T20A 2CKBH 4MXVF 1WC7A 3WIFB 2P8PA 1UA6L 1QOKA 1KPVA 1ZVSA 3GSWA 2VYRE 1QFUH 3Q6GL 1WITA 4QRQB 1RFDH 5DUPL 3VFVA 2R29H 1H9VA 1W2KT 3HG1B 4YHKH 5KZCB 4MJ5B 1T80A 3K8LA 3HAEA 3JV6B 4YHNA 2VZUA 5FUCC 2QHRH 3HE7A 1N6VA 5D96B 4GG8A 1JI2A 3FB7B 4M1DH 4Z7UE 2VL4A 1G7MB 3VXTB 1MLBA 2YPLD 5DK2B 3WN5C 1MCRA 1K4DB 5FF6A 1QPXA 3C5ZC 1S8DB 4PS4L 4LGRB 5EA0H 3BT2H 5KAQG 1PEZA 1MCDA 2CR3A 4RMVA 1IKFH 3CFEB 5CCKH 4LDEB 3CUPB 3H9YA 1V3JA 3MV9A 5J11C 4M8VA 1NDGB 3V5DA 5E4EC 2R2BA 2V17L 1G9MH 5DEZA 3X13A 3WFEL 3K0WA 1VKXB 2FR4B 1BFSA 4G43B 1A47A 5HPOA 2XWJB 3L7FB 2APBA 4XNMA 3WO4B 4Z7UF 3PGCB 5LXGL 1JPTL 3BXNA 2DBLL 1X7QA 3ZKXC 5ESAA 5E08H 2CGRL 3UX9B 1YNKH 3QHFL 4O58H 4ORGB 3CFJB 3U4AA 3W5MA 5C3TA 2ZP0T 1NDMB 2YBRA 4MCYB 4FP8L 1TCRB 4YXLH 1UYWH 2FLRT 3OXSB 1LO2H 4BQBA 2XFXA 1D6VH 2P46B 4NC2B 3C6LA 4F58L 4QO1A 4RGNE 2BVQA 1CU4L 4C57C 3RTQC 1KNOB 4UI2A 3I3BA 4QNPE 3NZ8A 3IAGC 1X9QA 4PJEA 4YHIA 2R2HA 3BP5B 1BECA 5CSGA 3O9WA 2E7HA 3CVHA 4PGCA 2J7LA 5CJ5A 1Q0XH 5TF1L 4QXUL 1LEKA 1BBDH 5EPMB 1GJIA 3BRGC 3WMSA 4U2ZA 3MR9A 4Q9QL 4IEFB 4G8EB 3PV7A 2ADJA 4NO5A 2JB5L 1K5NA 4JM2C 1YUHA 5A2LH 1SBBA 4ZS7H 4Y8DC 4N8CH 1BVLB 4YBHA 5EC1A 4QRPE 4D3CL 3Q3GA 1OCWL 2VXTH 4IIQB 5ALBL 4QNPF 3CAFA 5HI4C 2N1KA 2B5IC 3VXNA 1GAFH 1U95B 4NN6B 1IT9H 5GRXG 4Z7QE 1RZGB 1KTKE 3MRDA 1BIIB 3ARFA 4OZGB 3CFCL 3LKNA 4U1JA 4KC3B 4AIXA 4WY7L 3I6GA 2X4QA 5DVKA 1GVIA 3R8BB 3GK8H 5F1IA 2X1OA 3MRLB 1I3UA 2ZNXA 2VLJE 3GSQB 3P4NA 4G8FB 4LIQL 3BP7A 2Z9TA 4JZNA 4M6OL 5D70L 1KB9K 5FUCE 1RZJL 3ULVH 5I2IB 3VXSE 2GTWB 2I27N 4GFTB 4HJJL 4LPXA 1YA5A 3C2SA 3IKCA 3F7YA 3IT8D 5F7YC 5E8OB 5D7SL 1FGNL 3UJTL 2NNAA 3VJ6A 1EK3A 4Z7QF 4NHUA 5GGVL 2GJ6D 3IDNA 4LQ1A 3P9MB 4F3FA 3V5HA 5DHYB 4AL8H 2ZCHH 2QQKH 4KI1A 4JFDB 4XPGH 3K1KC 1K8DA 4G8IB 4NO0B 5D5ME 2QQNL 3HTLX 3L9RB 5GJTL 5KVMC 2O26U 4X9GA 2YEZA 3T3PE 4P57A 1JHTA 5DQDL 3IDUA 1NCCH 3HAEH 5FYKE 5EZJB 2BOCB 4MJ4A 4NSKA 2CDGB 4UBDD 4HDIA 4L5FL 5KBNC 2ICWA 5ISZA 3O4LA 3MRCB 3B9VA 5HYJD 4MDIA 4HLZH 1BFVL 4C56A 1P84J 2IBZX 4R2GD 4LU5L 2X6MA 3ZTJG 2NY0C 5IB5A 1BHGA 4U2YA 4N8VB 5D5MF 3RX8A 1D5XA 3KPSE 1WV7T 5B21A 4TOYH 3QXDB 4X4ME 3T3PF 2EDEA 4K23H 3SDDC 3MNVA 3QDMA 4LAJH 4HCRL 4NHCH 4KRMB 2O93L 4M7ZC 4UTAL 5GRJH 1T0PB 3D85A 4LSTL 1OTTD 3GMMB 4ZQKA 4YXKL 5FIEA 1JPFB 4Y19E 5HGDB 3S37H 1U8OB 4D0DB 2EIDA 1JYVA 2D0FA 1CFVH 4XCFH 2FO4B 3MBEB 4JFFE 1MAML 1UH2A 3JTTB 3QJFA 3KYKH 1MNUH 5J1AB 5C6TL 3D69B 1JVKA 1N26A 2HKHH 4GQPH 4KK6C 5MHSD 2H2SC 3VD7A 4EI5C 4U6TA 5IG7A 3DXAA 3MMEB 4FFZH 2APWA 1FNLA 1HWGB 2DI7A 5MP6H 3CVHH 4NZTL 3SGDH 3VFOB 2X89A 3B9KC 3W2DL 3LY6A 1OW0A 4I4WA 3RDTA 4JFOB 5TGBB 1C5CH 1DSFL 1CFNA 2R23B 1MIML 5K59F 1UJ3C 4NZUL 4R26H 1FYTE 5IFHL 1SYSA 3INUH 1UADC 3RAJH 3U4EA 4NO3B 3DTXA 3ZHKA 5ADOH 2AVGA 2VQ1A 3LV3B 4JFZL 4M9OA 2HJKA 2EYTB 5HHNA 3ZYOA 2VDRL 1I9IL 4G9FB 5TFSH 3UTSA 1B6DA 4GAGL 3QUXC 2IALA 5IVZB 5KVGL 4Q9RL 3QRFM 3BWUC 3P30H 5I1DB 4S0SD 5F3HB 3BIAX 5BS0B 1XGPA 1ZLSL 3BI9X 4XCYA 4OGYH 7FABH 4J3XA 5KSBA 2QKIA 1P2CB 2XY2A 4FQPA 1ZT4A 3BP6B 1OL0A 1MRFL 5CSZB 2G9HB 2IFFL 3MSPA 3EO1A 3A67L 3CFKA 1N7MH 1W8OA 4RA3A 5KZCD 4GG6A 3QG6A 4FQJH 3AS1A 1JPSL 5HHQA 4MAUL 3MOAL 1C08B 3UC0L 1AQKH 1PDKA 3LB6D 1WCBA 3MLZL 1INEL 3LZFL 5CBAB 2A9MH 5TDNA 3RZCC 5JW3H 3VXQA 4JO1L 5D7JD 1S7QB 1A7OL 3NA9L 3S4SA 1W0YT 1CLZH 5C0CA 1U6AH 3V95A 2VIRA 5DUML 1UM5L 3OXRB 5DJDA 1XZ0A 4NRZA 3KPPA 4XMKH 2AABL 1GRWA 4KTYA 4QXWA 4XNUH 4X6CB 1CE1L 5ENWA 4JFXA 3WFDH 1AFVH 2DQGH 4J4PA 2F8XC 3S7GA 3EZ8A 2Q6WA 4DZ8B 1KIRB 3OHXB 4ISVB 4KMTL 3QCVL 1ONQA 4PFEA 3B2VH 4S10A 4K2UH 4BFBD 5BXFB 3WIHL 1L0YA 4U1GB 5GRUL 1E4WH 3OKDA 5IBLD 4XPTL 3SGJA 2AK4B 4PRNB 2R0KL 2APFA 1ZOXA 3V52H 2AJSH 1NCBL 5B39A 3MV01 4K8RC 3ALXA 1OGTA 4N0YH 3O3BA 4JPIA 5DC9B 1UXSB 3VWKC 4PY8I 3FTGB 4PB0L 2ZSWA 5E7BA 3V6OC 2GTZA 5JXAH 4LLMB 3F12B 4ETQA 3G5ZB 2CMRL 3QHZL 4XAKD 4WW1B 5TDOA 3O8XB 3TZVA 1VEPA 2HT2D 4LLWB 3AB0B 3JXAA 1OAQL 2DD8H 5IB3B 5E9DE 3MODL 3VGHA 4FQXC 3GMNA 2QHLA 5I0DA 4MCZB 3W81A 1S9YA 5KTEL 2J4WH 3I85A 4LCIL 4PGEA 3MA7B 3ZKMD 4O2FA 2ID5A 5J3HD 3BW9B 1UENA 1TJHL 1NL0L 4OSUH 4M1CD 1XF2B 1INQB 2PW2A 4MJIE 5DEGB 1FO0L 4LVHC 5FKPB 2Z8WC 1WIPA 3PWPB 1KYOJ 2G5RA 1A6UL 5EO0B 4P2OD 3N1FC 4EI6A 3MLWL 5HGHA 1PY9A 3D0VA 1VEMA 3HMXA 4L8BA 4NJAH 3VI4E 1JZ7A 2ZJSH 4XCEA 4PJDE 2X2YA 4JHZA 1FFQA 2DN7A 4NQXB 5DMGC 3TO2B 5JHLH 3MUY1 5FDWB 4HUMB 1TZHA 1FORH 3MLTA 3O3EA 1A9BB 3MXWH 2WIIB 3BOVA 3M17B 2VITA 2KQNA 4JFDD 4WW2C 2FJFA 4NO0D 1P4LB 4HS3B 5DA0B 3S34L 4F15B 4MXWL 3S8WA 4YNYB 3VXRD 4EUPA 1JHKL 2FRGP 1JF1A 5HGBB 3UPCA 4L4TD 4X9BA 2R8SL 2X70A 1X5KA 3S36L 4P5TB 3VCLA 3VI4F 3RVWD 5IB4A 1EGJL 5LGJB 4U7SA 1MCPL 3QDGB 1XR8A 4HXBL 4JM4L 4HD9A 3AAZA 1H3UA 4R96A 1MRDL 4JN1H 5C92A 1F6AA 3OJDB 3ZMRA 1MI5E 3PHQB 4Y7MA 5K9OA 1IFHH 2EE6A 3RWHB 3BZ4B 1NAMA 2NY6D 1B0GB 3FO2A 2Y4SA 4KZDL 1BZ9A 4NUGH 5IMLA 1AJ7H 2YD7A 4FNLH 3DSFH 4FQ1L 2V2XB 3LSOA 3PHOA 1D9KA 5FHAH 1MRCL 2DMBA 3AU1A 3T0AA 1CGYA 4EDXA 3V6OE 4YHOH 3F6LA 3FT3B 3B5GA 3TBSB 4GKSA 3UBXA 1U8KA 1KCRH 2WSKA 1LO3L 5B38G 2ZUVA 5IMMA 2DL2A 2ZKHL 5C0BE 3Q1SL 5CD3B 1DQLL 5JPNB 1Z3GL 1R5IA 3OJVC 1MCIA 4XPFH 1NKRA 3NCJL 3QJHA 4O2EB 4Y1AA 2I07B 4LCYA 3MFGB 3BEWA 4XX1G 1QFWH 1F3JB 1SVCP 1HN1A 3JTSA 5T3XL 3MCKB 1I9JL 3UO1L 1EO8H 2BCKB 4MX7B 3W39B 1GPOL 4X83A 4DTGL 1YC8A 3S35X 4TVPH 4OM0L 1DQQA 1YNLL 5MENA 3WHXB 3ECBB 1HHJB 4WENB 4MB3A 5E0QA 4Z8FL 4ODBD 2X4OB 4K9EL 3EYVB 5GJSL 3K4AA 3C6SA 4WFEE 4ODSH 3TO4A 4ZUTB 3KPRB 3GSNL 4U1MB 4KQ4L 3MXVL 4UDTA 2AGJL 2HRPL 1G9NL 4G6KH 3QPQC 3O3DB 2MKWA 5BS0D 2XRAH 3SGKA 4JCMA 3QXUA 4Y4FC 3OSKA 3T77B 1HI6A 4JRXA 5HHMD 1D6EB 5KVEH 2IJ0C 3RY6C 4U1SB 3VRJB 1QYGL 1EHNA 4WHTA 5SWZA 4RFOL 4ZO8A 3VRIA 5IBTH 4WEMB 4X7FC 2DIAA 4L3EB 2CXKA 3HUJE 2ED8A 4N68A 4RAHA 1CDBA 3IDJB 3STLB 2V2TB 4JRYE 2V2WB 4JZJA 4HUVA 3BRFA 2VZ3A 3VFGH 4F37K 5J06A 5C08A 3ZL4L 3IFNH 3PL6C 3IU3A 1KN2H 4UZGA 2V9TA 3PP3K 4ZXBA 3KR3L 4WW2F 3SE9L 5FECB 4PJHB 4P9HL 2IADA 4NKIH 3O6FC 4MA8L 5BV7L 2PTTB 1AO7A 2P24A 1G7HA 1R3LA 3HUJF 3QUYC 4EUPH 1WAAE 4YH6A 1NMBL 3CLEL 1A9EB 5TQ2L 4QXTA 5H94A 5E5MA 2EDJA 4PGBB 3FB5B 1HCFX 2WUCL 1INDH 1CFSA 3RUGA 5DYOA 3HG1E 4DAGL 1S5HA 3DYMA 1J8HA 4I9WE 1QVOB 3HRPA 4KKNA 1KC5H 4C4KO 1ZHKB 3RL1B 4KGLA 4XXCA 1JV5A 3LKOA 2AK4D 4MNQE 1NAMH 2HH0H 2IFGA 1ZHNA 5DJAB 2P49B 3QI9A 3RI5K 1WAAF 1P7QB 4J23A 2Z93A 4I18A 3DVGA 5E6ZA 4NCC2 2HFEB 4K7FB 2W0FB 3STBA 2H32B 4UDUB 2M1KA 2YK1H 3MRKA 5D7LA 1C5BH 4G3YH 1WFOA 5IJKC 1FVDA 2ATPB 3MRRA 3O8XD 2Q86A 2CDEA 5D1ZB 3FQTA 3HZYB 5I8KH 1Y6NR 4QRTB 1GOFA 4RAUB 3I75B 3ALWA 5ESQB 2R1YB 3V7MA 3K4ZA 3ZKNC 1GOHA 3GB7A 1DLHB 3ZSSA 1N8ZA 4OUOA 3M8OH 5EU5A 3VFPA 3P73B 3MRJA 2HT4C 4KTDL 3JBG7 5AWNL 4NYLB 1L7IL 2QR0A 3OF6A 2QTEA 4WO4B 1YEDA 3QO0B 2VDNH 3TCXA 5T1DH 2XA8H 4OCRH 1I1CA 3ARDC 1IGML 1TJIH 2DQDL 4ONHA 4YR6A 2DLIA 5F7DA 4X6FA 3QULB 3VXPB 1OF2A 2GSIB 1YYLH 4I5BA 3U9UB 2NX5A 3QHTC 3U7YL 1J0IA 2X1QA 2XA3A 3QEHA 4XC1L 1NGXB 3EKCA 4N1EA 2BY1A 1FFOB 1ZHBB 1GGUA 1OP3H 2LABA 4OLUH 1ZHLB 3QDJE 3MBEC 3U7WL 1F00I 5J8OA 4NWUH 3BE1H 4NP4L 1EMTL 2WWMC 4NRXA 3NOIA 1T4KB 1KB5A 4OZGE 4TPRH 1IRAY 3MGOA 2YZ1A 3QFJA 4RZCA 4YZFE 5E6IC 1CFTA 4GKNA 3OKYA 1DDHB 1YN7A 2NY3B 4MYWB 1L7TL 1Q9WA 3C8KB 3L3GA 1F4WL 2BX5A 4HF5H 3V4VH 2Z35B 2NY1B 3ISWA 4CJ0A 3B2UC 3GJFH 5D7IB 3WNLA 2HLFD 4RCAA 2CLRA 1NAKH 2VSCA 2VOTA 1IGJA 3IETA 12E8L 1DP0A 3SPVA 3ABZA 3X17A 2ZCKL 4XNZB 1BX2A 2ICWJ 4CVWA 5CKAA 4OZGF 3HRZA 4K3EL 1LMKA 2AQ3A 2F53B 3EO9L 4YZFF 2ERJC 3QIUC 3RWFA 3FFCD 2R1WB 5EIIA 5HHVL 2VN4A 4XBPA 4LLUA 1F4XL 4M3JA 1IARB 1Q9KB 4LQFH 5GGTA 1TJGL 1BPVA 1E4XH 1FIEA 5DQ9A 4G7YH 1UFUA 5TDPB 3HAEG 5C7XH 1XH3B 4X7TA 3DMMA 4PJ7B 3NABL 4HWBL 3QA3A 4PP1C 2CUMA 5L8JB 5SWSA 2XN9A 3MLSL 4IJ3C 1K6QH 2AXFA 1ZE3C 4M61A 1UKQA 2A38A 4NUJA 3M1BA 1U8MB 2P43B 4H26A 3WS6A 2JJTC 1FAIH 5HJ3B 2FGWH 1BQHG 1RAMA 2EDOA 3N50A 4W81A 4RGMB 2VL5B 1JMXA 2HLAB 2ZPKH 5EUKB 4RFEA 5JQHC 1QFUL 1FVEA 4TSBH 4QKXB 1RFDL 2B1AL 3QISA 1A5FH 1N5AB 4MHHI 3PABB 4NC0B 4X4YA 2QHRL 4JRWA 1BGXL 3DRTA 5C0EB 2H9GA 4KK8C 1I8KB 4PY7B 3P4MA 4OLWL 5JW4Q 1FRGH 4X0KB 3O6LH 1XMWA 4U1GC 2X1PA 3BDYH 3L1OH 2WBJB 3HCVA 4OJFH 4TYUA 5IKCA 5EULV 4XP9L 4KUZH 3H7BB 4GBXB 4PJFB 1KTLB 3BT2L 5IK3A 2DQHH 3THMH 2IAMC 4J3VA 4AH2A 4L3ED 1IKFL 4BM7A 3TVMC 5JORB 1RZ8A 1MVUA 4WEBL 5I71C 2DQFA 3U46B 1C16A 1ZT1A 1IVLA 2P42B 2W60A 3FQXB 3VDAA 4KJYA 3E0GA 1UWEL 3IFOB 1PJ9A 3G9AB 1EUUA 4PRIA 1XIWC 1FNGA 2FCBA 2O5XL 3G9VA 3QRGH 1IEHA 3AB0C 4O58L 1PGRB 1OPGH 4M1GH 5FO9A 4G9FE 1U8NA 5JUEH 1UYWL 3GI9H 3MFFB 1A7QL 1LO2L 1YEKH 1M7DA 1E28A 3VXUD 1OAYL 2CLVB 3HMWL 3B3IA 1TQCC 3MJ7A 3SDXB 2VXVH 3KYNB 3FKUS 1D5ZB 3RX5A 1N6QL 3W0WB 3LQAL 4M8QB 5IW6B 2VH5L 2XZQL 1FV1B 2YN5A 1NUFA 3RWCA 5T3ZL 1DFBL 3FO1B 3KPMA 1F4AA 4JG1L 3LCYA 4NQVA 3NTCL 1UACL 3DX6A 4HKXB 2F19L 4L9LA 3AXLB 3UPRA 1TDQA 5TJWK 5EU4B 1RK0A 5IJVB 2YN3A 4QOKB 3RPIB 1P7QD 3KPSD 1QSFA 4HC1H 4XH2B 1NSNH 3UROR 3LKPB 1GAFL 1EBPA 1NLBL 1HILB 3WSQH 1JPGB 1KG0B 3IDYC 4X6CE 1KEML 4GUPB 1A7RH 5GGTH 4WV1C 2F58L 5D1ZD 3SE3A 4GXVH 3EAKA 3NGBB 3ARGC 3I84A 5D2NB 5DD1H 2AKRB 1C5DA 1I85A 5DJ0A 1KJ2A 1KYOK 5F89B 5HYQB 5BZWB 2YPLA 3JV4B 5CP7B 2NZ9D 4PJIB 5L88L 1VFAA 4DK3A 4QHLB 3G6DH 4TUKH 3SDCD 1Q8MA 4KQ3H 4HH9A 1U8LA 4NWTH 4WO4D 5IOPB 4ZFOB 4Y4KB 4WFHD 1UB5A 4AQ1B 4GW1B 2ICES 3HPLB 3ILPA 1HHIA 4X6CF 4KZEH 2ZCHL 3BZEA 2QQKL 5HVGB 4P23B 2UZYB 3PP4L 2NY5H 3QQ9C 4HGWB 5LGHH 5DJZA 4O2CA 4Z7WA 4P2RB 3MUHL 4O4YL 1ZK9A 2X4NA 4EBQH 2CRIA 3RVVD 4P9MH 4Q9CA 3NPZB 1MUJB 3MLVH 3DV6B 1T1YA 1PKQA 3GIVA 2E6PA 4OB5H 2WZPD 2ZUSA 1YNTB 4MA7L 4DWHA 1DBML 3HZMA 1ONQB 1A02N 4DN4L 2JK5B 4BSJA 4NKQB 2CRZA 5E2VH 2FL5A 4XVSL 1WEJH 5DK3A 4OCLC 1I3GH 5CS7A 4F9PC 4I2XB 4BSWA 1YMMA 2Y07H 4TOYL 4XXDA 5HY9A 2OJZL 3EW3B 3I9GL 2NY3D 4JQVC 1PG7W 1ZGLP 2VDOL 4IM8A 4MQTB 2X4TA 4D9QE 1ND0B 3PWPE 1B3JA 2VLME 4M7JH 2NY1D 2L4OA 3MRBA 5FO7B 3PWJA 1MWAA 4PRAB 1JNLH 3U0PB 1YEHH 5EORL 3Q5TA 4M9PA 5DC4B 2WP3O 3WL9A 4OTXL 3NA4A 1HXYA 4L8DB 3C08L 4WFGE 1BJ1H 4UT6L 5DR5L 1WGOA 1WZ1H 4F7TB 2E8YA 1SMOA 5EZOL 2HKHL 2JJWA 1GZQA 4H1LA 1MEXL 2H2PC 5ESVA 1SMAA 5MP6L 1JNHA 2BRRH 3MRGB 2HTLD 5D8JL 2DTMH 2OL3B 2I60H 4MAYC 1X5LA 4M03A 1YDPB 2MQ0A 4FRWA 3IDMA 3GMOB 5JOFB 3LKQB 5DS8A 3OKKB 1CE6B 3V7AG 3QDGE 5KN5B 2BVUA 3WDJA 4YHMH 2GSGB 3LN5A 3RAJL 1G7PA 4PP2B 1X4YA 1H15B 3O3AA 3GMLA 5TFSL 2GJ6A 1IGTA 1J0KA 2CJUH 4OV5A 3P30L 4ELMA 1MHPH 4N1CA 1N4XH 3S4SG 1TXKA 4YIQA 7FABL 4ODUB 4R0LC 4GW4B 1Z5LA 2AXJA 4GH7B 2KZ1B 4FFYH 4ODHH 1CYGA 4M5ZL 4DK6A 5C07B 2YS4A 2EO9A 3NFSH 5GSRB 1R3KB 2IQAB 5EBMA 2Q7NA 5D7KD 1IQDB 5ITFB 5HD8C 1PSKL 2DL9A 1AQKL 2FD6H 3G6AA 1EXUB 1KJ2H 3IKKA 1QR1A 2BVYA 1RZJC 2J5LB 4I13B 2NXYC 2WBJD 2VNCA 1MJUH 5HYJA 4HJGA 5JW3L 2FBOJ 4KXZI 4KRPC 4OLYL 5J0BA 1EHLH 2DWDA 2X9WA 5D6DC 3HE6A 4LL9A 4JFPA 3IDXL 2R1XB 1E4KC 3I6LE 5B39G 4JLRA 4HWNA 2WINB 3EJZC 4NQEB 5DEFA 3T1FB 1T66D 3F5WB 4DVRL 4IDJH 2A73B 1NGZB 5EU3B 2F5AH 4PIRF 2MCG1 3AREC 4RNRB 2Z8SA 1AHWC 5D72H 1AFVL 3QXVA 5FYLH 5GSVA 4ZDHA 2JTDA 4HX1A 1JGUH 5DWUL 4JB9H 3CZJA 5FO8A 3KPRE 4LCWE 4M93B 5IVXB 5EWIH 1SJHB 1HSAB 4NRYB 4AM0A 3QG7L 4JFQA 1Y18B 4PJCB 4G42A 5EOTA 4AY0A 3UTPE 1VPOL 4FXGB 3L95B 4IRJB 1OAKH 1UWGL 2AJSL 4JZOB 3W0WD 5IIEB 1TNNA 1VACA 1NCTA 5E4IA 2YHGA 4N0YL 4OQTA 4R97B 2OP4H 1FZKA 3SKNA 4G80B 2P47B 3LPWA 2X4SB 3LQZA 3G5VB 1FDLL 1A1NA 1FE8H 5B38B 3OZ9H 4QRUB 2HN7A 4TULL 3ZE1E 4RFNB 1MWAH 3FN0L 4RAVA 4PJGB 4V1DE 4H0HB 4FQIL 1KXVC 4U1KA 4QOKD 2PN5A 4K8RD 5IQ7L 3LVEA 6FABH 2OXGA 3EGSA 3QEGH 2DD8L 1CDGA 2CRYA 4PJHE 1U91A 5CJ8A 3DGGB 5BJTA 2WK2A 2PXYB 1UH4A 4H1LH 3CLFH 4Y16C 1QBMH 3IRZA 2I9LB 5HHXH 1FHGA 3DECA 3MJ8A 3W9EB 1YEJL 3ZE1F 4MJ5A 2EO1A 3JV6A 4S1RH 2V9RA 1PZ5A 2D3VA 4Y5VA 3CZFA 1IJ9A 3RRQA 2LVEA 1MVFA 2Q7YB 4H25A 2Y7QB 3KAAA 4PJHF 1T1XA 2WIMA 2J8OA 1OAZH 1NGYB 2OCFD 5D7JA 4HT1L 5TH2B 2QSCH 3HR6A 1MJ7L 4Y4KD 1Z9LA 2QADB 5FYJU 1R5VA 3CUPA 1FORL 2OMNA 1SBSH 3MXWL 1F45A 4Y2OA 1U3HB 5HVWA 5CINH 3MLYH 3RGVB 1N0XH 2D7NA 3V4UL 4G43A 5FGBC 3KXFD 5GS0H 2XWJA 2FHBA 3L7FA 5F97E 4AEHH 4FXLA 1B2WH 3MNZB 4NKOA 4JGJA 3NH7L 3EHBD 5D71L 2VZVA 5I1LA 2UUDH 5GS2D 3MRNB 2EDYA 4JN1L 4N8PA 3MUZ1 4G9DB 2D31A 3ES6B 2BSRB 1I9RH 1UZ8B 3VRLE 2MFNA 5JHDB 2G60H 2DJ4A 3WCYA 1L6ZA 3LD8B 4FNLL 1HHGB 5EPMA 3DSFL 3HS0A 4U3HA 4PJ9B 1YEFH 4FQHB 1XGYL 1HSBB 2CKBB 1DVFB 4G8EA 4YHOL 3D39B 3G5YA 3Q5OA 1FH5H 1YYMH 4HS6B 1FJ1A 1BVLA 1ES0A 1KCRL 5DD0H 1L0QA 3RWEB 4ONFH 2YD8A 5AAWA 2RQ8A 3CDGA 3EIFA 3BIBX 3PUCA 3SJVB 3P0VL 3F7VA 4ZPVA 2FIKA 3VRLF 2FJGA 3JUZA 4LHUA 4KKBC 3VD9A 1CGUA 4XPFL 3TPUA 2X7LB 4OLZH 1MREH 5D1QB 3T3ME 5DT1H 1RZKH 4DN3H 3CPLB 2B7DT 25C8H 4UT7H 2RIKA 1EO8L 2DWEA 1LO5B 4OQTH 4CGTA 4GBXC 3EYOB 3IDGB 2JCCB 4OZFH 4XAWL 4TVPL 3LMJH 4KI5C 1XF3B 4HAGA 4Y2DB 4KJWD 1TVBB 5I2IA 4PV8A 4QCIB 4P2OA 2PF6A 2VJXA 4OLXH 1UEYA 2X4PA 5J1TC 1IAMA 3DSNA 5E8OA 1U8QA 1HZHL 1F4YH 1RUQL 4XT1C 5HYEA 1HHKB 4X7DC 5BW7C 5EB9A 3NCFB 2JELH 1CD9B 3P9MA 3FONB 2YD2A 3MV7B 5C0AB 3S98A 4JFDA 4GKZA 4KTEH 4NO0A 5DHVA 4K7PY 4ZYKB 3L9RA 2E7LC 2KL6A 3EO0A 5C07D 3VXRA 2F53E 2PCPB 1T6WA 3QO1B 2FLBT 4JAMA 3HNSH 4WWKC 4L4TA 3RVTC 4AJ0A 1I8MB 2BOCA 3BN9D 2CDGA 4BH8B 2D7OA 3BPOC 3GEWB 3QPQD 1CDYA 3TNNB 1HOCB 1EEYB 2I24N 2W1NA 3HMXL 1TZIA 4P5KB 2ICWI 3VFGL 4QF1B 1I7UB 3LEXB 3IFNL 2AK1H 3OV6A 5H2BB 1T5WB 1KN2L 3OKOB 2N4IA 1WJ3A 3GDBA 3MYJB 4M43H 5E5RB 2Q76B 3QXDA 1QLFA 4NN7C 1F8TH 4NQED 4NBXB 5LQBL 1MJJA 2R0LH 3U0WL 1WFNA 4Z95L 3U48A 1HDMB 4UINH 4LDOB 1YJDH 4BQ6A 3TYFA 1A64A 5EUOE 2DQTL 1T83A 1INDL 4YDJA 4D0DA 1IGYA 2A1WH 3QAZB 1BD2E 1IBGL 1X5FA 3H3PH 2ADIB 2GK2A 2XPGB 2ZZUT 5D2NC 3JTTA 3VI3E 2FX8H 5J1AA 4XWOC 3L7EA 2DIJA 4E41D 4G6AD 2OJEA 4LCUA 3ALPA 4IRJD 5H37H 3MMEA 4XI5C 1CL7L 2ADGB 4U7MA 1A6PA 4JKKA 4JQXA 3F62A 4K3GA 5A2KH 1P6FA 5EUOF 4JFOA 4P2YA 5TGBA 4KI5E 3IGAA 3HZKA 5FCUL 5JW4N 1WC7B 5GRWA 2P8PB 1YQ2A 1DQTA 3JWDL 1KPVB 5HGGS 4P23C 3GSWB 1C5BL 4G3YL 3VFVB 3V6FB 3VI3F 3T08A 3LV3A 2C4FU 3VGAB 1DBBH 3HAEB 4G5ZH 1JGEB 3MREA 3HE7B 3VMPA 5I8KL 4CN6A 4PJAB 4GG8B 4XVTH 1EV2E 5F3HA 5BS0A 3PHSA 4NNPH 5F6HI 4OD3H 4KUCF 4QTIL 2B0SH 4J3OC 4PJFF 1P2CA 2PXYD 3M8OL 3H9SD 2VRAA 4ZS6D 5I74B 5CSZA 2G9HA 3HB3D 3SDXE 4U1LA 4HZAA 2VZSA 2XWTA 3CNKA 1OSPH 1BQHB 4FQQA 4AT6A 1CGSL 1CD8A 3LEYL 5C1MB 2R2BB 4BH7B 4ZUUA 3X13B 4EN3A 1UB6A 1NPUA 1ZSDA 2VDNL 4UV4H 2XA8L 4OCRL 1MCOL 2OI9C 3KDMA 5E00A 4HJ0C 3ZLQC 1HNFA 5FEBA 1UGNA 2X40A 3BXNB 4BELD 1X6NA 1X7QB 4XNXH 1DQJA 5I17A 4K9EC 4QHKJ 1YYLL 2MSPA 4F7PA 5KVDH 2ZUQB 4ZAKA 2FWOB 4X6BA 2YBRB 3WBDA 2QADD 3R1GH 5C0IA 3SDXF 2UZIH 2EICA 1G9NC 2XFXB 5I73B 4HK3N 3TJHC 1U3HD 1Q94A 5DHVH 3RGVD 2BVQB 1IC4H 4NWUL 3BE1L 1GYAA 3GZKA 2E27H 4YHIB 2R0WH 3BPNB 3C2AH 3CVHB 3S88H 2KKQA 3UTZB 4DZ8A 1KIRA 5IW1B 1LEKB 1WVZA 1MHCA 3BHBB 4DKDC 1MQKH 3MR9B 3OAUL 1WTLA 2GHWB 2ADJB 4NO5B 4N0UA 5D2NE 3FRPA 3L5HA 4N5UA 1YUHB 2LAAA 2HWZL 3N9GL 5E99H 4YFLF 2AK4A 4PRNA 2LU4A 4G8GA 5DJYA 1JHLH 4YWGL 5E2JA 4OCYH 1ZVHA 3QEQD 5I6XC 5JDSA 5DMJB 4PJBA 1P4IL 4P9HC 1UXSA 3VXNB 3FTGA 2X10A 2V5TA 5BV7C 5LBSL 2RFXA 3MRDB 3ARFB 5JW4R 1DVFD 3F12A 4P4KD 3G5ZA 4BKLA 1FZMB 3AUVA 2FH8A 3LKNB 3D39D 4WW1A 2OK0H 3B2UD 4Y5XA 2X4QB 1F97A 5F1IB 3O8XA 4JCLA 3O2VH 1VSCA 4P2RE 4LLWA 3BP7B 4JZNB 5F1SA 3RU8L 1CF8L 4RMQA 1F3RB 3SJVD 2ORBH 5IFJA 9CGTA 4YBQC 4R8WL 3K7UA 4G7YL 3H7LA 3WUZA 5IB3A 3FZUC 5D1QD 1PG7L 3PXJA 3F7YB 4EJ1C 4JDTL 4MCZA 2J5LC 4IRSC 3S36X 2NNAB 2BVTA 1T2JA 3BW9A 3IDNB 5T3XE 3BH8B 3DETC 4KKCD 2UYLA 4JKPL 1ORQB 5DEGA 1EVUA 5FKPA 3GBNH 4Y2DD 4I2XE 1EEUA 2D0GA 4Y8AA 4HKBA 3GRWA 3ME0A 5DJCB 1QNZH 2ZPKL 5J12C 4TSBL 4LCCC 4RDQF 1YPZE 2EH7H 4G6JH 1WFTA 2EE2A 2OR9H 5FFLA 3UDWA 5FDWA 5KANI 5ISZB 4E9LA 1A9BA 3MV7D 3O4LB 2WIIA 5FAAA 1Q9OA 1A4JA 5C0AD 3DI3B 1ACYL 4HH8A 3BDYL 4MDIB 3HFMH 3L1OL 4NQCB 2B4CH 4OJFL 3H0TB 4HS3A 1NBYB 4YNYA 2IMMA 2VXSH 1BFOA 1NBQA 5IBUG 2UWEB 4X9FA 3THML 1T7XA 2OTWB 1RU9H 3A6BH 4FZ8H 1R0AH 4R97C 4M62L 3MNVB 3MA9H 5F7EH 1OTSC 1YPZF 4XHJD 1J8KA 4LMQI 5GGRB 4P59H 4BFEA 1OP3K 3OJDA 3D85B 1GHFH 2XOTA 3PHQA 3RWHA 1U41A 3BZ4A 2R4SL 1B0GA 3I2CH 3QRGL 4M1GL 4KHTL 4MZ2A 3RWIB 3MJ9A 5JUEL 3QJFB 5AG8A 2DJUA 1CL7I 1PY4A 1YEKL 4RIRA 2XG5A 1MQ8A 1KV3A 4H5SA 3FT3A 5E2UH 5IG7B 3DXAB 4CMMA 1I1FA 3FFCA 4OKDA 4S1SH 4KHXH 1KB5L 1AGFA 3GJFK 4PV9B 3TBSA 2W0LA 5T5NG 1JF6A 2GW5A 4JO4H 1S7UA 4NJ9H 5ITBL 4OFIA 1A6VH 3UBXI 5CD3A 2OR8A 4PLKC 2A0LC 2Q3AA 1PYWA 3DROB 4DQOH 2W9DL 4XP1H 4JPVH 1XF4A 2I07A 1SYSB 4AENA 4BZ1H 5C2UB 3DTXB 1NGQH 2VB5A 2VDQL 1F3JA 5JDJA 2HJKB 3AVEA 5HHNB 4TNWK 3UTSB 4OZHE 1KJ3L 2IALB 32C2A 2BCKA 4HUXB 3W39A 3KYMA 1YY8A 2PO6C 1XGPB 4X99B 2BSTB 4XCYB 4ZD3L 5KW9L 4GRWE 5KSBB 4OFPA 1RD6A 1ZT4B 3X11A 5FYKU 4LEOA 3CFKB 1U8JB 5IT2H 3VGDA 4GG6B 2P5EE 4UQ2B 4ZUTA 3CSBA 1A7RL 4S1DD 5I8OL 5HHQB 3EDDA 4GXVL 2MQCA 3ULUE 5HSFA 2LAGB 1WCBB 3D2UD 1IGIH 3RIAF 3GNMH 3O3DA 1NQBA 4OZHF 1SM3H 5DD1L 1J0JA 3ZZ1A 5TDNB 3T77A 1Y0LA 5DFVD 2EEAA 5LKNA 1D6EA 5IVXE 4U1SA 4GRWF 3VXQB 5EC2B 3TT1H 3G6DL 4TUKL 1KEGH 2UY7A 4KQ3L 5C0CB 3S4SB 5F9WB 1CBVL 4NWTL 5HDOA 2VIRB 4L3EA 2BNRE 1K3IA 3TBTB 5DJDB 1XZ0B 4MQ7A 4OI8A 3JV0A 4NRZB 3IDJA 1LILA 4S1QH 2Y5TB 5GGUB 5DXWA 2V2WA 3GRWH 3ULUF 3PJSB 5ADPL 5ENWB 2NY5L 1NEZG 4JFXB 5LGHL 2ADFH 2IBBA 4WI2A 2DQIL 4L8SC 4MWFA 4HWEH 3ARZA 4DUVA 4A2MA 4EBQL 2P44B 4LKCA 5IVXF 4TSAH 2DQEH 4EXPX 4U6VH 1H3XA 2R15A 3TC9A 1J1OL 2J2ZA 3MLVL 4QRRB 3MLRL 1KSRA 1EEZA 1R3JA 2PTTA 3OKDB 5J89A 5DD3H 3VXUA 4OCMC 5H8DA 2XT1B 4PG9A 2VTFA 3BWAA 4U0RB 3ARSA 5B39B 1A9EA 3B5TA 2YA2A 4PGBA 4Q97A 1I3GL 4H1LG 2FDBP 2H26A 4JPIB 4YQXH 4RISH 2E7BA 1FL3B 2Y07L 2ZSWB 3QZWA 4PLJC 4S11A 2GTZB 5HI3C 5K9JH 2DYPB 1QVOA 4ETQB 1Q38A 2YD9A 5CZKA 1RMFL 1HKFA 1NJ9A 3TZVB 5JPMB 3RTQA 1YEHL 3O4OB 5LWYH 1PFCA 3G08A 4QLRA 3I6LD 3KPSA 2DICA 5JOPD 1B4RA 2HYMA 3WJLA 1S7XB 3P4LA 2XIDA 2W9EH 3GMNB 4C59B 4BZ2L 1S9YB 4K7FA 1WZ1L 2JJSC 4PGEB 4R4BA 2H32A 4J1UB 4UDUA 2NXZB 1JWMA 3CSYB 1S5IH 4OZIA 5I1KH 2DDQH 2ATPA 4JM2A 2BRRL 4Y19A 2PW2B 3LQAC 1ZLWH 5D1ZA 3HZYA 2DTML 5IESL 3BGMA 3FT2B 4RAUA 3X12A 5ESQA 2R1YA 3IU4L 1JRHH 4EI6B 3MJ6A 4KKLD 3MLUH 1W0WB 3D0VB 1AGEA 2AJYH 3ARBC 4YHML 4FABL 3P73A 3BKMH 1MJ8H 3QPXH 5ECJE 5KSVA 3SDCA 1MFAH 5CGYC 1ZTXL 2EDXA 4WO4A 1ULVA 2AQ2A 3O3EB 5JHDE 3QO0A 4OD1H 1MHPL 2HTKD 1NCWH 2PUQT 1QPPA 2WUBH 4YGVA 3IVKB 4KKAD 2ESVE 4FFYL 1G84A 5INCB 1JF1B 1OGAD 1EUTA 3QULA 1I1AD 1H5BB 3NFSL 3BX7C 2X70B 3VCLB 1X44A 3I3EA 2X42A 1EA9C 1NGXA 5F9AC 5ISZD 2FD6L 1CDUA 1XR8B 3O4LD 4JREB 3AAZB 3UJIH 1ZHLA 3RWDB 4NQCD 1F6AB 4MLSA 4ZNEE 5K9OB 4B7LA 2QL1A 1NAMB 3VD5A 3TA3B 3FO2B 5L0QC 1RIUH 4PR5B 1CI5A 1BZ9B 5GGQH 4YUEH 4HBQA 3N1QC 1OSZA 3LSOB 1D9KB 3KS0J 3GBLA 2Q8AH 2Y36H 1JBJA 2WBKA 2BJMH 4EDXB 3C8KA 5IROC 4OZFG 4J6RL 4EQ2A 2F5AL 2RR3A 4GKSB 3UJJL 2VLRE 1WCQA 5IMMB 1Q1JL 1JGUL 3VGAC 1C1EH 5JNYA 1GGIL 4PJ5B 1IM9B 1HQRA 5D2LE 4X9HA 4LCYB 1CWVA 5EWIL 1LO4H 4JG0H 2LU3A 1S78D 4JGMA 3JTSB 4GAJH 5I9QB 3DXAD 4F33A 2V7NA 3OAYH 5DFWH 5I74C 2JIXB 4HIJB 2VXQH 1TFHA 5T3ZE 4PB9L 2JLLA 5TDPA 4KU1A 1XH3A 5FA4A 3V0VB 3K1DA 4PJ7A 4MD0B 1SJVA 5D2LF 4I3SL 1LEGA 2VZOA 4O02L 3CGTA 3UTSD 4EI5A 4JANB 4UDTB 4RMUA 4D0CA 1NGPL 2ZUQC 4H0IA 3DX7A 1CTOA 1U8MA 4B5EA 5GQBA 4E42B 1OVZA 2JKXA 1T2QH 3C60B 5I75B 4POZD 4DVBB 4XVUC 4JRXB 4IMLB 4OM1H 1JYWA 3C6LC 3E3QC 4JFEB 5FK9A 4W6XB 3O11A 3CLFL 2OM5A 5EN2A 4KROB 5EUKA 1QBML 3CFDB 3VRIB 5HHXL 4XP4H 3O9WC 2VUOA 1DQMH 5GPRA 3MRQA 5DLMH 4EDWL 4W4NA 4JZJB 3LEVH 2VZ1A 2I25N 4LSPH 3OKNB 5EZLB 2EZ0D 5BRZE 3ULVE 3GJFB 4UNTA 5C08B 2DRUA 1WICA 4MB5A 1G6VK 3IU3B 5JTWA 5HVHC 1OAZL 2OQJA 3H7BA 1KTLA 5C0CD 2QSCL 2Z8VC 2IADB 4LLDA 3SBWC 4PJXB 3ZE0E 5E8PB 4N5EC 5H37G 1AO7B 1SBSL 4NQDD 4AG4L 1A3LH 1FPTH 1B4JH 5CINL 1KGCD 3RA7H 3U46A 5ICYA 1QHPA 3FQXA 1N0XL 3ARFC 3QUMA 1ZMYA 1A7PH 1TETL 4HV8A 3E2HB 4PJDA 5FUZL 1BFTA 1CFSB 1B2WL 1CN4A 3ULVF 1P7KA 1X5AA 1CDCA 5DYOB 2RCSH 1MLCB 4DEPC 3GIZL 4QRRD 4LVNB 3MROB 3LPFA 1JV5B 1KJVB 3LKOB 2CLVA 3ZE0F 3V2AR 4PLOB 3TT3H 2VDKH 1GOGA 4ERSH 5E24E 4LHUG 3Q0HA 1D5ZA 1ZHNB 3QI9B 1V3KA 4HIIA 4M6AA 3W0WA 4M8QA 3AY4A 1NFDB 5C86A 2Z93B 4UU9B 4U1IB 4WU7A 5JMOC 3ARTA 4X8JA 3WNOA 1SEQH 3MV9E 4MD5A 2DYPD 1YEFL 3REVB 5D7LB 1KN4L 5I76B 4HKXA 3AS2A 1ED3A 4GW5B 3MRRB 5J6GA 3FMGL 1G6RA 2Q86B 2CDEB 1T2XA 3FQTB 3MOQA 5DD0L 2EIBA 4ONFL 3RPIA 3FT4A 3CX2A 2NY4C 4HGKC 2WV3A 3LKPA 1N8ZB 3G04B 4OLZL 1MREL 2VABA 3VFPB 2IANB 3V6OA 3MRJB 1K85A 3E3QE 1RZKL 1UCBH 1BBJB 4DN3L 1KG0A 3BYYA 2QR0B 1F6FB 4UT7L 5I1AA 5KS9A 5IEHB 4PJEE 4QGYA 3GKWH 4X6DB 2YRLA 2PYED 3WEXB 3DNKA 2KUTA 3EYSH 3JUYA 2AKRA 5FV1L 1J11A 4DW2L 5F89A 3VDCA 5BZWA 4OLXL 2YR3A 1ERNA 4X6FB 4YDKH 3ZHDA 4PJIA 5F88A 1OF2B 4OFYD 1MHEA 1DZBA 1QRNB 4I5BB 1FZJA 2NX5B 3C5JA 4YE4H 4QHLA 1MELA 3KPLB 3QEHB 5IOPA 4CVUA 4ZFOA 5TF0A 4Y4KA 5GRZA 3LDBC 3GSOB 4ZODA 4GW1A 3QNZA 5DMYA 1OLLA 4PJEF 5ACZA 1FN4A 3RKDC 4H20L 4KTEL 2IF7A 4PUBH 3S37X 4NRXB 2H8PA 3A6CL 3KXFA 5T5FH 3LQMA 4PRPB 1NCDH 3U2SA 1IL1A 5IFAL 2APXA 4YC2C 1CFTB 2AXHA 4GKNB 4R4FH 3HC3L 3RDTC 4GO6B 1Q9WB 3L3GB 4HIEA 2FYYB 1IGFH 4OGAD 4QWWD 5DJ8B 3N85L 1KTDA 1IGJB 3TA3D 4OLVH 1JGVH 5DD6A 1OWRM 1FQ9C 4MQXD 3SPVB 4M43L 1BX2B 4HIXH 1BM3L 3HUJA 3TH4T 3ZYJA 4I0PC 4XP5H 3P0GB 3KPQB 4K7PL 1EJOL 4I3RL 3QCUH 1IEBA 3EYUL 3QUMH 4RWYL 3BYTA 1QSEB 5BVPH 2UUDK 4XBPB 4LLUB 4YHYB 1YJDL 1N64L 4PRAA 1NFIA 2NY7H 2FB4L 1LVEA 2G5BA 2NR6C 5KJRH 4GRMB 3Q6FA 5DQ9B 1KCKA 4M4PA 3H3PL 4L8DA 4NFCA 4PJ5D 4X7TB 1CZ8H 1IM9D 2ZG2A 5DUBA 4OCXH 3GUTA 4WI5A 4YDLC 3X3GH 2BVOA 2FX8L 2J1KA 1AKJB 4WJ5B 5DZNA 4F7TA 1OQXA 4M5YH 4L4VD 2HMID 2FECI 4C56E 2AXFB 3GSRA 4P46C 1JI1A 2JIXD 4M61B 2A83A 3M1BB 5KSUB 2V5YA 3BD3A 1E0OB 3NAAH 5EOCH 1YDPA 1A6WH 4Y5YC 5GRYA 5EBGA 4ALAH 2LU7A 3LKQA 3QDME 1H3PH 3REWA 3OKKA 1CE6A 4TSCH 2BOBB 4RFEB 2IC2A 1G6RH 2GSGA 2NYYC 4OUUB 1OWWA 4J4PC 4MNQA 5CAYB 3GI8H 2X09A 3VG9C 4G5ZL 3TN0D 4K8RH 4X4YB 5C0JB 3DRTB 1MPAH 3BKJH 2OYPA 1L0XA 2HFGH 2XWBA 4XVTL 3C60D 3P4MB 3QYCA 2V7HA 4NNPL 2DKUA 1A7BA 4ODUA 3HCVB 1N59B 4Y4HB 3SKMA 4JFED 5IKCB 4KDVA 4GKOA 4UV7L 3LPGA 4R6UA 4DGIL 5C07A 2JE8A 5GSRA 2IQAA 2NY2C 1WZMA 3OG4B 1OSPL 1CCZA 3I50H 4FA8A 4XCNB 1RZ8B 4E0RB 1MVUB 4OI9A 1G7JA 2DI9A 2J8UA 2DQFB 1EXUA 2W60B 1LE9A 3R8QA 1JNNL 3O2WH 1BOYA 2BY0A 3GM0A 4LASH 4RQQA 1P4BL 4ZPTB 4Y0GA 1X5YA 4XNXL 4JO3H 4J3TA 1WSST 4PRIB 5DQJA 1FNGB 5KVDL 1UT9A 3TZVC 1P9MA 2R1XA 4LAQH 1U8NB 1JZ8A 1E27B 2C3VA 2UZIL 1AO7D 3NZHH 2WINA 5ID1B 4NQEA 1CLYH 1E28B 1M7DB 3KNBB 5TE4H 3T1FA 5IBUB 3MJ7B 5IUSA 1TNMA 1IC4L 2X5PA 5EU3A 1J7VR 2NXZC 4RNRA 1XFPA 1LO0H 1BEYH 3AMLA 5B8CA 3B8SA 1A3RH 4LHQB 3LH2H 3RWCB 4XNYL 3ROOA 3PL6A 3MQIA 3STZA 5JXEC 1JYXA 4GG6E 1NBZA 2WNGA 5EDXA 5GZNC 3WXVH 1MQKL 1MFBH 5I1IL 3DX6B 3V7AE 1HSAA 3BMWA 4PJCA 3UPRB 3KJ4B 4E41A 5LG1A 4QRSB 3BAEL 4FXGA 3N1PC 3L95A 3EUUA 4HK3J 1JHLL 3PDOA 3QI9D 4JZOA 4D0BB 1X4ZA 5I1HH 5IIEA 2D9CA 2XZCH 4PBXA 5I1EH 1N0LA 1I7RB 2DAVA 2Z92B 2FBJH 2MPAH 4G80A 1NUGA 1JZ6A 5ICXA 4MVBC 4LPVA 2XXCB 1LGVA 5LCVH 1NC4A 3DOSA 4GG6F 1MY5A 4QRUA 2OK0L 1FNEA 3OKEB 4PJGA 3SOBH 2EDWA 3OQ3B 1MCNA 3QWQB 2XI9A 3RFZC 2IBGA 1DEEB 2PW1B 2BXZA 3WNPA 4MMXC 3PE9A 2BY3A 2ORBL 1GGCH 2A9NL 1C5DB 3BEVB 2AERT 1NFKA 1TQBC 1KJ2B 1S7SA 5GGSB 1CFBA 4FZEH 2GJZA 3QIWC 4ZTOL 2IAND 2PXYA 1VADA 3H9SA 5JIHA 1VFAB 4LSSH 1GIGH 3OF6D 1U8LB 2WLYA 3W9EA 4BUHA 1UB5B 4GJTB 3ILPB 1QSVA 4N9OB 3WNMA 2GITB 4X9IA 3GBNL 3BZEB 1YZZA 3SEPA 3G5XA 1X5IA 5I18H 1BMGA 1D9KC 3HI6L 4NQSB 4TVPE 4YBQD 3WFBH 5F93C 4Z7WB 3JWDC 2IMNA 2YD6A 4ZTPL 5HI5C 3VD3A 4KK5D 1QRND 5JO5B 3EDEA 4ZO6A 4OI7A 4F8QA 5F9OH 2YPVH 4PRBA 4OGZA 3B4NA 1QZ1A 4K71B 1T1YB 2OR9L 1PKQB 1UM4L 3GIVB 1HH6A 2CK0H 4XRCB 2ZUUA 1DUZB 4X8XA 4Q0XH 1V7MH 4OF8A 1U3HA 2VC2L 3HZMB 3WO3B 4OCSH 3RGVA 3NPSB 2V6HA 1BLNB 2B4CL 4CNIA 1TZGL 5HDQL 1X5JA 5F71A 1YQVL 1LDPH 3WFZA 4AIOA 4LOUD 2VXSL 3D0LA 1I3RB 1V7NL 2FL5B 4PRPD 2XG4A 4M6ML 3EOTL 1YMMB 4UQ3B 1Q0YH 3MNZA 4XXDB 4JFHD 4TQEL 1FZOA 1KPUB 1NEZB 5HY9B 1R0AL 3R0MA 2X4TB 2Z4QA 3MRBB 3PWJB 2W07A 3P77A 5CEZD 3MRNA 2BMKA 2Y9RT 5GS3A 4ODTH 1CLOH 1CGTA 1MWAB 2BNQD 4NZJA 3UXFA 4G9DA 3LIZH 5I30H 3TO4C 3ES6A 4M02A 1GSMA 2VDLH 2IPUK 2HFTA 3BPCB 1KULA 5I1GL 3WL9B 4HUWA 3I2CL 3QEQA 4Q6IA 5I8CB 4UAOC 4MNGB 5EH1A 1HHGA 2XZAH 4ENED 3IF1A 3IRPX 1H8OA 4FTVB 4FQHA 2A77H 1ZGLB 1ZANH 1DVFA 1JUFA 2KPNA 4P4KA 3S3PA 5IB1A 3OPZH 4H1LB 1QSED 2GT9B 2YD3A 3D39A 5A3IC 1JNHB 3BRDA 4S1SL 4KHXL 4JY5H 4YK4B 2ICCA 4HS6A 4DKFH 3RWEA 5CMAA 3UYRH 3QUZB 4JPWH 4JO4L 1LK3H 3NBNA 3IDMB 4HS8H 4LMQE 1MOEA 5DRXA 4DQOL 2C3XA 1T5XA 4XP1L 4JPVL 1AKJD 3LN5B 4BZ1L 4MB4A 5HHOD 3WIIL 1YEIH 4LHJB 3O3AB 1JN6A 3QIUA 1U3ZA 4FN0A 5HGAB 1N3NB 4ESKA 1IGTB 1LO5A 4XP6L 4ZXBC 2H6PB 4FHBD 3EYOA 4KDWA 4ELMB 3IDGA 2JCCA 3NFNB 1D7FA 1FLRL 1Z2KA 4Y2DA 1JWSB 1TVBA 3F6IA 1Z5LB 3UTTE 4N9GA 5AZEH 2XICA 4GMSL 3WE6A 1PX3A 1HH9B 2EKJA 2BY2A 2FSEB 1VFUA 2Z31B 5IT2L 5EBMB 4KY1H 3O6KL 2EDDA 4BSVA 4I8DA 1HE7A 4XPBL 5F44A 1M7XA 3ARXA 3T0BA 1QR1B 1HKLH 5JZ7C 2DOCA 1TLKA 5C0AA 2R69H 1E6OH 2OX5A 5I8EB 2IPKB 4KPHH 4Y1AE 4Y4HD 5HYJB 4HJGB 1G7QB 4XXCC 1QQDB 3X3FH 2DWDB 1GH7A 3HE6B 2PCPA 1KEGL 3QO1A 5DGQA 4JLRB 3WKMH 4K94H 2A2QT 4I18C 4APQC 4BH8A 1XGQA 3EYQD 2XTJC 3CU7A 2H3NB 2P8MA 3GRWL 3SQOH 2ED9A 35C8L 5MENE 4A6YB 3CMOL 3QZWG 2VKXA 2ADFL 3MRPA 4ZDHB 4TRPH 4QF1A 4HX1B 4ZO9A 1I7UA 4HWEL 4PRID 1JK8A 2G2RB 1MCWW 4ORZC 1T5WA 3OKOA 4KK9C 3ZTNL 3MYJA 4OFVA 2BSED 1FSKC 3BKCH 4TSAL 2CSPA 4U6VL 1ADQH 4NQUA 4NNXB 3QCTH 3JSSA 1URLA 4AM0B 5BOZG 4LRNL 4JFQB 1ZA6A 5ERWB 4G42B 5EOTB 2AJXL 3DI2B 1T6VN 4LSRH 3U0TA 4JRXE 4MS8C 3QR2A 1MF2H 5EZIL 1ZWIB 1SHMA 4HFUH 1VACB 1ZLVH 5H35A 5SWZE 4YO0B 5C9JA 3SKNB 4N90E 4XTRC 1SY6H 4OZFB 4YQXL 3SGEI 1TCMA 3G6JA 3LQZB 5J13C 1FIGH 2ADIA 1MCHA 1A1NB 2XPGA 4NO2B 4LPTA 2VWEC 4V2BA 4CMHB 3SE8H 4RAVB 3QDHA 5E2TL 4DZBA 3GO1H 2VDPH 2DLFL 3E6FA 5C08E 3DUSB 5F9JB 5MI0C 1YEEL 5LWYL 2OZ4L 3EGSB 3MJ9L 5GZOC 1FFPB 1L9NA 1U91B 5L2KD 5BJTB 2NTFA 4OT1L 5F1OB 1DN0B 1L4IA 1S5IL 1ZS8A 4ZSOB 4JVWA 3F7QA 2DDQL 3MJ8B 3LS5H 3V6FA 4YHLL 2J8HA 1JGEA 1PZ5B 1BVZA 3SDAB 5IM7A 4Y5VB 5I66B 2PYFB 3CZFB 4OLEA 2FJHA 3D2UA 4PJAA 3RUGE 3RVXC 4MLIA 4PLNC 4NOFA 1J8HE 3MLUL 5IW3A 4PGDA 5C0NC 4H25B 2E7MA 3OX8A 2AJYL 1T1XB 5GRVL 1PW3A 2KDGA 2VE6B 1LQSR 4KMQA 3EFDH 5D7JB 3QWRD 2XNAA 3QPXL 2D9QB 3F7PC 5CUSL 1JMZA 1V8HA 1BQHA 1D5MA 1MFAL 1R5VB 3KHOA 2IH1A 4QY8B 2P5WB 4YAQA 4BH7A 3WFHA 5CHNB 1KLGB 3EZJB 1U2CA 2XTJE 3V0WL 3RUGF 5D7LE 3VXOB 5JQ6H 1MH5A 3HNTH 5FYLD 2IG2L 4NKOB 4WHCA 1EJ6A 3HI5H 2FWOA 4H8WH 1H3VA 5I1LB 3AFLA 1SJEB 4NN5B 5J1SC 3UJIL 3DMMC 1MIEL 3OR7A 4KVNH 3R06A 1WIUA 1RUPL 4FFVD 3F58H 5I0ZA 2D31B 4FG6C 1TTUA 1LNUB 3TBWA 4MXQC 1A0QL 1RIUL 4CAGA 1YMMD 3HI1B 3UTZA 5CIPB 4JR9L 5IW1A 1PG7X 3P0YL 3WS6C 1MCLA 3BHBA 3HS0B 2BDNL 1RZFH 2Y36L 3PXHA 1Z0NA 1QFPA 2BJML 2ZOKB 2R0ZH 4O9HH 4KJQC 3G5YB 2VWEE 5SX5H 3WUWA 2QJDA 4M7KH 1FJ1B 1ES0B 4TTGA 2HFFB 4LPWA 1UVQB 5ILTL 3CDGB 1C1EL 4LSVL 2NX5E 5D1XB 1UC6A 3F7VB 2FIKB 4ZPVB 5HVFB 1J12A 3U9PL 2FJGB 4F9PA 3ZT6A 5I15H 4LHUB 3TPUB 1O7VA 4FTVD 1KJMB 5E8DH 3CH1A 3I3DA 3V6ZB 1RZ7H 1FZMA 3SE4A 2DWEB 3Q5YA 1JGLH 5CGMA 1QLEH 1CR9H 3QUZD 2GAZB 3MGTB 1J5OH 1Q9LB 3D3VB 3QFJE 2DMCA 4PV8B 4JPKL 4P2OB 1ZEAH 3MBXL 2M8XA 2X4PB 2EDFA 3MX0A 1U8QB 1T03H 1NANI 3QBTB 4WUUB 4FFWD 1RIVL 1F58L 5J9PB 1EH9A 4MDJB 4F7MA 3BH8A 1ORQA 1ZLWK 1QO3B 4G6ML 4UIKL 2C1OB 4GKZB 3KLHC 2O5ZL 5ALCH 5DHVB 2MCPH 4C55A 3EO0B 5CJQH 5DJCA 3VXRB 1MSPA 5GS0D 2VDML 3RIFF 2Z31D 1OGAA 4K3DH 4JAMB 1I1AA 5GRVK 2F8VA 4XP4L 3SCMC 4L4TB 3MRHA 3T0XA 1KCLA 3GSVB 3QUKB 3ROLA 1NLDH 2FX7L 3NFPA 2XYCA 1OTUC 1TZIB 1EO7A 4NQCA 3QQ4A 1FNSL 3BQUC 4L9LC 4POYA 3H0TA 2EXWC 1NBYA 2Z91A 4JO2H 3HE6D 2NY6B 4L8CB 1QHOA 5SWSE 2XN9E 2UWEA 4DKEL 2OTWA 4WFFE 1QLFB 1T1ZA 2V9QA 3H2WA 3X14B 1MJJB 2A74B 4ONOA 4HXAH 4NZDA 3MRFA 5DO2D 5GGRA 3TIDA 1CXLA 1KPRA 1CVRA 4X7EC 1A7PL 3E6HB 3TYFB 4HKJB 2YKLL 1T21A 4YDJB 1AXTL 1IGYB 4PJ8B 2FIRT 3SO3C 3SE3C 3IFPA 5K59E 1FP5A 3CDYA 2RCSL 5I1JH 3AGVA 3MNWB 3RWIA 1I85C 1WBYA 1ZLUH 1N6UA 3L7EB 3TWCL 3FHAA 3PQYE 1A1MA 2OJEB 3TT3L 2VDKL 2C5DC 4LCUB 2YD5A 1UA6H 3PWNB 3AREA 4PV9A 5EO1B 1EAPB 5DUPH 1XEDA 5DK0A 5C8JA 3EJJX 3FFDA 3MCLL 3IGAB 3HZKB 2ZUXA 1SEQL 3DROA 2EC9T 1F11A 4XMLL 1GXEA 1AXIB 1A14H 1PBYA 5BO1L 2NLJB 5EO9B 2Q8BH 1U93A 1KELL 3L5IA 2QV2A 5INDA 1KUMA 4D9RE 3MREB 1CIDA 2YC1A 4PS4H 4LARL 1VFOA 3U30C 4HUXA 5GS1C 3LRHA 4NIKB 3OAYK 1V05A 1KLUA 4X99A 2BSTA 2YRPA 3D9AL 5E70A 2AEQH 3P40A 4K3JL 2ZSVA 1QD0A 1CD1A 2DQUL 5HHMB 4U3CA 4OD2A 3U7AA 1UCBL 3SY0B 3VWJB 1X5XA 4U1LB 1U8JA 2XWTB 4FQQB 5K9QI 4UQ2A 3D87B 4AT6B 5LXGH 1JPTH 1OT2A 3SDAD 2CGRH 3QHFH 4ZUUB 2BHUA 1UB6B 4PBVC 1ZSDB 4C54A 5HDBE 4EN3B 4LNRA 3KDMB 5E00B 2R56H 3EYSL 4N0CD 3OMZA 2VMFA 1FCCA 4Z0BH 2ZCLH 3GKZA 4P2QB 1U2HA 3L3KA 2FEDD 2K1MA 4F58H 1DQJB 5I17B 4F7PB 5EC2A 1UWXH 4ZAKB 4YE4L 4X6BB 5EU6D 5C0IB 3S5LG 3TBTA 2P5WD 1Z9OA 4MMZC 1QSFE 5TF1H 1Q94B 4NQDA 4QXUH 2Y5TA 5GGUA 3TESA 4Q9QH 4ZNCD 2VQTA 3PJSA 5HDBF 4PUBL 1T0MB 5T5FL 2JB5H 5GGRY 3SKUD 2GK0B 1BREA 4GRLB 2ITCA 1MHCB 3E8UH 2HKFL 4D3CH 3ILQD 3P4OA 2LTQC 4QRRA 4MNHA 4N0UB 5L8LB 5KSAB 1AR1D 4UB0H 1VA9A 4FQ2L 4I0CC 5E56A 2YPLE 4F7EA 4G8GB 5DJYB 1U9KA 5D4QA 3DYPA 4Z5RB 1BJMA 4GMTH 1EBAA 1AQDA 4OLVL 1JGVL 5JDSB 1DBAH 5L6YL 4WY7H 4PJBB 3UAJD 3JZ7A 1WWAX 2C3GA 3NIDE 4HIXL 5CZXC 5MEPA 5SX4H 4LIQH 1FL3A 2RFXB 4KVCL 4BZYA 2DYPA 1RZJH 4KMLB 4W6WB 3QCUL 4BKLB 2L0DA 1BZQK 4R7NB 1B0RA 3EDFA 4KWUA 5C09B 1P53A 2WQ8A 4Y5XB 1GL4B 4HJJH 5ABDE 3FQNA 3HC0B 2R2EB 5JPMA 1TPXB 1FGNH 5F7WC 5L8KB 1WT5A 5IFJB 1EFQA 2Y06L 5D1XD 3UYPA 2AJ3A 2Y25A 3U36A 1KFAL 4UBDC 4PRHD 4LHUD 2W65A 3QP3A 1S7XA 1CZ8L 3PG2A 4I0PD 3QEUA 1J86A 2F54B 4OCXL 2AJZB 5FYJD 3B83A 4AEIH 1BF2A 3X3GL 3NIDF 2BFVL 4J1UA 3CSYA 4M5YL 4X80H 4BUGA 4EZMA 4XBEL 2QQNH 3TPKA 1M1SA 3GFUA 4R2GC 4PD4K 3W9DA 2UYLB 1CQYA 1NMCB 4MA1B 5DQDH 4R4NC 1UCTA 1RIHH 2HT3D 1WQVT 2PYEA 3FT2A 3D3VD 5LVEA 1ORSA 4XWGL 1A6WL 4L5FH 4HKBB 5C0RH 4ALAL 4H88L 1W0WA 3RJDA 1FG9C 2GKIA 2H1PL 1G6RL 3BPLC 3DV4A 4LP4A 4OFYA 4QEGA 4WUUD 4QGTA 3RGHA 3W11D 5C9KA 1U8PA 3T2NL 1OTTC 3GI8L 1MFEL 4UILH 4YDIH 4XPAL 2EE9A 1AY1L 1Q9OB 1A4JB 4IOFD 3FB8B 3IVKA 1QLRA 1BFOB 5INCA 1RZKC 1H5BA 3H8NA 4UTAH 4K55A 4YXKH 4BQCA 3I50L 2VXUL 2F9BT 4MSWA 5BW7A 2Y6SD 4Z7UB 3QIBB 1HWHB 3NACL 2AS5M 4X7SL 3RWDA 4N0RA 1CFQA 3BGAA 5C6TH 1P1ZA 4W70A 1YY9C 2E7LA 1AXSA 3BJ91 5D6CA 1WTGT 3TA3A 1ROWA 1H8NA 4PR5A 4ZFOL 3IXAA 1XAUA 2VLKD 4NZTH 3VA2C 3T65A 2GJ6E 1H3TA 2W92A 3UZEA 3NZHL 4ELME 4RIRB 4D94A 4Z7OE 2X1XR 2MHAB 3VXMD 1AGDB 4H5SB 4CMMB 1DSFH 1I1FB 3FFCB 1I1YA 1MIMH 5BQ7A 1AGFB 5IFHH 1LO0L 4WCYL 3LH2L 4PJ8D 1S7UB 2KQMA 1I9IH 1WF5A 1A1OA 2CO6B 1PYWB 1S3KH 4GAGH 5K9KB 5D96C 3LB6C 4PJ5A 1IM9A 2F74A 1XF4B 2EDQA 1ZLSH 4AENB 3BISA 3TFKD 4RGNB 1UZ6E 4U1HA 1UM6L 4LF3A 4F2MA 4Q9BA 4ELMF 4L4VA 5HYJE 4Z7OF 1BF8A 1VGEH 1MRFH 32C2B 3KYMB 1A8JH 1DN2A 1YY8B 3A67H 3MJGX 2JIXA 5T33H 4HIJA 1CICB 2YWYA 5DVMA 3MOAH 3UC0H 3GSXB 3MLZH 1NCAH 5LCVL 3BDXA 3V0VA 3X11B 1S7WB 5A16B 1INEH 1R5WA 4LEOB 4MD0A 4UIMA 3LZFH 1CDIA 2QLVB 3KYAA 2COQA 3WO4C 1YJDC 3DURA 4HFWB 3U6RB 5A40E 5CD5D 4JANA 1UZ6F 1IAKB 3TN0A 2OSLA 5ID0B 1NUNB 3NA9H 3DO7B 3RVUD 4E42A 3C60A 4DVBA 5DUMH 1UM5H 1Y0LB 1JGDA 1RHFA 4FZEL 3TYGL 4HPOH 4IMLA 3GMRA 3J8F7 5IBLC 4JFEA 4IHOA 4KFZC 2C1PA 2J88L 3V8OA 3VWJD 4LSSL 1CE1H 1UG9A 1GIGL 4ZFZB 3UTQA 3CFDA 4ONGL 5MHSE 2VR4A 5DJ2B 1A7NH 1MCCA 5F70A 5JIKA 2MOVA 2OL3L 4MQ7B 5FKAA 4EN3D 5I1CH 4KMTH 3VXSB 4LSQL 3WIHH 4ODWA 3OKNA 5EZLA 5GRUH 43CAA 4P2QD 3GJFA 4MWFB 3JVGA 1N5YH 4LKCB 3C5ZB 4ZAKD 4YDVB 2R0KH 2APVA 1DR9A 5F9OL 2HT2C 2YPVL 4F57L 1HYSD 5T1LB 4R7DA 2FX9L 1AH1A 4IIQC 4PJXA 5F7NC 1IC5L 4P4RA 5J11B 5E8PA 1EEZB 2DBJA 1R3JB 3BD5A 3W82A 2AAVA 2VN7A 5E4EB 3VXUB 1V7ML 2AJUL 2XTLA 4PG9B 5D5MB 5DD5H 2EC9U 5FGRA 5L2JA 4NN6C 4OCSL 3BWAB 3WLWD 4RA0C 1IGCL 1LDPL 3ZKMC 2CMRH 3QHZH 5TQ0L 5J3HC 4U05A 2H26B 4YHZH 3ZKXB 4GRLD 4QXGL 4M1CC 2B39A 3QNXB 3GSNA 1AIFA 3QZWB 1I75A 1NMAH 3CD4A 1KCVL 1K4CB 1MLCA 1OAQH 5KSAD 5TE7L 2ARWA 3MROA 4P2OC 3MODH 1KJVA 1NJ9B 4KRNA 3DRQA 4ODTL 5KTEH 3RNQB 4G8GD 4LCIH 3VGBA 3V0AC 3RTQB 1HCVA 2G75B 1ZGLM 2YUVA 3LIZL 3G08B 2VDLL 1NFDA 3KPSB 5AEAA 1TJHH 4UU9A 4TNVK 1AGCB 4U1IA 1FO0H 3EOBA 4LLQA 5JIIA 4R4BB 3REVA 2CLZB 1JWMB 2A77L 5A2IH 1OAXL 5I76A 4OZIB 1WISA 4HWUA 5C09D 3P9LB 1KF9B 4GW5A 4JM2B 1U0QA 3ULUL 4Y19B 4JY5L 4QHNB 3UYRL 1OARH 3BGMB 4JPWL 3GMPB 3X12B 2CPCA 5IF0B 1EO5A 3RVWC 4CJ1A 4HS8L 4JFFB 4OZ4A 2AV1A 1BZ7A 3EJYD 3MRIA 2ARJB 2F54D 2GY7B 1AGEB 1FFNA 2B5IB 2HA1A 4YFLI 3VGFA 3G04A 3AC0A 3TBYB 4GSDL 3CVIH 3EOYG 1JFQH 2IANA 3MV8D 3CXHK 1XCTB 3OB0H 1BBJA 5KSVB 4MXWH 3SDCB 1CIUA 4GOSA 4GAYA 3QXWA 1JHKH 2NY6C 1X4XA 5IEHA 1DTUA 3NCBB 4X6DA 3GBML 2R8SH 3WEXA 5DTFA 4CU7A 3KYOB 2RBLA 4YGVB 1F2XK 1A4KB 1MCPH 5LJYH 1FYTB 3WS3A 3CXDL 1CT8B 4JM4H 1U3JA 1QRNA 4XAKE 2ZWLT 4IRSA 1RULH 1OM3L 3FCTA 3KPLA 4CW1A 5K33A 4K7PX 1T7WA 3MRMB 3GMQA 1HK6A 4JJHA 3VGGA 1AC6A 3GSOA 3T0ED 1BWMA 5J4MA 1OLZA 1IAIM 4FQ1H 2J6EA 2PETA 1LE5A 2VAAA 2IGFH 2O5YH 5ANMA 3KJ6L 4PRPA 1P5VA 4NNYA 3HKFA 3B9DA 4G6FD 1OSZB 1WWBX 1LO3H 4NKDB 3HHRB 4V2CB 4K94L 3L5XH 4JQXC 2CDFA 2ZKHH 3PV6A 5B4MD 2LV4A 3QIBD 1WFUA 3SQOL 2EYSA 1P6AB 3DX9A 5JR1L 2FYYA 2BNQA 4U3XA 5DJ8A 4M7LL 1S9KC 2NY0B 5JNYB 5TE6H 1GPOH 3ZT5A 5A2JH 1HQRB 4HC1A 3KPQA 3SDDB 1BOGA 1YNLH 1DQDL 2XTJD 1U42A 4JFDE 4I77H 5LAXA 4F33B 1QSEA 4LSRL 4WIQA 4YFEA 2IPTH 2B4CC 2V7NB 4M7ZB 1MF2L 1U8IA 1H0DA 4HFUL 3VXRE 4K9EH 1EPFA 1T04A 5GJSH 3RX7A 1WBXA 3GSNH 4GRMA 4KK9D 4KQ4H 4L4TE 3MXVH 2P1YA 1MCBA 3DUUA 5FA4B 1G9NH 1FIGL 2WLZA 3HR5B 2YUZA 2Q3ZA 3H42H 4WJ5A 1AKJA 4RGND 3SE8L 1QACA 1LEGB 2I26N 5FOBA 4HQQL 5HHOA 4EI5B 3K80A 1FL5A 4D0CB 1QYGH 2E9IA 3DX7B 2B1HL 5DMKB 5KSUA 3B9KB 4JHAL 3CK0L 1BWWA 3GHEH 1CICD 3IFLL 5AG9A 2CKBL 5FK9B 5GIRA 3O11B 5EN2B 3DVNB 2BOBA 4HEPG 4KJPD 3FHQA 3LS5L 4OUUA 2R29L 4YHKL 4QRPD 3ZL4H 5HTSA 4LSDA 4ZUVB 1VFBB 1Z0MA 3MRQB 3QUXB 5C0JA 1QA9A 3SE9H 3L3OA 5E9DB 2PO6A 4M1DL 5C2BH 4WNQA 4MA8H 5BV7H 4QHMB 4GS7B 4B53A 1N59A 4Y4HA 3JWOH 2OQJB 5EA0L 1NMBH 3EFDL 3CLEH 2VLJD 3EYFA 4LLDB 4LLVB 5DDHA 5CCKL 4XCNA 2WUCH 3TH3T 4E0RA 3R4DA 2W59A 3VXSD 1G9ML 5ICYB 4DAGH 5CJOH 3MACH 3SKOB 1CXFA 3QUMB 4HV8B 4PJDB 3FO0H 5JQ6L 4Y5XC 4ZPTA 1P7KB 3BUTA 3C5ZD 3O8XC 4HWBA 5E08L 4B41A 1G1YA 1YNKL 3WUWG 1OB1A 5T1LD 4Q58C 4H8WL 2F15A 4L3CA 4YXLL 1E27A 4GRWH 5ID1A 1D6VL 2J6EH 3KNBA 5BS0E 2EIZA 1RK1B 3BZFA 4JKWA 2ESVA 5HHME 4HIIB 5IMKA 1LP9A 2OTUA 5ETUA 2X41A 3IS1X 5FYKD 5FDYA 1Q0XL 4WU7B 1RVFH 1BBDL 4MA1C 4X8JB 1KCUH 4MD5B 4CDGC 4Z0XA 1CLCA 4NBYB 1RZFL 3HZVB 5CEZH 1ED3B 4O9HL 5I16B 5J6GB 4NZRH 4QRSA 4Q2ZB 1G6RB 3RJQB 4M7KL 4OAWA 3RTQD 4ZS7L 4N8CL 4W4OA 4D0BA 2ED7A 4KTDH 3OGOE 3FT4B 2VXTL 4MXQD 1AD0A 5DF0A 3LHPH 1L7IH 1I7RA 2Z92A 1ZLVK 1HHHA 3AMKA 4D8PA 1T89A 1OD9A 5L2KA 2VABB 3IAQA 1IT9L 4DFHA 5E8DL 1BQUA 2YMXH 1SVZA 4F15C 2OLDA 4XGZA 4JM2D 3OKEA 5I1AB 4Y19D 2Y5EA 5KS9B 2VLRA 3GK8L 1JGLL 3TNMA 1DEEA 5C0BB 3LKSB 2PW1A 3WDIA 3U7YH 1I8LA 4P5TC 5E8NB 1J5OL 5ACMA 3ULVL 3BEVA 4JFFD 5HI4D 5D2LA 1ZEAL 5GGSA 2GIYA 4J3WA 4FQXB 1XT5A 5F88B 1QFOA 1MHEB 2JJSA 1FZJB 3C5JB 2HLFC 1MHHB 3NCYS 1EMTH 3B9AA 2AK4E 3QWRA 5IWLC 3QNZB 4LVHB 2GITA 4AL8L 5ACZB 1FN4B 3BO8A 4XPGL 4NQSA 3W5NA 1FYTD 1L7TH 2H8PB 3KXFB 5CJQL 1F4WH 2IH3B 1FC2D 5JMRA 3RHWF 4EIZC 3U2SB 5JO5A 1IL1B 1NCCL 1CDHA 5F7LB 12E8H 2BHYA 4HIEB 4XRCA 2ZCKH 1DUZA 2UVFA 4K3EH 1QSZA 4WW2B 1FG2A 3HNVH 1BLNA 5AD0B 3EO9H 3S5LB 5EBLA 1KTDB 4JO2L 5DD6B 1I3RA 4H0GA 5HHVH 1F4XH 4UQ3A 3HUJB 2EDNA 4K07A 1RHHB 1UQSB 4IS6A 2RHEA 1NEZA 1KPUA 4K23L 3K3QA 4JRYB 3VE0B 5FV2A 1IEBB 4XBGB 3N1MC 1FNHA 4NHCL 5BRZA 5GRJL 1OHQA 3ET9F 3NABH 1NFIB 4HWBH 4ODXA 5SWQA 4FXKB 2G5BB 2DLGA 2NY0D 3S37L 4HKZB 3MLSH 3BPCA 3Q6FB 5I8CA 1CFVL 4XCFL 5DUBB 1DANU 2EH8H 4MNGA 3GUTB 3K8MA 2LQRA 2VR5A 4HUUB 3SDDD 1XF5B 1Y6MR 2BVOB 3KYKL 1MNUL 2XKNA 4FTVA 4EVNB 1ZGLA 4P3WA 4DKAA 4DJMA 2EKSA 2GT9A 3LS4H 1REIA 4FFZL 3GSRB 3WXWH 3CVHL 5SX5K 4MGXA 5F8QC 2A83B 1JZ3A 4WDIB 1S9VA 4AZ8A 3C87A 4C58B 3QUZA 2B1AH 5DRWA