2GIYA

Crystal structure of the c-terminal domain of the hsv-1 ge ectodomain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
179
structure length
179
Chain Sequence
HVRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPPPRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLDIEGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Glycoprotein E
publication title Crystal Structure of the HSV-1 Fc Receptor Bound to Fc Reveals a Mechanism for Antibody Bipolar Bridging.
pubmed doi rcsb
source organism Human herpesvirus 1
total genus 38
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2giyA00
2Y7QB 3VFNA 1S7SA 2JJSA 4H0HB 4ZFOA 3T77B 1S9VB 4KJWD 5BW7A 2YUXA 4ISVA 3A0OA 2XKSA 4IOSD 2W0FB 1W0VA 4IOFD 4R97B 4G8GD 5FYKH 3OL2A 3A6BL 2E6QA 4NHUB 1ULVA 3NABL 3ARQA 4J3OC 3RY6A 4LLQB 5DWUH 4Z7UF 3DETD 5IHLB 1Q94B 1FH5H 3TBVA 1IM9A 1YEHL 1N8ZA 4LK4A 3CUPA 4LCIL 1GOFA 1KEMH 5B38G 1VFBB 2BSSA 4JO4L 4TPRL 1CXHA 3D0VA 4NZRH 4JE4B 1G7MA 5SX4H 3F58L 2AEWA 3ZTNH 1ZHLB 2FL5A 3DIFA 4HWEH 3BDBA 1C5BH 2X4RB 3CAFA 3L3KB 4PG2A 3VH8A 4JFYB 5CZXC 2WP3T 5GZNC 1MOEA 3X17A 1R3KA 5IHZA 1Q72L 2R69H 2AERT 1QEWB 2DAVA 4OGYL 5BZWB 5B38B 1NMAL 3ARVA 4KUZL 5C0IB 3HNSH 2JTDA 3QA3B 4NM4L 4XC3H 1HH6A 1U92B 1BJ8A 5ANMA 3SGJA 3SKJH 3QHFH 1KJ2L 3ZYIA 4DN4L 4M6ML 4TUOA 4MS8D 4P5KB 3NCYS 3CMOH 2QHLA 1J1OH 5SWZB 3O0RL 3SGDH 3MUGB 3MBXL 3QDHA 3TFKC 4J1UB 3WS3B 3ZDYF 5ILTH 2VXQH 2WWMC 4XRCB 4YGAB 1C8PA 1R3HA 5DR5H 3EIFA 4M5ZL 1HHKB 4XPAL 4K3HA 4XWOD 3QUZD 3DV4A 4ZUVA 3IFPA 3VXMA 3AY4C 4HZAA 3U6RA 5T33L 2XXCB 5BRZD 2DJUA 5C0NC 4XGZA 1J86A 1W8OA 2QKIA 1I8IA 3SGKC 3SGEH 4NSKB 2LABA 2PYEB 1TZGL 5IJVA 2HVJB 3BQUA 3SJVE 4JGUA 1A1MA 3VFVA 3ULUF 4XPFL 3QUKB 1F45A 2VXTL 4J23A 4HUWB 1MH5B 1W72B 3AREC 2BVOB 4FZEH 3OJMB 3FZUD 3QO0A 4MJID 4MD0B 5DJZA 1G7PB 3VFUB 2LAAA 5DUPH 4M3JA 4UT9H 3FB7A 2ZP0T 5C0CB 3IDYC 3T3PF 1KLGB 3IU3A 4PJIB 3TCXA 3UAJD 2G2RB 2WBJB 5DA4A 1H8NA 1IC1A 1W0WB 1IKNA 1BM3H 1KJ2A 3FQXA 4ZUTA 1ES0A 5F1IA 4PJDE 5GSVA 5FOBA 3RAJH 1UWEL 5K9JH 1CDGA 3JV6B 1Q9WA 4AT6A 5CD3B 2E3VA 4PBVC 3OX8A 3X12B 1K3IA 2C7UA 5DUBA 4R26L 5EIQA 4L29B 4LNRA 1M71A 2VABB 5F7LB 5ICXA 4DVBB 5MEQB 1DFBL 1AP2A 4LMQI 3I50L 4NO0B 4RGMC 3GMNB 1P7HL 2DKMA 2XG5A 2VTFA 4L8BB 3B9KD 1MIEH 4X9GA 1IM9D 1X7QA 1WBXB 4PJXE 1YN7B 5CGYC 3QDAA 1U8MA 4LCWB 3S3JA 2J5LB 1UXSA 3K3QA 3KPQB 3BPCB 3MODH 5KANG 1I8LA 3PQYD 5CCKL 5IG7A 4LFHD 1T7YA 3MLXL 2I27N 1B4RA 4CVXB 1ADQH 2ATPA 3T0VA 3CLEH 4UNUA 1TETH 5T5FL 1MI5A 4MDJB 5D72H 2F58L 43C9A 1MCPH 5L8LB 2ARJQ 5FXCH 4U6VL 5CUSL 3ESUF 3RBSA 4JFZL 5CP3H 1E4JA 4DGVL 3GMRB 4HMDA 1TENA 2GSIA 5JW4M 2WP3O 5DJ8A 2BNRB 4EN3C 4KZEL 3OKMA 2I60H 1FZJB 2X4PB 4BA8A 1LEGA 2FB4L 3V6ZB 1V3MA 3UPCA 3IKCA 3KLHC 3BIKB 3QFJA 5CP7B 5IROC 5IB4B 4I18A 2NY2C 3MLRL 4XPGH 2AI0L 5FF6B 4XBEH 1JFQH 4BQ9A 5IEHB 1F4YL 1UH2A 4W4NA 1S7RA 3VXMD 1BQHG 2WINA 5HDBF 1AQKL 3O3UN 2EH8L 2ED7A 5IT2H 5JORA 4NUJA 3TYFA 2O5XH 2R2BB 2WIMA 4ENEC 3DGGA 3RI5F 3TJEL 5IOPA 3HNTH 4NHCH 4Y4FB 1G9NC 2DMCA 1MSPA 1LO5A 3SHSA 5E5UB 2V9TA 3F7VA 5T3XH 1WLHA 1NCNA 2F15A 3MRFB 1XGQA 3NA4A 2UV3A 3QUMA 1HQ4B 4X80L 1XF1A 1BOYA 5EG6C 1XF5A 1SEQH 2AEPL 3NGBC 5B8CA 5MI0C 1NL0L 2Y07L 1QYGH 2AKRB 4P9MH 1Q0XL 5EO9A 4PJFA 3CSGA 1F58H 3DMMB 3ZT7A 1YPZA 2Z93A 3ZKSD 1HHHB 1RSFA 3UJTL 4AEIH 4Y2DB 5IFAL 3QUXB 1WFUA 3CSBA 3HUJF 3LQAH 1KB9J 3IU4L 2GJZB 2E8ZA 1IBGH 1ND0B 3KJ4C 4PJAB 2YWZA 1ZHKB 5JR1H 1E4KA 1MRDH 4GW5A 3HRPA 1PFCA 1TJIL 4GLRH 3O9WA 3D18B 4I48B 3O3AA 4HAGA 2X05A 3P30L 4YXKL 5E5MB 5FO8A 3V7AE 1GPOH 2FJGB 3OKKA 3E8UH 1KNOB 5AG9A 3R8QA 4YC2C 5EFIB 5JIIA 1MAML 3F7YA 3IVKB 1AXSA 4PRAB 3MNZA 3BPOC 1OARL 4UT7H 1FL6B 5C2BH 3QDGE 2R8SH 5B22A 2JCCE 4YHLL 4KHXL 5GS3A 3WFBL 4ODBD 4YHPA 3SN6N 5I1CL 5I1AA 1S7VA 3N85H 1BZ9A 2ID5A 1LGVA 5F9WC 4R96A 5F93C 1FZMB 5DO2C 1N4XH 1XIWC 5D2LE 1GGIH 4MA1C 1MI5D 4WFGE 3CDGA 5KVFH 1I7UA 2HKHL 5JHDA 2VH5L 1KFAH 1NH6A 2FR4A 2OL3H 2R9HD 3IDJB 4BH7B 4JPKL 4DCQB 2W07A 5C0FA 1YUHA 5GISL 5CBAB 1PQZB 2BDNH 1V3KA 3UJJH 1PLGH 2BY3A 4Q7DA 1M7IA 1DEEB 3QNYB 3BPLB 3VFWB 5D1XA 5BO1L 1JUFB 1DJSA 2VAAA 3ARDB 3MROB 4YHYC 2J4WL 2IAMB 3BKCL 3Q1SH 5HHNA 3SGEI 4M7KH 2X89A 1OQOA 4N0CD 2FCBA 2ADGA 1FZOA 3Q5OA 5L2KB 2L7UA 5GXBB 4PRHD 3V6OE 4MA8H 1HKFA 4ODVL 4APQA 5FAAA 1AXIB 2PO6A 2PTVA 3IJYA 3LKRB 5JOFA 1YMMB 5TQ2L 2EECA 1FFNA 2IH1A 2XA8H 5F89A 1GYAA 1XGYL 3MRIA 4HUMB 2IC2A 5M95B 1U3JA 3IAGC 1KEGL 1WC7B 3QZWA 4FG6C 3U46A 3CXHK 2ED9A 1NC4D 5E9DB 5I17B 3QQNA 5LKNA 2EYRA 1K4DB 3L3IB 4IRZH 4WGWB 4OQTH 4JQVA 1RHHA 4P5TC 4IIQA 4NQEE 3WEXA 3L9RA 2NY0C 1MHPH 1INDL 1JK8A 1MNUL 3BWAA 4NBYB 1HI6B 4NQVA 5JUEH 3V6FB 3OKLB 2PYFA 1NCDH 1T0NA 1BAFH 1F2QA 1WZ1H 4JR9L 2NTFA 4LU5L 1JYXA 2Z92A 3C5JA 5C0RL 1L7IH 4JO1L 4WW1A 4XH2A 3QG6A 4Q6IC 3O6KH 5CZKA 5D71L 1SY6H 3DV6A 1GGUA 32C2B 4DOHE 5ENWB 3CVHB 1RI8A 4NT6B 2ERJB 5IVZA 3FHQA 1YEJL 1U8PA 4X5XB 3SE8H 1N6QH 4NFBA 4QXTA 4FABL 4OI7A 2VDOH 4Z7QF 4XNQA 3U0PB 3TCLA 3U4EB 6CGTA 4HUKB 5IR1A 1T2QL 5F6HJ 1Z0NA 3RWIB 4O4YH 2IQAA 5HHME 1R3LA 3BGAA 3BUYB 4LHUA 1BQLH 4Y4HB 4CU8A 2GK0A 3SE4A 4OF8A 1H5BA 3CFEA 2X1PA 1JGLL 3C09C 2CQVA 2C4FT 4ZODA 5F88A 3OHXB 1QSEE 5C6TH 5IMOA 5FUZL 3KGRA 2V9RA 1KELL 3QIUC 3QEGH 4C57C 4PY7B 2DQIL 2GCYA 4PP2A 5EH1A 5INCB 3WDIA 1N64H 1MCLA 1WVZA 1CF8H 1FJ1B 3IXAB 3LQZB 3EJZC 4P23D 4WCYH 1E27B 1FVDA 3FT4A 3QUYA 3ME0A 1A7OH 1ZT4B 5HJ3B 4X6FB 3HG1E 4ZSOB 4MWFB 2EKJA 2GJ6D 4NCDA 1IM3A 3PJSA 3MCLH 1UEMA 4MQTB 4DZBA 5C8JB 3FTGA 3IYLW 1FAIL 5BOZG 1AIFA 4JEGB 2F54E 2L0DA 4WWKA 5ESVA 4RGOH 2Q76B 1AHWB 2I9LB 3P9LB 1UB5B 1ONQA 1O7VA 4E42A 5JA9A 1EAPA 1I9JL 4UOW1 3MRBA 3GK8H 5DJAB 4HPYL 4OLZH 1JYNA 3P0VL 5HI4D 4V2CB 1FFOA 1RUQL 2PO6D 3U7YL 2DL9A 3K80A 4KI5C 5ESQA 5SWSE 2Q7NA 1RMFH 5MENB 3WFDL 2XY2A 4CAGA 4I3RL 4RX4D 3VRIB 2D7TH 3D39E 2VDLH 2R0WL 1B4JH 4QCIB 5TQ0L 5JA8B 2BNUB 1T04A 4GG6F 2BC4A 4WGVB 1MWAL 4LASL 4JZJA 3P4NB 1ZLUH 4GLRI 3QEQA 1F4WL 4OZFA 1I1CA 1MLBA 3EGSA 4ONOA 2OR9L 2XACC 3ZSTA 2CKBH 4HJJL 5GZND 5EB9A 5JOPE 1MFCH 1J18A 5J11B 2EIZB 4YDLB 1U8LA 4JVUA 2ZUUA 1OM3H 2FEEI 1CGUA 1F2XK 5F44A 4ZUWA 3CDFA 3KNBB 4L8SC 4P4KA 5GGRY 5I18L 4W70A 5HVHC 2P24A 4UOW0 2XRAH 1JWUA 3N06B 2BSRA 3ALPA 4HWZB 4WHTA 4ZXBC 3E6HB 3KPRB 3U79A 3PGDB 2NXYC 1JPSH 3ARFC 3WHE1 1I1AB 1CFTB 3STZB 4PV9A 1CK0L 5JQ6H 3TEUA 3EYSL 4F33A 2C1PA 5GZOD 5I71B 2B1HL 4LVNB 4KK5C 5GHWL 4LHUD 1LNUA 2ZOLB 4OUUA 4BQCA 2XT1B 3SDAA 1QD0A 2A6IA 3SBWA 1ORSB 3WFCL 3AMLA 2VLME 5GGQH 1NGYB 3PWUB 3Q3GA 1RJYA 1K9TA 1MVUB 5DDHB 1CTOA 4XCEB 3C60A 1I7TA 1AC0A 3H3BC 3M8OL 1MVFA 4J3TA 4LLMA 2P8PB 1T89C 4LPWA 4CW1B 3C6LA 1UYWL 3TWCH 3HZVA 4BUHA 2W9LA 2CO6B 2KQNA 1LHZA 4P5MB 1OTTC 4J6RH 1PG7X 4NN5C 4LLYB 3VD5A 3QFDA 1G9ML 1MWAA 1NBYA 4JKWA 3RDTB 1YEFH 3VFPA 1RZGA 1T5XB 3VXUB 4ZPTA 1A7BA 1DN0B 1ZANH 2ZUQB 1DQJA 2Z4QA 4I4WB 2EXYD 2FECI 4NN7B 4YNYB 1LE5A 5CILL 4I2XA 3MRJA 5FYLH 3MRKB 5DJ2B 1ZOXA 4F37F 4M48H 1F90H 4Y1AD 2AJXL 3WHE0 4WWKD 3EZJB 4MQ7A 3U30B 4JN2B 5D5MF 4LOUD 5ALCL 4F8QA 1AH1A 4RIRA 3CVIL 2RHEA 1B2WH 3JWOH 4W68A 4LIQL 2QSCH 2AXFA 3AXLA 3IDIA 1FHGA 5AZ2L 4OCWL 4JQXC 3G6DL 1VB9A 1NFDB 4JY4B 3GJFA 3GI8L 2I26N 2DYPA 2BVTA 5F7DB 3ZKQD 5KSBF 1S7TB 4H25A 3H7BA 1ZA3B 4PJ9C 1I1YB 1QFUL 4BSVA 3JTTA 3EBAA 4OF6A 5MEPB 5CJBA 4PFEA 1UJ3B 4MAYC 3U7WL 3RTQB 5HGDB 4NM8H 5CGYD 1KB5A 4HV8B 3BEWB 4Y8DC 4JM4H 3U48A 3VGFA 1D5MB 4JFEB 3AU1B 2HG5B 1P7QB 1JHKH 3MRNA 1YECH 5DEFB 5DJYA 4AZ8A 4OCYL 2V2TA 5L9DH 3QEQD 4TULL 4M43L 3O81A 4P2CG 4ZD3H 1BZQK 2DLFL 5I76A 1IC4H 4HK3J 4NC1C 2JJTC 5IW1A 3CPLA 2ATKA 5ID0A 5JW4R 5E1HB 2V9QA 3TA3C 2FX7H 4EN3D 1A4KA 1INQB 3WV0A 3FN0H 1BD2E 3QWOB 1ZLSL 3CFDB 5DI8A 4YBQC 4ZNEA 4WEUD 4HKZB 1KOAA 4LDEB 3MOQA 3KLHD 5E8OA 4ELME 3LOWA 3G08B 2OSLA 1SYVA 2AV1B 4K94H 5CBEB 2NY5L 2H2PC 3BGFB 4QOKD 4DVRL 2AK1L 1LDPH 4ODXA 3JUZA 4FMKA 4ELKB 1F11A 2Y36L 1S9YA 5CD5C 4G80B 5FA3B 1MEXH 1DQQA 8FABA 1LK2B 1T0MA 4PJGE 3SDAD 1EHXA 2Z91A 3WBDA 4ENED 3B5HA 2V17L 4ZUUA 4D0CB 4JPWL 4RFOL 2AXGB 2WBJC 4XCCL 3TPUA 2N4IA 1B90A 3GSRA 3QIBA 3ZDZE 5I1HL 3DXAA 4B50A 4ZO8A 3GBMH 3HR5B 1KCLA 2DBLL 1PZ5A 5DD3L 2X2YA 2XWTA 1CXIA 2JELL 1MIMH 1S3KH 2AJZA 2MNUA 3CSYB 3WS6A 4QTIL 1CFSB 2UVEA 1Q9OA 4HXBH 4NJAL 3VFMA 1B6UA 4S1RH 1RZFL 1BVZA 4XNYL 1K8IB 3AGVA 4YZFE 3WLWC 4LKCA 4EUPH 1L0QA 5C08E 5KSAB 1OAZH 3WUWG 4EZMA 4XP1L 2J1KA 1QRNB 1S7WA 4X4XA 2R1WB 4FXKA 2MJWA 2ZCHH 3PE9A 2J5LC 4GG6B 4HF5L 1D9KA 1N0XL 1FSKB 4YPJA 3VDAA 1JPFB 1R5VB 1JNHA 3MRDA 4KHTL 2ZJSL 1VHPA 1ZAGA 1F4XL 3BZDA 4HMEA 4U3XA 3F12B 1PG7L 2Z35B 2DTMH 2NW2B 3WUWB 2X4SB 1DUZB 4ODHH 1DVFA 1YNLH 1ZT7A 4ALAH 5AZEL 3RUGA 3DX8B 4N5EC 1IKNC 5IQ7L 2P49B 4HX1A 5DRZB 4U1JB 4PJ5B 3FL7A 3MRPA 4UUJB 4KKCC 2UYLA 4JAMB 4P2RA 1BIIB 1K8DB 4RFNC 3N9GH 5FEBA 3WIHH 3S37H 3QJFA 1UCTA 2VDMH 4MB4A 4OBSA 2IANA 2DQCH 2DWEA 4JFFA 1J8HD 4FA8A 5KS9A 4FTVB 5IB1B 1FBIL 4UI2A 3IFLH 1S78D 2X44D 4LNVA 4L8CB 4HFWB 4NDMB 1PD6A 1A7NH 1XF4B 1A3RL 2DQEH 4P2QD 2R0KH 3ARZA 5ANME 1EMTH 3I6GA 2NY3B 5C0BD 1LEKA 5DJCB 1DQLH 1FDLH 3HAEG 1H3GA 4AMKH 5HYJA 3OXSA 3BW9A 3MSPA 3PDDA 1Z5LB 3LCYA 3EDDA 3N1MC 2QQNL 3PGFL 5EZJB 2APBA 4UTAL 3U36A 3IGAB 1X9QA 4DEPC 1YNTB 3LB6C 1IFHH 4UINL 4B53A 1QR1A 4Z18A 4MNGA 5EZLA 3VXME 5F7EH 2VSDA 4C4KT 1PYWA 4FZ8H 3HAEB 5D7SL 3SE9H 1VGEL 3THMH 5L0QB 4A6YH 5TE6L 3UTZB 3HPJA 1HSAB 5C09A 5HHXH 4WHDA 5AD0A 2MQ0A 3ARBC 2PW1A 4R6UA 5E4EB 3QO1B 3OR7A 3H0TA 4UZGA 1IAIM 4G9FB 2PTUA 4FG6D 1SMOA 1TZHB 2X7LB 4Z0XA 4R90L 5KTEH 2MTPA 4R7DA 5H2BB 4KDTA 3QIBD 4HWBL 1A6AB 3FCTB 4QYOB 4PREB 5E08H 1WV7T 5C0EB 2NY0D 3H3PH 1Q1JL 1A6PA 2ZCKH 3HE6B 4I0KA 3TF7C 4WY7H 3NA9H 5KSBB 2VQTA 4EI5C 3LQMA 5LQBH 1MRFH 2OZ4H 3T2QA 4AENA 4W6WB 3CX5K 4XMKL 5I1KL 1NCAH 4QT5B 4NQDB 4LEXH 4S11A 1JZ8A 5D7IA 5BV7H 2YR3A 1BVLA 2C9AA 4F57L 1EEZB 5E2WL 4M4RA 1VGKA 5FM5O 4DUVA 3QCTH 4PG9A 1XF2A 4XAWH 5IFJA 5B8CC 4OKVA 1D9KD 1OGAB 1K6QH 3OKDA 4BFGA 4GXVH 3VDBA 1RZJL 1ITCA 2VDQL 5DHYB 1FO0H 5BVJA 3PGCB 1KIPA 1S5IH 1P53A 1C16A 1ZKAA 4LLWB 2P5EA 4NRYA 3WNMA 3EDJA 4L8DB 4ODWB 2WNGA 2V7HB 4OD1H 1XZ0B 4IS6A 4TTGA 2J8HA 3GSVB 3SY0B 1J88A 1QFPA 2VZSA 4XMPL 5GGVL 3VXNA 1PY4A 2L4OA 3ULUC 3CSPA 1EH9A 3QG7L 4P59L 2GY7B 4JRXB 2QADC 1MI5E 2XTJD 1DBJL 3I2CH 4K7FB 2IAND 1IKFL 5ID1B 4HWBA 3MNVA 3U82B 2IAMC 4RWYH 2Y7QA 1MY7A 1E6OH 4WEBL 5ALBL 2ENSA 3GSNA 1YY9C 1KPVA 1S9VA 4RBPH 2AAVA 5GSRB 4AEHL 5KOMC 1I3GL 5EU3B 1DDHB 1CDUA 5DC4B 1N6UA 4NHUA 1QBLH 3ZT6A 5FUOL 4NP4H 5INDB 1J9CT 4KAQH 5HYJD 2P7TB 4RMWA 5CMAB 3HI1B 4MVBC 3QFJE 1CLZH 2EDRA 2BNQD 4MB5A 3EHBD 1OAKH 3G6JF 3LKNA 1A1NB 2EZ0D 2B2XL 5F6HI 3W2DH 4CU7A 5EORH 2DOCA 5J13B 3ROLB 3VFOB 5ADOL 4PRDB 5I66B 3I85A 3TH4T 1AGCA 2VDRH 4NNPL 4ODUB 1I3VA 1WQVT 4YUEH 1W72L 3QQ3B 4GKNB 2GJJA 3E3QC 1KTLA 1OAQL 3L3KA 1N5AB 2H2SC 3B8SA 2Y23A 4DN3L 4JRYB 5ISZB 1IGIL 4GG8B 5EPMA 1YC7A 2Y6SD 1OD7A 4KI5D 1F3DJ 3QCVL 4OBRA 2OJZL 4C4KO 1DBMH 2AJSL 2D0GA 2HRPL 5C0IA 4PV8B 3QA3A 5GGVY 1U92A 3T0EB 4MZ3A 4LRNL 1BOGA 5C07A 3RNKB 1FNEA 2J88H 1DBKL 4PJFE 1U8NB 4HSQA 1YPZE 3CH1A 4RNRA 3T65B 5SWZA 2NYYC 4O9HL 1RIUL 5IK3B 4GW4B 1L4IA 2OM5A 4M7ZB 2JB5H 1AGEB 1HQRB 4Y4HC 3FFCA 4WU5B 3MA7A 5IQ9A 4RAUA 1UWGL 1PY9A 4IOIB 1DE4B 1S5HA 4KQ3L 2HP4A 4R2GC 1NCCL 4HGWB 3D5OF 5I74C 2DQGL 4G7VL 4M00A 4LCCC 4X4ZA 1QOKA 3KVQA 4XVSH 3WIIH 3FRPA 2HVJA 4OZIB 3VI3F 4Q2ZB 5CJOH 2OTWA 4K7PH 3QUKA 3ARFD 5BS0B 3MRCB 2J6EH 4HUWA 4JANB 2MHAB 4H20H 1EGJL 5KJRL 5DLML 4OLYL 1A6UH 4AIOA 1NJ9B 2YEZA 3CFCH 5ACMA 1IGFH 4H8WL 1DBAH 4KROB 3WXVL 4GRMB 3MLTA 4MD0A 1P7KB 4PRBB 1NMBH 3HC3L 2GT9B 3PNWB 3FFDB 1S9XB 1KPRB 3GMLB 3CH8A 2IPTL 4MQSB 5C0CA 2BVQB 4JZNA 2G2RA 1E4WL 4M1DH 4QRRA 2FATH 4KTEH 1AE6L 1JGEA 4I0PA 1AHWC 3A6BH 1MCFA 2VDKH 5JHDE 4HCRL 1CL7L 3JV6A 3IF1B 3FO9A 4PBWD 3GHBL 2B0SH 1PJ9A 1ZHBB 5CD3A 4YHNB 4LCIH 4TPRH 4P9HL 3B83A 4HBCL 5JW4N 5IB5A 4L29A 1QACA 2P5WB 3AM8C 1KBGH 2FZ3B 5MEQA 1CT8B 1CFNB 4Q9QL 4NO3A 1S9WB 2CIIA 3GMNA 2H32H 3HE7B 3NZ8B 2BMKB 2D2OA 2MCPL 1NCBH 2NX5B 2Q8AL 3ZHDA 3VG0L 4LCWA 3V2AR 3VWJB 3PDOB 1Q72H 3OKNB 1FZKB 5DSCB 3NVQA 2IPUK 1NMAH 2I9TB 4FMFA 3D1MC 2ZKHL 4NM4H 1CD1B 2XWJB 4X6CB 1QA9B 4MDJA 1RD6A 5F3HB 3ARYA 4NNXA 1BGXL 5DFTA 4M6MH 5TE7H 4DN4H 5L6YL 4NO2A 3T04D 1GGBL 3B9VA 5DK0B 4PJ9D 1R0AL 4YFLI 4YDLC 4JLRA 4YPGB 4X7FC 2VMFA 1G84A 1P9MA 1N3NB 3MBXH 3GMRA 4XWGL 3TO4B 1U8IB 3C08H 2YC1B 2R56L 4PJCF 4M5ZH 2BNRA 4M1CC 4QHMB 3LRGA 1OB1A 2CKBB 3T0BA 4M3KB 4WHYH 3LN4B 3KPNB 4L3CA 4XPTL 1YYLL 3BIKA 3KLAB 2H8PB 5SWZD 4HCRA 1XGPA 4JY6B 4LVNC 5IMKA 5IEHA 2A74A 4XPFH 1OQXA 3B2VH 4XVJL 2VXTH 4RDQF 5I0ZA 4X6DF 5A3IC 2R2BA 2NPLX 1T22B 3MTRA 4FFZL 3UTSA 3K2UL 3ZKMD 2PYED 5HGHB 3BZEA 1RUML 4Y4FA 3U0TB 3JUYA 3MXVL 4TSAH 4DK6A 3CCHB 4ZUSB 5T3ZH 1IAIH 4WW2F 3MRFA 2W65B 2YUWA 4KRPB 1EFXB 2H2PD 4PTTB 1AKJB 3GGWA 4C83B 5HGAB 3VJ6A 4JQIL 5CD5D 3S8WA 3STLB 4IMLB 1HHHA 1IGTA 4BJLA 1MCWM 1EDQA 5A2LH 3RL2B 1QO3A 4NN7C 3QUXA 3FOLB 4U6XA 4DGYL 4H1LA 4ONGH 3G6JB 4X6BA 3ULUL 1CQKA 1R3JB 3LHPL 1CXFA 1J7VR 2F74B 2WBJD 3RZWA 4JG1H 1ND0A 4JM2A 3MO1B 5D6DA 3SDYL 4PJAA 4XTRD 1MRCL 4JHBA 4Q6YA 2Y1VA 3U30C 2QQKL 5L88L 4U1GB 3DBXB 1KJMA 4I48A 1HKLH 6FABL 5EU7C 3GHEL 3GBNL 3MLYL 3WHXB 5E5MA 3OGCB 3RKPA 3TZVC 5I1EL 1WIPA 4QRSB 1KG0B 4JFQB 3ZE2E 1XCTA 5H35A 5E94A 3I84A 4PJ8B 4DUWA 3IVKA 5DJ0B 1CGXA 1XAUA 4IRJB 4PRAA 5CCKH 1RULH 4X6EA 2B1AL 3MLXH 5T1KB 4D9QD 1ED3A 1FL6A 4HAFA 4AL8L 1OOAA 4H0GA 4NO0D 3EYFB 3WKNA 3BXNA 5T5FH 1FL3A 5DC9B 4BSJA 3UYRL 4WFFE 3A6CL 4LCWD 1R5WA 2AABL 4ZFFB 2GAZB 4JFZH 2FHBA 1WT5C 1BLNA 4DGVH 2OYPA 1FZMA 4LHQB 5D9SA 1ZK9A 3LMJL 4GQ9L 3MUHL 3GFUA 4MSWA 1LO0H 4XXCA 3CVHL 4N5ED 5DUMH 4BH7A 1RHFA 3WJJC 2HT3C 4DCQA 1MLCB 3MLRH 4P3DB 1XR8B 3LZFH 3L5XH 1E4XH 5DRXB 2E7LC 1PQZA 3ULVL 2BNRD 4NN6B 4KKCD 5IESH 5MHSD 2OLDA 1TTUA 4OD3L 1F4YH 1JIBA 3JTSB 1DEEA 3QEQE 1ROWA 1F3DH 2DN7A 1JUFA 2EH8H 3ARDA 4PLJC 1ZMYA 3KPMB 3GIVA 3HZMA 5FYJD 2LVEA 3VE0B 5C71A 2JLLA 1Q9KB 1H8SA 4X7EC 1CE1L 3QIWB 4NBXB 2DS4A 4X80H 1HNFA 1QSFA 4K3DL 1YMMA 1ZEAL 4PYGA 5H8DA 2HN7B 3QWRD 1NL0H 4ACPA 2ADIB 1RJZA 3QB7C 2Q6WB 1R6VA 3BPNC 4W4OC 2JJWA 3MLPA 5I17A 1T21B 4TVPL 2JF1A 3L3IA 2JB6A 1QSZA 1A2YA 5KVEL 4JDVB 5H94A 1P1ZB 2ORBL 3RGHA 4CMHB 1GHFL 3EFDL 1T83A 3V6FA 3BKML 3OKLA 5IB3A 3ZE1E 5HBBA 3LEXB 1MY5A 3DMMD 4PGJA 1BX2B 4HS8L 2PW2A 3TBTB 4Y2DD 3QUXD 3RKDC 3P30H 1G6VK 4YXKH 3L6FB 1DSFH 1G7IB 3CVHA 5GRUL 5KSAC 4NT6A 3D0LA 1CICC 4FQXA 1X5LA 3P0YL 3GNMH 3BP6B 5CIPB 5EU4A 1OARH 3T1WA 4HLZG 2VLRB 1FSKC 1MQ8A 3C5ZA 4MB3A 4QHNB 5JOEA 4FQQA 3MRGB 3MJ7B 4YHLH 4KHXH 1IGJB 1MCNA 2GKIA 1F6AB 3WFBH 4QTHA 5I1CH 4I2XE 2DWDA 4EVNB 2KDGA 4E5XA 3BUYA 3OB0H 3LSOA 4OGXL 1EAJA 2D7QA 3SEPA 3W9DB 4LDOB 5GRZA 4NQXB 5EZIH 5DRWB 1ZLUK 4PJCB 1QFWI 1OT2A 3H9HA 4RAVB 4FXGB 5CGMA 4RDQG 3BO8B 4FS0A 4I1NB 1MFBL 5FM5M 3TT1L 5C0JA 1MQKL 4E9LA 1A6VL 4WFED 5KBNC 4PY7A 1VDGA 1F5WA 3VXOA 5INCA 4Q9CA 3LIZL 3NIDF 2P8LB 5GISH 5I8EA 5E24E 2BOBB 2J7LA 3KWWB 5IWLA 3TNMA 3LQZA 3IXAA 1PW3A 3CK0L 5CSBA 1E27A 2Z31B 3AFLA 3ZE0F 1NCWL 2NLJB 5FO7A 1KB9K 4L3AA 2CLRA 4X6DB 5BO1H 4WHCA 4NC0B 5IGXH 2J4WH 2PKDA 3BKCH 4ZSOA 2NY3C 5KVDL 1KLFA 4CNIB 5IP4A 2CR3A 3VFTB 5A16B 1KJ3H 3WSQH 1DLFL 3IDNB 5C8JA 3ULUD 2IMMA 4ODVH 9CGTA 3MOBH 4WW2B 4UAOB 3P9LA 1UB5A 3ARDD 4HK0B 3U9UB 2IAMD 4PRNA 4P2QE 2KKQA 4PB0L 1YY9D 5L2KD 5C0BE 1KXTB 4W6XB 5H37G 3UDWA 3GIZL 5L0QC 2A1WH 4HEPG 1M4KA 4POYA 1T1ZA 1J05B 4PRIB 5IVXF 4ZNEE 3TYGL 2EDXA 4QNPE 1MNUH 1YMMD 5MENA 3DVNA 1ORQA 2ZSVB 1CDHA 5D1QB 5CJQH 4MQXD 1HNGA 4M62L 4LU5H 3VRIA 5E9DD 2N1KA 4WUUB 3TN0B 2A9NL 4HIJA 3PXJA 4JO1H 1T20B 2G5BA 5GRJH 3U0WL 5D71H 3OF6A 1GRWA 3HPLB 2BNUA 4OJFH 2E6JA 1V5JA 4QRPB 3HE6C 3LD8B 3P4NA 4J4PA 1AXTL 1YEJH 4BZ1L 4G8GB 1I1RA 3NH7L 4NKMB 1FYTA 3W39A 2EXWD 1ZWIA 3JWDC 4U6HA 4FABH 5IV2A 5C1MB 1LK3H 1SBSH 5IBLC 3C8KB 3GI9L 3DXAE 1SEBB 1T2QH 1BVKB 3ZHLA 3ILQC 1FG9C 3GSOB 3IKKA 3UPRB 3KNBA 5FYKL 1TQCC 2VWEC 3ULVD 2IG2L 4YBHA 1MF2H 5BV7B 1T03L 4HWZA 1OGTB 3E6HA 3KPRA 3QNXB 4GS7B 5DWUL 3PGDA 1JGLH 2BSED 1OP3H 1I1AA 5EO0A 1CFTA 5FM4A 2NYYD 2XI9A 2X9YA 1JGVL 3K4AA 5CHNA 4H0IA 1OHQA 3QI9C 1EVTC 3NCCB 1SBBA 4U4BA 2DQIH 1Z9SA 2ZOLA 4Y4HD 4NZRL 1YC8A 3NMEA 3WXWH 4P46B 3ZTNL 3VRLF 5F8QC 4HWEL 1FO0B 1C5BL 5FHBL 5K59F 1KIRB 1ORSA 2JJUA 3ISWA 1AFVH 1OPGH 4YHIB 3RWDB 3PWUA 1X5JA 4JKLA 4LBEB 1Z2KA 1MHCA 1QPPA 3OJVC 5TE4H 3VW3L 4D0DA 2R69L 2VLKB 3KLDA 3ZYOA 2P8PA 1QBML 4UQ3A 4M6NL 4P5MA 4YDKL 3HNSL 1BHGA 4LLYA 4W81A 4O2CB 4HK3N 3RUGE 5JPNB 1FAIH 4JPIA 4OZGF 4P2OA 1LE9B 1T5XA 1DN0A 5BRZB 2EDBA 2H1PH 5LBSH 3FQTB 4JN1H 4N68A 4P2RE 3CMOL 1J1OL 1RZ8B 4I4WA 2ITCA 3EOTH 5ILTL 4MJ5B 4YNYA 5C6WH 2QLVB 2XTJE 4HPYH 5DR5L 4K8RC 2RAMA 2IANE 3IFOB 5EN2B 4JFFE 3T08A 1MAKA 1MCCA 1VKXB 4U3CA 5KS9E 2F9BT 4FQ1L 2ZOKA 3SKUD 4JN2A 2GK2A 3U7YH 2MQ3A 3A6OA 4U7MA 2ZG3A 4WI3A 5D1ZB 1A6TB 2GFBB 3DLQR 4YO0B 4WI9A 1UACH 3WFEH 3WFDH 4LGSB 3GDBA 1NFDA 1WSST 4KC3B 2GEEA 1G9NH 3QULA 5FUCC 5HYJE 4UNVA 2R0WH 5F7DA 1U0QA 1KC5H 5JZ7C 2O61B 1I1YA 2P44B 3STBA 2D3VA 5MEND 5MEPA 5D2NC 4MNGE 3RTQA 1PKQB 3P73B 3BMWA 3WIFA 5DUPL 2J8UA 2XPGA 3O11B 4UT9L 3GMQB 3CNKA 5C09E 5JMRA 4PGBA 3MV8A 2CXGA 4J4PD 1LILA 4G6AD 4MX7A 5FDYA 1NFKA 4I13B 2VLJB 1WAAE 1GGCL 2PXYB 3EDEA 3OJDA 2D4DA 4HLJA 5JXEC 1ZE3C 3P9MA 1CK0H 3O8XB 4QGTA 4MNQB 4QHKI 4MA3B 2PR4L 5GHWH 4TOYH 3CFDA 2G60H 3D3VA 4HKZA 3EOAB 2YHGA 1X5GA 3KPRD 3M45A 1ZTXH 3FONA 3BE1L 1KPUB 5D7IE 1I1AD 3G08A 2FX8L 1A5FH 2AV1A 5DGRA 5CBEA 3EYVB 4IRSB 4ELKA 3M8OH 4C54A 4F7CA 5E6IC 5FA3A 3DUUB 3T0XA 1UYWH 4YAQB 1FC2D 1ADQL 5FDWB 3CLEL 5D72L 1G9MH 4D0CA 1MCPL 1QKZL 2BJML 4RQQB 4IDJL 4X4MA 3B4NA 2CSPA 2DI8A 1KCSH 1X4YA 2OXGA 5CILH 2P5EE 2CUHA 1LO2L 1S7QB 5TDNA 2I60L 1I3RB 2NTSP 2AJXH 1CFSA 1GJIA 3RDTD 5IVXB 3VXUD 2KPNA 5ALCH 1YN6B 3VI4E 3RFZC 3CVIH 4LIQH 4BSWA 4OCWH 4U7KA 3G6DH 1KF9B 4F9PA 3QXWA 4PLNC 4XVUD 2ARJA 1QRNA 1U3HB 3PABB 3HE7C 3TT3H 3UBXI 1JFQL 4WTZA 1P5VA 5FYKD 2XA3A 1CFVL 1JGUH 3GMPA 5IT2L 1K4CB 3VWJC 2BZDA 2O5XL 1J0IA 1EK3A 4DKAA 1Z9OA 1JPFA 5F96H 4M6OH 3ZKXC 4OV5A 4GKZB 1ZGLP 1SVZA 5EOCL 3F12A 1U8OA 3FT3B 4KRNA 5T3XL 4F7EB 2X4SA 4KZDH 3OKYA 4OZGA 3AB0B 3X14A 1YYML 2EE3A 4G6ML 3NPSC 5HI5C 3QJHA 1T1YA 3RVVD 1ADQA 1QYGL 4U1JA 2CO7B 1NDMB 3U4BH 1F58L 4S0SD 3RTQD 4AQOA 2C1OB 2VXSH 4K2UL 3L7FB 4OZHF 1K8DA 3H9ZA 3K4DA 3JWNC 5L8JB 1T1XA 1KULA 2P4AB 1PEWA 3IT8D 2QV2A 3LQAL 4JFED 5CP3A 2KH2B 1P7QD 2WMPA 4PJDF 1TQBB 5TDPB 4FTVA 2F19H 2KZWA 3MV7B 2V5MA 4WO4C 5DMKB 1X5FA 4CMMB 4NZUH 4L8CA 1ETZB 3IFNL 1HZHH 2C3XA 1A3LH 3G5XB 2VL5B 5DJDB 4LRIA 3TJHC 3QPQC 1U2CA 5M94B 2Q3AA 2HT3D 5C07E 4YJZL 5DJCA 1GPOL 1ZGLA 4S1DC 3LKQB 3D2UB 2AK1H 5DD5H 1Z5LA 3W5NA 1RK1B 4F7TA 5SWZE 4PJXF 4KJYA 4M8QB 1WJ3A 3CXHJ 2Z8RA 4UT7L 5C2BL 1TVHB 3IGAA 4PLJD 1YNTA 1NEZA 2V17H 1O7SA 1RUAL 2DIJA 4LKXB 4WV1B 3FFCE 2YA2A 5D8JH 3N85L 1U8KB 4FOMA 4UDUB 3LDBC 1P6AB 2YN5A 1DL7L 5I1HH 1YDPB 3RIFK 4LSQL 1HSAA 3W9EB 4Q9BA 1H3UA 1N4XL 2DBLH 3MGOB 5JLZB 4RBPK 5DD3H 2FJFB 2JELH 2VXUH 3T2OA 3FRUB 1JN6B 4G9FA 4QTIH 5FKPA 3RWFB 5KVFL 1M6OB 1ERNA 3I75A 4LPYA 5T1LB 4CGTA 4YGVB 1RZFH 1J8KA 2OL3L 4A2MA 2YPLB 3HZYA 3S96B 5H2BA 1J5OH 1OP9A 4XNYH 1PAMA 3FCTA 4QYOA 4OCSH 1KJVB 3T3ME 4GBXB 4PREA 5C0EA 4XP1H 1BEYH 3MJGX 4UNTA 2CMRL 1UA6H 3EO1B 5MP6H 1SJVA 3DSNA 2N56A 4HF5H 5C0CE 4YDVB 4QT5A 5FGRA 4X7TA 3Q1SL 1CG9B 4IRJC 4M7KL 4QRRE 3C2AH 3GSQB 3FJTA 3O3EB 1EEYB 3O6FB 1G6RH 1IC5L 5KSAD 1F4XH 5IM7B 1NC4B 1QRND 1NSNH 1PG7H 4G8IB 1BFOB 4GRLB 3RZCB 1QLRA 1OGAA 2C5DC 5LGJB 4YH6A 5AZEH 1F8TL 2XA8L 1KCKA 1J0HA 5FB8B 2D03L 5IQ7H 4H5SB 5DHYA 3ARTA 2IPUG 4D9QE 3PGCA 5I1LB 2VIRA 2DQTH 1IEAB 1UKQA 3K2MC 4LLWA 3AROA 1X5KA 3S36X 4XCFH 5LWYL 1KT2A 3ARGB 3Q6FB 4AIZB 5BZDB 5F97E 5B21A 4LCWE 5EWIH 1XZ0A 4IM8A 1NCDL 3RHWF 2E8YA 1JYWA 3VXRA 4PJ5D 1WZ1L 3SY0A 1KN4L 3TM6A 4NQTA 4NQCB 1A3RH 4LVHB 1SY6L 1MCRA 1HXMA 2OL3A 1YEKH 4FTVD 1PEZA 2HFEA 2QQNH 5EOQL 2X6MA 3KR3L 3F65A 4WDIB 1G0DA 3SE8L 1N6QL 2VQ1A 2P8MB 2BNRE 2VDOL 1HWHB 1DDHA 3DX6B 4GRWE 4LLVB 5DVOA 1KACB 4HUUB 1XF3B 4X9FA 2NY3D 2BXYA 4FRWA 3ZLQC 4O4YL 4OGZA 2P7TA 2JCCF 4RMSA 5F1NA 3IETA 1BQLL 4HQQL 1MCHA 1KLUB 5CEXA 4U1NA 5D7SH 4HJGA 3RY4A 3C9NB 4LSRL 1UT9A 1D5IH 2VKWA 5HPOA 1QNZL 3ROLA 5K9OA 5C6TL 4NO5A 1C08B 4XNUH 3DVGB 4ODUA 1QUNA 3KXFA 3AAZB 5TF0A 5D2LF 2C3VB 3QEGL 1NGXB 1HCVA 1N5AA 3OMZA 5E2VH 3O41B 4JRYA 2EDTA 4XNZB 4HWBH 4GG8A 4LARH 5J1SC 4ZO7A 1CF8L 2AJ3B 4UV7H 1Q1JH 1HHGB 4XBGB 4WCYL 2WIIB 1I7ZB 1GVIA 4G9FD 3SJVB 1EUUA 4NCC2 4F3FB 2AJYL 3K1DA 1CDJA 4I3SH 3T0EA 3OV6A 4EI6A 3U2SB 1SY6A 1QP1A 1MJJB 1AGFB 4IJ3C 2JJVA 3MCLL 3T65A 3LV3B 3HE6D 1F13A 1MJUL 4GW4A 3DHJA 1AGEA 4NQDD 3KPSD 2J3SA 4WU5A 4PJAE 2VDQH 3M17B 2NZ9C 3GK8L 5IBLD 1DE4A 5EIIA 1X3DA 1QZ1A 1KGCD 3DYOA 1IAKA 4ZAKB 4OZHB 3ORJA 3ILQD 5HHOD 5DQ9B 2XWBA 4NFDA 4MXVE 4JFPA 1N5YH 1JZ4A 4PJDB 2IALB 1YMHB 1SVCP 2B20A 4OZIA 3D9AL 1TZIB 2CPCA 3NN8A 4WWID 1JVKA 1FNFA 3MRCA 1C5CL 3NIGE 4XMPH 1Y0LB 1ZVHA 1LP9A 2D7TL 2PCPA 2AK4A 2Z31C 4P59H 5FV2A 5I9QB 4MAUL 4FQXC 1IKFH 1CFQA 2X1OA 3CMGA 4GRMA 2IBBA 4PGDB 4PRBA 4PTUA 4WFEE 3DRTA 5ITFB 3JVGC 3PNWA 1C5DB 2GT9A 2YN3A 3LN9A 3HCVB 3LEYL 4PJXB 4WEBH 5ALBH 5FO9B 5HPMB 3B9DA 2BRQA 4N9GB 5JHLH 2CKBL 4QGYA 2WAHA 5DVMA 2AS5M 1GL4B 3QWQB 1G0XA 1G1CA 1I3GH 2DLEA 4WW2C 5ICZB 4JRXD 2FH6A 1HSBB 2H9GA 3RGVB 1ITBB 1OM3L 2CDGA 5FUOH 1OTSD 4WUKL 3BH8B 3FAWA 1JYVA 5C7XH 4ZFGH 2BSTB 5TGBB 2XRAL 4YHNA 5I1GL 4QHUB 3MOAL 1UCBH 2B2XH 2JIXB 5IMLB 2P5WA 5ADOH 2FZ3A 1CT8A 1CFNA 3S36L 3A67L 4V2BA 1S9WA 3QXUA 1W72H 2I07A 3REVB 2NNAA 5HYSG 5D1QC 1T1WB 2GW5A 4RRPG 1QBAA 4JHAL 1DLHB 4DN3H 2IBZX 4L4VB 2HH0H 2V7NB 1RVFL 2D9QB 3MV9A 2OJZH 3VGAB 1L7TL 1S9KC 2A77H 5DSCA 3AREB 2I9TA 3G5YB 2HRPH 3MRRB 1CD1A 3VXTB 1QSFE 5DGQA 3MBEA 1YMME 2X4QB 2XWJA 4X6CA 1FFPA 4JRYD 3BDYL 4NUGH 5ISZD 4KKAC 3OAUH 2XXMB 4NRXA 5HYSB 3VD7A 5JZ7D 4QHLB 3JSSA 4J6RL 4YPGA 4Y1AB 3V5DB 4WNQB 1N3NA 2CK0H 1RIUH 1YEFL 3MNWB 2YC1A 2XKUA 5I16B 4B5EA 1ZANL 3CFBB 3T0ED 2CKBA 4TQEH 3BKJH 2WWKT 1UWGH 3LN4A 5FYLL 2HFGH 4I9WD 5DJXB 5E8NB 2H8PA 3QQ4B 1F90L 4MCZB 2DQGH 2Y5EA 3S37X 1T2JA 4JY6A 3V7AG 3SDDC 5HVWA 1H3TA 4OFDA 2W38A 1MFAL 4RGMB 2QSCL 3ULVE 2FWOA 1CLCA 1FG2B 3DROB 4MJ4A 4PB9H 1Q38A 5GS1B 4UQ2B 1EGJH 3LRHA 4LSPH 5KJRH 2EYTA 4DAGL 3C2SA 5T5NF 4L3EB 4IMKA 3U0TA 4TNVF 5K9QG 3CCHA 3HC3H 3VXQB 1MFEH 1UZ6E 4NWUL 5BS0D 4BQ8A 3BP5B 2IPTH 2W65A 4LSVH 4NM8L 4ZS7H 1EFXA 3CD4A 5FYKU 1E4WH 4OFIA 4JM4L 1AE6H 3QDGB 4IMLA 1JNLH 4KROD 1JHKL 3REWB 2JCCB 1YECL 5FYJH 3IJHA 3RL2A 1EHAA 4G8EA 4HCRH 2AQ2A 5EOTB 2LV4A 1XCQA 3VWKB 3TH2T 4TVPE 2H45A 4ZD3L 2F74A 3GEWB 4P4RA 1I8KA 2NY2B 4Q9QH 1U58B 3OWEA 1IEBA 4MDIB 5JDSA 1CBVH 4M6AA 4PJBF 1MUJB 5D7JB 3FN0L 4ZSOE 2MCPH 3TO2B 5IMMA 4PLKC 2D7OA 3VG0H 1FNAA 2VITB 5HD8C 5C0GB 1DR9A 4PJ8A 3VMNA 4KXZH 4YXHL 5DJ0A 2P5WD 3SDXB 3L5WA 2D9CA 3P4OA 1J0ZA 1MCQA 1JWMB 2BCKB 3EDKA 1LDPL 4L9LC 3HE7D 4LLUB 4WEMB 2YD3A 3BESR 2NX5D 5L6YH 4I5BA 1NCUA 2IPKB 3MLZH 3VWJD 1R0AH 4PJ7B 5E6YA 3BKYH 4O5LH 5JIPA 4KFZC 5MI0B 3G04B 1U3YA 1TFHA 2R56H 4XHJC 3LKPA 4HUVA 4NKOA 4QEGA 5GS2D 3KYNB 5MENE 2ADFL 1H0DB 2PXYC 5D93C 2FO1A 1YYLH 3ZL4L 3C6SB 4N0FA 4Y5VA 1MIML 1S3KL 1VACB 1MLCA 1XR8A 3OB0K 3TO4D 3O8XC 4S1RL 4P3WA 2EH7H 3U1SH 3DYMA 4Y4KA 4NQEB 2UVFA 3JTSA 3QEHB 4EEEA 4XVJH 3L3GA 3EJJX 3RVTC 5DTFA 5CJXA 1FYTE 1OCWL 5J7CC 4YC2B 2NR6C 1IILE 4G43B 4RAHA 3T2NH 4K3JH 3K2UH 4J8RB 4FQCH 2ZCHL 3QPXH 3BPOB 1Q9KA 4IRSC 4D9RE 3PL6A 2MOVA 2V5RA 3QIWA 3CFJB 2HMID 1JWSA 3MXVH 3RJDA 1QSVA 3QHTC 1VESA 2IH3B 4HFUH 4YK4B 2HJFB 3FB6A 1M05A 4LEOB 2HN7A 4S1DD 1EZVX 4C56A 3KPRE 3MREB 2DTML 2ADIA 4QXGL 4JQIH 2HLFD 4CADA 1HXYA 4L9DA 1T21A 5CFHA 1XH3A 1XIWB 4MA1B 4TVSa 3PHOA 4DGYH 3UTOA 4H88L 3ULUH 5ETUB 3LHPH 5C9JB 1EFXD 3SDYH 1AKJD 4OFPA 4G3YH 3LEXA 3N9GL 5GS0C 5KVMC 4QY8B 3WIHL 3WN5C 4Z7NE 3S37L 2QQKH 5L88H 2VDML 3I02B 1BX2A 1RY7B 2DQCL 3SKNB 2BFVH 4HH9B 3DO7B 3WNKA 5CEZE 2Q20A 5DRNB 3IFLL 3MLYH 4OFYA 4YHML 1UFUA 2G75B 4HGMA 1BBJB 3BP7A 4L5FL 5DT1H 4ZO9A 2DQEL 5DYOA 2R0KL 5IW6A 3FN3A 4PUBH 7CGTA 3MA9H 1DQLL 2IBZY 3ZYZA 1QLFA 4AMKL 5FYLD 4EUPA 5E56A 1NPUA 4ELMF 2EEAA 4QHNA 3N0PB 4U1SB 3V79C 1NC2B 3MRGA 4KDWA 5D6CB 3MJ7A 1AC6A 4WIQA 1IGJA 5E2UL 3UYRH 2VLLB 1EBPA 4KKBC 2AABH 3HG1B 4KK8D 3SCMA 1D5BB 4PJ8D 2VUOA 3MC0A 3RIFF 4R0LA 4UV4L 2Q8BH 4IRJD 1T5WB 1PGRB 4PJGF 5FYKE 5T1KD 5E00B 4HKJA 4RAVA 5FFLA 3GMOB 1JV5A 4U1IB 5HI3D 2F54B 4GQ9H 4FZ8L 3THML 2F53A 4CJ1A 3SDCA 4A6YL 3V5HA 1A64A 4CBPA 1MPAL 4P5TB 5HHXL 5T5NG 1F3JB 1NFDE 5JW3H 1CTNA 3S5LG 3ZDZF 3IS0X 1BREA 2P8LA 2OTPA 4UMGA 1A7RH 5DS8B 2BOBA 4O51B 1WIOA 1ZA6B 1I7RB 1N7MH 2X4TA 5KTEL 1IQDB 1MJ8L 4K7PX 4OD3H 3RBGA 4F9PC 5IHUL 2NLJA 3WIHA 4Z5RA 5E08L 1OP3K 3L1OL 1JPGB 3QT2A 4AG4L 4WY7L 3NA9L 2ZG1A 1MHEB 4YZFF 5DFVD 2OZ4L 2J8UE 1AD9B 3B2UD 4LPTA 5EU6B 5A16A 4M7LT 2YSSB 1NCAL 3VDCA 3MV8E 3BN9C 1GXEA 1RZKC 5E7FA 2YS4A 5BV7L 2QQQA 3GRWH 5DMGC 1UXWB 3QCTL 4WV1C 2W59A 2X40A 3LRSA 1MCWW 4XAWL 2H3NB 3CJJA 3LS4L 1VFMA 4IHOB 3SKMB 1RFDH 3C09B 1BF2A 3GM8A 5KVEH 1WITA 1J05A 2ORBH 1FO0L 3EYOB 1FNHA 3ROOA 3D3VE 1TCRA 1BWMA 1NAKH 5FGSA 2FO4A 3QIUB 2RBLA 1S5IL 3Q48A 4LPUA 2EDWA 4HC1H 3WL9B 4YHOL 3V4PH 1CL7I 3TN0A 4HS8H 4A6YA 2YWYA 1T20A 4OD1L 4PJBB 4G9DA 4GBXC 4NZTL 3HPLA 4DKFH 2AQ1A 1UADC 4MNHA 1I1FA 2W0PA 4N8VG 2LFGA 4OD2A 4G8GA 3P0YH 4QRTA 4GW1B 4D3CL 4NKMA 3LKSA 3PWVB 4W6YB 1QRKA 2DQDH 5J06A 1Q9LB 1JP5A 3H9SD 2D31B 1E6OL 4S1SL 1H15A 1F97A 4X4ME 5IB2B 4L4TB 3O6FC 4M9PA 4U05A 3F5WB 1SEBA 3S4SG 2OZ4A 1WWCA 4KXZI 3GSOA 3UPRA 2YOCA 4GRLC 4OGXH 1IGML 3FQRB 3RZCC 4N8VB 1QBLL 2AW2A 1SMAA 2VLRD 5GGSY 4NP4L 2DB8A 3MGAA 3QNXA 5GGSA 1G6RB 2EDJA 1HWGB 3TT1H 1CLZL 1A6VH 1JHTB 2VL4A 4HEME 4HULB 2DMBA 5DD6B 1UM6H 2QSQA 3B5GA 1QRNE 3MUJA 4U1KA 3S4SB 4UDTB 1VENA 4P46A 4HZLB 5I2IB 2BVPB 2IQ9L 3TP4A 1OAYH 4EDXB 1FO0A 2O26U 3CK0H 5FHAH 5L2JB 2GUOB 3RWDA 3H9YA 4LBEA 5HYQA 3O3BA 1L0XA 2YD4A 5I30L 2HT4C 2VLKA 4ZQKB 1U91B 1DBML 3MJ6A 4J7RA 3MV11 2SEBB 1L6XA 4KK6D 2BY1A 5DZLA 4ZFZA 3VU2A 1EJOH 1DLFH 3PHQA 5I75C 3MJ8B 3KYMA 1JPTH 3PWLB 4MXQC 2Z31D 5EOCJ 1LMKA 2D4FA 2HA1A 3ARUA 1HEZA 5BRZA 4NPYA 2BVEA 3H42H 4GKOA 4AH2B 3P77A 4L8SB 2CRMA 3I6KA 2JB5L 4HUXB 3EO9H 3IFOA 1B9ZA 1GGYA 3GSXB 1NLBL 5E5RB 3GIZH 4FTVE 4M93C 1T7ZA 2EKSB 1EZVY 3KLSA 4XZUB 4ZXBB 5HDQH 2WW8A 4N8CL 4ZG1A 1GC1C 2NXYB 2XNAB 2DKSA 3TYGH 3VXPB 5D1ZA 1A6TA 2GFBA 3ARPA 1BFVL 1N59A 5D4QA 3CC5A 5F9OL 3PWNA 5MERB 2UY6A 4X8JA 4XVSL 3WIIL 2A9NH 4E0RA 4MJIA 2V5SA 1JNNL 2UWEB 2XQYG 4K7PL 5CSGA 3O45B 4PRID 1RIHL 3FOMB 2R4SL 2O61A 2ZNXA 1O0VA 5FKAB 3K4ZA 1BD2B 1MCBA 3PUCA 3T4YB 1A6UL 2WM0A 5D1QD 3HI5H 3CFCL 3B3IA 4U6YB 1IGFL 4AEEA 1DBAL 4GAYB 5EO1B 4WUUD 3TN0D 1F02I 4ELMB 1NMBL 3B6SB 3TNNA 4NN5B 3OBAA 1JGDB 1EO8L 3GI9H 1G7LB 2AGJH 4QRPD 1D5XA 5EUKB 1KTDA 2M8XA 4JKMA 4CN1A 4Z7OE 5T3XE 4M1DL 3PV6A 4GFTB 2FATL 2IG2H 3ARWA 4KTEL 1CWVA 2YZ1A 4G9FE 2VLJA 1T03H 2QQLL 1OSPH 2VDKL 3U4AA 1LO3L 2HT2D 2DM4A 3OKOB 4S0TD 3B9KA 2Y4SA 2ZG2A 2WLZA 2B0SL 1A9EB 4ZAKC 5T1MB 4Q0XL 1JGVH 4Y16C 3VCLB 3L5JA 2EC8A 5FOJA 3MYJB 3PQYA 5EBWA 1K2DA 1KBGL 4K07A 1FN4A 1Q0YL 2NY7L 5FHBH 2D7MA 1WBYB 1CGVA 1AGDA 3BH9A 1K5NB 2LU3A 1NCBL 3EYVA 5TFSL 4PJ9B 3SDDD 5I9QC 3VW3H 4BH8B 2FGZA 3LH2L 4ZOBA 1NMCB 5K33A 1D6VL 4K7PY 4P46D 1QBMH 5C08B 3BX7C 2GTWA 4JCLA 4M6NH 4MAYB 4YDKH 1IMHC 1L9NA 2J6EA 2RFXB 1OGAE 2H26A 3VFNB 1S7SB 5AYUH 5FDWA 5F7NC 4FQ2L 5J0BA 4WI6A 4R4FL 5TE7L 4KGLA 3V5KB 4ISVB 3CLFH 4RQQA 4LFHG 3KPPB 3WJLA 4Y19B 1W0VB 5B3NA 2Y06H 4XPHH 2VLKD 5CLTA 3RGVC 3ARSA 1A0QH 4PJFF 3TLRA 1ACZA 3KPOA 1J0JA 4NJ9H 5TJWK 3VH8G 1YPZF 3BD4A 3C08L 4RGNE 1GIGL 1I3RA 5IHBA 1N8ZB 4FQ1H 2BP3A 3CUPB 1NEUA 4K3EH 3VXRE 3HMXL 5FA4B 2AV7B 1G1YA 3QDJB 3TA3B 5I1IL 1G7MB 3GUTA 3IDMA 2FL5B 4AM0A 2WV3A 5CSZB 1CZ8L 4WRLA 4CRPA 1U3HA 3PABA 1RZKL 3MLUH 2K1MA 2X1QA 3B2VL 1KCRH 2UY7A 2OJEA 4Z7WA 1BF8A 1RUPH 2DTSA 4E41B 4Y0GA 5D1ZD 1R3KB 1YJDC 3VGAC 1JCKA 4OGAC 5CZVL 1U93A 4MD4B 2DBJA 2H32A 3DRQB 1FRGL 4PLKD 1Z9LA 5ANMB 4TSAL 5T3ZL 1IAIL 4POZC 2MKWA 3T4AB 4PJEA 1P2CB 3HN3A 4Z76B 3MYZA 2V2WA 2BXZA 1P84J 1JMZA 3CDCA 3KXFE 1J12A 2C1OA 3BHBA 1GGCH 1CLOL 4ZUVB 3IFPB 4HGKC 4R9HA 4JRYE 4X98A 3PXHA 1MREL 4ONGL 5E99H 1WGOA 3EFFA 4JG1L 4XHJD 2PR4H 3MV7A 1I8IB 4G6FB 3VFRB 4FP8H 2VLJD 3BQUB 2BY2A 2PXYD 1UVQA 1A1MB 1HKLL 3QH3B 4Y5XC 3OSKA 3T0EE 3BE1H 3M1BB 1CGYA 1V7NL 2FX8H 1N2RB 1DANT 5GS1C 1IC7L 3O8XD 4MNQD 4I9WE 5IJKC 2WQRA 1H3WM 3LKOB 1TPXB 5E8DH 3RWJB 2H6PA 4PJHA 1RULL 2AXJA 4U7SA 3TGXA 3QO0B 1TVHA 3RVTD 4JG0L 3FO2B 2NR6D 5DMYA 3RVXC 1EXUA 3FB7B 1QKZH 2BJMH 4QWWC 5GGUA 4N1HB 1U8KA 5A2JH 4IRSD 4IDJH 1BQUA 1IVLA 1KJ2B 3SE3C 3FQXB 4ZUTB 1WFNA 1ES0B 4HXAL 4TNWF 5HGBB 3MGOA 5GSVB 1LO2H 5FOBB 3VWKC 4OZIE 1RV6X 4Y5YC 4NOFA 3FRUA 3QSKB 4RFNB 3RQ3A 1N6VA 4AT6B 1M6OA 3OX8B 1AQDA 5DUBB 1LO0L 3O3DA 4G6KH 1LP9E 5KVGH 4ZTPH 2AK4E 4LNRB 5DUML 1M71B 5ICXB 2Q7YB 1RURL 4CVZA 4UILH 3LZFL 3L5XL 1U8HA 1AP2B 2F5BH 1E4XL 4RSVA 4PRHA 5IESL 3HLAA 1FCGA 3OJ2C 2FYYB 5D7JC 5GS0D 3EO1A 5E2TL 1TJHL 1CFVH 4YDVA 3BFOA 3LAFA 5DHVB 5D7KD 4NCC1 3GSQA 3EDFA 3HI6H 2BHYA 1NC4A 3QEUA 1U3HD 5EULV 3PP4L 5EOCH 5EUOB 1UM4H 2VXVH 1FVCB 3HAEH 4G8IA 4GKSA 1BFOA 1GZQA 1GC1L 1T6VN 4DEPB 1HHJA 3QYCA 1YYMH 5C9KA 4G6MH 5J12C 5LGJA 4Z8FL 4ZYKA 3TVMC 4X9BA 1BQHB 5FB8A 2DICA 3Q5TA 4A2LA 1OW0A 2C3HA 3V6OC 2GSIB 2P5WE 4JGMA 2ZZUT 1VADA 1P69B 4K2UH 3OKMB 3GB7A 4Z7UB 4OB5H 3ARBB 1JI1A 4LSTL 5E8EA 4KK9C 1T80A 4ZDHA 3ARGA 1NGZB 1U8JB 3QFJB 5KSVB 3L3JA 2GTZA 4I18B 3MV9E 3BIBX 3LVEA 2XN9B 3IFNH 5F71A 5E2JA 4NQCA 1D5ZB 4OIIH 4JFHD 4X6CE 3HMWH 3I9GH 2WINB 5BXFA 1DSFL 4JFDB 4EI5B 5DFWH 4K71B 3P3YA 4NUJB 3U83A 3UYPA 2X70A 5FGBA 3DGGB 5SX4I 3MV7D 3GNML 5C0AB 4NQSA 2HWZH 2HJLA 3DX7B 3ZE2F 2EDLA 4HD9A 4KJQD 3ZZ1A 4ZOCA 3QCUH 4HUUA 1XF3A 4YK4C 1RUAH 1BFSA 3QUMB 4U0RC 5KSUA 3VFGL 4C58B 1XF5B 4MCYA 4LCUA 4X9IA 2CLZB 5B8CB 3D2UD 4JO2H 3F6LA 4NGHL 2E6PA 5EO9B 1OAUH 1DL7H 3BN9D 4PJFB 5EZIL 4LSQH 2Z93B 5DMGD 4P23A 4CU6A 2DQJH 1C08A 3QQ9C 5GRXG 3AAZA 3OR6B 1URLA 2CUIA 2A2QT 1A1OB 3SGDI 2C3VA 1NGXA 3SOBH 3IB4A 4WI8A 1QQDB 4QKXB 2GJ6A 3NCBB 4O58H 5T3ZD 3O9WB 1AR1C 1HHGA 4CVUA 4XBGA 2WIIA 4LCYB 2CMRH 4WJ5A 2OCFD 5FO8B 3LS5H 2QADB 4RMUA 5T1LD 1RZIB 5ITBH 1JZ5A 4U0QB 2YPLD 5IGXL 1WICA 5SV3A 3F7YB 1AXSB 2UZYB 3MNZB 2FIRT 5D70L 3PL6C 4GBXD 3BI9X 1KJ3L 2CDEB 3WSQL 1YEEL 1IC5H 4YIQB 4M9OA 1BBDH 3HHRB 3MOBL 4YHPB 3E2HC 2X42A 1GOHA 2EIBA 3UYOD 4LLDA 1F8TH 2E7HA 4R96B 2D03H 3M17A 2YA1A 3S6CA 2ZSWB 3L3OB 5HVFB 3K46A 3O6FD 2APVA 3WDHA 4RX4A 1T2XA 3RNQA 1FE8H 5FYLE 2EDEA 4GRLD 2A1WL 3L3HA 3RZCD 5F1SA 1II4E 2IALA 1I7UB 5LWYH 1R5IB 1LVEA 2FR4B 1TZIA 3P2TA 1NLDL 5CJQL 5C0FB 1YUHB 1D6EA 1IARB 1KN4H 2Q86A 1OSZA 1VFAA 3AMKA 1NFIA 3ZE1F 5GRJL 3QXAB 5ECJE 5CWSA 1M7IB 2XFXB 2Z0BA 5D1XB 4OJFL 3ARGD 3LPGA 2VAAB 3QZWG 1U95A 4FQPA 1CXEA 5D96B 3KPTA 1C5DA 2RR3A 3DO3A 5HPMA 5FO9A 5EOQH 1NANH 3KR3H 2NXZC 3X3GL 4NQCD 3FO0H 4XI5C 4APQB 2MFNA 5ICZA 1HINL 1LK3L 4NKDB 1SBSL 4G5ZL 3SKOB 1X5HA 3HS0B 3IJYB 5JW5B 3MMEA 2OTUA 5JOFB 1X6LA 3BH8A 2A0LC 1UQSA 1FFNB 4OZ4B 3X11B 5F89B 2BSTA 1MFDL 4HQQH 5I73B 4ZOEA 4R4ND 4I0CC 4MXQD 2ESVB 4GAJH 3U46B 4LSRH 1MF2L 3AY4A 4QHUA 5B39A 5J3HD 1QNZH 2JIXA 4R2GB 5IMLA 1RHHB 4ODSH 3UTPE 5I74B 3WEXB 3P4MA 3SGKA 3BWAB 4TTDD 5I6XC 4LCCB 3AS0A 4NQVB 3REVA 2PYFB 3I6LD 2AVGA 1DLHA 1T0NB 3WXWL 4L4VA 3TC9A 2Z92B 2V7NA 4WW1B 3UBXA 4XH2B 5HY9B 4UTBH 4MGXA 1AFVL 1OPGL 3DV6B 5F9JA 4JHZA 3L3DB 4LHUG 3AREA 4KUCF 3G5YA 5F3BB 5IVZB 3VXTA 2AJYH 2X4QA 5TE4L 5B39G 1U8PB 4KJPC 1G7JB 4RWHA 2NY1B 4C56E 4TN9A 2A73A 3ZMRA 4QHLA 4QXTB 2CH8A 2VZVA 2VOTA 1OTUC 3JZ7A 4HKXB 4XNQB 4Y1AA 4YBLC 5DURB 3V5DA 2YBRA 3P4LA 4GMSL 4GAGH 1MJUH 3VGGA 3SJVD 2IQAB 5I16A 3QDMB 2H1PL 2X1WL 5LBSL 2XOTA 3CFBA 4JN1L 1EERB 1ACYL 2X4NB 3EOTL 1AGBB 2GK0B 4X4YA 1HDMA 3GM0A 5I1DB 1H5BB 1QLEL 4UOJA 5E8NA 4MCZA 1WCBB 3HB3C 3HUJB 3ZDXE 4B0MM 5AEAA 4PP2B 2DQUH 3D9AH 3IRPX 4AYFA 1J87A 1UACL 4XC1H 3IRZA 4KV5E 4QNPF 3WFEL 4S2SB 1JHLL 1C5CH 5GS2H 1G9NL 3OXRA 4K9EC 4ZAKD 3WNPA 2C3WA 3NACH 1R3IL 3TBWB 4MAUH 1FVEA 4KJWC 1FVDB 3FT4B 4WVRA 1KC5L 2E7CA 3QUYB 4L3EA 3P11L 4IOFC 5E7BA 4F2MB 1YY8A 1BFTA 1P4LB 3VXQA 1FNSL 3MJ9L 1NGWB 3LEYH 2BX5A 4NFCA 3DVFA 5CZXD 1IM3B 3BP5A 3C5SA 2NZIA 1PSKL 3PJSB 4XNXL 4DZBB 4HUNB 1CVRA 3FTGB 3RP1A 3UO1L 1HK6A 1KIUA 1TMCB 2F53E 1ONQB 5A1AA 4WUKH 3REWA 3RRQA 4E42B 43CAB 4EN3A 1HHIA 1EAPB 3MLVH 2CKNA 3MRBB 4ZS6C 5GGRA 4D94A 5I1GH 3MOAH 5AWNH 3D69B 5EDXA 1EHNA 4P57B 4AK1A 1A02N 1FFOB 5IROA 3RGVD 3KJ6H 5HYFA 3TFKD 5JW4Q 3S36H 2WWMD 3A67H 4OZFG 1U58A 5ESQB 1HILA 4MDIA 4QOKA 3OAYH 4N90E 4TOYL 4JHAH 2G60L 3TO2A 3BMVA 3S9DB 5GJSH 2VZTA 4M1GH 1RVFH 2VITA 4OCMC 3O4LB 4BFIA 1ZTXL 2JIXD 1L7TH 5C0ND 3SDXA 4O02L 4FQHB 1A5FL 4MS8C 1JWMA 4NBZB 1E28B 4N9OB 4U1LB 4JZJB 2GYSA 3E6FB 4AJ0A 4U1MA 2R4RL 1CD9B 3BDYH 1MLBB 5IFHH 4L4VD 3MRLB 1JPST 3QUZC 2DF3A 1TVBB 4PJ7A 3FO1B 4M7JH 2FSEA 1QVOA 1HOCA 3ARED 2V5TA 1LDSA 3RL1B 4GH7B 4P0DA 3RUGF 3Q6GH 2APTA 4KRLB 4P4KB 5DJ6A 2P24B 1KCSL 3U9PL 4POZD 1H0DA 2BSRB 3C6SA 3D25B 1CU4H 4PV9B 2X10A 1JRHH 2C1PB 3T1FA 5KS9F 4IBLT 1IT9H 5KG9B 4OUUB 3QEHA 1MFAH 3FZUC 3HFMH 4G8GE 2R2EA 4EJ1C 2EYSA 1CGWA 3BP4A 2VNCA 3GSWB 3TT3L 3TZVB 1K85A 1ZT1A 4G43A 4QRUB 4DAGH 4J8RA 1WZMA 4UB0H 3R8BB 2NCMA 4URTB 1JGUL 4FFYL 3NFPA 1NDGA 1KCUH 2FGWH 4TUJA 3C60B 1I7TB 3CFJA 5A2KH 1NMCC 1YEDA 2J2ZA 4LLMB 1I8MB 1I85C 3C6LB 4NWUH 4M6OL 4WU7B 5F96L 3HZVB 2HJFA 2D0FA 4X8XA 2JJSC 3MREA 2GHWB 1NBYB 5BW7C 3VFPB 4KZDL 1RZGB 4G6JL 4L3ED 1J8HA 1DQJB 2Z4QB 1EO5A 3BJLA 1XIWA 3S98A 1NUGA 1LE5B 4ODTH 4I2XB 3MRJB 3RY6C 5HYEA 3U4BL 5ERWB 4U2YA 4QWWD 5ETUA 2VXSL 3HNVH 5C9JA 2CDFA 4P2QA 4MQ7B 3S97C 4U3HA 2R15A 3QDGD 3SKNA 5C0BA 2X4OB 3TH3T 4HH9A 3CZFB 3IXTA 2F19L 5E4IA 2AXFB 2VLKE 3AXLB 3IDIB 3VWKD 2G75A 4NZUL 1X5IA 5BCAA 3GJFB 1HZHL 1A3LL 4PG2C 3FQWB 2DYPB 3ILPB 1KENH 4CL7A 4YXHH 1F6FB 4H25B 2NY2D 2K7PA 4HHAA 4NYLA 5BRZE 3VD4A 4WFGD 5D7IF 1NC2A 5DD5L 5D7JD 3RI5K 4KY1H 1KSRA 3PWJA 4PLOB 5DEGA 2EEDA 1F42A 1KB5B 3SGJC 4B7LA 3DJ9A 3WJLC 1SJEA 4D0BA 5E00A 5D8JL 3BPNB 4DUXA 4U1IA 1A7QH 3BAEL 1P4IH 2V2TB 1NBZB 2ADFH 2E5EA 5I8OL 4KWUA 1OD9A 4P5TA 3X3FH 3JV4A 3ZL4H 4MJIE 2VXUL 5KN5B 1NKRA 1IGYA 4O51A 5F72S 2E27H 1I7RA 4ETQA 3QNZB 4KH2A 3V95A 4KTDH 1A4KB 3N1GC 5CIPH 1DBBL 1J5OL 3OGOE 4IDLA 4Q6IA 5DI8B 5ACLA 5IBUG 4OCSL 5E95B 3BQUC 4JKPL 4N0RA 3VI4F 1JPGA 1BEYL 1VEMA 3NIFE 5E8OB 1OCWH 5IVNA 1KTRL 1CICB 5CKGA 1UA6L 3K8MA 5EU6A 2OSLB 2MMXA 5MP6L 4ZO6A 4UIMA 1GH7A 5E8PB 1TPXC 4XNMB 4ODXB 2N7AA 1F11B 4NQED 1S9YB 3C2AL 1UH3A 3E1F1 4OLWH 3BD5A 1A7PH 1RUKL 1G6RL 4LQFL 1IJ9A 3DECA 4RMQA 4JVPA 2G9HA 2QR0B 4HLZH 2VLJE 4ZNCD 1NSNL 1Y6KR 4ZUUB 5ELIA 1RU9L 3DTXB 5JXAL 4ORGB 4QXGH 5J8OA 3TPUB 1LQSR 4BFBD 5DMIL 4NNYB 4IHOA 1EA9C 4M7LH 4F7PB 3T8XA 3DXAB 2A38A 2ILLA 2EDDA 3PQYE 3EYOA 4XP9H 3GZKA 4H88H 2XWTB 3QIUA 1AY1L 2DQTL 5JMOC 1Q9OB 2J8OA 4XCFL 2CRZA 3WL9A 1CE6B 5DD1H 5EWIL 5DO2D 3BISA 1XIWD 3X13A 3R06B 4YHMH 5J1AB 4LKCB 5HHMD 3S35X 1SYSB 3QQ9D 5ESAA 3MR9A 1S7WB 4FQIL 4X4XB 4L5FH 4FXKB 4PIRF 1VFOA 3RU8H 3QXDA 1YEGL 1YEKL 4N0YL 4OLXH 1AR1D 1I8LC 1TCMA 1Q9LA 2OI9B 1OLZA 5IB2A 4R8WL 4L4TA 4OSUL 5E2UH 2BNQA 3F5WA 4JY5H 4Z7VA 3V8OA 4UV4H 5MEOB 3V9FA 1DVFB 1ZT7B 1PX3A 3RUGB 3O2WH 1PVHA 2R9HC 2OBGA 5TF1H 1G6RA 1NC2D 4HX1B 1FGNL 4HIEA 3T09A 1JHTA 4XCYA 1MPAH 3RA7L 2UYLB 4P2RB 1D5IL 3EYUH 3D6GA 3HG1D 5GJTH 4J12A 5H37H 1Y6MR 4XNUL 2XY1A 5D5MB 4JJHA 1WAAA 5D7LB 4EDXA 5KS9B 4Z7WE 2F54D 5L2JA 3NCMA 4I18C 1MJ8H 5E2VL 2GQHA 2ICES 1HH9B 5IHUH 5K9KA 3LN5A 4LARL 4P5TD 1S8DA 4QF1B 3L1OH 4UV7L 4AG4H 3T3MF 2SEBA 4K71C 1LEKB 1C7SA 1I9IH 1SM3H 4PGCB 5L7XL 2A6DB 3BW9B 4I3SL 4UIKH 4XP6L 3KPSB 3PWLA 3FT2B 4PJEE 3VMPA 5SWSD 2Y5TA 3U36B 3OQ3B 4ZPVB 8CGTA 5HHQB 1XGUB 1QR1B 4V1DB 5HHOB 1TQCB 4AH2A 4L8SA 5EU6D 3LS4H 4HUXA 5EU5A 4ZXBA 2B4CC 4J3WA 4XZUA 3MV7E 3ZYJA 2XNAA 3ARFA 3HPJB 5C09B 3VGBA 3VXPA 15C8L 3IDGB 2A0LD 1MJ7L 3QI9B 4MZ2A 3H0TB 1SHMA 1N5YL 1RJLB 1B0WA 4YHOH 3O2DH 5DQJA 1IL1A 3V0VA 1E4KC 4EQ2A 2UWEA 4HIIB 1ZS8B 2P45B 4NZTH 4PJHE 3ALXA 3O9WC 1S7UA 4PYHA 3JV5A 3OPZH 1CXLA 3QIUD 3M07A 4R4BB 3T4YA 1T7XA 5LCVH 4D3CH 3ELAT 4AENB 1T89A 3ET9F 4GAYA 1WWBX 5EO1A 3T0AA 4TUKL 2X4UB 3B6SA 5JO5B 3QHZL 3EJZD 5DF0A 3NCJH 4S1SH 2ZUWA 1RIVH 3T77A 5JHLL 5EUKA 1VGKB 5T3ZE 4PG9B 2W0FA 2VE6B 1IGMH 4KJPD 3NZHL 4OKVB 4G42B 2VLMD 5C7XL 3OKDB 4GRWF 4LLQA 4ZFGL 1Q94A 5FGCE 4L4TD 2XZQH 4EBQL 2VAJA 4P23C 1UCBL 1VFBA 1KIPB 4PRHE 1C16B 1XMWA 2P5EB 2IQ9H 1ZHLA 4JHWL 2EDYA 4JQXA 5B3JE 2X4RA 1FV1B 3UZQA 2VUYA 4JFYA 1K5NA 5J6HB 5FV1L 3C87A 2C4FU 2GSGB 4TRPH 3WNOA 2HH0L 3NBNA 3S35L 4PJ9A 5E1AB 5I30H 1QEWA 4RA3A 2A77L 5D1XC 3WLBB 5BZWA 5B38A 5D2NB 2Q3ZA 3MNVB 3VFSB 1ZVSB 3DI2B 3FB5B 4KVNL 5D96C 2RFXA 4LVOC 4JGJA 3V0AC 3R0NA 5C6PB 3GSNB 5J9PB 4NUGL 2IADB 3OAUL 1KPVB 2W60B 4X9HA 4UU9B 3DNKA 3V5KA 3TBYB 2VC2L 3KPPA 4JKKA 4Y19A 4P5KA 4APQC 5HI4C 1BMGA 3R1GL 2PO6C 3MUGA 2FDBP 4J1UA 2CK0L 1HYRC 3WS3A 4XRCA 5GIRB 5LVEA 5C70A 1R24B 1HHKA 5I73C 1NLBH 4TQEL 3BKJL 5JDJA 2JJTA 4N8CH 1DQTA 2HFGL 3LKNB 5F8RC 4JM2F 5FA4A 5GRWA 2AV7A 4JQVC 4PJAF 4NQCE 4IIQC 1BFVH 3QDJA 3TA3A 2OK0L 1RK0B 1O5DT 1AGCB 5JIKA 5F9OH 5CSZA 4ZS6D 4NSKA 4BUGA 2PYEA 4JZOB 4D9LL 3BSZH 1KTLB 5HHVH 4ZXBD 1JNNH 4MXVF 3RWGB 1CD8A 2NXYD 1RIHH 4YLQT 2R4SH 3H8NA 4PB9L 5EPMB 1MH5A 4E41A 2X9XA 5FCSH 1JZ2A 2EE6A 4MHHI 4LSPL 1W72A 4KK5D 2BVOA 3KYAA 4MD4A 3DRQA 4TSBL 1IGCL 3NIGF 3EAKA 5E6IB 2O5ZL 1M7DB 3S34H 3VFUA 1G7PA 1QFWL 2NY1C 2XIDA 3TBSB 1BOGB 5C07B 2YPKB 3I6LE 1MFEL 1FNEB 1EO8H 3T4AA 4DKEH 3V4UH 4DW2H 4LSVL 1AJ7L 3CH1B 1KLGA 4RNRB 4PJIA 4ZS7L 2WBJA 1BD2D 5GS0H 3FRPG 1P2CA 1WCQA 1UH4A 4Z76A 1W0WA 1HCFX 5GZOC 1JNLL 4GQPH 2QQLH 5FYJL 2I25N 3KHQA 4OF3A 1LO3H 1OTTD 3FFCB 3MA7B 5IQ9B 4RAUB 3SE4C 2YRZA 1H5BC 2X5PA 1S5HB 4YX2L 2GJ6E 5CS7A 4OCXH 4Q0XH 3X12A 2I24N 5IIEB 4F37K 4OCLC 2VABA 2ICWB 4DVBA 1NCTA 3VFRA 5DK3A 1Q0YH 4NO0A 2NY7H 4HT1H 1CBVL 2WBWB 3IDXL 2OTWB 3QH3A 4HPOL 4L8BA 3M1BA 1N2RA 1WBXA 3S3SA 5GRYA 1YN7A 1IAOB 5IKCB 3OTTA 5TFSH 3KPQA 3LKOA 1X5AA 3BPCA 3RWJA 2YEZB 3LH2H 3QUYC 1D6VH 2R1YB 3MLTB 4CVXA 2K7QA 3ZKXB 2EXYC 2W9DL 35C8L 5DQDH 2EE2A 3FO2A 4DTGL 4FQ2H 1EGJA 1DTUA 4R4FH 1TVDA 4JZNB 1A6ZB 3O6MH 4LSSL 3MLZL 4QRRB 3L5HA 3TIDB 3NPSB 4WWKC 4OZHE 1CS6A 4JJ5B 3BKYL 4O5LL 1JGEB 1FFRA 4I0PB 5GGTH 3INUH 5F7UA 4LOUC 2R2CA 5C08D 2EEBA 5HVGB 2JKXA 4MAYD 1T3FB 5HGBA 2HLAB 1GIGH 2ED8A 3FO9B 2ZUXA 1FZJA 2X4PA 4JFOB 3MCG1 1OVZA 3V6ZA 4Y19D 2DI7A 3HR6A 1J1PH 5IB5B 3HMXH 5CP7A 1NGPL 2Q7YA 5I1IH 5IB4A 2UUDH 3VRJB 5I1JH 1A3QA 1CGTA 2OS7A 4NO3B 1XT5A 4WO4B 1CZ8H 2EH7L 2CIIB 3WKMH 3U1SL 2D7NA 5FF6A 2FYYA 5DVLA 4X7CC 1RZKH 2KUTA 4OCRL 5BVPL 4OFVA 4LF3B 5DHVA 3VA6A 3DARA 3ULVF 3QUML 3QDJD 3QWRA 3TA3D 5CZVH 3T2NL 4K3JL 4FQCL 1FRGH 4YBQD 3QPXL 4JZJC 2DLHA 5EUOA 2B4CL 1FVCA 2GI7A 3PIQB 2VDPH 1C12B 4NNXB 1E6JL 4HFUL 4NO2B 4LQ1A 2DDQL 1HQ4A 4E41D 4JLRB 1NUNB 1BQHA 1UZ6F 4XP5L 3GSUB 2W91A 2AKRA 4M03A 3LDBB 3E0GA 3DMMA 3FQUB 5DZNA 5KW9L 1HIML 4GRWB 4P4KC 4Y2DA 4Z7UA 4YR6B 1OB1B 3ARBA 1CLOH 5DA0B 2NMSA 3B5TA 4L3CB 1VFUA 2GJZA 1MREH 1NGZA 2ZPKL 4L4VE 1U8JA 2B7DT 5KSVA 5LAXB 4G3YL 1ZHKA 3SO3B 2XN9A 1XGPB 1FGVL 1U6AH 5IMKB 5F9DC 3SQBA 2IJ0C 2BFVL 3D18A 1D5ZA 3WMSA 2A74B 3GO1H 2ARWA 2VZ1A 4JFDA 1V7NH 4EI5A 3SDAC 3SBWC 2FJGA 1KNOA 1IC7H 5DT1L 5EFIA 1A4JB 3WFZA 4QRQB 3UTSB 5C0AA 4G6FD 4Y1AE 2XICA 4MJ6B 4PUBL 3MA9L 3BZEB 3DX7A 3ABZA 1JTPA 3BQUD 3C60C 4FQJL 3WLWD 4H1LG 4JG0H 3C6LC 3IAPA 1CR9L 2WSKA 1AD0B 2CLZA 3GGWB 3UXFA 2GITB 3VJ6B 4J3UA 2Q8BL 1IGTB 2A83B 2GY5A 4HXAH 1QO3B 5A2IH 1FNLA 4U6XB 3WD5L 1WF5A 4NWTH 4LSUH 4H1LB 4NRZB 2FLRT 4X6BB 3OR6A 1A1OA 4LPVA 4JM2B 5JW3L 1QQDA 3F8UB 3IDJA 1RURH 5HTSA 1A7RL 1KJMB 2LTQC 5CBAA 3LEVL 4X7DC 4L3EE 1P84K 2PF6A 1N7ML 4J3SA 1ZHNB 1WEJH 4LCYA 3CGTA 2CLVB 2YA0A 3H2WA 3QNYA 4YE4H 5E2TH 3VFWA 1TJHH 3TIEB 1RZIA 3MROA 5H35B 1XCTB 5E94B 2IAMA 1TTFA 4MXWH 4X6EB 4H26B 1ED3B 2CDEA 4HBQA 5L2KA 1N26A 1DEDA 4YIQA 5I0DA 3PP4H 3BXNB 5F7WC 1FL3B 1GC1H 4N1EA 3GRWL 2LE9A 1R5WB 2IGFL 1D7FA 3LKRA 4Z8FH 1XR9B 1BLNB 2ZSWA 3L3OA 1WC7A 5D9SB 4O2FB 1ZSDB 5E9DA 2XG4A 1KCVL 3NFSH 1K4DA 3G5ZB 1RFDL 1S78C 4QOKE 1G9MC 3UTQB 4LSTH 4MSWB 3LB6D 4ZOAA 1R5IA 1FAKT 1NAKL 4QXUL 1HI6A 5C3TA 4LDLB 4RMTA 4HIHB 4HC1L 3L95B 3SDXE 3V4PL 5HYIA 5J57B 3QXAA 1NAMH 3R4DA 4Z7NF 1UM5H 3ARBD 3H9SB 4G7YH 1UC6A 2XFXA 1H3VA 32C2A 4DKFL 5ENWA 2A9ML 5CAYB 3GIVB 3QFJD 3HZMB 3PF2A 1FFQA 3QAZC 4PJ7E 3Q5YA 5LGHL 2EE9A 2XN9D 4X5XA 2DQDL 2HRLA 2P1YA 4B7IA 4IJ3B 4NKDA 3U0PA 3SKOA 3U4EA 3HS0A 4JFDD 4EI5D 5JW5A 3VFGH 1QSFB 1XEDA 3RWIA 1BWWA 4OZ4A 3X11A 3WCYA 2DQFB 3HC4H 4NGHH 1RJZB 4YDIH 4Y4HA 5C0AD 2ESVA 2XV6B 3R0MA 4PGEB 2LU4A 1NGQH 2EDHA 3GRWA 3QIBC 2JB6B 1A2YB 5ADPH 3OHXA 5H94B 3WO3B 4P2YA 1LEIB 4LCCA 2VR4A 1UM6L 3SQOL 5IB3B 1A6WH 3WS6C 1X5XA 1NFDF 1OAYL 2PW2B 5HY9A 5I15L 1FJ1A 1JNJA 5FHAL 5HDOA 4BK5A 3L3DA 5F3BA 3D0LB 1T7VA 3PV7A 1ZT4A 3FB8B 4HC1A 5HJ3A 5KZCB 4KU1A 4FQXB 4X6FA 1G7JA 5EU4B 4MWFA 5SX5H 1D9KC 3OAYK 5D70H 2D0HA 4G8FB 4J2XA 3O9WD 1YEEH 3C5ZB 1EJOL 2OI9C 4HKXA 2ICCA 1J8HE 2PN5A 4FQQB 4EDWH 1JPTL 2J8UF 5J89A 1N0LA 4I77L 3W5MA 4QTHB 2QADD 2Q76A 4YDJB 1AHWA 2I9LA 2DWDB 1UEYA 3QDMA 2NY5C 4L4JA 3H42L 4E5XB 3LSOB 7FABL 3CDYA 2X4NA 3WE6B 4M4PA 2CK2A 4Y7MA 1DVFC 1AGBA 3VG9C 5I1DA 1CN4A 3I3DA 4U2ZA 5DJAA