1EPFA

Crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
189
structure length
189
Chain Sequence
LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords PROTEIN (NEURAL CELL ADHESION MOLECULE)
publication title Structural basis of cell-cell adhesion by NCAM.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 43
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1epfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1epfA02
1MEXH 1GGYA 5DK2B 5IBUG 5LGJA 2OL3H 2C1OB 2ADFL 2PYEB 3WJJC 4BH7B 3G6JA 1K2DA 5FCUL 1I3VA 3KPTA 5HDQH 1Q0XH 5FGBC 3FFDA 3W0WE 43CAA 5EWIL 3MRRB 4JJHA 3BH9B 4PGEA 3U7AA 5H35B 3L3DA 3MV9B 3QDJB 1VGKA 1H8NA 3TA3A 1WWBX 2R0KL 3LKSA 1LE9B 5JLZA 3Q2CA 1K8DA 2I07B 1ES0B 3L6FB 1Q72L 3QWRA 1GCFA 4NZRH 2X1WL 3PHQB 4OZHE 3WIIH 4WTZG 1NGPH 1A0QL 5CAYB 4J1UA 1G7QB 3QB7C 5C0AD 3VFVB 4LFHD 2I60H 2QQLL 4EUPA 1ZHLB 1HXMA 2XZCL 3NIGE 4EZMA 1CDYA 4ZUWB 4PJBE 3ME0A 3OAZK 4OF7A 4A6YA 4KXZI 4ONGL 1CG9A 4WWKC 1RVFH 2CK0L 5I1LA 1S5HA 4U1GB 1MHEA 3RU8H 5IVZA 2UUDK 2HVJA 4O2CA 1KB9J 4BSWB 5BQ7B 5CGMA 4FNLH 3MPCA 1XF2B 5I71C 3L5JA 5T1KD 4MA1B 4HWBL 4JFDA 2Q8BH 3NTCH 3BIKA 4QHLB 1TQCB 4R3SB 4XH2B 1MLCB 3U4BL 4DEPB 2D7TL 1S7TA 2OR9L 3SDDA 4LEXL 4KRPB 2IANE 1I1RA 4HK3J 3L9RB 3MBEC 4URTB 1IE5A 3R06A 5I16A 1E28B 4R4BA 2X9YA 4M3KB 3VG9C 5IBLC 4CJ0A 2JJSA 3R8BB 4U1IA 1IBGH 1I7TB 1W0YT 3BGMB 4FFYH 5KANG 1UWEH 2VIRA 1BQHB 3B4NA 3EDFA 3ZE1F 2F8XC 3QWRD 2ICEA 4D9LH 4EUPH 1PG7L 3JBG7 4UNVA 2AERT 3D25B 2ZPKL 3ILQC 1F8TH 5F3BB 5EZJB 3P4OA 4HXBH 4HC1A 4JFED 3O0RH 2WAHA 4LP4A 1BWMA 1WFOA 2HLFC 1CXKA 1IGCL 4P2RA 3TNMB 5GGRB 3U9PH 5F7MC 5JTWA 2B8OT 1TCRA 3O8XC 4I1NB 1JTOA 5C8JB 3HMXA 4NGHL 2VH5H 3OAUH 3QHFH 3WXWL 1VACA 4UTBH 2X09A 3JXAA 2HKFH 4KAQH 5DO2D 2VDMH 3U0PB 4TTGA 4I9WD 2VLRA 3MNWA 3REVA 3EO1B 2MKLC 4JFDD 3NA9H 5IB5A 1WZKA 4X6DA 3THMH 2F5BH 2F8OA 4LPVA 2DIJA 3NACH 5C3LD 3HZKA 4ZPTB 1OL0A 2NY0B 2VITB 5AYUH 5T1KB 4C59B 1HCFX 1JI2A 1EJOH 2FGWH 2V17H 1E6OH 1U3JA 1MCHA 5DMGD 4KKAD 5FHBH 4H20L 1CBVH 4MQXC 5I8CA 5D1QC 5LGJB 3ULSA 5BOZG 3WKNA 4UAOB 3G6JB 1K2DB 4M4PA 1VESA 4IRZH 3VMPA 2X4SA 1NEZG 1JPTH 1BJ1J 5GS0C 2BVYA 4HC1H 3FFDB 5FOBA 2O5ZH 4JHWL 43CAB 5GGTA 3OV6A 3HE6A 4PGEB 4LHQB 5T1DL 3N85H 3L3DB 1VGKB 5DRWA 5IIEA 3TA3B 5K9JL 5L2KE 1I85A 3H3PL 3LKSB 5DUPH 1A6VH 5JLZB 1K8DB 3VWJA 2H2PD 4P2RD 4FQ2L 3PF2A 4RBPH 2ZG1A 3HMXH 3U48A 1FYTE 5I66A 4JR9L 4S1QL 4Z7VE 1WWCA 1EFXD 2VC2L 3SDCC 4FTVE 3HNVL 4J1UB 4YHOL 1UKSA 1QPXA 1P4IL 1BQLL 1F4XH 4JFEB 4XB7A 4EUPB 5FDYA 5J56B 4H88L 1HXMB 2P5EA 4A6YB 1FZMA 1NMBL 3SJVE 1OVZA 3ARFD 5HDBF 2YRZA 4K3DH 3MLRH 4MJIA 1CG9B 1NGQH 1ZANL 4D9RD 1S5HB 4RX4A 1MHEB 2XG5A 4LCWA 5IVZB 3KS0H 3O2DA 3UTTA 2HVJB 4O2CB 4Y2DA 2VZ3A 2IG2L 5GISH 3CDFA 3T0AA 2EE9A 4ZYKA 3GKZA 2A6DA 1BIHA 4JFDB 1FQ9C 2VXUL 3BIKB 1LDPH 1S7TB 4LPUA 4R4FL 3SDDB 3WDIA 4GLRI 3RZWA 1NLBL 2C4FU 5GGTH 3R06B 3SQBA 5I16B 5LCVL 4R4BB 1DL7H 1S7VB 3BKYL 2BNRD 2DMKA 3HE6D 5CJXA 4U1IB 3IJSA 1U9KA 2E7MA 1IMHC 2VIRB 3VWJD 5E5MA 1TJHH 3CFBA 4ZQKA 4F33A 4PJ9C 4XPGH 2ICEB 4PJ8C 4M48L 3WKML 1XIWA 1U92A 1DQJA 1J1OL 2NZ9C 3P4OB 5FHAL 1OAZH 3CFDA 1QLRA 4G7VL 4QXWA 2P5ED 4P2RB 2J8UE 2D7MA 5D72H 5FYJE 3MV7E 5C0DA 1N0XH 4JFHD 3WFBH 3O2DH 1TCRB 4NJ9L 4MJID 1R3KA 4XVUC 4RX4D 3V7MA 3UBXG 4LCWD 4GXVL 3UMTA 4W4OA 4X7EC 1TETL 4Y2DD 1YEJH 1VACB 3D3VD 2YPLA 2OCFD 4HJ0D 5I73C 4DGIH 2VLRB 3ULUC 3C6LD 3REVB 5KVDH 5F3HA 5IB5B 1T89A 4WGVB 4X6DB 3QXTA 4DK3A 3C5ZD 4PRIA 3O41A 1F4AA 3G6JF 4AEIH 1D5XA 3A6CL 3OGCA 5LXGL 1WFNA 3BP7A 1N4XH 1AH1A 2EXYD 3V6ZA 1NC2A 2ZZUT 4NIKB 3QAZC 4H8WH 4JRXA 5I8CB 3QQNA 1LP9A 3ULSB 2I5YH 3TC9A 4ZDHA 1CR9L 4YUEL 2X4SB 1SYSA 4LIQH 4R97C 4NC1C 5CILL 5FOBB 1OOAA 4WDIA 4H0IA 3HE6B 4WI3A 4M7LL 2C3WA 4J6RL 4GKSA 2E3VA 5DRWB 5IIEB 5TE7L 1H8OA 4UT9H 2Q3ZA 3VWJB 1ZGLM 1A6WL 4OTXL 1U3YA 4FQHA 1AIFB 5I66B 3IXAA 2E8YA 3CX5K 5FUOH 2IBZX 2OP4H 3IXTA 1MFNA 4RMVA 4Z7NE 3QIUC 2P5EB 3GHBL 1X9QA 2EKSA 4Z18A 1FZMB 1U8LA 1MOEA 4G6KH 3LZFL 4NQUA 3VFUA 4HWNA 3SY0A 4FA8A 5LGKA 2VDOH 3N06B 3PDOA 4MJIB 5A3ID 3UJJH 4KZEL 4LCWB 4OM0L 4L9LC 1G7LB 4POZC 4Y2DB 2K9UA 2NY7L 4JPVH 4MNQA 1Q0YH 1RZFL 5DLMH 5HY9B 2BSRA 4ZYKB 2A6DB 3UZVB 2ZG2A 5JZ7C 2PO6C 2DM2A 1RJLA 3GSWA 4P2CG 3SE9L 3JWDL 4FXLA 3V5DA 1T7YA 5D7KD 5C0NC 2FD6H 1IM3A 4LOUD 3HTLX 2MJWA 5GRJL 1OW0A 1A3QA 2VDLH 4QRRE 4O58H 4XCCH 1L0QA 5J1TC 4OGZA 3CVIL 1DBJH 4MB4A 3V4UL 1TPXC 4X80L 4RCAA 3TEUA 3IJSB 1CTNA 1QFWH 4MA3A 4WFFD 3CFBB 4OFVA 4ZQKB 4F33B 2ESVE 2D03H 3SE3A 1AE6H 4K2UL 1RMFH 4TSCH 1U92B 4HSQA 1G6VK 2VLKE 5GJTL 1DQJB 2WQ8A 3CXHJ 3HI5H 1IEBA 1CU4L 3CFDB 1QLRB 4JM2C 1S7WA 1T7ZA 4OD2A 4ZXBA 4OFYA 5C0DB 4BFGA 3CZJA 3BGFB 5JNYA 3QFJA 1H3TA 1JRHL 4OCWL 4X6DF 1DEEA 2LVEA 1R3KB 4RGMB 5HHMD 5DJDA 2CDGA 3QSKB 3RNQA 4U0RB 1DUZA 1RUML 2AI0H 4L8CA 4JQIH 4BM7A 3QFDA 2DM4A 4BFEA 5F3HB 1WTGT 2WUBL 4LSQH 2P44B 3W81A 1MRDH 2OXGA 4PRIB 3O41B 4CN1A 3GI9H 2ZCHL 4ODTH 3U82B 1D5XB 1K4CA 3OGCB 2Q1EA 2JLLA 3QEUA 2KQMA 3BP7B 3LQAC 1AKJA 4FOMA 4PJHA 4R90L 4WEBH 1OAUH 2Z4QB 4NKDA 4QXUH 1KCUL 3V6ZB 1CLZL 5B8CA 4JRXB 1LP9B 5KSUA 5J9PA 1LO2L 5ANMA 4M7JL 3E8UL 4ZDHB 2HFFA 2Z31C 3BO8A 1SYSB 3ARQA 3ZDZE 2E7LA 4U3CA 3KPPA 2WWKO 4WDIB 3VGAB 4IMKC 4GKSB 1GRWA 5HD8C 4G42A 2J7LA 3VA2C 1JZ8A 4LGRB 2FYYA 5I1IH 3WV0A 4R2GC 1LD9A 4FQCL 4X4YA 2EYRA 1UYWL 1LO3L 1YY9D 4FQHB 1JP5A 3V4PH 3UPCA 4FFVC 2FX8H 1A5FH 3IXAB 1H3PH 1UACL 2YD4A 3FAWA 3IXTB 4ODVL 1RUKL 4L4VE 1KJ2A 4QF1A 3OHXA 4M5YH 1EVUA 2EKSB 4I18C 3O6LH 1U8LB 3EJZC 3VFUB 3Q5OA 3SY0B 5EN2A 1RZJC 3PDOB 1L6ZA 3SGJC 5HHMB 5EC2A 3A0OA 2VDPH 5ILTH 4JFXA 3WD5H 4MNQB 2BSRB 3FTGA 2RAMA 5HSFA 4PJGE 1XZ0A 2VZOA 1VERA 1RJLB 3S35X 1X5YA 3GSWB 4ZS6D 3ZT6A 1R0AL 3V5DB 1C08A 3GO1H 3N1QC 2J8HA 3BW9A 4YWGH 1IM3B 3BE1L 4XX1E 1EZVX 1V3KA 4HKXA 5TPWL 1F4YH 3NPZB 3QI9A 3OJ2C 1UM6H 1B2WL 1YJDH 1Q9KA 1F90L 3QDGA 3C6SA 2COQA 5IW3A 4K3GA 4JFQA 4N5ED 3CVHA 4BFIA 4MA3B 1CL7L 5DHYA 4PLKD 1KJ2H 2WWMC 2HP4A 1TNMA 5IM7A 1VEMA 5E7FA 3R1GH 4OI9A 4NJAH 5KTEH 1IEBB 1IEAA 3FJTA 1S7WB 2HTLD 4OD2B 4ZXBB 4QHNA 3AY4A 4OD3H 3KWWA 2Q3AA 4N1EA 2AABH 4HPYH 5JNYB 3QFJB 2HT4D 3NABL 2J6EL 3T0WA 1DEEB 3MXWL 1HWGB 1RIVL 5DJDB 3RTQD 4B7LA 2CDGB 3GZKA 3LSOA 4PLNC 3QCVH 3KYOA 4RDQG 3RNQB 4BELD 1DUZB 1JRHI 3W5NA 5DQDL 3QRGH 2G9HA 3I2CL 4L8CB 5BS0A 2YHGA 1NAMA 3GUTA 3QFDB 2VYRE 2NY1D 3QQ9D 2AEIT 5B3JE 4UDTA 1LHZA 1H3VA 1QSVA 5A1AA 4K23H 4FQPA 1KCSL 1VFBA 4RGOH 5IHUL 1K4CB 2V2TA 3ZDXE 1NGXA 5JW4Q 3QEUB 4NRZA 1AKJB 4PJHB 4IRSD 3CVHH 4NKDB 5F72S 1MFBH 1DQMH 1JK8A 1FNHA 5B8CB 4OF3A 4TUJA 4DCQA 5KSUB 5J9PB 4KHXH 4MYWB 5ANMB 3GSNA 2NY5L 2HFFB 4XBPA 4NKIH 3BO8B 1YEKH 1B0GA 2OR8A 2NY2C 2K7QA 3KPPB 3S9DB 3SDYH 4XXCC 5HHOE 5ID1A 3GI8H 4G42B 3MRBA 2FYYB 5DVLA 3W11D 3FAXA 1RHFA 2BERA 5ITBL 4G7YL 1LD9B 4X4YB 2EYRB 5KOMC 1EHAA 3C2SA 1WICA 4U1HA 5F7DA 5AG9A 2A2QT 2FECL 5MP6H 2V5YA 3QCTL 5ADPL 1CTOA 3G5VA 5EOCL 1KJ2B 4QF1B 1NAMH 4JHZA 3OHXB 2EC9T 1KOAA 4WUKH 4PY8I 4EI6A 2IALA 4ISVA 4XPAH 3DUSA 1P6FA 5BS0D 5EN2B 5K93A 4QTIH 1CGTA 5EC2B 5SWQA 4MAUL 4M43H 4KTEL 4JFXB 2AJSH 3O2VH 2QSCH 1UGNA 4JDZA 1UJ3C 3FTGB 4ODHL 1G9MH 1GC1H 1XZ0B 2AJUH 3PQYD 4Y4KD 3GSNH 1C08B 2EYSB 4NM8L 5EZOL 4K3EH 3BW9B 1A22B 5DC4B 1G7JA 1RK0A 3VFMA 2VMFA 4N0UA 5DD6A 4HKXB 3RWJA 3QI9B 4M9PA 3VFTA 1Q9KB 3QUZA 3QDGB 3C6SB 4F8QA 1DFBH 1AJ7H 4JFQB 3BD4A 2APVA 3CVHB 4BFIB 4DGYH 2NYYD 4HG4K 4Z7WA 4M6NL 5I15H 5DHYB 5D93C 4JG0H 4JRYE 3GSVA 5IM7B 1CL7I 3AUVA 3KYAA 2FJHA 1R5WA 1IEAB 3DURA 3BHBB 3H8NA 4J12A 5ISZA 2X4TA 4QHNB 5DEZA 5J7CC 3KWWB 5D96B 5D2NE 2PW2A 3CDCA 5SWZD 4IJ3B 5D5MA 1SMOA 5JXEC 4UBDC 1QO3A 3LSOB 5AZEL 3KYOB 4PJ7A 4OJFH 3TV3H 1D5IL 5BO1L 1V7NH 3V6OE 1ZLUK 5GHWH 2G9HB 5HI4C 5BS0B 3MJ9L 1NAMB 1QSEA 3GUTB 1N6UA 3CAFA 1KTRL 5DT1L 2IPUG 1QRNE 5FF6A 1N5YL 4UDTB 3DV4A 4M03A 4HGWA 2FR4A 1VFBB 2XOTA 5E6IC 2V2TB 1NGXB 1LO4H 4MA8H 4NRZB 2VXTH 1O7VA 2XG4A 3GSQA 3I85A 4XAWH 4HJGA 4CU8A 5SV4A 1JK8B 2HMID 4TUJB 4DCQB 1HKLH 3H6JA 2P4AB 4JFFE 1EEQA 4UTAL 2GI7A 1SVCP 3GSNB 4XBPB 1EBPA 4OLZL 1B4JL 5EIQA 4P5TD 1B0GB 1UH3A 5KSBE 3CFEA 1QPPA 1HINH 5GRUL 5ID1B 3S34L 3FCTA 4GKZA 1FLRH 1JIBA 1TFHA 1W72L 3MRBB 1TIUA 5BVPL 1OAYH 4YXHL 5GZOD 12E8H 4HFUL 2W9EH 3PABA 4U1HB 5F7DB 3VI4E 3UJIH 3HB3C 3O3UN 5F1IA 5B39G 2HFTA 1G6RL 1E27A 4P4RB 2I27N 3G5VB 3VFNA 1AC0A 4ZPVA 1MFCL 1BBDH 5GGQH 1CDGA 4EI6B 6FABL 4ISVB 3DUSB 5DMKA 4NPYA 2L4OA 4ELKA 1JNJA 1QSED 4AQOA 2L0DA 4TVPH 3GJEA 2O61A 5LKNA 2BNQD 1KB5L 5SWQB 1OP5H 3NH7H 2E9WA 3PHOA 4TSBH 4TVPD 3QUYA 5IKCA 4JGMA 4JDZB 4KROD 1CICA 2M1KA 3NCBB 4I0CC 4Y0GA 4OZIE 3J7HA 1MNUL 3JV0A 5D1ZD 1UCBH 1G7JB 1RK0B 3VFMB 5IEKA 1ODAA 2XTJB 4ZAKC 1N6QL 2B39A 4GS7B 2N7AA 3LHPH 1QHPA 4N0UB 5C0GA 3RWJB 3VFTB 1GOGA 3QUZB 4EIZC 1K3IA 1JMXA 2FRGP 2CRMA 3EFDL 3CCHB 5C3TA 1WEJH 3BESR 5TDOA 2JJVA 1I3UA 4Z7WB 1NCCL 1VA9A 2Q8AL 3F62A 4JKWA 4QRTA 3GSVB 4YZFF 4GRLD 1FZOA 4ODUA 2FJHB 1R5WB 3H9HA 2QADD 4X0KA 3DURB 3FQUA 3H9ZA 4NQCD 5C0CE 1VEPA 2X4TB 5ISZB 2IC2A 4N90E 2VDKH 3VXSA 4YHML 3KPSA 3S35H 4F9PA 4KQ3H 4QRUA 4OLUL 2PW2B 4PJ5A 4HULB 3HC3L 2ZOLA 5D5MB 5I1DA 3CPLA 3VWKA 1A6ZA 1QO3B 4PUBL 3RVTC 4JDTH 1WZ1L 4PJ7B 1C12A 3BRFA 3U2SA 4RISH 2APFA 4RFOH 2H8PA 4FHBD 4A2MA 2FH6A 2AJXH 1QSEB 2R39A 3PV6B 4N1HB 5GRVL 4XP1H 5DWUL 5GQBA 4C56D 2BNQB 2FJGB 3DV4B 4ACPA 4HGWB 1E4WH 2VABA 5F9WC 2FR4B 1OF2A 4UINL 3RBSA 3AS2A 4KROB 4WFGE 2PTUA 2VR4A 1MF2H 3GSQB 4LSTL 4HJGB 1XCTA 3QUXA 3OL2A 3ARGD 1OTSD 2R8SL 1HXYA 5J13C 4MDJA 3TN0D 3BQUC 4UILL 2EIBA 3L3KA 1YEHH 4ZFOA 2EH7H 1INDH 3PP4L 1F6LL 2YWYA 5SV3A 2YZ1A 3CFEB 4PGZA 3MLTA 5GJSH 1CQKA 3MUZ1 1WIPA 1SM3L 4X4XA 2WINA 3FCTB 1PSKL 5GZND 4GKZB 1YMME 1BQSA 4PB0H 3JVGA 3LKQA 5EO1B 3S3SA 1Z9SA 3PABB 3MR9A 3L5XL 1UH2A 4P99A 2MCPL 3ARYA 1MI5E 4KV5E 5F1IB 3RA7H 3S4SG 5DA4A 1E27B 4X6EA 2RCSL 3V7AG 4X9GA 3VFNB 2WBJA 4ZPVB 1RU9L 3MRJB 4JM4H 5JIKA 1FH5L 1PX4A 3P2TA 1JCKA 1MCLA 4KVNL 2ICWA 5DMKB 4KJQD 4NPYB 1MCOL 4ELKB 1MJ8L 4XHQA 2QSTA 3VXNA 3S88H 2O61B 4I0KA 4KRNA 1Z3GH 3PHOB 1H0DA 3RX5A 2XFXB 5E08L 5IMMB 3QUYB 4OF5A 5CJOH 5IKCB 1AXTL 2GK2A 2IPTL 1CICB 1RIHH 3WHE1 2GITA 1BAFL 1JN6A 3L3HA 1Q1JH 1U8PA 4QO1A 4S1DC 5HXMA 1UA6L 1AXIB 1RK1A 2GHWB 2DQTH 3NZ8A 4YR6A 2V9TA 3VD3A 4Z7WF 1ZHBA 4AENA 5IEKB 2NR6D 3BPCA 3I9GH 3EDJA 5BXFA 1CF8L 5C0GB 1PZ5A 2W65A 2DMBA 2EH8L 4QRPA 3O2WL 1ERNA 3ARGB 3HC4L 1DBKL 5EBMB 4BQ6A 5GXBB 3GBNH 4K94H 2C3XA 5TDOB 4YK4B 2P46B 1KN4H 2XZQH 4QRTB 1WQVT 1A3LL 2KKQA 1RUAL 3KPLA 4PJ7F 4Y4HC 2Z35A 1DBAL 4ODUB 1FZOB 2JIXA 3H9HB 3LEYH 2WBJD 4M1CD 4X0KB 3FQUB 3ZKXB 1FO0A 3NFSL 3PWPA 3KPSB 4PJ5B 2DLFH 5E1HB 2ZOLB 3X3GH 1AGCA 5I1DB 1J5OH 1FDLL 3VWKB 1L4IA 1A6ZB 4G80A 2NXZC 4O5LH 4KHTL 4F37F 1ZV5A 5ABDE 1I75A 1NBVL 4YDLB 4YHZL 2AJZA 3U2SB 5EIVA 4FQLL 2H8PB 4G8IA 4QHUA 2VKXA 4IMLA 4AEFA 5L7XH 5BV7H 3RVVD 3KPRE 3FQWA 1OAQH 4AQ1B 4GSDH 4XPTH 1OWRM 2CJUL 4K9EC 3UJTL 2VABB 1OF2B 1ZGLP 1DSFH 4CMHC 4RBPK 3HN3A 4YHYC 1KTDA 3MA9H 4KMTH 1IGIL 1XF5A 2D7NA 1CS6A 1XCTB 3QUXB 5H37G 3RVXC 4KGLA 4QRPD 2BY3A 5FYLL 4YBLC 4MDJB 2R2BA 5DZNA 3VW3L 2VQTA 3L3IA 2OL3L 3L3KB 4XCYA 1WAAA 4ZFOB 3M8OH 3KPNA 3QQ4B 3TYFA 3MXVH 2P7TA 1MWAA 5HDQL 2W60A 1FO0H 3NGBB 5JIPA 2WINB 4UQ3A 3MLZH 4U6VL 5EOTA 2JIXD 5LJYH 1CIDA 3LKQB 1X5HA 1AHWC 1KGCD 4OIIH 1IGYA 4MB5A 5ESAA 2VZSA 5ECJE 3MR9B 4I2XA 2ZUYA 1G9NH 4GW1B 3EYVA 4X6EB 1NGPL 4N0FA 2WBJB 4TNWF 1U58A 5KSAA 5AAMA 3IFPA 4ZD3L 1XGPA 2ICWB 3I50L 4PGJA 3TVMA 5CKAA 4LCCA 3T3PE 2OTUA 3I6LD 3QWOB 3T4AA 3VXNB 4C4KO 1LO0L 1S8DA 3WN5A 1J8HE 4HBCH 4JE4B 1IKFH 3RJDA 2B1HH 1H0DB 3C5JA 4B0MM 4WI5A 4CDGC 1U95A 5DD3H 2GITB 4HHAB 2ZUTA 1JN6B 3BSZL 3L3HB 4FNLL 5I1AB 1U8PB 3V6FA 3LN9A 4PRPA 1H3UA 1QHOA 3BPNC 3RNKB 1RK1B 1OWWA 3NTCL 3NZ8B 4KKLD 5BV7B 4YR6B 1ZLSH 1BQHG 3K8MA 4XP5H 4AENB 1JFQL 3GMOA 3BPCB 5BXFB 3T3ME 1PZ5B 2W65B 2ED8A 2NNAA 2DQGH 4MXQC 3O6KL 4QRPB 2R69H 1WCQA 2ZSVA 1WCBB 1YUHA 4GW5A 25C8L 3RAJH 4OV5A 1PEWA 1CCZA 3IU4H 3GKWH 4CU6A 2XRAH 3NFNA 3U6RB 1UWEL 1N5AA 3EGSA 4Y4FC 1MCPL 4KU1A 1PG7W 3KPLB 4D9LL 2FO1A 1T0MA 2Z35B 3C08H 2JIXB 3O4LA 2EDDA 1IM9A 1AY1L 1ZA3A 5KSAD 4LLYA 4OKDA 4HXBL 1FO0B 4Z5RA 3PWPB 4JLRA 2VISB 3FFCA 5T33L 1AGCB 3AMLA 4GAJH 3ARBA 1AQKL 4K8RC 1ORSB 4G80B 1KXTB 2AJZB 1RQ5A 2R4SH 3GNML 3OAUL 4G8IB 4YBQC 4IMLB 5I8KL 4UTBL 4KAQL 2HKFL 1PAMA 3SBWA 4J3TA 2JB5L 3FQWB 4K71C 4PRPD 2VR9A 3NA9L 1X7QB 1QFWM 1FYHB 4UT6H 2F5BL 4XPBH 5GRWA 1EGJH 3NACL 3EHBD 2P5WE 4AY0A 4LSSL 1XF5B 4S11A 3HZYA 4L8DA 1KELH 2X7LA 1MRFL 5DMIH 5AYUL 4JREC 3KLHD 5DVKA 2FGWL 1E6OL 1J11A 4WO4A 2R2BB 1MJ7L 1JWUA 3L3IB 2CIIA 3DUHA 4XCYB 3B9KC 3KPNB 3VDCA 3TYFB 5D7SH 2P7TB 4IRZL 2Z0BA 1JZ7A 2EDYA 1MWAB 1JPTL 2W60B 4AH2A 4HC1L 2O5ZL 4JQXC 4KMQA 4UQ3B 3IJHA 5EOTB 1JGVH 4EUPG 2AJYH 3O4LD 9CGTA 1CGXA 3Q6FA 1UG9A 4KI5D 4HLZH 1IGYB 1WWWX 5ESAB 4NQDA 1RUPL 3FO2A 3C60A 1ZTXH 5EG6C 4I2XB 4YHKH 1JPFA 3EYVB 1T7VA 1QKZH 4N0FB 2P24A 4TUKH 4L5FH 1U58B 3HUJA 5KSAB 1R3LA 3IFPB 1F4XL 1TJIH 1XGPB 4FQJH 3D69B 4RFNC 5TF1H 5MEQA 3TVMB 3GRWA 3EYQD 4LCCB 3DI2B 4LLVA 2OTUB 3T4AB 1S8DB 3WN5B 1U8JA 2W1NA 4K3DL 2R0ZH 3MLRL 4U3XA 4Y1AE 5HI3D 4FQQB 3QT2A 1S9WA 1EMTH 5FM5M 3C5JB 5GISL 1U95B 3RGVA 3T0EA 3V6FB 4XCNA 3ZE1E 4P2OD 4PRPB 4AL8H 3IDMA 3WNKA 1U6AH 4OIAA 3ZMRA 4BQBA 3TZVA 3OKEB 4WO4D 2VOTA 1LDPL 1OLLA 3VU2A 3LS4H 3GK8H 1WK0A 4L4TE 4P23D 1T1ZA 3GMOB 4LARH 4OQ1A 4BSVA 5IROA 1XMWA 2X2YA 5GS1C 7FABH 2NNAB 3K4DA 5ELIA 4HDIA 4O9HH 3LDBB 5EPMA 3VXMA 1YUHB 5HHVH 1VFAA 4GW5B 4IOSD 4OV5B 2OR7A 1KN2H 1OD9A 3ZHLA 1B4RA 3NFNB 3QEGH 4OAWA 1TJHL 1N5AB 3EGSB 1JPSL 2VUOA 1YA5A 3G9VA 3WMSA 1MAJA 1T0MB 1VSCA 1DQDH 4NQSA 2NY3D 1P5UA 3ISWA 3O4LB 1IM9B 1BJ8A 1ZA3B 1YDPB 2FB4H 3C09B 4Z5RB 4LLYB 1OAZL 2PYEE 4I8DA 3T0DA 4JLRB 1M6OA 2MKWA 4F57H 5LWYH 1ETZA 3ARWA 2DBJA 1N0XL 3WFBL 2C5DC 3EO9H 2F53A 3T65A 3RY5A 3MV9E 3QDJE 2VZTA 4I4WA 5FIEA 1LE5B 1JGEA 1YEJL 1OCWH 4GBXC 1E4XH 3N9GH 5FKPA 3T0ED 3T0XA 2K7PA 4DGIL 3RI5F 4ZUUA 4LVNB 5KVDL 4ONFL 1FNAA 5E8DH 1WAAF 3HRZA 1R5IA 1UM4H 4K7FA 1MCDA 1QTYT 5C2BH 4AEIL 2E27H 1CFNA 2LE9A 2Q7YA 3HZYB 4L8DB 5I1CH 2X7LB 1V3JA 2FX7H 1PQZA 4ZOAA 3VXMD 5FGBA 2ITCA 4WO4B 3QISA 4BZYA 4WV1C 1JWUB 3BEVA 2CIIB 2MPAH 2I5YL 4WU5A 3JTSA 4G43A 2RJMA 4AH2B 3EW3B 1XGYH 5HDBE 2IJ0C 5BZDA 1YY8A 3FZUC 3IJHB 3WDHA 3Q6FB 5FAAA 4WVRA 1TZIA 4X8JA 2ADJA 5DRXA 4UT9L 5MI0B 1RJCA 4NQDB 3FO2B 3TJHD 1MAMH 3C60B 1GSMA 1JPFB 2YOCA 5IR1B 4HBQA 3P11H 2NY3B 4NOFA 5FUZH 2P24B 3BOVA 4WWKA 3HUJB 1R3LB 3CX2A 4U6TA 5MEQB 5KSVA 1OM3H 3T2QA 4LLVB 4GQ9H 4K7PY 1PZUB 3FQRA 1U8JB 4Q9RH 1MQKH 2VDOL 1IRAY 3MREA 2JB6A 2VDRH 3JUYA 1FRGL 2R0WL 3RBGA 1JHKL 4WW2B 3T77B 3IT8D 3X11A 5D7LA 1T0PB 4CGTA 1N26A 4JPVL 3MBEA 1Q0YL 3RGVB 5CGYC 1TQBB 3B9AA 3DARA 5DLML 3T0EB 2R0LH 3BZEA 2MFNA 1IKNC 4JGJA 1C8PA 4OQTA 3IDMB 4A2LA 3QJHA 1ACYH 1UXWA 4NUGH 3J8F7 3BVNA 1SQ2N 3MV8A 3OQ3B 1T1ZB 5K9KA 2X4RA 3BH8A 3WJLC 4BSVB 1BPVA 2VDLL 4HDIB 4O58L 4HT1L 5EPMB 3VXMB 4KI5F 3FRPG 4MJ5A 1VFAB 2NXYB 1DBJL 5E5RB 1Z9OA 5JQ6H 1EAPA 4P9MH 1QFWL 4OAWB 5L2KD 5KJRL 4OLVL 2D03L 5DQ9A 5BMFH 1CZ8L 2OTWA 1AE6L 3MMEA 1RMFL 1YEFH 4PRAA 2HT2D 2UWEA 4GAFB 4JPWL 4NQSB 3ULVE 3O8XA 2WK2A 3LQMA 5I17A 1M6OB 1Z0NA 4DWHA 3TBTA 3G6JE 1ETZB 1HNFA 1LK2A 5T1MA 1KC5L 1ZVYA 4YFLF 3BPOB 3T65B 1JV5A 4M9OA 4KTDH 5EU6A 1GPOH 2ZCLL 1U3ZA 4Z9KB 4I4WB 4I3GA 1CE1H 4PIRF 2CRIA 2XPGA 3STBA 1K4DA 3WIFA 4OQTH 2AI0L 2CSPA 2XWJA 1X5GA 3OMZA 4DFIA 5JR1H 1FFNA 2WUCL 5FKPB 3MBED 4OGAC 3ZYOA 5IESL 4UB0L 1NGZA 4ZUUB 2XKNA 4RWYL 4ZFFA 3HRZB 4JFEE 5DUMH 1MRDL 3TM6A 4K7FB 3GI9L 3FOLA 5D1QA 1H3WM 3WXVH 5I75B 1QYGH 5IFHH 1YEEH 1CFNB 5ETUA 2Q7YB 3HE7C 4CUCA 1WV7T 2DQJH 4V2CB 1PQZB 3FN0H 2IH1A 4KKBD 2ITCB 4QXUL 1PKQA 4P49A 3C9NA 3BEVB 3KYMA 3SKJH 4WTZA 4WU5B 3JTSB 4G43B 2BY1A 3P4MB 5I30H 2HLFD 4RMTA 1L9MA 1NSNH 3SGKC 1IGFL 4HWEL 5BZDB 1YY8B 4JFDE 3HUJF 1RZKL 3O3DA 3O8XD 3RWDA 3SDCA 2XZAH 3MLXL 1TZIB 4X8JB 2ADJB 2WWKT 5DRXB 1J88A 5LAXB 5FYJH 2XV6B 3ARUA 3RVWC 5TFSH 4DTGH 5CP7A 5FYJD 4WW2F 5B3NA 2EICA 1P5VA 4DUVA 4WWKB 2QJDA 3DROA 3N1FC 2VWEC 2YA0A 3TIEB 5KSVB 2X4QA 1I4FA 3FQRB 4LK4A 4WCYL 5DGRA 3MREB 1V7MH 4YFEA 2JB6B 2W38A 1QP1A 3X11B 2VDPL 3PWUA 5D7LB 5ILTL 2YD1A 4NT6A 5IUSA 4P2RE 5D1QD 3MBEB 1EIBA 3BZEB 1RSFA 5C0RH 4PRNA 3ZT5A 2BVTA 3QJHB 3WNLA 2ORBH 4C58B 4YO0A 1UXWB 4YHPA 2VLMD 1WF5A 3BVNB 4DVRL 3GO1L 3MV8B 1VPOH 4YWGL 5K9KB 2X4RB 3BDYL 3BH8B 4I3SH 5ICZA 3CFCH 3G5YA 2QTEA 3DOSA 5KVGH 1KPVA 1Z5LA 4XMLL 5HYEA 4X6DE 4PJ8A 4MJ5B 4F7PA 3G6AA 4RZCA 2UZIL 1EAPB 1G1CA 4W68A 5D2LA 2GJ6A 2EKJA 5DQ9B 2WQRA 2OTWB 3MMEB 4PRAB 1IAII 2UWEB 1D6VH 3R1GL 3O8XB 2L7JA 5I17B 4Z78A 5KTEL 4X7SH 2YEZA 1NMCC 3JV6A 3TBTB 1P84K 1IC5L 3D2UA 1RHHA 4OD3L 1LK2B 4HS6A 2AABL 1BM3H 1TTFA 2DM3A 4HPYL 4UI2A 1IVLA 5T1MB 1JZ4A 1WBZA 5HTSA 1JV5B 3TO4A 5EU6B 3DX8B 2XI9A 4K3HA 5HHXL 2XPGB 3JWDC 1K4DB 3PE9A 4P9HL 3WIFB 2XWJB 3RPIA 1FFNB 3QRGL 1LVEA 4MAYC 3KR3H 2P48B 1NGZB 4FFWD 4ZFFB 3V6OC 1PLGL 1KCRH 3Q1SH 4FQ1H 2DQHH 2P5EE 3FOLB 5D1QB 1U3HC 4PFEA 1MRCH 2X1PA 1AQDA 2X9XA 5ETUB 2D2OA 2HT3D 4RGOL 4JFHE 2ICES 4MJIE 2HWZL 2IH1B 4WRLA 4P48A 1PKQB 2XICA 3ESVF 3MOAL 4LCWE 4PJ8D 4NO3A 3ZDYF 3IFNL 3KYMB 4JKPL 5HBBA 5GGSY 4LSDA 2NZ9D 1KULA 3D3VE 4NKIL 3NZHH 1YEKL 3NFPA 4F37K 1A6PA 4NQVA 1A47A 3B5GA 5E4EB 5DD5L 3O3DB 3SDYL 1OP5K 3SDCB 3RWDB 3WL9A 3MLPA 4LVOC 3GI8L 4XPHH 4EBQH 3QIUA 5IW1A 4ZMAT 1IC4H 3D2UD 4GW4A 3UAJC 1MFEL 5CP7B 3AAZA 4KY1H 3TO4D 5MP6L 2MQ0A 2BRRH 3DROB 5JOEA 4LHUA 1T66C 4L9LA 1HEZA 1IL1A 3QXUA 4WUKL 1BGXH 3ZKQD 2X4QB 4XPAL 1YZZA 1ZVSB 1DBBH 4NWTL 5IB1A 5E03A 4QTIL 4KUZL 3FMGL 4LIQE 2PO6A 2VSCA 4BUHA 1JZ5A 1SY6A 3PWUB 4JPKH 2CKBL 4NT6B 3PP3H 4RMUA 2AJSL 3SDAD 4Y5VB 2BVUA 3QO1A 1G9ML 3H9YA 1GC1L 4PRNB 4YO0B 4YHPB 4RGNC 1BVLB 2A0LC 5IB3A 1U8NA 2JJWA 3IFLL 3IDNA 5ICZB 3G5YB 1QBLH 4PRBA 4UT7L 1QRKA 1YQ2A 2UWEF 5CJ8A 4TNWK 1KPVB 1Z5LB 5CS7A 2R56H 4U1NA 4PJ8B 1CDUA 5FGRA 4F7PB 2X4UA 2ZUUA 1MAKA 3G6AB 4RZCB 1F13A 4PRIE 3TF7C 2LABA 2X10A 1DFBL 5ITFA 1XCQA 4MMZC 3DHMA 4K7PL 4DGYL 4JM2A 5D2LB 3QIUD 2DQCH 2GJ6B 3UBXA 1NFDA 4JG0L 2GTWA 2YMXH 3IF1A 4JRXE 4Z78B 1LP9E 5D7KE 1FIEA 1I3RA 3NBNA 2YEZB 3BT2L 1KIQA 3JV6B 1U8QA 1IGMH 2OJZH 3EKCA 4POZD 3D2UB 1GGIL 1RHHB 3L1OH 4HS6B 3K3QA 1WBZB 1SY6H 3O3BA 3CFIC 1HSAA 3OR7A 5I73B 3WSQH 3TO4B 2XQYK 2RR3A 4YC2C 5JZ7D 2PO6D 5FO7A 1T83A 4R8WH 1V7NL 1TITA 1LWRA 4WFFE 2XQBH 1YC8A 4D9QE 2D3VA 5GHWL 3RPIB 2FATL 3OKOA 3WEXA 4BQ8A 4I0PD 4EXKA 1EO8H 3P30H 4MCZA 3DI3B 1NEZB 1TZGH 2FEDC 3QAZB 1V3LA 1GHFL 1AQDB 3I3DA 1SJHA 3MLYH 1LO4L 4MA8L 4C57C 2Z31A 3K2UL 2X89A 3BPLC 4WY7L 4XAWL 5HHME 3ARZA 3BD5A 5A2FA 1BP3B 1WIUA 4NO3B 4IMKA 1NKOA 43C9A 3MOQA 2KZ1B 2DBLL 4MNQE 2H32H 4JM2D 2VR5A 2C26A 2R4RH 3NFPB 5F7EH 4JPIA 4NQVB 2P43B 1TLKA 4N8PA 4JQVC 5HI5C 4P59H 3WL9B 1ZMYA 4D94A 4LPWA 1SHMA 3AREC 4O4YL 1C5CL 4K3JH 1CFVL 2EDFA 2H41A 4Z7NF 3QIUB 5IW1B 3QCUL 3MLVL 4GW4B 4I18A 1FL3A 4Z77A 3AAZB 2J5LC 3IGAA 1M05A 4Z6AT 3SGJA 4LHUB 4JKMA 3PGCA 2B7DT 4X9IA 4L9LB 1HEZB 1IL1B 4I3RH 4LRNL 3LIZH 4ORGA 2C3HA 5IB1B 3QG7H 4P2QA 5CBAA 1D7FA 3EZ8A 1H9VA 3Q5TA 3G08A 1LILA 2OJEA 1OTUD 5DUBA 1F00I 4OT1H 2PO6B 1AP2A 1MHHA 2MCG1 3NH7L 4TSBL 3E6HA 1TJGH 1YNTA 3CMOH 5D71L 2UZXB 1EHXA 2NY5C 3QFJE 3WFDH 4ZNCD 3H7LA 3QIBC 3QO1B 2V7NB 4V2BA 3MUHL 2VO5A 2G75A 1NDGA 4OZGA 5ID0A 2UY6A 4PY8J 1HIML 3U0WL 4TQEH 1EAJA 5DI8A 5HD8D 4DN4H 3ZL4H 5IB3B 1UCBL 1U8NB 1FORH 3IDNB 4PB9H 1NCWL 4PRBB 1BF8A 1MELA 1X3DA 5I1KH 4GH7B 3LHPL 1NANH 2DD8H 2EXWC 2E6PA 3Q6GH 4U1NB 4UNTA 2X4UB 2M8XA 5I1GL 5I1EL 1ZE3C 5ITFB 1XCQB 4LSUL 2QQNH 1WT5C 1WEJL 4JM2B 4LLAA 3SCMC 2IADA 3FB6A 3UBXB 3PL6D 4OSUH 1W2KT 1BQUA 2DYPA 2D7QA 1NFDB 1ONQA 2GTWB 5C71A 2H32B 3IF1B 4MB3A 4IS6A 4OV6F 2PXYD 4P0DA 4NN5C 3CX5J 1I3RB 2GYSA 1CDJA 3RWHA 5ANME 1KIQB 1U8QB 1A7QL 3S35L 2Q76A 1W0WA 3O3BB 3UTOA 1HSAB 2EC8A 2QL1A 3BZDA 3OR7B 4JEGB 5FKAA 3OB0K 1I8LC 1P4BH 4IOFC 4JDTL 1M1SA 4QOKA 4OKVA 4Q6YA 3UPAA 4RISL 3VJ6A 1KYOK 3IYLW 3DYMA 5CSBA 4J2XA 1AO7A 2DLTA 4R96A 5JW3H 3DVNA 4XP1L 4MCZB 3TFKC 3IU3A 3BKCL 3P3YA 3D39A 4ZNEA 1SJHB 4MCYB 1HH6A 4D3CL 5A16A 2HTKC 3V0WL 2Z31B 3B6SA 1MF2L 1PJ9A 3ARSA 4Z7UA 2YUZA 5ALBL 4RMRA 43C9B 1DVFC 4P3CH 4XXCA 3B5TA 4R2GB 2EH7L 4JPIB 3HR6A 3OKLA 4D0DA 1JHLL 3S7GA 2R9HC 5FYKH 4PB0L 4UOW1 1R5VA 1YECH 1MREH 1JYVA 3QDHA 4X4ZA 3V8CA 3RI5K 4I18B 1FL3B 5FYKD 4Z77B 3RA7L 1M05B 2PXYB 3QDGE 1CLCA 5JXAL 4QOKD 1LEGA 4JM4L 2KBGA 3OB8A 1YPZA 4ORGB 4JN1H 4MQSB 4P2QB 5CBAB 1UJ3A 3V6BR 3G08B 4NM4L 3S88L 5C0JA 2OJEB 5DUBB 3FKUS 4J3SA 1AP2B 1GAFH 1MHHB 1QRND 5DJCA 3D39D 3E6HB 4AT6A 2FZ3A 1YNTB 1WSST 5CJOL 3E2HC 4V1DA 4MZ3A 2G75B 1NDGB 5E9DA 4OZGB 5CCKH 4KJPC 5E70A 1ZSDA 4W6WB 1NCDH 4YZFE 2A77L 2YR3A 4TSAH 4JM2F 5EOCJ 4L3CA 2Q6WA 3NAAL 5IMLA 3V79C 4Y8DC 5BS0E 1P6AB 4Q0XL 1NC4A 4OM1L 1G0XA 2HRLA 5GSRA 3GSOA 3KYKH 2O5XH 2F19H 4Z95H 1JUFA 1QOKA 3LS5H 4LPXA 5EA0L 2M2DA 1HHHA 4HIEA 3V0VA 1LK3H 3C2AH 3DSFL 2IADB 4XNUL 5J6GA 3FB6B 2DYPB 4JZNA 1ONQB 2ARJQ 5JO5A 1HCVA 2OBGA 4WI9A 4P3DA 1QD0A 4IS6B 2JJUA 5JXEA 1CDHA 3RWHB 2NPLX 3DWTA 1AD0A 4BH8A 2R29H 2DAVA 2Q76B 1HNGA 1W0WB 4NN7C 3QA3A 3TYGL 3CGTA 5FKAB 3DJ9A 4O5LL 1J87A 4QOKB 3TPKA 2ZUVA 5CJ5A 5H94A 3VJ6B 5J1SC 1AO7B 5E6IA 4QKXB 4R96B 4MA7H 4V1DD 3BD3A 3LB6D 1T7XA 3DVNB 1OAQL 3FQTA 3BYTA 4XPTL 5E9DD 5D7JC 5IW6B 2Y6SD 3IU3B 1S9XA 1QR1A 1UT9A 5CMAA 5FM8A 3D39B 3QIWC 4J8RA 3SPVA 1HH6B 5A16B 3B6SB 4PBWD 3MA9L 3QG6A 1EPFA 2NY2B 4Y88A 1T7WA 4Q6IC 4Z7UB 2YPVH 3S8WA 1VFOA 4M62H 1DEDA 2CGRH 3GMMA 5FUCE 2D7OA 3ZKMD 3CSBA 3M8OL 3E3QC 4OCYH 5E0QA 3MXVL 1BOYA 2E7HA 4MZ2A 1CK0H 5AG8A 3OKLB 4D0DB 1EBAA 1O5DT 3DMMD 4EI5D 2VDQL 4M5ZH 1ADQA 4PJCF 5E95B 3H42H 1R5VB 4OIIL 2XTJE 5IJVB 3D0LA 4N0UE 4ZOBA 2B5IC 4TULH 1A9EA 3QXDB 2CXKA 1DLHA 3C87A 3EIFA 1LEGB 2DTMH 3GBLA 1YPZB 1S9VA 4Z7WE 1NAKL 2AW2A 1UJ3B 1JGUH 4OZGF 1UZ6F 3QNXA 4FQIH 2WZPD 5IFAH 3JWOL 2JCCA 3SE8H 5ISZE 5DJCB 4C4KT 2B1HL 4AT6B 2A9NH 2FZ3B 3TT1H 3OKKB 4KK5C 2YUVA 4V1DB 5D5ME 5HHPA 2M26A 1V3MA 4ZAKA 1XGRA 5E9DB 4Y2OA 4MGXA 4WFGD 4PJ7E 3BISA 1ZSDB 5FB8A 1BD2A 2VB5A 5I0DA 3O6MH 1GVIA 2EDLA 4L3CB 2FHCA 4LP5A 2Q6WB 5IMLB 3IKCA 4XP5L 1FNEA 5E99H 4NOBA 4UV4L 1KT2A 1QSEE 4QWWD 1A6UL 4U0QB 5ACMA 1NC4B 1ADQH 3CNKA 5D93B 5GSRB 2DQGL 3GSOB 5LBSH 2R69L 2BNQE 3HB3D 3LEVL 1KB9K 3D6GA 4GUPA 3TLRA 1JUFB 1MVUA 4TVPE 3RAJL 1HHHB 2J4WH 1YEGL 4HIEB 3V0VB 3FRUA 1YMMD 5J6GB 3QUMA 4JZNB 3TBSA 2Q7NA 4M8VA 5JO5B 1GOFA 3PDGA 4S1RH 4P3DB 4CVUA 3U7WL 1MI5D 1X4YA 4IEFB 1AD0B 4GKOA 4BH8B 4JVWA 2FNBA 2NZIA 4GAJL 2BK8A 3FQNA 4PS4H 1A7RH 2MMXA 2UZYB 4WNQA 3DLQR 4G8EA 1CFTA 5ENWA 4L3ED 5CEYA 5E6IB 1YNLH 2BRQA 1ZOXA 4Z7UF 1IAIM 2V6HA 4RWHA 4U1KB 1U8MA 4YH6A 4HEPG 5JQHC 4HPOL 5CUSH 4HJJL 1KCVL 1S9XB 4PRHA 1QR1B 1FC1A 5CMAB 4TUOA 1BD2D 3R8QA 3RKDC 4PTTA 4XPBL 4ETQB 5C7XL 3VXTA 1I8KA 3BQUA 4J8RB 3SPVB 1EGJL 2HKHL 4LNVA 5L8JB 3T1FA 4AIOA 4XI5C 3QG6B 4BZ2H 4U3HA 5DMIL 5TQ0H 4PYHA 1CD0A 3P9LA 3GMMB 1S78C 4WI8A 3SKUD 3E6FA 4XC3H 2JJTC 2EDWA 2EEBA 3ZYZA 3GSXA 5D7SL 3WLWD 4C56E 4U1GC 4HG4J 5J0BA 2DN7A 1JGVL 1KBGH 1TDQA 2AJYL 4EN3C 3WNPA 1FAIH 1YPZF 4NO0A 3I3EA 1FAKT 3GBML 4PP1D 1RFDH 3D0LB 4QXTA 1D9KC 3BI9X 4YHKL 1A9EB 2F5AH 4QGYA 3VFPA 1DLHB 1QKZL 4KRPC 5J3HC 1U2CA 32C2A 1DE4A 1TJIL 4N1CA 4FQJL 1DQLH 1S9VB 4PJBA 5TF1L 4YDIL 5L2JA 3A6OA 2YXFA 1T21B 4QYOA 3QNXB 4WFHD 2R0ZL 2JCCB 1BECA 2E6QA 4EDWH 4PRHD 3KPRD 3MRFA 1EMTL 4MHHI 3KPSE 4L3EB 3LH2H 3S3JA 4PJ5E 3WFHB 4KGJA 4PTUA 4QCIA 1T2QL 1SJEA 5HHPB 4HIIA 4ZAKB 4LMQE 3OG4B 4JG1H 1XGRB 1FV1A 4OF6A 5FB8B 1BD2B 4NQXA 1YYMH 3GK8L 2EDTA 3IKCB 4JO4H 1FNEB 1QSFA 1GZPA 4LARL 1KT2B 4PJEA 5EU5A 1NCUA 1GGCL 7FABL 4O9HL 4GUPB 1KLUA 2FL5A 4Y4HA 1MVUB 5HHVL 4KK9C 3T08A 5IVOA 4NO0D 3FRUB 3MRNA 3QEGL 5AD0A 3WFCH 3QUMB 4WUUA 1NKRA 3TBSB 4XTRD 4HMCA 1CDBA 1DQDL 2PR4L 3CU7A 4OD1H 3WIHL 2JELL 5IV2A 4XCFH 1GIGH 4M6ML 4NRXA 4XNXH 3CSPA 5LWYL 4LU5H 3I84A 3FQNB 4R26H 2MWCA 1UM5L 4WNQB 3O3EA 4LVHC 1J18A 1CFTB 3QEQA 3BMVA 4G8EB 3LMJL 4KDTA 4UAOC 4YDKH 5ENWB 2J12B 4NNXA 5F9WB 5CEYB 3EYUL 4PV8A 1S7QA 5I9QC 1GH7A 4LPTA 5CZXD 1YEIL 4YHLL 2GEEA 1U8MB 4X7FC 4PRHB 4TUOB 5KVFH 2ED7A 2BFVH 3VXTB 1I8KB 5CLWA 3T0VA 3MBXH 1QSFD 2GJJA 5C2BL 2L7UA 4XVSL 2E27L 2F54D 4U05A 3T1FB 2D9CA 4JFPA 3TIDB 1WWAX 4GMSH 3P9LB 1PFCA 1SBSH 5IGXH 4Y5XC 1PG7X 3S4SA 3E6FB 2MPAL 4FFZL 4DAGH 1RUQL 3GSXB 1E6JH 4WUUD 4MWFA 2X41A 4H1LG 2JF1A 5HVHB 3N1MC 3RVUD 4NO0B 4F58L 1JF6A 2V5MA 5EUKA 5L9DL 5EU4A 4F2MA 5I6XC 4QXTB 1MAML 5GGVY 2ZNXA 4QRPE 2JCCF 4K9EH 4Z7VA 3VFPB 3MA7A 1JE6A 4MD5A 5DJXA 2ADIA 2DLIA 32C2B 1DE4B 1I9JH 3VXOA 3QEQD 2PCPA 4AEEA 1YQVL 2A9ML 1MFAH 4DKFH 3MACL 5L2JB 4QYOB 5EU3A 5HYJD 1IT9L 4EQ2A 1IQWH 4YFLI 3W9DA 2HG5A 1WVZA 3L7FA 3MRFB 1KGCE 3CSYA 3PWPE 3RZCD 1FPTL 2BXZA 3BP6A 1GGBH 1WC7A 2VL4A 3CXDL 3G6DH 5DFVD 4PTUB 3TJEL 4QCIB 2HJLA 1SJEB 3ALPA 4WIQA 3ABZA 1FV1B 3A6BH 5TDPA 2AEQH 4M7KL 4NUGL 4NQXB 2H2PC 3SKMA 2CKNA 2GSGA 3VG0H 1S7SA 1QSFB 1GZPB 4PJEB 5EU5B 3SHSA 2VXSH 3RP1A 3I6LE 5DFWH 5L0QB 1U36A 4Y4FA 1INEL 2GJZA 2FL5B 1WZLA 4Y4HB 1P1ZA 5CGTA 5GPRA 1KEMH 5JQ6L 2AQ1A 3ARFC 1I9EA 5DC9B 3MRNB 3CFJA 5AD0B 4WUUB 2F58H 1FNSH 5BMFL 5IT2H 4OLYH 1J86A 1ZLWH 4M93B 3MLUH 2V9RA 5HGBA 3IRPX 5IV2B 2WLYA 3WS3A 1WAAE 3QP3A 3B9VA 4NRXB 3D18A 2E9BA 2P47B 1OGAD 2XXCB 2QR0A 4G5ZH 5IHBA 3O3EB 3ALWA 3QEQB 3HNTH 2E9JA 4TVSa 5DJ8A 4HUXA 3DYPA 4NNXB 4M6AA 3GMPA 4CMHB 15C8H 1X5FA 1OP9A 5JR1L 4PV8B 1S7QB 1H3XA 3BN9D 4OCXL 4I2XE 1G7MA 1X44A 4YHYB 5HYJB 1R24A 1LO5B 3NIDF 1KLFA 1I85C 1KNOB 4HH8A 4YBLB 3P4LA 3RL1A 3WXVL 2QSQA 5IFHL 1YEEL 2E5EA 2PNDA 4XNYH 3B9KA 1HHIA 4OI7A 2O5YH 4JFPB 5D7IA 4L4TD 2DQJL 4Y4FD 1KFAH 4JQXA 4IRJD 4DN3H 3S4SB 3WNOA 3SKJL 1DCLA 1DJSA 4PJDA 1L7IH 2ERJC 4RQQB 4MWFB 1NSNL 4FQXD 4PRPE 1BVZA 1N64H 2DQUH 4FZEH 2O93L 1FZJA 3HRPA 4Y2DC 3VXUA 4XWGH 5EO0A 5EUKB 5EU4B 3I6KB 3LN4A 3PP3K 2DQDH 4HJ0C 4HXAH 4F2MB 5MHSD 5FYJL 1NMAH 2CDEA 4YBQD 3C6LC 2PYED 1BFVH 1U41A 5HDLA 4MX7A 5J57B 5TFSL 1IAOA 4DTGL 3MA7B 3C5ZC 5JHLL 1Q9OA 4MD5B 5DJXB 2ADIB 3VXOB 2PCPB 5EC1A 5BCAA 3FT3A 3K2MC 3MV9D 3ORJA 4X8XA 2EXYC 2N7BA 4N9OB 3V5HA 1V5JA 4YXKH 3O4LE 3W9DB 2HG5B 3BPNB 3L7FB 3CSYB 2PTTA 4PJEF 3BP6B 1WC7B 4N8CH 4YQXH 3BUYA 3CK0H 2HJLB 3I75A 5GS1A 4KMLB 3T2OA 5TDPB 2ORBL 3O4OC 1A7NL 1JPGA 3SKMB 2GSGB 2LU3A 3S37L 1S7SB 4J3OC 1VPOL 1MIEL 1AR1C 4Y4FB 2GJZB 3KYNB 2CPCA 5KVGL 4M8QA 1P1ZB 1I3GL 1PYWA 4WI4A 4L8SA 3VFRA 5K59F 1P7QA 3KPQB 3STZA 1T5XA 3CFJB 5A3IC 4G3YH 3BDXA 3MOBH 1IQDB 4FQXB 5F7FA 4YE4H 1QFPA 2GUOA 4NC0B 1XF4B 5HGBB 5K9QI 3R4DA 2ADFH 3WS3B 4X7SL 1I1AC 4KPHL 4X9FA 2UVEA 1AI1L 5CP3H 1EJ6A 1F4HA 3D18B 4PJXF 5DVNA 4GBXA 5SX5H 2IQAA 5FECA 3QUKA 4KZDL 1UEYA 2QR0B 4MQTB 1FCCA 4LOUC 4KKNA 2R0KH 5DJ8B 3BGAA 4HUXB 3GMPB 2B2XH 1UENA 2IBBA 4NQDE 1G7MB 4N5UA 3RY4A 1RULH 4HZLA 1R24B 2E9IA 3LEXA 3KVQA 4JREB 3HUJE 3VFGH 2QQLH 3Q1SL 4UOJA 5KS9A 4WV1A 3WLBA 2DQHL 3RL1B 2NQCA 2NMSA 1MRCL 3H7BA 5BZWA 4NUJA 3NPSB 1HHIB 1T5WA 2H9GA 5D7IB 1UVQA 1U93A 2Y7QA 5CBEA 4BSJA 4O00A 4Z0BH 4Y5YC 4PRDA 3QHZH 3IAPA 4HUWA 4I5BA 4PJDB 1KEGL 5F44A 3T0EE 3X3FH 1QACA 4GLRH 2QQKH 4M1GL 5MENA 3PJSA 4AEHL 1G0YR 3ULVH 1FZJB 2NY0D 2D7TH 2OR9H 2BCKA 4FP8L 4LEXH 3VXUB 3GDBA 1QFOA 2B4CL 1EA9C 1HI6A 2DLHA 3MJ7A 2DOCA 5EO0B 3LN4B 3ULVD 4XPHL 4EBQL 2CDEB 5C08A 1VFMA 5LVEA 4RFNB 5CKGA 1IC4L 1ULVA 4GBXD 4MX7B 1Z9MA 1IAOB 1N3NA 1C1EH 3VXME 4L8BA 1Q9OB 5TH2A 2BRRL 5J12C 4J4PC 5DQJA 5EC1B 4LQ1A 3FT3B 4XBGA 2V2WA 1BGXL 3TA3D 1M71B 3H9SA 5DD0L 1CXEA 3BMWA 4U1LA 3V5HB 3O45A 5CZKA 3QQ3A 1IC7H 1IKNA 2LVCA 1CD9B 4HGMA 1PBYA 5BW7C 4ZUVA 5A2IH 2VERN 4LKCA 3L3JA 4ZOEA 1VHPA 2PTTB 4JPKL 1ITBB 4A6YH 3BUYB 3OXRA 3I75B 3WJLA 5EZIL 2YUWA 5GS1B 4NGHH 4X5XA 1MCQA 2A38A 1A7BA 4ZTPL 3W82A 3OR6B 1JPGB 1RZKC 5DYOA 1RZIA 2MTPA 3FZUD 3HMWH 1YY9C 1EEYA 5GGVL 1MLBA 3BFOA 3B2UC 1QBLL 1KPRA 4Q9CA 3O9WC 2R56L 4M8QB 1PYWB 4L8SB 3VFRB 3UDWA 5IMOA 1AFVH 1P7QB 4MNGA 3STZB 1T5XB 4UZGA 2N1KA 5JW4N 3SDDD 5CEZH 5C08D 2AVGA 3MC0A 2DQCL 3BN3B 3EOTL 1B3JA 4H0GA 2I25N 2YS4A 2GUOB 4H20H 5CEZD 3HAEA 4DFHA 4KQ4H 4OZ4A 3NA4A 3O3AA 2OJZL 4Q9QL 4L1DA 2JE8A 4H26A 4GBXB 2HA1A 2IQAB 4ZS6C 5FECB 4JHWH 3QUKB 2YRPA 1E4KA 3WSQL 5T1DH 4CW1A 1P7HL 4S1SL 1ZVHA 1QBBA 3ZDYE 3H3PH 5F93C 1FVEA 5DK3A 4ZO9A 4LAQL 4FQ2H 2WMPA 5IF0A 1XGUA 4JR9H 4HZLB 3OPZL 1VDGA 3HE7A 3LEXB 1U8HA 5KANI 1EO8L 4YHOH 4N5EC 1P4IH 3MRMA 4G6MH 5KS9B 5I19H 4WV1B 4PJDF 3S5LG 3WLBB 1YJDC 4LCYA 3H7BB 5BZWB 4NUJB 4UV7H 5T3ZE 3RIAF 1T5WB 2H9GB 4AMKL 2HLAA 1UVQB 1U93B 2Y7QB 5CBEB 4PREA 5TGBA 1ZANH 1X5ZA 5IVXA 3SGKA 5L8LB 3CLEL 4PRDB 1JYNA 2HTLC 2VLRD 1FSKC 4BQCA 5D7LE 2CUMA 5I1LB 4I5BB 2HT4C 5GIRA 4M7LT 1UC6A 2R4RL 3RTQC 5MENB 3PJSB 1J7VR 1MPAL 5EOQH 5INDA 5HVWA 4LHUG 5HHOA 2BHYA 1Z9LA 2I26N 1HI6B 3MJ7B 3G9AB 4X7TA 1NLBH 3WUWA 1C5DA 4K3JL 3ROLA 4OCRH 5LCVH 5C08B 4P9HC 3FN9A 3OAZH 4RAUA 2NY1C 3QQ9C 4QT5A 4X6CA 1N3NB 5JUEH 4JGUA 4L8BB 5D8JL 5TH2B 2C4FT 5DQJB 5IHZA 2HRPL 1B9ZA 8CGTA 4XBGB 4EOWL 1MFDL 2V2WB 2DDQH 3H9SB 4IRSC 4JCMA 4O02L 4XHJD 4M48H 4U1LB 3WKMH 3O45B 3QQ3B 3HE7D 4ZSOE 2UWEE 1J1OH 2HH0L 4GQPH 4ZUVB 2DQEH 5FHAH 4LKCB 3ETBF 3HKFA 5HYIA 3L3JB 4G7VH 4S0SD 2B1AH 3MGAA 1CE6A 4G8FA 4POYA 1TJGL 1OTTD 3FRPA 2VJXA 3OXRB 3IS1X 8FABA 3MRKA 2Y07L 3WFDL 1DQQA 1DLFL 3DX7A 1JNLL 3TCLA 4ZFGH 1T03L 4B50A 1K85A 3ZKND 1P9MC 4XNMA 5E8EA 5EU6E 4X5XB 3W11C 4KJYA 3U4EA 5DYOB 1RZIB 5TDNA 4YJZL 4RAVA 5D96C 4DN4L 1EEYB 1MLBB 4JO2L 3UTTD 1J1XL 4XVJH 4FABH 1KPRB 5I1KL 4OB5L 5F9OH 4FG6C 5DHXB 2DD8L 3Q6GL 1I9RL 2OQJA 3MNWB 3ULVF 5FM4A 5IMOB 4W4NA 4MNGB 1CLYH 3A6CH 5LXGH 3HZKB 4JRYA 1QFUL 2WNGA 1SEBA 2VLME 1PKQE 2DQIL 4LHJB 4R7DA 5CEXA 4TTDD 4OZ4B 4Y16C 1D3CA 3IETA 1CR9H 3O3AB 4YUEH 5IG7A 1HHKA 4HIXL 4H26B 4Y4KC 3NCJL 4MAYA 4M7LH 4J6RH 1G9MC 5KS9F 1GC1C 5ACZA 1P4BL 5IJKC 1XIWD 2CR3A 1FVEB 3V6OA 1Z2KA 5E2UL 2ID5A 2YD5A 4OTXH 5IF0B 4CL7A 1U3HA 1XGUB 3HE7B 1U8HB 2IMNA 5JW3L 1F5WA 4FXKA 3MRMB 1X5JA 1ZT4A 1JYWA 2GIYA 4LCYB 4DW2L 4EJ1C 3LZFH 1I8MA 3NCEB 3LCYA 2HLAB 5E2JA 2EDOA 4PREB 2YPLD 4WI7A 5IVXB 4KZEH 5SX4I 2BJML 4OM0H 4UIKH 3D9AL 4M1DL 2KPNA 1IZKA 3N50A 4P3CL 5E8NA 4E0RA 3UTTB 5I8OH 4PRID 2Z8VC 1BJMA 5GIRB 3S98A 1ZHNA 5INDB 1Y18A 3MRGA 1FFRA 3IDIA 3KXFA 1H15A 4ESKA 3OKYA 5B21A 2X5PA 1NC2D 4X7TB 2D4DA 3WUWB 1C5DB 5TQ2L 1TTGA 4JRXD 5GRJH 5BRZA 1A4KA 4RAUB 1BWWA 2VE6A 4X6CB 1EEZA 4MAYD 3MUJA 3IB4A 3DXAA 3IDUA 4GAGH 1CFSA 1BBJA 2D0HA 4S2SA 4X80H 3V4UH 5IHZB 1V05A 2DL2A 3MODH 4NZUH 5D2LE 3MJ6A 1I1YA 2GJ6E 1U3HD 4JHAH 4K2UH 5E5MB 2HMIC 5TE6H 4D9QD 5GJTH 1CU4H 1XIWB 1VGEH 4BZ1H 1FBIL 1T3FA 4P5TC 1CE6B 3OTTA 4G8FB 2HFEA 8FABB 3MRKB 5DC0A 1DQQB 3DX7B 5TE4H 4OCWH 3TCLB 5KVEH 4XNMB 1OY3B 5L88L 4U2YA 5E8EB 4KJYB 3VFSA 3U4EB 5CCKL 5GZOC 1JZ6A 4OZIA 5TDNB 3U30B 3VXRA 5E2VL 5KOVC 4RAVB 5CZVL 2YUXA 5ALCH 3PXJA 2IWGA 4H25A 3ILPA 1JJUA 2YPLB 1AR2A 4MNQD 1WTLA 4LDLB 1N8ZA 2OZ4L 3KYKL 2O5XL 2WUBH 1UB5A 2F19L 2P8LA 2OQJB 5KAQG 2EDRA 3LS5L 4G6FB 4LEOA 5DR5L 1BFTA 5EH1A 1LK3L 3C2AL 3L95A 3S96A 4R90H 4X4MA 5DJ6A 4JRYB 4NC1E 3CD4A 1KCUH 1CGUA 1CGSL 1SEBB 3DXAD 1NC2B 4R7DB 5CEXB 1KJ3H 2APWA 4LLDA 4M7JH 4KROC 3IETB 1PDKA 5IG7B 1HHKB 4XPFL 1RJZA 2BMKA 4MAYB 1MH5A 2VXVH 3ARDA 5D1ZC 1F4WH 1HSBA 5ACZB 1A14H 2BX5A 3AB0C 4LCIH 4U1MA 1YC7A 4FQCH 3K0WA 1UYWH 1G7PA 1LO3H 4RGND 1U3HB 5B38A 1MUJA 5IVXF 3X12A 1ITCA 4U7SA 4ZXBD 5F9DC 2IPUK 4OFYD 1ZA6A 4FXKB 2CMRL 3QFJD 1RUKH 1F97A 1ZT4B 3VXRD 2VN7A 4BQ9A 4M7ZC 1I8MB 4YEFA 4GRLC 4RRPA 1LGVA 2QADC 3CLFH 1KACB 2YPVL 4JQVA 2J6EA 2KH2B 5E8NB 2CGRL 4LVOB 3EFFA 3AREA 2AJVL 4E0RB 4JO3H 2CRYA 4OCYL 3TESA 1ZHNB 1Y18B 3MRGB 3IDIB 3KXFB 1GZQA 1H15B 4DQOH 3DRTA 2R2CA 1AKJD 1X6LA 3BE1H 3UC0H 2NCMA 5BRZB 1EFQA 1A4KB 4LDEB 4QRQA 3BZFA 5FO9A 3RKPA 2VE6B 1EEZB 3KDMA 1P84J 4KVCL 5T3XH 1B2WH 3ARDD 3DXAB 1CFSB 1BBJB 3DYOA 4S2SB 4R0LC 1FL5A 3WUZA 3ZZ1A 2QBWA 5DHVA 1CL7H 4HAFA 5T3XD 1I1YB 3G5ZA 3RWCA 3U4AA 3AGVA 1NFDE 3ARGC 1JGUL 1OTSC 5EU7E 4E42A 3TN0C 5IFAL 5TJWK 1T3FB 4RGNB 5AZ2H 2HFEB 3TT1L 4GXUN 2DS4A 1DQTA 35C8H 1BEYL 2J6EH 1OAXH 3MXWH 1RIVH 5K33A 3OZ9L 3VFSB 3KPOA 3TGXA 3KAAA 5F21B 1MJJA 2XWTA 3VXRB 1JGLH 3O6ML 5DQDH 3ARED 3OKNA 5JW5A 2DRUA 4H25B 1SMAA 3ILPB 3ET9F 4HK0A 1C16A 3LN5A 3SCMA 5LGHL 1ADQL 5I1HL 1QVOA 3RDTC 4YDLC 5LBSL 1N8ZB 4NP4L 1UB5B 4QXGL 1K5NA 1LP9F 4PV9A 4LEOB 4KJQC 4NZTH 2J4WL 5IHUH 3V52H 4H0HB 3L95B 5C0BA 3S96B 3O11A 5DJ6B 4KKCC 4GT7A 2OSLA 5DHVH 4LLUA 4S1RL 3UEZA 5MERA 2ZUQC 1I8LA 3TWCH 3QI9D 2ZP0T 4YC2B 4LLDB 4ODSL 3QDGD 2QEJA 3OG6B 3ZE0E 1RJZB 1SEQL 4MHHG 3MCLH 4XGZA 1MH5B 3ARDB 2VAAA 4JY6A 1B0RA 2ZUSA 4Z76A 5ITBH 1RI8A 4U1MB 2NR6C 2X4NA 3INUH 4G7YH 3ROOA 4OF8A 1G7PB 5B38B 4ZFZA 1MUJB 5AWNL 1KENL 3X12B 1CGWA 1ZA6B 2E7BA 3QCTH 1XF3A 5E5UB 2H2SD 5EOCH 3JVGC 1JNNL 2EIEA 4PJCE 4XP6L 1DVFA 5F7NC 5C6TL 1NGYA 1PGRB 1MCSA 4MXVF 2Q20A 3SCMD 2EE6A 4BZ2L 1YNKH 5TQ0L 2CUIA 4MAUH 4KTEH 5DURD 2B20A 3SE4C 3EFFB 2W59A 3AREB 1AGBA 4XC3L 4OI8A 5C0BD 1TENA 4XC1H 1CXLA 2HJFA 4OZGE 1CT8A 1UZ6E 3DRTB 3MJ9A 4LRIC 1P53A 4NM8H 3V4VL 3HPJA 5EZOH 3RRQA 3ZTNH 2J5LB 1KBGL 5EO9A 1OGTA 1M7IA 2NTFA 4QRQB 3RVVC 3BZFB 5FO9B 4X6FA 3KDMB 4OUOA 1X5IA 1FE8L 3X13A 3MLSL 4L29A 4IDLA 1FL5B 1IZJA 5DHVB 5KW9L 4RA0C 4X83A 1EK3A 3G5ZB 3RWCB 1UZ8A 1H5BC 2W0LA 4E42B 5J06A 3HI6L 1RV6X 1TVBA 3IKKA 3PWLA 1A64A 1FGVH 2A1WH 4U6XA 4KWUA 5T5NG 1DN0A 5IBTH 2P45B 1DVFD 3F7RA 5DEGA 4XCEA 1W72A 1T6WA 5FYKE 1ZLWK 3RJQB 3KPOB 1XH3A 4ODBD 1MJJB 4QOKE 4F15C 2XWTB 5BO1H 2X9WA 2BHUA 2YD7A 1G6RA 3M17A 3OKNB 3F58H 3EJYD 2R9HD 5JW5B 4HK0B 3SCMB 3LN5B 5DT1H 4JO1H 5GGRY 4P57A 1QVOB 1ZLVH 4PJHF 2W0PA 4D2NA 5E00A 2YPKA 1OP3H 1K5NB 5DURB 5HHNA 3D39E 2WIIA 3U36A 4NN5B 4ZNEE 2DJUA 4AM0A 1KB5A 5C0BB 4G9FA 3WFCL 3O11B 4GOSA 1EDQA 2OSLB 1J0KA 4LLUB 1O0VA 5MERB 4Z7UE 2ENSA 2XTJD 4ERSL 3F7YA 3JWOC 1C5BL 2NY6D 3QUZD 5F1OB 4OLZH 2AXJA 1B4JH 4F7CA 1U42A 1MCCA 4XNXL 3LQZA 4LU5L 4XGZB 2C1PA 4KKLC 2VAAB 4JY6B 5GRUH 5D1XC 1B0RB 3S34H 5E6YA 5L6YH 4Z76B 4YXHH 2X4NB 2DKSA 3QIWA 4HFUH 3FO9A 1F11A 4ZFZB 5ISZD 3BRGC 3DETD 5F96L 2Q87A 3BRDA 3ARTA 1XF3B 3BWUC 4J3WA 1MVFA 2R23A 6FABH 1DVFB 1YPZE 4HWZA 1NGYB 3MBXL 5MEOA 2FECI 2IALB 4QGTA 2V5RA 4FS0A 1KB5H 4R9HA 4ZS7L 1SBSL 4G8GA 1AGBB 4FZ8H 4LCCC 4XVTH 1WFUA 2VNCA 4G9FD 4RMSA 4V1DE 2HJFB 1BMGA 5E9DE 4M6OL 1CT8B 3WYRA 1MNUH 2G60L 3HA0A 3HPJB 1M7DA 4BA8A 2GW5A 5CJQH 5EO9B 5FA3A 3IDGA 1M7IB 1N2RA 2G2RA 3VCLA 2NTFB 4WHYG 4M61A 4X6FB 3QNZA 3U9UA 4UQ2A 2V2XA 2VDNH 3BZ4A 3X13B 1I1FA 5DD6B 1NBYA 4P5MA 2ITDA 4PG2C 3EFDH 1Y6MR 2EEAA 4FXGA 4W6XB 4NC2B 2V5TA 2NY6B 1I9JL 2AXFA 3EHBC 3D0VA 1MFAL 1X4ZA 3KLHC 5E7BA 3LDBC 1KYOJ 3CFKA 3GM0A 1TVBB 3PWLB 3H3KA 1B88A 2HN7A 1FHGA 1DN0B 4KI1A 4JVUA 4OLUH 5INCA 5DEGB 4XCEB 1CGVA 1W72B 3G6DL 5DSCA 4PD4K 5JOFA 1OPGL 3EO0A 4MJ6A 4NBZB 4PUBH 4KI5C 3C09C 1HDMA 2IFFL 3BDBA 1G6RB 3M17B 3MUGA 4PLJD 5DTFA 4OBRA 4L9DA 5SX5K 4P57B 3QUYD 2DMCA 4LLMA 3D1MC 4W70A 5E00B 2FJFA 1CICD 4OGXH 2YPKB 5HHNB 3SOBL 2WIIB 3U36B 5FF6B 1KEML 4UINH 3EYQC 4AM0B 1KB5B 3R0NA 4G9FB 4LSTH 5HI3C 4XXDA 3QPQD 2F58L 2XIDA 1RD6A 4NN7B 1OAKL 4O2FA 4OLYL 3F7YB 2R8SH 4WGWB 4UILH 3UYRH 2IGFL 4F7CB 4GKNA 3EOYG 1FIGH 3PWVA 4P2OC 1XEDA 3LQZB 3L5WA 4KK5D 3VGGA 2C1PB 3P0GB 4WO4C 1SM3H 1HWHB 2ZWLT 3I02A 1S3KL 3OKMA 4G5ZL 4HUKB 4P23C 1QLEH 2DTSA 3HNTL 3ARVA 1OARL 1NJ9A 1TVDA 3QULA 4IIQC 3QIWB 2VUYA 3BKJL 3WBDA 2MCPH 3FO9B 1F11B 4TNVF 3U7YH 4XP4H 3VXSD 5F7YC 3IDXH 3KPSD 3VD5A 1NQBA 4PJ5D 2RCSH 2HFGL 1H8SA 4JFYA 1RU9H 5DJZA 3VWKD 1M4KA 2R23B 4KVNH 5MI0C 1HK6A 4YXLL 4HWZB 1MCOH 2E6JA 1MJ8H 2JJTA 2ARWA 3CZFA 4E41A 3A67L 2O5YL 4N0RA 2NY3C 4NN6C 2JCCE 2X05A 3GJEB 4N8VG 2J3SA 3GSUA 3QEHA 4G8GB 4LAJH 4L3EE 4EN3A 5E2WL 4U49A 1AXTH 5D6DC 3LY6A 2ZKHH 5DDHA 1BAFH 1ZT7A 1T1WA 4HQQL 1FLTX 4XWOD 1HYSC 1D9KA 1N64L 4WW2C 4FZEL 3D5OF 2Z92A 1BD2E 3QUXD 5HGAA 5FA3B 4LF3A 3IDGB 1N2RB 2G2RB 4XWGL 3VCLB 4X5LA 2FX9H 1FG9C 3L9RA 1TQBC 2Y72A 4M61B 3T0EC 3QNZB 1NMAL 4LKXA 4LSPL 4P4KA 3GIZL 4UQ2B 3U9UB 2XY1A 2V2XB 1FGNH 2EH8H 3DX6A 3O2WH 3HC4H 1I1FB 1DBKH 1XFPA 1MY7A 1NBYB 4P5MB 1KUMA 2ITDB 5B4MD 4HGKC 4FXGB 3ARXA 1UH4A 2AXFB 5JHDA 3D0VB 3ZHDA 3KHQA 1NUFA 2BSED 4KK8D 3DNKA 3BJLA 1A1NA 1SVZA 2OL3A 4OCSL 4GMTL 5E56A 3CFKB 5D5MF 3SQOH 4YXKL 2HN7B 2QSVA 5INCB 1S78D 5DSCB 4HKBA 1HZHL 5JOFB 3VXSB 3EO0B 1CLOH 1IAKA 3IDYB 2P8PA 4MJ6B 4QRUB 1LEKA 4E41D 5AEAA 1NBVH 1HDMB 3CPLB 5C0AA 2FIKA 2YZ8A 4GJTB 5LQBL 5DTFB 3MUGB 4JFOA 1C12B 2F8VA 4CNIA 4WFHE 4LLMB 1ED3A 2X6MA 3B9DA 2FJFB 1CYGA 1D9KD 2XWBA 2FBOJ 2CJUH 4PRHE 2Y1VA 3VFWA 1OD7A 5J3HD 5BOPA 1IGIH 4P4KD 4XXDB 3X17A 5T1KA 4G3YL 4O2FB 4YE4L 2EDXA 1IJ9A 5FYLH 3NIDE 2VRAA 3VW3H 5I75C 1PD6A 3QJFA 1MEXL 4XNQA 5JHDD 1HXYB 4HS8H 5J11C 2VZUA 4GKNB 5FYLD 3BIAX 2GCYA 1F02I 3PWVB 3KNBA 4CVXA 3MLWH 1DUYA 3L5WB 4LSVH 5C92A 1F58H 2XKUA 3I02B 4U6VH 3OKMB 1Q0XL 3MLTB 4KDVA 3MJGX 1KTLA 1QBAA 4X4XB 1TTUA 1NJ9B 3QULB 2B2XL 3QNYA 4U1SA 4MS8D 3PWPD 2Y06H 1RULL 4JFYB 3KGRA 4NZRL 2R15A 5DJZB 2FLRT 3VFGL 1Z0MA 3VMOA 3WIIL 4JFEA 4ZD3H 3I50H 4KK9D 1IFHH 4Y5XA 3G04A 2I60L 3SGEI 4FRWA 3CZFB 4PJIA 1LO0H 2HT2C 4E41B 5HYSA 2P8MA 3U46A 3V8OA 4GRMA 4Z0BL 3GSUB 3HNSH 3QEHB 3QHZL 1RVFL 4EN3B 1JZ3A 3RU8L 5DDHB 1CFBA 1ZT7B 3U1SH 1T1WB 3BSZH 3MSPA 3GIVA 3X3FL 1NLDH 2JTDA 2QQKL 3AFLA 1D9KB 3ULVL 4X5WA 1QLFA 2A6IA 2Z92B 1QA9A 5HGAB 2OI9C 4LF3B 1BZ9A 2QHRH 1D6EA 2Q8BL 1QSFE 1JFQH 3BYYA 4F7EA 2F54E 4PJEE 5C9KA 1MWAH 4LKXB 4P4KB 1ZHBB 3O6KH 1S7VA 3DX6B 4NKMA 3IVKA 1ZK9A 1C1EL 25C8H 5CSZA 4MLSA 3VDAA 5JHDB 5M94B 3QR2A 4XP9H 3SGDI 4F3FA 1IBGL 4Q2ZA 4WUUE 1MCPH 1A7PH 1A1NB 2OL3B 4FFYL 5C0FA 2AJ3A 4KKBC 1IC7L 1F3RB 2PYFA 1BZ7A 1AY1H 2GSIA 5AUMA 4PY7A 4F7MA 1F8TL 5T33H 4A6YL 5K59E 1JL8A 4KK6D 4HKBB 4R7NA 1IAKB 3O0RL 1AQKH 2P8PB 1LEKB 1W0VA 1EFXA 3TVMD 1WFTA 4B7IA 1G84A 5C0AB 3U9PL 2FIKB 2VTFA 3QEQE 3GNMH 4JFOB 3HMWL 3LKOA 4NCC2 3TCXA 5I8KH 1ZS8A 3BAEH 2VH5L 4HCRA 3ARFA 4CNIB 3QHFL 4JAMA 4QHUB 2JB5H 5HYJE 1ED3B 4PJXE 2XWBB 1JBJA 2VDML 3OF6A 4RFEA 4LASH 3RIFF 2Z91A 3VFWB 1JPST 3KLDA 3THML 1AFVL 4L1HA 1HILA 4LSSH 2NY4D 4ZO6A 5E24E 5CEZL 2DICA 3D48R 1MRFH 5SWSA 1KTDB 2CD0A 3JTTA 1UCTA 4RIRA 1MJ7H 2YSSA 1EJOL 1B6DA 2V17L 3QJFB 4XNQB 2W0FA 4KQ4L 4LVHB 3V7AE 5FHBL 1WUNT 1CBVL 2GCYB 3HPLA 3KNBB 4CVXB 1DUYB 3EDKA 3O81A 2BNRA 2VN4A 5I9QB 4MXWH 2IAMC 1KTLB 3RY6C 3AM8A 1HH9A 2R1WA 3N85L 1IM9D 1EH9A 1JF1A 3QNYB 1I7UA 4U1SB 1RUPH 3RL2A 5DUPL 1AIFA 1A6VL 2I9TA 5E4EC 3FFCD 4HF5H 4Y19A 4NSKA 3HMXL 3ARBD 4HCRH 3V0AC 4G6ML 4LLWA 2EZ0C 4ZUTA 5I19L 4APQC 4H1LA 3UROR 4Y5XB 3G04B 2WP3T 4G6AD 4UV7L 5C07A 1J1PH 1CVSC 1OGAE 4PP2A 4PJIB 5HYSB 5F8RC 2P8MB 2ZOKA 3U46B 2V5SA 4GRMB 3OF6D 4TPRH 1G7LA 2N4IA 1NGQL 3DVIA 3D3VA 4NO5A 5I6XB 3GIVB 5HY9A 2H1PH 5CHNA 4W6YB 5SWSD 3C6LA 5EOQL 1NBZA 3GMQA 4JB9H 4EKXA 2PF6A 2F74A 3DVGA 1QLFB 2A6IB 4X5WB 3RQ3A 1HYRC 1MCFA 1QA9B 3C5ZA 1BZ9B 1D6EB 2ICCA 4Y5VC 5ERWA 4F7EB 2NY4B 4OCRL 4FFWC 4NCC1 4NKMB 1JGDA 5GGTL 3IVKB 3BKMH 5DZOA 2ADGA 5JUEL 3WE6A 1DL7L 5CSZB 2ZSVB 1VEOA 4ENED 2HT3C 4PBXA 4N0YH 4F3FB 1JPSH 4Q2ZB 2DDQL 5J6HA 4LNRA 5C0FB 1CXFA 2AJ3B 1NBQA 3F65A 4Y19D 4NQDD 4H1LH 2EIZA 2PYFB 3C60D 4XPGL 1OQOA 1BZ7B 4R4ND 2DQEL 2GSIB 3DVFA 2X40A 3P0VH 5AUMB 4PY7B 2B1AL 3GRWH 5MHSE 4F7MB 4QY8A 4OZFA 4XX1G 3TNNA 1FJ1A 4R7NB 4MNHA 2BSTA 5EFIA 5JDSA 1CDCA 5C07D 2C4XA 3FFCB 1W0VB 4ZFGL 1EFXB 3ZE2F 5D72L 3ARBB 3O2DL 1JVKA 3LKOB 4WEMB 1J05A 1ZS8B 2B4CC 2P1YA 2DQFA 3ARFB 1PEZA 4JAMB 3L5HA 3RWEA 4XVJL 4FABL 3TO4C 2UYLA 3HAEG 5F9OL 4ONFH 2VLJA 3GM8A 4RFEB 1VADA 4XBEH 5CWSA 3RGVD 2Z91B 3QZWG 3TZVD 1HILB 1I1AA 1CLYL 4ELMA 5D7IE 1BFSA 5SWSB 5C6PB 4AG4H 2Z4QA 3WJJA 3JTTB 2XY2A 4RIRB 2YSSB 3MZTA 1CQYA 1N4XL 1MIMH 3SDAC 2W0FB 2KL6A 3MZGB 4PJDE 3HPLB 4H8WL 2NXYD 2VL5A 3BEWA 3VGDA 3VI3F 3H0TA 1KSRA 4ZUSA 2BNRB 1QNZH 4YDJA 4LIQL 4OZFH 2FCBA 4Q58C 4X7CC 3VXUE 1HH9B 2R1WB 1JF1B 1I7UB 4PJIF 1F6FB 3RL2B 2I9TB 1VFUA 4Y19B 5I18H 4NSKB 1AR1D 2IBZY 4DGVH 1U91A 5FUOL 1X5KA 4Y5YA 2AK4A 2F53D 4LLWB 4ZUTB 3JSSA 2OP4L 4H1LB 4OCMC 5C07B 1NUDA 4PP2B 4PLOB 2ERJB 3FONA 2ZOKB 4K7PX 4G6KL 5DMJB 5F71A 1FRGH 2R0WH 2VLJD 4KDWA 1JHKH 4UIKL 3WUWG 2DWDA 3ZHKA 5J4MA 3UJJL 2BDNH 1S9WB 3D3VB 3MV11 1I1AD 5I8OL 4NO5B 2E8ZA 2Y36H 5CHNB 5C9JA 3C6LB 1NBZB 3GMQB 1MCEA 4YPGA 2F74B 3DVGB 2J2ZA 4HWUA 4XCNB 3C5ZB 3OAYH 4XRCA 1FN4A 3TZVB 5ERWB 4J4PA 4I0PC 3MYJA 3EBAA 2FD6L 1BJ1H 1JGDB 1FVCA 4HT1H 3FOMA 2ADGB 5KG9A 3WE6B 1MCIA 1XR8A 4GAGL 4XCCL 3EZJB 6CGTA 2X42A 5BW7A 3N1GC 5EB9A 3EOBA 1HHGA 5AYQA 1IAIH 4OBSA 3MODL 4NZUL 1A6AA 4YNYA 5KJRH 5J6HB 4OLVH 4LNRB 3DIFA 1CZ8H 4JHAL 5F1SA 1QBMH 5TE6L 4JPWH 2EIZB 1S9KC 3CU1A 3UZQA 2Y23A 4TSCL 1VGEL 4BZ1L 3O4OB 2AK4D 1D5BA 3IFOA 4QY8B 4OZFB 5T3ZH 4WWKD 3HI5L 3TNNB 1FJ1B 5CSGA 4MNHB 2BSTB 2EO1A 5EFIB 5JDSB 1KC5H 4ZTOH 1IAMA 5EU7C 5TE4L 5T3ZD 5KVEL 3FHAA 2ZCLH 1T2XA 1JYXA 3O9WA 2F53B 4NHUA 3VRIA 1J05B 1JGEB 2WUCH 2DQFB 5ALCL 5D7LD 5HYQA 3RWEB 4JZJC 2UYLB 5IESH 4UB0H 5B22A 4QTHA 2VLJB 4RWYH 1VADB 5CWSB 2N56A 4JQIL 1T83C 2CIKA 3S36X 1F45A 5KS9E 1IGTA 4LSQL 3K74B 4J4PD 1I1AB 1R5IB 4MQ7A 5IBLD 4ELMB 3HG1A 3MV8D