1EPFA

Crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
189
structure length
189
Chain Sequence
LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NEURAL CELL ADHESION MOLECULE)
publication title Structural basis of cell-cell adhesion by NCAM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 43
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1epfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1epfA02
2P8PB 1U8IB 3N9GL 4DUVA 3B9KC 3CH1B 5I76B 3BSZL 3T77B 3MRFB 4X5WB 1T21B 4CBPA 3QDJB 4IRSB 1YY8B 2Q86A 3KYKL 2DQHH 1IE5A 1Q94A 5I2IA 1QACA 3O3BA 2H1PL 4MDJB 3K4ZA 3MRNA 3EIFA 3IDGB 4XPGL 4YBHA 1I1FA 3IDXH 1U91B 4Z7NE 5I1DA 1JGVL 2FX8L 2R15A 1I7ZA 3MJ8A 5I1IL 1KJ2H 3WN5A 2YK1L 1RZ7H 1IAMA 1T89C 3QEUA 3UTPE 1G6RL 2YPVH 1ZKAA 4Z8FL 3QQ9C 1J0IA 4KZEH 1M05A 4PGCA 2KH2B 4L8DB 3WL9B 3GI8L 3VE0B 3ULUF 1K8DA 2ZSWA 5GSVB 3HZVA 3HAEA 1NEZA 1FLTX 4S1RL 4Q9QH 4S1QH 2DQJL 1P1ZB 4XPHL 2QQQA 5GGQH 3W82A 3FOLB 4R26L 1U92B 2X7LB 3GSXA 5CBEB 4HQQL 1IC7L 1UEMA 3U9UA 4ENED 1J8HA 2A0LD 4JPIB 5D7LD 2X41A 5FYKE 1PG7L 2ICEA 1OAXH 3DROB 3RL1A 4X7FC 4X4YB 3QG6A 5CS7A 3E6HA 2KQNA 3GFUA 3HS0A 1N6QL 4DVRL 2G75A 5KBNC 5F7DA 1WFTA 3W2DH 2GSIA 4OGYH 1OAUH 3F62A 4JFDD 5FHAL 5HPMB 3K3QA 3V5HB 5ICYB 3IJYA 4WEBH 2L7UA 3OXSB 1UH2A 2AK4A 4U6YA 4WHYG 1UWGL 3IFLH 3IJHA 1UXSB 4FRWA 1IEAA 5JPMB 1Z9LA 4LDEB 5FGBC 4YXHL 3PJSB 4M7LT 2AXHA 4KDTC 1RJLB 4HZAA 3ARYA 3VFUA 3E2HC 4IS6A 2K7QA 3L95A 4M7LH 4KY1L 4TYUA 3DHJA 3FQTA 3P3YA 1MFCH 4GOSA 3WMSA 3RWGA 5B38A 1D5IL 4YHKH 1A7RH 1GC1L 1CXIA 1KJ3H 5IMLA 4N68A 2XWBB 2Z8WC 3ROLA 2VLLA 4GW5A 3V4UL 1T2QL 2W65B 1D6EB 4YQXH 4XRCB 2ATPA 25C8L 4GMTL 4W4OA 4Z7WE 1N2RA 2Q87A 2XY2A 4QCIB 3GGWA 4OT1L 4RAUA 5DA0B 3PHSA 4P23B 4M6OH 4AENB 1MQKH 4MNGE 5GZOC 4ELMF 2XZCH 4K9EH 4OB5H 1RPQA 3DGCR 2SEBA 3VH8B 1WEJL 5ILTL 1MCSA 1VFAA 5FUOH 4XPBL 3BD3A 3KYMA 4E41A 2XYCA 1FG2A 2RIKA 1E27B 4S2SA 2VZTA 5HBBA 3RIFK 4WEUD 4NT6B 5E4EB 4CADB 4PY7A 1T0NA 4PB9L 3ZDZE 3OKDB 4DQOL 4R90H 4Z7UE 4FTVE 5BOZG 3KLHD 43C9A 4U1HB 2IGFL 2VDQL 4ZS6C 1S8DA 3MGOA 5FM5O 1T4KB 3DX8B 4BQCA 4PBWD 4G8GD 4G9FE 2YHGA 2NY3C 1JTTA 5C0DA 4E41D 4GRWE 2OSLB 4RAVB 4K07A 5L88L 2CK0L 1A2YA 1X44A 4HK3N 4Y4HB 4TTGA 4AMKL 5D5MA 5DJ8A 1T83A 4R97B 2KPNA 4KJYA 4I5BA 2AEPL 4HF5L 4MXQD 2EDQA 2NLJB 4MA8H 2G9HB 4RX4A 5DJ0B 4BQ6A 2E6QA 5DRNB 4AL8H 4H26A 5T1DL 3SDAD 3QUZA 5TF1L 3VH8G 3NZHH 4ZFZA 3ZKMC 1RJCA 3LVEA 3NAAL 1S7XB 1T5XA 5DK3A 3RY4A 3ZHDA 1T6VN 4X4XB 4XMKL 2GY7B 3HPJB 3MCG1 5MHSE 5I9QC 1Q9OA 5FO7A 4LVHB 1DLFL 3VFSB 3T0ED 2JB5H 2FECL 1EHNA 4G6FB 4DGVL 1F11A 4RX4D 4G6MH 4OI9A 1PSKL 3FAWA 4RGOL 2Q8BH 3QUZD 1H3PL 3LN4B 3JTTB 2VR4A 3KPNA 4NRXA 3TCXA 3O4LD 3H0TA 4PJDB 1PW3A 3AFLA 1W72H 5JXAH 5HYSB 2MPAL 5TGBA 5KS9E 2PO6A 2WWMC 1UVQA 5FKAB 5ISZA 3VFRA 2A9ML 3U36A 4YBQC 3TFKD 1T03H 5JA8B 1BP3B 3ZE0F 5T3XD 5IWLA 4JG1L 1YECL 4R2GC 1LO0L 1U93B 2PTVA 1WTLA 2OR7A 1IGFL 3WO4B 3VFTB 1INQA 5EZIH 3IXTA 5KG9A 3BHBA 1EEZA 3LZFL 4ZS7L 3IETA 1KXTB 2PO6D 5L2KA 5ISZD 1CGWA 2G5BB 1Z6JT 1JCKA 3AU1A 1UKQA 2JJTA 3MLWL 3QCUL 3GMQA 1NAKL 3GBNH 4U1MB 3QEQA 2UY7A 5DHVA 3R1GH 5L2JA 2Q8AH 1TZIA 3GMPA 5HGBA 4Z5RA 4PJ7E 3ZYOA 3MRLB 3HAEH 3GNML 4NKDB 3ULVE 4S10A 2PW2B 1C7TA 3HUJA 1YMHA 3AXLA 3C8DA 4J6RH 2R0LL 5EOTB 3QUYA 5HYSG 1MFNA 4JO1H 3FQXB 4OTXH 2EXWD 1A4JB 2EDTA 2R23B 3O2VL 4UNUA 3P0YL 3RZWA 4Z9KB 1TZHB 3PWPA 4GS7C 5JUEL 3QEQD 3H9HA 3LSOB 2ESVB 4I2XA 1JZ2A 3HRZA 1W0WB 4G43A 4P99A 2DQIH 2E7HA 4OZGE 1I75A 1HI6A 4L3ED 4OLVL 2PNDA 1EEYA 1OAYL 3TBVA 4RGMC 2HVJB 1E28B 3VI4E 2Q7YB 2FX7L 1YUHA 4N0UB 4CDHA 3QUYD 4QRRB 1AE6H 4JFOA 5CHNB 3ZYJA 5HYJD 2EKJA 4HIHB 1K2DB 5BS0D 5B22A 5CUSL 1IGYB 3PWPD 3GHEH 4LBEA 5SV4A 1DP0A 3QDMB 1FGVL 4FMKA 4NQTA 3SBWA 3V2AR 4D9RE 1BWWA 4LIQH 1U2CA 2XA3A 1NPUA 3F58L 3VG9B 5D1ZC 1DBAH 2QKIB 4R0LC 4M9OA 3MFGB 1EZVY 5JW4N 3GSQB 2V2XB 4QRRE 1B0WA 5TPWL 4LVOC 4X80L 5GGSB 1M7IB 3QHZH 3S97C 3QEHB 5F9JA 2EO9A 4LCCA 5B3JF 2OJEA 1J0KA 5DSCA 3QDME 3NN8B 4MX7B 4MAYC 3UAJC 4ZSOE 3H6JA 1TQCC 5JORB 5CP7B 1C08B 2L0DA 3QIUB 5AYUL 3BH8A 5CIPA 3PHOA 4YFLI 5IROA 5J3HC 3MUGB 1YYMH 1RZJC 2H2PC 3K80A 2A74A 3U9PH 1YQ2A 4UV7L 4RBPH 5ACMA 5FHBL 4ZYKA 2WW8A 2VR9A 3QCTL 6FABH 1E6OH 1WZ1L 3HTLX 5HSFA 4LLYB 3PWNA 3FO0L 3IDYB 5E5MB 1QVOB 2R0ZL 2EEAA 5GGRB 3QWOB 1PX4A 3QDGD 3KPPA 3I6GB 1CFQB 3TNMB 4DVBB 2A73A 4PS4H 1G7JA 3SY0A 1T1XA 5LGHL 3F7YB 4F15C 4XAKE 5DR5H 5FCUL 1KCSL 4ISVB 2QJDA 4P48A 5J1AA 4MJ4A 4LPTA 1QLEL 4HXAL 5I8OH 4LHUB 5K9KA 3WHXA 2PCPB 3ARXA 4OZHF 4PGBA 1AXTL 4C56A 4F9PC 5DS8A 1MLBA 5FYKL 3SKJH 1G0DA 3MPCA 4Y2DD 4FFZL 4UINL 4KXZI 1S5HA 2AEWA 4PLJD 2XN9B 5A2KH 4KVCH 5ALCL 4M7JH 4KWUA 4Q0XL 4AEHL 1JI2A 4FFWD 1ZTXH 2ITDA 4L4TE 1JV5B 5LWYL 1UKSA 2NR6C 3BD5A 3TIDB 2VDML 4DCQB 4BKLA 1ZLSH 1N64L 1ZHKB 4C56D 3MRKA 2FR4B 5T33H 4TULH 1JHTA 5KVEH 1LD9A 4WWKB 1X4YA 3NZ8A 3JWOL 3V6ZB 1MHCB 4JRYB 1W8NA 2GFBB 4MAUL 3AM8C 2XN9E 5I0ZA 5AYQA 2D9CA 2IPUK 4NOFA 1JNHB 1X5LA 4JCMA 2HAZA 2UV3A 1UWEL 3U6RA 2WUBL 4LHUG 1VACB 2XZAH 3M07A 1V7ML 4MA3B 4TTDD 5T3XH 4QHMB 3CXHK 1A7PL 1C5CL 2IALA 3N1QC 4KJPD 4BQ8A 5K93A 4CU6A 2PUQT 3L3KB 4PRHB 3U4EB 4FQQB 3QG7H 1NAMB 1QSED 3S7GA 5TJWK 2IH3B 5EZLB 4PJHB 1OAKH 3QULB 5LGJB 3BO8B 1JWMA 2F5AL 3PP3H 3QJFB 3U0PA 1QFHA 1MY5A 1S7RA 3QHFL 5KJRL 4LSVL 1CDGA 1TJIH 2XNAB 1NDGB 1KGCD 3IFPA 1ZLUK 4IMKA 5CJXC 4TPRH 2OP4L 5IVXB 4JLRB 2YPKA 5HDQH 5F6HJ 4YPJA 4QHLB 3MBEA 2HRLA 2X70A 2X44D 4HKXB 3JTSB 4KK5C 5ICZB 3MRHB 2ZPKH 1H3GA 4LP4A 1NC2A 3BWAA 4NOBA 5HHNA 4K94C 4RMWA 4XCFH 2GYSA 4HH8A 2BDNH 3CLFL 1BLNA 3REWB 2VLKD 1KC5L 5DHVH 4Z76A 1F4YL 1AGDB 2OZ4L 1XIWB 3LY6A 5GGUB 1BBJA 1TCRB 3MBED 4GG6A 1I8LA 4L3CB 3LQZB 3HE7A 1DBBL 3VGDA 2EH7L 1I1AD 4R8WH 3HE6D 4KHTH 1NC2D 4JY6A 1VGKA 3UC0L 3PWLB 2O93L 2Q76B 1X7QA 1RK0A 3QI9C 5T5NF 3JWDL 2YEZB 5FECA 5IIEB 3MLVH 1YDPB 3WUWG 3G04B 2XFXB 1VFMA 5BO1H 1LO2L 4HWZB 2EDHA 4D9QD 2VXQH 4MS8D 4PJEE 4S0TD 4NZDA 4E5XA 1GHFH 5SWQA 5E8PA 5A2IH 4WFHE 1IQDA 2BJML 3DSFL 4HFWA 4JFZH 1AIFB 4WFED 4G42B 2H6PB 1C7SA 4OIBA 5EC2B 2CMRL 1CXHA 1M7XA 2X4SB 3D2UB 4YHIB 1DFBL 5GJSL 4NNYA 5A16A 5JDJA 3S37X 5DO2C 3V0AC 3ZMRA 4O58L 4JFQA 1NSNL 3WS6C 4DTGH 3P4LA 1HSAA 3CFCH 3MNZA 3MV8A 1KELH 4K7PX 5JIKA 2BVQB 3ZKXC 3K4AA 3OPZL 2MFNA 4NM8H 2ZUTA 3TJHD 5E6ZA 1A6ZA 1AXIB 5IB5B 1A47A 4U1NA 4X6CE 4HV8A 1JZ7A 3S36L 2F53E 3GSWB 1E4WH 4PG9B 4BQBA 4M5ZL 3O45A 4Y1AB 4NNPH 4OF6A 3NA9H 3KDMB 1EMTH 1DSFL 3MV8D 4PBXA 3BPCB 1H15A 4GH7B 4LCYB 5CIPH 4JRWA 4ZXBD 4N8VA 1MWAL 5BMFL 3VXNA 4G8IA 2GCYB 3DX9A 5CGTA 1FNEB 2WUCL 4L9LB 5FK9A 3ZL4L 1U3JA 1U8KA 3EJZD 5EU6A 5EOCL 2WBJB 2QV2A 3O3EA 4X4MA 1PY9A 4QHNB 4Y1AE 3WFHA 4DZBB 1NMCB 1KN2L 3ULVL 5B4MC 2VWEE 2HKHL 1XH3A 4ZUWA 1CFSB 2IQAB 5EO0A 3FTGA 2I07A 5JTWA 4XMPL 4KI5E 3DO7B 1MLCB 3EGSA 3OKKB 3OJDB 4LSPH 5EU6D 3KPSB 4RA0C 2XKNB 1MCWM 4YWGL 2C4XA 2IAMC 3T1FA 3N1PC 2PYEE 1S78D 1IGIH 1N7MH 3VFMB 1NCWL 2NZIA 4M6MH 3KPRD 3OR7B 3I3DA 1Q9LA 4HKZA 3WNLA 4MCYA 1QFWH 3EDJA 4NQXB 4WI2A 5F1NA 1PG7W 3EJJX 3V4PL 2AABH 5I1GL 1RJYB 4XNXH 5AG9A 4GBXB 3SOBL 1QRNB 2A77H 3KPSE 1XEDA 1RK1A 5LQBH 4TQEH 1KLUA 4WV1B 2VLRE 4QWWC 1BOGB 3IB4A 1BREA 3DYMA 4ZAKA 4WDIB 4RMVA 2VZ1A 4L8CA 1HNFA 2AAVA 4CN4A 2Q6WA 1RQ5A 3ARVA 3L7EA 1CT8B 3RY5A 2BVOB 4NJAL 4XCCH 2V5MA 3OAZK 5KW9H 5KVGH 5CZXD 5J11B 1LK3H 1HOCA 4KROD 1FIGL 4PJFA 1QRNE 3Q3GA 2JELH 3EYFA 3ZKSD 5CEYB 4U1SA 4PJAA 3WFEL 4ZTPL 2ADIA 2JLLA 3VD9A 4ZUVA 3T0VA 4GXVL 2N56A 3EO9H 3Q6FA 1J1PH 2AXFA 3TA3C 2W9DH 3LKPB 4BSWB 2J1KA 1XR8A 4KMTH 4I9WE 4PRBB 4AM0A 4NKMA 5E94A 3S37H 4P46A 1S5IH 1U3HA 1VERA 1K4CA 5JOEA 3FZUC 1NMBL 4LAQL 2WINB 4RDQF 5DF0A 1WK0A 4K7PH 1BECA 2APVA 4PJIA 3UPRA 2GI7A 5CJ5A 5ANMB 1F8TH 3NCJL 2O5ZL 3CMOH 5DZOA 3PDOB 4P0DA 3MRPA 1N8ZB 4NP4L 4P2CG 5DRWA 5JNYA 1LP9F 4UU9A 2B0SL 1UT9A 2V5SA 3Q5TA 4HC1A 5IF0A 1AD9A 2OL3A 2IBZY 5C0EB 1JVKA 3CFJB 4P46D 4APQD 1GGBL 3VXTB 3I84A 1R3HB 1RZIB 4XX1E 3FRPA 2RB8A 4B7LA 1OAZL 1FH5H 2FATH 3IF1B 3MRDA 1MIML 2Z8SA 4F7PA 3BPLC 3TBYA 3ESUF 1X6LA 5DD3L 5TDNA 1LQSR 3KAAA 4DUWA 4KTDH 1A0QL 3BP4A 3MJ7A 3KHQA 1ZHBA 5TDPA 1CTOA 3SHSA 1JZ5A 3WS3B 3KYNB 5J13C 1EIBA 4A2LA 4YIQA 4NCDA 1G7MA 1A7OL 3FMGH 4YEFA 4NBZB 4JO3L 1OGAD 2VIRA 1U95A 3VDCA 4KRLB 4X4ZA 2DL2A 5IB2B 2MSPA 3D0LA 3MROB 3MLSH 5DWUL 4QXGH 5FB8A 1T7YA 2EZ0C 4DWHA 3CFDA 2NY4C 3FRUA 4IEFB 3L3JA 1SJHB 3P4MA 2Y5EA 1URLA 1Y0LB 3H7BB 5CJQL 1K4DA 1QEWA 4QY8B 2AKRB 4P9HH 2HLAA 1N6VA 5EU3B 4HG4J 4G80A 4EVNA 4LVNC 3GM0A 1FFQA 1IL1B 3I50L 1I3VA 5DEZA 1X4ZA 3BT2L 3ECBB 3J8F7 4JFXA 4Z7QE 5IMMB 4YHZH 3P4OA 4YLQT 1KLFA 2W92A 1X6NA 3UZQA 4XXCA 1JK8B 4X8JA 5LXGH 1RZKL 4PV9A 3C60A 3QUXC 2CXGA 2AJ3A 4X7DC 2VAAA 4XCYB 3WXWH 3WNOA 3LDBB 2FWOA 3O2DL 2Y07L 4TNVK 1LEGA 3FOMB 4XZUA 5BVPH 4JHAL 3HI5L 1VEOA 4O9HL 3C5SB 3U4BH 1W0VA 1MCKA 3GJEA 5DRXA 1XFPA 1P6AB 3S4SB 4DGIL 1F6FB 2GY5A 3O6FB 4UQ2B 3C60D 1P4IH 4QYOB 5EUOF 2CLZA 2EYRA 4NO0A 4M93B 1OARH 2EIZB 2M26A 2VLJD 4AIXA 5DK0B 2IH1B 4OCLC 2Y06L 4N0FB 4K8RL 2D0HA 4N9GB 3RWCB 3TVMA 1JNNL 2JB6A 2DQCH 1J11A 2BNQD 4UTAL 5DJAA 1AR1C 1FJ1B 4OKDA 4S1DC 5E99H 5GRJL 1L9NA 1X5YA 1AGBA 2BVEA 4X7SL 2DLTA 4LVEA 3VWJB 3QAZB 4UZGA 1J0HA 4UBDD 3QH3A 5FEBA 3V95A 2LABA 2ZJSH 5I15H 3PWVB 3U46B 2D0FA 4CVZB 1MJUL 1U36A 3OX8A 4HS6A 2B2XL 1FYTE 5D7KE 1UB6B 3ILQC 5JZ7D 4LQFL 5DTFA 1JZ8A 4ZNEE 4WCYL 1U8HB 3DI3B 3GMRB 5TQ2L 4JQVA 4FFYH 3RP1A 3OTTA 3F7RA 4G7YH 3D0VA 3T3PF 4MJID 3WEXB 1C5DB 3LS4H 1L9MA 1JYXA 4YGVA 3FN9A 2JJSC 3ZKND 3OXRB 1IAOA 3VWKA 2X4UA 1MCEA 1H8SA 1KJ2B 3V7AE 1NCAH 1XGPA 2XXCB 4ELKB 3D69B 3FFDB 3HC4L 4QOKB 2QADC 3RPIB 2AK1L 4D0BA 4Z7VB 3S35H 1QUNA 4I1NB 1V5JA 1DEEB 2J6EL 1F6LL 3RY6C 1FFRA 2L4OA 3ESVF 2DD8H 2OK0L 2J8UE 3GMMB 5DXWA 2C3VA 3F12A 4Y4FA 4M1CC 4MQ7A 2NXZB 1LO4L 1UADC 4RFNC 1A3QA 4XNYL 2HKFH 3FCTA 5C2BL 3WIHL 4Y88A 5CLWA 3QXUA 4QOKE 4H8WL 5LJYH 2K1MA 1IM3A 4MJ2A 4NZUH 1KIQA 2R0WH 1PX3A 5K9JH 3ZSSA 4L9DA 5T1KD 5IHZA 3H7LA 4C59B 5K9OB 1K85A 2BRRL 4HS3B 5HHOA 1DTUA 1O0VA 1HQRB 4A6YA 3MO1B 3RNQA 4QT5B 4YHOH 2BVTA 2N7BA 3E8UL 4LFHD 4O4YH 2H26B 3WV0A 4FQXA 1QBLL 5D8JL 1XCQB 3O8XC 5EN2A 4UIKL 1NC4A 5DA4A 3MTRA 3UJTH 4ZFGL 4L5FH 4MVBC 1J88A 3P0GB 4HSQA 1AI1L 2VUYA 5MP6L 5IKCB 2CRIA 4XHJD 2O5XL 4KFZC 2X4TA 4Y5VC 1RHHB 4FQXD 4XP6L 2GK0A 4CMMA 3LOWA 1IMHC 1DQJB 3PV6A 3RZCB 5GJTH 4ZG1A 3MCLH 1IC1A 4GSDH 4HCRH 1JPGB 2OMBA 1GC1C 4HFUH 4OGAC 4KVNH 4UT6H 4O2EB 2V5RA 3VW3L 2ATKA 3WO3B 2FGWH 4YEEA 3O3DB 2NX5B 2Y5TB 3REVB 2KZ1B 1NGWB 2HT4C 2DM2A 4JN1H 4J8RB 4RGNB 3LPFA 1UCBH 3TO2B 1IT9L 4HBCL 3NIGF 2EXYD 4O2FA 2F54B 5CGYD 3VRLF 4WW1B 1PKQA 3KYAA 2DTSA 5AZEH 5SWZA 4PP1C 1INDH 1SY6L 5C0JA 4JANB 2GJ6A 5C2UB 1J05A 3UJJH 4HHAA 5D6CA 1B9ZA 2WNGA 5I1EH 3U2SB 1CLYL 1EO7A 2NX5E 2YKLL 5C0CB 4Q9BA 2ICWA 2X40A 3DV4A 3FKUS 4KRPB 4GKZA 5F9WB 2ED8A 3CUPA 3DGGB 1CFTA 3CSPA 1KLGB 2VZOA 2F54E 1R3LB 3AREA 4L8SA 2V2TA 4XAWL 4PJ9D 1E4JA 4ONHB 3W81A 3CSYB 3TO4A 3TJEL 5HDLA 1NCNA 1FFNB 4WU7A 4YHNB 4UAOB 2CRMA 3BZEA 1RUKH 4JM2C 4OV5A 4IRZL 4HDIA 1TITA 4H1LA 4BZ1L 1YPZF 5DQDL 2DM7A 2DTMH 1AKJD 2VZ3A 3G6JA 4JVUA 4QRPB 5I16B 4WI5A 3HNTH 1NGPL 1A4KB 5EUKB 5C0CE 5GIRA 1PKOA 3MOQA 5E70A 4I3SL 3SKOA 4HK0A 4G3YL 4LKXB 4YX2H 1YEFL 4P4RB 4L4VB 3ARED 4X7TA 4EUPA 3P4NA 4PRIA 4EN3D 3BESR 4YHPA 1IJ9A 3HMXH 2ZCLH 3V0VA 1T22B 1C8PA 3O41B 2FJHA 4U1IB 3O9WC 5L7XH 2X9WA 1NFIB 4QRPE 5E9DD 1TVHB 1PYWA 1QHOA 1D5ZA 4IHOA 4QRSA 3P9MA 4JM2F 3TZVA 3CVIL 5IQ9B 3CPLB 3NH7H 1CU4L 4PRID 1EX0A 3VXQB 5AD0A 3WIFA 1VFBA 2YXFA 1IC4H 3NMEA 5T5FL 1CDCA 1ITBB 2IMNA 3VFNA 1IZKA 2M8XA 1MIEH 2HTKD 4NKQB 3T2QA 2YPLA 4ZODA 5F6IB 1W72B 4LSSH 1ZA3A 1JHLH 1DQQA 1OWWA 5DT1H 3W5MA 3DPBA 5JW3L 1Q72H 3LIZL 1CXLA 2Q86B 4YAQA 4NWUH 5IBUB 1Q94B 2CUIA 1SYVA 2YUWA 3C6LA 1CF8H 1YEGH 3LD8B 3SE8H 5D1QC 3U30C 3X3FH 5CCKH 2CSPA 5I2IB 2ID5A 3O3BB 2XTJB 4NQEA 2QQKL 3MRNB 1B3JA 4HWEH 2YPLD 4OBSA 1I1FB 1NGXA 2VDLH 3FO9A 5B39A 5GHWH 1ZVHA 4JHWL 4TUOA 1I7ZB 3MJ8B 1JTPA 4TNVF 5JMRA 3C08H 3G08A 3WN5B 1NCDH 5D7IF 3QEUB 5DUPL 2IQ9L 1L7IL 4P4KD 4PGCB 3C6LD 5D7LB 1YYLH 2ZSWB 3DHMA 1ORSA 4NQED 3HZVB 3LKSA 3HAEB 2FSEA 1NEZB 3EYOA 3CLEL 5GISL 2FX9L 1DVFC 3BGAA 5ICXB 3HC0A 4WO4C 1WVZA 4HGWA 1BZ9A 1D6VL 1AP2A 1TFHA 3GSXB 3BDXA 1DR9A 4LU5L 1FRGH 1XMWA 5IBUG 2VE6A 2VC2L 1J8HB 4LPWA 2ICEB 5D7LE 3RNKB 4OM0L 3RL1B 4DKFH 3MXVL 3QG6B 4M1DH 1JPFA 3E6HB 1MNUH 4GO6B 3HS0B 2OCFD 2W38A 4RWHA 5TDOB 2G75B 3TCLA 3OG4B 2XQYG 5F7DB 3V6OE 3LQAH 2GSIB 3VG0H 3IJYB 2HT3C 2NYYC 1I9JL 2YRZA 4JFDE 3WDJA 2AK4B 3QFDB 4U6YB 4MD5A 3MV01 5DJ6A 3IJHB 1ZGLP 1IEAB 3G5ZA 3V0WH 5IV2A 1TJHH 1IEBA 4PJBB 4CNIA 1P9MC 1NEZG 2XQBL 4FXGA 4JFHD 3C5ZD 5ID0A 1OM3L 3MACH 1CFNA 4TVPD 4OZ4A 3DXAA 1CDYA 3VFUB 3MJ9L 2R2BA 2FEEL 1H3UA 3H3PH 1T7XA 1T5WA 3DBXA 2VABA 4IS6B 3L95B 1D5MA 4K23L 4ZNCD 3R0MA 3UBXG 1A9EA 3RWGB 4FA8A 5L0QB 1A3RL 3KNBB 1KJVA 4HWUA 3EYUL 4PJBE 5HHVL 4LIQE 3S96A 4DJMA 2HH0H 5IMLB 4MA1C 5CWSA 3WHE1 2OX5A 1QSFA 1KB5L 1KN4H 3DXAD 3ROLB 2VLLB 3TYGL 2XG5A 4HIIA 1XGYH 2HFFA 1MPAH 1UM4H 2FYYA 3S34L 5LVEA 5EBGA 3INUH 1GRWA 3MC0A 3EFDH 4XVJH 1BJMA 2ATPB 4PB0L 5AEAA 3RUGA 1N2RB 1HE7A 5I74B 3WJLA 3IXAA 1QR1A 3GGWB 1BIIA 1P7KA 3QIBA 4GRMA 4WENB 3NIFE 2AEIT 1WITA 2SEBB 4OF3A 3RDTA 1VFAB 3KYMB 1QBAA 4E41B 1FG2B 1OP5H 3HRPA 1AQKL 4S2SB 3TEUA 2R8SH 2F58H 5BV7L 5HYQB 1PDKA 4TOYH 4PY7B 1T0NB 2IF7A 3UPCA 5B38G 3MFFB 5FGSA 1NBVH 1WQVT 3EDFA 4OCWH 2APTA 5JHDA 4HAGA 3S98A 1MAJA 1S8DB 3MGOB 3MLYH 5IW1B 3SDAB 1AO7A 1O7SA 4G8GE 4H1LH 5C0DB 4Q9QL 3UTQB 4N8CL 5T3ZL 5DMGC 35C8H 3OB0H 4H0IA 4TSCH 4LAJH 4E41E 5DRZA 3BRGC 3RA7L 1IARB 5HVHC 1A2YB 4OLWH 2XG4A 3TBTB 4ERSH 5D5MB 4ZUSA 2CKBH 2QBWA 4ODVH 4RMRA 5C08A 4I5BB 2P5EE 2HFGH 1TNNA 3ZE1E 5E6ID 1Z9OA 4H26B 2F74A 1OAXL 3B9KA 4BZ2L 3PQYA 3QUZB 4P9MH 1AO7D 1IAIH 4J1UA 4O00A 2ZG2A 2DQEH 3JWOC 2YA1A 4RMUA 5FKPA 4ZFZB 4NZTL 1IZJA 1T5XB 1BQHB 4HUXB 2UZIH 4OF8A 2ZOLB 4GXUN 1RZFL 1Q9OB 5FO7B 1DEDA 4GMSH 5C0GB 1OPGH 4OIIL 3T0EE 1F11B 1M1SA 4LCUA 3Q2CA 3KJ4B 4NQUA 2WV3A 3PQYD 5DFVD 4U6HA 5FXCH 3KPNB 4NRXB 1YEDB 1YEIL 3FN0H 3K2UH 4LLUA 1T89A 3E6FA 3H0TB 1F4WH 2DBLH 3O4LE 1FIEA 1UWXH 3SN6N 3BE1L 5TGBB 2PO6B 4K3EH 3VFRB 5ISZB 2OJZL 3U36B 1A6UH 3Q0HA 1FNSH 2UWEA 3O6MH 5FF6A 3WFZA 1SVZA 2NY2D 5D2LA 2R1WB 4WUKL 4Q6IC 2RCSH 5T3XE 3SPVA 2FDBP 3CDGA 3NGBC 4YHKL 4EDWL 1A7RL 4LSTH 1F13A 1T1YA 3LKRA 1INQB 1KJ3L 1U58A 3DTXB 3IXTB 4LRIC 5KG9B 3HPLA 3BHBB 3H2WA 3RVTD 5DD6A 3U48A 3FO2A 1EEZB 5CINH 3IETB 5JDSA 2JE8A 5L2KB 4V1DE 2HJFA 3WNNA 1QHPA 4Q58C 3X13A 3AU1B 4Y5YC 1XGRA 4HZLB 2DIAA 1LILA 2D0GA 2GJZA 1SMOA 3GMQB 5F6HI 3QEQB 4POZD 5BXFB 5DHVB 5GRVL 3OZ9H 4M6OL 1TZIB 1ZVYA 1P69B 3AROA 5HGBB 3MUJA 2B1HH 1BVZA 2XZCL 1HYSC 2DIJA 1YMHB 3AXLB 4WW2B 1MCFA 3QUYB 4NN7B 1IILE 2AV7A 5HYJB 5FGBA 2YD5A 4YE4H 4KPHH 3GZKA 3NPSB 4KDTA 4HIXL 2DRUA 1MEXH 3PWPB 3HMWH 3H9HB 4R90L 1IC5H 4YR6B 3MNWA 3QEQE 1BBDL 3JWDC 1GZQA 3MSPA 3HRZB 3ULUE 4G43B 3RKDC 2BXZA 1HI6B 1ROWA 1EEYB 3TBVB 4L3EE 5D70L 5IM7A 4TVPH 1YUHB 1TZGL 2XOTA 4P2QA 5KN5B 4N5EC 4JFOB 2WWKO 3K1KC 4LSDA 5HYJE 3IFNH 5C9JA 1BM3H 1NCTA 4H88L 3WD5H 4NWTH 2I9LA 3OKLA 5BS0E 4QXUH 3WUZA 3FT2A 3EYQC 4LBEB 3ISWA 1QFWM 2BFVH 1QLFB 5ETUA 4DFIA 5L9DH 4AL8L 2EE3A 4XC3H 3SDDC 5C0AA 1E6JH 3NZHL 4P2QD 5KANG 4KUCD 3EO0A 3LN5B 4JREB 4PJXE 5DMIL 4BSVB 2YD3A 4KJQD 3WCYA 5JIPA 3RHWK 1MFEL 1I8MA 4LCCB 5A3IC 1R5VA 2JB5L 2B5IC 4HIEA 4LVHC 4HUNB 2OJEB 4G6ML 3GSOA 5HHPA 4UQ3A 4ETQA 1MI5D 2Q8BL 4JGMA 5HD8D 5C0AD 5EH1A 3SDYH 1P84K 1DBKL 3BH8B 4JEGB 5CIPB 3PHOB 1W72L 1MAML 3BP7A 4FNLL 2EC9U 2A74B 3BZFA 3ZHKA 5EWIH 3A67H 3U1SL 3B2VH 4ZYKB 1R3KA 1PZUB 3GMLA 2APWA 5IEHA 4HUMB 3BYTA 4FG6C 3NPZB 2VYRE 3KPPB 3QDGE 2RQ8A 3UTTA 2X05A 3QPQC 2A73B 4MJ5A 3Q1SH 5ESVA 3ULVC 1T1XB 2ITCA 4M00A 4KHXL 5BZDA 3VXPA 5D2NC 4K3DL 5J1AB 4MGXA 4NSKB 5HXMA 3ZTJH 2V17L 4JO4L 4LSQL 2LTQB 2PXYD 5J12C 3WHXB 5K9KB 1WFNA 4JM4H 4PGBB 4C56B 5DS8B 1MLBB 4PJDF 3NCEB 4ELME 3X14B 2HVKA 4UTBH 3M8OH 4KGLA 5SX5K 4PRPD 3D85A 1DJSA 2BY1A 5CFHA 2ITDB 3SCMC 4MNQA 4OTXL 4KKLC 4OQTH 1EK3A 3K8KA 3FB6A 3RX5A 1MCOH 1JGDA 1E4KC 4ONGH 4BKLB 4FQ1L 3MRKB 3ZZ1A 4C56E 1JHTB 1LD9B 4WHDA 4P3CH 3NZ8B 4JGJA 3FQWA 3FN3A 5DJZA 5EA0L 1UB5A 5TE6H 3D85D 4IRSD 2NY1C 4LCWA 1CE6A 5GGVH 2J5LB 1AE6L 5C8JA 4MNQD 2R4SL 2X1OA 5E1AA 5B8CC 3U6RB 1NGQH 4NM4H 2FB4L 5C0ND 2EDNA 5DJCA 1T04B 1DBJL 3GHEL 3VI4F 2BVPB 1GGYA 5E8DL 1O7VA 2JCCB 4N8PA 2BC4A 1A9BA 1LGVA 4LIQL 1IKNC 3QO0A 3FFCD 3HB3C 1WUNT 4GAGH 4HJGA 1DBAL 2VL5A 3D39A 2YD6A 3RVWC 1QSEE 5F3HA 4DGYL 4K71C 5FYLL 3QIWD 1JWMB 5I17B 3U0PB 4NQCA 3JV0A 1S7RB 2FHBA 3QHZL 3IFPB 1KGCE 3D3VA 3HI1A 4XC1L 3ARDC 2YPKB 2JCCE 3Q5OA 4JHZA 3MBEB 3D39D 2X70B 3ARFC 3BGFC 3HC3L 4PGDA 3KGRA 4OCXL 3HE6B 3OF6A 1NC2B 3BWAB 1GAFL 5HHNB 3QIUC 1YYML 4HIJA 1BAFH 5C09A 5AZ2H 4XVUD 1MRFH 3DUHA 3U9PL 4DN4H 4U1LA 3LB6D 1BLNB 4WI6A 5D96B 3SQBA 5F72S 4DKDC 1E6OL 4Z76B 2VLKE 2QL1A 2Z31D 1BBJB 3PF2A 4OFKA 1I9RH 3IDYC 4X6EA 4KKNA 4ORZC 1WBXA 2JJWA 1N0XH 3N1MC 4PS4L 2P8LA 2DLGA 4JY6B 1VGKB 5IVZA 3BKYH 4IOIA 5FGCE 2AERT 5D1ZA 4HWNA 1X7QB 1EZVX 1RK0B 4R0LA 3HR6A 1F00I 3L1OH 3GDBA 4LLVB 4DW2H 1HIMH 3T2NH 1CLZH 2A6KA 1TENA 1V7NL 3EJYC 2V6HA 2AQ1A 4KAQH 3LN9A 4E5XB 3BYYA 4W6YB 4D9QE 4KVCL 1RVFH 5H37G 4HLZH 2QLVB 3ILPA 2Z0BA 3A6CL 5SWQB 3UEZA 5E8PB 5IESH 4MAYA 2BZDA 3NTCH 5D1ZD 4HFWB 4YZFE 5J6HA 3VXSA 4LDLB 5A2LH 2WK2A 4WFEE 1A8JH 4WY7H 3CZJA 3PNWA 1NQBA 5EIVA 3ZE2F 1W2KT 5FYKU 2NZ9C 4NNYB 2C4FU 2LVCA 4JJHA 5A16B 5KVEL 1X9QA 4J4PC 5EIQA 3VFGL 1FNGB 4GT7A 4JFQB 5CBAA 1FL5A 1HSAB 1UACH 5KSVA 3MNZB 1BJ1H 3MV8B 5GGSY 2YUXA 3AGVA 5CZKA 3UAJD 4PP2A 3QFJD 3GMNB 2BERA 1A6ZB 2WZPD 4U1NB 3WHE0 1RZKC 4PRDA 2XZAL 4LOUC 5D71L 1Q0YH 5T3XL 4HT1H 5E4IA 4S1SH 5J3HD 3O45B 2J4WH 3N85H 5HHME 1P4BH 4AQ1B 3O2WH 3UTSA 4X9IA 1I85C 1LEIA 1H15B 1OAKL 4ETYA 3MV8E 3O3UN 3HG1A 4F9PA 1FZMA 2WMPA 2X4QA 4N8VB 5J0BA 3VXNB 4G8IB 3DX9B 5FK9B 1U8KB 1XZ0B 2Y72A 3EW3B 5GGRY 5EU6B 1TJIL 3DMMC 1DCLA 3O3EB 1UZ8A 2PETA 1KFAL 1PGRB 4K8RC 3WFHB 1JWUA 4Y4HD 1S7WA 3HZYA 43CAA 1SJEB 4NKIH 2KZWA 1XH3B 3V6FA 3HG1D 5EO0B 5I8KH 4M48L 2I07B 2ZPKL 1GPOL 1HHGB 5EU4A 4QHKJ 1PVHA 4XCFL 1BQLL 3EGSB 2BDNL 4I3RL 4P3WA 3AM8A 2VN7A 3QUKA 4HPOL 2GQHA 5EU6E 1JI1A 1MHHB 4PJHF 4X4ME 3ULUL 3T1FB 2H9GB 2NR6D 3VXOA 1G9MH 1XIWC 5JO5A 3CU1A 4AZ8A 2HJKA 1Q9LB 3KPRE 3UO1H 4HKZB 5EOQL 1F58L 1FZJA 4R8WL 4N8VG 3DURA 4MCYB 4U05A 2YD7A 5F1NB 5IVXF 4K2UH 3RHWF 3RJQB 1GH7A 4E0RA 3HZKA 5F21B 3CC5A 3MOAH 5E8NA 1AY1H 4D3CL 4MDIA 3OBAA 2G2RA 1RK1B 1KLUB 2XTLA 3KPOA 2FL5B 3RVUC 3MLVL 5HJ3A 2Z9TA 3PGFL 3RWFA 3CMGA 1KTKE 5BO1L 3SDXA 4ZAKB 5KVDH 2FH6A 1MQ8A 2FIKA 4L8CB 4X5LA 3UYRH 4WFFD 4WHYH 5CJXA 3L7EB 1GHFL 2E9JA 5C07D 1JNLH 1F6AA 1QBML 4BH8A 4JFZL 2B20A 1HOCB 2W0PA 3GIZH 2HWZH 1H3TA 4J23A 4PJFB 1RHFA 3Q3GB 3EYFB 5LBSL 4RSVA 1QFUH 2VDRL 3AB0B 4U1SB 4HUVA 4MWFA 4PJAB 1ZLWK 1KCVL 1GL4B 2ADIB 3F7QA 3C8KA 4ZUVB 5GGTA 4H8WC 3Q6FB 2LU3A 3NCMA 1UJTA 4FQIL 3CFCL 2AXFB 1CQYA 5BJTA 4P2OC 4ODXA 1XR8B 4GW1B 4NM8L 1JZ6A 3LH2H 5FV2A 4NKMB 5E94B 4M02A 4P46B 5I73B 1E4WL 1U3HB 1K4CB 3IRPX 2YWYA 4KKCC 5C6PB 1ADQL 2MKLC 1AHWC 2VDPH 4NNPL 4PJIB 1U8QA 3UPRB 2CGRH 5M94B 3QI9A 4JFFD 3O6KH 4JDTH 2ESVD 3MRPB 2VWEC 5DRWB 4CVXA 5ADOH 4UU9B 1DN0A 1QYGH 4PV8A 5IF0B 5E7FA 5JOPD 4CAGA 1KTDA 1FO0A 5I0DA 4KI5C 5EBLA 3IDJA 5JOFB 2ORBL 2VH5H 1UJ3C 2I25N 4C57C 3MRDB 4F7PB 1XF5A 3LEVH 4RAHA 1RV6X 5TDNB 3QI9D 4XVTH 1M6OA 3RAJL 5GS3A 1WAAF 4MCZA 3BP4B 3VMNA 3MJ7B 1S7UA 4NQSA 1ZHBB 4ZFOA 4L29A 3QUMA 5TDPB 4AT6A 5F9OH 4PRNA 5DC0A 1G0XA 2ZUVA 2UYLA 1R24A 1G7MB 2V5YA 4HXBH 3T8XA 4X7EC 3WS6A 1A64A 1OSPL 1SEBA 4LSPL 2CDFA 2VIRB 4IIQC 4KK6C 5C0IB 1OGAE 3AS0A 3TH3T 4OCRH 5F8QC 1XGTA 3F6IA 3D0LB 4QF1A 4UOJA 1KEGL 4FXKA 3MYJA 1EVTC 1IGIL 2F9BT 1HQ4A 3CFDB 3FRUB 1EEQA 3PXHA 4M6ML 3L3JB 3P4MB 3QRGH 5LCVL 3B9AA 4B5EA 2I5YH 4O5LH 1K4DB 1QEWB 2AABL 1RURH 2HLAB 5JW4Q 3FRPG 5L8KB 4XP9H 4G80B 12E8L 4EVNB 1MJJA 1NJ9A 1ZEAH 3GI9H 4MQXC 4Q74A 4TQEL 1VESA 4I3GA 1QG3A 1RZJH 5DYOA 1I7TA 4M43H 4JFXB 1RFDL 1QFPA 3P4OB 2QEJA 2W59A 2OLDA 4JVWA 4OAWA 1SJXA 1QBBA 2VAJA 5KOVC 4X8JB 4XPFH 1HCFX 3MOBH 4PV9B 3C60B 4MHHI 4XCCL 1F4XH 3B4NA 2AJ3B 2D7MA 2VAAB 5KW9L 1LK3L 5CKAA 2FWOB 3VMOA 3W0WA 4Z6AT 1LEGB 4CN1A 4XZUB 4ZO7A 4EI5C 2EDRA 2X10A 2RR3A 1YY9D 2QHRH 2XPGA 3GJEB 4JKLA 4LHUD 3EO9L 1L4IA 2AJZA 2W9DL 2CLVA 2VXTL 2F5BH 2IAMA 5GZNC 3O6LH 4KMTL 2CLZB 4X9GA 4YXKH 1TTUA 2YD1A 3KJ6L 4I0KA 5I8EA 5B4MD 4CUCA 2VLJE 1HXMB 4MQTB 1BVLA 4U6XA 3OGOE 1IGMH 1PLGH 3TVMB 1TPXC 1A14H 4GG8A 2JB6B 4K7PL 4YK4B 2BNQE 1EO8H 3BUTA 1AGBB 5TFSH 4HG4K 1SYSA 4YHLL 3CMOL 2IAMD 4OLYH 3UYOD 4WWKD 3GSNL 1NLDH 4Y4KC 4YC2B 3BVNA 4TNWK 2ADFL 4X6FA 3OX8B 4HS6B 3VGAB 5HPOA 3FONB 3I9GH 4ZUUA 5DTFB 1FH5L 2FATL 3QPXH 3X11A 4TSBH 3ZHLA 5GRXG 1KBGL 4PJ8C 4P59H 5JR1L 1GVIA 3MLUH 4KTDL 2WP3T 3D0VB 4MD0A 4MJIE 1QSVA 5J9PA 4YGVB 4YDVB 4QWWD 1LP9A 1IAOB 3WUWA 1KNOA 2X4UB 4U1GC 3VWKB 3FMGL 1RAMA 3C9NA 1FZOA 5MI0B 3TA3A 3U7WL 1EUUA 1XGPB 5E8EA 2VZUA 5FYJL 3ARQA 3TBWA 1RMFH 3MLSL 4D0BB 3L3OA 1OF2A 1L0QA 4QXGL 5D7JC 5A2FA 1L6XA 5EG6C 3TT1H 5K9QI 1R5WA 1LO3H 2C3VB 3F12B 4Y4FB 1ITCA 1QNZH 3ARBC 4OUUA 3WFBH 4CMHB 4GAJH 5MENA 1M4KA 1M71A 4NGHH 4PJ5A 5JHLH 1IM3B 1DE4A 5GGTH 4YHZL 3JZ7A 1KIQB 4FQLH 4OI8A 2PTTA 4MZ3A 3FZUD 5CJOH 5LXGL 1A7NH 4A6YB 5H94A 3RNQB 5BRZE 2DQFA 3KPQA 1FQ9C 3WXWL 2QSVA 2OR8A 1VKXA 3LHPH 2EIBA 1CD8A 1FSKC 1A6AA 1OY3B 3O11A 4FQXB 2W1NA 5EN2B 5C0BA 5MEND 4PJ5D 5BVPL 1GOGA 2E8YA 3R4DA 1N5AA 4JHBA 1K5NA 4WUUA 1PQZA 4PR5A 3MGTA 1MCQA 1CLOH 1XGQA 2K9UA 3U4BL 2VXUH 2ARJA 3CFKA 4LEOB 4OCSH 1U8OA 2DLFL 1T20A 4J3WA 2BRQA 4AG4H 1A6WL 1C16B 5I1CL 1J0JA 1IAIM 1P4IL 3U0WH 2BCKA 1I3UA 2X4TB 3GRWA 1FO0H 5EC1A 3RTQC 4HJJL 2F15A 2V7NA 5E2TH 2GK0B 2VN4A 4X9FA 4CMMB 4LHJB 4M93C 5C0BD 1F3JA 3PV6B 4QTHA 2H3NA 5E2UH 1J8KA 2XKUA 1CZ8L 2D4FA 5SWSA 2ATKB 5IFHH 3JUYA 4MA7L 4MNHA 3MLZL 1EGJL 1KCRH 2EZ0D 4JE4B 3GSUA 5CSZA 1TQBC 5GPRA 5MEQB 5FA4A 3R8BB 3CK0L 1UA6L 1PKQB 2ZUYA 3OKEA 3QUXA 5SWZB 1I1YA 4PJ9B 1UFUA 4FFYL 4QHUA 5C0JB 1S7QA 3LAFA 2DYPA 4G7YL 4NZJA 2GJ6B 1YNLH 3B83A 5SWSD 1J05B 4HHAB 5D6CB 3SDCC 3IKCA 3ZDXE 5DZLA 2ADJA 1CBVH 3RU8L 5T1LA 3DV4B 4GKZB 4R96A 3WFCH 3A6OA 3CUPB 1CFTB 1EERB 5BV7C 4QLRA 1NCAL 2DQTL 2BHZA 2P44B 4HBQA 2NY0C 3AREB 1GIGH 4L8SB 2V2TB 4EN3B 4GLRH 3MA9H 4JB9L 3SKMA 4UT9L 3S35L 3TO4B 2YZ1A 5HGHA 5F93C 2DYPD 3L3DA 4WGWB 4WU7B 4YDLB 4PREA 3DETC 3LEYH 3SJVA 3BZEB 4NHCH 4BJLA 4OV5B 4HDIB 2RFXA 4H1LB 3WFDH 3O4OB 4UT7L 2B7DT 4FXLA 5T1LD 3ES6A 3G6JB 2J12B 4N0YH 3KG5A 1WFUA 4N0RA 2H8PA 5GIRB 5HYIA 2CKBB 2X4NB 3SKOB 2F19H 4HK0B 5F1SA 4H0HB 4HULB 1HZHH 4X7TB 4P2YA 4EUPB 1J5OL 3P4NB 3LEXA 4PRIB 1NMAL 1JNJA 5I1HH 3CU7A 4NO3A 3CVHL 3K8MA 3GBMH 4OSUH 2EDFA 5DEGA 1UG9A 2HRPH 3V0VB 3W39A 4BUGA 3SO5A 4X5XA 1NANH 2FJHB 2ZCHL 1OQOA 1AR1D 5J57B 3G6JE 4XBEH 4LASH 2HN7A 1PYWB 1DL7H 4Z7VF 5E9DE 1D5ZB 2MQ3A 4IHOB 4QRSB 2P8MA 3P9MB 3TZVB 3PGCA 5T1MA 2JJSA 4AH2B 3MZGB 4PRIE 5AD0B 1YNKH 3WIFB 1VFBB 3T0XA 4GBXD 2ZSVA 2XT1B 3ILQD 2X89A 3VFNB 3QNXA 5F1OB 5EUOE 2YPLB 4JO2L 4RBPK 1FL6A 1G6RA 1QFWI 1ZA3B 2JKXA 5IHBA 1DQQB 2AV1A 4NO2A 1S9YA 3RY6A 2EE9A 2CJUH 4YHYC 4EUPG 4YAQB 5KSBA 5GJTL 4P4KB 3BXNA 3C6LB 3MV7A 4J2XA 3MCLL 4JFEA 4GSDL 3BPNC 4HCRL 3RBSA 3NCYP 3MLRH 4NQEB 3CGTA 4Q9RH 4HFUL 4R4FL 3FB7A 4UT6L 2OM5A 2YMXL 1HKLL 3QQ3B 2FGWL 1NGXB 2QADD 2CQVA 3FO9B 5B39B 3DYPA 3SQOH 4JN1L 3WLBA 4TUOB 1X5AA 1UCBL 2Z91A 2ARWA 1BD2A 1NUGA 3PWUB 4J3VA 3G08B 1UGNA 1G84A 1DQMH 5CD3A 4JGUA 1QLRB 4JDZA 4M1CD 1MJ8H 4JFED 1ORSB 1DQLL 4NN5C 3LKSB 4OZIA 5DVKA 2FSEB 3EYOB 3O8XA 1B2WH 4HWBH 3SEPA 1XT5A 3HC0B 4NUJA 1BZ9B 1AP2B 1TETH 1BD2D 1NCBH 1EPFA 1G7HB 5IQ7H 2VE6B 2HLFD 4LSRL 4Z0BH 1LDSA 4YNYA 4DUXA 4L1HA 1YEKH 4Y5VA 3RWHB 4NO5A 3V5KA 1QKZH 2ICES 3SGDH 4NQVA 3QT2A 4RISH 1JPFB 3O8XD 4J12A 2CPCA 5B39G 3TCLB 4TNWF 2DTML 2OS7A 4UV4H 2IPKB 2EE2A 4MD5B 4RWYL 2MWCA 1NLBH 1BFOA 3I75B 3QQNA 4YX2L 3SO3C 3G5ZB 5IV2B 4XB8A 4XP5L 3D6GA 1IEBB 4CNIB 2BNRA 2A1WL 4FXGB 3J7HA 4WI3A 4RCAA 3HMXL 1A3LL 3OAYH 4JFHE 4X83A 1CFNB 3PP3K 3DXAB 3MRIA 2R2BB 4BFEA 3T4AA 1N4XH 1T5WB 3DBXB 1GGCL 2VABB 1G9EA 3GRWH 5I1AB 1ZA6A 1D5MB 1J86A 3GIVA 1OL0A 4Z0XA 3FT3A 3NCFB 3DVIA 3NH7L 3WKML 2AS5M 1M7DA 5CZVH 1CFVH 1Q9KA 1JFQH 1PG7X 2DQUL 2Y6SD 1KJVB 3VFPA 2BMKA 4ZD3L 5JQ6H 5CWSB 1QSFB 1JYVA 2PW1A 4HIIB 4HEME 1MIEL 1K6QH 2FYYB 4NPYA 1BJ1J 3GBLA 3MRGA 4LSSL 4D94A 1XF2A 3E3QE 1JHLL 3LMJH 5DT1L 1FPTH 3RUGB 1Q72L 3IXAB 4JM2A 4JKWA 3X12A 2DB8A 1J0ZA 1G1CA 1BIIB 1P7KB 3QIBB 1ZVSA 2Y4SA 2D03L 3DRTA 4GRMB 4NWUL 3SE8L 5CCKL 2O61A 1Q9WA 3RDTB 4AIZA 4LKCA 3K7UA 2VDLL 2FLBT 3KXFA 3TYFA 5GHWL 3NIGE 2E3VA 4ONFH 3V9FA 4RMTA 3RUGE 2IPTL 4WU5B 3V79C 1JPSL 5JHDB 3O9WA 2OR9H 4ENEC 2A6IA 4IRJD 3O0RH 1AO7B 1H3XA 1NFDA 2AW2A 3T04D 5JW5A 5L6YH 3KXFD 3BMWA 1AGEA 5DRZB 3HNVL 2WIIA 3GEWB 3V6OC 3RVXD 5KSAC 4R3SA 2VDKH 2EDDA 1ES0A 2ADGA 1OTTD 4UUJA 3VWJD 5D7IA 2E7BA 1H3WM 3O9WD 3B6SA 2CK2A 3IGAA 1XF4A 4P3DA 3VMPA 4FP8H 2F74B 3B9KB 3PQYB 3QHTC 4J1UB 4Y2OA 1AO7E 3BSZH 4M1DL 2BVUA 4NDMA 1ZGLA 1WT5C 3KYKH 3LQAL 5D1QA 3VG0L 1PJ9A 4GFTB 2OTWA 2NY2B 1DANT 3EOBA 2H1PH 1T0PB 1A7QH 3CFBA 3GSVA 2APBA 4EQ3A 3TN0D 1UKTA 1TJHL 1LDPL 4U6HB 3JBG7 1WSST 4Z78B 1JGVH 5D93B 4LLUB 2J88H 3E6FB 3MACL 3VD7A 5I1IH 1DLHA 2EYTB 2YK1H 2D4DA 5FAAA 5DQJA 2AJSH 4QKXB 3UJIL 4Z8FH 3WE6A 1TCMA 4KJWC 4YFDB 2UWEB 5FF6B 3GI8H 5D2LB 2A6DA 3FQNA 2HFTA 1DVFA 3SPVB 1P53A 2OXGA 4WO4A 3QA3B 1QFOA 2NXZD 1BFVL 2GTZA 4XPHH 1Q38A 2C1OB 1T1YB 3I2CH 2HH0L 3LKRB 2FZ3A 1U58B 2APXA 4XTRC 3BIKA 3HPLB 1KN4L 5DD6B 3FO2B 1IC7H 2PR4L 1IVLA 1XGYL 2YC1A 1MPAL 3CSBA 1RUML 2HJFB 4FQJL 5D4QA 3X13B 4F7CB 1PG7H 1V3LA 3OJMB 1XGRB 4PJBF 4XVJL 1R0AL 2GJZB 2Y25A 2WANA 3SE3C 1CLCA 3MNVA 1H5BC 3DUUB 1N6QH 1C12A 2P47B 2NY5L 4R7DA 3V6BR 4KKAD 5IJVA 4OJFL 1UQSA 7FABL 1IGJA 1RIUL 3MODH 1I9IL 1UWGH 2AV7B 1NGYB 5F89A 4XVSL 2NXYC 2R9HC 4DOHB 1IFHL 1P9MA 4M7ZC 2F58L 2R8SL 1P7QA 1FDLL 4NQDA 5INDA 4YXHH 1JYNA 4JAMA 4ODUA 4TOYL 4HH9A 3OKYA 3MNWB 4O2CA 2MNUA 3OMZA 1GZQB 2R1XA 4OCWL 3EBAA 4FZEH 1R3JA 2NYYD 4MXQC 1OCWH 3C2SA 5IM7B 2XRAL 2XKSA 4PJGB 2X4PA 4P2QB 3SDAC 3RZCD 3S5LA 1WIPA 2W0FA 4P5MA 5C9JB 3HA0A 1D5IH 1P7QD 3L7FA 5KSUA 4NQDD 2IBBA 2I9LB 3OKLB 4OF7A 4OLWL 1OT1A 3FT2B 2CKBL 4S11A 4AEIL 1U3ZA 4G5ZL 3QSKB 2BVYA 3T0EC 5ETUB 2HMIC 5FM8A 4RGND 5ITBL 3V4UH 3IU4L 1CICD 5C0AB 3BGMA 1P6FA 4I18C 4P2QE 4PJGE 2DOCA 3VD5A 1H9VA 1S7TA 1HINL 4FQCL 4OT1H 1O5DT 1K3IA 4GMSL 1I8MB 1OPGL 5E0QA 1R5VB 4HIEB 3TFKC 5IMKB 1WWCA 3L5IA 3GSOB 5HHPB 4ETQB 4XPBH 3UX9B 3IDGA 3H9SD 2GIYA 1MI5E 1JGLL 2ZUUA 3FN0L 5D5MF 4YUEL 4PB9H 5DUBA 1CDUA 4KZDL 4K3EL 3Q6GL 3O6ML 2Q1EA 1R3KB 1DDHA 1KPUA 4MB4A 3ROOA 1SMAA 3GMLB 1IAKA 2GW5A 3VGFA 5IEHB 3THML 4B41A 2CK0H 3FOLA 3T2PA 3UTTB 4PRPB 4AMKH 4LPXA 4MJ5B 5ESVB 3EAKA 4PD4K 2ITCB 2AEPH 3ALPA 1KSRA 5BZDB 3VXPB 5ADPH 2FLRT 4Y0GA 5E6YA 2EC9T 5TF1H 3DROA 3TP4A 4TSAL 4BELD 5DMGD 1B0RA 1RIHH 3OZ9L 3NAAH 2BHYA 4MYWB 4HS8H 5I9QB 1T1ZA 3ULUC 2HVKB 3T0DA 5EULV 2B1HL 3IDNA 3D85B 3F7VA 5HPMA 5ICYA 4PRPE 5C0RL 4QHKI 2AJYH 3WLWD 1OTUD 2C1PA 4DGVH 4WW2C 5D72H 4NN7C 4MNQB 1MFBH 1PSKH 3BQUD 4NNXB 2NY7H 2XACC 1H3PH 5BW7C 1JGDB 1ZHNB 5DJDA 4JPWL 3HMWL 4M6NL 5F7WC 3KLDA 4FABH 1IC5L 4IJ3C 4ALAH 4ODWA 3FQWB 2MPAH 4E9LA 1OSZA 3FFCB 4MLIA 5DJZB 1UB5B 3FHQA 4OUOA 3QDJE 2QSCH 4Q6IA 3UDWC 4Z7WA 3MCKA 4LCWB 1CE6B 2E9IA 2M2DA 3QIWB 1YECH 2QR0B 4JG1H 5C8JB 1OAQL 5E1AB 1LO0H 1RJZA 2MOVA 4MNQE 4NWTL 2XTJD 4FFVD 5DJCB 3C6SB 4MNGA 3EYVB 4KV5F 4LRIA 4WW2F 2BC4B 1A9BB 2P46B 3VXMA 4LLAA 3LZFH 3IU3A 1HKFA 5L9DL 3QO0B 4HJGB 4Y5YA 1A5FL 2GSGB 2VL5B 3FFCE 3D39B 1WGOA 5CMAA 1GCFA 4BH7A 1E6JL 2Y36H 4LK4A 1CL7H 4Z7UA 1NAKH 4FTVA 4QCIA 3UBXA 4YXLL 3QZWG 4NQCB 2OZ4A 1X5XA 2W0LA 3OJ2C 5FUZH 1QPXA 2DJ4A 4WRLA 3GNMH 5IG7A 3KVQA 4G9FA 2V2WB 3HI1B 2KL6A 3VXMD 2Z31B 4NBXB 1Y18A 4OD1H 2R0LH 4PJXF 1N3NA 4RZCB 1RZGA 2Z8RA 3ZDYE 2CKNA 3MRCA 4MJ6B 4PGDB 2DMCA 3O2VH 4GS7B 3SDYL 3P0YH 4IOFD 1YEJL 4GQ9L 1J8HD 4FTVD 5FDWA 2WAHA 3OKDA 2R2CA 4HGMA 4ZPTA 5ALBL 5C09B 4U1HA 4RGMB 2NQCA 1U8MA 4U1LB 5GRZA 3A67L 5LAXB 3B2VL 1T4KA 1KUMA 3DX8A 4WI8A 1YN6A 2FX7H 5IBTL 2P45B 4WEMB 3STZA 2AK4D 5DVMA 3FO1A 5ITFA 1WBXB 2RJMA 3OV6A 4G6JH 4Y2DC 3VFVA 1XAUA 2P8LB 5IVZB 4PLJC 4IOIB 5D1ZB 2OI9C 3SDDA 4X7CC 1KF9B 3S88H 3ZLQC 3VA6A 3T3ME 4NRZA 2P24A 4LVOB 4K3HA 3CZFA 5MHSD 5KS9A 3V5DA 5TPWH 1SEQH 5I30H 4H20H 5IW3A 3DV6A 1ZT4A 1SBSH 3ILPB 2C3GA 2J8HA 2YD8A 3QFJB 4AIOA 3W5NA 5J6HB 3VXSB 1TQCB 2EH8L 4OQTL 1ZK9A 1R5IA 3LN4A 3H42L 3JTTA 3PNWB 1Q8MA 4LNVA 4TTDC 5IJKC 4P3CL 2HG5A 5JQHC 2CUMA 2EDYA 4LLQA 2VXSH 5JW4M 4KJPC 2D9QB 1MWAA 5FKAA 3HCVA 1FL5B 2HYMA 5TE6L 5KSVB 1EBPA 4PY8J 5FHBH 2ED9A 3QCTH 5EBWA 4PP2B 1U2HA 3QFJE 4P5TC 1NH6A 2XWTA 4NM4L 1AXSA 3K4DA 4PRDB 4PJ7A 4L1DA 3X3GL 4F7MA 3VFTA 4F15B 1CK0L 5D2NA 2C4FT 4BK4A 5FCUH 4PJCA 3UTSB 5FO8A 1KCSH 1LEIB 3QWQB 1B6UA 2RHEA 3HG1B 5C3LD 1FZMB 2EDKA 4AY0A 4U1MA 2X4RA 2BSRB 3OKMA 2EDOA 1AXTH 4FG6D 1T1WA 3HHRB 3T65A 4OZGA 4U0QB 5HGDA 3NACH 3MLXL 4FFZH 4NCC1 4M62H 2YA2A 1UZ8B 1E4XH 1RUQH 3QB7C 5EOTA 3SCMA 1JWUB 2MJWA 2XICA 1S7WB 4ACPA 43CAB 5LWYH 2DKUA 4CVWA 5DJXB 5GRWA 1A4JA 1E4KA 1I7UA 3V6FB 1ACZA 2VDMH 4JY4A 3HG1E 4RFEA 4N0CC 5FGRA 4ODHL 3BWUC 3LSOA 1I1AC 2JCCF 1BAFL 1XGUA 3HE6C 5AZ2L 3S36X 1W0WA 5F9AC 5C6TH 1MRFL 4IBLT 4XBGB 3QUKB 1JBJA 1UM6H 1Z0NA 3ARPA 5M95B 3SCMD 1I1RA 2R56H 2NW3A 3VXOB 5B8CA 4QRRA 3DVGB 3UCRA 4C54A 1OQXA 2VDOH 4HIHA 4DAGH 1I9RL 5JO5B 1IAII 1UWEH 2HJKB 3DRQA 2WUBH 5MEPA 1N0XL 3QXTA 1IGYA 4YHMH 3DURB 3EUUA 2F8VA 3A6BL 4PLOB 4MS8C 5C07B 1A7PH 1IKNA 4E0RB 1JGUH 5FOBA 4H5SA 3CC5B 5E8NB 4ZSOA 3MR9A 4MDIB 2NY1D 2G2RB 3UTZB 1NCCL 4PJDE 3KPOB 3I6KA 5HJ3B 3RWFB 1CLZL 4P49A 4TVSa 2GT9A 2V2XA 2F5AH 3SDXB 2FIKB 3PHQA 4OFYA 4UOW1 4QRTA 4OD2B 5HI4D 5DD0L 3QEHA 3TV3L 4WFFE 4ZOEA 1HEZA 3ARDA 1F6AB 1TIUA 5C07E 4ZTOH 3NTCL 4BH8B 1GGUA 3RVWD 3TJHC 3ARFA 1OGTB 2EDBA 5E7BA 1L6ZA 3P2TA 5CP7A 5L2KD 5I75C 2B4CH 4HUVB 3QIUA 1DUYB 4MWFB 1FLRH 5HDOA 2VO5A 3MUGA 3C8KB 3SDXE 4YZFF 4JFFB 1P84J 1UACL 3GMOA 4L4JA 1HCVA 4ODXB 3ME0A 5F3BA 3KS0H 1KC5H 1F4YH 2OZ4H 4LLYA 4XNQA 1U8LA 4ZXBC 2L7JA 4YDJA 4K7PY 2NNAA 1DBBH 3QYCA 1Q0YL 3QDAA 1CFQA 5E03A 4HT1L 3EJZC 2JIXA 1EXUA 2EH7H 3QCVL 2J4WL 5GS1C 2AGJH 4GRWH 1U8QB 3QI9B 4L4TA 3IVKA 5B21A 4JFFE 3OKNA 4MB5A 1EH9A 5EZOL 2ESVE 4CVXB 2FJFA 3TF7C 1DN0B 2PCPA 4PV8B 1KTDB 1FO0B 4UI2A 3Q5YA 5JOPE 5EBLB 3IDJB 2QQLL 4Y8AA 1LEKA 4N0UE 1OW0C 1RULH 4UB0H 2XN9A 1XF5B 3GKWH 4L4TD 3IDUA 4G9DA 4MCZB 5J8OA 2BJMH 4NQSB 4EZMA 3T0BA 1S78C 4NKIL 4ZFOB 3TIDA 5JIIA 4HW6A 4AT6B 1X5KA 4Z7OF 4PRNB 4URTB 3EJYD 4J4PA 5C71A 1DFBH 5GJSH 3L5HA 3T8XB 3EZJB 2DWEB 1MHCA 1CN4A 2CDFB 2V7HA 4O58H 2GITA 3WXVH 4YFEA 3ZKXB 4QF1B 1ZT7A 2QSTA 4FXKB 2QSQA 3MYJB 1HQ4B 4U0RC 1G9ML 1OD9A 4M7KL 3S36H 1VACA 3V52L 4OFIA 3SGKC 3O2DA 4M5ZH 4J4PD 4XWGH 1OB1A 1CE1L 1FGNH 1MFAL 1I85A 5CP3A 3U4EA 1DSFH 4BA8A 1MJJB 1NJ9B 3TH4T 5CZXC 4KROC 5EZLA 1HHHB 1HHJA 2E7MA 3QULA 5DYOB 1I7TB 1MWAH 4BSJA 3ZT7A 3QJFA 5KVDL 4LOUD 3O3AB 3ZL4H 3DMMA 3UYRL 4OAWB 3P9WB 2YR3A 5EOCH 4ZUTA 2N1KA 2WBWB 3P9LB 4DN3H 3GIZL 3ZE2E 2HWZL 3ULVH 2HKHH 1A6TA 1MY7A 1A02N 1QFUL 2KDGA 4OLEA 3PP4L 3MRHA 2N7AA 2NY6D 1XCTA 2ED7A 2XPGB 4XMPH 1R3IH 3DMMD 4LPYA 2AJZB 2EDJA 4F80A 2CLVB 3VA2C 2AEQL 2ZCKL 2IAMB 3GHBL 4K8RD 2VDNH 1A1NA 3X17A 4YWGH 3LH2L 4OCMC 1XIWA 5I8EB 3BKCL 5DI8A 4NUGL 1BVLB 3VDBA 4U6XB 4PJEA 2YD9A 4APQC 2I9TA 1Z5LA 4GG8B 2N4IA 2EKSA 2UUDH 2R2EA 4QO1A 1UCTA 3BOVA 1SYSB 4JDTL 3SOBH 4NN6C 3VJ6A 1S7SA 3DI2B 4PJFF 3QEGL 1ZS8A 3BVNB 5IIEA 4U3XA 4PLNC 4PJAF 4QXTA 2VUOA 4JRYE 4X6FB 5A1AA 1MF2H 2J6EA 4ZUUB 3X11B 3D9AL 1MFDL 3RGVC 4XVTL 4XMLL 1UXWB 4P57A 1XF3B 4X6CA 5I1JL 2F53A 3B9VA 1OP5K 4OBRA 4G42A 4MD0B 4OGXH 5F9OL 1A22B 3D2UA 4KU1A 4JZJC 1KNOB 3WUWB 4PRHE 3WIHA 4HXBL 1CGSL 4XH2A 4PJIF 3WFEH 3C9NB 4ZTPH 1FZOB 4EOWH 5CD5C 5F1KC 3TA3B 1UM5L 4PJHE 4P2OA 4GXVH 4HJ0D 5E8EB 4OCRL 1EAPB 4LF3A 1A1OA 4Z95L 3L3OB 1OF2B 1T2XA 5ESQB 2F53D 3L3GB 3OB0K 2VERN 1T0MB 3QRGL 4PG9A 5C92A 1WCBA 5IVXE 5F7KC 1AHWA 1DQDL 3SKNA 4BZYA 1RURL 3MXWH 2ZOKA 4OUUB 5CEZD 1FN4A 4XP9L 4P2OD 4OM1L 5MENB 1M71B 4PJ5B 2AJVH 4RDQG 1FG9C 3BW9B 4DEPC 4QRUB 4NP4H 4M6AA 4M43L 1ZSDA 5JW4R 1JUFA 1DE4B 1ND0A 2C3WA 2PTTB 4KQ3L 1IM9A 5FO9A 1UJ3A 2EE6A 3BP5A 5EBMA 2OTUA 3BPLB 1OAZH 4XPFL 1FE8H 1MIMH 5H94B 1F4XL 3HE7D 3N1FC 3DJ9A 2DQFB 2YSSA 3KPQB 1FORH 2FIRT 2PYEA 1VKXB 1G7IA 4NFDA 1MREL 1A0QH 5C0BB 2DWDB 5J13B 3T09A 4PJ5E 1N5AB 5K33A 1K5NB 1PQZB 3MGTB 1JIBA 5I6XC 1XGQB 1UWXK 1FVDA 1IM9D 2IPUG 4KRMB 4U1JA 2QHRL 1A7OH 2ARJB 3CFKB 4IIQA 1U8OB 1NUNB 1T20B 1ZWIB 3KPSA 3HZMA 4EEEA 3HFML 2VLRA 5EC1B 2FD6H 4YXKL 5DHYA 2RAMA 3T08A 3MUZ1 2V7NB 2NTFA 1SY6A 2VQ1A 4QTHB 5C0BE 1PLGL 3G6DH 2H3NB 1A14L 5JZ7C 1GYAA 3PWJA 3KHOA 4QRQA 4Y5XC 3BKML 2K7PA 4KK6D 5ABDE 4LVNB 3PXJA 5SWSB 2MMXA 4WFGE 4MNHB 1JHKH 1EHLH 1CGYA 2VLRD 3GSUB 1V05A 2BNUA 5TE4H 3U7AA 3EHBD 1BGXH 4OIAA 4OFVA 5FA4B 3PIQB 3OKEB 1VFOA 3QUXB 1WAAE 1I1YB 1RZKH 4QHUB 2EEDA 1S7QB 4ZPVA 3MLUL 1JF1A 2DYPB 1FVEA 5JLZA 4MQXD 3IKCB 5SWSE 3O2DH 4JDVA 2ADJB 3EOTL 2FEDD 4EI5A 5T1LB 4JHAH 1T3FA 4O9HH 4R96B 5CP3H 2Z35B 2ERJC 2EICA 3GO1L 5L8LB 2DDQH 3MV9A 2H2SD 1RMFL 2AJXL 1ONQA 5HGHB 3L3DB 2P43B 4PREB 3DVNA 3SJVB 3WDHA 4Q2ZA 1IKFH 2RFXB 4K8RH 1MH5A 4EI5D 5IGXH 2M1KA 2P7TA 3ES6B 1BOYA 1JNNH 1MJ7L 2H8PB 5DJ2B 4OFDA 2IFFH 5GRJH 1I3RB 4U3HA 1IGCL 3WFBL 4GAJL 1AH1A 4X7SH 4P2RA 4Y4KA 3LEXB 5F7FA 3IAPA 3MV9D 5FYJU 4NO3B 1N8ZA 3QR2A 3WBDA 4P5KA 3MLTB 4FQLL 3BAEL 2UZYB 4Q7DA 3EOAA 3OR6B 5DEGB 5CJOL 5EIIA 3W39B 1R3HA 2BSSA 2CIIA 4X5XB 1NEUA 1A7NL 4WCYH 4PJ8A 1WCQA 4HD9A 2HN7B 3LQAC 3LHPL 3QWRA 2P8MB 3RIAF 3IFOA 4P2RD 1D5XB 1T2JA 5T1MB 2FO1A 2V9TA 1OTSD 2ZSVB 1CLOL 4F3FA 1DN2A 3QNXB 4U31A 3U7YH 4AG4L 3I3EA 2QADB 1FL6B 2DN7A 3U0WL 1N26A 2G60L 4ZAKD 5IB2A 4YBLC 2AV1B 3GJFA 4R4ND 4NO2B 1S9YB 5D7JA 3H3BC 3BZ4B 2J6EH 1SM3H 5KSBB 4WTZA 4HUKB 2EXYC 1AGFB 5CJ8A 3BXNB 3H7BA 4JFEB 5F7LB 3ARBA 1S9XA 4RFNB 3STLA 1LO4H 1WC7A 2HJLB 4QY8A 1BFSA 3FB7B 2R4RH 2FO4A 4IMLA 4KQ4L 2HTLD 3BN9D 4XNYH 1FFOA 5C2BH 1CGTA 1KCRL 3WLBB 2Z91B 4UOW0 5D7JD 5IW6A 3NCBB 4H8WH 1BD2B 4M4PA 3I6LD 1C5BL 5CEZH 5A43C 1FBIL 2J8OA 5H37H 4JDZB 1JK8A 3RL2A 2EIDA 4NZRL 1BJ8A 4C4KT 3ARBD 5HY9A 1U3HD 4JFEE 2ICCA 4OZIB 4PJ9C 3E8UH 2BY2A 3O8XB 2WQRA 1HDMA 5DZNA 2NY5C 5D8JH 2CD0A 2Y23A 3TLRA 4NUJB 1CBVL 1Q1JH 5I66A 3WYRA 2DJUA 4EBQH 1D5BA 1K3ZA 5EORL 5ESAA 5ANME 1YNTA 1BD2E 3TPUA 4ZFGH 5AG8A 1AI1H 1QP1A 3S4SA 3ZDXF 4LHQB 4YNYB 1GIGL 4TUKH 4XBPB 5DD1L 3MJ9A 4RNRB 4Y5VB 2O5XH 4NO5B 2D7TH 3V5KB 4QYOA 3RTQA 4EN3C 4NQVB 1WICA 4OZIE 2DQDL 3LEYL 3CDCA 1CD9B 1FYTA 2E27H 5E08L 2AI0H 4EIZC 3WFDL 4ZNEA 15C8L 3L5JA 2FBOJ 1FZKA 1F3RB 2BY0A 1BFOB 5MEOB 3C5JA 1Z3GL 1HZHL 4XHQA 1KB5A 3VW3H 4KRNA 5I1LA 3TT3L 2APFA 4AJ0A 1S7VA 2EIEA 2YD2A 2GUOA 4K3GA 3U46A 1JN6A 4CVZA 4OSUL 2VXVL 5D7KD 4W6WB 4WGVB 3MRIB 3T4AB 1ZA6B 4XBEL 5TF0A 1DL7L 3BZDA 4QNPF 1K9TA 3GIVB 3SDCA 5HGAB 4Z0XB 3FT3B 1QA9A 1M7DB 4JJ5A 5C86A 4X6DA 1YJDH 1Q9KB 1T66C 1YNKL 3BKJH 2J8UA 5E2JA 2CDEA 3G6JF 2BMKB 2Q7NA 2YKLH 3VFOA 4YO0B 3C2AL 1ZHLA 4I0PC 4J3XA 4N1CA 3MRGB 5CSGA 3P0VH 1JPTH 3OGCA 5DQ9A 1XF2B 1NAML 3KR3H 3QXDA 3FJTA 4XAWH 2FBJL 3I85A 3TJEH 3SDCD 1KENH 2CJUL 1FL3A 3X12B 1F45A 4GW4A 2ENSA 4GRLC 4IRZH 1ZVSB 1BQUA 3DRTB 5I18L 1ZANH 1RUPL 2O61B 2CIKA 5CKGA 4IRJB 1Q9WB 1NGPH 4P4KC 1X5ZA 3MA7A 1VDGA 4AIZB 4LKCB 2NY0D 4I3SH 4UIMA 5BCAA 5GS0D 4WI9A 4G3YH 3KXFB 3TYFB 1YEFH 4QGTA 1FNLA 1ED3A 4GUPA 3OHXA 2DJSA 5DD5L 1X5FA 4M1GH 1AC6A 1MHEA 3DETD 1H0DA 5F44A 4Y16C 3O9WB 5T3ZD 1MJ8L 4NO0D 1YMMA 2A6IB 2YN5A 5D9SB 3SGJC 1NFDB 4G6AD 1B2WL 3MBXL 3TVMD 4HWBL 5JW5B 2GK2A 1SHMA 4XCNA 1CU4H 2H32A 2WIIB 3U83A 4X9HA 4HPYL 4G8FA 4R3SB 1CXEA 1ES0B 2ADGB 4UUJB 5IQ7L 4Z0BL 3B6SB 1XF4B 4P3DB 5IT2L 3TN0B 1SVCP 1YMMD 4K7FA 2DLIA 1DQTA 2XZQH 4RISL 2OQJA 4R4BA 1NKOA 3C5ZC 3L3HA 3LIZH 4Y19A 4N9OB 3U30B 5IB1A 5EU7C 4OF0A 4CW1A 2OTWB 3GK8L 4KTEL 3GSVB 5HVWA 3VWKD 4NHUA 3REVA 4JHWH 1TLKA 1HXYA 3P73B 2DQGL 1BIHA 4MZ2A 1ERNA 1DLHB 1JWSB 4Y19D 5F7NC 1NL0L 2IQ9H 5DQJB 3HLAA 3BPOC 1IQWH 3WE6B 4Z7VE 4HX1A 3GJFH 3E3QC 2A6DB 2CDGA 3FQNB 3CLEH 3RQ3A 4WO4B 3CCHA 4M8QA 5GISH 5CZVL 3OG6B 2FX9H 4Y4FD 4GKOA 1JFQL 1VB9A 2GTZB 1REIA 3G5VA 2FZ3B 3PL6C 4HUWA 3B5TA 5JQ6L 5EB9A 4YDKH 4OLZH 3BIKB 4MD4B 1JF6A 4NYLA 3MX0A 2YC1B 4PIRF 2VSDA 2VC2H 3TIEA 1BZ7A 3KS0J 3LMJL 4ONHA 1UYWH 4U6VL 4OM0H 1FFPB 5DDHA 1LNUA 3MXVH 1WTGT 5HHOD 3MNVB 5SX4H 2CRZA 2FJGA 4ONOA 2GTWA 4HC1H 4PGEA 1C12B 2OL3H 4R7DB 1EFXA 5IJVB 1UQSB 1IGJB 2Y7QA 1NC4D 5F89B 2W60A 1P7QB 4NQDB 5INDB 4JAMB 4ODUB 2V9QA 4HH9B 4G6KH 2Q3AA 1BEYL 4O2CB 1OM3H 3ALWA 1MCHA 2R1XB 3MJ9H 1R3JB 3W9EB 2OR9L 1KEML 1S9VA 1CIUA 5HDBF 3O0RL 1OP9A 1CICB 4K23H 5E6IC 4JRXA 5F96L 2X4PB 3RUGF 3S5LB 3NFPA 4JPVH 3CPLA 2W0FB 4KK8D 4MXVF 4P5MB 3TGXA 1QPPA 1A3RH 1ZMYA 3L7FB 4NQDE 2A6JA 3UXFA 4MSWA 4PTTA 1N5YH 1KB5H 4LDOB 4LRNL 1CR9L 4OF5A 2QQNL 4ODSL 4B0MM 4RGNE 5DMKA 3H9SB 4UDTB 1W72A 2HFEA 4WJ5A 4JRXD 1T6WA 5DFVC 4IDJL 3BGMB 4PB0H 3NA4A 4F58H 1S7TB 5SWZD 2R1YA 2ZUQC 1Z9MA 3TWCH 4PYGA 3QXWA 3N0PB 2GJ6D 5C7XL 2Q20A 3VGGA 3FHAA 3ZYIA 4CJ1A 3JV4A 1A7QL 2HT2D 2NY2C 7CGTA 5IB3A 3CFIC 1KXQE 1AQKH 3H9SE 4O51B 4PY8I 5BV7H 4M5YH 1QQDA 2J88L 3S5LG 3IJSA 1L7TH 1TNMA 5GS0H 5D93C 5DUBB 3M17A 3WDIA 3RVTC 2AJSL 3TO4D 3ZSTA 1LMKA 1KB9K 4RIRA 1NBZB 5EOCJ 3RX8A 5D7LA 4MXWH 5HYFA 3EO1A 1HH9A 1DDHB 1KPUB 3ROOB 2KKQA 2FNBA 3BH9A 1IAKB 3F65A 4N8CH 5D1XC 5ICXA 4GLRI 5T3ZH 4POZC 3V6OA 5HVHB 4RQQA 2R29L 3I2CL 3RA7H 4F57L 5KSAA 4KKBC 4HUUA 4JFDA 1INEH 4L4VE 5F88A 1CCZA 3WSQL 2EDWA 4OLUH 4U3CA 2DIBA 4W81A 4BZ2H 1G9NH 3BQUB 3RNKA 4KDWA 2Y9RT 5EZJB 4NFCA 1WT5A 4NZTH 2R39A 1B0RB 3HN3A 1U3YA 5TDOA 1T1ZB 5IB4A 4AEFA 5KSAD 1RZFH 3TZVD 3IS1X 1KCKA 3F7VB 3IDNB 5KAQG 2UWEF 1F2XK 3QFDA 5D2LF 3MODL 2C1PB 4OIIH 5IK3A 2MCG1 5JXEC 2H32H 1EDQA 1NANI 1QZ1A 4TRPH 4Y7MA 2YBRA 2W9LA 2P42B 4WIQA 4JQXC 4PJBA 5AUMA 3OQ3B 1GSMA 5DJDB 1OP3H 1YEIH 1UH3A 4U49A 4HEPG 5I1DB 4ODWB 4FZEL 3BE1H 5GGVY 1YEHH 1OSZB 1OCWL 2OJZH 2DKMA 5TE7H 4GXUM 4Q6IB 1UC6A 2AXGA 4Z7WB 3MCKB 2C5DC 2JTDA 2Z8VC 4U1KA 4WUKH 3NGBB 1M05B 1RJZB 4EI6A 3KNBA 1K8DB 4U7SA 4EDWH 4Z77A 4MNGB 2XTJE 2ZUSA 3L5XL 4KJQC 1K8IA 3VXMB 3IU3B 4KJWD 5FYLD 1FNHA 4Y5YB 4DKAA 3BIBX 1D9KC 1MHPL 5CMAB 1NBYA 1NCUA 3SE3A 4BH7B 1VSCA 3AY4C 3U9UB 5HD8C 1H5BA 1WIOA 4Z7UB 4FTVB 3UBXB 1F4HA 5DFTA 3PGDA 4UNTA 4XTRD 5IG7B 4ZOBA 1FAKT 2V5TA 4G9FB 3HI6L 4G8GA 4PJGF 4A6YH 2YUVA 1Y18B 4KUCF 3FT4A 3VXME 1AJ7H 4GRWB 5F7YC 1EEUA 1N3NB 1RZGB 1YC8A 4KK9C 3MRCB 4RRPA 4JKKA 5HYQA 4HIXH 4XCEA 5FDWB 1Y6NR 2P5EA 4KC3B 4NRYA 1J8HE 3MFFA 4ZPTB 4Q6YA 1BBDH 1D3CA 3RWJA 2LQRA 1W8OA 1U8MB 4NKOA 5IW1A 5D70H 3SDAA 4XPTL 1YN6B 1TZGH 2B8OT 2NXYD 2R9HD 3STZB 2PXYC 3UTQA 1U41A 1MAKA 2JF1A 1YQVL 4LCIH 2AK4E 3FQTB 3FO1B 5ITFB 4H88H 3FB5A 4OLXL 3SGDI 2QHLA 1OD7A 3TBTA 5KZCB 3VFVB 3I02A 2P5ED 5B38B 5C70A 3T0EA 5D7SH 1V3KA 5E56A 5ADPL 4NFBA 1GGIH 3SDDB 5CAYB 4GW5B 3N06B 5I1KH 4I18A 4NRZB 2PF6A 2P24B 3O4LA 5E00A 1RIHL 4LLMA 5DMIH 5K59E 3CZFB 4HS8L 1BQHA 3ARGC 4HUXA 5KS9B 3V5DB 2ZOLA 2WLYA 3DV6B 5I8CA 1MFEH 1ZT4B 1G9MC 2B5IB 4RAUB 5C0GA 2DQHL 2AJYL 2HMID 4IRSC 4YH6A 4HMCA 5D72L 1U8PA 3ARUA 1MFBL 1QSFD 1R5IB 2NY7L 3UYPA 2EEBA 4M4RA 4AEEA 5C0NC 1YEDA 4FABL 1LO5A 3MRQA 4ALAL 1DBKH 1DBMH 3IDXL 5KVFH 2HG5B 4LLQB 4V1DA 1MAMH 1MWAB 4QGYA 3HCVB 1KJ2L 2VISA 4FNLH 5IEKA 1RZ7L 4PYHA 3U1SH 2QSCL 1AD0A 2YPVL 1LE9A 43C9B 5EBWB 2R1WA 3QIBD 1F42A 4KZEL 2XWTB 5ID1A 2PYFA 3QIWC 1MCBA 5J1TC 1AXSB 3TH2T 4PJ7B 3RDTD 4F7MB 1LVEA 4S1QL 3DTXA 2W9EH 5GGQL 1JP5A 2IG2H 4KHXH 4V1DD 5D2NB 4FZ8H 4PJCB 5DJ8B 5FO8B 4KJYB 4K3DH 4OZFA 5J12B 4O02H 2V17H 4HZLA 4JO4H 2Y36L 4EUPH 1CL7L 4LSQH 5LG1A 2VITA 1XR9A 5JHDD 4PLKD 2X4RB 3OKMB 1PEWA 1T1WB 5BXFA 3T65B 4OZGB 5HGDB 5FUZL 3S6CA 4L3EA 4XVUC 4DKEH 2ZNWA 4KUZH 4OCNC 3JV6A 1WBZA 3LB6C 1LHZA 4WW2A 4OD1L 3W2DL 3SCMB 4OGYL 1OAUL 3K1DA 3NFNA 5D2NE 2Z31C 4WEBL 5HYJA 4PJCE 5C08D 5D5ME 3CAFA 5BW7A 1I7UB 5BS0A 2MCPH 3EZ8A 1CYGA 3IFLL 5DC9B 4JY4B 4RFEB 4FQ1H 1A7BA 3B9KD 4YR6A 3ULUD 4MB3A 5ACLA 1XGUB 1PZ5A 1BMGA 4XP4H 3ZDYF 2NY1B 1B4JH 3UDWA 4JN2A 5EA0H 3ULSA 1KV3A 5DJYA 1UVQB 2NW3B 4PJXA 5B8CB 5KN5A 3HR5A 4M7LL 4EDXA 4F8TA 2R4SH 1U42A 2FB4H 1MFCL 3DRQB 5MEPB 4G6JL 5DVOA 1DBJH 4XWOC 2B1AH 3W9DA 5E8DH 1QLFA 3SGEH 5FOBB 4H5SB 4ZSOB 3JUZA 3MR9B 3S88L 1HHKA 3D87B 3QQ9D 3G6AA 4K71B 3I6KB 2NCMA 5GSRA 5CILH 3LN5A 4DGYH 1HSBA 5FYLH 2GT9B 5ISZE 3JV5A 4BSVA 4YQXL 1SEQL 3PHQB 5I30L 4H20L 4QRTB 4BQ9A 4UMGA 1SBSL 5J6GA 2LAAA 3T3MF 1HEZB 3ARDB 5L2JB 1ADQA 3GMPB 4XC1H 1MQKL 4Z5RB 4P23C 4X98A 4CU7A 4K9EL 4OB5L 3ARFB 3BGFB 3HUJB 3W11C 2NW2A 3QDGA 3HC3H 5FUOL 4OCXH 5L2KE 1DZBA 3F5WA 2VL4A 1GAFH 3VRIA 2VXSL 5E4EC 5EFIA 4DK3A 5IHUH 3GMOB 4I2XB 5F3BB 4HKBA 3VU2A 1IBGH 4XNQB 3BI9X 1U8LB 4KV5E 4LLWA 4ELMA 4H25A 4YDJB 2NNAB 2XA8H 4Y2DA 3DNKA 2F8OA 3HUJE 2X2YA 4ZQKA 2JIXB 1EXUB 4CJ0A