4QLWA

Azurin mutant m121e with iron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALEKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Redesigning the Blue Copper Azurin into a Redox-Active Mononuclear Nonheme Iron Protein: Preparation and Study of Fe(II)-M121E Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4qlwA00
1PAZA 2ZXWB 4GP4B 4KO9A 4N8UA 3FU7B 3CVBA 1JZGA 1N68A 5PAZA 4AKQA 2GSMB 3FS9A 3DIVA 4YSUA 2P80D 1OCZB 5B3SB 2VM3A 4FAAB 1E5YA 1J5DA 1RKRA 2VSKB 4YSRA 1ZDSA 2PP9A 3WKPA 3CDZA 1BXVA 4AI7A 2VW4A 5B1KA 3AG3B 3BQVA 1JVOA 3RYMA 1IC0A 1PCSA 2YAOA 1JZFA 4BDVB 1JZHA 5B7MA 3AW5A 2FQFA 2HRGA 3WIAA 2OCCB 2PPCA 4KO5A 3UACA 1OV8A 2IDTA 1SHWA 1MG2C 2PPEA 3T9WA 3FSWA 4KOCA 3FSZA 4WKXA 2N0MA 1JVLA 4E9SA 5IY5B 3S8FB 4HHWA 2Y69B 5I26A 1AS8A 2DV6A 2EINB 1DZ0A 4BXVA 3D12B 4YSOA 1ZIAA 4F7KA 1A4CA 3NYKA 4DP0X 1KGYE 3EH3B 4JHUA 1WA0X 5TK2A 2XX0A 2YAMA 5E9NA 5I5MA 1GYCA 1B3IA 2H47C 2GI0A 4DP7X 3SQRA 3ABMB 4DP2X 3SBPA 4ZK8A 3UADA 3CZUB 2IAAC 4HALA 2H5UA 3T6VA 2IH8A 2QDWA 1WA2X 2EIJB 2UX7A 4P5RA 3FU7A 1NIEA 2FT7A 3PPSA 3S3CB 1FWXA 1WS8A 1CYWA 2XV0A 2IDSA 4A2DA 2PPDA 2AFNA 2AZUA 2PPAA 1GS7A 1N70A 1AIZA 1T5KA 2XX1A 2XV2A 3QQXA 4G7RB 1CUOA 4P5SA 3FYEB 4KO7A 4BDVA 3IE9A 2RACA 1NWPA 1JZIA 5I6OA 1ET5A 1OF0A 1ILUA 2FJSA 2HXAA 2BP8A 1J5CA 2VN3A 2GB2A 4GY4A 3V9CA 1URIA 1HAWA 3S3BB 1XB3A 3OMAB 2YQBA 4A2FA 1E30A 5D4JA 2LLNA 2IDFA 3CVCA 3NSFA 4HCFA 2XWZA 4BWWA 1BAWA 2CUAA 1PMYA 1CC3A 5AFAA 2YARA 2R7EA 3H56A 4NB7A 2I7OA 2GC7C 1KDJA 2PPFA 2MTAA 3EH4B 3FPXA 5PCYA 1NICA 4BWTA 1NZRA 2XV3A 5B1JA 1ETJA 2Q5BA 2YXVA 3FQYA 2HX7A 4QKTA 3ABGA 3G5WA 1L9PA 2JXMA 3KW7A 1CYXA 1SFHA 1SF3A 4DP1X 2YAFA 3OMIB 3NJKA 2VSMB 2IWFA 4YVNA 1AAJA 3H4HA 2Y1AA 3T6XA 7PAZA 2YAQA 2YXWA 1NINA 2UXGA 1CURA 1PLAA 4DPAX 1PLBA 1E65A 4PCYA 2PP7A 4HCGA 1EHKB 4ENZA 3IBOA 4DP4X 2QPDB 4E9VA 4Q8BA 3TASA 1M56B 3EF4A 2TSAA 2GBAA 3X2QB 1J9RA 2CJ3A 1DYZA 1J9QA 1JXDA 2VM4A 2J56A 2IDQA 4GP8B 1WAEA 3GDCA 1J9TA 1L9SA 4KOBA 2AANA 4NERA 4KO6A 1QNIA 1AG0A 1GR7A 3CG8A 3OD3A 3CVDA 3IN0A 2BZCA 1GY2A 3HEIB 1J9SA 2E86A 2EIMB 3WNIA 2JFCA 3H4FA 2UX6A 2A3TA 4JHVA 3FT0A 4AKPA 1AG6A 2H3XC 3DKHA 1BYOA 2ZOOA 1TU2A 3QJRB 4N4YB 4CSPA 5B1JC 1JERA 2DY2A 1AANA 1IBYA 3PXLA 1QLEB 4HIPA 3ASNB 3X1BA 2BWIA 1V55B 2DYRB 2QDVA 5FC9A 3TU6A 2I85A 2WO2B 4K9JA 3BVDB 2UXVA 3UGEA 4DP5X 1OCCB 2BP0A 2DYSB 3FPYA 2FQGA 2CAKA 4A2HA 6PCYA 3ABLB 3X1NA 3AY2A 4HCIA 2PP8A 2ZONA 3AZUA 4Q89A 5D4IA 3NSDA 2HRHA 2BW5A 1WA1X 1BXAA 1ZIBA 5TK4A 3OM3B 1NIBA 1AS7A 1SFDA 1OE1A 2GIMA 3GYRA 5I6NA 4AX3A 3ASOB 4E9YA 3FYIB 3S3DB 4BWUA 2VW7A 3NP3A 3AG1B 2XUWA 1PF3A 1AOZA 1IBZA 4M3HA 1AQ8A 3NSCA 4UF7C 1NIAA 2X87A 5AZUA 7PCYA 1R1CA 1ET7A 1XB8A 4AZUA 4RH4A 1M57B 2HZHA 3T6WA 1M9WA 2I7SA 3WKQA 1JZEA 2OV0A 3MX0B 4YSPA 3PLYA 4G71B 1RZQA 1KCBA 2B08A 4YVUA 3NJFA 3AG2B 4E9XA 1AZNA 2QPEB 5F7BA 2W8CA 3TBCA 5B7FA 1W6LA 2FWLB 1BEXA 2VMJA 2WSDA 3OQRA 4UANA 1SJMA 4E9TA 3TA4D 4E9RA 2FT6A 1NWOA 1SHXA 4BK5C 3CDZB 3DTUB 5D4HA 1IKOP 2TSBA 1EZLA 5I5IA 4X4KA 2Q9OA 1BYPA 1BXUA 3SBQA 5I6PA 4A2EA 3EH5B 4GYBA 1QHQA 4KNSA 1SDDB 4YL4A 1OOWA 1E67A 1NTDA 1L9TA 1PZAA 1HFUA 3NP4A 2IWEA 5A7EA 3X1EA 1KDIA 3SBRA 2P80A 9PCYA 1PZBA 5B1AB 3NJIA 1WS7A 3WNJA 4TXVB 1X9UA 3FQ1A 3NJLA 4KNTA 5AKRA 2IH9A 1UATA 5LDUA 1NDTA 4W1TA 2XLLA 3TBBA 2NRDA 1OCRB 2J55A 2XXGA 1GS6X 3V9EA 3X1FA 1OCOB 1BQKA 4A2GA 1MZYA 3NJHA 1JOIA 1NPNA 1A4BA 1PLCA 2CALA 6PAZA 4M4RB 4DP9X 2XYBA 2GC4C 2PCFA 4A67A 3NJGA 1YLBB 3EHBB 4HHGA 3PAUA 1HAUA 4YSCA 1A65A 2B3IA 4A66A 3IEAA 4MFHA 1ID2A 4NAJA 3UAEA 2J5WA 3ABKB 1IUZA 4DPBX 4AKOA 2AZAA 1KV7A 1NIFA 1PY0A 2ZWNA 1KBVA 3PAZA 5EHFA 1ZDQA 4G70B 1TKWA 3FU8A 2BHFA 3C75A 1ZPUA 2HX9A 4DP8X 1ET8A 1ASQA 1SDDA 1W6WA 2BO0A 4HAKA 3ZIYA 1PNDA 2FQEA 4G7QB 2BP8B 3KW8A 4F2EA 1OE3A 1TEFA 1BQ5A 2CBPA 2VW6A 1ASPA 4JKNA 4CSZA 4E9WA 3AG4B 4YSSA 1MZZA 1E5ZA 2EIKB 3QJVB 3NSYA 1GY1A 1SF5A 3JT2A 1AR1B 3IN2A 1VLXA 1KBWA 3N55A 1NIDA 1A3ZA 1ILSA 2EILB 3X1GA 3QJTB 2R7EB 4WTQA 5B1BB 1I53A 1X9RA 1AACA 2AVFA 1V54B 3JTBA 2FQDA 1AZBA 1XB6A 1BQRA 1MG3C 3U25A 1AS6A 4YSAA 1L9QA 4W9ZA 2XU9A 3FU9A 2YAHA 1SNRA 1KYAA 2BW4A 1RZPA 3PCYA 3NT0A 1GW0A 2UXTA 4BXSV 3NJJA 3MBWB 1A4AA 4EF3A 2BZ7A 2JKWA 4GP5B 1KCWA 3QJSB 1AZCA 3S8GB 1JXGA 1AZUA 4YSDA 5ANHA 5I6KA 2UXFA 1MDAA 4PAZA 1TEGA 3T6ZA 1JXFA 1JZJA 1ADWA 3ERXA 2QT6A 2CCWA 4KNUA 5I6LA 5I28A 4FA7B 1F56A 1ASOA 3HB3B 1OE2A 2DWSA 1GSKA 3QJUB 2J57A 3UAAA 4YSEA 3ZX1A 2IWKA 3T71A 4QLWA 1PNCA 2XVBA 1AZRA 4G72B 3UABA 1GS8A 2W88A 1PZCA 2WO3B 1NPJA 2HLEB 2FTAA 4DP6X 1XMEB 4GXFA 2PLTA 3FSAA 3PAVA 4G7SB 1L9RA 4YSQA 5I5JA 2FT8A 3NJMA 4F2FA 1W8EA 4A68A 4UAHA 3OMNB 1L9OA 4L0PB 2YAPA 3L45A 3ZDWA 1FA4A 3QJQB 3WI9A 2XXFA 2DWTA 3WG7B 4HZ1A 3GXUB 2PCYA 4E9QA 3NJNA 5I6MA 8PAZA 2OJ1A 2FNWA 2YAEA 4DPCX 5F7AA 2GHZA 1V10A 1FFTB 5B7EA 2IDUA 1A8ZA 2BP0B 2HX8A 2X88A 1RCYA 3N2JA 3QPKA 1ZV2A 4YSTA 2MRYA 3ZBMA 3FSVA 3FQ2A 2BWDA
chains in the Genus database with same CATH superfamily
5MEOA 4Y2LA 4N8UA 5HYJE 1B90A 2ZCHL 5EC1B 3MR9B 4QI3A 4LIQH 2C9SA 3BVVA 4PJXF 4XCCL 3BT0A 2FBJH 2VM3A 5E7FA 1HS6A 5E94A 4B9IA 4UOQA 3JTSA 1J5DA 1RKRA 2E9IA 5F7DB 1N64H 1F4XL 4R4NC 2KMWA 4OFDA 1HYRC 1EGJH 4G42A 1XF5B 1CI3M 2VH5H 5D7IA 4JQXA 3WHXA 3FJTA 3O8XB 1MREH 4NQEA 3RWEA 1J0IA 2Q2EB 4JREB 1NAML 4RMSA 2EDNA 2COQA 5JHBA 1MH5A 2ZE0A 3ARFC 3MLZL 4N90D 4KZDH 2ADIA 3T9WA 2D3JA 3IYLW 3KYKL 1L9NA 2Y69B 1C12B 2UY6B 3QJFA 3QPQD 1JL8A 3D12B 3UTZA 4R5XA 4OCSH 5IQOA 1A4CA 2ZUXA 1V3JA 4TNVF 4I85A 2PYED 1OW0C 4NKDB 3MLTA 5T1LB 1KYUA 3ZKMC 1EFQA 4KMTH 1ORSA 1B3IA 2A9DA 2NDGA 2W38A 4HQQL 1UB6A 3IPBA 3IM1A 1LVEA 3ME0A 3N1PC 4YFLF 1G6VK 3SKUD 1AFVH 2WNKA 1KTRL 3MJ9A 3RVWD 4HISA 4G6KL 4OZIE 5K39B 2PXYD 4Q0XH 1JGVH 2P5WB 3U4BL 3S3CB 1FWXA 4LEBA 2RQEA 1W80A 4FHBD 4JB9H 2X7LB 1T83A 4F91B 3F7RA 1IM3B 2HT3C 1R24B 4Z5RA 4C4KO 4QRUA 3ZDZE 4RAHA 4UYPA 3DRTA 2Y06L 5HGDB 3G5VA 2XTJB 3H9SD 2A77H 1A6ZB 1I1FB 2HTLC 2GPZA 3JWDH 4YDNA 4P2RB 1UZ8A 5DS8A 4TRPH 2BSTA 3KPLB 1ED3A 1I8AA 4JN1L 4L37B 4NUQA 1U8JB 1ILUA 2WCPA 3W9EB 5DQ9B 2D3LA 3GTVA 1BM3H 2WP3O 2BFVL 5HVGB 1AE6H 1FJ1B 5TGBA 1MAML 4KITB 3KYAA 5GGRY 3W2DL 2AEOA 1YEHH 2XWTA 3L95A 3FU5A 5D4JA 2VJXA 3CD4A 2P52A 4KXCA 3UCQA 1X5ZA 3QYCA 3IRCA 5T1JA 3KL3A 4PV9A 3OXRB 4HEPA 2D2OA 4MXQD 5D1QD 5DMJB 1U58B 5JIHA 1SXZA 4OF3A 4OFVA 4X4YB 4GUPB 3EW3B 5CD5D 5DQJB 1TSRA 3FFCD 1J1PH 1FIGL 1KTDA 1DSWA 1NICA 2OR8A 4AQEA 2WXGA 4TL5A 4UYQA 1W8NA 5D71L 1TU2B 2XKNB 4FA8A 3V4VB 4KJPC 3QI9C 2FAUA 2FR4B 3V5HA 5EUOA 2C1PB 4OKVB 3L2NA 3NJKA 4U1HB 2XG4A 2P24B 2BC4B 1AAJA 4LPCA 2J8OA 3ARWA 3H4HA 5KVDL 3T6XA 3NZ8B 1SEBA 3AWGA 5IFJB 1XCQA 3PWLA 1NGQH 2V37A 2BVPA 2E8YA 3EYFA 3QJHA 5SX4H 4JM2C 3SIKA 4ATWA 4JG1L 1BZ9A 2QKIA 3RU8H 4ENZA 1QMUA 3VXTA 1TQVA 5AKVA 3F84A 1BZOA 1TVBB 5C0GA 1X4XA 2QVIA 5G55A 2WSKA 3TPKA 4C83A 3W38A 1YEJL 1ZS8A 1QSED 3RWCA 5KZCB 3QDHA 2Y24A 3B4NA 4A7VA 4C56D 2BERA 1XCWA 1I3VA 2IDQA 5E2VL 4TVPL 1EFXA 1QAWA 3ZRCC 3CUPA 4K23H 4DZBA 2WK2A 5I1AB 1EHXA 1TXKA 3IXTA 4A55A 2DYPD 2ZCKH 2YA0A 2ESVD 4L3FA 1I7TA 2ADJA 3KYMA 1O6VA 3BSGA 4PJFB 5HHVH 3S34H 1AD9B 1FNHA 4P3CL 1O7VA 5DHEA 4CVWA 3MNZA 5KJRH 4DKTA 3IFNH 4ZBJA 4HWNA 2VL5A 1D5RA 1A4KA 5KSUB 2Z7ZA 3WN5A 5AZEL 2X2IA 2I9TB 4I3RH 1OB0A 2J72A 1XIWB 1I3GL 3ASNB 1V55B 2QDVA 2CLVB 4WI8A 4CVZB 4K9JA 1S7UA 2CR0A 4GH7B 4LARL 3V55A 3FPYA 1INEL 2CHNA 2G3NA 3EFDL 1NC4B 4RISH 1P69B 1ZJAA 2Q7AA 5FKPB 1DQDL 3P73A 4XP4L 2YHGA 3RVVC 4DVRL 5IW6A 3WU1A 3PDOB 4MX7B 3MV9A 4Z7QF 4XN9A 4KX8A 1G9MC 3RDTB 1ONQB 5D7SL 3INUL 3GF8A 2GTZA 1ZSDA 4IIZA 4P4KD 3F65A 3NIDB 3N43F 5E4OA 3SGKC 1KPVA 4QOKB 3PRZA 1P6WA 5DC0A 4PJEE 3OC5A 4BKTC 4HS8H 1UQSA 4LSSL 2GQHA 5JDSB 4MXVE 2XZCL 5CWSB 4GAJL 2VDOH 1E9PB 5JUEH 1AQ8A 2DQGH 3E0GA 4OZHE 1QSVA 2IANA 3A4EA 3CVIL 1BREA 2VMFA 3IDGA 4WGKA 5BVPL 1JD7A 3DTXA 3CPLA 4R84A 1RPKA 5DRZB 3T0EC 5F70A 3VVWA 2DM4A 2OV0A 2HN7B 4ZFZB 1MI5A 4BFKA 4YX2H 3HAEA 2CGZA 4M6OL 2H32H 2FRGP 2JKNA 3AREC 4AQOA 3CSTA 4Z78B 1U3ZA 5E5RB 4TOYL 3A21A 2DQ6A 1PKQE 2BVOB 4LMQI 3NCEB 4XH2B 5F1NB 5C0BB 1KCKA 1W6LA 3EFOA 2APXA 4Z95L 3K72A 4KNQA 4HJIA 4PJBE 2Y3NA 4HJJL 5HHOB 3FOMB 2VDLH 3F8UB 1OY3B 4O51A 4Y5YB 1QTPA 4C54A 3VFVB 2QHRL 2R23A 4FFYL 4WHTA 1FRGL 3RDJA 2XNAA 2Z7YA 3IGKA 3SDXE 3SYAA 4HU8A 1QI5A 4LLWB 3CSGA 1SVCP 4EOWL 1PCXA 5H94A 4FQJL 5I6PA 4KNSA 4TNGA 4S11A 4BZ1A 1SDDB 1HOCA 5LO7A 1E67A 4Z9KB 5HI3C 4PJ8A 3RTQB 1N59B 4X7FC 3ZN6A 1A8JH 5IQMA 1J8HB 4ABWA 5IG7B 2OBGA 2YGQA 2JLLA 3ARBA 3PGDB 3BRDA 3SBRA 3H54A 2H26A 5I0YA 3O6ML 4FYTA 3UBXB 2IV9A 4Y4FD 4HWBL 5GSVB 4N6RB 4U1SB 3ILQC 1N5AA 4LBEA 3GBMH 3ECQA 1NCUA 4JFZH 2E9WA 5D7LB 3X13B 3BD3A 1F8TL 1XGPA 1OCOB 5EN2A 3GPSA 1CCZA 1MWAH 3FN0L 4G8GD 1NPNA 5D2NE 3A6BL 4EKXA 5L2JB 3KPPB 2D3VA 4XP5H 5ENWB 4HHGA 4PW4A 4ZODA 1F5WA 4AMKL 3NRPA 4OLVL 3U7YL 4AT6B 3WXVL 3VQMA 4A66A 3IEAA 4Q6IA 4XCFH 1YEGL 4HIXH 1Z3GL 3SJVA 3KH4A 4E41A 1E6OL 1KV7A 1E7VA 3BKYH 2R29H 4PD4K 2A4CA 1I85A 2Y1ZA 1SMAA 2AC0A 2DLFH 2HLFD 1U4FA 5AVXB 1RAMA 2V7NB 2HSIA 2VDNH 2VWEE 3DPBB 1SDAB 4TTDD 4HUXA 3ZGHA 4F7CA 5KBDA 4XCNA 2VLRE 3ZR6A 3TEYA 4IKKA 1ZVNA 2VMDA 1QOKA 3RBSA 4HZLB 2YD8A 2EZ0C 3WL9B 3GSVA 4Y4KD 1A6VH 2DF3A 4BD4A 5DJ6B 4S1SL 4F2EA 2DEYX 2RMNA 3BHBB 3NCCB 4CSZA 1JN6B 1BBDH 2VAJA 3PP4L 2EH7L 4X6BB 4EDXB 1UA7A 5GZND 1GIGL 4U7MA 3O6LL 3ES6A 5IVXE 3GB7B 3GZOA 3VXSE 3OGCA 2Y36L 1Z32X 4OB5H 1PU0A 4AVHA 1I9IH 2JJTA 3GSXA 3IJHB 4FI8A 4WDIA 3ARFB 1MCJA 4WTQA 4S0TD 3SPVA 3JTBA 4FG6D 2WINB 1M6OB 4Z7VF 2Q86B 1IL1A 4YQXH 1YNKL 4L3CB 2JK5A 4NI6A 4JDVB 1BZDA 4LHJB 1DSFL 3H3PH 1H3PH 4H25B 4XTRD 5L2KE 3OF6D 1I8IA 1GW0A 3NESA 3OKDB 1O9WA 1A4AA 2VJ0A 2W9EH 2JKIS 2JKWA 1I31A 3O2WH 4GP5B 3QJSB 4L4VE 5G5DB 1IFHL 1QWNA 2NYYC 4NEHB 1NCCH 2MKLC 1AZUA 1M4KA 3MJ9H 4YSDA 2W91A 4PRBA 5ANHA 3ZU8A 4M8QA 4MDIB 3RFZA 1KENL 5E2UH 3BUPA 3IJYA 2PF6A 2OW6A 1ESOA 4IRJA 5JXAL 3IMUA 4N2CA 3FAXA 2YSSA 3RVWC 2VERA 5F96H 3GMRA 4FXLA 2DWYA 4LCWD 4R3SA 2X28A 3D25B 3GHBL 3IS1X 3KPOB 4Z18A 3MBEA 4IMLA 3B2UD 1ACYH 3KPNA 2IWKA 3QFJA 5FFLA 1SN0A 5FK9B 1PNCA 4AVJA 1HSBA 3U2SB 1ECYA 3RL1A 4XWGL 3WTSA 2DMGA 2Y22A 3BD4A 3HI6L 5E0FA 3VI3F 4C57C 3VQ1C 3OKYA 1ANUA 2BXYA 3O3EB 1D6EA 5E6IA 1FFOB 2AQQA 2GBTA 4OCMC 3PHAA 4UDTA 3F05A 1T5WB 5F7EH 5AKTA 1S7XA 1G6RA 4L0PB 4Y2DD 1WGVA 2IFFH 3HE6A 3I02B 1RLBA 4MA1C 3SDAA 1ETZA 4OD3L 3JWOL 1FFPB 2DWTA 2GSIB 3QR2A 5SWZD 4Z7NF 4ZW5A 3MRDB 1HT6A 2D7NA 3NCFB 1KWKA 5DR5H 5FA3B 2Q6WB 4P49A 3WGUB 4E9QA 1H8LA 3O3DA 3KLHD 4YHMH 4X6CF 4S0HA 3MBWA 3EO9L 3MOAL 4FP8L 1TETH 2W60A 2WQ8A 5CLZA 3T8XB 3N6YA 2BOCA 3R8QA 3I6SA 4XO4A 4Q9QH 2HX8A 1C5BL 3ZVVA 3PABB 3HS9A 1ZV2A 4W93A 4IGBC 3TIDA 3TX4A 3I6KA 1RUML 1Q4NX 4KXZI 1RZJH 5KVEH 3N1GC 5HD8C 3CQFA 3ZE0F 4IOIB 4MXQC 3QI9B 3CVBA 5I8EA 2VITB 3B3IA 3LXAA 5AW7B 5CD5C 1MELA 4J3OF 3VXQB 1E4XI 1NGXB 4HETA 4PWKA 1DR9A 2Y7SA 3HKZA 4Q14A 4MCYB 3S98A 3WENA 3VW3H 1NA8A 1ROWA 1CF8L 3QPXH 4JBSA 4N9GB 4OVUA 3ZDXB 4GXVH 5DWPA 3QNYB 4I77H 4JM2B 3VUAA 5B1KA 4JFXA 4UNVA 3BRGC 4PGEB 1U2HA 2B9AA 3ZYZA 2PYFB 2I24N 2F58H 4H7VA 1RZ8B 3F7VB 5LCVA 1BQLH 3ESUF 1SYVA 2D31B 1YAIA 1M53A 3CXDH 1RZIB 3QCUL 5EU6A 4JHWH 3W9DA 3JV0A 2ZKHL 2YRPA 4MJIA 5AW3B 1JRHI 1CDYA 3OKLA 1BFVL 1SJHA 5T3XE 1FI8C 4JFOB 5HHME 1CL7L 2QV2A 4BUQA 5BZDA 1WA0X 2R2CA 3EXJA 2CZNA 3ESMA 4IBQA 2BY0A 3ATAA 1JHLH 4HBCL 4R5VA 3NIFB 1OGTA 4MJHA 4L8CB 2P28B 4XC3L 4HHAB 4M4RA 3QZWG 1FSKC 4P2YA 1K4DB 1DVZA 1VSCA 3U4AA 5E2WH 3BP4A 4KROC 3LHPL 4GIOA 4P5TD 3N9GL 2PWDA 1FO0A 4MNHA 3II3A 4NZ8A 1Z5YD 2WCGA 2DS4A 1YY8B 3ET9F 2WXNA 3CFEA 4PJ5A 4YDJB 3I3DA 3SDYH 1JFQH 4EVNB 2XX1A 4XGZA 2V17H 5DZJA 3STLB 2F68X 3GWJA 2Z31C 3FYEB 2NT1A 2OJEB 3FN3A 2C4XA 3NCYP 5GS1A 5I1CL 2P5EA 3PWPB 2JCCB 3ESPA 3ULUH 1KT2A 1FV1B 2BP8A 3QEGH 5BJTB 3ZKSD 2DQTH 2VN3A 4OGYH 3VTTA 1XEDA 1URIA 5DO2D 5BZXA 5ACLA 2ISDA 2KZWA 4PG2C 2AEIT 1QBMH 5D1ZI 5TDOA 3TH3T 1ZVHA 4HP5A 3NSFA 2XWZA 3ZE1E 5A6IA 5KN5B 4B9ZA 3G04A 3QQ3A 1YUKB 2QVKA 5E00A 4X4MA 2ITEA 3T0EB 1B2WL 3QR1A 1N0XH 1I3RA 1GTFA 2MTPA 3EH4B 3CFUA 1F2QA 3HAEH 4JKPH 4Z8FH 1VFAA 3CFJA 3N1MC 2IG2L 2LVCA 1WZAA 2KZBA 3AREB 3GIVA 5BQDA 3V0AC 4BWTA 3QULA 1Q9LA 2M83A 2ICWB 4QRRD 5L8KB 2X4NA 1YUHB 3HNTH 1MJJB 1CYXA 1KB5A 3L6FB 3M17A 4NNYB 2OZ4A 3S88L 3BD5A 4TLTA 3DIFA 4XMWA 1X5YA 2GCYA 3LD8C 3O45B 4JO1L 5IHLB 4HFWB 2YN5A 3VWJA 3U0PA 4HIHB 1THCA 3VFUB 1LE9A 3LEYH 4V11A 3O2VH 5DVPA 3FT3B 2CR3A 1P5VA 3C5ZD 1AKJD 2H8PB 1CVRA 2YRLA 4FQ1H 1T0NB 4BZ1H 2J3SA 4JW3A 3TVMA 3KLDA 2GJRA 4PYHA 3LTVA 5J6GA 2P9RA 3BPCA 3KVPA 4ZUUB 3W11D 4X5WA 1UXWA 3GI8H 3O0RH 3QFDB 2WKLA 2X4TA 3FT2B 3UCRA 3GXMA 4Q9RL 2APFA 1QRND 5A2KH 4ZMPA 2WXRA 4X9HA 4NKIH 1JNHB 1YNLH 4I88A 3TM6A 4FQXA 4P9HL 2ZOWA 4NJAH 3HEIB 4ZQKA 4Y4FC 4AENB 1CE1H 3W39A 1OARH 1P2CA 3B9KD 5GS3A 4MMYA 4H0GA 4PJCB 2VE6B 2V8LA 1OP4A 3HBPA 4K94C 4ZS7H 2UYLA 4G6MH 2MNWA 2BNQD 1KLFA 1FH2A 1ZA3B 4N4YB 5B1JC 5GS0H 1JERA 1D5MB 4HS6A 5T3ZH 2F74A 3CMOL 1EV2E 3HMXH 1A7NH 4WRLA 3E6FB 5E6UB 4ZFFA 3BVDB 4KV5F 1I9JH 2VSDA 3IB4A 1ZTXH 1I4FB 3NFSH 1RIVL 3HUJB 4DK6A 3ATDA 5C0DB 1INQB 4YO0A 1BZEA 3DO4A 3LH8A 1XF4B 1H5BA 5HYJD 1E28A 4Q89A 1OSYA 1ZD6A 2D7QA 2OMXB 1WBZA 1N2RB 2XBZA 2IH1B 3L3JA 5ANMA 3GTTA 5CP7A 4XHQA 4FQHA 4WW2C 4UAOC 1WG3A 3D05A 4RFNC 3S3DB 3BDYH 1DQQB 1JZDC 3Q48A 4H8HA 4FF9A 4JMXA 3T3ME 1WPCA 4M3HA 3FONA 2J4WL 5EZLA 4ADIA 4PJDB 4Y4KC 4UF7C 4K8RD 4TS6A 3G6AB 5EBLA 2Y5EA 4B3EA 1KZQA 2HZHA 4OSUL 3MYZA 4JM0A 1AXIB 3OZKA 2P8PB 3MQIA 1RIUL 4G71B 3QEQD 5GGTA 35C8H 4QRPE 4LP4A 1A1MA 5KVGH 5LVEA 3OLDA 1CFQB 1KTJA 2J8UB 5KSBA 1U3YA 3AG2B 1NPUA 3EYVB 4G2AA 4MLIA 4KKNA 2WYHA 4Y1SA 5CINH 25C8L 4OFQA 1G1CA 2WIIB 4NNXA 5DC4B 4MWFA 3BN9D 2F1AA 3MBXH 1XWVA 2A83A 1MFVA 1XL6A 3KCPB 2WLMA 1FP5A 2Y5QA 2BOLA 4PLOB 4X99A 5DT1H 4IJTA 5INDB 1WFNA 3RWDA 5KS9E 1XVSA 1YNTA 2G60H 5EO1A 4E9RA 1PG7W 3TJEH 1PLGL 3A22A 1NWOA 1NFIB 2V3DA 3DTUB 4I7ZC 3PXHA 4O02A 1QTSA 1TSHA 2PUQT 3C6LC 1G7PB 1EHNA 4KPHL 2VKXA 1HHJB 1M2VB 4P9MH 3C08H 3FTGA 1HHIA 4OF8A 4I8DA 3S36X 4F7TB 5DK3A 2JMRA 5ITFB 1SLXA 1FLTX 3UAJA 1KSRA 5JHDD 4NUJA 1VDGA 2IWEA 5C0IA 1BVKB 1NLBL 2XN9B 3DX7A 1V3LA 4N2MA 1TCMA 5CMAA 3VD2A 4BE6A 5J9PA 4N3UA 3V0WL 3HNVL 4L4TA 5ESAB 3Q6GH 3DOSB 5EFIB 1Z9MA 3EUDA 4M1GL 5DS2A 4ZNEA 2IH9A 5DHDA 4QXUL 1QP1A 4XPHH 3OHXC 3V0DA 2J55A 5HHPB 2NSQA 1G6RH 2CJTA 3I6GB 1XR8B 3EOAA 3GZKA 3N06B 2EE3A 2AXGA 4DFIA 4Z7WB 1GPOL 2E56A 2EE6A 3HC0B 1I1AA 4MA1B 4X4XA 5C07A 7FABH 5I1LA 4MXWL 4PTUB 4Y5VC 4U6XA 1QVOB 2BVQB 3WFEL 5EBWA 1F3DH 1MHHB 3KPSD 4Y2DC 4JY5L 1RPUA 5AQ0A 3DI3B 5SWSA 4KQ3L 2A73A 1KJ3H 1ZA6B 1S9YB 1QNZL 2VXQH 4KDWA 3V6FB 1QFWM 1M1XB 4IGBB 3UTTA 3EOYG 5D1XE 3MFFB 4WI6A 3KLHC 1T22B 1Y6NR 1DBAH 4GAGL 3TBTB 1IEHA 1S9XA 2J12B 2VZSA 2A6DB 4APXB 1QPPA 4KHXL 3G5XB 3H9YA 3NEOA 2AEWA 1BZ8A 2CSPA 5EV7A 2LU3A 3Q3GA 1ZT7B 3QUYA 2P8LB 3DRQB 4KBPA 1VZHA 1WBXB 5KSAD 3VE0A 4HV8B 5IROC 1B0IA 5INCB 3BQUD 2PN5A 3UMTA 3QJVB 5F9DC 1AQHA 3DMMD 1ZAGA 8CGTA 5HPMA 4KVCH 1HHKB 4QTFA 5J6SA 3KGUA 2V3FA 1YECH 1OAUH 2X44D 4K9EC 4N0YH 5LCVH 2OR7A 4ALAH 3AACA 3GKZA 3OVUB 5E08L 3I6LD 4LP5A 2P43B 3TFBA 3MRKB 4RGNE 4JZNA 1BVLB 1HXYA 4HG4K 1S8DA 3PV6B 5B8CC 1F4AA 4F7MA 2VRQA 1TUPA 1XB6A 2JI1A 2P8MB 1RK7A 3RNQB 2AXFA 4OM1H 1ZRUA 3ISWA 4PY7B 3WLWD 3TZVD 5IBLD 5KJ7E 15C8L 2BJML 3KS0J 4PRNB 2B1HL 4L9LA 3DOHA 3MV7B 4ZO6A 1WZKA 2ZUUA 2OP4H 2QVTA 3DETC 4BFRA 4WK2B 3KYOB 4N1HB 5DEFB 1YN7B 1AIFB 2LAAA 4MD4A 3U4EA 1QEXA 1AZCA 1FSKB 1JXGA 4NO0B 2YPVH 4XPAH 1JG9A 3OLGA 4HH9B 4OJDH 2ESVB 3RAJL 5JQ6H 2A9NH 2BS9A 4IRSD 3Q1SL 3O3BB 4PAZA 1F11A 3TV8A 1TEGA 1JXFA 3L5WB 4KROB 3TURA 3D33A 4HJTA 3ZYJA 2FCBA 4PD4J 2VR8A 3UJTL 4U1MA 2CK2A 1DUZA 1BSIA 3EBIA 2UVFA 2X2HA 2PKDA 3CZFA 4P5TC 4JG9A 4HIEB 2Z31B 4O4YH 3UABA 2VABA 1W72L 1LQSR 2FTAA 2Z6FA 1NBZB 3PHQB 2WJ7A 5B38G 3IDJB 4H1LA 4WGWB 5FKAB 1FYHB 4YSQA 4TSBH 3OJ2C 2ZPKL 1NEZB 1SXCA 2EC9U 2K70A 3KPQA 1QTYT 3M7FB 3OMZA 4OZGB 4U1JA 1ZOXA 3AS3A 3L5XH 1L9OA 1WWCA 3OBAA 2F8XC 3RGVA 3WUWG 3W82A 5JW4M 2V2TA 3G08B 1ZKAA 3ZW3A 3HHSB 5C1MB 5IOPA 5L88L 3WV0A 4N87A 3GXUB 2OMUA 2R39A 4HKJA 3BWZA 2OAAA 3BFQG 3GUFA 2AJ3B 5DO2C 5F7AA 3DI2B 3CFCH 4H26A 4NGHL 3BP5A 4ZUSA 3V4PB 3PV7A 3TYGH 2VXVL 2MRYA 2QMJA 5M7QA 2P45B 2E9JA 4YXHH 5D7IE 3CHXA 5BUAA 4NQEE 2X5PA 5DUBA 2XFGB 5IV2B 3CFKA 1S7QA 2AV7A 4PVMA 4IBUA 3M46A 1M42A 3LH2H 3MLSL 4K3HA 1F6LL 1KB5H 1HE8A 43C9B 3P9MB 2OZ4H 4L8SC 3GLEA 3LV3B 1CXFA 5HY9B 1D9KC 5IB5A 2D03L 2RH0A 3LD8B 3VFNA 5HJGA 1NKRA 4KY1H 5E99L 4LNRB 5C0AA 4AI7A 4XXWA 4HYTB 5FYJE 3BEVA 2DPKA 1JVOA 2HVJA 4M5TA 4HD9A 2W65B 4BSVB 5GS2D 4QCIA 1KGCD 4JO4H 3RJQB 3DV6B 4QRQA 2EO7A 4LLMB 2KPNA 3CC5A 4CA4A 3CN4A 1KCSL 3FB6A 2IALB 3GSUA 3C5ZC 5ERWB 3VXNA 5CD3B 4AUUA 3KWXA 4LLDB 3OAUL 2V33A 4J3UA 1WWAX 1ETB1 4XO3A 3F6JA 4Z77A 4AVIA 3DVGB 1ZIAA 5LKNA 2PO6D 1RVFH 1G94A 3W11C 1SY6L 3TBVB 5KSVA 1WFTA 1J1XL 1JHTA 4MAZA 1G7LA 2MPAH 5T5FA 5IJCC 4Y4FB 1P1ZA 1AD0A 5MEQA 4M8RA 3E3QC 3A3YB 3MJ8A 1GXEA 5D2LB 2E27L 4QHNA 4KKZA 3GI9L 4ZK8A 4YNYA 4G9DA 3PYCA 2EIJB 4N2DA 5GGRB 1CICA 3IETA 4FMVA 3VXMA 4L1BA 1AO7B 5ABAA 3FU7A 2BIHA 3MUGA 3B9KC 4GLRH 4WKZB 5IB2A 4MNQA 3BVTA 3IDNA 2WWMD 1AI1H 3GBEA 1XBRA 5IW3A 1RMFH 1HQRB 1VGKB 3IWUA 2VCOA 5GRZA 1YY9D 4BGDA 4Y19B 1TJMA 3D69B 4NQDA 5BV7L 2EVFA 1P9MC 1FNAA 4G7RB 2OMZA 2EDQA 4MYPA 2HVKB 4JFYA 4P5MA 4AXWB 2BMKA 4D0DA 4OCWL 2YOAA 2WYTA 1DQJA 3U83A 3ZZSA 3MACL 3Q2CA 4LAQH 4FQLH 3V4PL 1AQKH 3FQUB 4WW2B 5AAWA 2EXYD 4GQ9L 1T0PB 4UAOB 5IFAL 2FD6L 5KTEH 4XO8A 4RFNB 2YLKA 5KVEE 1TIUA 1SHSA 5J8OA 1JGDA 3CDGA 2Y2TA 5EO9B 4YWGL 3KEHA 5FOBB 5CZVH 1IGCH 5GGSA 3CH8A 4Y4KB 1CFVH 5EUOE 3C60C 3VXSD 2HFGL 4K2UL 2ZZUT 4FABH 3MLUH 1IM9A 1JV5B 1Q9WB 5CM1A 2I7OA 5IB3A 3K81A 5GGTH 5F89A 3ZT6A 3VCLB 2VQ4A 3ML8A 1OT2A 4K8RC 2X1WL 5F9WC 43CAB 2IMMA 2R4RL 2QGBA 4BUGA 5KYWB 2Q5BA 2ENPA 3RKDC 1GCYA 2VIRA 1TKWB 2YD3A 1UM5L 2HX7A 4APQA 2NQDA 4XZUA 1M7IA 4QTIH 2R27A 4XP6L 2XWBB 4FLSA 2J1XA 1SF3A 4XPTL 3OMIB 4L4VD 3IFPB 1RUPH 3WJJC 4AGPA 4XNXH 3T04D 5GSRA 4JZOA 5JHAA 4PJHB 5ADPL 5L7XL 2HWZH 5EZIL 1JWMB 3ARDA 3RILA 5JXEA 3D3VA 1GGCH 4HKBA 1II4E 3C6LB 2Y07H 2LLGA 3WXWH 3IBOA 4N2HA 2QPDB 1UT2A 1V05A 2ZCHH 1K2DB 4EXPX 2WC7A 4K7PH 4MJ2A 1FVDA 1S3RA 4LLQA 4J4PA 3GMMB 4XCCH 3CPUA 2A9MH 5K9KA 1C16B 2QMKA 5FDWB 2L7JA 3M1BA 4FYRA 1YYCA 4GKLA 4QT5B 1AXTL 3LRGA 1ZSHA 3GDCA 1MCEA 3FFOA 4F1SA 4NERA 3DO3A 1T0OA 1WEJL 4PEEA 2VLJB 2FJGB 3ZKND 3OHXB 2QJDA 3P77A 2BZCA 1HCFX 1UOLA 1EEZB 2E3VA 5AB2A 4BQCA 4FFVC 5H8DA 3MV9E 3ZOAA 3NQIA 3T0AA 2O61A 4Y4HD 3WS3A 3FT0A 3R7QA 1DE4B 4Y5VB 1MFBL 3MLXL 5E1IA 1ORQA 3AWEA 5FO7A 3SQOH 4HUWB 2C26A 1C5DB 4EIBA 3ULUE 1N5YL 2FL5B 4LSRL 1LK2A 2CRZA 3PXJA 4Y2DB 1FC2D 4NHUB 4AJ0A 3H42L 4LBAA 4IU3A 1CLYL 2CAKA 2MQ0A 4HQQH 2C9QA 4U0RC 4BFJA 1IAOA 1RK1A 1AGDB 2IANE 3KWUA 3BIKA 4G6KH 5F1KC 3QC6X 4IOFC 1KIRA 2J1YA 4JR9L 4NN6C 1MI5E 1SN5A 3T4YB 4H88L 3QIBA 1TG8A 3ZTEA 6FABH 3T0WA 2A6JA 4TMPA 3TPUB 4R26H 2C34A 3A67H 1QA9B 3DURA 3U0TB 3ZT7A 3T3PE 4B5ZA 1GL4B 2Y06H 4HIJA 4B97A 5HVFB 2XXCB 4EDWH 4HPYH 4NUGL 3L81A 1XGYH 1RZGA 1W0VA 1GRWA 2IBZY 3BWAB 5DK0B 2IIJA 2YUWA 5B8CB 2NCEA 4R7XA 5TQ0L 1YEIH 5DA4A 1V7ML 4U49A 1X9QA 2VDRH 4L5FE 4I2XA 1U8NB 5JW5B 5T3XD 4E9XA 5FO9A 4ZW6A 2RAMA 5B7FA 5CS7A 3TCTA 3NCJL 1Q1PA 1QFHA 1D5BA 2KQMA 3WLWC 3CBRA 4LCCC 3OQRA 4NCDA 2F15A 5FWRA 1H15A 1IQWH 1KIQB 1SHXA 1I8MB 5F7UA 1FIGH 5D4HA 3OB0K 3P4LA 4BRJA 4JPSA 3SO3C 3RTLA 5C2BL 2ZKMX 4PLNC 5CR1A 4R96B 3AABA 3QDJA 4F7PB 4YL4A 4YDKH 1FHNA 2W5PA 4V1DA 4YHKL 4ODBD 4QRBA 4KFMA 4LDLB 1A9BB 1L9TA 1DDHB 4DIXA 5EEXA 4JG5A 5E8DL 1OTSD 2E7MA 3LXCA 5KVDH 1X3DA 3FCBA 4P5TB 3K4ZA 1UG9A 1DJIA 4RCAA 2C4FU 3GNMH 3V5DB 5T3ZE 4ISVB 3NJIA 4Y7OC 1IAIH 3RJOA 4QYAA 5C0CB 4H1LH 1A3RL 3SJVE 4JG1H 5AKRA 3SCMB 3QXVA 4E41E 1ZTXE 3QIUD 1KCVL 3EJTA 3ETSA 4YDZA 4XNUH 4A1RA 3SE4C 5EU5A 1JYXA 3Q2WA 1WT5C 2FYYB 2DTSA 3EH2A 4WWPA 4ZZKA 3KLAB 5HDRA 4PG9B 4HUVB 3UAFA 1JNNL 2AJZB 1FAIL 4JY6A 4ANUA 5I18H 3ECBA 5MHSE 4JKKA 1SYSA 1MDTA 2IAMA 3FT9A 1O7SA 3IK2A 4WFHE 4XMKL 2GUOB 4G3YL 1LDPH 3BISA 4DPBX 2V7HB 1PY0A 3KPMA 2O5XL 4G82A 3AY4A 4XMLH 2BS8A 3SPGA 3N41B 3MROA 4F3FB 1NL0L 1QBLH 1YQ2A 1WZLA 3WKYA 5ABDE 5AW5B 2AQPA 3C75A 5GZOD 1UADC 4GKSA 4Q6KA 3TFKD 4L8SB 4E5XG 5B4MD 5JW4Q 1D9KB 2CO7A 5ACZA 4A2MA 3QZLA 1Q9KA 5KVGE 3LZNA 2CBPA 2WLNA 4JKNA 1ASPA 2VLKB 4LP8A 5ELIA 4KJYB 5CCJA 1BPVA 3REWB 2PTTB 1Q1JH 4K3GA 1IIKA 2OYMA 2ED8A 5E1AA 2F9BT 1ZLUH 1J86A 3IN2A 1W8OA 5FB8A 3INUH 1G1YA 4ODWB 4R90L 3LS4L 1KB3A 3FB5A 3FB7A 5A3ID 1Q9OA 1KGWA 4WFGE 4FHJA 4GSDL 4QJ5B 3WSQL 3STZA 3HVDA 4IHBA 4M6MH 3C5ZB 1PL3A 2AVFA 4NQVB 1N10A 1RP9A 3IPFA 4I0PC 1PYWA 3BZ5A 5DMYA 5ESQB 4XCYA 4ZX6A 4W4OA 4GRMB 2FIRT 2ED9A 3EYSL 2WJ5A 3CCHA 4ABVA 5HBBA 1A6UH 1KYAA 4HUUB 4NI3A 1HXMB 5T5FH 2FEDC 2FECL 2VR9A 1E6JH 4BXSV 1IKFH 2Q7NA 3QFJE 4H44C 1QRNB 4GG6B 4O5LH 1N7ML 1CB4A 4ONFL 2PO6C 3ROOA 4QO1B 5JZ7C 5I6KA 1RIHH 1NSNL 3BT2H 4M6OH 1UCTA 3KHOA 4WGVB 12E8L 2GG1A 2YWZA 3UGXA 3B9KB 1P5UA 4NKOB 1TZIB 5J3HD 3DHJA 5DFVC 2KDGA 4ZW8A 3SGJA 3UBXI 2BNQB 1KXHA 1UJ3A 4QXVA 1DVQA 2H0EA 3L3OA 3B3BA 3HPLA 2EYTA 4IRZH 5EU7C 2JIXA 2R2EA 4ETQB 1ERNA 2I32A 4NX0A 1GZPA 2WWMC 1BM7A 4PN6A 2MQGA 4LASL 4CDGC 5KYYB 5AYUL 1FIEA 1BJ1J 1IBGH 5DZPA 3SKNA 5JA8B 2CCLA 1J0KA 1E5CA 3FSAA 2MCMA 2R8SL 3QEHB 3MV01 3THML 3KJ6L 3K6OA 3NFPB 1G7HB 1W8EA 2W0KA 3U9WA 4UQ2A 1F6AB 3Q43A 5CZXC 1OGAE 3RX7A 5EIIA 4Z7UE 4BZ2L 3LKSA 4PB9L 2F19L 4P06A 4X9IA 1MRCL 3L45A 4G6FD 4M6NL 1X5XA 4MB5A 4X6FB 1GJWA 2EXYC 4LKXB 3C60B 4HG4J 4LCVA 1AHWA 1MFAL 3UTSD 1LEGB 2CNYA 1BAFH 1Z3RA 3N42B 1QZNA 1H6TA 2V9TA 4RMWA 1ZGLM 1UOVA 4OF0A 4PTTA 4QRPD 1K4CB 4U7KA 4HVBA 1XMWA 3DV4B 3HR5B 3BC9A 3DC0A 4NT6A 4HU2A 5F9WB 3OSVA 3O9WD 3X3GL 2ZWKA 2CDFA 4YIQA 5I76A 3AADB 3F7LA 3HE7D 4DVBB 3LRLA 2WBWB 4JFFD 4N8VG 2GK0A 1ZHLA 3P1VA 3QEQB 5TQ2L 1OCWH 1AQDA 3VTAA 3U7YH 3WXVH 4TUOB 4AEHL 4NRYB 1AY1L 5FXCH 4MJIE 5FX3A 2F7RA 1GHFH 5IMMA 1OLLA 2ZG3A 2ORBH 1IEAA 4K3JH 5FV2A 3BYTA 2ETWA 1W0WA 2IGLA 1I8LC 2WTPA 3VNYA 3OAWA 2HG5A 1FL3B 2PCPA 2V9QA 3L16A 4MQTB 1F1GA 2V5MA 2FJFB 2PPCA 2X3BA 5AAMC 2J71A 3HG1B 3K91A 2IPKA 5FFOA 5J56B 3QUMB 5JPNC 1CD1B 1CGSH 3ZL4L 4HEPG 1VACA 5F1IA 3BPNC 4WKXA 4IDLA 1NC2B 4S1SH 4NFBA 2J73A 4MKTA 2DV6A 1F58H 3PP4H 2VC2L 5FYJU 3ZDZB 4IU2B 4KH2A 1F90H 2OI9C 2WN3A 1A1OA 4DP0X 3P30H 5JHDB 4YHPB 2X70B 4PJ5E 3HRZC 2WXJA 1VFBA 1JPTL 5J13C 4PJFF 2Y36H 2NNCA 1X7QA 2GI0A 2R0WH 3N04A 4F37K 3MNWA 1U8KB 5IHZB 4M8UA 1MHCB 4NPYA 2MWCA 3WGVB 4ZSOB 2P5EE 3H3BC 4POZD 5FHAH 4YHOH 4DGVL 1QSFA 4POUB 3MLRL 1HNGA 3K46A 5I1HH 5AW4B 4KZEH 3D4GA 2YC1A 2XV0A 1R75A 3ALXA 2YA2A 1VCAA 3L3KA 3SY6A 1A5FL 3TV3L 1I9RH 4R8WL 3CFDB 2JKRM 5IQ7H 1QYGL 1N70A 5D1XD 1RU9L 4U0RB 4Z76B 4CMMB 2A9CA 4ZW3A 1IFHH 1ZT1A 4HKXB 3KPSB 2ADFL 2VDPH 5CKAA 1JHKL 3M07A 5TFSH 4BDVA 5JR1L 4CN4A 5IKCA 4X4ME 4PBWD 5FM5M 3NIDF 4EN3A 5EOTB 4NN6B 2D2CC 5JXAH 1BX2A 3F7YA 4K8RL 4K5NA 1IFRA 4OJFL 4ONGL 3A0OA 3QORA 1RURH 1J1OL 2D73A 3IAQA 2V2WA 2W1NA 3E6HB 1CFNB 4G5ZH 3VGGA 5JA9A 3FTXA 4FNTA 3BAYA 3M86A 3VSTA 4QHKI 2IDFA 4OQTA 4TNWK 1HINL 1UM4H 3AS2A 2LQRA 3HI6H 2F53A 2WNXA 2CDEB 3KYNA 4FFZL 2DBJA 1Z5LA 1VERA 3JZ7A 4RETB 4ERSH 3VFWA 3ARVA 3QZBA 3W37A 4J3SA 2AI0L 3PNWB 3QIWD 1CFSB 1XF3A 2WV3A 2NPLX 3QXUA 4NXKA 3V7MA 3AS1A 2WNWA 1LD9B 4X8XA 5GGQL 2BHYA 4HIIB 5I82A 4PRIA 4WVRA 5HDWA 3L3IA 1HEZA 5DZNA 1U8CB 3KW7A 1MJ8L 3RIAK 4B96A 1M7DA 4LCCB 4G1EB 5EH1A 1KOAA 5EA0L 1ODUA 2FATL 1OD7A 3IKCB 4LL9A 1Z6JT 3LN4A 4YBQD 4IDJL 4LL4A 3WJLC 4GW4B 3MA7A 4GQQA 4WK0B 4PCYA 3BVWA 3SO3B 3E38A 4FQ2H 1NGYB 4FTVD 5AZ2H 3KL0A 2QGDA 3ZTNL 1RHHA 2R0ZH 2K9UA 1FLRL 4MCMA 4X9YA 2IQ9H 3U7AA 2WQWA 2TSAA 2EEBA 1ZV5A 3BW9A 3K0WA 3MRLB 4A7GF 2YD5A 1T21A 1GYWA 1BW8A 1XAUA 2K4WA 5BS0A 3U48A 3HAEG 2B39A 4LCYB 2O6CA 1SOSA 4N0UE 1T4WA 4AK1A 1VAHA 1AG0A 3R4RA 1MKFA 4RGMC 3OD3A 5GJTH 1OTSC 4LRIA 3FRUB 3UJIL 1I1YB 1AOHA 3S96A 3CFIC 3JTTB 4P0DA 1LYQA 4MMZC 2VR3A 2YXMA 3QYNA 3CDYA 5AUMB 1MHEA 5LBSL 3MRCB 2DQJL 2A5UA 2E8ZA 2FSEA 5E5MB 4ES9A 3QIUC 1KY6A 5ANME 3QXAB 2ZKHH 1PTZA 2BOBA 1YEDA 2XIBA 4W9JC 1BFSA 3TL5A 3X1BA 1Z9SB 3VACA 2R0LH 3AXIA 3KMDA 5D1ZA 1CL7H 2WOYA 3AUWB 1S7VA 4L8DA 4CN1A 4B9JA 4FNQA 1IBDA 3GRWL 3LN5A 4RAUA 3NZSA 3S3SA 2XCMC 5C0EB 4JDTL 3CZLA 4XC3H 1JMXA 4NQED 5HDBB 4UMGA 2CGYA 1NANI 3AQYA 4CNIB 3AZUA 3ULVE 1NBYA 2CPCA 1I9EA 1SUHA 4YH6A 3BPLC 5DVLA 5EORL 5FCSH 3Q8AA 4J3OH 1EDHA 1UH3A 1HWHB 3HC4H 3LHPH 1WD8A 4Q2ZB 1SFDA 1DJZA 2KLTA 3N9GH 4GRLA 1FNEB 4N2KA 4AX3A 5KSBE 5KUKA 3E1ZA 5GZOC 5FYJD 4BWUA 2VW7A 3TFKC 3ZE2B 2WXIA 3VMOA 3MDJA 1EO5A 4YFEA 2XUWA 5CHNA 1PF3A 1Z1WA 2LAGB 4P2OA 2CR6A 5ES4B 5A2LH 3U1QA 3RWGB 1TLKA 5IP4A 2BM3A 2BXZA 2FWOA 3EOTH 3GXTA 1NIAA 5ISZB 4UOW0 3CV5A 1DBKL 3VQLA 5I1CH 1AXSA 1U33A 3HLKA 4WUKL 1D7CA 2QVFB 3LB6D 2ICWI 2FO4A 1MLCA 4I0PB 3VRLF 3EGXA 2YD7A 4MDJA 4GG8B 1S9WA 1MNNA 2OSLB 1YEFL 2XZAH 3H8NA 4YAQA 5B3NA 4UIKL 2V4LA 3BZ4B 5F7BA 3S36H 3ZTJH 2WTRA 3MUHL 3RBGA 2E6QA 2WBXA 5GRVL 1JXJA 2QTVA 5JNYA 2GJ6B 3GKWH 4OZ4B 1E5UI 1LO3H 3SKMB 6TAAA 3SKOB 2PO6B 3CIQA 4E9TA 2CJUH 1IGTB 3MRQA 2EYSB 4KGLA 3BKCL 4L4TE 3I3BA 3SOBH 3LKPA 4ZNEE 2KZKA 3V95A 1BZ7B 5K9JL 4KZCA 4FRWA 4EUPB 2X4QB 3TJHC 3WEBA 4BA8A 4DJMA 2FJHB 5I0ZA 2OMVB 4X8GA 4N28A 5DD3H 2NSXA 3JWDC 3WEAA 1S9VB 2BIPA 1TYJA 3VH8B 2O1AA 4TUJB 2NR6A 5FGBA 3L4TA 1NTDA 1VCBC 3B6SA 4PQXA 5C07E 3S88H 1E3ZA 1MJ7H 3D0LB 1F0LA 3X1EA 2DLEA 3HC3H 1A7PL 4M7KL 2P80A 1FZKB 3N85L 4JFSA 1OPOA 1WO2A 2QADD 3MLVH 4MJJA 5SWSE 3FO1B 5ESVA 1TLMA 4V33A 3IMVA 1Y0LA 1V3KA 2OTUA 1NJ9B 4TULL 3Q06A 3GS7A 5DD6B 3UTTE 1A0QL 2DQCH 2C9VA 2YZ1A 4W9HC 1JCVA 3P0VL 5DQDH 4F33B 2O5ZL 1KULA 3KZ8A 1P0SE 1I8UA 4JRYA 4CJ1A 3RI5K 1L3WA 5I1JH 4Y2NA 4EI5C 1MVYA 4JHAH 4OCRL 4M03A 2ZKXA 2Z8VC 3HZMB 3O11B 4WWNA 1HKLH 3T0DA 4KJQC 1V5JA 4KXBA 1RK0A 5FO8B 1U0QA 4E9LA 3U9UB 2DQUL 1F4YL 4LNVA 2ZKYA 3T65B 5K59E 1U2YA 2R9HC 5D7KE 3MJGX 2FZ3B 3ORJA 2BVTA 1JF1A 3H7LA 5HHQA 5EC2A 4PHXA 3BZFA 4C59B 3VSVA 3VJ6B 3U0WH 1KJMB 5ICXB 1EJ8A 1GCFA 4X6EA 3S5LB 2FGWH 2CO6B 3ZDXF 2NYZA 1EFXD 3QEUA 3U82B 4AMWA 1NOFA 1DVFC 2RQ8A 4LRNH 2YMXH 4JM2F 2ZAHA 4MD0A 3CN2A 3GZQA 5K9QI 1F4WH 1DO5A 1FL5B 4A6YA 3NSYA 3KR3H 4M62L 1C9SA 1U6AH 3EF7A 3MJ6A 4QRTA 4YFDB 4TLSA 5ITBH 1DBMH 2WLIB 2YKLL 3IMRA 4LEOB 1GC1L 2GABA 3NABH 5JPNB 2CLRA 3OPZH 4D3CH 1UZ6F 3BPNB 4AVKA 2E4TA 2Z93A 3DOIA 3UG4A 1MHPL 4L3EE 5BO1L 3SODB 1MG3C 2D7TH 4KK5D 3U25A 1EZVX 3CZJA 3V5KA 4XBPB 2VDKH 2Y72A 4XXDB 4OJAA 2OI9B 3T1FA 4J12A 2ENJA 1X4YA 1KLGB 1ZHNA 2YEZB 3Q7JA 2GITB 4NJ9H 1T4KA 3HRZB 4XN4A 3GUTB 2IADB 4PJ7A 5J13B 4O2FA 4D0BB 1JPFA 1IJNA 3NIFF 3BO8B 3MV9D 1XGRB 4YHIA 3BH8A 4PV8B 4BSJA 3T09A 4LHUD 1C5CH 1CXIA 3TIEA 3S8GB 2FB4L 5TE4L 4XP9H 2E59A 1RUKL 2P48B 2VT0A 3ULUD 1FZMB 3ZK0A 1MDAA 1WLHA 5DRNA 4MCZB 4OIFA 2XYCA 2QT6A 4F8NA 4YMPA 3RRQA 3H2PA 4XXCA 1F56A 4FE9A 3MA9L 4PRPA 2F0CA 4HC1A 2IJ0C 3PGCB 1T04B 4POZC 3SPJA 3I74A 2AABL 4MAYC 1HNFA 5EEZA 2IAND 1DJHA 1IGIH 3PG2A 1EANA 4L05A 1PLGH 1SUJA 2R0KL 1PZCA 2X1XR 2GAZB 1M71A 4KXZH 4HX1B 3K2UL 2JCCF 1MI5D 1OXYA 4JFVA 1R33A 5IWLA 4N85A 1L9RA 4KPHH 4AMXA 2FX7L 1JWUB 1KCLA 3WNMA 1HILA 1E4XH 4YC2C 3OG4B 1KEGH 3VXUB 4PS8A 1S5IH 4O58H 4XX1E 2AQRA 3ZDWA 1HX0A 2CKBA 2XWRA 5DVMA 3T4AC 3D87B 1H6FA 4UU9B 2YEVB 1NMCC 4M1GH 1DEEB 2E4FA 4OM0H 1HZHH 2QPFA 4QXUH 1T7VA 5C0AE 3DK2A 2A6KA 3B9VA 3RLSA 4XCEB 2X2JA 1OD9A 3GZPA 3P4NA 4IOSA 4PJXB 1T1ZB 1EEYA 2Y6SD 3ELQA 4KK8D 4Z0XA 3IXAA 4PJ8D 4KO9A 1E2WA 1OQXA 1OGSA 3OJMB 3P9WB 1KJ2B 4UT6L 3ARBD 2GSMB 2H7WA 1JRHH 4FCAA 5T1DH 2NMSA 2D7MA 4LF3B 2ZYHA 4NSKB 4JY5H 1RSYA 5C6PB 3FCSA 3L7FA 2NQ3A 3Q6FA 4K3DL 4OCNC 2VSKB 4P2QA 4KKBD 3WFZA 4ZX5A 4XAKE 4G1MA 1T89A 3SPHA 3MJ7A 4AUYA 4XN7A 1CE6B 3AW5A 3I50L 5HYQA 1IARB 3FCUB 3HC2A 3OZ9L 4JFDD 4WHDA 5L8JB 3QDAA 1IT9L 2OJZL 3JVGC 4PWIA 4LOFA 1FL6B 2A9AA 1A4JB 3IGAA 5DI8B 4XAWL 5GS0D 3VXME 4LSQH 3O41A 5I8OL 4AQ1C 5T3ZD 1JVLA 3BSHA 5C09A 1CLVA 1Z2KA 4UUJB 4MNQE 5EU4A 3SJVD 3GMOB 3ETTA 2BSDA 3MRPA 3UZEC 1JPSH 1HHGB 4IBZA 4E41D 5IMKB 1KBKA 3MCKA 4RGMB 3AGVA 4NZRH 1LNUA 3G5YA 3FU6A 2CBOA 4NQDE 5E9NA 2C9RA 4MMZB 4PJCF 5C7XL 5IZ7A 2BHUA 1XCTA 1OSZA 4Z7QE 1QQDB 3TS8A 1BJMA 4HALA 3T6VA 3TGXA 4HPHA 4I0KA 3QIUB 2X4RB 4GT0A 4MSWA 1MW0A 3KL5A 4NWTL 1KXTA 1WIOA 3GXIA 1RZFL 5MHSD 2Z91B 1XD1A 3PNRB 4PRAA 5HGHB 1E4JA 1C7SA 4Y5XC 1SRDA 1KJVA 2EEFA 3L3GA 4Y16C 1WS8A 5J4MA 1HOEA 2VTFA 2JH2A 2IGFL 3AFLA 4ZAKC 3HUJF 4UDUB 2PPAA 2G5RA 4FLHA 4A2LA 4TUUA 2X4OB 4HKZB 5DJZB 5CBEA 2Q8AH 3RPBA 1KXQA 3CVHL 3JZYA 3BPLB 2ZXQA 2OXHB 3A6CL 2H0PA 2ZSVA 1F00I 3PWUB 3UYRL 4RNRA 5DMGD 3U2JA 4OZFA 2O72A 1WHOA 2JKLA 1DJXA 3HBGA 2BZDA 3QJZA 3MRBA 1UEMA 4PLJC 2B0SH 3KH3A 2YXFA 3UC2A 1X5KA 4PJDF 1YZZA 3F00A 4Q56A 4A2FA 4TNWF 2WOBA 4BQ6A 4G8EA 1MSPA 4FZ8H 4HK0A 4WFGD 5T3XL 1JIBA 3TF7C 3NCMA 4HJEA 2YARA 3MOBL 3B1TA 3EJYC 5D7JA 5JMOC 4CC1A 2ZPKH 1WF5A 3QAQA 2OQJB 2FE0A 2J8UF 3D3VE 4IRJD 4ZDHA 4Z7OB 4EBQL 5EWIH 5HHNB 3FQYA 1D6VH 3ZQXA 3TO2B 4W9FC 3LB6C 3G5WA 4RWYL 4X0KA 3MBED 2A4EA 1P7QB 3QFJD 3L08A 1JSYA 4RDQG 2VR7A 3X11B 3D2UA 4ICWA 5I30L 1JZ3A 1T7ZA 1QFWL 3ATEA 3IDUA 4Z0BL 1ADQL 3CFMA 3HZVA 4ZMLA 4Y2OB 1DQML 1IQDB 4RVBA 5CCKL 1IU1A 1D5ZA 3ARZA 1XHHA 5E6ID 4NC1C 4B60A 2LR4A 3QWNA 4JPKL 1P7HL 1MFCH 2OR9L 4PJIB 3VYOA 2DLIA 2ALAA 1EHKB 2X4UB 1PFOA 2VISB 1NFAA 4GBXA 4OJCA 4TM9A 3HE6D 4GFTB 1UWEH 4NWUL 3SDAD 3HI1A 1VGEL 4GUCA 3WNKA 5AB9A 5JORA 4F15B 1DCLA 4B6ZA 2W07B 4P23A 1AR2A 5LBVA 4N3TA 1HH9A 2VM4A 2HFFB 4IEFA 3EJPA 2O6FA 2XY1A 2C1OA 1IEBA 1PX4A 2C3WA 1BDYA 4LIQL 2A6IB 1VA9A 3FL7A 4BA0A 4E36A 5JIDA 2I5YH 1GZQA 4KKCD 5CEXA 4W9KC 1DLFH 4P46A 2LOEA 4Z7WF 2UX6A 1KCSH 1N64L 2GT9A 4JGMA 4WJKB 3QH3B 5C0RH 5HGBA 5DS1A 4WI0B 4EI5B 4I4WA 3FQTA 2VYRE 3QJRB 4X7TA 1EGJL 4KDVA 1IAIM 4I87A 4NKMB 2G2PA 4OFIA 3LQAH 4JY4A 5KG9A 3MRIA 2XPYA 1MREL 2EEDA 2DI8A 3AXLB 4V2CB 2YD1A 3VI4A 5JHLA 4X7EC 2R1YA 2F8VA 9CGTA 2FO8A 4KZDL 3Q5YA 4D2NA 1E2ZA 2EDDA 5H2BA 3UTSB 2OCFD 1LO4L 2JJVA 2HJLB 4QF1B 3BVNB 4P5KB 4OY9A 4X5XB 4X9GA 3C09C 3FCTB 3FF8A 4OCSL 2YKKA 3ZYOA 3MR9A 5A2FA 1RFDL 2DMBA 1MPAH 5EU6D 2XVLA 1WHPA 3DDFA 1FORH 3JYBA 2EDTA 3QO0A 4OU3A 4KMTL 1JDAA 2GFBB 3QHFH 5ABZA 1OE1A 1XH1A 4MJID 4JJ5B 5GRJH 4Z7VE 1WWWX 4RLDA 4I2XE 4JFFB 3ASOB 5H4YA 1DVFB 3FYIB 1NM9A 3FB8B 1AFVL 2QVMA 1EAJA 4K4KA 5F7DA 1FVCB 2ITFA 3DVNB 4A6YH 2OMWB 2FHFA 5KOVC 2X89A 1D5XB 3B34A 1IBZA 4N0FB 1JGVL 4Q0XL 1PEWA 4XNQB 3VDBA 3O8XA 1UENA 4OCWH 4OFYA 4JB9L 1ET7A 4RSVA 4P4RB 1G9NH 1Q0YH 3WY1A 3KWWA 5IFAH 1AGCB 2FD6H 2ZCLH 3FHAA 1NDGB 4F8QA 1KCBA 1C12A 1FPTH 2UY6A 2A77L 3DBXB 3QZMA 1O6SB 3QDJE 1ACXA 1K9TA 4PJ5D 4V1DE 4TRPL 4G43B 4PVLA 4NKDA 4E42B 3SDCA 3MUUA 2Z64C 4K2UH 1HSAB 4Z6AT 4LOUD 4TVUA 5GPRA 1DSYA 3FBKA 4D0CB 1AE6L 3FTYA 3GMNA 2P5ED 3W5NA 1YEHL 1E9QB 3RFRA 3VFOB 1ZHKB 2P5WA 1YJDC 1BYPA 1J8SA 3P2DA 2VQ1B 4PJGA 5EO0B 2X7LA 4WU7B 4HC1H 1IM3A 4XP6H 1R24A 3T8MA 3HTLX 4MAYB 5GGUB 3WFCH 2WO4A 1R5VB 2V3EA 1J1PL 3IDMB 4Z7NE 1BFTA 3ASWA 1VKXB 4X83A 2NX5B 1A6ZA 2NY0D 4LOEA 3AQXA 5IMOA 3WNJA 4G83A 1B0WA 4P2RA 1RJZA 3KPLA 2VDOB 3DHPA 5IQ9B 3MCG1 4D9QD 1U8JA 2DQDH 1Z5HA 3APCA 5DQ9A 2ZWYA 4OZGF 4ZJ9A 3W9EA 4LQFL 2XLLA 3L5IA 3QISA 3GSWB 4YC2B 4B9YA 1SMDA 4ZUVB 3FAWA 1FJ1A 5MEPB 3NJHA 3ZE0E 4ADGA 2NCMA 4B9KC 2G3ZA 4KRPC 3RI5F 2CKBH 4AIOA 3T4AB 3TBSB 3WS6C 5E24E 3QARA 4YSCA 1SM3L 4L29B 3CBJB 3VGDA 1QWUA 4LMQE 5EZOH 1NMCB 4L2YA 4UNUA 3U46B 3VWJD 3OXRA 4HJ0D 2X4PA 3UEZA 4EI6B 3EZ8A 3ECVA 4X4YA 2FLBT 4GUPA 3WEMA 3MXVH 3GBDA 3UTOA 3SGDH 1WAAA 3VMPA 3OR6B 4Y1AB 3UMNA 2OCJA 4G70B 3TVMD 1C7TA 2XKNA 1FC1A 4GQRA 3V4VA 4OKDA 5HJ3B 2BIOA 4ORZC 1MFBH 1ZK5A 3HHMA 4K23L 1OT1A 1TQSA 2CWRA 2K6YA 2FR4A 1N5YH 2WQXA 3DSFL 1EDYA 2C1PA 1VEOA 3MRHB 4HAKA 4LLUA 2WBJA 2P24A 5IJVB 2BC4A 4H1LG 1TEYA 5HHVL 3S34L 1BHGA 3NZ8A 3WTWA 4AYDC 5IFJA 2DAVA 5KJRL 3IFNL 4BK5A 2VR4A 4FQXD 4E9WA 1MY7A 4CC4A 5GISL 2NSMA 2WQUA 3CGTA 5I17B 1BQHG 4I3RL 2WWOA 1UEYA 2XWJB 2XRAH 5CJBA 5DGRA 3ZKQD 5F93C 1N3NB 4RISL 3N40F 4BCYA 2HH0H 8FABA 1NFDB 4FTVB 1Q8MA 4AQ1B 1MCHA 1Q0XH 4G8FB 3FFDA 4YEEA 3HI5H 4HMDA 3DBSA 1QABA 2ZJSL 1BF5A 2CHWA 4WWOA 5I1AA 4ZOEA 4WTZA 2BW4A 4KAQH 4NUGH 4XX1G 2UXTA 4BH8B 4PJFA 4FNSA 5D2LF 4W9CC 1W0YT 4W68A 3IMWA 3FUNA 1HL4A 1HEJC 1V7MH 5KSUA 3BCDA 5JUEL 2VDOL 3ZMRA 2NNRA 4M93C 2I9TA 4HWBA 4LE8A 1XIWA 2B2XH 2DQGL 2N4IA 3T6ZA 2RFXA 4GMSH 1ADWA 3DROA 4Y5XB 4WAFA 1BMZA 4KNUA 4Y16B 4FA7B 2VDNB 3VI3B 2XFXA 3C6SB 4ZAKB 1NC4A 3IT8D 5LN8A 1MFEH 4J1UB 3X3FH 3NCJH 5FKPA 4YX2L 1BF2A 4MKMA 2B1AL 3PDOA 3SKJH 5HYSB 3WY4A 4FLRA 4MX7A 4G72B 3RDTA 1QUNB 5TF1H 4JFHD 5F3HB 3WFBL 1T66D 5BW7C 4R5TA 4I48B 4LOVA 3AJ7A 3SGEI 3CFQA 1PD0A 3NJVA 4HGMA 1GZHC 4WW2F 1NUGA 3ZPDA 4QOKA 3BKJH 4X6CB 2V2XB 2VDLL 4YHKH 4EZJA 3RY6A 3C5XA 2AXHA 2ADIB 5JDSA 2E7HA 2NY5H 3FF7A 1E9PA 3PJSB 3UTZB 4NP4H 1HYSC 4DHLA 3CLFH 4X7DC 3N91A 4DPCX 4QNPF 3AT8A 2GHZA 5I16B 3MLTB 2HN7A 4ZFZA 2X1OA 2ATKB 3KDMB 2BP0B 3RVXD 4Z3JA 1UB6B 2YZ8A 4TKWA 3EDDA 2NY2C 3UDWA 2G30A 3FSVA 4RMVA 4N2FA 5C0JB 5LXGH 4Z78A 1TZOA 3TN0D 5DJDB 2AGJH 3DLQR 5C0BA 3B2VH 2BVOA 4XH2A 4XNDA 3EDEA 3GBML 3B5GA 4OBSA 3N3EA 1BGXH 1HH6B 3OAZH 3WLBB 5BPPA 3D0AA 2MNJB 2ZX8A 5AVUB 5HHOA 3FOMA 1SXAA 3RUGA 4Y5YA 4L4TD 1MWAL 4Z5RB 4PJHF 3VFVA 2NY6D 4QRUB 2OULB 2O5XH 3DRTB 1JF6A 3MBEC 4XP5L 1NL0H 2R69A 1IB5A 1UZ8B 3NPSC 2BSTB 1I1AD 4KRNA 4GSXA 4JHZA 5C07D 3RTQA 3EXLA 1X9LA 2PTVA 5IG7A 4XMZA 1THAA 3PGDA 3BUIA 3BKYL 2R29L 3UBXA 1QSFE 1LEKB 5TGBB 4HHWA 1P6FA 2H6PB 4FNLH 2DLFL 5GSVA 1U92B 3FUEA 3HE6C 4N6RA 4U1SA 5SWSD 2CHXA 4JDZA 3ZMNA 3BJLA 3L95B 4H2AA 4NOBA 1Y07A 3MTRA 2VDNL 1WFOA 4JQIA 2L04A 4AEIH 1NCWH 3UTTD 3WE6B 3LPFA 4A7UA 3AQZA 5D7LA 3X13A 2B59B 2K7PA 3LS4H 2MOVA 3K0YA 1A6VL 1XH2A 4WSGA 4GSDH 1KCRH 1OM9A 3LRSB 4Z1PA 3KPPA 2H5UA 5ENWA 3P02A 2UWEB 3Q13A 4AQEB 3QUYD 1NBCA 5C6TH 2DMHA 4QIRA 4YXLH 4AIEA 1QEWA 1TJHH 1KYFA 4AT6A 1NIEA 5JHLH 4OB5L 1FUNA 2IDSA 1UASA 1I9IL 1YMHA 4JQVC 5DMIH 4JFPA 3HB3C 4R7NB 2ZXBA 1XBDA 3N1QC 3JV4B 4NRXA 4UTCA 4XWOC 5I8CB 2YJQA 5D7KD 3E8UH 3WNPA 1SEBB 4ONFH 3WD5H 3QO1B 3WDHA 4YQXL 2WN2A 2BVPB 4HJGB 1CUOA 3C09B 5FYJL 2F53E 2ZWZA 2V7NA 3RIFK 3DPBA 1H3PL 3BN3B 4GKOA 4HMEA 5JOFA 5DURB 1ZPLA 3FC8A 4X98A 3TONA 3WIHA 4ALAC 3WL9A 3O2WL 4ZT1A 1BJ1H 3SYOA 5IF0B 1NCCL 1BEYL 2VN4A 3BHBA 3MJ9L 2HYMA 1JN6A 4PRIE 4EDXA 4HBQA 4X6BA 4HT1H 1KTBA 2XWDA 2LV4A 1NUDA 2O6EA 3BSZA 2YQBA 3LKNA 3B2XA 3CLWA 1ZLWK 5AYUH 5DA0B 4DZBB 4F58H 3CH1B 2ALWA 3CSPA 1E3FA 1R3IH 3ARFA 5F96L 4P07A 3HN8A 3KJ6H 2WINA 2FBRA 3MODH 1AYRA 1M6OA 1OF2A 2Q86A 2XA3A 3BYYA 5C0FB 3LVEA 5E03A 4JGJA 4BZ2H 2F19H 4WY7H 4RAVB 4JDVA 1GOGA 4LHQB 4H25A 1HK6A 4PREA 1XQ4A 2CKNA 3MFGB 1P1VA 5FYKU 5LHDA 3OKDA 4D7BA 4UTBA 5LQBH 5G5DA 4LDCA 5FGCE 3NK3A 2Y1AA 1RHFA 5BS0E 3DTDA 2IFFL 2YAQA 4DPAX 5IW6B 1L0XA 3EJSA 3TYFA 3P2TA 3D6GA 4MDIA 1UA6H 2AEQH 4U1IA 1TZGH 5H37A 5DR5L 3X3GH 3K5SA 4LHUB 4GS7C 4QRSB 3IJEB 1U95B 4TQPA 5I1EL 4YHML 1OAKL 3M6DA 3F12B 3RGVD 4Q8BA 1TETL 3TASA 1TNNA 3TP4A 5IJDC 4Q9QL 3T5WA 3D25A 2XA8H 2IV8A 3X2QB 4Q52A 5FK9A 3ZL1A 1RZJL 5KVEL 4CW1B 4U1NB 5CILH 4HLEA 4R9HA 2IBBA 2AANA 3M88A 3IMBA 3QR0A 3O3EA 1NLDL 1FFOA 4BUHA 1I82A 3IDGB 3IN0A 4LKCB 4MNGB 5CU9A 5IBUG 3VW3L 2NY0C 5I15H 3DTXB 2NZ9C 4LL1A 4N0CD 3QPXL 4GXVL 1P4BL 2VXTH 1KC5L 4MMXA 4KRPB 3UH8A 1AG6A 1FFPA 2GSIA 4DQOH 4MB4A 1H8OA 1T2JA 5CCGE 1XH0A 5FA3A 3TCLA 1IBYA 1N8OE 3MXWH 1BQLL 5C0AD 3T8XA 3G6JB 1EJFA 1PJ9A 5F3BB 1HNYA 1N12A 2O6PA 2WQRA 3CXDL 3PABA 4NQXB 5F6IC 4JHWL 3ATBA 3N41F 4O51B 4UQAA 2R23B 3LZFL 4WHTB 3V4VH 4HJ0C 5MENB 1N6QL 4IOIA 3NSDA 1B0GB 3QI9A 4MZ3A 4QAWA 5DO8A 2VITA 2Y1VA 1G9HA 2UY7B 4KY2A 5H94B 1O0VA 3VXQA 4AEEA 1JHLL 5I66B 1LLAA 2DMKA 4NYLB 3FZUD 1A5FH 1NQBA 3Q01A 3QWOA 4R8WH 2FSDA 4XAKD 2GY5A 3QG6B 2VLRA 5CGYD 1LP9B 4JM2A 1L7TH 1RU9H 3TWCH 2WQSA 5DJAA 4AM0B 3IDXL 4PGEA 3DX6B 1WBYB 5E2WL 2ADGB 4ELKA 1MIEL 3KXFB 2PYFA 2E7BA 2K1MA 1TTUA 1RZ8A 3F7VA 1UYWH 2LU4A 3W57A 2D31A 2J6EA 4AZUA 4ESKA 3VX0A 4ODXA 3T2QA 1M9WA 1RZIA 4A39A 1XGPB 4YSPA 3CBKB 3SDYL 2WUBL 2V17L 4ONGH 4N2GA 1J1OH 3PUUA 4MNQD 4QHLB 4JFDB 4FQPA 4LSUH 1TOXA 2OW7A 2ZNXA 4TL4A 5DJXB 2YD2A 4JFOA 3R0MA 3ULUL 2FWLB 5ICUA 1CLZH 3VFSB 1PS3A 2PWFA 4GG6F 3U79A 4JG0L 2DQTL 2IOIA 4L8CA 5EOCL 4J3OG 3AU1B 1UXSB 4HHAA 3TEUA 4FFZH 2JKXA 2PWGA 4O9HH 4LEXH 4OGYL 4OT1H 5BNXD 5L2KA 1PVHA 3U9PH 3CFTA 3HJEA 1F4HA 1K4DA 3OTTA 4NZTL 1QBML 4M93B 5JPMC 3DO7A 2UZPA 3PL6D 2BNRB 2P7TA 4X4KA 3V8CA 3L4WA 3KVDD 5C0ND 4CILA 1XZWA 4WEBH 2ZXAA 2YQGA 3R18A 5EOCJ 3FQNB 1WC7B 4CBZA 4M7JH 4ZOBA 5E8PB 4JRYE 4YXKL 4EVNA 3NN8A 4JKPL 4Z8FL 2XBTA 3NP4A 3MAWA 4PBDA 2CMRL 5EA0H 3M1OA 5TD4A 2XJLA 3STLA 4GJTB 2FATH 4HWEH 1Z7JA 4DO5A 2DTMH 1IM9D 2OJEA 1WS7A 4ONOA 3WIIH 5ICYB 3HNTL 3BH4A 4HLJA 4AYMC 3PWPA 4AYBA 1X5FA 3ZJAA 2P26A 2V5YA 1NDTA 5BJTA 3OGCB 3SGKA 2FNBA 1N8ZB 3GSXB 1SPDA 1T66C 4APQD 1PLCA 4LXFA 3VG9C 4FCHA 3OKKB 4LO9A 3LEYL 4A67A 5IBTH 1IL1B 4L5FL 5K33A 3VXRA 2JK5B 5KN5A 4BZ1L 2Q76A 4FQ1L 3N42F 2X6MA 5A40E 5T1MB 4K5PA 4WSJA 4G9FE 3T0EA 4NQTA 1U9KA 3LZLA 3UJIH 3ARDD 5DC2A 5JXED 3D3VD 2AKRB 4LCUB 4ANKA 3GI8L 3O0RL 1Y6KR 2NY2B 1EJOH 4G80A 3AREA 5AVYB 1TPXC 5LBSH 4NN5C 3P0GB 1YUHA 4NKIL 1YNLL 3UBGA 1MJJA 4J4PD 3TNMB 4MS8D 4FJ6A 4NQQA 4AL8H 3RVXC 3GLZA 3PY9A 3FO0H 3L6FA 1ASQA 4NNYA 4NJAL 4I1PA 1DANT 4F9PC 1U3HC 3QUZC 1OARL 3TN0C 3O45A 5CEYB 1J5OH 4PSPA 3K2IA 4HFWA 3F64A 4O2CB 2DQIH 4R3SB 1TEFA 3Q8EA 4HIHA 4ZS7L 3MBEB 3VFUA 4G6ML 3GM0A 3QFJB 5CF3A 1U8MB 3FT3A 5EIIG 2BSRB 2R69H 2RCSH 5GS0L 3AT0A 3TT3L 4LSVH 4HULB 5T3ZL 1A9EB 2V5TA 2QQKH 3RL1B 3HMXL 2ICEC 1A7NL 1T0NA 1HHHB 1M05A 1F6FB 3NPSB 4ZRGA 3ROLA 2NY6C 3RY4A 2XQYA 4TNVK 3VD3A 1I9JL 3J2PA 2ATAA 2AJYH 4TLKA 1ZTXL 4PGCB 4ZUUA 3NFSL 4NO3B 3WUWA 1YPZB 1JDDA 1S7XB 2BSSB 3FT2A 3HE6B 4YPGA 3ZDZF 1I1AC 1QG3A 1A2YA 4Z7IA 3WHE1 4JQIH 2N1KA 1KPUB 3LKRB 4PRPE 4PVBA 3KM1A 1KIPB 3NJJA 3MBWB 2W60B 2KLSA 4PJCA 2VE6A 4XP1H 1ZE3C 1K3IA 3BDYL 5DD0L 1E9OB 3OJDA 2R51A 3A6OA 3HCVA 4PS7A 3LDBC 1ZA3A 3QIBD 1D5MA 4XVUD 1IC5L 1QFOA 1YEFH 3I9GH 2Z0UA 2YD6A 1NCIA 1RV6X 3E6FA 3WNLA 3EIFA 4IMKC 1K8DB 4OD1L 3QG7H 1ASOA 3HB3B 1K5WA 1I4FA 1XXDC 5F2FA 3D30A 3HUJA 3FUFA 3QUYC 5C0DA 1INQA 3VA2C 1IVLA 35C8L 1E4KA 2NUTA 1UXLA 1XF4A 5H35A 5KVGL 1M3IA 3UO1L 4LCIH 1ND0B 5EDSA 2WKGA 3BUDA 5FHBH 3KPRE 3O6FC 2ICCA 3BH9B 4OF5A 5CINL 5K9JH 4MVBD 2IH1A 1E4HA 3IRZA 1GSMA 4YN3A 5FYLH 3MRJB 3WIHH 3II2A 1TTGA 1SYVB 4JFUA 5DT1L 3FOLB 2G60L 1MCQA 1UWGH 4W6YB 1DQQA 3OMNB 5EU6B 4LVOC 1B4TA 1E0OB 5KANI 4AGMA 5AVWB 1QLEL 3QJQB 3NSXA 3RWHB 4M7KH 4PJDA 4M61B 5DLMH 3G6AA 5I6MA 1X5MA 8PAZA 2NXZD 2OJ1A 3C08L 4MRBA 2C9XA 2AF2A 4P2QE 1BWMA 1G43A 1X4ZA 2P8PA 5C70A 4TTGA 2VZ3A 3SHSA 1SLVA 3K6FA 3FT4B 1CFQA 2J8UA 1S7SB 3J27A 1BD2D 3QDJD 4GKZA 3EYVA 3LIZA 1WFUA 4V1DD 4GO6B 3Q6GL 2WIIA 3E9TA 1D7BA 4ILDA 2ZOLB 3TBWB 1IBBA 3OXSB 4FULA 4MJ4A 4NZJA 4UTBH 4XPHL 1Y7VA 5INDA 4MNHB 1PZDA 1CYGA 5C09E 4NO2B 5B3SB 1G6RL 2JQAA 1EDQA 1DVUA 3GRBA 3MNMA 2XSKA 4PJ5B 1NFIA 1JNLH 1X5HA 4I3GA 3UOAB 3WKPA 7FABL 5IEHA 1BXVA 2ZOKB 1QW9A 3OB0H 3VFMB 5EN3A 5FUZH 2H6UA 3AG3B 1H8SA 1G7PA 4GS7B 1MCFA 1X7TA 3AWFA 4G11A 1M2VA 2P5EB 1R9FA 3BRFA 1FCCA 5AG8A 1KJ3L 3RWIB 4Q58C 4KO5A 5ITFA 1KT2B 2OL3A 1BVKA 4FLOA 3EJCA 2XN9A 2WLYA 2IAMD 4U1KB 1DBAL 1F3DJ 4AG4L 5I26A 3NQKA 5ESAA 3DOSA 5EFIA 4RFEA 5I74C 4AY0A 2BDNL 4MB3A 2IC2A 5DD5H 3G04B 3LKOA 3LSOA 3QQ3B 3ZLQC 1CFTB 5HHPA 3WELA 2YKLH 4POYA 1GYCA 1KXQE 3I6GA 1GC1H 2VKWA 4Z7WA 1MY5A 1DN0B 1CWVA 2B5IC 2HLAB 3HC0A 4B9FA 4WZ9A 4XB7A 2ZOTA 3CZUB 4PTUA 2IH8A 2K3HA 4J3OD 4LU5H 1QVOA 2BVQA 3GIVB 4MA3B 1JGEB 2UX7A 3P9LA 4KVCL 5DHVB 4N0YL 2C3VA 1YECL 4N0CC 1TJGH 4MXVF 5LCVL 1MHHA 3KNBB 1HESA 4PP1D 4TLUA 5DJCB 1QZ1A 5LGKA 1ZA6A 4A2DA 1S9YA 2BSCA 4MQ7B 3TTYA 3F85A 1I7UB 3V6FA 5F6IB 4IGBA 4ATTA 2F5BH 5HDBF 4OM1L 3QQXA 1G84A 1LHZA 4Q9CA 3LIUA 4KVNH 1RUKH 5LGJB 5MERB 4XXWC 3RIFF 4DOHB 1T3FB 3G5XA 1V27A 2JB6B 1F1DA 2OP4L 2RACA 3NEXA 3B7YA 2Q7YA 4L1HA 4X6DB 3F6IA 2P8LA 3DRQA 1WBXA 3MA9H 4MJ6A 2WWKT 2QZQA 5HYEA 1DQLH 4HV8A 5JYLA 3ZE2F 3R06B 4X5WB 3O4LB 5INCA 4LT7A 2E74C 5JQ6L 4YBHA 2A9NL 1T1XA 3OX8B 1SGKA 1HHKA 2F54D 4UOJA 3SDXF 3CK0H 4BINA 2VOTA 2JELL 3MRKA 3BE1H 1BVLA 4NB7A 3FQRB 4ZQKB 2PPFA 3PV6A 3W39B 2P8MA 3FPXA 2XKSA 1UD8A 3RNQA 4DUVA 1E5BA 2P47B 1OAYH 2NTSP 4O4YL 1HJBC 5F9OH 4X4ZA 4PRNA 4JO2H 4DGYH 3MV7A 5F6HJ 1JMZA 4TYUA 4NZFA 3HZ3A 4X42A 5BXFB 1U3NA 3D0VA 1HZLA 3KYOA 2JIXD 4TSBL 1YN7A 4ZFFB 1AIFA 2YAFA 2AK1H 4YVNA 4MD5A 3N0AA 4M29A 2J44A 3L5XL 2LFGA 3AU0A 4NO0A 1UWYA 4XHJC 1KFGA 2RJMA 1NINA 3B2DC 4HH9A 4QGYA 3O3BA 2P42B 5JPMB 1UT9A 3L5WA 3L9RB 1HCZA 1KTKE 5FW6A 4QUOA 3PP3H 2MHAB 4UM8A 1M56B 2Z1KA 3CFCL 1S3KL 3QNZA 4L23A 3PL6C 1NOAA 3TYGL 5C0NC 1D2PA 2OTPA 1G9MH 4HIEA 4KX9A 4EEEA 2Z31A 1FNLA 3NG5A 4GP8B 3PHQA 3VI4E 5BRZE 1YMMB 1KB5L 2OZ4L 2FX9H 1NEZA 1QPXA 1WTGT 1MCNA 2V0AA 1Z9NA 5ETUB 2FEEL 2OMTB 4FX5A 4HWZA 2A3TA 3VG9B 5KBLA 3CXHK 3G08A 3OSKA 4PG2A 2G2RA 4AKPA 3ATFA 3HHSA