4QLWA

Azurin mutant m121e with iron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Redesigning the Blue Copper Azurin into a Redox-Active Mononuclear Nonheme Iron Protein: Preparation and Study of Fe(II)-M121E Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4qlwA00
3NJNA 1DYZA 2LLNA 3FQ2A 1NIBA 1PMYA 1MG2C 2OCCB 2XYBA 5D4HA 5B1AB 1NIEA 3S8FB 2IDFA 1NDTA 1HFUA 2ZXWB 3TASA 1SJMA 1GYCA 4HCGA 1NZRA 1BEXA 4E9WA 3SBPA 5I6LA 1EZLA 3AG2B 2E86A 1AS8A 4UF7C 2FTAA 1A4BA 2GSMB 1PZAA 1WA1X 1XB6A 2FQDA 1JZIA 5EHFA 1J9SA 5PAZA 4GYBA 4L0PB 1MG3C 3NSYA 3DKHA 3UAAA 5I6MA 3FSZA 3FU7B 3UABA 4KOCA 1IBYA 4DP1X 5AZUA 1NINA 4E9YA 2IAAC 1CUOA 2IWKA 1E5YA 4ENZA 2JXMA 3WKPA 2BWIA 3FYEB 1WS7A 3IEAA 2BP8B 3EH3B 4PAZA 3ZIYA 4E9QA 5ANHA 3TBCA 1V55B 2CJ3A 1XMEB 1QLEB 1CC3A 1KV7A 1JZHA 2FQEA 4BK5C 3T6VA 1ET5A 3X1GA 1A8ZA 1L9TA 2AANA 2B08A 1AACA 1WS8A 3EH4B 3NJJA 2CBPA 4GXFA 2HX7A 3FU8A 4P5SA 1L9OA 3PLYA 3EH5B 7PAZA 4CSPA 2EIJB 2P80D 1BQRA 3UACA 2YAMA 1SFDA 1SHWA 1ZPUA 1B3IA 4X4KA 4YSRA 2VW6A 1PF3A 1QHQA 4DP7X 4F2FA 1PLBA 2BZCA 2XLLA 2PPEA 2HX9A 2XU9A 3WNJA 4A2DA 1M56B 4KOBA 4YSTA 5AKRA 2GIMA 4AX3A 1PZCA 1PCSA 2VMJA 1SDDA 4BWUA 2I85A 3DIVA 3OD3A 1AZRA 5TK2A 3IN2A 2ZOOA 1JZJA 3TU6A 4QKTA 4E9VA 1ILSA 2PP7A 1QNIA 1KBWA 8PAZA 5AFAA 3CDZB 1E5ZA 1WA0X 2R7EB 4DP8X 1MZZA 2FQFA 3U25A 4BWWA 2CUAA 3IBOA 4N8UA 3ABLB 4DPAX 5B1JC 2BP0A 4BDVA 1E65A 2WSDA 4A2FA 3S3DB 1PAZA 4HCIA 3OM3B 1AZNA 1L9QA 2YAPA 3SBRA 1GSKA 3JT2A 1L9PA 1OCRB 3NJIA 2GBAA 4F2EA 1PNCA 3C75A 3T9WA 4YSCA 4YSEA 4UANA 1RZPA 1OCOB 2PPFA 3CZUB 4M3HA 1NPJA 2FJSA 2YAFA 3QPKA 3AG4B 4G71B 1IUZA 4G7QB 3FYIB 3CVCA 2NRDA 1CYXA 2FWLB 1URIA 5B7FA 1AG6A 3PXLA 2VN3A 2AFNA 2X88A 3PCYA 2XXGA 2N0MA 3X1BA 1GS6X 2TSAA 1JZFA 2YAOA 3KW8A 1JVLA 2HRHA 4F7KA 1L9RA 1ZIAA 2XV3A 1VLXA 2Y69B 4Q8BA 4NAJA 4AKPA 4AI7A 4HHGA 3FT0A 4NB7A 1AZBA 4KO7A 4YSDA 4ZK8A 3ASOB 2OV0A 2XUWA 1WAEA 2XXFA 3WG7B 1AANA 3D12B 3N2JA 3PAVA 5FC9A 1BXVA 3T6XA 1KGYE 5I5JA 1PNDA 3S3CB 1J9QA 4E9SA 4GP4B 4A67A 4P5RA 4RH4A 6PAZA 2J5WA 2J57A 4M4RB 3ERXA 2GHZA 3IE9A 1N68A 4MFHA 2BZ7A 3QJRB 2YXVA 3FPXA 2HRGA 1E30A 4HIPA 4EF3A 2YAQA 1NIFA 3AG3B 3OMNB 2YXWA 4A2EA 2UX7A 1PLCA 3OQRA 2FT7A 4E9RA 3UAEA 1V10A 1KBVA 3NJMA 1ZDQA 3OMIB 1KCWA 1J5CA 2PCYA 4DP9X 3CG8A 1RKRA 2B3IA 1GY1A 2XX1A 2VM3A 4BXVA 4PCYA 3BVDB 2EILB 3NP4A 3CVBA 3AG1B 4TXVB 5LDUA 1SF5A 1ASQA 2XV2A 1NICA 2BW5A 2H47C 3NYKA 3V9EA 1J9RA 2IDUA 1ADWA 2PPAA 3TA4D 1TEFA 4W1TA 4AZUA 1V54B 1AS7A 1GS8A 2VW4A 2UXGA 3X1FA 3GYRA 4KNUA 3FSWA 1TU2A 3FSAA 1X9UA 2GC4C 4KO5A 1RCYA 1SDDB 2Q5BA 5TK4A 4DP6X 4G7SB 9PCYA 1ASOA 4KNSA 2XVBA 1HAUA 4E9TA 3T6WA 3T6ZA 3BQVA 3SBQA 1XB8A 2BWDA 3H4HA 1A3ZA 4KNTA 4YSUA 3TBBA 1JXFA 7PCYA 1OE1A 5I6NA 2TSBA 4WKXA 2DYRB 2DWTA 1GY2A 3CDZA 1T5KA 4BXSV 4YSPA 2UXVA 4A66A 2YAEA 3WI9A 2BW4A 4NERA 2FNWA 3G5WA 4BDVB 2BP0B 1NWPA 1FWXA 1M9WA 1OF0A 5B1KA 4A2HA 3QJQB 5I6OA 5I5MA 2YAHA 3HEIB 1JZEA 4KO6A 2I7OA 1OOWA 1MDAA 3WKQA 1PZBA 1CURA 6PCYA 3QJUB 4YVNA 4N4YB 5PCYA 3NJHA 1NWOA 2ZONA 2GI0A 1W6WA 1BAWA 2DWSA 5F7BA 4AKQA 2QDWA 3S3BB 4G70B 1WA2X 1ZIBA 3H4FA 1OCZB 3ZX1A 2PPDA 2BO0A 1OCCB 2XV0A 4YL4A 2PP8A 5B1BB 1ID2A 3FU9A 1A4CA 2X87A 4YSQA 3QJSB 3ASNB 1A4AA 3NJFA 2OJ1A 3WNIA 5I6KA 1XB3A 1NPNA 2J56A 2VW7A 4HZ1A 1N70A 2I7SA 4DPBX 1OV8A 2RACA 1NIDA 2Q9OA 2W88A 4HHWA 5A7EA 2YARA 1W6LA 4K9JA 1GR7A 1IC0A 1M57B 2AZAA 2GC7C 2H5UA 2JKWA 2AZUA 3KW7A 4FAAB 3ZBMA 4WTQA 2VSMB 1J9TA 1JOIA 1UATA 1X9RA 1JXDA 3FU7A 1FA4A 1YLBB 1AAJA 1CYWA 1J5DA 2QPDB 1AOZA 4UAHA 1DZ0A 1ZDSA 2QDVA 3IN0A 1EHKB 3L45A 2PP9A 4JKNA 2IDTA 4HALA 1AS6A 5D4IA 1L9SA 3NJLA 2IH8A 3NJKA 1SFHA 2AVFA 3QJTB 2BP8A 3X2QB 3WIAA 1BXAA 2GB2A 2UXTA 1BXUA 4GY4A 4DPCX 1SF3A 5IY5B 3RYMA 3NSCA 3AW5A 4W9ZA 4DP4X 3ZDWA 1GS7A 3PPSA 3N55A 3UADA 1OE3A 5F7AA 1E67A 4HAKA 2UX6A 4GP8B 1AZCA 1MZYA 3DTUB 4A68A 4YSSA 2MTAA 3NJGA 2DV6A 3EHBB 3NP3A 1JVOA 2DY2A 1FFTB 3FPYA 3HB3B 2FQGA 1SNRA 1NTDA 1AZUA 2HXAA 3QJVB 4G7RB 2MRYA 3ABMB 3PAZA 2H3XC 2XX0A 1AR1B 1BYPA 2PPCA 1KCBA 4YVUA 3GDCA 3NSFA 4GP5B 1W8EA 2J55A 1AQ8A 3FSVA 2YQBA 3JTBA 2ZWNA 2HZHA 1OE2A 1A65A 2UXFA 1ZV2A 1R1CA 1IBZA 2HLEB 2A3TA 3FS9A 1JZGA 4QLWA 5I28A 3S8GB 2HX8A 2CALA 2PLTA 1HAWA 2CCWA 2IDSA 1ET8A 3ABKB 5D4JA 2Y1AA 1ILUA 1SHXA 2DYSB 1AIZA 2EINB 5I6PA 1I53A 2P80A 1ETJA 1TEGA 1KDIA 3NSDA 3SQRA 3MX0B 4YSOA 1RZQA 3EF4A 2R7EA 4JHUA 4YSAA 3CVDA 2VSKB 2CAKA 3MBWB 2IDQA 2JFCA 4JHVA 4AKOA 4G72B 2VM4A 5E9NA 4DP0X 2QT6A 3ABGA 5I5IA 2QPEB 1BQ5A 1F56A 3UGEA 3AY2A 1JXGA 2EIKB 4CSZA 1TKWA 2FT8A 1ET7A 3FQYA 4DP5X 3T71A 1KDJA 2XWZA 3GXUB 2IWEA 4KO9A 3FQ1A 5B7EA 2W8CA 3PAUA 3X1EA 5B1JA 4A2GA 3NT0A 2IWFA 4Q89A 1AG0A 2EIMB 2BHFA 2IH9A 3AZUA 4HCFA 2WO3B 3H56A 1JERA 1IKOP 2FT6A 2WO2B 1PY0A 4DP2X 1BYOA 1PLAA 2PCFA 1KYAA 5B7MA 3OMAB 1ASPA 3X1NA 4FA7B 4E9XA 1GW0A 1NIAA 4BWTA 5B3SB 3V9CA 5I26A 1BQKA 3QQXA
chains in the Genus database with same CATH superfamily
4JDZB 1G1YA 4DGVH 2RAMA 4R4ND 2D7TL 3ZDXE 4A6YB 3HE7B 1Q0YL 4L8SB 5E1GA 3FQUB 5DYOA 5GRVL 1NZRA 1H5BB 5JZ7C 2E3VA 4KVNL 3HFML 3B43A 4NNXB 5CSBA 3EFFA 5T1LA 3RILA 3VH8A 1BP3B 1QEXA 2VR6A 1BFVL 2AK1H 4MVBD 5AVYB 1ESOA 2LOEA 4HUNB 2V2TB 5C07A 4QXGL 1IGMH 1XB6A 3VWJD 4F33B 5J9PB 3AREA 4QF1A 5AW0B 2Q8AL 1LO4L 1CTNA 3FSZA 4UOJA 4MMYA 4V33A 5DRNB 1UM4L 1F3RB 4XWOD 3ZO9A 3D08A 2QVIA 3GKWH 4CC0A 4TNEA 1SOKA 4MA8L 2LFEA 4QCIA 4WI7A 5I74C 3WENA 1RZ7L 1A1MA 2YRZA 3MUGA 3CK0H 1DANT 1PKQA 2CBOA 5CU9A 3DHJA 1BPLB 1JZHA 1OWWA 3ZRSA 4FE9A 3UTTA 5F1IA 5D1QE 4KI5C 5HHVL 4PRIE 4PGEA 3VXOB 1WIUA 3VNZA 4L0YA 1L9TA 2WZPA 2JSFA 2WSKA 3QB7C 3DO3A 5DRWB 2JELL 1NC4B 1QRKA 2HX7A 4UTAL 4IKIA 1DBBL 3PLYA 4GW5B 7PAZA 5EFIA 1XAKA 2K3HA 2X6MA 1MJ8H 2AQ1A 3U4KA 3HZYA 4MCYA 1OP3H 4YHYC 1V5JA 5FA4B 4DO4A 4N28A 5CD3B 5AW2B 4LASH 2FO4A 3S4SG 3IGAA 3MJ8A 5GGTL 5E5LA 4LL9A 3GO1L 2FCBA 1OAKH 2NY4B 5EU6D 1WFTA 1YYLL 2WTRB 5GZOC 5DTFA 3OSKA 2C5DC 1CI5A 3O41B 1JV5A 3S5LA 3H2QA 3V0AC 1FVEA 1PZCA 4PJCF 5CN3A 1SDDA 5D7LB 1IAOA 1FIGH 2BCKA 4P5KA 3TO4C 3HC0B 1WAAA 4ZNEA 4L23A 4UCFA 1R3KB 2PP7A 3GKZA 2B39A 4ZUVB 1H6EA 2CLRA 3N43B 4WTZG 3A67H 5T1DH 3QDME 2F08A 4M56A 3FH5A 5HHPB 3N42F 4IRJA 2A6DB 4WWOA 3BKJH 5DJCA 1AP2A 2DEYX 3GXPA 3MRJA 3TZVB 4NQDB 2QPFA 5ACZA 1M7IA 3M1OA 4CBZA 1QW9A 2NZ9C 1JXKA 2ZAIA 4G7VL 4KK8D 4CADB 3IMBA 2O6CA 5IFJA 3S3SA 1ZSDB 4P2YA 2AJVL 3SBRA 4ZQTA 1ZLWH 3GBDA 5ABDE 3E7JA 3ZZSA 1BWWA 4MB3A 2OW7A 2GTWB 3I6GA 3IFOA 4UANA 4YSEA 3QHZL 3GBLA 1EEUA 3KCPB 3MZTA 4X6CA 4X8JA 4KTEH 5EH1A 5LG1A 3IDJA 3PG2A 1YEWA 4PJEA 3QORC 5T1LD 1RIHL 5F7DA 1UD2A 2AQ3A 2UWEB 4OBRA 3FUIA 4N2NA 4JPKL 4JCLA 3MNWB 1XIWA 3U4BL 5C07D 1GGYA 2NYYC 3RI5F 4HIHB 4B50A 3ARED 1L9RA 1JK8B 4A7GF 2DH3A 2F8VA 4JFZH 3D69A 2XA8H 3QUHA 5ALBH 1IGJB 5B21A 4FERA 1A3RH 5CZVH 2YQ2A 2E46A 1QYGH 2BVYA 4LEEA 3ASOB 2ZWSA 2W0PA 3OXSB 2OMXB 3RVWD 4AZ8B 3D18A 5TE7L 2C3VA 4F24A 2ZWLT 3SKJH 4FJZA 4HIEB 4MHHG 3ZOAA 3KBHE 3MODH 4NO0B 2YA1A 1VADB 1WH0A 1XH1A 4LP8A 3OR7B 2DTML 3UTTD 3RI5K 4PGDA 3HI6L 1KLFA 2BSRB 3WOVA 1CVRA 3WEOA 1NFIB 2QZ5A 2WZPD 5GS0H 3QQDA 3TPKA 5HVFB 3T77A 3EDFA 5EF1A 3HJ0A 5C3IA 1EK3A 1UYWH 2QTEA 2X89A 3FOMB 5INCA 4YEFA 1NIFA 5AKSA 3PQYE 4G80A 1KB5L 4B9ZA 5JO5A 3WDIA 2VDQB 3IS1X 2Z35B 3QNYB 5JNYA 3BN9D 1V10A 4I2XB 1AFVH 4FMVA 1P2CB 1XSOA 4AVKA 2E74C 3RVUD 4HOXA 3QFJA 4MXWH 4NRZB 1SEBB 4XVJL 4Z18A 2HJFB 2H8PB 4M6NH 2VM3A 1O9WA 3VVVA 2BSSB 3VXOA 3QRFM 2E7LA 2VXUH 1OSZA 2XT1B 3REVA 4ZXBB 5JHBA 1ZE3H 4ZJ9A 2FEJA 1FNSL 2FHFA 3LKRA 1ZJBA 4WK0B 3CGTA 4WWKA 2Y7QB 4I3GA 3WELA 1S4IA 2GTQA 1ADWA 5TE6L 3GMPB 3WJJC 3BGMB 4RZCB 5J13C 1KIQB 1TLKA 5AB9A 4I9WD 4C83B 4IRJD 1CLOL 1N59A 2VABB 4UNUA 4XNDA 4GUPB 5HHMB 4YHZL 4CC1A 4QRPE 3ZKMD 4DZ8B 4ZO6A 5EUOE 1HHKA 2CHDA 2IANB 2FL5B 4G8IA 4U2ZA 5I76A 1QKZL 5HPMB 4F7TA 5J0BA 4X8XA 4P9MH 3IM1A 5TDOB 2DQCL 4ES9A 1MNUH 3GC3A 4ZUVA 5JOPD 1OE1A 1FP5A 4KQ3H 2WBWB 5EZLA 3KGTA 1T5KA 4P59L 4M9OA 4LCWB 4G9FB 2J21A 4TTGA 2A6DA 3P3UA 3UC2A 4BKLA 5MENE 2BW4A 2FB4H 1F4YL 3BWAA 3QCVH 3C5SA 1NWPA 3DETC 3TZVA 1HXYA 4KRNA 4JFDA 3U2SA 3GJEB 2I7OA 1XIWD 2B8OT 1KC5L 1MDAA 2ZPKH 3MLTB 3ISYA 2NY7H 1YMME 4LARH 4HUCA 1NMBL 4ETQA 4PRDA 2IWGA 1LXMA 2GFBB 3GXMA 1OM9A 3KYMB 2N56A 1YAIA 1YPZB 1F6AB 3RVTD 5KSBB 2N59A 3BE1H 1BAWA 2WKGA 1N18A 3JV4A 1U92B 3KCPA 3QCUH 3SGJC 1QBLL 4D9RD 3G6JF 2HJKB 4ERSL 3WXVL 1UTDA 2VT0A 5BV7L 3VW3L 1MPAL 2YRBA 1WP6A 2EEXA 1HH9A 1X5FA 5ID0A 2V5TA 4KJQD 2DWXA 1M05A 1QZNA 1SLXA 3AB0C 1INQB 1C16A 3BIKA 5D1ZA 3WJLA 2RHEA 3WMPA 5IV2A 3G7TA 1S7SB 1HSAB 3CFTA 2Q8BH 4HIJB 2BVUA 2X6VA 1MCWM 2RACA 1JPTH 2X89D 3MV9B 3U7YL 1UOLA 3ULVC 4PJIF 5IOPB 4EIZC 1PG7L 2R0LL 1E9QB 4NBZB 2GVYA 1GR7A 5DS8B 2O61B 5EU3A 2Z31A 2VZSA 3BI9X 3B7SA 4N5ED 3BKYL 3VD2A 4FFYA 4D8PA 1RK1A 1PSKL 4Y4KB 1HIMH 4NO0A 1WO2A 1JOIA 4NM4L 2WW8A 3WCYA 2Z92A 3QFJD 1VADA 3FMGH 3L3DB 4PB0H 1G6VK 2O1AA 1AGEA 4UAHA 1DZ0A 3EGXA 4M62H 4QLRA 4L3EB 4X4ZA 4CMHB 2A9ML 1ADQA 1C1EH 4PRHB 3KEDA 2F5AH 3VXRB 4L2YA 2XKNA 6FABL 1S9VA 5D5MF 1LK2A 3QS2A 3UTSE 1MEXL 3S0PA 4IIQA 1KV3A 5ESQB 4WWKD 4JGNA 1ND0A 2DQDL 3GQFA 3SE8H 4WCYH 3BO8A 3SY0A 4Z78B 2EYRB 3LRHA 3VDCA 4YDKL 3QNYA 3HUJF 4MZ3A 4I2XA 1OALA 2CK0H 2OBGA 2DQ6A 1WV7T 2GSGB 4JO2L 5ID1B 1P2CA 4ZG1A 1BM3H 3U48A 1UT2A 1EO8L 4XVUD 1EEYA 4UQ2B 2XWCA 4XNXH 3MJ9L 2O4EA 2R4RL 3FRUB 2OXHA 3CZGA 4CW1B 2HJFA 4KROC 5EBWA 2H3NA 1EXHA 1GPOH 3RU8H 5I6XC 2BSSA 3Q13A 4LLDB 2VDPL 3TC9A 1E90A 3PAZA 2BDNL 1OTUC 2ZT9C 2ADIA 1YY9D 2VCOA 3MJ7A 3CSFA 3PWUA 4AWJC 3OGOE 3NIFF 1W8EA 2L0DA 2QSCH 4XNMA 5IB3A 1AKPA 5IR1B 1PDKA 2Y7QA 2YQBA 3CLEH 2C4FU 3N04A 3IAQA 3NCJL 2IDCA 4C56B 3GMPA 3IDMB 3Q1EA 1OL0A 3NACL 5CGYC 2X38A 2YUVA 4LO9A 2WXFA 1OKEA 1Z66A 4DFHA 4NC1C 3TGXA 1NEZB 1DVZA 4Q4EA 3RG1C 1U58B 1F1GA 1GZQB 3HG0A 4JFDD 3BDYH 5GGRY 3SJVE 4P9HC 5IKCA 4A04A 2EKJA 4RFOH 4LU5L 1FJ1B 5ICYA 2IANA 2WWNA 4IBVA 2CR3A 3HIZA 4H8WL 2P8PA 4KKPA 4O5LH 4N2GA 4QTFA 5IVZA 5TDOA 4YSAA 3IFLH 1DO6A 3ESPA 3MBWB 3IMTA 2VXVH 3F04A 2CK2A 3BOVA 3GHPA 1G5GA 3S88L 1MFVA 2R2BB 2VERN 4MQSB 5ADOH 3P3TA 1PVHA 2IQ9L 4KUCF 4QHKJ 2G60H 1BG9A 4G9FA 4IMKA 4LVNB 2G2RA 1AXSB 3S37X 4RMBA 2CIKB 1JI1A 3VFGL 4F8LA 2QPEB 1CO1A 3L6FA 2H1XA 1A14H 3FF8A 4DP5X 2QQLL 1XVSA 5D1ZD 3B8SA 5D96C 3FQ1A 3R8QA 4F3FB 2IWFA 1T21B 4K23L 4ANXA 2DJUA 1DUZA 4FTDA 4H88H 3FN9A 1EHLH 2IH9A 3I75A 3KYMA 4XPAH 3TXAA 4R4BA 2MIZA 5CGBA 2UZIL 5DUML 3HE7C 1LP9E 1PLAA 3OPUA 2NQCA 4L8SC 3OMAB 1U92A 2GTZB 2MNWA 3LNEA 4QXUH 4EI0A 1ORSB 2Z31D 1H5BC 2FECL 2DBJA 2JKTM 2AQTA 4KVCH 3WTTA 4NO0D 2JJTC 3TONA 1WIOA 2W0FB 4UDUB 5BQ7B 3WEXB 5KYYB 4XVTL 4Y19B 1ERNA 5I5RA 1P4LA 4X5WB 4OVUA 4M48L 2ARJQ 2YN5A 4WK4B 2IBZY 3HA0A 2J8UA 3S8FB 3BRGC 2NXYD 4AL8C 2KLTA 3UYPB 4NC0B 1X3DA 4GW1B 1SJMA 2WQWA 2Z8VC 4HIJA 1ED3A 4B97A 4X83A 4AM0B 1SOXA 2V2WB 2X4PA 3I50H 5K39B 3HNVH 3BN3B 1GJIA 1HILB 2FGZA 3LAFA 4HX1A 2JTDA 1EAOA 3AU1B 1E9QA 1A4BA 4G1MA 2GSMB 4KMQA 2JQAA 5FCUL 3RWIA 1OAYH 3MVSA 3NH7L 2YMXL 3MACL 1U8HA 3CQQA 3CSTA 3IU3A 4MMZB 5F6IB 4XMLL 3VMNA 1OQXA 1YA5A 4X9BA 4Y5VA 1PYWA 5CINH 5AYUH 4LRNL 2CHWA 1OGAE 4M00A 1PFCA 2JE8A 1S78C 1IQWH 1HTYA 1R34A 2E7LC 3D3VB 3PWPB 4NUJB 3TF7C 4NQEA 1OGTA 2Y72A 3D85B 4LGSB 2AK4B 4UQAA 5ETUA 1MRCH 3BLPX 1LO2H 4LRIC 1V55B 3ALXA 4TVUA 1IO4C 1EUUA 1YEIH 2X6BA 2OMTB 3V0JA 2JMRA 1K6QL 1XD0A 3QUXA 4KKZA 3C5ZA 3OJMB 1KIRB 3MXWH 4GXFA 2NY4C 2C26A 3CN2A 2DQFB 4P5SA 4KFZC 3GMQB 1NOAA 2DWEB 2DLFL 1UB6B 2QLVB 2J12B 4N86A 2V8LA 2IAND 2MCAA 4FXTA 4UI2A 2CQVA 3W37A 2NXZD 2ATPB 4N1HB 3S35H 1JNHB 4GNKB 3W0WA 1X5KA 1M1XB 1Y7VA 4BA0A 3OGCB 3DIFA 3FZUC 1PLBA 1RVFH 4M7KH 4MJIA 2OMVA 1NAMH 5ANMA 3K0YA 1QFWM 4S0SD 3WS6A 3FT4B 3HRZA 4L29A 5I71B 5GSVA 2OFQA 4OUOA 2R0WH 1QSFA 4C56A 3MGOB 2A2QT 4NQCB 1RMFL 4JB9L 4A2DA 2BRRH 2F1BA 1BMGA 1FV1A 2ZUWA 2ZXQA 4M1DL 4R6UA 4YHML 2WINA 1AYOA 4UT7L 3BZ4B 4HDIB 3LN5A 5BUPA 2W07A 3TZVC 3BXNB 3ELAT 1UVQB 5SX4H 4ADGA 4E9VA 1UM5L 3E80A 1FJ1A 4E36A 1IC7L 1L0XA 1CGWA 3BEWB 5BOZG 3D39E 3WL9A 4QRSB 5GS2D 5HJDA 1PQZA 3O8XA 2HB0A 2FQFA 3KPQB 1QRNA 4PLKD 4XPFL 4ZFZA 4GRWH 3V6FB 1KJ2H 2X4OA 1RULL 1UURA 4L8DB 1R6VA 5JIPA 5IJVA 4PJFF 5SX4I 3IXAB 1XSKA 2G4EA 1HWWA 2KLSA 4U1JB 5E2UL 1AXSA 1A6TB 1UACH 1XGZA 4Z7VA 4RMUA 2GBAA 5K9KB 4KRPD 1OANA 2HH0H 4HFUL 2UYLB 1TZAA 3VG0H 1DQIA 3C08H 4P2QB 2VERA 1MCNA 5L8KB 5FCSH 3WNKA 5D2NB 2FRGP 1TXKA 3KXFE 3CZUB 2D31B 4A2LA 1NPJA 4HZLB 4N8VA 3WHXB 3STBA 3MMEA 2D03L 1FAIH 3OB0K 4X7TB 3QJZA 3FTGB 5LCVH 1IFGA 2J6EH 2DYPB 1AG6A 2NW3A 2HVJA 2ZXEB 3WTWA 1QD0A 2X88A 3RFRA 5JORA 3FFOA 2C3GA 1YYMH 4UV4L 2GTZA 5E2VL 3IJHB 5K1JA 4Q9RL 2E6JA 2F15A 4YNYB 3RVVC 2N1TE 2HWZH 3D7PA 3O3AA 5E94A 3N42B 3WEXA 1A6VH 4TUJB 3ESOA 4P8QA 4M8QB 1DCEA 4X5WA 3VRJB 2AEQH 4Y2DB 3P30H 4F8PA 5EU4A 3E9TA 4NQED 3UYPA 4M5SA 4CJ0A 1PS3A 1DBML 3HVDA 3MU3A 5I5JA 2WP3O 4M43H 1JYNA 4GP4B 1T22B 5JIHA 2CDFB 1NBQA 2ZOKB 5D6DC 1VGEH 4EVNB 2DMCA 1MJJA 4QHMB 3LKPA 5AVRB 3EBIA 5AW3B 3ULVL 4OZIB 4I48B 5CR1A 2APVA 3QUXD 1UWFA 3C5ZD 5EN2B 3TEUA 5DS1A 1HQ4B 3NFNA 3CZNA 5GRJH 2HJLB 3ARGB 1X5YA 4UT6A 4YJZL 3SPJA 2V2XB 2ZAHA 2IBBA 3FQRA 3HN3A 4L3CA 1MFBL 2XTJD 1H8SA 3EJUA 4ZXBC 1MXDA 4HISA 1THCA 4OZHE 3GLDA 4U31A 4Z7UE 3W0WD 1QHOA 5KVDE 3EH2A 1P6WA 3LHPH 4KMLB 2VMDA 4MJID 1KN2H 3S4SB 4DKTA 2ZX6A 2B3IA 2VQTA 3O6FB 1XTMA 1QSFD 4C56D 4UV7L 3S36H 3CFIC 1U8IA 5FW8A 1MIMH 3KPLA 1TTCA 3PDOB 3TF4A 4DGWC 3RX5A 4JFSA 2DQFA 5DT1L 5LDUA 2GABA 2DWEA 2D8KA 4HH9A 5AW1B 5AW4B 3MLYL 2IPUG 3ZHNA 4ZW8A 1RJYB 3JVGA 3X14A 2XV6B 1OPGH 1NBVH 2DZEA 1ZHLA 4JAMB 1AS7A 1FRGH 2XVKA 3ZSSA 3O8XD 3BWUF 1F4WH 1QRND 2NOYA 2J1WA 5E8DH 3UYOD 4DERA 2YD3A 5DA4A 4RMWA 4KXCA 1HSBA 5E6IB 1L6XA 2V3DA 3MZGB 3L5JA 3ML8A 1S5HB 4RWYH 5ESAB 4Z0XA 2V5MA 5EC2B 1MFCL 4H8PA 1A3ZA 1BJ1J 1RZIB 1PL3A 3H3PL 3BEWA 2FJGB 4F5CA 2AKRA 2UXVA 4QRSA 4I89A 2BP5M 3O2WH 3IJ9A 3RY4A 2FNWA 3GSWB 4M4PA 4R4FL 3ZXAC 1FWXA 3WIFA 3EFDH 5I5MA 2WQ8A 4PY7A 2HFFA 1O9ZA 3G5YA 3KYKL 4WHYG 5GJTH 5C6TH 4XCEB 3IXAA 3QC6X 2C1PB 2MJWA 3NCFB 5I8CB 4KX9A 5J4MA 5IP4A 4ES8A 3GHEH 4U4BA 1J5OH 1JF5A 5AYTA 5E2JA 5EZIH 2ZOTA 3D6GA 4HK0B 5EG6C 2G3MA 2DWSA 3BVTA 2C1OA 4UM9B 5IGXH 2D31A 4AQZA 4TVPE 3MI6A 1ZIBA 3CFDA 4HZLA 1EV2E 4B27A 4WI8A 3O45B 1YEFL 1IBBA 1XGPA 1FYTB 3K6DA 4HEME 1OM3H 3U30B 4IBUA 1PX8A 2DYPA 5E00B 5IWLA 2PR4H 2EIBA 5DJXB 5IROC 2WXNA 1EERB 3ASNB 4QJ5B 5HD8C 2CO2A 2OYMA 5GS0D 3CSYB 1T80A 2ZJSH 4FHJA 3ATBA 1AO7B 4O51B 4OZGE 2E0PA 4Y4KC 2X4SA 3N06B 4XHQA 1YQ2A 2XZQL 3L4UA 3S2CA 3V95A 1WBYB 3RY6C 1Z32X 4TUJA 1U8LB 4CMHC 3WFBH 3A6OA 3CLWA 1A6ZA 2WC7A 5JQIB 1FH5H 1IGFH 3APNA 4M6OL 4N2HA 3TJPA 3QEQE 3A24A 4MSWB 4AL8L 2VSMB 4NX0A 4BE5A 3ULUE 4S1QH 1UATA 1GRWA 3C6LA 4HWNA 3SKNB 1SN2A 4EVNA 5EEUA 3D4ZA 2IPUK 4GQQA 2XKSA 4PG2A 4Z1PA 2GITA 3MRFA 4QHMA 2PYEA 4R3SA 1NCNA 4FXGB 4N3TA 4YDIH 1HU8A 3HBPA 3PREA 3DHUA 4MD5B 1WYJA 4HKBB 3P9MA 4NZTH 5DWUL 3U83A 5A1AA 1J0KA 2R15A 4FD0A 4PV8B 1F00I 3G6JB 4ANUA 2B4CH 1R5VB 2FATL 3AS3A 3SQOH 1GTFA 2V2XA 4RISH 3KLHD 4PV9B 2DMBA 1HXKA 3D2UB 1CWVA 5I1HL 2BS8A 3BIBX 2VTFA 2R4SH 1CLZL 1U6AH 4FYRA 5IB5A 1OE3A 3QISA 4YO0B 1FVDA 1RSFA 2EEDA 3OZ9L 5ABAA 2HT2D 3AQXA 1NJ9A 1VGKA 2QVTA 4YHPA 3EHBB 3QA3B 2EDKA 4YZFF 4AIOA 2FQGA 4FQHA 4FNUA 5TD4A 4NYLB 3FTYA 3NIDE 3C2AL 5CNHA 1MVFA 2PN5A 4NBXB 4PJIB 2Y07L 3I3EA 2H3XC 3VNYA 1EXUA 5T1MA 3OKEB 1KLUA 3GDCA 3BZDA 1BVNT 1KXTA 4DOHB 1RFDL 4XN7A 4PWHA 2JCCA 3LEVL 1I7TB 1IBZA 1E5UI 4PJGB 3VUAA 1HAWA 3ABKB 2O5YH 4RIRB 3QR1A 2QQKH 5SV4A 3VE0B 4EBQH 4AQAB 2I9TA 4FQXB 3F85A 1AMXA 1E4JA 1NDGA 4M8VA 4JDTL 4BKSC 3SQRA 3MX0B 1BLNB 1UASA 4ZYKA 4DN3H 5E1HB 5CGMA 1WZMA 1BM7A 3CJJA 4NRYA 4EI6A 5D93B 1UADC 3LV3B 5EC2A 2YMOA 5E08L 1YEEL 3PRZA 3HG1A 1Q9WA 2P52A 3MGTB 1O9VA 1OB1A 3WS3A 5IW1B 3HBGA 4K9EH 1HZHH 1G9MC 2FJGA 5JUEH 1VB9A 2ATKA 3HBZA 2H26A 1O7SA 3S37L 1J88A 4PW4A 4PWFA 1RZKC 5E1IA 4QKXB 4LSVL 4HUXA 2R1XA 3JV6B 3DDFA 2CO4A 1JPGA 1U8MB 3NIFB 4F2MB 4PJ8B 3JYCA 3FCGA 2IJ0C 1CXEA 3ZTJH 4MA7H 3LZNA 1IC5H 3QK0A 2EDQA 1CF8H 2C4XA 3GZKA 2QHRH 3HZKB 3WGVB 2ZKHH 3NCXA 5EIIG 2CR0A 2YGNA 3ORJA 3KG5A 1NC2B 1J87A 3BAEH 3KYOA 2VR5A 2E56A 1SJEB 4Z8FL 2AQNA 4F8TA 1CU4L 3HS0A 1EANA 3C6LD 2WXQA 5E2TH 2XWEA 4KZEL 1BD2B 4Q9CA 2XI9A 2EE9A 1KELH 4IBYA 5DJYB 2OCCB 2PYED 3L3OB 5B1AB 4DEPB 2LE9A 1W0YT 1D5MB 4MMZC 5F6IC 2ADJA 4R7DA 4XE5B 2D9QB 1MCQA 1BEXA 4FFYL 3HC4H 1VF5C 1WBYA 4PJXE 1TOXA 4OSUL 5C0DA 2E86A 3WNLA 4QTHB 4IBQA 5K59E 2XY2A 5GGUA 5IJKA 2R0ZH 1ADQL 3T0EE 3WNNA 5IHLB 5BZXA 1WA1X 2FQDA 4Q7DA 1J9SA 4MXQD 1T6VN 3WHE0 4UT9H 3A0OA 1KBPA 3CFQA 4L0PB 1QPPA 3FOLA 5I6MA 2HMIC 3TBSA 4F7MA 4WUKH 2ESVB 3F7RA 1NINA 2AXGA 1CXHA 4O2CA 4DT2A 1E5YA 1WCQA 1FGNH 4AJVA 3L4VA 4LGRB 4IDJL 2BS9A 1W9XA 3WD5L 3GRWH 4PV8A 1MCHA 1OB0A 1T1WB 4U7SA 4FNSA 3TBCA 4CAGA 5K69A 5L4FA 1ID5I 1KSRA 1HZKA 4N90E 3SBWC 1UENA 1G43A 5TH2A 4X42A 3CDCA 1W16A 1M53A 3N0AA 2IH3A 3GZOA 3O0RH 4PTUA 5DZNA 4PRPA 2ZYIA 2BY3A 2F6AA 1RD6A 1I3VA 1H3GA 4B9IA 5I71C 2CUHA 4FNQA 3MROB 5DURD 1JSYA 4JFYA 4KJPC 3CBRA 2BSCA 3PV6B 5E1AB 4MBRA 3OAZK 4L4TB 3V0VB 1G5AA 7FABL 4NEHB 5IHWA 3K1DA 2TAAA 4N2BA 1NAMA 5MEPB 1BQLL 4F2FA 2H9GB 4DQOH 4HJ0D 4APXB 3DVFA 3HG1D 4BFJA 1TQUA 4JFFA 4N0CC 4JGJA 1DUYA 1I7TA 3QQ9D 4QT5B 5F0JB 3ULSA 4M7JH 3ZHFA 1KEMH 5IQMA 3MUZ1 1K2DB 2R69H 1JV2A 3TYGL 1UUSA 4NAQA 4UOW0 2IXQA 3EJTA 1TITA 2OSYA 1KFAH 5C0IA 3VE0A 5FK9A 3OC5A 3F00A 5TQ0L 4O02B 5F89A 1BFTA 1QWNA 5IQ9B 3V6OE 5AL0A 3MOAH 3EYSH 3MRKA 3U46B 3V52L 4E41B 8PAZA 3ROOA 1WBXA 4U1MB 1QTPA 1NBYB 1KG0B 1KJ2A 1ORQB 4PMEA 5G55A 1MRFH 5LBSH 4YBLC 2R0KH 5DJDB 3GBNH 4QRUA 5HGGS 4X6BA 5D2NC 3MGTA 5CIPH 1E28A 5IHHA 3ZDYF 1TSHA 1UWGL 3NTCL 1JWMA 1PAZA 1MWAB 1U2YA 4FLOA 4J8RB 5FKAA 4BGLA 1QTYT 4GUOA 3UTZA 4GKNB 4JG0L 4N68A 3BVUA 5H37G 4FHKA 5J7CC 2CCLA 4FNTA 4A7TA 3IS0X 4KHTL 4F2MA 3L7EA 2MQ0A 4PJ8A 2AJSL 4D0CB 1UFGA 4HPOL 2AJUH 3QEGL 1RH8A 2X2YA 1G6RH 3TP4A 3AGVA 1L7IL 5I1GL 4KKLD 1LDPL 5LCVA 2J6EA 2P43B 1DLHA 3ABZA 3MOBH 5FEBA 4DGVL 3IJ7A 3VO0A 4BFKA 2MOQA 4HWZA 4XP9H 4ZSOB 4IK7A 1H3VA 4Y2DC 3OPZH 1DVSA 1E8ZA 2R2HB 5I82A 3EYUH 2HKAA 4JO1H 4RMSA 3KW8A 1OK8A 2GEEA 4RGMC 2Y7SA 3VI4E 3TNMA 2DQTH 1S8DB 3BD3A 4DFIA 1KIUB 2HUEA 2AK1L 3BT0A 4V1DA 4YPGB 8CGTA 2I60L 5DJYA 1IGML 1MI5A 3CPUA 2XFGB 2XRAH 1D5MA 3MLSH 3EBGA 2WANA 5FUCC 2P4AB 3ARGC 1T1ZA 3SDAA 4DHLA 5C08B 3SYAA 4JDVA 1OZTG 1THAA 4HKXB 1NCAH 1G7MA 4P4KA 1T7WA 1REIA 2FGWH 4Y5XB 2J5WA 1LWRA 3GKWL 5KVFH 1AMYA 4M7LL 1WC7B 4AYFA 1N0XL 3O9WB 4L4VB 4N1CA 4PRPD 3CK0L 2Q86B 4QUOA 1XCQB 3F7YB 3NCWA 5SX5K 3O6FC 3NOIA 2I07B 2IO5A 2K7QA 2ICWI 4HWEL 4UU9A 3FUEA 4J8QA 2A99A 4E9RA 2QLYA 3WFZA 4Y0GA 3P1VA 2GW5A 4HLZG 4R9HA 4FG6C 3ZDXF 4QRBA 4JFVA 1RKRA 1I8LC 4QDGA 1BJ1H 1ZLSL 4BQ9A 3KLQA 4JFFD 4R96B 1RP9A 3S35X 2I9LB 4L4JA 3VGDA 1EDQA 1K8IB 4LASL 3ZT5A 2CU9A 2EILB 1UT1A 4EUPG 1OAKL 4NNPL 4AQOA 5C97A 4OZ4A 3IMSA 2H2SC 4R97B 5I24A 2FIKA 4PP1C 2WMPA 3FUDA 3Q1SH 4G5ZH 3ZE1B 1TVHA 3QDJE 5E6IC 4MNQE 2X44D 4KWUA 2XZCH 1CE6B 1CLYH 1FIGL 4FQJH 4Z9KB 3Q5YA 2H9GA 2D2OA 3FB7A 1GS8A 4Z76B 3SDXA 3SOBH 1HEZA 1KTCA 4UAOC 4OGYH 1NGYB 1JL8A 2I24N 3A67L 5T1DL 2GC4C 4ZX4A 2P8MA 2B2XH 2XWBA 4ALAH 4LHUA 3BUIA 1J0HA 3BKJL 3QJOA 4TLTA 5TK4A 2MNJB 4OFYA 2E76C 3LQAC 4FCHA 5IK3B 1JNNL 4NKDA 2Y6SC 3DRQA 1JZ4A 4PJ8D 1TTBA 1YMHB 4MGXA 3TBBA 4RGNB 1HYSD 3VXNB 1D6EB 5AVZB 4JHZA 4M1GH 4NIYE 2EDRA 3MRBA 1NBYA 4ZQKA 5H4YA 1NCOA 1ORQA 5ISZB 2WLNA 3TV3H 4S1SL 5DJDA 2GSIA 2ZF8A 4OM0H 4AUYA 5IIEA 2CWRA 4OT1H 2Y36H 5DO2C 1CGSH 4NDMB 1OOWA 1FNGB 2X70A 2XFXB 4KTEL 1RK7A 1YN7A 2VB5A 4UBDD 3ZTEA 3WO3B 1PZBA 2Z4QB 4YAQA 3U30C 1A8JH 1JWUB 5IUSA 5EEVA 1T20A 3QQ3B 1E8YA 5A16B 1H8NA 4FLQA 5DRZA 2P5PA 3VTMA 1HHGB 4V1DD 3QEUA 2B20A 1MI5D 4TUKH 4WY7H 2JK5B 5L88H 4JFZL 1OCZB 1T03H 2WZ0A 2CHXA 3SDAD 4QWWC 5ALBL 4F20A 1A3RL 5CZVL 1QACA 1U4FA 2LAGB 5EU5B 1SBBA 1BJ8A 3RTQB 1QYGL 3BP5B 4K07A 4OZFH 5F1SA 1BSIA 4P4KD 4ANKA 3N1MC 2P49B 4PI2A 1TQSA 2VDNH 3V0DA 4L1BA 5KYUB 3SKJL 3MODL 5D70H 4DESA 4EQ2A 2DI8A 4D0DB 4BJLA 4DVBB 5DLMH 1JVKA 5EU6E 2CO7B 1Q1JH 4PJ7A 4PJBB 1Z9SA 1TLMA 3AY4C 3QI9B 3D07A 4FLRA 2WUBL 4FXGC 4MKTA 5DCCA 5G5DB 4BZ2H 3EJYC 2XBDA 3RGHA 4G8AC 3ISWA 5GS0L 4H2AA 2K9UA 4YDJB 1QR4A 1UYWL 3MC0A 1PX4A 4UT6L 2JJSC 4W9IC 1AAJA 3CN4A 1WFIA 1OAJA 1A5FL 1AFVL 1T66D 1LD9B 1E27A 2QMJA 5I0VA 4BFFA 1LEGB 3NMEA 1N64H 1CT8B 1NBCA 3EHBC 4JM2F 4MXWL 4IJ3B 1XCQA 5HYJB 4AXWA 1BZQK 4I1PA 4M6NL 1JP5A 2AQQA 3B56A 3DX8A 4TMPA 3S36X 3TBTB 4LCUB 2VXUL 3NSCA 1SYSB 1ZVNA 4Z7NF 1JFQH 4KKBC 4ZTOL 1GS7A 2SEBA 2Y6TE 1KJVA 3K72A 5F3BA 4PWKA 5IT2L 2OZ4L 5B1CA 3OHXA 1E2VA 3BPCA 5EBMB 1N8ZA 3KL0A 3H3KA 1FFTB 3AACA 5AAWA 3QUMB 1RHHB 2I9LA 1VKXA 1F4XH 2VOTA 4B7LA 1HS6A 4BK5A 5KW9L 4CUCA 4G1EB 3I2CH 4LHUD 1OAUL 3FAXA 5AW9B 4KY1L 1G7PA 4AC2A 4OFYD 4IK6A 1NLDH 1PEZA 2FR4A 2H0PA 4UDTB 4FQXC 1I85A 5E8EB 1Z0MA 4R5VA 3TS8A 2ZWNA 2DQEL 4P5MA 2PCXA 1NGZB 4J3OH 2EC9U 5DS2A 4PJHA 2XDHA 3FS9A 4NGHH 4P9ML 2CMRH 4H1LG 1NGXB 4NQSA 5I28A 3G3LA 5D93C 1KMGA 1MNUL 1J8HE 4XPHH 5FA3B 1WG3A 2FAUA 3G04B 4J2QA 2W9LA 3H1ZA 4MCZA 4XOBA 4X7SH 4KTDL 1TEGA 2CUMA 3NSDA 2F61A 1TJGH 2ED7A 3IFNH 3R7RA 4K94H 2FB4L 3T09A 1QR1A 5DQJB 2OMWB 3D4CA 1GZPA 1EGJH 3L5WB 5FGBC 1C8PA 4HS3B 3ZYJA 2CAKA 3K91A 3VXMA 2C9UA 4WF7A 5BCAA 1TCRB 2ZPKL 1IKNA 4JHVA 1PD6A 2NY7L 2P28B 4HSQA 4ZS7H 3QFGA 3U2IA 3ZO0A 3L3JB 5DI8B 5MERA 3B7YA 3PWVB 1YUKB 1ZEAH 3EO9H 4NQVA 5BRZE 4FKEA 3QULA 5IB4B 3UGEA 2EKSA 3RWDA 3DVNA 1NGPL 3MLZL 4NDMA 1B2WL 1UEMA 1K5NB 3X1EA 4O2FB 1Y0LA 2OTPA 1UXLA 1IBFA 2OJEA 3T1FB 1Y6NR 4FADA 3MYZA 3RWCA 4QD2E 5GIRA 3NSJA 4JFXA 1LVEA 3L3OC 4B5ZA 4DEPC 5J1AB 2NNXA 4Q4IA 2H6UA 1EXGA 2EAEA 5DXWA 1HJCA 1NIAA 5B3SB 3ATFA 4P5TA 2UVFA 4XHJD 1FFNB 2BOCA 2OMZA 4NUMA 4K7PY 1WAAE 3FQ2A 1MG2C 5CJOH 2ROXA 1T7ZA 1AVAA 2X2HA 2E9BA 3WDJA 5EZJA 5C0FA 1E9PB 4MNHA 3AFLA 5ICZB 4X6DE 3RUGE 4PB0L 2ITDB 1R3LA 1TR7A 2E6PA 1MUJA 2QQQA 4Z7IA 4M62L 1E4WH 2OQJA 1WIPA 3ZW3A 4YDLB 3KGUA 4AG4L 3WTUA 2FTAA 2F5AL 4Q9BA 4L18A 3LHAA 4UT9A 3T4AB 5F6HJ 4XTRD 2HYMA 2JVUA 2ED6A 5D72H 5CWSB 5DEGA 3W56A 4TRPL 2XOTA 3SE8L 1OARL 3GNML 5JOPE 5TFSH 3LZOA 1NEPA 2CK0L 1WGOA 4X6CE 3QO0A 5E8PA 2XETA 2P9RA 5EOCJ 1BM3L 3GRWA 4WI3A 1WS7A 4PJEE 3V0EA 2NX5B 1GOFA 2AMUA 4G59C 4JL2A 4OGXH 5JIQA 1BOGA 1U3HC 4G8EB 4HC1H 2Q2EB 2Q87A 4EAEA 4UYQA 5CZXC 1FZOA 1D2PA 5AZEH 3LXUX 2QEJA 4MD4B 4UM8A 3RU8L 3BW9B 4S11A 3TBTA 2B1OA 2DM4A 1SYSA 3DK2A 3GZQA 5FB8A 1LHZA 3GSNH 4OD1L 4RQQA 1JGDA 1KCKA 2HVKA 3Q8CA 3UG3A 3AUVA 1GC1H 2C9VA 2FEDC 2P42B 2XG4B 4LFHD 2QSCL 3S7GA 2FX7L 2DQJH 4X0KB 4O58H 1CE1L 3CZEA 3IXTB 2F54B 4NFBA 4H40A 4NSKB 3TNNA 1M71B 1T6WA 2E9WA 2J1KA 1HHJB 5DFVC 2FWUA 2DQUH 4JY4B 4G1EA 3B3IA 1ZPUA 4YSRA 5J6HB 4GG6A 1ETB1 4ELMA 4XPBH 4UDTA 4GO9A 3ZVVA 3BDYL 4RFOL 4PIBA 5HI3C 5BZZA 1EZSA 3VXMD 3OR6A 1NGZA 4AW4A 2R69A 5DZJA 2J1ZA 1IM9B 3DHMA 4LMQE 2EECA 3WHE1 2Q10A 3IFLL 1A6PA 3RY5A 4YL9A 5LWYH 3IF1A 2IFGA 3FT1A 4DWHA 3H9HB 2K0RA 2ZOOA 4LQFH 3TU6A 1NCDL 1DQTA 2BJML 4ANVA 2ETWA 2JKIS 2CGRL 4PPTA 4X9IA 5DUPH 3FCUB 5LDSA 2WKOF 5LBSA 4ETYA 1KENL 5EO0B 3NZ8B 1RIUL 4ORGB 4WFHE 3VI3A 2FHBA 3L5WA 3U25A 4UINH 5CIPA 4P2OB 4QRTA 3ABLB 3LZLA 2BP0A 1TCRA 1ZVHA 4OLYH 2HTLD 5IW3A 3SCMB 4H88L 4GIOA 2WV3A 4P5TD 4HW6A 4GSXA 3LS4L 1SYVB 2EO7A 1T5WA 3NCYS 1TQBC 3M7FB 4LK4A 4XPAL 1YYCA 3G6DH 1MCFA 5B22A 1G6RA 5DMYA 1K5NA 4QXUL 2BERA 3ZR5A 4O2FA 4EO5A 3P77A 5B4MC 4R2GC 2NUPB 4KVCL 1OOAA 4TLSA 5DK0A 1DVYA 1K4DB 3ZDZF 2A4EA 2G3NA 4OZFB 1AHWB 5BUGA 4D9LH 3BC9A 4Y1AA 1T04B 2GCYB 4NN7B 4XC1H 4KX8A 4AQ1A 4BZ1H 2YAOA 3X13B 1QFOA 2BVQB 2PWHA 2JKJA 5F3FA 5HDWA 2JLLA 1UD5A 3Q7JA 2L7QA 4Q8BA 5BW7A 2GHWB 3KNBB 1UZ8A 3FXIC 2WBXA 4Y5XC 3FT0A 3BH9B 1AZBA 1M6OB 3E3QE 1WCBB 3KLDA 4XWGL 3C5JA 4BZYA 3WG7B 2PYFB 3O9WC 1Q0XH 2QADB 1TZHB 1UGNA 5IM7A 4I7ZC 3B8YA 5AYUL 1YDPA 1P0SE 3AXIA 4A67A 2NNAB 2FLRT 3PS6A 1IQWL 3MLWH 5MHSD 2VLJA 4JHWH 4IS6A 1NCWL 4M4RB 3VFNB 3SGDH 4LKCA 1SOQA 3HHRB 4YGVA 4LEOB 3SEPA 2X4UB 1LO2L 1A9VA 4Y7MA 4A7QA 5AENA 4Q97A 4B9PA 1Q94A 3N85H 2WXLA 4HIPA 1KGJA 1YEIL 3GMMB 1CFBA 4A2EA 1FL3B 2Y1YA 1MF2H 4FQCL 5CJXA 3MXWL 4J28A 3VXSB 5AOMA 3DRTB 3D33A 3L5XL 3OKMA 1J5CA 4G8EA 3N9GH 4OGAC 2FWOA 4FG0A 3SGDI 4R97C 4ZMVA 2GJZB 5AD0B 4MTMA 3Q01A 2BX5A 3QAZC 3DXAA 3VJ6A 2NNFA 3CHRA 4JUTA 4QPEA 3O6MH 3S35L 1EJOH 5C86A 1WZKA 4PCYA 4HEPG 4U1SA 3V6BR 3NP4A 4R7NB 4M7KL 1IL1A 4X0KA 1TSRA 4JK0D 1A6WL 3S96B 3TIEB 1R3HA 2XQYG 3G08A 3H9SB 3O4LB 3U0PB 3TEYA 4XO3A 1M71A 2BRRL 4FP8H 1YEDA 3O2DH 3Q2NA 5EBLB 2I5YH 2H32H 3UL4A 2WXIA 3OG6B 1EJ6A 2ZG1A 1P1VA 1OSPH 3EKCA 4HJ1A 1BECA 1Z5LA 3HW7A 3PNRB 5EO9B 2ZWKA 5GSRA 2ATAA 3IVKA 4RGNC 4HUVB 3MCKB 1CXKA 2PR9A 3MRDB 3IJEA 2DIJA 1U21A 3VXTB 5BXFA 3NN8A 4WO0A 1S7TA 4RAHA 3GIZH 4AVIA 1XF4A 5CBAA 1KJ2L 2ENJA 4G8FB 5AAMC 2JKNA 5ILTH 4XVOA 3H9HA 2XN9B 3DC0A 4YFDB 5T1KA 3SBQA 3W2DL 1FVCA 4H4NA 2BWDA 3ZDXB 5IZ7A 3L1OH 5EOTB 4M61A 1GY2A 1UACL 4FFWC 5KSUA 3B37A 3K4ZA 3ZHLA 2HH0L 1CLCA 3MUUA 3VG0L 1ZRUA 3BWUC 3G5VA 4AENB 5IESL 3BP6B 1JYXA 4XI5D 1O7DE 1S7WB 2Y5TB 2YAHA 4Y1AD 3QO1B 4GQZA 3SCMA 2F7RA 4NRXB 1JJUA 1J1OH 1FAIL 4LF3A 4NZFA 5HVWA 3JYBA 4L9DA 3E6HB 5FAAA 3UC0L 3RTQC 3WN5A 4TUUA 3LEYH 4HIXH 2W92A 4DSYA 1E5AA 4U1LA 1Q9OB 3QIUB 2WJ5A 3NCEB 1S3RA 1B0GB 4U6XA 4XBGB 2B9BA 4E5XG 2HWZL 2XV0A 4I3RH 3U7WH 4JEGB 2WVVA 2NMSA 1A6VL 4OZFA 3QI9C 4GFTB 1OLLA 1TZIA 1W2KT 1D2OA 2AEQL 3TBVA 5C0JA 3P30L 4YSQA 3EYVB 3GSXB 2VLJD 4ISVA 4OF0A 5D1QB 4PRIB 1QA9A 2UY6A 3OC8A 2BVQA 4POZC 2IV8A 3HZMB 1TYRA 3O3BB 4N6RB 2XWJB 3UAJC 3FQ4A 4AIXA 3SE9H 4BH7A 3R8BB 1DSYA 1B4RA 4BZ2A 2V3EA 4N26A 2NY2D 2MMXA 5A7EA 4G6JL 1WCBA 1OLZA 3BIAX 2CBTA 1TVBB 4Z7WF 5JW5B 4MAZA 2PYFA 4S1RH 1EBAA 1AOHA 3QRGH 5D6CB 1AGBB 1T4KB 4MZRA 4XGZB 2P7TA 2AJXL 4IJ3C 1JXJA 1HE7A 1KGWA 4KTGA 3DGCR 5KOVC 1KBKA 2XQYK 3EFOB 4HGWA 4NKOB 4U1HA 1FA4A 1MREH 1ETZA 1YLBB 3DXAD 3HZVA 1IVLA 2VLRB 3UBXG 1HWHB 5JXAL 3PWJA 2ARWA 3KR3H 2OP4L 5HYQB 1LEIB 1RL1A 3LHPL 2BIOA 3JWNE 3OJ2C 1VESA 4MJ5B 1WGVA 4Y4FA 3WIAA 5B39A 1G87A 4EUPB 5CEZL 4OBSA 2NY0B 3S36L 4V2BA 4F7CB 1WUNT 4XP5L 1G4RA 4U33A 2NUTA 3QDMB 2ITCA 3N55A 4GAJH 2VRKA 3BSHA 3MCLH 3CC5A 2MTAA 1BZ8A 1EJ8A 1ZANH 4EZLA 1OD9A 2X53A 4FLSA 1UWEL 1IJ9A 5FUZH 1OPGL 3HPJB 2J8UE 3KWWA 4WI0B 3RFZA 1FRGL 3BMWA 4BM7A 1I1YA 5IMKB 3UTQB 3IDIB 1JN6A 3PP4H 1YJDC 1S7RB 4D0BA 4NZJA 5JIKA 3P54A 4R0LB 1T89C 3TIEA 4ODTH 4UZUA 5E8DL 32C2B 5T1KD 1EDYA 2VC2H 2X42A 3GSRA 3HAEG 4YDMA 5EBLA 2VAAA 1U8KB 3NRFA 5CJ8A 3SYQA 5ALCH 2VISA 3AM8A 4OCRH 4JFEE 4I5BB 3TH2T 4RWYL 3E8UL 3BGAA 3ATAA 4XBPB 2F8OA 2HX8A 4MB5A 3MA9H 4C4KT 1SHXA 4JM2B 3T04D 3KPNA 4HUVA 2ENSA 3CFCH 2HFEB 4JQXC 2P80A 3PPEA 2J8OA 4LNRB 2NY5C 4MA3A 4MDIA 4NQEE 2OULB 2UZXA 4IOIA 2X6UA 1VFBB 1SQMA 1TMQA 2XWTB 1EGJA 1U91A 2XWXA 4Z7NB 5GXBB 4ZTEA 1I8KA 4HUUB 4ZODA 1OF2A 3DX3A 1VA9A 1T5XB 1K72A 1IARB 4LCYB 4JKWA 5GJTL 3MREA 4WEUD 3TIDA 4EZKA 3CIQA 2LU3A 5F21B 1MWAL 5FO8A 2OLDA 2VITB 1WFJA 5AZ2L 1J5OL 4UTBL 1XGRB 4XB8A 5EZIL 3MKGA 2EVIA 3KGSA 3T08A 1F42A 4WU7B 1BQ5A 4AENA 3BP6A 4NN5B 2CKBH 4NO5A 2Y5TA 5IGXL 3GXUB 3QO1A 1DVFB 2IALA 4X98B 4OJEH 2FYVA 2H0JA 5C9JA 4HIIB 5J8OA 1BQHA 1A7RL 2PR4L 4RAUB 2WO3B 5JQ6L 1QSFE 3PQYB 5C7XH 1N9PA 3ZE0E 2ZJSL 5I66B 5FW7A 4BUHA 4BWTA 1ZLUK 1KJ3H 5I26A 2UZYB 3EGSA 3PABA 5F6HI 4B0MB 4YDLC 2GT9A 4WDIB 4HULB 1R47A 1D7DA 5GRVK 1IGFL 1OD7A 3R0NA 5D1QA 1JAEA 3T4AC 2BSEA 4JFPB 3PNWB 4LLAA 4UYPA 2QKIB 2XWJA 3CPLB 5AG9A 1GYCA 1J10A 3ARWA 4E9WA 3I84A 2EIEA 1XR8B 4Y4FD 5I6LA 1RJLB 1C5CH 3PJSB 4YDIL 1B4JH 3TJEL 4NZTL 2AMGA 1TVBA 1PZAA 5JW5A 4P2AA 2A6IA 1JZIA 3F58H 1AGBA 5D6CA 1QSEB 2D0FA 2B4CL 1NAKH 2E7DA 2LT9A 3DKHA 4RISL 3EFOA 3FU7B 3FFCA 5DJAA 1FHGA 1NCCH 2YOAA 4QRPB 2OSWA 1LO5B 2CR6A 4RA0C 2R4SL 3M7OA 3DUSB 4HWBH 4PR5B 5EUOB 3T3PE 3PIQB 4E9YA 2ZKMX 5EPMB 5JHDA 4HC1A 2VDMH 4CU6A 3CQFA 2DQHH 3QXUA 3D0VA 4QAMB 4W6WB 4A63A 3S8WA 1ZT4B 4R7LA 1PJWA 4I0PB 3RDTB 1AIFB 4HBQA 3GSNA 4J3OD 1U8NB 1MHPL 2A1WH 1I1AA 4S2SA 4D3CH 4HKJB 1ACZA 1MLCA 1AACA 1BVKA 3AT9A 4GO6B 3QUYA 5MENB 1AXTL 2YD7A 4WEMB 4H1LB 1O6SB 3EH5B 5KWYC 1PBYA 1XDTT 2EYSA 3EAKA 4BFIB 2P80D 2HPOA 2CBQA 4WI0A 5HGAA 2XIIA 1QLRB 4UIMB 3GSUB 2X2IA 3GIVA 1WE5A 5IMKA 3FO1A 5B8CA 2FDBP 5C2UB 1VFUA 2JKRM 2H7WA 2QQKL 1OCWH 4EBQL 2EZ0D 3NGBB 4B9YA 2WNWA 1AY1L 3WNJA 1U8KA 3UIYA 2G5BA 1TU2B 2Y5QA 3BUYA 5DSCA 5H35B 4NENA 1XGTA 5AKRA 2GIMA 2Y5EA 4DN3L 4DUWA 4I5BA 4GRLB 4YHNA 2OTUB 1CDBA 5B38G 4BD4A 1G84A 4P2OC 3B6SB 3KL3A 5CP3H 4PS3A 5L6YH 4YQXH 3PHOB 4K9EL 1HZHL 3SDYH 1RUKL 3SCMC 5JUEL 2UUDH 4EPSA 1XL6A 1Y1UA 4TQHA 1H3PL 4IIZA 4U6VH 5AYQA 1E5ZA 4CKVX 5F0PB 1BWMA 4DH2A 1G4MA 3GK8H 3ZE2F 2IOMA 3VVWA 4J12A 4ZW7A 1F58H 1KF9B 4GBXA 1T5XA 3SQBA 5B1JC 1WBZB 4MA7L 1EEQA 3OAUH 4OCWH 4WEEA 4X8CA 3S3DB 3C60C 1F90L 4C8XA 4OM1H 4PJ9A 3GSVB 4RBPH 4TSCH 3EYQD 2ZKHL 4WO4A 5HYIA 1BZ7B 2MPVA 1AHWC 4PJDE 4XPGH 3ME0B 4WU7A 3IKCB 1JRHH 1Z5HA 4GSRA 4E68A 4PRAB 3H7LA 5AKTA 2GUYA 1U42A 4NN7C 4PJCA 1SXSA 1FZKB 1P7QA 2YPLE 1WDAA 4Y5YB 4Q6IB 1RZPA 4XNAA 1J1XH 5IREA 3TPUA 1RLWA 4BSJA 4F58L 2VE6B 5IEHB 4KVPA 2K1MA 2NRDA 5E2TL 1CYXA 3UTSB 3D34A 1KELL 2FLBT 2PWFA 4BZ1A 4LNVA 1JRHI 2N0MA 3CX5J 5I66A 4LAQH 4ZOBA 1JZFA 4LLYA 5I9QB 2QADC 2HT4C 4X7EC 4TQIA 3HC4L 4EZMA 3OB0H 2DI7A 4CVUA 1HINL 4WZ9A 5C8JA 1I7UB 3I02A 4OLEA 1L7TH 5JA8B 2E27H 2HCZX 4F92B 3FFCD 2QVMA 1G9NH 4B41A 3T0AA 4LSTH 5TDPA 4JFPA 4GI6A 1T1YB 1XF1A 4M3KB 5JHDD 2QKIA 4UT9L 2VL4A 3C87A 4GAAA 3C12A 1RURL 3U1QA 4G3YH 3U0TB 1KCLA 3G5XA 2VDKH 2APBA 4P4RA 4WUKL 1F1AA 4P5RA 5GGSY 2NY0D 1EZUA 4J4PC 2XZAH 1J05A 5EN3A 1OAXH 1I1AD 1I1RA 4KDWA 2OL3B 1BFOB 2X0VA 3L4TA 4XAWH 3AAZA 2HFGL 3GRWL 3LKNA 2QBWA 3DSFH 3QJRB 4G9DA 4IJTA 3NZSA 3QUYD 4G42A 2HLAB 3QP3A 3QGVA 3ZDZB 4PD4K 4A2MA 5EF2A 1J8RA 1ZV9A 3OMNB 3SJVB 1CGYA 2IFFH 1NMAL 2DH2A 1PLCA 1Y6KR 4XP1L 1KBVA 2AJYH 3OX8B 3F6LA 4NLAA 4FI8A 4HGKC 4IRSB 2E47A 4O4YL 2VDRH 5FM8A 4WHTB 3FQTB 3ARVA 4FLHA 4KXDA 1HQRA 2WGNB 5FM5O 2YSSA 5DYFA 1JZ6A 4OD3L 3NQIA 4U3SB 1ROWA 1HHHA 1S7VA 3BZEA 3AWFA 5I8KL 3HS8A 3THMH 4DQOL 1G0XA 1B6UA 3UZQA 4KHXL 1A1OA 1SF5A 1ASQA 3O2DA 1WQVT 2H32A 5AALA 3WNPA 1S9XB 4NHUB 4JRYE 1ZMYA 5E7BA 5JPNC 3NCYP 1CDHA 2YD9A 3O4OB 1YMMA 3SSGA 3VACA 1UGKA 3FTSA 3VFMA 4JN2A 3MRGB 4PCTA 2Q6WB 5CJQL 3FTVA 1JCVA 1KFAL 2JQZA 1CVSC 1JK9A 2MKLC 2IH1B 3EJSA 4GBXD 5KSAA 3MOAL 3EYSL 2PYEE 4Z5RB 3M1BA 1LP9B 1NFDF 1TU2A 2DQIH 3LNGA 3P11H 7CGTA 5F9OL 3NJXA 1RCYA 4PJ9D 4TVPH 1NUDA 4WO4D 5LBSL 2OTUA 1D7FA 3GBNL 2FEEL 2X28A 4KNSA 2XVBA 5KYWA 1D9KB 1CDJA 3LRLA 4OCYH 2EIZB 3VXPA 1QASA 3EADA 4FNLL 4MJ4A 4XZUB 2L3BA 1P7QD 1Z1WA 5I0XA 4RDQG 4KV5E 1KGUA 4N2CA 3L3HA 2YAEA 2K9FB 1WWAX 4GQRA 3VB9A 2WK2A 1IEBA 1RQ5A 2NY1D 5F2FA 1IX2A 2AJUL 3QIUC 3HEIB 3RJDA 2HUHA 2V9QA 3MOBL 1FL5A 2OTWB 4WFGD 1KPRB 1BZ7A 1FBIH 3S3PA 4XP9L 4Q14A 3OPZL 1JD7A 2PW2B 4PRAA 1OGAB 3ULUH 4BK4A 1T3FA 3HN8A 2X1OA 3KYNB 1XH3B 1AR2A 2H0FA 1FZKA 3K80A 5D1QC 5GQBA 2F74B 1WPCA 5E6UB 3BH8A 4DCQB 5KYNA 2V3FA 2YBGA 5SWQA 3I6LD 3SE4A 2DQTL 3IRCA 2DIAA 1H6FA 3L81A 3UTSA 1KLGB 4JPSA 3BLKA 4ZUSB 3P3SA 3P3YA 5F88A 1KPVB 3QIWA 2XRAL 3GUTB 5EDXA 1CGUA 3CFEB 3MLSL 4XP4L 4ZPVA 1A0QH 1A9BB 1CN4A 2FWSA 4NPJA 1L3NA 1O75A 2X3CA 3WTSA 1NCAL 1OV8A 2ZOLB 5FDWA 3T1WA 3ZR6A 1NCBL 5I1DA 4OLWH 3EYFB 3IJYB 4XB7A 3L2MA 2ICEA 3QPXH 2BNRA 5ESVB 1H3TA 1M9SA 3DV4A 4MQ7B 4PRNB 5F1NA 4HFWB 4D7BA 4NZRL 5F70A 1HDMB 3WMQA 2QPDB 1JZ7A 2ARJB 2LU5A 4PREA 1DQJA 4PS8A 2WLLB 1BFOA 1QNZL 1ZHKA 4MA1B 1KB9J 4H8VA 4RDQF 2V6HA 3NJLA 3B7UX 1U8OB 3VWKA 25C8H 1EBPA 3COOA 2ZX8A 5D2LF 5DQDH 4AEIL 2HLAA 3WTYA 3BVNA 2P5WE 1FIEA 3JTSA 2Y0SA 3MTRA 1JHLL 3D39B 1YMMD 2WOYA 4TL4A 3UADA 2H45A 1OTTD 1Z2KA 4R0LC 1FE8H 4WHTA 5CLTA 4XOCA 5A3ID 3FQTA 2DY2A 4PSPA 3N44F 3M07A 5HDRA 5KSAD 1C7TA 4XN2A 4G5ZL 3ILQD 4G7YH 1FORH 4FQJL 1CLYL 2WB7A 4GFXA 3AROA 2N7AA 1AR1B 1X5HA 1YN6A 3GHBH 1COBA 3T65A 3O6KH 3SOBL 4GP5B 4JM2C 1MCJA 4AUJA 4AITA 3AC0A 4FYSA 2BCMA 5FR3A 4XC3H 2B2XL 2DLTA 3QDGB 4BA8A 3GTTA 3HRPA 1I3GH 1X9LA 3IETB 3KXFB 1ZV2A 3MNDA 4LT7A 1J9CT 4DIXA 4Q2ZA 3QC5X 1EHXA 2Q6WA 4PBXA 4HCRH 4Y1SA 3MDJA 4QOKE 4XXCA 2QR0A 2R29H 3HUJA 4QAWA 3V5HA 2HN7B 4DK6A 1TUPA 1RI8A 3MUJA 1AIZA 2W59A 4N0FB 1LP9A 1ETJA 5F9JB 1BVLB 1RUAH 1EA9C 1SUJA 3CTTA 4M1GL 4YHLH 4Z95H 5HYFA 5KEZA 2AGJH 3KM1A 3TURA 5HI5D 2WXRA 2MQGA 3P0YL 2WM0A 3TV3L 4OM0L 5DK2A 2F1AA 4NN5C 4OT1L 1ZKAA 2Y36L 2BNUB 5KZCB 4CGUB 1EFXA 2GK2A 1DVFC 4XZUA 1EX0A 5FWRA 4AKOA 3QJXA 4R90H 1ZV5A 4NCC2 5TF1H 4X6FB 4AYDC 1A02N 1FNEA 2BS71 4KI5E 4PN6A 5IB2B 5FECA 4BFOA 4E5XB 2CKBA 2CPUA 3OVUB 2V5SA 3QIWD 4KRMB 4TUKL 3ILEA 1ZS8A 3LKOA 4IHOB 4GKLA 1UA6H 1T03L 4Q89A 3T3ME 4XH2B 2BXYA 3VD3A 5FFGA 3F2LA 3VSUA 3O3EA 1MCOH 3LPGA 1DBAL 4PUBL 5TTRA 1J1PH 3A6CL 5F7WC 3X11A 1D6VH 3RL2A 3WLBA 1TETH 2YEZB 4JFFE 2CD0A 3W57A 2VDNL 4AOFA 4Z0BH 2QKIC 3VRLF 5D70L 3V4LA 5MEOB 2VNCA 2WHVA 1FO0B 4OZHB 4Z7UB 2BNRD 1Q1JL 3QUKA 1UOKA 3LPPA 4NHCH 2EDWA 4MD0B 4X6EB 1LYQA 4BZ2L 5IUCA 2WBJA 3H55A 1A22B 3PU7A 2OX5A 5INDB 5IFAL 1ZHBB 1EZVY 4ZUUB 1BIHA 1MFEH 3VWKD 4JKLA 3QFDA 4KAQH 4XRCA 35C8H 3NPSB 3ESMA 3OKNA 5EA0H 1IC1A 1HOCB 3TVMA 3V6ZB 5FOBB 1OGPA 1N64L 5EHFA 5CAYB 5DEFA 2Y22A 2EO9A 3U9UB 1OPOA 4I0PC 4YFLI 3RDTC 1H15B 3UAAA 5ACLA 1IBYA 4HWBA 3EOAA 5AZUA 4M9PA 3AXLA 4NQUA 1JFQL 1GJUA 1YEGH 2C3HA 4TLKA 3WKNA 5DJ0A 5G4MA 4JO3H 2P26A 5ICXA 2X41A 2VDRB 3O2VH 3TO2A 3VH8G 5I2IB 3V5KB 3MYJA 5IBLC 4HUMB 4EIUA 2X12A 3HHSB 4E9QA 1R9FA 3BP7B 3PV7A 4XMKH 4EXKA 1LE9B 2KH2B 3ZTCC 4QRAA 2QSTA 3I2CL 4WJ5A 3T6VA 5KBDA 1N3NB 2E4TA 2QGEA 5FKPB 4P04A 4Q74A 2B08A 2Y1ZA 4AH2B 2CBPA 2IAMA 4HJJH 4A39A 2F7QA 5E8OB 3FU8A 4XX5A 1EVUA 2VQ1A 4WW2B 4MWFB 3NIGE 3ALPA 3QIBD 3VG9B 3ECVA 4NNYA 2Q20A 4GRLC 1D5RA 4PS4L 1R5IB 1YEHL 1QHQA 4DP7X 1E4KC 2QJDA 3QPQD 2O5XL 1UXMA 4P2RE 1EFXD 3UEZA 5ITBH 1PKOA 3LZFH 2DAVA 4PVMA 3OKDB 3FCSA 4GMSL 3VFTB 3OAZH 4WFED 5GZNA 4RSYA 2B59A 4Z7QE 3HI5H 4XX1E 4NKQB 2VMJA 1HT6A 5CP3A 4WNQB 4FJ6A 3IT8D 3CX2A 2HN7A 4F1ZA 4OV5B 2X4TB 1IU1A 3QXAA 1ILSA 3BEVA 4ZS7L 4M7LT 1LDSA 1Y18B 3Q43A 4MXVF 1P4BH 3CFKA 3KPOA 3S98A 5E4IA 1WTGT 1W0VB 1S9WB 2GJJA 4HJGB 4YDNA 3S5LG 3HE6B 4Y5YC 4DPAX 4N87A 4Q6IC 1QQDB 2W38A 2KS0A 3A23A 1UWXK 4GAGH 3BSZL 1GGUA 3MRNB 2NTFA 4HCIA 3SPGA 3US9A 4H20H 3QEQB 4WSGA 2GPZA 3VFUB 1GSKA 5KS9E 2NPLX 4KQ0A 2LLLA 3NJIA 2MCMA 4EEEA 1TKWB 3JUYA 3P2BA 5LBVA 5CLZA 2WBJD 1UA3A 2VLKE 3WJMA 1AGFB 5GGQH 4Y16B 3E6FB 3FQWB 1Q4NX 5FGCB 1BGXH 4G71B 2Z4TA 4WJG3 3ILDA 3SDXE 4POUB 1Z9MA 3PXLA 1V7NH 3LRSB 3JZYA 3HMXH 4QHUB 4PJ5B 3TVMD 3RJOA 4JLRA 1N4XL 1TZGH 5B3NA 4OZHA 4Z7UA 4M1CC 1UQSB 2P8LB 4XXWA 2DMKA 4MD0A 1E4WL 4UQ3A 3AWGA 3SGKC 2L7UA 4OI7A 1FH2A 1IE5A 1U93A 1SLVA 1WHOA 3DOSB 3CVHB 5IMMA 4LEXH 1ML0A 5HGHB 2EXWC 4WKZB 2XG5A 4JRFA 5D72L 1R0AH 5KVMC 1D7CA 2ZSVB 5D71H 3P2DA 3SKUD 5IVXE 1PNDA 2UZPA 4H25A 2Q7YA 3P4NA 3R4RA 5TFSL 3BD4A 2JB5H 1RV6X 3F64A 3OAYH 3CLFH 2PCPA 3H6JA 3TN0B 1SZNA 4QR7A 3DUUA 4OGXL 3JWOH 3CXDH 4IRSC 4HC1L 5KSVA 2BZ7A 2EO1A 5IB1B 2IAMD 3ARFB 3ARQA 4HG4J 4JZJA 4ZMTA 1JNJA 4LGPB 1VACA 2HRGA 3TOPA 3AG3B 2C9RA 1YUHB 2CUIA 2NQ3A 2UX7A 3GSNL 4U3XA 5D1XB 3WKMH 4AV4A 2FT7A 4YE4H 1GC1L 2XKUA 4CSSA 1RHFA 2ERJB 3BUQA 2DQJL 5CCGE 5MEQB 1WAAF 1E4XI 4KQ4H 1VCBC 2Y7OA 3HHSA 2V17L 4O58L 4Z6AT 4OV6F 5BZDA 3ETBJ 3GRGA 1EIBA 5C0BA 2WPGA 1LE9A 1J0JA 4JANA 3TBWA 2DQUL 1RZGB 1IQDA 3MKKA 4FMFA 3O4OC 3RE0A 4S1DD 2BH0A 3V8CA 5GZND 4AH2A 4XPBL 4BGDA 2BVPA 2VZOA 4L05A 4K55A 1AQDA 2FD6H 3PWLB 1TTFA 4XXDA 4HMDA 2BW5A 4EI5B 3BPOB 4WW2A 5B38B 5I1EL 4L37A 2O5ZH 1KJMB 3VFVB 1ITBB 2COQA 3DYOA 3C6SA 4XMUA 2RCSH 2YWZA 2A83B 4KKCC 5LWYL 1D9KC 1YG9A 4G6AD 4OLXL 5DZPA 4LQFL 3RURA 1C08A 2ZD0A 3LKSB 1WTLA 4B3EA 2FZ3A 4FYTA 1CQKA 4EE2A 2AABH 5DUPL 1IZJA 4PJEF 1X6NA 3QZWA 4OKVB 1BYNA 4OFDA 3QYNA 5J89A 2YPKA 4HEMA 2XPGB 4UINL 4WNQA 1M42A 3SDDB 4P23A 3D87B 4UOQA 2PTUA 5C6WH 5JTWA 4OLYL 3T6WA 1MNNA 3EDDA 3MV8A 2X1WL 5LBGA 1R5WB 1DE4A 3NRQA 2ZG2A 2TSBA 2YRPA 3DX4A 4KK6D 4WWID 3UXFA 4DKAA 4OZGA 3BCFA 5F0MB 1RJZB 5A40E 3L1EA 2BLFA 3G6DL 5I17A 2P5EE 2ZUQB 4CU8A 1E43A 4NERA 4ZS6D 2WLKA 3G5WA 4TPRH 4BDVB 3P4MA 5B1KA 2DJMA 3ALWA 3CN3A 3P4OB 3F5WA 4ZUTB 2BSBA 4HVBA 2CDEA 1R24A 5IHUH 4YXKH 4QGYA 4K71B 3A5VA 5C09B 2D0GA 3UO1H 4D9LL 4MB1A 1CG9A 4NT6B 4XC1L 4AK2A 2G9HA 1ECZA 1AGFA 1W6WA 2YKLH 2BHUA 4HKZB 2QDWA 3FQWA 3G5ZA 1AD0A 1NGQH 3H4FA 1NFDB 1QEWA 5EZOH 4LLUB 4ICWA 5C6PB 1VHPA 3E38A 4K2UH 4ZFQA 3RBSA 1A4CA 1ONQB 3RNQB 1JZDC 2J2ZA 1WVZA 4U1KB 5A2JH 1A4JA 2N7BA 1Q0XL 4YWGH 1W0WA 4Z77B 3JWDH 5DRXB 3V10A 5I6KA 4PWGA 3PGDA 5BV7B 4MBOA 3EO1A 4IMLA 4XNBA 4ELKA 1M7DA 3MLWL 2UVEA 3VXME 3QUZB 5HTSA 4K3EH 4GOSA 2BFVH 2W88A 4MA1C 1HEHC 4OJFL 1HNYA 5FUOL 4LBEB 4CVXB 4E42B 5LNDA 4HLZH 3RB7A 3EXLA 3TYFA 3SE3A 1KUMA 1L9NA 1XX9C 1Y6MR 5KN5A 3N85L 4LSSH 5I0ZA 3L95B 2EICA 3LS5H 5HHQB 5C0BD 4NM8L 3GLZA 1MF2L 1YNKH 5IFHL 3ARBB 4MASA 3TN0A 1UWYA 4JKNA 5DC0A 2FJFA 4FFVC 2G0LA 3N9GL 3NJKA 2WLIB 3WFDL 4U3CA 1QLFA 3FCTB 1J48A 3WN6A 4N2MA 4HUKB 4J3UA 4JQIL 1EJOL 1YUHA 4APQB 1SF3A 2B9AA 2VDLH 2H1LM 1FZJA 3FJTA 2OMYA 1AR1C 5F1KC 4BE6A 3B7TA 3OV6A 2IPKA 3RWEB 2N7SA 4NP4H 4U2YA 3PP3K 4W4OA 4XB3A 3V0FA 2QL1A 4U6YB 3RKDC 3ECBB 3C8KA 3N43F 3FPYA 2I5YL 3WY3A 1SNRA 4TSBL 4AQ8A 2XJKA 4TVPD 1OSPL 3T0XA 1RUQH 3QH3A 4P23D 4A7SA 1HEJC 1H19A 4Z3IA 2VXSL 1X7QA 5F3HA 2EDTA 2F19H 4JHBA 3MV8D 2IG2H 3I9GH 1OE2A 2LABA 1A65A 3AMLA 2VDPB 3GIZL 3BZFA 4GJTB 1DJYA 1YRKA 3QG7H 4HCRA 4JR9L 1E6JH 3SKOB 4ATTA 5I1AB 2J7LA 2R29A 5KOMC 3TEXA 4F9LA 2B15A 1F3DJ 2GJRA 5HHNB 2KKQA 1B0RA 3W82A 2E7MA 3LKSA 5C0GB 1GOHA 3FB6A 1CZ8H 4LCIL 1X5ZA 5L2JA 2WNXA 4NC2B 1LQSR 2HPTA 3MTXA 1SXAA 1KTDB 2AXFB 4ODSL 5JPMC 3SDDA 2XPGA 2UWEF 3RWGB 3ULUD 1RZJH 4K3JL 2ZP9A 5H2BB 4BUGA 5LXVA 2RBLA 4TOYL 5MHSE 1DCLA 2X09A 2W60B 3TCLB 1ZA6B 3SPVA 4U4IA 2IDQA 5I23A 2HTKC 1J1OL 2R9HD 3B2PA 3N44B 5E9AA 3TBYB 2D7NA 3WY1A 1A3LH 3JTTB 3CZFB 4X9HA 3ZUNC 3LEYL 3IMRA 3IGLA 1LLAA 4HIXL 5EV7A 4PJXA 3BHBB 1UB5A 1HKFA 2NR6C 3LN9A 3MO1B 1ET7A 4HXAH 5EU7E 3UERA 4PY8I 1RU9H 1KDJA 5E95B 1X6LA 3T0EA 1U36A 3FNKA 4I3RL 3U7WL 1TG8A 3C09B 2X6AA 4GG6E 4QY8B 4N1EA 5DJ2B 4ACPA 4AIZA 4ELME 4NI3A 4BK8A 3KE0A 2Y7NA 4CMMB 2FT6A 3SD5A 1KACB 4FFTA 1PY0A 2VH5H 5HGDA 1KYAA 5J3HD 3B9KB 1FG2B 4E9XA 1GW0A 3FO2B 1OXYA 3SE9L 4GS7B 4LDOB 4LSUH 4PWIA 1MLBB 3QJFA 4WIQA 2AJZA 4K5MA 1XCTA 3NPSC 3VQ2C 1N0LA 3NJNA 2MNUA 1F11B 2E8YA 3FK3A 4MCMA 2FX8H 4PCSA 3T6QC 2IF7A 4XMPH 2ADGB 4OIFA 5GS1A 1FN4A 5D4HA 4NQDE 4ELDA 1T2JA 3L2NA 3QRGL 3WAJA 3MRCA 2EH7H 2LAAA 1JWSA 2ZXWB 4DVRH 3VI3E 3OQ3B 3N6YA 3SYPA 5I19L 3WY2A 4OI9A 5L9DL 3QUZA 1BAGA 4FGMA 3RGVA 1RLBA 2AI0H 3KR3L 4MQXD 2IPTL 3HCVB 5C70A 3MNZB 2OL3L 3HI1A 3VQMA 3QDJB 1LK3H 4MNQB 4F7PA 1S5IH 2EVJA 5EOQL 3RIFF 1KCVH 5A7BA 2XNAB 2ZXDA 4RAVA 4A38A 2E7BA 1ODUA 3PHQB 1ZLDA 4XCYB 3C8DA 1RIVL 4I18A 4GAJL 3VFWB 3EOBB 3K2KA 3MCLL 4RRPM 2R1WA 2WLIA 3IEAA 4ENED 4JMNA 1IKFH 1VEMA 1NKOA 3ARYA 4PAZA 5EUKA 5ANHA 4GAYA 1I9JH 1KV7A 4Y1AE 2FX9H 4FFZH 5CR8A 3GB7A 5IMLB 1KNOA 3VWJB 4WEBH 2WWKT 3P02A 5F97E 3X1GA 3BQUA 3H42H 3RIFK 4NXKA 4ODTL 1XZWA 3LKQB 1PIFA 2CLVB 4ZPTB 1L9OA 1TNMA 2DI9A 1CFMA 5ALCL 4LMQI 2B1HL 4OCRL 3A6BH 3OKLB 1P1ZB 5E2WH 1UZ6F 2WQXA 3UACA 2ICES 2HLFC 4JREB 1U8JB 2KZBA 2L7EA 2RMNA 2VW6A 3GPSA 4MMXB 4PM1A 3SDDD 5M95B 4FQQB 1ZGLA 3GXNA 4KJYA 5BJTB 4OCXH 3KEHA 1N6QH 5KVFE 3CDGB 2VLJE 2XU9A 4PG9A 5CP7B 1UHVA 3DK0A 3KLKA 3NZHH 3ECQA 1KT2B 4EN3A 3ZQXA 2OPCA 5E56A 1NDMA 2K45A 5EF3A 2RQEA 3UG4A 2YBRA 2BNQA 1AQKL 2BINA 5JHMA 1KEGH 1INEH 1BG1A 3HE6C 1K8DA 4A37A 2GBVA 3RNKB 1W15A 1WFNA 4HBCL 2YQGA 3L16A 5IG7B 3VFOA 3T0ED 2ITFA 1FCCA 5AFAA 1L5GB 1KTDA 2BSTA 3NK3A 5EIIA 3ULUC 3ARXA 2R7EB 4CILA 3TTYA 3VI4A 1BIIA 4KUZH 5EU6B 4MS8C 1MHCB 4LCCA 1FPTL 4DW2H 4L5FH 4K7FB 4QGTA 3LPWA 2SODB 1E65A 4Y16C 5EEWA 1LE5B 2YC1A 1QO3A 4DK5A 5F1OB 2EDLA 3KGRA 2VZ1A 3EJJX 2N1KA 1WZLA 4Z3HA 5C7XL 2VDOH 3MO1A 3H53A 1P84K 2A0LC 5ITFB 3MA7A 4N90D 3VGFA 1D5XA 3KDMA 5F96H 4JFHE 4NLHA 5EOCL 5KJRH 2GYSA 3DX6A 4YX2H 3IDNB 5GGVY 1KZQA 1GXEA 4M3HA 4U0RB 4WTWA 3ZRCC 3L7FA 1MN4A 4TL5A 4PGBA 1I3RA 3CVCA 4BQCA 1SXNA 4X9FA 5BRPA 5DD6A 1BBDH 4CMMA 3GMRB 3HMXA 5CM1A 4C57C 3RGVD 2CDGB 5F7EH 2CZNA 4BSWA 4U7MA 4BFNA 3CH1B 2TSAA 3FRPA 1QI4A 4KZDH 2FIRT 2HG5A 4YIQA 5FHAH 1C5CL 4F7EB 2WWMC 3E8VA 4N8VG 4AYGA 4J3SA 3TN0C 2BP3A 1A7PH 4QNPF 3F58L 1MCLA 5DYOB 3O6LH 1WAEA 2WLYA 4L1TA 2NNRA 3ARFC 4NQQA 2H3KA 3QZPA 4RETB 5T1LB 3EFFB 3VH8B 1VZGA 3VFSA 4BFBD 5BO0D 1JD9A 5D1XC 5KSBE 3TJHC 1YY8A 3IMVA 5C07B 4AGLA 4NZUH 2ERJC 3OKKB 3AREB 2DQHL 5CBEA 3EGDA 3BQUD 5FXCH 2DDQH 3ROLA 4FI7A 4IM8A 4JQVA 5BPPA 2C3XA 5F7HA 4EF3A 2A1WL 2DQMA 1SM3L 5CSGA 2EEAA 2LR4A 4WNJA 1ZY9A 3OQRA 1DJHA 3I3BA 3EOBA 3B34A 5KBMA 4LLQA 1OP3K 2ILLA 3BFOA 1A1MB 1JHKH 3MUGB 3D06A 4EI5C 3BPOC 2R1YA 3BDXA 4OF3A 3ISRA 1GMIA 5F1IB 1GY1A 2AEPH 4NZDA 4PGEB 2W9EH 3H2PA 3M1CA 4EN3D 3DPDA 1P6AB 5D7EA 1LEKA 1OCWL 4JG1H 2BNQD 2ZYRA 2BY1A 3AG1B 3VX0A