4QLWA

Azurin mutant m121e with iron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesigning the Blue Copper Azurin into a Redox-Active Mononuclear Nonheme Iron Protein: Preparation and Study of Fe(II)-M121E Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4qlwA00
1PLAA 1NWOA 1KBWA 2IDUA 2FQEA 2FT7A 3IN0A 1E67A 1J9QA 3DKHA 1M56B 2QDWA 1MDAA 1AR1B 1CYWA 2YAPA 2HLEB 1A3ZA 5I5MA 3T6ZA 1ZV2A 4E9TA 3NJFA 4DP5X 1R1CA 1GY2A 1GS6X 4HAKA 2PP9A 4YSTA 1F56A 4KO9A 5A7EA 1W6WA 1NIDA 3TA4D 1SNRA 2X88A 1L9QA 3NJHA 3NJNA 2DYRB 3AG3B 3QJTB 3H56A 1PZBA 2EIMB 2I7OA 3GXUB 2IH8A 4BXVA 1M57B 3FS9A 5ANHA 4GXFA 3GYRA 2PP8A 5LDUA 4DP2X 1NICA 1JXFA 1GY1A 3IE9A 3UAEA 2XX0A 5I5IA 2CUAA 1L9PA 5D4HA 4YSDA 2FT8A 2GB2A 3ZDWA 2HRHA 3PXLA 2VM4A 4KO5A 3HEIB 3OD3A 3SBPA 2IDQA 1PLCA 2CALA 3IN2A 3FU9A 3CDZB 3FU7B 3WNIA 1AOZA 1IUZA 4KO6A 2YQBA 1OCRB 3ABKB 5FC9A 1RZPA 3NSCA 3WI9A 1WA0X 3ERXA 1CUOA 1ET8A 1GS8A 2DYSB 3WKQA 1NIFA 2A3TA 2BHFA 1EHKB 2AZAA 1OF0A 4YSSA 2EIKB 2OCCB 4Q8BA 1PLBA 5I6NA 1TKWA 3NT0A 2HXAA 4DPBX 1TU2A 1WS7A 2ZWNA 3NYKA 2HRGA 2GBAA 3OM3B 2BP0A 4YVUA 1NIEA 2P80A 1A8ZA 4BK5C 7PCYA 4P5RA 2BP8A 3ZIYA 4DPCX 3ZBMA 1JZEA 3CVCA 3RYMA 2GHZA 1A4AA 2BZCA 3T6VA 3QJRB 2FTAA 1IBZA 4AKQA 1WA2X 1BQKA 4HCGA 4L0PB 3NJMA 3ABGA 4HHGA 1J5DA 2FQDA 1AS7A 5I6MA 4HCFA 3KW8A 2DWTA 5AFAA 1SFHA 5TK2A 3EH5B 1NTDA 1UATA 1T5KA 2EIJB 1XB8A 2IH9A 3DTUB 5F7BA 3UACA 2YXVA 1HAWA 3FU7A 3NJJA 1AS6A 2H5UA 3T6WA 4EF3A 3TU6A 3WKPA 3X1FA 4GP4B 4KNUA 4F2FA 5D4JA 2BWIA 2FWLB 3WIAA 1BEXA 1GR7A 4NERA 2GC7C 7PAZA 3S8FB 2XV2A 3T9WA 5B3SB 3X1EA 4A2EA 1XB3A 1L9TA 1V54B 3AZUA 4E9VA 1DZ0A 2J55A 2BWDA 3FYEB 5I5JA 4AX3A 1XMEB 2P80D 4E9QA 1OCCB 3HB3B 1FA4A 3CG8A 2VM3A 1WA1X 1WS8A 1JZJA 1KV7A 2UX7A 1GYCA 1JVLA 3PAUA 1L9OA 3WNJA 1J9SA 1ZDQA 1AZBA 3V9CA 2UXGA 3DIVA 3D12B 2JFCA 2UXTA 2XVBA 4G71B 2AANA 4A68A 4HCIA 2IWEA 1W6LA 3S3CB 4E9XA 2VN3A 3FQ1A 4AI7A 1CC3A 1PZCA 2WSDA 5B1JA 1E5YA 3QJQB 3ZX1A 2YARA 1OV8A 4UF7C 5B1BB 1KGYE 3KW7A 4F7KA 1AZCA 4QKTA 4GY4A 3BQVA 4HZ1A 6PCYA 1PAZA 2TSAA 3IEAA 5IY5B 4FAAB 2GSMB 2UXFA 2XXGA 2BP0B 2VSMB 2YAEA 1KBVA 2W8CA 4N8UA 4FA7B 2DV6A 1ZDSA 2UXVA 1AQ8A 1ASQA 4YSPA 3PCYA 2B08A 3NJLA 2Q5BA 3NSFA 4PAZA 4KO7A 1L9SA 4RH4A 3X1BA 2XYBA 1SHXA 3BVDB 1IC0A 3X1GA 1QHQA 1NDTA 1MG3C 2GC4C 3U25A 3CZUB 4DPAX 4E9WA 4BWUA 5PCYA 1YLBB 4AKPA 1HAUA 1IKOP 2WO3B 4QLWA 2WO2B 4HHWA 1X9RA 4YVNA 1JXGA 2PPCA 1ID2A 4CSPA 4A67A 4KOCA 3CVDA 2QPDB 1ZIAA 3JTBA 4DP9X 3AY2A 3EF4A 4YSRA 2AFNA 6PAZA 3ASOB 4DP8X 1BXUA 1RCYA 1MZZA 1ASOA 1BXAA 2NRDA 4YSCA 1A4BA 1V55B 1BYPA 3FYIB 2J56A 3FSVA 1AG0A 1AZUA 1OOWA 1ZPUA 4HIPA 1KCWA 1CURA 2AZUA 4G7SB 1J5CA 3TASA 4WKXA 2N0MA 4DP1X 1OCZB 2BP8B 3QJUB 2CBPA 4YL4A 2HX7A 2ZXWB 4A2HA 1JZIA 2R7EB 2Y69B 2B3IA 4W1TA 3T71A 2VW6A 3QJVB 1JZFA 3FSWA 5B1JC 3WG7B 2H3XC 4KOBA 3X2QB 1VLXA 4JHUA 3MX0B 4GP8B 4KNSA 2PCFA 2GI0A 2W88A 3OMAB 5I6OA 1ET7A 1PY0A 2FQFA 1HFUA 4Q89A 4YSOA 2GIMA 3SQRA 1XB6A 3MBWB 1PMYA 2PCYA 2CAKA 5I6KA 1N70A 1JZHA 2Q9OA 4BDVA 2BO0A 1RZQA 4N4YB 3UADA 2PPDA 1E30A 1BYOA 1AAJA 2HZHA 2MTAA 3H4HA 4A2GA 1AACA 4JHVA 5I6LA 2QDVA 1KYAA 1NZRA 1JXDA 4BXSV 4DP7X 4YSAA 1EZLA 2CJ3A 4JKNA 2H47C 4G7QB 3CDZA 1QNIA 3ABMB 4PCYA 1AANA 1NWPA 5B1KA 3X1NA 2JXMA 1FFTB 3FQ2A 1JOIA 4AKOA 1SHWA 4UAHA 4BWWA 3AG4B 5AZUA 1FWXA 5AKRA 3V9EA 2XUWA 2Y1AA 4NAJA 1ET5A 2YAOA 3OMNB 4G7RB 1BXVA 2BZ7A 1B3IA 4HALA 2PP7A 2IWFA 4W9ZA 4DP0X 3FT0A 3NJKA 2VW7A 2UX6A 1PCSA 2LLNA 3C75A 2J5WA 3AG1B 4TXVB 3SBQA 1W8EA 4YSEA 1MG2C 2YXWA 5E9NA 1TEFA 1E65A 1I53A 2I7SA 2FNWA 2CCWA 3G5WA 4BWTA 3AW5A 2RACA 1RKRA 1DYZA 1SF3A 1A65A 2YAQA 4BDVB 3QPKA 1ZIBA 2IDFA 3NP4A 3FPYA 1PNDA 1BAWA 2XLLA 3QJSB 1AIZA 1ADWA 3PAZA 5PAZA 5B7FA 3FSAA 2XX1A 5B7EA 3ASNB 4WTQA 2FJSA 3SBRA 2E86A 2R7EA 1M9WA 1V10A 3S3DB 1IBYA 2ZONA 3TBBA 1URIA 3FPXA 3OMIB 4X4KA 1NINA 2BW5A 2XXFA 3T6XA 4KNTA 3H4FA 3FSZA 2PPFA 1BQRA 2IDTA 1MZYA 2BW4A 3JT2A 3PAVA 1KCBA 2QT6A 3TBCA 1NPNA 3EH4B 5I26A 4DP6X 2YAHA 4K9JA 5B7MA 5I28A 2IDSA 3N2JA 5B1AB 2XV0A 1JVOA 1OE1A 1CYXA 4ZK8A 1A4CA 1KDIA 4A66A 5F7AA 1GSKA 2PLTA 2JKWA 2OJ1A 1PNCA 3NJIA 2DWSA 4G70B 2I85A 1ILSA 1PZAA 2ZOOA 2IAAC 3FQYA 3OQRA 4E9YA 4P5SA 5I6PA 2EILB 3ABLB 3PLYA 1E5ZA 3EHBB 5TK4A 4DP4X 3UGEA 3PPSA 5EHFA 1NIBA 1QLEB 2HX9A 1PF3A 3EH3B 4M4RB 8PAZA 1SFDA 1KDJA 4NB7A 1J9RA 3NSYA 2X87A 2XWZA 1OE3A 2EINB 1SDDA 2DY2A 4GP5B 2AVFA 1GW0A 4CSZA 2PPAA 2FQGA 1OE2A 2QPEB 2FT6A 4YSUA 4G72B 1L9RA 2XV3A 2YAFA 4GYBA 3UABA 1ETJA 4F2EA 3N55A 3IBOA 1BQ5A 1JZGA 3L45A 2YAMA 3QQXA 1WAEA 2OV0A 1AZNA 2PPEA 9PCYA 1ASPA 1AZRA 1SJMA 1NIAA 1SDDB 4E9RA 3S8GB 1AG6A 2TSBA 3AG2B 4UANA 3UAAA 2XU9A 1OCOB 2VW4A 2VMJA 4AZUA 1GS7A 1JERA 4A2DA 1X9UA 3CVBA 4YSQA 3S3BB 1NPJA 1J9TA 2IWKA 4A2FA 1SF5A 4E9SA 1N68A 2HX8A 2MRYA 2J57A 2VSKB 3NJGA 1AS8A 3GDCA 3NSDA 1TEGA 3NP3A 5D4IA 4ENZA 3FU8A 4MFHA 1ILUA 4M3HA
chains in the Genus database with same CATH superfamily
5T1LA 4GXUN 4R26H 3RFZB 3FQ4A 4ZS6D 4GUOA 3KL3A 1D6VL 4LVOB 3B2XA 2VXTH 1XF5B 2YAPA 4DVBA 4N2AA 1WD8A 2VDLB 1YAIA 3HE6D 4PJEB 4NM8L 2MTPA 4MXQD 1JE6A 4UT9L 1QFWL 1F56A 1A9BA 1DQML 3BPOC 1GZHA 2FD6L 1MHCA 2J44A 2LU7A 2DAVA 2NY6C 3B5TA 3X14A 1E2WA 4I1PA 3N42B 4JFDA 4UINL 4Y7MA 4MNGB 2KLSA 3LHPH 2XZCL 1LEGA 1UH2A 2AP2A 1HCFX 3BN9C 2JNZA 4GXFA 4NFBA 1D9KC 3GMRA 4DP2X 1QLRB 5F1NB 2CR0A 1JF1B 5FGBC 3EFFB 1F3DJ 3L3DA 3HZVB 2L7EA 4JFFD 4PYGA 5F9DC 3O4OC 5DYFA 4YSDA 3QQ3A 4R7VA 4MVBD 5GGVY 2GB2A 4HJSA 3ZDWA 2ZE0A 4G42B 4WF7A 4I0PC 2R15A 4Y0GA 3T3MB 3HS0B 5TD4A 4HWBH 2IG2L 2WXGA 5KSUB 2NYYC 1EAJA 5A7BA 1TQCC 1A1OA 1IUZA 1HL4A 4G9FD 3ZE1B 5H94A 1AP2B 5DVMA 2IADA 1NGZA 1UWXH 4W9EC 3T4AC 1XGRA 2PTTA 2VQ4A 1NCHA 1UZGA 4LCUB 4IOSD 4H5SA 4LQFH 4YXKH 4XNMA 1VEMA 5KSBF 2UZXB 4TUOB 2WLNA 3P3RA 4YH6A 3NH7H 2BRQA 1P69B 4XNXL 5F7EL 3W37A 2C3VB 1JMZA 5F8QC 5LCVA 3N1MC 1WS7A 2VXQA 4IW4C 3VRLE 5TPWH 2GBAA 1LTXA 5TH2B 2Z35B 2SEBB 2N59A 4N1EA 2Y24A 4P5RA 3ZIYA 1LO3L 4NQDE 2FO1A 2CO7A 4QHLB 4DPCX 3IGFA 1MCHA 3P4OB 1LO5A 1QW9A 4G8GA 2WSKA 3L5XL 2O61A 3V5DB 3VFTB 5KN5A 2Q3AA 2NX5D 1YEGH 1PY9A 2P28B 3KJ4C 1BQKA 2CSPA 3RVXD 5IEHA 4FOMA 2HKFH 2BSRB 2VDPB 1X9LA 4N9GB 1ACCA 1MDTA 2ID5A 4WI3A 2ENYA 3L3JB 3SDYL 2ENPA 3PWPE 4U7SA 4Q56A 3U46A 4NIKB 4PJ7E 1NBVL 3OAUL 1OLZA 5GGQH 3NMEA 4ZMZA 4QIRA 2IQ9L 2WKOA 2NY0C 5IBLD 1HT6A 2IH9A 4G8AC 3ENEA 1FSKB 4JN1H 3IPBA 4Y5YC 2H5UA 3T6WA 2K1MA 1JHLH 1T4WA 5FYKE 1GYUA 1IFHH 3C6LB 4LAJH 4AEIL 4KWUA 5IREA 1JPSL 5B3NA 3IBEA 3TOPA 3MLWH 4PH8A 3U9PL 5FUCC 3EBIA 1D5ZB 3NCEB 4NBZB 3IFPA 2BVQA 4HPHA 5F7DA 3DV6A 5K9OA 3UG3A 3FQUA 5C0BA 3DOSA 2ZAIA 1JNHB 3OC5A 5E5MB 1N3NA 3BZFA 1W0WA 4JGJA 4KTDL 4GSDL 1IE5A 3HB3B 3ARGC 2MQCA 3NIGB 2K70A 3VFSB 1FA4A 1OHZA 3M17B 4B0MB 5KS9B 4QD2E 1JZJA 5DD1H 5CSGA 3OBAA 4NDMB 4YUEL 1G9NH 2R56H 2EXYD 2VN5A 2PW2B 5EZIL 4ANXA 1SJHB 1LO0L 4JFSA 1QSEE 4CC4C 2I9TA 4HV8B 3FN0L 2NY1D 4EIUA 2F54A 1OANA 3MLVL 4PJ9D 4HG4J 4Z8FH 1JGVL 1W6LA 4KDTC 2QPFA 1MHHA 5IBUB 4AL8H 3D0LB 1XGYL 4RWYH 3SPGA 4DH2A 3VYPA 1URZA 2VLMD 2KUTA 4OZFG 1A9BB 1AZCA 2R2BB 4ELKB 1YQ2A 2FX7L 4DUWA 1MJJA 4XBGB 2X05A 4YS4A 4ZMQA 1PAZA 2X2IA 4JJHA 4PJDB 1HNYA 2YXFA 3JV5A 1OB1A 2XWTA 5AB9A 2EH8L 3H9ZA 2DIBA 5E1AB 4U1MA 3PJSB 5D5MA 3VFGH 3GIVA 3VD2A 3HNSL 1AQ8A 3K74B 4PEEA 3W3BA 1L3NA 4G6KL 4R7NA 2ITDB 2UV3A 1FL6A 5DQJB 3RTQB 1B2YA 1BIIA 1ZHKA 2P5EE 4HJUA 5TJWK 2X9YA 1UOVA 4G42A 4AVKA 4J3BA 2GTQA 3TJHC 5EZOL 4RAVB 1ED3A 3QXDA 4OD1H 5EU6E 2APBA 4AKPA 5I1EH 3Q8FA 2K9UA 4NC1C 3B4NA 3K91A 5AW5B 1JXGA 4F80A 4KU1A 1HZKA 2IADB 5D96C 4OZGF 2CLVA 5FHAH 2HJKB 1SYSA 5DJCB 4YSRA 3LRHA 1XR8B 3QXVA 4DP8X 4DO5A 1HKLH 1KLFA 4KRNA 4MQXC 5I8CA 1HDMA 1R3IL 1HOEA 3IDMA 43C9A 2VR5A 4P59L 5JXEC 4NBYB 2DWDB 2N0MA 3QCUH 1VENA 5E2UL 1KXVA 4A2HA 4V2BA 1DVFB 3VFTA 4U3SA 5EOQL 1H3GA 5KN5B 1JZFA 4NZDA 3SQBA 3V7AG 2MWCA 4BA0A 1MFVA 5B4MC 1Q38A 1WIUA 4M8QA 1SRDA 1U9KA 4WUUD 3I2CH 3GSNB 3S5ZA 3GSWB 2EDYA 4NP9A 2RD0A 2NDFA 3WNMA 1H15A 5EEUA 2HJFB 2QQNL 1HFUA 3DGGB 1U30A 4IS6B 5LAPA 3UBHA 2A9NH 3ZJAA 1PMYA 1S9KC 3E6FA 4J8RA 3RJOA 5KYWA 4FQIH 1EDYA 1O5PA 1VJSA 2EYSB 4U1SA 2D03H 4U3HA 3U82B 4KITB 1BM3L 3V4VB 2D7QA 1BZOA 1BG9A 4XH2B 1G87A 3RDTC 4JFPA 3QPQD 1W9XA 3LQAL 1QNIA 4K73A 4O2CB 5I1HH 4U6XB 1TEYA 3U1QA 4N68A 3T6QC 2JI2A 2EP6A 1ZS8A 3GI9L 2X2HA 3QUXD 4X8GA 1FUNA 4UTAH 5E4IA 4JQIH 3H7BA 5EWIH 4HFUH 3VD4A 5I1AA 2X53A 1KPVB 3GXDA 2X4OA 3GS0A 3MLSH 5B8CB 4N85A 3FQRB 1EANA 2R2EB 4PBVC 4JPKH 5E8EA 4PV9B 5ENWB 2ZUVA 4B60A 4UQCA 2H26A 2PP7A 4ABUA 4NAQA 3GHEL 3PGDA 4JG1L 4PWFA 5KANI 1MRDL 4PM1A 3QVAA 3ESNA 2WXJA 5IHZA 1PY4A 1M2OA 3UIYA 3MLUL 3HRZB 2YPVH 4YX2L 2XQ0A 2NUTB 1FCGA 2YA0A 5DWUH 3ZU8A 2DJMA 4C56D 1RSYA 4M3JA 1MG2C 2YXWA 4FQQA 5E9NA 5D2LE 4P5TD 4N6RA 4KQ0A 1I53A 2XC8A 3V4PH 3I75A 2VABB 2F2HA 4HISA 4K8RL 2R2BA 2X3BA 4HGMA 5DJAA 5TDNB 4HWUA 2CKBH 2XA3A 1DEEB 4TLSA 2VDOL 3P4LA 3QUMA 4CU6A 5JIPA 4EN3C 3MOAH 3KPSB 1WFOA 3O4LE 1E9PB 4PJFF 3H2PA 2QSCH 3P9MA 5ISZD 3I6GA 2V2TB 4KAQL 4ODVH 5D1XB 2VDOH 3MLYL 1IAOB 4G7VL 3D25B 4HJ0C 4OFDA 5F72S 1YQVL 1QSFB 4XCNA 2LQRA 2ZNXA 3B6SA 2IXQA 1KCSL 4YPJA 2V2WB 4NO5A 2HG5A 2EQDA 2VQ1A 2BW5A 1MFNA 1N6VA 2GBTA 2XXFA 4FQJL 4A38A 1DQIA 2HT4D 3D2UA 4J3OD 4PRIB 2BCKB 1K4CB 4ZUUA 3K4ZA 3SCMD 1GC1C 3LKQB 4Y4KB 1BW8A 3L2LA 3FCUB 1QRKA 2P44B 4A1RA 4FP8H 1CZ8H 4R0LA 2ATPB 4JGUA 4EPSA 5E08L 4FI7A 3B3BA 3SBWA 5GGQL 1IIIA 1X4ZA 4O2EA 4Y5YB 1LEKA 5J8OA 3U7WL 1KLFB 2Y1ZA 1XH0A 3TYFA 1E40A 1QUNB 4WFGD 5AG8A 5FLVA 2QHRL 3K2KA 3MUY1 4U6TA 3VD9A 4BZYA 3MRLB 4U2YA 4BZ1A 4PB9H 2KDGA 2AK4D 3RKDC 2XFXB 4PREA 2NSXA 4FQLH 5J11C 3NBNA 2PCFB 2ERJC 4LRIA 4QHMB 4XNQA 3LHAA 2C5DC 3PPSA 2LVEA 5LXGL 1MNUL 3TCXA 3OL2A 3EH3B 4F5CE 5KTEH 2EDRA 3SDDB 2AXHA 3S35L 4DZBB 3GBNH 3G6JB 2HP4A 4GB9A 2V3EA 4JZJC 4HLZH 4IYKA 1UA3A 3C8DA 3GGWB 4S1DC 3IETB 3HN8A 3S3SA 3IU3B 3W0WB 4AC4A 2DY2A 2DEWX 4PJAA 1XXDC 5D7JC 3C6EA 3HBZA 3OJMB 3QRGH 3GKWL 5DEGB 1JNNL 2B4CL 3Q05A 1A0QH 3SDAA 1WAAF 3FMGH 1GGCL 2ZUYA 5DF0A 1WT5A 2ENSA 3UAJC 4XVJL 3RUGB 4ZJ9A 4UQ3B 2A9ML 3OB8A 4Y2DB 5F96L 3SOTA 5IHUL 5LUMA 4ZFZA 5EEYA 1YN7A 2X6VA 3HKFA 5DHMC 5IBTL 3IFLH 4XNAA 5CD5D 5LWYH 3B5GA 2MCAA 5IHBA 1Z1WA 2WYIA 1MHEB 5LVEA 2OMYA 4C8XA 5KYXB 2WP3O 4OJDH 4HKBA 4OZIF 4X5XB 2A6JA 4A2MA 5AAPA 1CGSH 1UJTA 1M4KA 4IIQB 5KYUB 4Z0BH 1TTRA 2VLRD 4UI2A 4NZUL 4PJCF 3Q2LA 2MRYA 4NKMB 4M7JL 3T0ED 3BZ4B 2J1YA 3CFIC 2Q1EA 3QFJB 4H7VA 4XXWC 3WUZA 5HHMD 3MNZB 3E8VA 4NKOA 5D4IA 4HOXA 3LJ3A 5SX4H 2FEDD 5BPPA 2W9DL 4XWOC 4IRZL 2E0PA 3U36B 3IB4A 1FNEA 4X4XA 5C08D 2BIMA 5D7LE 3VXUD 1KBWA 4FE9A 3D85D 3QQ4B 4F7PA 2HVKB 2QDWA 3NIFB 1OAQL 2F74B 3P73B 5D1QB 3TL5A 5KS9E 1NFIA 5C9KA 1MW3A 1NGPH 1T5WB 1RZIA 4Y8AA 5DMIH 1JV2A 3X3GL 2WUCH 3RTQD 5BOJA 5CSZB 3BGMA 1XTLA 3FH7A 5TDNA 5EU3B 1XH2A 3F2LA 4NKIH 4AYBA 1SOKA 3LD8B 3S7GA 1U92A 1W6WA 4R5TA 3TIDB 5IB3B 2TRHA 5D9SB 2W60A 1BOGA 2IVFC 4P5TB 4FLQA 4ZMXA 1BLNA 2VIRB 1SNRA 2MOGA 5DU7A 4APQB 3VDBA 1AO7A 1PD6A 5I66A 4PYHA 4M02A 3PHOB 4TQEL 5B4MD 4ZQKB 4KXDA 2QQNH 2VJ0A 1G1OA 1SDYA 4D0BB 2AS5M 2ZOUA 4LKCB 2JB6B 2F53D 3FCGA 3QZLA 3RZCB 5D6CB 3VNYA 5K9KA 2P8PB 3DJ9A 4OAWA 2FDBP 5E8DL 4KKCC 3EO9H 3BFWA 2RGSA 2B9AA 1S9VB 1AOZA 3G6DH 3ABKB 1M6OA 2Z4TA 2A1WH 5FC9A 3NSCA 4S0TD 1VFAB 3KPNA 5CIPA 5G5DA 5EBWA 3BH8B 3ZL4H 4U1KA 5LB1A 1GS8A 2R0KH 5GRJL 3LDBB 3QQDB 5E8NA 3TWYA 3VFRB 3ULUC 3U2SA 3EYUL 1N64L 1F42A 3IT8D 4OR1A 3MGOA 4Y5VA 2P8MB 4PJHF 3NQIA 4QRSB 5DC9B 4WWPA 2BP0A 2ZWKA 1VACB 2N4IA 4HDIA 4U6VH 4DEPC 5I15H 4EI5D 1I8UA 2PCPA 3H0TA 5C3IA 3QDJA 3L4TA 1ORQB 2P5WA 4GUPB 2HRPL 4G9DB 4NOFA 4X98B 1C12B 5DHXB 3S3PA 3UYRL 5DA4A 2AAVA 3HHRB 4MXVF 1WA2X 3BZDA 5B38G 5KVGH 4APXB 1X5JA 4M5SA 2HN7B 2Q76A 2E56A 1N8ZA 1QHPA 3H6AA 1KBGH 3QZOA 5DJ2B 2FQDA 3WSQL 3A6BL 2V9QA 3LXAA 5E00A 5DT1L 4HCFA 2YO3A 4LHUD 2VXVL 2J2ZA 1NUDA 1UXSA 1O75A 4HPYL 3FQTA 4JFZL 3OKKA 1TQBB 4FFYH 1KYDA 1WD9A 1OM3H 4H2AA 1NANH 4M6NL 4PVMA 1WISA 2DL2A 2H1XA 3JWDL 1DQDL 1N67A 4S1DD 2BS71 3FU7A 4Y1TA 5C0CE 5IKCB 4AEHL 4ORGB 4ZW3A 1V5JA 1G1CA 1PJWA 1IGCL 5TE7L 3HC0A 3BVNB 1L3WA 5FO7B 3DDFA 7PAZA 2R1WA 4JRXA 3RVWC 1NANI 2AV7B 5BRQA 1BZEA 4FXLA 4MA1B 5C1MB 3TEXA 3KXFA 1A6TA 4UQAA 3UBGA 4AX3A 3FYEB 1U8KB 3QIBA 2XT1B 4NC2B 1G7HA 2DMBA 3OKNA 1C16A 1V3MA 2WXKA 4ZXBC 2OMUA 2WO4A 1F13A 3BGFC 4XTRD 3LPWA 2X7LB 3MRGB 3VTMA 5D7IF 4KJWD 4N2FA 4OD3H 2UXGA 3PAYA 4CMHC 1BF2A 4IK6A 1CT8B 2C4FT 5EO1B 2EC8A 4F8PA 5FB8A 4G71B 4DQOH 1ZSHA 4P46A 4YHIA 3S3JA 1A6UL 3NZSA 1EHNA 4LNRA 2IGTA 3FT3B 4Y1AD 4I3GA 4HW6A 4MNQA 4K3HA 2H0JA 5DJ8B 3ZSSA 4WW2C 4PWHA 5AWNL 3U7WH 3ZKNC 4TSBL 3QUYB 1F4YL 3CDFA 2IC2A 1U8PB 3DO4A 3KLLA 4EUPB 4FAAB 1VPOL 2C9UA 2AQSA 2D8KA 2VGLM 4LGSB 4PRAB 3OKOA 1JGIA 4YHYB 2CIIB 1CLZL 4LSPL 1SJHA 4QRRA 2VDRB 5T3ZE 2WTRB 4PFEA 1RQ5A 4HIEB 5F44A 3VXUE 3X1BA 1CL7L 1DVTA 1WAAA 4XPAH 6FABH 1LP9B 2DI8A 3NN8A 1RIHH 3QXAB 1MWAL 4AIZA 2XIDA 3IJYA 4QWWC 1I1YA 2GC4C 5DUPH 5EORL 3CHPA 4FQ1H 4K7PL 1D7BA 1W72H 3U48A 1LNUB 2JKTM 1IAMA 4K94L 3KPRE 2EH7H 3JTTA 2EVHA 4N0CC 1SXBA 3VXSD 2Y25A 4GRLB 1DQLH 5DWPA 5HGHA 3V0IA 1SEQL 3CVDA 3NPZB 4GQPH 1BFVH 4OLZH 3AY2A 2QL1A 4FQXA 4OZIA 1RHHB 1NA8A 4AQAB 1E3XA 4I18A 1YNTF 3GIVB 3DIFA 3MR9B 3QO1B 4MJID 3FSVA 1YNTB 4ICWA 4JHAL 3EYOA 4RGND 4DKTA 4BE6A 1JV5A 4I4WA 1A7NL 5CBEA 3LZOA 4XP6L 5E6IA 4EE2A 2ZXWB 3VXMA 3OPUA 3GM8A 2XZQL 3QDJB 3PWPB 4JFEA 4ZNEA 3QUZA 4WJ5B 4YFDB 2NDGA 5I24A 3HG2A 5IGXL 5JHDA 4JFYA 4AE1A 4RRPG 2H3XC 3AROA 5MENA 4XMWA 3MUGB 3D39A 4W9CC 1VKXB 4FD0A 1INQA 2R1YB 3ARBB 3D3VD 2EDTA 4ERSH 2NR6C 4LSVH 4Y4HD 1VGKB 4XRCB 3F6JA 3NESA 3FKUS 4IRJA 4OGAC 4AQ1B 2LFGA 2YOCA 3IDUA 3N3EA 4UQ2A 2WNWA 1PVHA 1QSEA 5KAQF 3W1ZA 5JLZB 4Z7AA 4JM4H 2DLTA 4JAMB 4JHBA 3FB6A 1NFDE 3KYNA 5T1DH 2Z8SA 4LIQL 1B4JL 2PR9A 2G4EA 2CJ3A 4TQ8A 3KJ4B 3EFOA 5A6IA 2DQGL 1FNGA 4PGBA 35C8L 2VT0A 1SEBB 4QJ3B 1EHXA 3VD1A 4FXTA 4KKAD 1AANA 2YEZA 2VXSH 2X4QA 3HVNA 3RUGE 1BX2A 2WPGA 3VI4B 3ZRCC 2D7NA 1CE1H 4J2QA 1XF3A 4H5SB 4G1EB 4ZMWA 5CEZH 4PD4J 5I0DA 1VAHA 2BSSA 4Y5XA 3GZPA 3QA3A 3VFPA 4P2OA 3V6OC 4GW1B 2YGQA 1ETZB 1VFMA 2VW7A 5J1TC 1MJ8H 1ZANL 1PG7W 4LVNC 1RUAH 3F7YB 1MVUB 3J8F7 4N24A 4TXVB 2C1OB 3CFJB 1Q9OB 4PJDE 2Q87A 2Z91A 4GAGH 4PLKC 1W8EA 4LASL 4YSEA 4ONFH 5B1CA 1CQYA 2FNWA 3HRZC 4OKVA 1FYTE 3G5WA 1UUSA 3ELAT 2B8OT 1DYZA 1KC5H 3RY4A 2YAQA 5CCKL 3TO2B 2OMWA 1PNDA 2X4OB 1JGLL 1SM3H 4XO5A 1UXWB 4QXUH 1TVBB 4FP8L 1HHKB 3APCA 5IVZA 1LJMA 4XC3L 4M7KH 1QFUH 3RB5A 1SBSH 3MXWH 5EU6B 4DGWC 4Q6YA 5DS8A 4HWZB 4HAGA 3SBRA 4QY8B 3HZYB 3GS4A 1RUKL 2N56A 4JO4L 3M7OA 4IU2A 2E8ZA 4HH9A 1RMFH 3Q9PA 4XXDB 3CWGA 5FK9A 2WIIA 2BSBA 2VJXA 3M45A 2CHWA 3MRBA 3U9UA 1E4XL 3O6LH 4XAWH 1SLWA 2H1LM 3GFUA 3VXNA 1DP0A 4U1HB 5C0ND 3MREA 1JK8A 1P5UA 5FWRA 5C6TH 4I77H 2J6EA 1JPFA 5CLZA 4MBOA 1MCWM 1CLOL 4KRPC 2ZCLH 4ZFOB 4M4PA 4ODWA 3T8XB 3GHPA 4UOQA 5AOMA 3FCTB 1NLBH 2R4SH 4I0PA 1DVFD 4MS6A 5KVFH 1TJGH 3MR9A 3QO1A 4GUQA 4U1IB 1PZAA 2DYPA 3FU3A 1PEWA 2F54B 3QC6X 3L7EB 1RK1B 2AJVL 1T83A 1KELH 2H41A 1OIOA 3N44B 3K6SB 4XO3A 5HYJD 2BNUA 4X5RA 5DO2D 3PL6A 3F3HA 3TTSA 3AU1B 2X2JA 3S35X 4UBDC 1OXYA 2PXYD 3EYFA 3CFDB 4M7LL 2AHIA 5IF0B 4HIXL 1B0GB 4XBGA 4JANB 1F58L 1L7IH 3ZGHA 4Z3HA 1IQDB 1SDDA 5DZVA 3FMGL 3MXVH 2VZ3A 3ZRFC 1UXMA 1QPXA 3FO2A 4FG0A 3BIAX 1NEUA 3PJSA 5D5MB 4Z3GA 4L37B 2JJSA 2ZYRA 3OGCB 3D2UD 4H4NA 3EADA 5ERWA 3ULUD 2D0FA 3UZQA 2CBQA 3MCKB 1ZTXE 5JO5B 3MRLA 4JVWA 3ET9F 3GMOA 2V7NA 4H1LB 4ODTH 1DL7L 1KLUA 5JIDA 2OYPA 3F7PC 1NAML 3TA3B 2NPLX 3M07A 3FUKA 1ML0A 2FB4H 1T0OA 3F7QA 4NQSB 3F5WA 2VLKB 4QXTA 1HVXA 3HPJA 4DZBA 1AE6L 1AQMA 4OM0H 1UUNA 4QRUB 3UMTA 4RAUA 3HI5H 3N40F 4K23H 1JERA 1GAFL 3WEBA 3ZYZA 1NCBH 2X09A 4YSQA 3BDXA 3CVBA 4FNRA 4Z77B 1AGBA 1A4KB 1XSKA 1P5VA 1VHPA 1VZIA 3ZKMD 5J06A 1DVFC 2YRZA 2IH1A 4PGJA 5LBSL 4RSVA 5ITBH 3OTTA 4NLAA 2ZYHA 3GDCA 4XO8A 3BWZA 3RE0A 1OARL 3B9AA 1NAMA 3NP3A 4ZO8A 3SPCA 4ADIA 4KK9C 1ETZA 4BFBD 4KK6D 2C1PA 3V0GA 4DKEH 3ATEA 4AJVA 3NZ8B 3PWNB 2VL4A 2VH5H 4P9MH 4S10A 4YR6B 2GUOA 2QZ5A 1I85A 1EEUA 3SGDI 4LDOB 2Y5TB 1J9QA 3MRRB 1DN0B 2ZXGA 1TTFA 4YOKA 4S0HA 2JE8A 3RY6A 2YD4A 3MNWA 3Q2VA 1KOAA 3DGGA 4HBCL 3LN4A 1F45A 4F7TA 3QIBC 3TT1L 3UGXA 3BDYL 1GIGL 3BP5A 1JXJA 5AL8A 1E27B 4MTMA 3FFCE 3N85L 5CLYA 2H6PA 1CG9B 5JPMB 4OH2A 3MNZA 4NKOB 4UB0H 2VKWA 4OUOA 4PJ9A 3KGSA 4L8DA 2DLGA 1GZHC 1A6AB 1OGSA 1TMQA 4V11A 4FADA 4R26L 4CU8A 2A77H 4M1DH 4P4KA 3RUGF 1UKQA 5D4QA 3OAWA 4LEEA 5LN8A 1CF1A 1QYGL 4FG2A 4P5MA 2JXMB 4MZRA 5EU6D 1ACXA 3ZT6A 4ZFFA 2DQEL 4NNYB 5CD3A 2N0KA 3QDME 3HEIB 1OL0A 2WXOA 1UGNA 1CIDA 5ACZB 1M3IA 2W94A 3ULUH 1WWCA 2WWNA 2BNQD 2YD8A 5EIQA 3D4YA 5EIIA 3TJHD 5C0CD 1BMGA 1ITCA 2NY7L 3MRCA 4H0LC 4QRBA 1D5RA 2H26B 3UP6A 1A7OH 1NDGB 3FC8A 5JOPD 3GBLA 1B90A 2XPYA 1OF0A 1T80A 2CCVA 2OCCB 2Z7WA 4WGVB 4YSSA 1BEYL 3VXTB 5I0VA 1QMUA 3WHXA 1BQLL 1EUUA 2EE0A 2K8QA 3N1FC 3IRPX 1AYOA 2NUTA 3VUAA 5DZJA 4EI5B 2H2SD 1P4UA 2DD8L 2ICES 3P4NA 4GSXA 1DANU 5D7KE 2BP8A 2Z3FA 2V17H 1KCSH 1IC4L 4E5XA 5ICYA 3TWCH 4QTHA 3QJZA 1DEEA 1BM7A 4BRJA 3HHSB 4DEPB 4HS6B 3D4GA 5D93C 5GS0C 3E9UA 5IEKB 3IXTB 4DIXA 1Z3GL 5EBWB 4Z78A 1XIWB 1MI5A 5DUJA 3CVHH 4XNZC 2PNDA 2I26N 4S1SH 1RULL 2WXRA 3G5YA 3MSPA 2VDLL 4P3DA 1G6RB 1MFAL 2H8PA 1GMIA 3WIHH 4M61A 3B6SB 2B59B 4FNLH 3U1PA 2BK8A 3MYZA 2KQNA 4G80B 1IFHL 4GAJH 4AEIH 1INEL 3QNYB 1FNSH 1PIGA 4HDIB 4RMSA 3UACA 3L4ZA 1DBBH 1AGEA 4FFYL 3KPOA 4GP4B 2F5BL 4KRPB 1ORQA 4DK5A 1RJYB 3AS0A 1DFBH 1EDHA 4NERA 3TBSB 4WRLA 2V9UA 1Z3GH 1YZZA 3CZFB 4PQXA 3DI2B 3B2UC 4LCIL 3RNKA 3MJ9L 4JKWA 4KI5E 2JMRA 2XPZA 4JBSA 3BKYH 2F8VA 3QNXA 3JV4B 1HQ4A 5C0IB 3QEGH 5C6TL 4GRMA 4XP4L 5AB0A 3NK3A 3CG8A 2Z64C 3R7QA 4G5AA 4OF0A 4EBQH 2Y72A 2NW2B 3MV7B 3GBML 1FVEB 1JF1A 2HB0A 3V6ZA 1MAJA 1NFKA 4TUKH 1INDL 4U6YA 2UYLB 1HINH 1I8KA 4PWGA 1UWXK 5BQ7A 5J13C 1ANUA 4NX0A 2W0FB 4IIQC 5IKCA 1UG9A 5EC1B 2HFTA 3GBMH 3BPLB 1M2VB 4HU2A 3O9WD 4PTTA 5F1OB 2CUIA 4QRFA 5LNGA 4U1GB 1UZ6E 2F1EA 3OKDA 3KR3L 4RNRB 5ALCH 5EBMA 4MDIA 5IW1B 5F3FA 1QASA 4CC4A 1IL1B 1X7QA 3H6JA 5DVPA 4BQ9A 1BD2D 4W9FC 1LDPL 4JG9A 5T5FA 1BQSA 4JMXA 3MACH 1AHKA 3QWQB 2OTWA 4PI0A 2ZKXA 4RMQA 4GMTH 3ILDA 3TN0A 3NA4A 2NW3A 1F4XH 1Q0XH 4L3EB 1MWAH 4H44C 1KBBA 1A6AA 4GT7A 3KYAA 3L9RA 5C0RH 4RGMB 4JHWL 1UGKA 4TRPL 3FBQA 4ZUVB 3GMQA 4UT6A 5AQ0A 2CBOA 4RMUA 4XP9L 4Z7OF 2D7OA 2VZ1A 3OXSB 2NYZA 3PS6A 3JVGA 1DE4A 1IGJA 1W8OA 2FWOA 2J8UA 3MRDB 3PHSA 2VDNH 1A4JB 2ZX7A 3FQUB 3L13A 4MKTA 1WTLA 2R51A 2BFVH 2DWYA 5GS0H 5ISZA 2IV8A 4BFEA 1TFHA 4KX9A 1Q1PA 2Z1KA 3NSJA 5F3HB 1YECL 3VRIA 4JY5H 1ID2A 3WMQA 4KOCA 4UBDD 3L1GA 4YWGH 4QKXB 1PSKH 3ULVH 1MCSA 1NMCB 2ORBL 1IKFL 4KK5D 3CFEA 4POUB 3QDMD 4WWKD 4XMLH 4PVNA 1N0LA 3F83A 1NAMH 2NX5B 4ELDA 3DYPA 5IQMA 4WW1B 5A2JH 1DCEA 1C5BH 4XMLL 1JHTB 4YHOH 2CBPA 4JMNA 1HCVA 3QZMA 5HPMA 1V27A 4QTHB 4A7UA 4DGYL 4RX4D 4JY5L 2XKNB 3COOA 4AQ8A 1GZPB 3C5ZB 4O9HL 2Q7NA 5GS3A 3MX0B 5E0QA 3MRNB 1K4DA 4WO0A 1HHGA 3CK0H 3IPFA 4Y8DC 5DEJA 1HHIA 4CAGA 4DGYH 5F7HA 2HLFD 2VERA 4YSOA 2X28A 3DSNA 3MZGB 3JWNH 4MMXA 4YBHA 2G9HA 3AXIA 5IG7B 3V5KB 1TFPA 5I6KA 1FL6B 3RTQA 4Y19B 3DIFB 1KFGA 1QACA 2QR0A 4M7ZC 2YPLE 4ANKA 1E28A 2UVEA 5ANMB 5MHSE 3MRKA 4W9HC 4XNUH 1AAJA 1SBBA 3QCUL 5FR3A 4KJQD 5D6CA 1CK0H 4GSUA 1QZ1A 4IDLA 2EVGA 2XA8H 4BXSV 1MIMH 2WK2A 1UA7A 1AO7D 4CGUB 1OTSC 1UJ3C 5FYJH 3WOVA 4X6FB 1GGIL 2ENJA 1OY3B 4WHDA 1K2DB 3U6RA 1DEDA 1TVHA 3SKNA 5C2BL 4ELKA 1BDYA 3TBVB 4B97A 2ZCKL 3KPNB 1FFTB 4PS7A 1A6ZB 2FGWH 2XTLA 4EXKA 1QRNB 3DVNB 3FTUA 1WH0A 5C3TA 4M00A 3B2VH 5I2IB 1FWXA 3FDWA 3OLGA 5ADOL 5I8KH 1RU9L 4N22A 4NAJA 4NO3B 4PS4L 4F57L 1NGYA 1LE5B 3OZLA 2GEEA 3PV6A 1D5MB 4YFEA 1U95A 5H35B 3NJKA 4I2XB 1OSPH 2J88H 3C75A 3ABZA 3GSVA 2KDYA 3EBHA 1EJ8A 3RRQA 3RBSA 1BPLB 3TONA 4ZUTB 1QI4A 3GC3A 2VXQL 3SJVD 5T3ZH 3EGSB 4UOW0 1XD0A 5CJXA 3BP6A 1I8AA 2R27A 3HUJE 1EMTL 3S9DB 4ALAL 3ZL4L 5HDBB 3ZKQD 4P23C 4J8RB 1A5FH 4A7QA 4G1EA 2IDFA 2PR4L 1FIGH 2JV6A 3MCLH 5JA8B 3D0AA 3O9WA 4WQOA 1BAWA 2HG0A 2E7LC 1FFRA 2BOBA 3VYOA 1L7TL 4GRWH 3QJSB 1ADWA 4PGDA 1ZT4A 2P7TA 3ALPA 3Q1SH 5DQ9B 4MD0B 1MFCH 1VF5C 2FJSA 5FO8A 1QBBA 2E86A 2YLKA 4BKLA 1YYLH 4PJ5E 5C07E 4NQXB 4RFOL 3FRPA 1UD2A 2J20A 4PJFE 1KCRL 2O5YH 3KPRB 4ANVA 1M9WA 3S3DB 1SBSL 4LVEA 3TBBA 4HT1H 1MFCL 3CZSA 5G2NA 1F6AA 3CH1B 4ZW5A 5KYYA 2AMGA 1SOXA 3FUIA 3FSZA 3PWJA 5IOPB 1JG9A 3R1GL 5HVWA 5LHDA 3PAVA 2DLFH 3QW9A 1FP5A 2VAAB 4KTDH 1NPNA 4QJ4B 1U8KA 1I3GL 1L0YA 2YAHA 2A7BA 5TQ2L 2BPBA 1YMME 5DRXB 3GMMB 3ZYIA 2D9CA 3LXBA 2IJ0C 3MLWL 1DJIA 1EFXA 5I1KL 4LSUL 4A66A 3CFEB 4MWFB 3V4VA 2HKAA 4LLUA 5EU6A 1P6FA 4P46D 4PJ9C 3WELA 5IQ9B 1KJMA 2ZAHA 4JO5A 4F9LC 4E36A 4ODXA 1QO3B 2I85A 4QDGA 4NP4H 2GSIB 1BXXA 2FEEL 2IPUG 2Z7UA 3UEQA 4JFED 4G82A 1X6NA 3WLBA 5HYSB 4FMKA 3M1CA 3PP3H 3C5ZC 4JRYA 2O5XL 2KERA 3IU4L 5K69A 1MH5B 2BC4A 3CHXA 1ZT7A 2YUVA 1JRHI 2AJSH 5AB1A 4AVJA 3PDGA 3D3VA 1RZKL 3MACL 4HLZG 5E9DE 3RY5A 1FDLH 2OXGB 4B5ZA 1Z9NA 4PHXA 5EULV 4U1JB 3MNMA 3ULUF 4A7TA 3RGVD 3V10A 2EDMA 3HI5L 2VB5A 3NGBB 5J6HB 1I7UB 3O9WC 2PPAA 1P7QB 2KHAA 2CU9A 3LSOB 4XZ4A 3S98A 3FCTA 4XNBA 4D0CB 1LK2A 1JRHH 4HWEL 4RFEA 5I9QC 3AJ7A 1UOWA 2FB4L 2OXHA 4PJDF 5L7XH 4U05A 4UDTA 2P49B 4KV5E 4QEGA 4RMWA 1T3FB 5F7KC 1OP5H 2BCKA 3CFKB 4W9LC 1ASPA 4KH9A 4DW2L 1S9YA 4ZUWA 4DKEL 4KZEL 2TSBA 5TDPA 3LKQA 2UUDH 2XVLA 2X4TA 4Y4KA 3AG2B 1NSNL 3L17A 2EXYC 3A4FA 3HNSH 1TVHB 5I1DA 4GMSH 2VMEA 1OWWA 4JPQA 4MJHA 2VN7A 4HMEA 2ZUSA 4PJ7F 1X9UA 1W15A 5T33H 4JFDB 1J9TA 2YWZA 2HFFA 4WI6A 4XOEA 4UNTA 3DX1A 4C56A 4DK3A 1CGVA 1GYAA 2E6JA 4HJJH 3ARED 4J3UA 1A7QL 1SGKA 3O2WL 4PRDA 5IWLA 5BS0E 3M8OH 4L5FE 1JV5B 1OTSD 4I4WB 5CBEB 4DO4A 3QQ3B 4NO5B 3U1SH 1U95B 2ADIB 4WI7A 3DYMA 3QJHB 4FTVB 3F04A 4HK0B 2VDOB 5F6HJ 2PTVA 3DKHA 3SO5A 4IGBA 5KBPA 4NFDA 1U8JA 4PWIA 1M56B 1MDAA 5DRZB 4M6ML 4PJAB 4E9LA 1UB6A 3P2DA 3H3BC 2EDDA 3UO1H 5JZ7D 1U8HA 5B38B 2UY6B 2CJSA 1P5VB 1TDQA 1G5GA 4TUOA 3HMWL 4JJ5A 3RVXC 2CLZA 2GITB 3CZLA 1UWFA 3ES6A 5HHPA 4GIAA 1IGTB 4O2FA 4YDLC 1BQHB 1E6JL 3MLXH 1F4AA 3NJHA 4LF3B 3QJTB 5E5RB 3SKMB 4Q9CA 4UNVA 5ID0A 4L4JA 2CKBB 3GSUA 3O8XA 3DJZA 4L9LB 1CDGA 3LMJH 1M57B 2WGXA 4Z7QF 2WWKT 5DDHA 2ICWI 1FO0A 2JQAA 3VFWA 3RWFB 4N2OA 3SSGA 4GINA 5CU9A 2ZZUT 1RZKC 1UVQB 1YO4A 2IQAA 4KMQA 4X7DC 3SDXA 2A6JB 3HG4A 3IVKA 3UTTD 1JHKH 3GGWA 3TO4B 3A4AA 3B7RL 4C83B 4P5KB 5HPOA 2BVOA 4ATTA 4RMRA 2G4GA 3BZ4A 4ERSL 2OK0H 5GRUL 2X6BA 3U46B 2IWGA 3SJVA 1QP1A 4HIIA 4IRSD 1KXVC 2F54E 2FECI 2Y1YA 3QJFB 3ERXA 4YMPA 4UU9A 2IIJA 3VXME 3GLAA 3QFDB 3RUGA 2R4RH 4S2SA 3GRBA 5IP4A 3GS7A 3OKMA 5LN4A 1TZAA 4MCYA 2HXAA 1EX0A 2MPAL 1Q9OA 4WAFA 2DH3A 4CVWA 4JFZH 5FYLL 3LY6A 2X4NB 3RDJA 3TYGH 5EBGA 3AWEA 2X9XA 4RCAA 4FG6C 1JCKA 5IIEA 1YEIL 4PW9A 4KRMB 4XCYA 3JXAA 4NI6A 2YUXA 1NKGA 3HS0C 2CZNA 4UDUB 2GHZA 1A3QA 4IMKA 3QJOA 5CN1A 1JZ2A 3T0EA 4L3CB 5D1ZD 3C12A 1YEFL 4PWKA 4GRWF 4K07A 1AO7B 1UXWA 2DQMA 3H54A 3R1GH 4PJGB 5L2JA 3OMZA 1RUML 2GSGA 1PGRB 3LEXB 4NN7C 1ZHBA 1IFRA 3RVVC 1UWYA 2F68X 5IFJA 3E7JA 2VLJD 4U4BA 3UTOA 5KBKA 4EUPG 4XN4A 1MCEA 1A25A 4ZFOL 2BY3A 1DQDH 2ZWSA 3QXTA 4NQVA 4ZTEA 3MNVB 3MLUH 4YX2H 3TS8A 2XN9B 4IOIB 2Y06H 1KT2A 1I9IH 5HYJA 4PBDA 4JFVA 3DO3A 4M7KL 4XPBL 1FLTX 3NIFF 3MREB 1UENA 3RGVC 1Z9OA 2HTLC 5I1DB 1RJLB 4JDZA 3MA7B 4HKXB 1DANT 3V0WH 2DLIA 4ZD3L 4LEOB 1QEWB 1HEJC 1BVNP 1X5MA 4PCKA 2XWTB 4HEMA 5KSVA 1LQBC 5JUEH 4YO0B 3HC3H 1NCUA 2WHVA 1BQHG 4KKAC 1NJ9A 2JQMA 3TURA 4JFWA 3GD1C 1WA1X 1VACA 5FCSH 3NZHL 2VRQA 4RFOH 4D0BA 1RK0A 2AJXL 3OG4B 4WLCA 5BZWA 4Z0XB 2E74C 1J9SA 4JZOB 4L23A 1QRNE 5KBNC 1U33A 1XF2B 3NZHH 5CKGA 3IFNL 4J4PC 4FTDA 1M7DB 4BFNA 4CSTA 4LSDA 3ULVF 4OI9A 4JANA 3FOLB 4YHKH 5J13B 5I1IL 4PY7A 3MJ9H 1LWJA 1BGXH 3CN3A 4MLIA 2RQEA 1AGDA 3I02B 3NDZE 1KGYE 2KZWA 3BPNB 4FI8A 5I8CB 2CO2A 3GMRB 1HC1A 3VXSB 3JV4A 5C0IA 4U1NB 5IM7B 3V7AE 4HS8L 4AE0A 2UZPA 5ETUB 3ESMA 2EO1A 4Y2OB 4JM2A 4F3FA 2DQJH 4DVRL 1HHJA 5SX4I 4LMQI 3T2NL 1KELL 2UXVA 4RLDA 3U6XA 4N1CA 4I48A 5EU4B 2F7PA 4YSPA 3VJ6B 3S48A 2XXMB 2B08A 3H0TB 1ZLVK 2NY1C 4R9HA 4X9IA 1KTBA 4C4BA 5KVEH 2A5UA 4DKFL 2DLHA 5KBDA 2KZ1B 1XGRB 2WKLA 3GK8H 1X7SA 1I8IA 4XMKL 4M6OH 1HKFA 3QIBB 2UZXA 4E2OA 1WFNA 1IKOP 1U2HA 5TF1H 1N6QL 5J3HC 4X6CA 2C26A 2XTSA 4PRNB 4GMSL 1EV2E 4LLDB 5T1KB 4BELD 1T2JA 1WCBA 1HX0A 3ZGIA 5D1QD 3CH8A 5G4OA 3EJCA 4GKLA 4N8VB 2IGFH 1G84A 2X9WA 1L4IA 3CLEL 3M1OA 3OAZH 2B0SH 2MH4A 1CL7H 3BWUC 4WK2B 1KCWA 2ORBH 5IEHB 1DLFH 4GSRA 2FSEB 4PJXE 4N0YH 3WCYA 1ND0A 2QPSA 3H7BB 2VW6A 3V0VB 1OGAB 2IMMA 1E3FA 3WG7B 4EUPA 2A9NL 4P2RA 1QWUA 1EHAA 4Z7WA 5C2BH 3ZDYE 2R2EA 1G7HB 1XZWA 3MNDA 1DVZA 1KLGA 2CLRA 3MBEB 4GP8B 4QRPA 5H4ZA 2FQFA 3ATDA 4LHUG 3MCYA 3IRCA 2NSQA 4JDVA 3SQRA 2WZAA 5E4EC 3C60B 2QGDA 3VE0B 1A14H 2AEOA 3IXAB 4FABH 5EN3A 5EU5A 2P5WE 2BO0A 3WD5H 1M05A 1Z5HA 2RIKA 3K2MC 3MNVA 1IRAY 1XIWD 3CLFH 4G7YH 1YCSA 4YSAA 3H9HA 3C5XA 2ZYIA 4KJYB 4W9DC 4Y9BA 1RJLA 4OFVA 1UQSB 4BFIA 3PNRB 1DQVA 3N04A 2WUBL 4K0OA 4PRPE 2HT4C 3QDAA 2BRRH 3SY0A 3US1A 4UAOB 2A6KA 1NDGA 2VDQB 4OBRA 3EDFA 1F4WH 25C8H 3L1OL 3TNNA 3G5VB 3VGHA 4UNUA 3D25A 1MF2H 4N2MA 3T09A 5EIVA 4J3OH 4BYHA 4EI5A 1UD8A 2YQ3A 1RK0B 5BZWB 1CK0L 3GQFA 2DMKA 4HIEA 5D1ZI 3FH8A 3HE6A 2D31B 3KCWA 4IKJA 5HJ3B 3QUZB 3Q1SL 1N7ML 4ADGA 4ODVL 4KI1A 4XNDA 4KHXL 5FPIA 1MUJB 5IZ7A 4ODUB 3STLB 4BCZA 4HK3N 3L4CA 3SPIA 5MENB 3SBQA 3AMKA 3BVUA 1BAGA 2PYEA 1D7FA 5SWSE 1HYSC 2MOVA 5FXCH 3RPIA 4LHUB 1MCNA 2ATPA 2K6ZA 1QKZL 2WVTA 3OZ9H 3QUXC 3CN1A 4BQBA 4Q97A 1GTNA 5C0EA 5J6GB 2A1WL 3QS3A 4WKZB 5IB5B 1LE9B 4AH2A 4TM9A 3TYFB 1QPKA 4FQXB 3L16A 5FIEA 4PLJD 1AZZC 2IBZY 2PO6C 4I77L 3FPYA 3H42L 2OSYA 3MODL 4ODBD 5CR8A 3UGUA 4BHUI 2YOAA 1IC7H 3FQNA 2DQFA 2KQMA 4NJ9L 4ZT1A 3UJIL 2XLLA 5CUSL 2CDGA 2GCYA 3QZNA 5D7SH 3RHWK 1OSPL 3QNYA 2E4TA 1MRDH 5F6IC 4GH7B 4ANWA 3KEHA 3ASNB 4WTQA 3EFDH 3ESPA 5EU4A 2ODIA 2Z8WC 3HBQA 3EJTA 1LO3H 1YYML 1YN6B 4M5YH 3REWA 3JVFC 1WBXB 3FQXB 1CD0A 1WWAX 3FPXA 3W0WA 9CGTA 1FRGH 3KXFD 3CZFA 4KNTA 5JW4N 1JTTA 2YMOA 3H4FA 2DH2A 3T65A 2FJFA 3BP7B 1UEMA 2VITA 3RZCC 3MLRL 5E7FA 1YPZA 5BJTB 1U8LA 3WHE0 1F5WA 1GOGA 1WFMA 3TBCA 5I1IH 1REIA 4UIKH 4HIXH 2FBOJ 4HKJA 5B1AB 1WP6A 4LLDA 5SWSD 2JCWA 4MNHA 1L5GB 3MRQA 2AQ1A 4JDEB 5JXAH 3JTSB 1XTMA 4MXQC 2Z8RA 4JFTA 4BSWA 4E42A 1QZNA 1QA9B 1CS6A 2VLJA 5AKVA 3FQWB 4JRFA 1NLDL 3SQBB 2OBGA 1TVDA 4LSSL 4MJ6A 4PTTB 4Q2ZB 3DJSA 1F4XL 5JOPE 1NLBL 1SEBA 2R4SL 3GSNA 3V4VL 1G7QB 1E5ZA 4NQTA 5EBMB 2FIKB 3EO0B 3MHZA 3ZKND 3Q06A 4TL4A 1MW0A 3FT9A 4LESA 1PF3A 1KIQA 2QADC 2IOMA 4YXHL 3OG6B 3GMNA 1AH1A 3D5OF 5EZLB 3FU0A 4B9ZA 2TRYA 4ZW6A 3ARFC 4AEEA 1CZ8L 4F7CB 5IROC 4B9KC 3HBGA 3PWUB 2EVJA 4B50A 1KTLA 4N1HB 4YHKL 4DPRA 3TESA 3BESR 3S5YA 4W4OC 3GMMA 5DS8B 3TN0B 3DURB 1OE2A 4RZKA 4DAGL 4JFPB 4ZOEA 1IM3D 1ZLDA 1C5DA 4LVNB 4GAYA 4DZ8B 4N87A 1HCYA 1LO0H 2G0KA 3MOBL 1D9KB 3MRDA 2PPEA 1JK8B 1GPOH 2X5PA 4AYFA 1GGCH 3RILA 2ZSVB 2IAMC 5L8JB 4RGOL 3I74A 4UANA 4PG9B 4HUVB 3L3GA 1ZT7B 4LO9A 5ALBH 1F41A 32C2B 1G7MB 1A3LH 4FZEH 3FRPG 1VFBA 2CJTA 5KZCD 3V6OA 5C7ZA 4MKMA 5D72L 2OMWB 4Q0XL 4J8QA 3JWOL 3GTTA 3TNMB 3SEPA 4Q9RH 1NDMB 3PFUA 3S36H 2F1BA 1XIWC 2EICA 4URKA 1XX9C 2NX5A 3DETD 2B1AL 2J57A 3RKPA 1KPUB 1ERNA 4HUWA 4F7EA 1AS8A 3G6AB 1XF5A 4NI3A 4LKCA 4IU2B 1AGCA 3HUJB 3CFCL 1MREH 1JPST 2CHNA 4HJJL 1MHPL 4NUGL 3K5SA 5DJAB 3QUHA 4X7CC 1R3IH 2IDUA 3GJEB 4BQ8A 4G6JL 1QTYT 3QR2A 4X0NA 4FFZH 3ARSA 2V5YA 5ICZA 3FO2B 3MLPA 1QLFB 5DK3A 4QHUA 1K4DB 3HI1B 1CBJA 3E3QC 3JQOB 4G1MA 4WNSA 4I0PD 1CICC 2BNRA 1IAOA 3HCVA 3DV4A 3ULVC 2HFFB 4HAKA 4J3VA 5GRYA 5B8CC 1BOYA 1Z9SB 4OF5A 5CKAA 5DMYA 5EEWA 3U4KA 1Z0MA 3KYKL 4Y5VB 5ANME 3FQNB 5DUML 3GSRA 2HFEB 5DD0L 2GI7A 2B0SL 5KEZA 3MRJA 1F3RB 2QJDA 4FC3E 1MIML 3NJVA 4TVPH 4ZTOL 4J2XA 1IQWL 4OZHA 5GGSA 2Y7NA 4H8WH 3JYCA 1KEMH 5HHVH 2A83A 1BHGA 3LPPA 4YHYC 5JQHC 2O1AA 2IFGA 2UZIL 4D9LH 2WANA 3MVSA 1B0GA 1KB9K 2BOCB 1AI1H 4I18C 4MAUH 5L6YL 2NXZC 3P69A 2NY3C 3BVXA 4XN1A 3L5WB 3TN0C 3N5AA 2ZT9C 4KO5A 3RWDB 1B4TA 3GO1H 3LQZA 4R4NC 1MOEA 5AVUB 2LAAA 3WNIA 3CFMA 4M5ZL 3DMMC 4OLVL 2J2ZB 1RY7B 4FLRA 1TZGH 1JWUA 1X5ZA 2ETWA 3DX7A 3MTXA 4G9FB 3QUZC 3FJTA 4OZFB 1ET8A 3DIDA 3SKMA 3WKQA 4MJ5B 1NIFA 1H3TA 1U4EA 2VLJB 1MJ8L 1A1NB 4XX1G 1BWMA 5CJOH 3SDDA 3CE1A 1PG7X 1VSCA 4OJEH 3LNHA 3VRJB 1HWHB 1YC8A 1I3VA 5B21A 3SPVB 2EECA 2WC7A 2GJZB 4BCXA 3POCA 1AVAA 2BSRA 3IETA 1G7QA 3OZ9L 1IC5H 2ITEA 4JDTL 1GHFH 2H4EA 2EYTB 1HEZB 2FK9A 4K55A 4QAWA 4XVUC 1I9JL 2EDLA 1U8OA 3LZRA 2BVEA 3HG1B 1VFUA 4MX7B 1IGIL 2CK0L 1KN2L 1UM5H 3JSSA 4XNMB 1YUHA 4S1RL 5AVQB 3IDXH 4MMYA 4ZX3A 3OWRA 4FKHA 4E41B 2XCMC 2AQRA 3U9PH 3L5XH 1NCNA 4EKJA 3QUMH 2IBZX 4PJXB 5AW1B 4DOHE 3HLAA 1J1XH 3T3PE 1C5DB 3WE1A 4OGXL 4BKLB 1NAKH 3FW6A 1OGAE 5EZJB 5AAMC 5TK2A 5TPWL 2LTQC 3K71B 3C60C 1D9KA 5GZND 2COQA 4HC1A 4HKZA 4WI0B 1QSED 3PIQB 3B56A 5DJZA 5F7BA 4G6AC 1J9CT 2ZSVA 4NUMA 1I7RB 2ADGB 3RTLA 3L3JA 2OMTB 4R4ND 4UDUA 4F9PA 2YJLA 1GR7A 1FH5L 2R2CA 3R8QA 5I1LA 1U8PA 1R5VB 2WGNB 3AREC 4JFHD 3T9WA 5B3SB 4M7LH 4XOCA 3GSOA 1CGUA 3QUXB 1PZ2A 1KGCD 4IGBD 4R2GD 3WUWB 1VB9A 2DEXX 3A6OA 3U0PA 4P07A 2XIIA 4WU5A 3V8CA 5SWZB 4JO4H 4W81A 3S37H 2EDJA 3RY6C 5FYKD 5KVGE 1E6OL 1GCFA 1JV2B 3WFBH 3FB7A 5FO9A 3V9CA 2AEQH 3TV8A 4OLXL 4AITA 2A9BA 1FVCB 1WYJA 3LIZL 4HS6A 1U92B 1U8QA 1TZIB 3QWRA 1OB1B 1DQJB 2JKLA 3L5IA 3LOWA 4OZ4A 1S7SA 4APQD 3WKNA 2IWEA 5BXFB 2NQ3A 1IGFL 5INCB 3CHOA 1CFSA 4LSTL 2JLPA 3QJQB 2XWXA 1EHLH 1WEJH 4JRYE 2XZAL 1Y1DA 1MJ7L 2O6CA 2VZOA 3Q3GB 1DVYA 4QKTA 2XWJA 1ZHKB 2EDNA 4KY1L 3BUYB 4MA3B 1NC2A 4QHKI 5BRZE 3CFKA 1CO1A 1A3RH 4PTUB 5I16B 3RL1A 2ZIDA 5I1JL 1IV8A 3O2WH 4NNXB 5EDXA 3A5VA 1F18A 4OBSA 1JZ8A 4MS8C 1L9SA 1IMHC 5GZOD 1KTKE 1JWMA 1CYGA 1M1SA 5J4MA 3MUHL 5EH1A 3PGCB 1FDLL 2EO9A 3R06B 2EIZB 4RISL 3U25A 3EJZC 2DI7A 1MRFL 3LQZB 5GS1B 5JIIA 2AXWA 2EXWD 3LD8C 2V6HA 5HYQA 4JX0A 2JKRM 3RG1C 1ZGLA 1NEZG 4R2GC 1JWUB 5DLML 2KZBA 4C54A 5FGCE 3TO4D 4WNQB 1DVSA 3K1DA 1U6AL 3QWOB 1DUZB 4LDLB 3WTXA 2QVIA 2J4WL 1VEOA 3KVQA 4FTVA 5DUMH 4RAVA 2B1HL 2CIKA 1I7TB 2NRDA 2XTJB 1A4BA 3E1ZA 3ALXA 5D8JH 4PBWD 1U58A 4YIQA 4M7ZB 3QHZH 2WNKA 3H9SA 1U8JB 1BIHA 4DP1X 5C8JB 2WMPA 1GYVA 4HUXA 4NEHB 3S37X 1FO0L 2C9XA 2FO8A 4LPUA 2JTDA 3KLSA 3GTNA 1I8IB 2EE6A 4OCSL 3SGJA 2EYSA 5FHBH 1UXSB 1FNFA 4LCYB 5BVPH 2O5NA 3V0HA 5E7BA 3H3KA 5DD6B 3W0WD 1BQHA 1ZV9A 4OCYH 1LMIA 4B9IA 1CVRA 2B16A 3IMTA 4LLYB 2A38A 2NY0B 2YD5A 1NFDF 4H88H 2ICEC 2P4AB 2EABA 4N8VA 1E8ZA 2PCYA 2CAKA 3NIDE 2P42B 1YSOA 4OT1L 4N4YB 2QQLH 1DE4B 1IGJB 1UVQA 2FWOB 3F8UB 4E41A 2HJLB 1HNGA 1FV1A 3I3DA 4FHKA 3IVKB 4MMXC 5T3XH 3AY4A 3OKDB 2MMXA 3WEAA 2LHAA 1NC4A 1T89A 3ULUL 4EDXA 3VXOA 1R5WA 1G4RA 1ND0B 3G6JF 3RZWA 5KVDH 2FEDC 2D3JA 4PCYA 3OF6D 3LYRA 2WAQA 1E5BA 5KYWB 2NT1A 3RJQB 3SPJA 1ZXKA 4DFHA 2Y6SD 2O6DA 5EDSA 4XBEH 2K45A 1U8CB 1FFPA 5EA0L 2ZUWA 1FE8H 4H8UA 5DYOB 5C0AA 1MKFA 1NL0L 5D1XC 3B3IA 2MFNA 2QVFB 3C2SA 1BXVA 4BFJA 4XBEL 2BZ7A 2RFXB 1KBPA 4CVXA 4IJTA 2NYKA 4W9ZA 3U9UB 5CEZE 2AAAA 2YC1A 5LCVH 1QFUL 4LZKA 1XGTB 5I30L 3QWRD 3SD2A 3P0YL 4KJYA 4S1RH 1U8QB 1JNLL 3CVIL 3HE7A 4Y4FC 4Z1PA 1AHWB 2EEDA 4MNQD 4PJGA 5CCKH 5L2JB 3M6DA 4X7SH 3VRLF 5I76A 1QW8A 4L05A 2MKWA 2F5BH 4L8CA 2F7IA 3N50A 2A6KB 4X4MA 1KMGA 4A7VA 4HFWA 5JHAA 5E8OA 2MQ0A 4NWTH 4GRWB 4OGAD 4UM8B 1ZIBA 4U1IA 2DBLL 2IPUK 2F53A 1F2QA 3VI3A 4NSKB 2AJYH 2OZ4L 3LRKA 2X38A 2XDHA 4QRRD 4UM9D 3VSQA 4X6BA 1ADQA 2YA1A 1J1XL 1ZLWH 5KVFL 3BPOB 1U8MA 5DT1H 2F6AA 5EZIH 3PNWB 1UT1A 2B39A 1NEZA 3OMIB 5E23A 1T1XA 1H6EA 1UM5L 1FGVL 5C0BD 3T6XA 4IEFB 3VWJC 1R4XA 1MZYA 5IB1A 3J07A 1UKTA 3JT2A 3UMNA 5C0EB 4YO0A 3BWSA 3IYLW 2HKFL 3SE8L 3SQOH 3HS9A 5I1GH 1H0DB 3FN3A 4CA4A 3ZUNC 2CRYA 2GFBB 3GBNL 3OGCA 4MMXB 1YYCA 2BERA 2Z7YA 2O93L 4X0KB 2AJXH 2OZ4H 2GTWA 1E6OH 1JPSH 1MCDA 4ADJA 3GUFA 5ANMA 3NGBC 2GBUA 2KBGA 1TQSA 3KE0A 2X89D 4FQLL 4WWKB 5C92A 5BVJA 3FHAA 1WWWX 4NENB 3NCMA 1JD7A 4QTIH 4UWQB 5CF3A 4AQ8C 3H9SB 1TKWB 3JV6A 3N41B 3FOLA 1YN6A 3REWB 1FGVH 4Y4FD 3CFUA 4N9OB 1MRCL 1VGKA 1XGPA 1OHQA 3TBVA 1BD2A 4B9PA 3LVEA 4ZAKD 3B9EA 3T65B 4JQVA 3QAZB 3LN9A 5AWNH 1JGUL 1QSEB 1C5CL 5DK2A 1OE3A 1N0XL 2GK2A 3BUQA 1P4IH 4HKJB 2EKSA 4NO3A 4EN3A 3I9GH 2W07A 1TCMA 3QNZB 1E4KA 3K6NA 5HY9A 1K3IA 1HHJB 1KGXA 1NLDH 4YSUA 1L9RA 4P2AA 4ELMA 1MFDL 1IBDA 4GYBA 4PIBA 3N55A 1S9WB 1VCAA 4OJAA 3QDJD 4KRLB 5DFVD 1TJIH 1IKFH 2CR6A 4C4KO 4DCQB 3C9NB 1AQDA 5DJ6B 4F7MA 9PCYA 4KNQA 3VMNA 1NIAA 3WTWA 1J8RA 5LAXB 2MQGA 4G8EA 5SWSA 4Y1AA 2OI9B 1ZSDA 3T3PB 4L2YA 1HZLA 1P6WA 5E4EB 1F58H 4R4BB 2DIAA 4QT5A 4LBAA 4GKZA 4UAOC 2MCG1 3UAFA 4WGWB 5FDWB 5GGTH 1U3HB 2BWQA 4B3VA 5CS7A 1I1CA 1FNEB 3HNTH 3HR5B 3S88L 4A7SA 3DURA 1KUMA 3BWAA 4JE4B 4P2CG 4HWEH 4AMKL 1MREL 3QQ4A 3BVWA 2DQJL 3BFOA 2EZ0D 1TLKA 4JQXA 5FKAA 2NY5C 3QUGA 4GAYB 2EJ1A 3EO1B 3K81A 1RVFL 1QX1A 4IDJL 4P5MB 2LABA 3TF7C 2Y7LA 2HTKC 4U3XA 3BMWA 3Q2NA 5J1AB 3HE7D 5EUKB 1G1KA 4P2RD 6CGTA 4AZ8B 2FQEA 3RWJA 1A1MB 3FO9B 2WY3B 4O9HH 3IJ7A 2IF7A 3VFSA 2M8XA 3I2CL 4P2RB 4Z7WB 4WV1A 32C2A 3VCLB 2ZJSL 2WSPA 1AI1L 2XACC 3MGAA 3P2BA 4MAUL 5L6YH 3DUSB 4B0MM 1CGXA 5LJYH 3T2OA 1ZV2A 4D0CA 5FA3A 3MV8A 3SDXF 1HU8A 4NQEB 5MEPA 4FCAA 3D8MA 1CU4H 4FQ2H 4H8PA 3ARGA 1RUPH 1KB3A 4P3CL 4KVNL 3LS5L 1R34A 1OPGL 3NJNA 3AG3B 1JYNA 3H56A 2GSIA 3U0TB 3V95A 4LIQH 5DTFB 3Q6GH 3ZL2A 1L6PA 1FFQA 3BQUB 4D9RD 1S8DB 2FVNA 4QO1B 5FDYA 5C0AD 3KYKH 4L1TA 3TA3C 4F57H 3DI3B 4XPFL 3S5LB 1ROCA 1JYWA 2RH0A 1O9ZA 1EZVY 2GJ6A 5T3XE 4G11A 1F02I 4KJWC 1L9PA 5D4HA 3CXHK 4ODWB 5IEKA 3TLRA 2R23A 4HCRA 4FLOA 4GI6A 2ODHA 1EQWA 3MOQA 1ZVNA 3QT2A 4L29A 1U3HC 2GFBA 3GNML 4LPWA 1U8IA 3P0VL 1GJUA 2Q86A 2X0WA 3K6SA 4QNPF 1K8DB 1IT9L 2P5EB 2WLLA 3OQ3B 4E41D 3L3KA 4ELMF 4ZG1A 2A3TA 2NY6D 4KXZI 1ED3B 3MC0A 3H2QA 4OLVH 5J7CC 5EOCH 3MODH 5EEVA 5DD5H 1IBHA 3OHMB 1TKWA 3SE3A 2CMRH 1MW1A 2XWEA 2AK4B 4Y9EA 5I8KL 5A2FA 2CGYA 3LEYH 3OM3B 1S7WB 4QRPE 5DUBA 3ZHFA 5MP6H 3DX4A 2WXMA 3DXAE 4AC2A 5DFWH 3BH8A 1AR2A 2Z0UA 4BSVB 5F88A 1SJEA 1EAPA 2QKIB 4XB8A 3OKYA 5G4NA 4TVPE 3QI9A 3IDMB 2XTJE 2G3MA 5EUOB 5IQ7H 4ZQTA 3UTZA 3HNVL 2NQDA 2OJZL 1DZBA 5LNEA 1NBZA 5F1KC 5LGHH 5K1VA 3WL9B 1H3VA 3HS0A 4R90H 4Z23A 5LQBH 3E1F1 3NACH 3N1GC 4EN2A 3I6LE 5GSRA 1S9XA 4JRWA 4JUSA 4ONGH 2F0CA 3O0RH 5F0JB 2NXYB 1T5KA 3LV3B 5GHWL 2Q8AH 1QBLH 2QHRH 3F65A 3EJPA 3O4LD 3TEUA 5IFAH 1LK3H 5AZEH 4IS6A 4ZD3H 4R6UA 3NJJA 3KHOA 3X1FA 1XL4A 3GLZA 5D2NC 5IWLC 3IU4H 2WLYA 3ZT7A 2L7JA 2DQCH 3B83A 2GC7C 3ALWA 3DTXA 4ENEC 4PJAF 3O6FA 1RERA 1J0ZA 2W65B 3S35H 1WRFA 4TNGA 2OMNA 3VXMD 4E42B 4DJMA 4EZKA 1GJWA 4RZCB 2AJYL 2GKIA 1XCQB 2HH0H 3L9RB 2V33A 2Y5TA 4J6RH 1BZDA 4NZTH 4MJ6B 2P47B 3B34A 5BZZA 2VM3A 2IQ9H 4G8FB 3FT3A 3SE3C 1ES0B 1P0SE 2GPZA 4QHPA 4UTBH 3SYAA 1EJ6A 1VGEL 5JXAL 4HKZB 4Q6IC 2BIHA 3AY4C 2EYRB 3K6FA 1ZKAA 5CZKA 2AEWA 2BIOA 3SE4A 1A02N 1DSYA 1DBKH 3AB0B 1GPOL 2EEFA 2HKHH 2ZX5A 3LNEA 2X2UA 3LRLA 3S3CB 3VQ1C 3FUHA 1UZ8B 1DDTA 5I74C 8FABA 1N5YL 2ZP8A 5IMOB 3MLTB 5F9JB 4LHJB 1WZMA 2X89A 3WUWA 4KVCH 1NCOA 5HHXH 5HJDA 3W0WE 1UT9A 2FLBT 3ZKXB 2C7UB 2F61A 4TL5A 1IC1A 4MDJA 4YPGB 1OSEA 3CFBA 1Z9LA 2RR3A 4NAMA 1WAPA 3TGXA 1RJZB 3L3HB 1ASQA 3ZVVA 3CZKA 2NY3D 3O6FD 3VH8G 3ECBA 2BOLA 3BP4A 3SGEH 2XYBA 2C7FA 3CSYB 2FYYB 3WV0A 5FOJA 5IMMB 3CLWA 1CFNB 2VERN 5ECJE 1LWHA 1SPDA 1U3NA 2FEJA 3L4WA 3MX0A 1S3KH 1TETL 2LR4A 3QFJD 1Q90A 4CW1A 3LIUA 3ZYJA 1JPTH 4BWUA 5PCYA 5KVEL 5I8EB 2VDKB 1QSFA 1J87A 2WO2B 2N7AA 4ZMTA 2FR4B 2QBWA 2DM3A 3KLAA 4XXWA 3BUYA 1PYWB 3CBRA 3HUJA 4LVOC 1KF9B 1Q94B 5HXMA 4ZSOB 4JPWL 4AIZB 1NBQA 2X10A 3BKMH 3HG1E 4OZIE 2ESVA 4KPHL 4X6DA 5C0GA 1OAZH 3BH9B 4NCDA 3ZKXC 4GG6F 1N5AA 4Q6IA 2BY1A 4UINH 3GJEA 3BKJH 5D6DC 3A4DA 3QFJE 3TZVC 2H3KA 4GRLA 3QJUB 5HGHB 4PJEE 4NM8H 1FN4A 1W72L 2GIXA 5FGRA 2Y69B 1BZ9A 4Z7NF 3DJRA 2CBMA 1M9SA 1RHHA 4KKZA 1G4MA 2DTSA 2F5AL 2CH8A 3EHBC 3WKML 3D4CA 3RIFF 1OAQH 1OSZB 3CCHA 3DYOA 3WNKA 4F8OA 4C55A 3O2DL 3QQNA 4WFED 2AJ3A 1KIPA 1T1YB 4N0FB 4Z3FA 2JI1A 1WZ1L 2BSCA 3SDDD 3NG5A 1IM3B 5F6IB 1YRKA 5CBAB 3QH3B 4KI5C 3SYQA 4P59H 1DDHB 1E30A 2HZHA 3H4HA 5AW9B 1AACA 1RI8A 2A73B 2W9LA 3UIZA 3MUGA 3GT6A 3T3ME 3VGGA 2OK0L 4OCSH 1S2EA 4F8NA 1KGUA 3I50H 4JLRB 1KPRA 1CLCA 4XPFH 3QYCA 5K59F 4AL8C 4LLVA 3X1NA 4OY9A 1I31A 4JM2D 4WWNA 3EYSH 4HUUA 1ZT4B 2P7TB 2WW8A 3GZKA 3MV8D 4O02B 4IBZA 4CN6A 4YHLL 5D7JA 5CIPH 4YFLI 1GL4B 3VMPA 2C1OA 2XG4B 3P3YA 2HWZL 2VLKD 5IHHA 3HJ0A 3FZUD 3O3BA 1M53A 1FCCA 1SN5A 3OMNB 5CZRA 1HSAA 3AS1A 2D7MA 4KTEL 4W93A 3GJFB 3HMXH 3O3DA 4NQDB 4J1UA 3BSHA 4H8QA 3MBXH 4AMXA 2M83A 3BSZA 2OFQA 4GBXB 1R3LB 1YEFH 1IAKA 1YEKL 2VE6A 1FORL 3V4PB 1D2OA 3O8XC 2OTWB 4RFNC 3ESUF 4YDVB 4KV5F 5HHNA 5BRZB 1L6XA 5DURB 4PJHE 4PR5B 4HH8A 2I7SA 5CEZL 1CXIA 1P2CA 1KB5B 1EH9A 1UWEL 3DX6A 1WCBB 1SF3A 3A22A 4HJTA 1RXLA 3F64A 4XPTL 5IBLC 3WJMB 3SZ6A 3NP4A 5J12B 3WTUA 1IO4C 2EIEA 1WZLA 5DHVA 3VH8A 1S6NA 4N0RA 3DRQB 2RFXA 4B9YA 2DIEA 3HTLX 2BP5M 5I1KH 3NCWA 4KJQC 5B7EA 2FSEA 1UM4L 4FFYA 4D9QE 3HIZA 1RJCA 4CJ0A 4YNYB 5B8CA 2OMTA 4ZFOA 3BAJA 2PTUA 3VRIB 2OXGA 1RLWA 1ADQL 4OCXH 2AQNA 1W80A 2ZX9A 4GG6E 1EUTA 4N2HA 1UD4A 3LIZA 2VUOA 1I7UA 4D94A 1QI5A 2BW4A 2APTA 1I1FB 4JR9H 1ZGLM 3HN3A 1RSFA 3LVTA 2NXZD 1PKQB 2DRUA 3FO1B 4X8JB 1WVZA 4JKLA 3IXAA 1IEBA 4Q4IA 1CYXA 3LRSA 4KROC 5I1GL 4NNPH 5HGBA 3EYFB 3QAQA 3NZUA 1S4IA 3ML9A 3T2PA 1S5HB 3NJIA 3GKWH 2DWSA 3BGAA 1E2VA 1BG1A 4ZO6A 2XKNA 2H6UA 2CK2A 3BUIA 4LGRB 3TH3T 3VX0A 3FQYA 1JPGB 4JG0L 5MERB 2VL5A 4FQHA 1FRGL 1GRWA 2CGZA 3NPSC 4TOYL 3ZDZB 5BXFA 2VUKA 3WY2A 3N9GL 1OK8A 3DSNB 2X70B 2YGVA 3NIDB 3O3AB 3PF2A 2JJWA 3MGOB 1YUKB 1TNNA 1KLUB 1E28B 4DSYA 1AE6H 1V05A 3J2PA 3A6CL 5ACMA 1NC4D 2DYPB 5C09E 4J6RL 4PY8J 4WFHE 1R24A 3VW3L 3RU8L 3WO4C 3ZYOA 2R29H 2GTWB 1K4CA 3UFIA 4QR7A 2CRMA 2IMNA 2FT6A 2OQJB 2XV3A 3Q8CA 2YAFA 5JW3L 4P04A 5BVJB 3C8HA 3ARDA 3OJDB 3TXAA 1WAEA 2FJFB 2OV0A 3BP7A 1A6WL 1UFUA 1X5KA 2PWEA 2WXHA 3CDGA 4ZO7A 4E9RA 4JN2A 5BRZD 2VMFA 1BZ7A 3DO7A 3CSTA 1M71B 3KWVA 5ILTH 3HG5A 4LLVB 5HDOA 4X50A 2Z92A 4MD4A 3MI6A 3CX5J 1OOAA 1EVUA 3GXFA 4H1LA 2VXTL 4M1GH 1O0VA 4O02A 5CINH 4POZD 4JFFA 2FBJL 2FX9H 4LSRH 4Q2ZA 2EDEA 3VI3E 1I7TA 4IRZH 3L3OA 1DR9A 4B53A 3FTVA 3VYNA 2RBLA 3NJGA 5IJKC 1A1OB 3NSDA 3GIZL 1XR9A 4I0KA 5GGUB 3B9KA 4JFEE 3GB7B 3TO4A 1QSZA 1A4KA 4MQ7B 3BD4A 1PLAA 5D7IA 4JM2C 1MEXL 2FT7A 5EU7E 1E67A 2XN1A 4J6IA 4ZX4A 4EZMA 1NCWH 2WBJC 4Z7UF 1QFWH 2IANE 4Y2DA 2D7TL 5MI0C 2Z35A 4UU9B 4D8OA 1F8TH 4F2MB 3HJEA 5AAWA 2XZQH 2Y07L 1GY2A 4L3ED 4KZDH 2PP9A 3KBHE 2OR7A 1ACYL 1OP4A 4MCYB 2JJSC 5F7DB 1QFWI 1U2CA 4NYLA 2DYRB 4F1ZA 1SXCA 3HS8A 1AD9A 1MQ8A 5ACZA 1RFDL 2I7OA 3FS9A 5KVDL 1ZPLA 1HH6B 2WWKO 4HXAL 2ZCKH 4TS6A 3P77A 5LCVL 3NFNA 3N44F 3TNMA 3W38A 3BP5B 4E5XG 3TYGL 4NGHH 1GW6A 5KWYC 4IK7A 3PYCA 4DEWA 3OD3A 1G6RL 1PLCA 1KJ3H 4I0CC 3FU9A 5FA3B 4OFPA 3ZL1A 3H9SE 1N12A 5DHYA 3EJYD 4BKSC 3ULVE 2QQKH 2JKXA 4OF3A 3WI9A 2Y3AA 5FM8A 4GQ9H 4XVOA 1J8HE 1T5WA 2V2XA 3D05A 3DX3A 1ZK5A 2XN9A 2BHFA 3GXNA 4IOIA 4P57B 2VAJA 2UZYB 2AXGB 3Q6FB 4KX7A 1RULH 4I1RA 4ACPA 3OWEA 3L9BA 3HMXA 2R0KL 3FTSA 3II3A 3SYPA 4ZPVA 4LEXH 2ZOTA 4JFXB 1NCCL 1QKZH 4MVBC 3BSZH 5E1AA 5CP3H 5D2LB 4K3JH 4ZS6C 4HU8A 3U6XS 2PO6D 4EI6B 2WBJA 5H8DA 1G6RA 5KSVB 1ZHLB 3HC2A 5BV7L 1Z9SA 4U6HA 1P9MC 1RUAL 4QUOA 3PE9A 4FI6A 4HCGA 4L0PB 3NACL 5AG9A 1J5DA 2F8XC 5FM4A 2MCMA 5K9KB 4OZHB 5GGSB 1O7SA 3VG0L 5HDBF 3MA9H 5DHVH 1R17A 4QRTB 4L9LC 4P9HL 4J3SA 5J11B 2H2PC 3BE1H 4ZXBD 1I8MA 1UWGH 2YLHA 4OCXL 3DUUB 5CILH 1SYSB 2YRBA 3D39B 2AK4A 1SLUA 1NEZB 1JN6B 5C09A 1T66C 3KH4A 1NCTA 4PCTA 3QHTC 1TPXB 2C3WA 5E6IC 2YXVA 4OQTH 4F58H 2NUPB 1KJ2A 2ICEA 1TIUA 1EMTH 3WKPA 5EOTA 3QIWC 1FZJB 1TTCA 2LU3A 4MQSB 3V4PL 2NW2A 4BQ6A 3DV4B 1YYMH 4EVNB 2Y06L 3M86A 2D0GA 4AYMC 5I73C 2FL5B 2D4FA 2Q8BL 3UTZB 5I23A 4MJ5A 4Y2OA 3APDA 4JM2B 3GSRB 1L9TA 3LKOA 5D2NB 3AMLA 4ODHL 1L9NA 3DJTA 4NKQB 5I5JA 5EG6C 1XMEB 2P80D 3QUYC 4FNLL 4TUJA 3TFKD 3GMPA 2APSA 5AKTA 4IGBB 4K15A 2A6DB 2DW5A 4YHNB 3L48A 1RJYA 2ZXBA 3LZPA 3SDXE 1YMMA 4AGLA 1Q1JH 4HMDA 3AT8A 1CB4A 1AZBA 3U2JA 1N10A 1F90H 3PU7A 2Z34A 4I13B 4ETQB 4TN9A 2CGRH 4KROD 3D9AL 3T77A 4JJ5B 2WVUA 5CN2A 5ESVA 1HQ4B 3X12A 1F2XK 3DX9B 1XBDA 5DHEA 4L3EA 4KVCL 3U4BH 1EO8L 1QEXA 3BVVA 5ES4B 3I85A 3ZX1A 5D93B 5DUPL 1J8SA 4PJCA 3INUH 4U6YB 5GGVL 1CGYA 3LNIA 4PJ5A 5C07A 2R29A 1OQXA 3N0AA 3SO3B 5FO7A 5FO2A 5DLMH 3LPFA 3VB9A 3EAKA 1AD9B 1EFXD 1P4IL 1OAUH 3O11B 5BZXA 1LVEA 1IFGA 2YAEA 1I7RA 5LAXA 4MDIB 5GISH 5D5ME 1J11A 3D9AH 4L8BB 2E47A 3I6KA 4A63A 4KO7A 2WNGA 1SHXA 2VRKA 4NO2B 4R97B 2VQUA 1T6BX 4XNYH 1W72B 4U1SB 5HI3C 1QR4A 3VTTA 1KFAL 1WFJA 1USQA 4HD5A 4ZMAT 1JZ3A 1XT5A 3T3PF 1B4LA 1G9HA 1KENH 5AB2A 3MLZH 5DHYB 2VLKE 2UVFA 4H1LH 4OW6A 4QLWA 4KY1H 4XXDA 4YVNA 5D7EA 1JNJA 1DJYA 5FKAB 2ENQA 3I75B 4ODSL 4XO4A 3TBWB 2FATH 2JJVA 4YXLH 1ZIAA 3WFHA 5HPMB 2WBKA 4GLRI 1V7NH 4GJTB 5AVXB 5T5NG 4N25A 3FUMA 4YPGA 1XEUA 5CHNB 6PAZA 4L0ZA 5JPNA 3QUMB 4OI8A 1Y6NR 3BUPA 4L3CA 1KYOJ 4PW4A 1TYRA 2NTSP 3OXRA 4CN1A