5DVNA

Fc k392d/k409d homodimer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvnA01
3MLUL 2DD8L 4OM0L 3RQ3A 1QSEB 5ETUB 3VWKB 3V5KB 3GMQA 2E7BA 2D3VA 5F6IB 2YZ8A 1WWCA 2X40A 5I66A 4F58L 1F4XL 3P9MB 4UUJB 2VL4A 1FYTE 5KG9A 4ODHH 5B39A 4NZJA 4U1NB 1RFDH 5FGSA 5GZOC 2FX9H 2ICES 1KB9K 2UWEB 3KPLB 4UINH 4YDKL 3L5WB 5F3HB 3LD8C 1SBSL 5BW7A 1NCBL 1WAAF 3MRPB 12E8L 5EBMB 3FFCB 1HILB 2ICWJ 2ZSWA 2NYYC 1PAMA 1A6ZB 5GGSY 3NVQA 1MNUH 4MQ7B 1BBJA 3X14B 1QA9B 1G7IA 3RWFA 4OZIB 4RFEB 5DJXA 2XRAL 4L4TB 4EDWH 3P4MA 1JPTL 2AJXH 2LABA 5EA0H 1PKQB 3HNSL 1AC6A 4LAQH 4QHMA 4S11A 1EX0A 2P24A 1WCBB 3O6FB 5FYJH 3EFFB 5I1HL 1VGKA 1WK0A 1EEYB 4DKFH 4WDIA 1ORQB 3BD5A 4L8DA 4LLMB 5EU4A 5LBSH 2VLJE 3NA9L 4HHAA 4M8VA 1A6UH 2PYEA 2FSEA 4XC1H 5J3HD 1JWMB 3IDXL 1MFBL 2Z91B 4YQXL 5SWSA 5GS1A 1INQB 4KV5E 3H42L 4G6JL 1KEMH 4FFVD 4IDLA 3ULUC 5C0CA 4CU8A 3ULUL 2XG4A 4UDTA 3TBYA 3QRGH 4H1LG 3ISWA 2ITCA 1T7WA 2NW3B 3VMOA 5I1AB 3QG7L 2E7LA 1KCRH 3BKJH 4YFLI 1ZA3B 2A74B 2AABH 5F71A 4DVBB 3O6KH 4HAGA 1X5KA 1IM9B 5DR5H 5IB5B 4D9RD 4N0UA 2ZCHH 2ZOKB 4M7LT 3GHBL 4Z7VE 4QGYA 2VXTH 4PJGB 5L2KD 5DQ9A 1I1RA 1WC7A 1DLFH 1E6JL 3I50H 4HV8B 1A3LL 3RDTB 3O81A 4D0CA 2FIKA 1KJ3H 1NGXB 1KIPB 1MWAL 3MTRA 2QSCH 3OZ9L 1FBIL 3W0WA 2W0FB 3UBXA 5I17B 1Z9SA 4UT7L 1RUPH 1P7HL 5DD3H 1QP1A 4NYLA 1RU9L 3VDBA 5KSVB 1V05A 3O8XB 1PSKL 3NZ8A 3P0YH 5EO9A 1G9ML 4L4VA 3LQAH 1RZKH 2Z35A 2JK5B 1CZ8H 3GKWL 4AK1A 1GOHA 4IOFC 3ARFC 3OXSB 4ZSOB 4YNYA 5HJ3A 4OLXL 4P3CL 3QUKB 4TTDD 4PJEB 2FECL 1CIUA 1WSST 4M9OA 3CFCL 2HMIC 2HRPL 1D5ZA 3CFEA 3BGAA 4AEIL 4EJ1C 3I6KA 1RIHH 1C5BH 4RGNC 4MNGA 2C1PA 3G5ZA 3RP1A 1INDH 3LKPB 4Z7NF 4F33B 3JV6B 4JFFB 3EO9H 4Q6IB 1TENA 1FZKB 4R9HA 3NGBB 5HD8D 2YD5A 5JW4M 1YPZA 1CG9B 2GK2A 5HDBE 4ZQKA 1NMAH 1U3HD 4O2EA 1ZT4A 3D48R 2JIXB 5EFIA 4YHLH 4C58B 3ARPA 3VFMA 4GRMB 3O3EA 1YQVL 5HBBA 3AMKA 3MJ8B 5CD5C 1IBGH 2XA8H 3TVMA 4F7PA 2OTWA 1VB9A 2PTUA 3NTCL 5T1LB 1GCFA 1IT9L 1L7TH 3EYSL 5DUBB 3HNVL 4LHUG 1FAIL 3K1KC 1EHXA 3MOAH 1NPUA 4NO3B 1LILA 3K81A 5TPWL 4G8IA 2CO6B 2IPTH 5DVMA 3QHZH 2O26U 3EZJB 1YEDA 1FGNL 4EUPH 2DQDH 1MFEH 3NFNA 4KHTL 1FIEA 1A4KA 5ADPL 1NCCL 3K8MA 1R3JA 4DGIH 4LMQI 4FG6D 4MA8H 4Y4HD 4EI6A 2NY3D 4JR9L 4OI7A 3KPRD 3RWEB 4D0DB 8FABB 2LE9A 4HUXB 3NAAL 1JN6A 3G5XB 2ZNXA 1UKSA 4CMMB 1TPXC 4URTB 2X05A 1QYGL 5GSVB 3HC0B 2RAMA 3MYZA 3HZMB 5C09A 1I8KA 1NGQL 3OKLA 4PJ5D 4HWUA 2JJUA 4I0PC 1MLBA 1YN7B 3ARGD 4HPYH 2ZPKL 2DLEA 2IH3B 3PL6B 1CD1A 3W11D 2VXVL 1A9BA 5HGAA 1JGUL 2F74B 4KC3B 2W9EH 4N9OB 4Y5XC 3T77B 3AY4C 3ROOB 4YUEL 5E9DE 4YH6A 5EUOA 2EDYA 2CRMA 2F15A 1S5IH 2GITA 4PLKC 2ICEA 3RAJL 1XGYH 2ZG3A 2C3XA 5I8CB 2OJZL 2Q76A 3X3GH 1ND0B 4Z0BH 3WO4C 3DV4A 3L3JB 3WFHB 5E8OA 3AB0C 4PJ9D 3VFNA 2JCCA 5D2NB 5TE7L 4NJAH 4LSQH 5FYJE 5L2JB 2JELL 2EYRB 3DVNA 3BP4B 4XTRC 3SGJC 1H3UA 4LNRA 3AM8C 3GSNH 3HHRB 1OPGL 5ITBL 5J6GB 4X99B 2Q1EA 3MREB 3RX7A 1ZE3C 1DUZB 5FA3B 1TZIB 3BESR 1MFNA 5DJ6A 1Y6MR 1MAMH 3SGEH 3MA9L 4G9DA 3QCUH 4XNZB 1S7QB 4JJHA 4PY7A 5CFHA 1A14H 1WBZB 4LGSB 2NX5A 1MCWM 2YEZA 1W0WA 4MCYA 2UYLB 1BFSA 5C2BL 4ZG1A 5IB2A 3V5HB 2DB8A 4FZ8H 2PF6A 3MRDB 3LKNB 5KTEL 4FFZL 4N0YL 4GRLA 1KN2L 1IQDA 3ARBB 3BQUC 1CLYH 3MRCA 3HKFA 1G6RB 5HYFA 5B38B 1HQRB 1YEKL 5KJRH 1N6UA 1EHNA 5FYKU 1FV1A 5HHXL 3MNWB 3H9ZA 2MHAA 2HT2C 3CX2A 1T21A 3NCJH 3AVEA 1SBBA 5HYIA 1MQKH 3FN0L 2QADB 3MJ6A 3OX8A 1Q0YL 1J8HD 1O5DT 4AIXA 1TNMA 3P11L 1BBDL 1VCAA 3QB7C 5JORA 4P5MA 4DKDC 3VXTA 3IS0X 4PBWD 5CCKL 2I26N 4LQ1A 4GG6E 4JKMA 3TBWA 4S10A 4ZS6D 4G8FA 4QRRB 4HK3N 1JPSL 3MRRA 3BP5A 1H8NA 3MJ9L 1MJ8H 4A6YL 4LEOA 4DCQB 4HIXH 3DI3B 3FOMA 4ODXA 2VL5A 2CLZA 4AQ1B 1J88A 2B2XH 4KRPB 2G2RB 3HN3A 5FUOH 1ZANH 5JW5A 4I0CC 3MMEA 3EFDL 4TRPH 5JW3H 1GC1H 2GFBA 3B6SA 5MP6L 2VLRA 1ACYH 1MJUH 5F8RC 2D7MA 5IVNA 5E5MA 4D0BB 3PP3K 2EIZA 1KYOK 2BNUB 3GBNL 1BPVA 4V1DA 1AHWA 2OM5A 4HH8A 1YZZA 1RK1A 3KYMA 6CGTA 5DQJA 4HCRA 4PV8B 3BN9C 4ZUVB 2FB4H 4FQ1H 3RWCA 1I1AA 2Q8BL 5FKAA 4MLIA 5FB8B 1EJOH 2DTMH 3PJSB 3KLSA 4XPFH 1VHPA 4QYOA 2P8PA 3W5MA 4OCWL 5FO9B 5T3ZL 5DRZA 3O9WD 4DZ8A 4EN3A 3FRPA 2VZ3A 5E4EC 1ZGLP 3VA2C 3KYNB 5F1KC 4NQXA 4NRXB 4QXWA 2F54A 3DYPA 3QUXC 4EBQL 4R90H 5F9JB 4JRYE 4WV1A 3PV6A 2DLTA 3FB8B 5TDNA 3WD5H 2Z8SA 2DQJH 1OOAA 1TJGH 3FB5B 5D7IA 3HMWL 1K2DB 2OSLB 1FPTL 3LN4B 4M43H 5HHOD 1RMFH 4OQTL 5C0AE 3SE4C 3VE0A 4GRWB 4WO4D 5K9OB 2VLKD 1ADQA 3UTZB 5D1ZC 5EU6A 3HLAB 2CMRH 2DWEB 3FHQA 4EI5B 1IGMH 1CDBA 3O3AB 3T2NL 1EMTH 2KPNA 3VXUE 1X5GA 1IL1A 4H20H 3CXHK 3ZMRA 4YDVB 3E3QE 5GSRA 2DM2A 1RUKL 5I8OH 4PREA 3G5YA 2ZUVA 3KPQA 1UM5H 4LARL 4F15B 1WZ1H 3FFCE 3AS2A 4P46D 1QFHA 3RVUD 3TJHD 4MA1C 1FVCB 4I4WA 4OZIE 1EFXB 1D9KC 4RAVB 1QRNB 4LSVH 2F58H 4KI5E 5E99H 3UZQA 4UDUA 5TF0A 5E6IB 5DS8B 2ESVE 1H3PL 5E8PA 5I74B 1FE8H 3UTOA 2APVA 3T3ME 1QFWM 2WLYA 3BJLA 4PGBA 5C1MB 5I9QC 2N56A 2BVPB 2VXUH 5CEXA 3FQTA 5D1QA 2F53E 3BEVB 1J1OL 2NY7H 3HAEA 2V6HA 1LDPH 4M7JH 2Y1VA 2CRYA 5SWQB 1KPVB 3VFPA 3PWVB 4GW1B 3PV7A 1KPRB 5ISZE 3P0GB 1ZK9A 2XWJA 3SDCB 2V5TA 1WISA 3HCVA 4G9FE 4ODUA 3UC0H 3MV7D 3L6FA 1AFVL 1XZ0B 4OFPA 1E0OB 1I1FA 1UWEL 2QQKH 3ARYA 5EZIL 1CGSH 1FG2A 4P3DA 5E7BA 4QY8A 1HIML 2GIYA 3H2WA 5HYEA 4PB9L 4PRIB 1S8DA 1P9MA 1XIWA 2IG2H 4HQQH 1ITBB 5L7XL 3MCKB 2XTJE 1KG0B 3NH7H 2AXJA 3ESUF 5ADOH 1Z9LA 4Y19B 1DQMH 2NY2C 1A9EB 3QUZC 1RURL 4P57A 3MXVL 3O3DB 3REWA 2XACC 4OSUH 3OGCA 2ADJA 1VFAB 3TN0C 4K3GA 1D3CA 1QBML 3FZUD 3OHXA 1A3QA 5LGHH 4MAUH 2J1KA 4NRYB 4OCRL 2BVOB 3LQZB 4KJWC 1LP9E 5D2LB 1M6OB 1DSFL 5J56B 3CH1A 3LPFA 2VO5A 4PJFB 2C7UA 5DEFB 4XP1H 1V3KA 3DVGA 5D7IF 3DBXA 5I19H 3VXOB 3JTSB 4NNPL 3OGOE 2Q8AH 4APQA 2EYSB 4L8SA 1CDIA 2EH7H 1NGWA 1G7JB 1XFPA 3U7WH 5HGDB 3V6ZB 1FGVL 1MCPH 1OGAD 1BREA 1JFQL 3DXAA 3D0VB 4LRIA 3A67H 1IARB 4XPGL 1A7NL 3TV3H 4HIIB 4OFDA 5E08H 5BO1L 3LOWA 3QEQE 1HDMA 2JE8A 1UM4L 5F44A 2HFGL 3CDGA 3ARUA 5IV2A 1W8OA 5L8JB 4AL8L 1BD2E 3MOBL 2I9LA 3F12A 4M6OL 1KJVA 3O4LD 3VDCA 1HHIB 3ZL4H 1BFTA 1J1XL 1CFQA 2BSED 4YHMH 5IR1A 4P5TB 4FTVE 3DX6B 4TQEL 2VDPH 5I30L 3DMMB 2N7BA 3TT3L 2MCPH 4F37F 3SKOB 1P7QB 2HJKB 3V6BR 3VFWB 1A4JB 2FZ3A 3BH8B 4J8RA 4NCDA 5TH2B 1DN2A 5EO1B 2R56L 1UB6A 5C2UB 5JIPA 4ZUUB 1B9ZA 1A2YA 3T2PA 3S3PA 3WHE1 1L7IH 3FQXA 2EO1A 4FQXA 3T1FB 3U4BL 3SY0A 1K3IA 2HJFA 2JLLA 4XTRD 1K4DA 1CGXA 3W2DH 3CLEH 5AD0B 1JZ7A 4HKBA 2W9DH 2NNAA 4O5LH 4JQIL 3CFKA 5AZ2L 1WICA 4JM4L 4NC1C 2AJYH 4NQDB 5E1AA 3S36H 5EOQL 4N8VG 3QPXH 2DIJA 4ODSL 2R0ZL 5GRZA 1ZT7A 3GMQB 4MXQD 4NHCL 4FQIH 3KLAA 5GS2D 3H3PH 2FX8L 4NBYB 1I8MA 1PQZA 1TETH 4FQJH 1S3KH 5I66B 3EUUA 2RCSH 3D5OF 3RWIA 3EJZC 2R69L 4OV5A 4H88L 4NQED 4PJ8C 3HS0A 5HDLA 5E2JA 2R2CA 5B39B 4KGJA 3U4AA 3UJIH 4XRCA 4EOWL 4Y1AA 1CXLA 4XCCH 5GS0C 4WUKL 3U1SH 3U46A 3WLWD 4IEFB 4U6HA 2ICWA 5FEBA 1KACB 1NH6A 5C8JA 3VA6A 5I1CL 4WENB 1HCVA 1KXVC 2VDKL 3FT4B 4ZS7L 2GJJA 5D7SH 3QBTB 3HNTL 3QDGE 4YXLL 3VD7A 2XN9E 1NCWL 1KJ2L 4KDTA 3VI4F 5IFJA 4O02L 5C07D 1RJLA 2ZSWB 2OL3L 5JIKA 5F3BA 1NAMA 3OG4B 1BBJB 1F5WA 3IT8D 1G7IB 3RWFB 5DJXB 5E4IA 2GCYA 2XI9A 3P4MB 1F4HA 1HQ4A 3LH2L 5HHNA 5EO0A 3LKRA 4QHMB 5GRJL 3ZKXB 2BXZA 2P24B 4ZFOA 2YKLH 2DKUA 1NCUA 5CEZH 4NZDA 4GMTL 4NZTH 3IXTA 1I4FA 1VGKB 3OR6A 4MCZA 3UTTD 3BPNB 1HEZA 1VADA 4I77H 4UV7H 4L8DB 3QIBA 1RI8A 4WDIB 3T3PE 2P5WD 5EU4B 4IOSD 3GI8H 4PJ7A 4HHAB 5DJ0A 2PYEB 2FSEB 3OJVC 5GGQL 2CIIA 2JTDA 3MV9D 1NEZG 2VB5A 3DIFA 2E8YA 4MJ2A 3E6FA 3MBEC 1NFDE 3L3DA 1KBGH 3WUZA 5SWSB 3U9PL 5GS1B 4X6EA 2F19L 1UCTA 2Y25A 2FATH 3G04A 1JNLL 1VACA 5C0CB 4YFEA 1T1WA 4UDTB 5I71B 3TBYB 2EC9T 3N85L 3SE8L 2ITCB 1KENL 2DJSA 3BKMH 3QXAA 4DKAA 5JR1L 5IFHH 1NL0L 2FD6L 2FH6A 4C56D 2F5BH 4LASH 2RGSA 1TQBB 3F58L 4N0UB 1DL7H 5DQ9B 1WC7B 4AH2A 4KZEH 4YE4L 4IJ3C 2PO6C 4G8GE 2GUOA 4D0CB 3UEZA 1FNGA 2FIKB 3M17A 3KS0H 5DVNA 4MNQD 3SE9H 2NY6D 1UWGL 1UZ8A 3UBXB 1UT9A 2XY2A 3OV6A 1T2QL 2BNQE 3ARED 3LEVL 2P4AB 5D1ZD 4DFIA 4NYLB 1O0VA 3EOBA 5IESH 5EO9B 2XOTA 3D0LA 4L4VB 5FKPA 2Z35B 1NUDA 4S1SH 5HJ3B 1JGVL 1Q1JH 5TQ2H 4M3KB 3SJVD 5E2WH 1Z6JT 2XXCB 4HFUH 5F7FA 1PGRB 5DK3A 3CFEB 3WNMA 2WBJD 1C1EL 1L0QA 3I6KB 4PFEA 4XVJH 3HPLA 2Y5TA 4JFDE 2DM3A 4U1GB 1XCQA 4MNGB 1CICD 2C1PB 1EPFA 3F5WA 5INDA 1XF1A 3ME0A 1D9KD 4IDJH 4KVCH 4LKCA 5T3XH 3D9AH 1YPZB 5H35A 3S36X 3QXWA 4ZQKB 4O2EB 1ZT4B 2YPLD 3HG1D 1HCFX 4WWID 1R5IA 5EFIB 3CPLB 1W72L 1QSFD 5LWYL 3MUZ1 2D7PA 4JFOA 1U3YA 2H1PH 4LVHC 4OGYH 3TVMB 4F7PB 3S8WA 2OTWB 1F4AA 5DMIL 4YBLB 3GMMA 2J2ZA 1TZHB 1LE9A 2VQ1A 1R3LA 5C0BB 3NBNA 5KSBA 3VCLA 4G8IB 4NSKA 3ULVC 3K0WA 5A3ID 3C60D 1DQDL 1CLOH 5LGJA 5L2KA 1YEDB 3INUH 3NFNB 1I3UA 4MYWB 1Y0LB 5H8DA 4ELMF 5I1EH 1A4KB 2G5BA 4G7YL 1VFUA 3VWKC 4QTHA 1J0JA 1R3JB 1MRCH 3MRMA 1I3RB 2ATKA 3TYFA 5F6IC 1DUYA 4R3SA 5F9OH 5D1XA 5E5RB 1LGVA 4J1UA 3IDNA 3MRHA 2BOBA 1JN6B 1NJ9A 1FVEB 4WTZG 5C7XL 5IOPB 1A1NA 4PJHE 2DWDB 2EDQA 4YR6A 1F6FB 4P4RA 4U0RB 3FTGA 5HHQA 1PEWA 1SJVA 4PYGA 4AMKH 2O5XH 4J4PD 2BHZA 5C09B 5D7LD 1I8KB 1CFTB 1TXKA 1JMXA 2OP4L 3OKLB 2DQGH 1MLBB 1F6LL 4PJXA 1CD1B 4QO1A 1A9BB 5HGAB 3DTXA 1X4XA 2Q20A 1ETZA 1A21A 4XPTL 1J1PL 4OZFA 5EZOL 1U3HA 5EUOB 1KPUA 2Y36H 3D2UD 4RMQA 1AR1C 4K23L 1W2KT 1A7RH 2GITB 1GGTA 2DQCL 5DJDA 5IQ9A 4KGLA 1OM3H 4XVTL 3OAZH 2ICEB 2FO1A 1EUTA 3Q6GH 4D9QD 2Q76B 1I7TA 3VFTA 3NPSB 3QIWD 3JWNC 3UJTL 1Q9WA 3DV4B 4GBXD 4UU9A 4WW2F 1V8HA 1PY9A 2MTPA 1T6VN 4AY0A 3VFNB 2P8MA 4ZO9A 2JCCB 1XF5A 4O9HH 3DSNA 3O6FC 5JHLL 1E4WL 4GAYA 5CEZE 1FLTX 3MV8D 1OTUC 4Z7UA 4LNRB 3O3BA 5BZWB 1KB5A 4S1QL 3SQOH 3PDDA 3SDXF 5E24E 4K94L 4KHXH 2KKQA 1EZVY 1ES0A 4G9DB 1AY1H 1QFWH 4PY7B 3MCG1 1B4JH 2NX5B 3GSVA 4E41B 2YEZB 4PJCF 4Y4HA 1K85A 1JWSA 5IB2B 4RISH 1FIGL 3KPRA 2AJUH 1NC4D 3V8OA 2NR6C 3BUYA 1JRHH 4Y19E 2YSSA 4N0CD 4GRLB 1IQDB 3FAXA 1WAAE 3MRCB 4YHKH 1AGFA 3JUZA 5C08D 2GW5A 5F89A 3IU3A 1M7XA 4K71B 2ZSVA 4G6FD 5IVXF 3F62A 4C4KT 5IJKC 4BH8A 1FV1B 4HEME 4OF6A 3L1OL 5C6TL 5D6DC 1G7MA 2MHAB 5DUPH 1TJHL 3CNKA 1T21B 2C9AA 3T09A 3ARGA 3HZVA 3OX8B 1HYSC 4OGAC 4WWKA 1B0GB 3O45A 3PGCA 1X6LA 2EE6A 1U3JA 3ZTJG 5JORB 3RDTC 3W9DA 5I1JL 1A6AA 1YMMD 3V79C 3VXTB 1FNSH 4AEHL 3TBWB 4G8FB 3WFDH 3SQBA 3MRRB 3BP5B 2GTWB 4LEXH 2E6PA 5AYUH 2IQ9H 4R26H 2A38A 4HXBH 4KMTL 4LEOB 4ZPTA 4RWYL 3O8XC 1KFAH 2XICA 4ODXB 5GS0D 1JK8A 2VL5B 2CLZB 1H3VA 4PJ9A 5CIPA 3T0XA 3P9LA 3V0WL 3P2TA 4IRZH 4Q7DA 5JW5B 3KJ6L 4FZEH 4JG1H 1R3KA 3MMEB 1RZFL 4UTBH 4N5UA 4ZDHA 2JKXA 2GFBB 3B6SB 3FHAA 3PHQA 2VLRB 3QZWG 5E5MB 4XPHL 1FCCA 2A1WH 1JPGB 2EIZB 1U92A 4Z76A 4HW6A 5IJVA 4V1DB 3F7VA 4HJJL 1AHWB 1W0VA 5T3XE 5TE4H 4Q6IC 1ZLWH 2DLHA 1HXYB 1RK1B 2E7MA 3V6OC 2GKIA 3KYMB 2P47B 3NGBC 3RNQA 3WIIL 3H9HA 3CAFA 3B4NA 3RWCB 1I1AB 4LSRH 4KVNL 5FKAB 2XZCL 3ZKMC 3O2DL 1E6OL 1YMHA 1RULL 4ALAH 2P8PB 3TBTA 3MLVL 1J11A 3RIAK 1OD9A 5DRZB 3MLYH 4DZ8B 4EN3B 2P42B 5I76A 2VQUA 5JUEL 1RIUH 1KIQA 3CSGA 4NM4L 2WUBH 4PBVC 5INCA 3ARRA 1YECH 5FYLE 5DVLA 4LVNB 3AFLA 4F7CB 1OT1A 1G0YR 5J1SC 4HEPG 5BV7H 4OZHF 4WV1B 3BISA 4Z7UF 1PX3A 3PV6B 1EGJA 1J8HA 4HUKB 5TDNB 3OJ2C 1CU4H 5CJQH 1XF2A 5J13B 4U1IA 1Q0XL 5HHMD 4NHUA 3CSYA 3MNZB 4Y7MA 3D87B 3VE0B 1JNJA 4JKWA 3HPJA 3VH8G 4L5FH 1YA5A 3CFDA 1NMCC 5EU6B 2EDWA 4WU5A 4JN1L 3V4VL 4FQQA 2PKDA 4QOKB 2YUZA 1V7NH 4XXCC 5D7JD 1IL1B 4GFTB 5GSRB 3QI9C 4Z7NE 3ILQD 4P9MH 4PREB 3G5YB 4MJ5A 4X7DC 5DZLA 3KPQB 5GIRA 3S88L 5FHBL 5FXCH 1U8QA 1G0XA 4YBHA 4K8RD 2PO6D 1DE4A 3QQ4A 3FONA 3I2CH 1NANI 4GW4A 2I60L 4HGKC 3Q5OA 4I4WB 2EC9U 3F6LA 1FZJA 4H1LH 3WO3B 2AI0L 1ZOXA 3IS1X 3BGFB 2NY4D 4UDUB 1F3DJ 4EXKA 1ZSDA 4GSDH 3OF6D 4ZTPH 3UTSD 5F7HA 2CRZA 2ADFL 5E8PB 3BZDA 1BM3L 1WBXA 2DQFA 5K59F 2R8SH 1F02I 1F2QA 3ZT7A 4LLWA 3VXRD 5BVPH 5CEXB 5D1QB 1YUHA 2IAMB 3TT1H 4PJAF 1HHKA 4FFYH 3H6JA 5D2NC 3VU2A 5JQ6L 1VFBA 3NABL 3VFPB 3OB0H 2HLAA 5JLZA 3F8UB 2ADGA 5F1SA 1U8NB 4JCLA 4LHQB 1TQCB 4AYFA 3HCVB 1NGZA 1K9TA 1NCNA 1TJIL 1KCUL 4ODUB 1OAXL 3L6FB 1I1FB 4Q9QL 4MJIE 4WFHE 5HHOA 3BDYL 4PG2C 4XNZC 2XYCA 4JVUA 4Z7WB 1FG2B 4WO4A 2VLKA 2FEDD 1HXMA 4QY8B 3QUMH 1S8DB 3O3UN 3PDGA 1XIWB 3ARQA 3TNMA 2O61A 1P4LB 1FCGA 4HWBA 5ECJE 3HE7D 1DCLA 2GJ6D 3ULVD 5FUZL 3L3OA 3U6RA 4P57B 1MCIA 1G6RL 4P46A 5B21A 3REWB 4MB5A 3OGCB 1X9QA 2ADJB 3C5JA 2DQEL 5HYJB 3OHXB 4NKMA 4JQXA 5FYKL 1IZJA 4XCFH 2JF1A 3W0WE 1UA6L 5J1AA 1WBYA 1JHTA 2QADC 5LCVH 2E7HA 2G9HA 3L5IA 2VABB 3CUPA 2FL5A 3CH1B 4OD3L 2C7UB 3HUJA 3DARA 3ZTNH 1ZKAA 2IAND 3DBXB 1LEIB 3QDJD 3SDDB 3MJGX 3BP7A 4APQB 4L8SB 1QKZL 1NGWB 1JL8A 4ONHA 3MFGB 5F7EL 3H9SD 1A8JH 1HI6A 2CR3A 3VW3H 4PJDA 5E2VH 4CN1A 1HDMB 4KRPC 1JYXA 3LZFH 3CDGB 4OB5L 4P9HH 1DBMH 4FNLH 4KDWA 1IM3A 3CZJA 1UKTA 2I9LB 3F12B 4CJ0A 5JOPE 1JHLL 3ZHKA 2XFXA 5B8CC 1KJVB 2KL6A 1CFQB 5F1NB 1WZLA 2YUVA 2X4RA 4YPGA 4NPYA 1AR1D 1CQKA 4XC3H 5T1MA 4R2GD 3U79A 3U0PA 2FZ3B 4HBCL 5KVFH 5C3LD 3QWQB 2M1KA 2A73A 3GJFH 4JY6A 2FHCA 1UB6B 2DLFL 1OTTD 1A2YB 2A9NH 4X5WB 5A2KH 1AQKH 5ALCH 3FQXB 4FQXB 1F58H 3CK0L 1LO3L 4NFDA 2GK0A 4JFHE 3SY0B 1N5YH 2HJFB 1K4DB 2OK0H 4HKBB 2NNAB 2J8UA 3CFKB 4KK6D 4J3VA 4LSTL 1A7OH 3O6ML 5E1AB 4ZTOH 1TMCB 4M5ZL 4RQQB 1ZT7B 4EDXA 4H25B 2VIRA 4I9WD 1SY6H 2ARJQ 3LS5L 3KLAB 3TO4D 5KVGL 4I3RH 4JO1H 1I8MB 1IZKA 4JY5L 1RHFA 3RWIB 3GSQA 4OV5B 3TESA 3S4SA 3ULUF 4HUNB 3HS0B 3LMJH 1OGAA 3EYQC 4PGJA 4XWGL 4EI5C 4N5EC 4Y1AB 2H6PA 1XT5A 2WWMD 3U46B 4I2XE 2J6EL 5DA4A 2QSTA 4U6HB 2ICWB 2RIKA 5C8JB 3GBLA 1P6AB 1HH6A 2E6JA 3B8SA 4W81A 1MFCL 5HHPA 5DJ2A 4F15C 2EDDA 3T4YA 4EKXA 1YYML 3VWJD 4TNVK 5F9WB 2EICA 1J12A 5IFJB 3O4LA 3MRKB 4JFZH 1JZ8A 1MPAL 4Q0XL 5F3BB 1NAMB 2ILLA 3VGGA 1AGDA 5DWUH 4YXHH 1OP3H 2Z93A 4WHTA 2DQTL 3CVIL 1TNNA 4LU5H 2GCYB 5E6IC 4OLYL 1HQ4B 3MGOA 5HHNB 3OSKA 5EO0B 5I74C 3LKRB 5F7MC 2FJGA 1N59A 4M7LL 3JWOC 1DQQA 1DTUA 5IBUG 1BX2A 3JWOL 3PWUA 1UM6L 3IXTB 4PRHD 1I4FB 4N8CH 1BAFH 1CWVA 3OR6B 4QRPE 4MCZB 2NXZB 3QUYB 4O4YH 1HEZB 1VADB 2VWEE 3QIBB 3NACL 1J7VR 4L3EB 4PJ7B 5D5MF 2CIIB 4YWGL 1UVQA 4HX1A 3EJJX 4NKOB 2VDQL 5ALBH 3STBA 3DIFB 1BLNA 4KZDH 3E6FB 1MJJA 3SDCC 3L3DB 1FORH 3BXNA 2CJUH 3GMRA 4I13B 4I3SL 4X6EB 2HJLA 4JZOA 3G04B 4IS6A 1QPPA 4HLJA 2NY1D 1VACB 4GW5A 5E1HB 1T1WB 4WI6A 1BWWA 4RAUA 1QVOA 2R4RL 3QXAB 5I1LA 2YN3A 3UDWC 5D8JL 3BYTA 3GDBA 4TPRL 4OCXH 2MFNA 3QT2A 2IGFL 1MEXL 1FNHA 2JJSA 4GKSA 2DF3A 4OIIL 5C07A 5T1KD 2H32H 1FLRH 3H7BB 4AH2B 4LGRB 5JIIA 1E4KC 1CIDA 2GUOB 5IW3A 1KCSH 3H3KA 1EHLH 1HZHL 3EOTL 1MCLA 4OZGF 1UZ8B 4DTGL 3ZYJA 2GTZA 4ORGA 1ZEAH 2F5AL 3GRWH 2VH5L 3B5GA 3BKCL 4JPVL 3L5JA 4MJ6A 1UQSA 4WVRA 3EOBB 3W5NA 3MUGA 5FKPB 4K7PL 3QI9D 5ELIA 3L3KA 2ORBL 1B3JA 1A7PL 4M61B 5BOZG 1AI1L 3HI5L 3HPLB 3TJEH 3L9RB 3RGHA 1XCQB 3I6LE 3F5WB 5INDB 4KTEH 4RNRA 4KY1H 3MV9A 5IGXL 3P4OA 4LKCB 2DIAA 4RDQF 3OBAA 1N4XL 4S1RL 2PCPA 5TF1H 5H35B 4P5TC 4HS8H 3RVVD 2FDBP 1GSMA 1R5IB 3WSQH 4LRNH 3K8LA 3FQNA 4JFOB 3MR9A 4KK9D 3MA7A 1J10A 5IMKA 1DBAL 3D25A 3GSRA 1MVFA 1LO0H 1ZLUH 3GMMB 3I9GH 5MENE 2VQ1B 3FO0H 1R3LB 2HTLC 3WXWH 4CU6A 5T33H 2F54E 1OSPH 5KSBB 3I84A 4L29A 3UAJD 43CAA 4C56A 3VCLB 4NSKB 2DQHL 1IC4H 1VPOL 3VGDA 3M8OH 5L2KB 2R0WL 4QNPF 5FCSH 5D7IE 3O41A 1K4CA 5F96L 4MNQA 2G5BB 4OQTA 5FYLL 3D39D 3GBMH 2DBLH 4QTHB 4X6CA 3AREA 3MRMB 5D1ZA 5IF0B 2DS4A 2ATKB 3TYFB 5D70L 1DUYB 3ELAT 1UYWL 4R3SB 7FABL 5ESAA 4FQ2H 1CL7I 4LGPB 4U49A 5LGKA 3IDNB 3MRHB 3BWUC 1BIIA 2BOBB 1FC2D 2ZJSL 1J18A 4B53A 1F8TL 1WFTA 1T80A 5FFLA 4R4FL 2GJZB 4YR6B 2EEAA 4P4RB 4MD5A 3DSFH 2O93L 2WBJA 1JF1B 5IMOA 3SPVA 1EVTC 5JZ7C 4QHKI 5BW7C 4U1KA 2J5LB 1QG3A 2QHRL 2YPVH 4PJXB 1D9KA 1A6WH 4QTIL 2YXFA 1C08A 3DTXB 2WLZA 4PRPE 3DETD 2VSCA 1ETZB 4JZNA 4OZFB 2FGWL 1U3HB 2YPLA 3HG1A 5DJCA 1QSFA 1T04A 2WV3A 2IMNA 4JFPA 3ALWA 5IQ9B 2NY0D 1GGIL 3IDJA 3KNBB 5LJYH 1I7TB 1HOCA 4LPVA 3U4EA 3VFTB 1Q9WB 4UU9B 4XI5D 3JTTB 4U0QB 3ZKXC 3WXVL 2LVCA 2P8MB 5DK2B 5SX5H 3VXMD 1KYOJ 2AEQL 1XF5B 3RHWK 5DYOA 4EIGB 1FFQA 3CVHA 4WEBH 2RJMA 3C60A 5FV1L 3OKMA 4KAQH 5DMGD 1WUNT 2Y06L 3DURA 4LSPH 3N9GL 3O3BB 4U6XA 3MZGB 1S78C 1KB5B 2B5IB 3QDME 1D6EA 3FL7A 4IMKC 2R4SH 3IXAA 4OLUL 3GKZA 4PJBF 3BMWA 3LB6C 3RBGA 5EC2A 1MIML 3GSVB 4NCC2 4Y4HB 5HTSA 1JWSB 4GAJL 1UJ3A 2NY3B 5GS1C 1DBKH 3MJ7A 3KPRB 4MHHG 1UCBH 4YHOH 3BUYB 1N64H 4FXGB 4P59H 2YSSB 3WFBH 1EXUA 3NIDF 5I71C 1BOGA 5F89B 3B3IA 3VI4E 3IU3B 4JG0L 1VEPA 1P4IH 1Q8MA 2ZSVB 3DUSA 3WDIA 4J4PA 3K1DA 5D7LA 3RUGA 4NP4L 3T0AA 1G7MB 2WUCL 4PJ5B 2DM4A 1JBJA 1KTDA 1O7VA 3RVXD 4QWWC 1FFRA 1TQBC 3WFCL 3ARGB 1K8IA 1EFQA 3O45B 1NAKL 4L9LA 3W9DB 1A6AB 5IHLB 2PW1A 4ZOBA 3D2UA 2BNRD 3CXHJ 4Z95H 3VXNA 2FJFA 4TUKH 4G5ZL 1AKJD 4OCLC 4LCIL 5ITFA 3DXAE 1ZHLB 1MCWW 2W92A 3VG0H 3QIWA 4NN5B 3U7YL 1B4RA 4GBXA 5B3JF 1NLBH 1F4YH 4TSCL 1JK8B 4ZO6A 4PJ9B 5CIPB 3IFNL 3UXFA 3UZVB 2W65B 2J4WL 2BVQA 4M1GH 1YEFH 4ENEC 1R3KB 3LKOA 2VZ1A 1DP0A 1A1OA 4Q97A 4ZDHB 1B2WL 1IEAA 1Q9LB 2I5YL 4GLRI 2AS5M 5IM7A 4U1GC 4Z76B 1U92B 1UG9A 2YUXA 5IJVB 3F7VB 3CXDL 4Q6YA 4UIMB 2WBWB 3QYCA 1CDGA 3HC3H 3RNQB 5TDPA 3H9HB 3GIVA 3FQUA 1MCOH 3C2AH 3SO3B 4R97B 1NC4A 1SYSA 4LDOB 4A2LA 1YMHB 5A2LH 1OARH 3TBTB 5KW9L 1PZ5B 5C08A 4YBLC 4I5BA 4CVUA 1A6TA 4KXZI 5I76B 2EXWD 1UEYA 4XWOC 1CK0H 1KIQB 3X11A 5INCB 4ZODA 3S37H 2DOCA 5HVFB 1YNLH 1J8HB 1A3RL 5I18L 5HXMA 1YNKH 4X4ZA 5JMRA 3HRZB 5EU7E 2VYRE 4TVPD 4XMKH 1XF2B 5BS0D 1YMMA 4U1IB 4DN3L 5CUSH 4NHUB 2D7OA 1FDLH 5KSAD 3CSYB 3VGFA 2WQ8A 1MCHA 3HPJB 1E4XL 1X5XA 2XV6B 4JO3H 5ICXA 1Z3GH 4HMCA 3LKSA 4WU5B 2HWZL 2OMBA 4PLJC 4FQQB 5TQ0L 4KV5F 4ZO8A 1RUML 4HLZH 1SMAA 1BQLL 1EAPA 3ESVF 4XXDA 1OAYL 4MJ5B 2VUOA 4YAQA 1CXHA 1NFKA 5KS9A 3V2AR 5GIRB 4U0RC 4MQXD 3DV6A 1QLEH 1U8QB 2VDLH 5BRZE 1KGCD 1AGCA 3G6DL 1DE4B 3QQ4B 3FONB 4GW4B 1DFBL 5E8NA 1FZJB 1EO8L 4NFBA 2ZUTA 2VLMD 4G6AC 3RU8L 4CN4A 1ZSDB 2CGRL 4MHHI 2NTFA 4OI8A 1IAKB 4LNVA 3ZSSA 1WBXB 2DQFB 3QJFB 1OAUL 1VKXB 4BK4A 2QQNL 1UWXH 1I9RH 4U31A 4X9BA 2OZ4A 4LLWB 1YY8A 4JPKL 4JRXD 3NPSC 3FT3A 3O9WB 1ZGLA 1YUHB 3EYUL 2AJVL 3TCLB 1LO4L 1HHKB 2QQLL 4H0GA 3QWRD 3ZKQD 4ELME 3IDUA 3TYGH 1VFBB 4UT9H 5CP7A 3UTPE 1M7DA 2HLAB 5JLZB 1KXTB 4NWTL 4PJIA 2ADGB 1JGDA 1S9VA 5SWZB 3OKNA 4NO5A 2EIDA 1NGZB 3QQ3A 1IQWH 1PLGH 4JM2C 5DMYA 5FECA 5DQDL 5HHOB 3G6JA 5ACZA 5D93B 3VG9B 1FYTD 4WO4B 3GM0A 3AUVA 2VLKB 1U8JA 1HXMB 5CILH 5KSUA 3VMNA 1P5UA 1X5LA 4G6KL 3PWPE 3LSOA 5GGRB 5HDBF 1CZ8L 3AROA 3TNMB 2O61B 4OM1L 5D7JA 5EOCJ 4GRLC 4PR5A 1FO0A 3EYVA 2AEPL 4NUJB 3L3OB 1DVFB 2CUIA 3U6RB 4OFKA 4P46B 4KUZL 4K71C 3C5JB 3OAZK 1IGYB 1JTOA 2BSSA 1LK3L 1DBJH 4NKMB 5GRVL 3S96A 5GGRY 1YEGH 2PO6A 2VXQH 3GSXA 4M6AA 1WEJH 5FF6A 5J1AB 1JHTB 1SJHA 1OCWH 1S7UA 2G9HB 3CUPB 5GHWH 2FL5B 5HGHA 4GAGH 4P2QE 4DAGH 3HUJB 3OF6A 3WKMH 3UTSA 3LKQA 4K3EL 1UACH 1PDKA 3CLFL 3Q5YA 2FH8A 1F4WL 4WI5A 1MRDL 2NXYD 2VKXA 2EDHA 4F9PA 1X5AA 5MERA 2EDKA 4ONHB 4P2OD 5F97E 5HI3C 4P4KD 4JKPL 4ODBD 3VFUA 1HI6B 2X1XR 1B6DA 3X13B 1X4ZA 1FRGH 4X80H 4LLQA 3RPIA 3SDXE 4YHZH 2VLJD 3KR3L 5BV7B 1GIGH 2IPTL 4LSSL 1IM3B 4N1EA 2X4PA 4E0RA 1VGEH 1T22A 4PJCE 4R8WH 3H0TA 2XFXB 1MF2L 2MKWA 4BK5A 2BJMH 1RQ5A 2XQBH 3S37X 1IGFL 5ID1A 3MV7B 3KLHC 1PZUB 1L4IA 1W72A 1AHWC 3R0NA 2JB5H 4YPGB 4NPYB 2IBZX 5T1MB 1NDMA 3TLRA 3U0PB 4DK6A 4MA8L 2BDNL 3B2VL 2R39A 3KDMA 3V4UL 2OJEA 1RZ8A 4NZRL 4BFEA 2A73B 4JY6B 1IC7L 2EDEA 4HCRL 5IVXE 2ZUXA 3D3VE 3S3SA 1I1AC 1W8NA 1YDPA 4ZFFA 5KSBE 2YR3A 4RFOH 4JJ5B 4NKDA 3MLUH 4JRWA 5HHVL 2DD8H 3U0WL 2GJ6A 3HB3C 4OM0H 4QHKJ 4YX2L 2ZNWA 2ATPA 5A2IH 4EN3C 4OV6F 2J8UB 3EOYG 4LVNC 4F58H 1F4XH 4WV1C 5DHVH 1MQ8A 2HTKD 4AEFA 1GRWA 3LB6D 2W9EL 1IAOA 2VIRB 1Z2KA 1A6VL 2IANA 1N0XL 4ONFL 1HH9A 3QDJA 5J13C 1DLHA 4YDKH 1NSNL 4X6DF 3GSQB 4FXKA 1SBSH 2V7NA 3S4SB 4OCMC 2YWZA 2BRRL 1ADQL 1NCBH 4NQCE 12E8H 1OGAB 2ZCKL 3H9SA 5GGSA 2M2DA 1CCZA 2H6PB 1ZLWK 5C0GA 3KPLA 3FO2A 3MLWL 3L5WA 5C0FA 5HGGS 3BEWB 2XXMB 2HT4C 1HH6B 3R0MA 4LLYB 2MQ3A 1UENA 5DJ2B 4HG4K 3T4YB 4DJMA 5EZLA 2XRAH 5DFVC 2CIKA 2WAHA 1MCEA 3O4LB 1JPTH 2AK4B 3AMLA 1GVIA 2R0LL 1AGDB 1A14L 1F13A 1X3DA 3X14A 4Z6AT 5KANI 4WHTB 1XGRB 3T0EE 3A6BL 3BGFC 3EJYC 5HSFA 4X8JA 1H8SA 1NEUA 2XKUA 4F57L 2APXA 4PP1C 5I1HH 5HPOA 3MGOB 3G9AB 4JGJA 3B5TA 1N59B 4DQOL 3NA9H 3EGSA 1DQQB 3VXQA 4N90D 5KVDL 4Z7UE 1BX2B 3IDXH 3ZTJH 1MFBH 3PWUB 2VDOL 2HH0L 3MRBA 1MI5B 5D1QC 2IAMC 4YQXH 3VI3F 5HI4C 4JFEE 5JXAL 4LLMA 4XBPA 1QTYT 3H42H 3RI5K 2FIRT 3CFIC 4G6JH 5GGTA 5LXGL 4YZFF 1UVQB 4HX1B 2Z91A 4C54A 2MJWA 3ULUH 1BLNB 1MJJB 1TQCC 3TO4A 1G9NC 4DN4L 3BXNB 1G9NL 1INQA 3GMRB 5JW4N 4YFDB 2HJLB 1HNFA 4JZOB 4MZ3A 5I6XB 1HE7A 4IS6B 4NQEB 3SGEI 4WI4A 2VR4A 3GHBH 5B22A 4RAUB 1P9MC 2NW3A 1QVOB 5DO2D 1XIWC 4OF3A 5I1AA 5I1LB 1E6JH 1RZIA 5D6CA 1A3LH 3DRTB 4TTGA 5CHNA 4G7VL 1EBAA 5J9PA 2COQA 3BZ4A 3OZ9H 1MWAH 1FBIH 5AWNL 3Q5TA 4GKSB 4X83A 4UT7H 5F7NC 3RNKA 3TBSA 1ACYL 3VWJA 3TZVD 5C07B 5E9DD 4HV8A 5A40E 1WFUA 1PSKH 1G9MH 1T83A 5FGCB 3GKWH 3UROR 4J7RA 2GTZB 4OLXH 4ORGB 4P3CH 3GJFB 4MJ6B 1UQSB 3O2VL 3WFEL 4LK4A 3CFCH 3OB0K 2HRPH 3VFRA 4M48L 3MLXL 5GJTL 2K1MA 4PJAE 2QEJA 3SDDC 4AEIH 4R4ND 3MUGB 3VFVA 4APQC 5FUCC 4L8SC 3G5VA 5FYJD 3L3KB 4UILL 4F9LA 4PRHA 1LO5A 4LRIC 3L7EA 4H8WL 3UTTB 2UWEF 1T7ZA 4NUGL 1IKFL 2P5WB 5C3TA 3I3BA 5HYSG 2AERT 4CN6A 2G60L 3HI1A 1YQVH 5FGRA 4RNRB 5CJXA 3MV9B 4Q6IA 5MEOA 3P4OB 3V6OA 2O5YL 1FHGA 3NTCH 4JANB 2PCPB 1IT9H 3EYSH 1Y6KR 4OLWL 3V4PL 3HNVH 1FAIH 3BVNB 1MOEA 2WP3T 5CSBA 3QO0A 2CPCA 1FZMA 4YDLC 4OZIF 5TPWH 3FQNB 4HH9A 3MR9B 3MA7B 3D25B 3GSRB 1GGCL 1NGPL 1X44A 4S0SD 5F7LB 3FCTA 4LCCA 1FGNH 4TYUA 2Y7QA 3HTLX 4KHTH 1OSZB 3AS0A 43CAB 4C56B 4FQXC 3CX5K 1NBYA 2I9TB 5CP3H 1I9IL 5T1KA 3BIKA 4Z5RA 4JDZA 4JR9H 4L3AA 4JM2D 1RV6X 3LRGA 3NAAH 3WN5B 2W0LA 4MNQB 1IAIL 4MLSA 2NY6B 1J05B 4MD0A 5I8KL 1KNOA 2DJ4A 4X6CB 5HVHB 4N1CA 1R3IL 4E5XA 3AREB 5TFSH 2AXGA 5GRUL 5IW1A 2CLVB 1QYGH 5ESAB 2X89D 3RWEA 5JMOC 1BIIB 1MHHA 1WV7T 1MJ7H 1NGQH 2A77L 3G5XA 5I1GL 3QI9A 3SJVB 2G5RA 2ZPKH 3VMPA 2R1YB 2VXVH 5GSVA 1JGUH 5LQBL 4MD5B 2GT9A 3ZYIA 2WBJB 4YUEH 5IMOB 3DO3A 3SPVB 4YDJA 1FC1A 4GKOA 5I16A 5FDWA 1CICB 1CYGA 4EQ3A 4U1KB 1YN7A 3KYOA 3RAJH 1D9KB 3LQMA 4PJGF 5F9WC 4KDTC 2OJZH 1C08B 3F7QA 4NN7B 3ROOA 2ZKHH 4JZNB 4JFQA 5CLTA 4FMFA 3BYYA 2YPLB 3STZA 4WU7A 2QQKL 1NAML 3LEYL 1J0KA 5DJCB 1QSFB 1CGUA 1T04B 4JFPB 2WNGA 4WIQA 5TE7H 3TP4A 5E2TH 2R1WA 3IDJB 2JELH 2C4FU 3C8KA 1HOCB 2IG2L 3U4EB 1OPGH 2HKHL 2B7DT 5GPRA 4HBQA 3MLZL 1ERNA 5IB1A 5ADOL 5D72L 3SDYL 2FJHA 4ZFOL 3CVHB 3MA9H 2EC8A 4D9LL 1VESA 4JRYD 5JDJA 4PJEF 4FXLA 3C60B 3BP4A 3OKMB 3DURB 4U6XB 4KKLC 3RVTD 5C2BH 2NXZC 3QUYC 3KJ4B 1RJZA 3QIBC 2ID5A 2HT3D 1XH3A 1DUZA 3OKEA 1FL6A 5FA3A 5HHOE 2P49B 5KTEH 2DI7A 5C0AD 4FFZH 4N0YH 4PG2A 3IXAB 3D39A 2W1NA 3ULUE 5EC2B 4O00A 4NKIL 3C09C 4UIKL 4V2CB 3V5HA 1UJ3B 4F37K 1YEKH 1LD9B 1KTRL 3MJ7B 3VXUD 3ARSA 4XNYL 4OGXL 5HHXH 1IVLA 3WIHA 1BFVL 4ZNEE 3C6LD 4FQPA 1KIRA 1EXUB 3TC9A 3S34L 2F8OA 3IFOA 4OJFL 3FN0H 1Q0YH 2R2BA 4TSBL 1BOGB 3TV3L 2OS7A 3HE6D 5B38A 2DIBA 3VRIA 1FNAA 1BBDH 3P11H 4RSVA 3DUSB 4OZ4A 4XHQA 3WFZA 3RIFF 5D7LB 3RUGB 1T20A 3CJJA 2P8LA 5CCKH 1CXFA 2P5EE 3FB7A 3SKUD 5F7KC 1KTDB 4AG4L 2HA1A 1JPSH 4TNWF 3EIFA 4KI5D 1K8IB 3MJ9H 2P7TA 4QHUA 1DN0A 3O2WL 3P4LA 4LQFL 4A6YH 4L9LB 2ESVD 1TDQA 1H3XA 4Y5YA 5DD0L 4WGWB 2PW1B 5DVOA 3D2UB 4H5SA 3VXNB 2FJFB 5K9JL 4L1HA 3P3YA 1AH1A 1WJ3A 5ITFB 1JUFA 3C6SA 2YXMA 4PJDE 2F53D 5MP6H 3QIWB 3R1GL 4GBXB 4QOKD 3BT2L 4RGNE 3PUCA 2G2RA 3VXMA 4WUUE 4DUVA 3GBNH 5CGYD 5D5ME 2BVQB 2HT4D 4K3DH 5ISZD 1QNZL 3MV8B 4Z8FL 5DD1L 2V5YA 3LKOB 5TE6L 2X1OA 4XZUA 4G9FD 5B8CA 1IEAB 5FOJA 3A6CL 4PYHA 4D0BA 4H26A 1QQDA 2Q8BH 1R0AL 3EAKA 2BNUA 3QPXL 4PD4K 3MBXL 4QXUL 1MVUA 1FL5A 4X8XA 2YD7A 3GFUA 2W07A 4OCWH 2IMMA 5E95B 4OD2A 4PS4L 5T3ZH 4ZD3L 5TDPB 4GJTB 3I3EA 3FQUB 1T3FA 2DYPB 2XTJD 3ARZA 4XNUL 1Z9MA 1NC4B 1SYSB 3WHXA 3PJSA 3QO1B 4FFVC 4EBQH 3BSZL 4LPTA 5C08B 1S7TA 4I5BB 3GI9L 1A6TB 4WFGE 4G6FB 4RIRA 3KYNA 3MV01 4LPWA 3HMWH 3X11B 4ZO7A 1FPTH 1WCQA 4OZGE 1OP9A 2XWTA 4OQTH 4BKLA 4OIAA 1Q9KA 3MODL 5F93C 2V17L 1OWRM 3BPLC 3QEGL 3I75A 2Z92A 4ONOA 4BSWA 4HKJA 3FB5A 3T2NH 1L9NA 2UVFA 1YMMB 4UNUA 4ZUWA 4RRPG 2D0HA 2BNRA 2PTTA 3F6IA 1RUKH 1ZTXL 4MAYD 1AKJA 4HMDA 4LARH 2FO4A 1M71B 3BI9X 5E00A 4HD9A 5ICXB 4EQ2A 3LKSB 1E27A 1F11A 3QEQD 3BZEB 3BN3B 3MO1A 4ERSL 1EAPB 3SCMD 4XXDB 4TULL 1BD2D 4LCWE 4TTDC 4YAQB 5FHAH 5J89A 5KS9B 1CFVL 5M94B 1A02N 1CN4A 5GS3A 3RZWA 4FTVD 1AGCB 1ZLUK 2HRLA 5CBAB 3LHPL 5ANME 1FVCA 5E8NB 3BWAA 4XNMA 2C3VA 2J5LC 4DKEL 4M5YL 3WJJA 1X5IA 5CLWA 4U2ZA 2VR9A 1FYHB 4HKZA 5HD8C 3T0DA 1JHKL 2NTFB 5IHZA 1J1OH 4WTWA 4Y4KD 3TGXA 2ED9A 2R0KL 2H26A 4RGOL 1T0MB 5A2FA 2BVPA 3FT3B 4CVWA 4QNPE 1ZGLB 1KTLA 3MLRL 4ONGL 2KUTA 5B39G 1AFVH 2F5BL 1UWEH 3JV4B 1QO3A 2LAAA 5CP7B 5EZIH 3IAGC 1M7DB 3KPSE 4U3CA 1KC5L 1HIMH 2YRLA 4PJIB 2Z31C 4PB9H 1JGDB 1S9VB 2B5IC 2GHWB 1KB5L 4NO5B 4X7EC 3VD9A 4N0RA 3I02A 4QRSA 1QBLL 3QQ3B 5EIQA 5L7XH 1N7ML 5BS0A 1XZ0A 5FECB 1G7PB 5HHMB 5KSAA 3G6JB 5ACZB 1XEDA 4UAOB 3UCRA 1U8JB 1G7HA 4FG6C 2LU7A 3GNML 1RURH 3CDYA 5KSUB 4Y4HC 3MXVH 2QTEA 4C57C 2NY3C 1QBMH 2QKIA 4AENA 4Z7OF 1OL0A 3MACL 3UDWA 4M7ZC 2CK0L 5D7JB 1KG0A 1MCDA 4OCRH 3KXFE 4PR5B 1FO0B 4QRQB 1A9EA 3GO1L 2ITDB 1DSFH 3EYVB 3QDGD 5JW4R 1MRFL 4JFYA 3BKYL 1VFAA 3MRQA 2BSSB 4HSQA 1INEL 1WIOA 4NNPH 3GSXB 5FF6B 2BSRB 1BJ1H 1M6OA 1SJHB 3ARGC 1S7UB 2EYTA 5SX5K 5T5FL 1KUMA 1MCCA 4PJFA 3KGRA 4O2FB 3W11C 5HGHB 1FGVH 1NC2D 2NY4B 1JFQH 3UTSB 4XPGH 1A7NH 4MDJA 3LKQB 5BO1H 3VXOA 1UM4H 3W39B 2HFGH 2H1PL 4O51A 1NCDL 4GRWF 2Y07L 5IT2L 5DFTA 5GGVL 1NFIB 4HGMA 4XNXH 4AL8H 1YYLL 2ADIA 5AZEL 4HJ0D 4JVPA 3VXRB 1U8HA 4M6OH 1OP5H 3VFUB 4BZ2L 1X5ZA 4NN5C 5CKGA 2IBGA 2OR9L 2P43B 2NMSA 1J1XH 2E9WA 1S9WA 4LLQB 3RPIB 4PJ9C 1X4YA 3Q48A 3PGDA 4TQEH 3QWRA 5I30H 4MB3A 3TT3H 4PJBE 3IJSB 5CGTA 3MV9E 4E0RB 3MUHL 1T22B 5GISL 4XP6L 4BELD 3H0TB 4JDTL 3J7HA 1F2XK 2VXSL 1CF8L 2NCMA 5ID1B 4POUB 3HR5A 4JHBA 1P7QA 1NDMB 3VFWA 1FYTA 2C3HA 1BF2A 2OXGA 1IGIL 3NIDE 3KDMB 1YY9D 3EDJA 3U4BH 2IBZY 4JAMA 5T3ZE 2OJEB 4L1DA 4NN6B 4TOYL 4HC1A 5DF0A 4Z9KB 4AEEA 3UBXG 5TGBA 1U8KA 2IADA 5HI5D 3SO3C 4R97C 4JQIH 5AZ2H 1YDPB 4JM4H 4ZFFB 1UZ6F 4NKDB 4WCYL 3ARDD 4XNQA 1KV3A 4P2RE 3HE7B 2GJ6B 1VA9A 4ODSH 5J12B 2YBRB 3BIAX 2R0ZH 4NJ9L 4NHCH 3HMXA 2H45A 5AD0A 4AMKL 3MPCA 2PYFA 2FX8H 1FH5L 4GOSA 3C8DA 4L3ED 5EB9A 2R69H 4X6CE 4H88H 3DVFA 4X9FA 2BNQD 1IAOB 2IALA 1EGJL 4RGMB 4HUVA 1IC5L 3OL2A 4EOWH 2IANB 5B3JE 2Y36L 4WUKH 3BZFA 1HH9B 3QDJB 4UTAL 5HY9A 1DLHB 3TBVB 1RZ7L 4ZS6C 5I1CH 1F00I 4FXKB 2V7NB 4OZHB 3TFKC 2VDKH 4ZS7H 1N2RA 4P2OA 3HNTH 1VSCA 4P4KA 4YXLH 1QSVA 5CAYB 3H9SB 1NCWH 5GGSB 1KJ2H 1AJ7L 4O02H 1A0QL 2OL3H 3DECA 4JFDD 5C0GB 3EBAA 2DJUA 3B5HA 1JZ4A 3FO2B 2VLJA 5C0FB 1G9EA 4UBDD 4OCYL 3KG5A 4RX4A 3B2UD 3ZZ1A 4KKAD 3ZE2E 5M7QA 3FT4A 4M1DL 4HDIA 4X7CC 4DVRL 5EZLB 2XZAL 1GHFH 1S7SB 2K9UA 4M6ML 2CIKB 3DUHA 4QHNA 5FDYA 2X1WL 1DQLL 3LH2H 3HG1E 4YHNA 5GRJH 5D2LF 3RVWD 3NIGF 3NA4A 1I85C 4R2GB 4PJFF 1R24A 2X41A 3OQ3B 4KJQD 4X8JB 4GMTH 1CFNB 1J0IA 2XKNA 2AJUL 4J23A 4U2YA 3MUY1 5I8EB 5DMKB 3VJ6A 3AS1A 1M7IA 2OX5A 5F7DA 4RA0C 3EGSB 3ZT6A 3PIQA 3VXQB 1MCRA 3U48A 1RPQA 5GGQH 3G08A 4Z7VA 3MRBB 2KZ1B 3O9WC 3OKDA 4WW1A 1SVZA 3U9PH 4O2CB 4YGVA 4XBPB 2OMNA 2F19H 3I85A 1QBBA 4IMKA 1JNLH 5LAXA 4MDIA 3B83A 5J0BA 3TNNA 3TO4B 3SE8H 1KENH 3GMPB 1NL0H 2FD6H 5D93C 1T7XA 2EE9A 3NCFB 3VG9C 4WO4C 5JXED 3OR7A 4R26L 4NZUL 2ENYA 1QFWI 3BE1L 3F58H 3CC5A 3GMOA 4ZAKD 2X9YA 4JVWA 3SKJL 4YE4H 1RZIB 1ZHKA 3NFSL 5D6CB 4D3CL 1T2XA 4KJPD 1MCNA 5CHNB 5J9PB 4HWBL 3BZ4B 4JG1L 3Q3GA 3MUJA 3S98A 1JRHI 1UWGH 3ZDZF 1DVFC 3TBSB 3RNKB 1HHHB 1T2QH 1UWXK 4P46C 5C0IB 3LEVH 3PWLA 3VWJB 4JQXC 4WFFE 1A7QL 3RVUC 3TJHC 3IDYB 4MXWL 1F3JA 1FN4A 2PR4L 3GHEL 1JGVH 2VC2H 3P30L 3DYMA 2D7TL 1HKLL 4GXVL 3VFRB 5ENWA 3VFVB 1NUNB 1HSBA 3G5VB 4P23D 5CEZD 3C5SA 5GRWA 2XIDA 1WFOA 4PRHB 3KPMA 1LO5B 3L7EB 4LP4A 1YECL 3WEXA 3C5ZD 3MLSL 2NW2A 5BV7C 3PDOB 2AJSL 5BV7L 1IGJA 4GUPA 4OD1L 3CSBA 3HI1B 5MEOB 2X4NA 2ZG1A 4M4PA 4CDHA 1CU4L 5AEAA 4CW1A 5DMIH 5CJ8A 5C9KA 1T66D 5ABDE 3CPLA 3QO0B 1S5HA 4PB0L 1FZMB 2C1OB 2NY1B 4HH9B 3L7FA 2Z8VC 3MQIA 5GXBB 1DQDH 1TZHA 5DGRA 4IRJD 3FO9A 3H9YA 3FCTB 4LCCB 5C0BA 2Y7QB 3GIZL 4QHLA 2OLDA 5CINL 4G7YH 4YXKL 3RA7L 4JE4B 4P49A 4BFIA 2FBJL 5BZDA 1NBYB 3QRFM 4KUCF 2Z31D 3E2HB 1AXSA 2VQTA 4KI1A 4S1DD 3FZUC 3TZVA 3OG6B 5T1KB 2HVJA 5E9DA 2YMXL 3BIKB 4Z5RB 4JDZB 1Y0LA 1A1MA 4MD0B 1KNOB 2WMPA 5C7XH 1GGBL 3GSUA 4E5XB 1I3RA 2AXGB 5IW1B 2DICA 3P0VL 1NMCB 1P84K 4W70A 1PBYA 1RJCA 3JXAA 1PFCA 1AD9A 1MHHB 2H41A 2OP4H 3L3IA 1FVEA 5FK9A 3QI9B 1T03L 2VUYA 1BZ7B 3PQYE 5IOPA 4W4OC 5BVPL 3P4NB 4NT6A 2DWDA 3TT1L 2YUWA 2E3VA 2GT9B 2IF7A 2MNUA 2OXHA 4XPTH 1J1PH 4F8TA 5E0QA 3LVEA 5EZOH 4YDJB 1U8LA 3WUWA 4CVXB 1VDGA 5I16B 1CFTA 1TZGL 2Y23A 5FDWB 2JJVA 4K23H 3FRPG 5T3XD 2DQCH 5TDOA 4XVTH 3KYOB 4XMPL 1MCFA 1SEQL 4LPYA 3X3FL 3GGWA 3UJTH 4JFQB 4GQ9L 4KROD 1HSAA 3STZB 4FRWA 4WU7B 5E5UB 1BEYL 2R1WB 1E4WH 5JHLH 3RGVB 1KN4L 3C8KB 4PRAA 3P40A 1QOKA 3S35L 4S1QH 3H8NA 3U83A 2UZIL 1FZOA 5IB1B 4K94H 4UB0L 2FJHB 3IDGA 1V3MA 4NCC1 4ZYKA 1IAMA 3RY5A 5BZWA 1RJZB 1XH3B 1EZVX 4M1CC 3OKEB 1FIGH 1FL6B 5DURD 1GPOL 4JM2A 4GG6A 1IE5A 4X6DE 3D39B 1I3GL 3MOQA 1FFPA 4MXQC 4E41A 1TTUA 3KS0J 3ZHDA 3WS6C 2PW2A 1YPZF 4MQSB 2X89A 2N4IA 1YEJL 2FHBA 3K2UL 2XPGA 3L1OH 4MA3A 3RKDD 5I6XC 1KIRB 5IHBA 3IFOB 5KBNC 2R2BB 3T0VA 1Z0MA 3VRIB 3WLWC 4P9HC 4OZ4B 3QJHB 3ZO0A 1T20B 4JDVB 2P8LB 4MZ2A 4AEHH 3O4OC 2EZ0D 3FB7B 1D5MA 2JJSC 1OTSC 3HAEG 6FABL 4X4XA 1B0GA 5SX4H 2NZIA 2P7TB 4QHUB 1DN0B 4KMTH 4RWYH 5JPNA 1UEMA 4Y5YB 4G80A 3GMLA 4UT6L 1P1ZA 2L0DA 1RSFA 4M93B 4H5SB 4NO0D 3V0WH 4ZOEA 5HVGB 2HN7B 2NY0B 2Y72A 3TFKD 2EDFA 3KJ6H 2GTWA 2BHYA 1RZFH 4EZMA 1JUFB 3C6SB 3VI3E 4XPHH 5KN5A 5ALCL 3VXMB 1U58A 4HJJH 1EAJA 4DK3A 2E5EA 4JRYA 4TVSa 3QR2A 4YZFE 1WWBX 2AAVA 3RI5F 3RWJA 3LV3A 4IM8A 4XZUB 3S5LA 4EUPA 5B8CB 4XAWL 3LDBB 4G3YL 1T89C 4H26B 1QQDB 1JPGA 4MJID 2XZCH 4I0KA 4WFHD 3BRFA 2IPUK 1A6PA 3O2DH 5C0AA 3QNZA 1E6OH 1ZVYA 1MVUB 1FL5B 1RULH 1SY6L 1HXYA 3MLVH 1MAKA 4OD2B 1ZMYA 1QR1B 4I3RL 4LFHG 4JO1L 5IBLC 5EUOF 3WJLA 1T3FB 3VXUA 5JUEH 3MRLA 1XGQA 2VDRL 1F45A 3V5DB 5E2UL 3WHXB 2YA2A 1HYRC 1X5JA 2DLGA 4XHJD 2VJXA 1S7TB 3Q1SL 4FQLL 5H37H 4RIRB 1A5FL 2JCCF 1Q0XH 4F7CA 1KELL 2XWTB 1QSEE 1K6QL 4BKLB 4BZYA 4KRNA 1Q9KB 2EDNA 2LFGA 5ACMA 2CR6A 5SWZD 3I75B 2Z92B 4JN1H 4BSWB 3V4VH 4HKJB 1NMBH 2ESVA 3WNPA 4ZUWB 3WN5C 2BNRB 2NY6C 4KDVA 4DUXA 2PTTB 3MNZA 1MCKA 5HVHC 3O0RL 3QXDA 3AREC 1AKJB 5E00B 2FO4B 1KSRA 1PX4A 2HLFD 3S88H 5FHBH 3AU1A 2F53A 3T0WA 1E27B 1F11B 2A6JA 4QOKA 2FEEI 2UWEE 3MO1B 1U6AL 1JNNL 1J5OL 1CE6B 4JZJA 4U1MA 1U3ZA 2I60H 5ISZA 3GSNA 2AI0H 5JOPD 1DVFD 4X6BA 5L88L 4G9FA 2WBJC 1S9YA 3CFBA 1C8PA 3PF2A 2ADFH 3AC0A 1BM3H 4Q74A 1CICC 5DVKA 4ZUTA 5J1TC 3BWAB 4XNMB 2C3VB 4OKVB 4NM8L 4L4TE 2RB8A 4YHIB 4NN7C 4HKZB 3TA3B 1PKQE 1J86A 4FOMA 5L9DL 4NWUL 4A2MA 5FA4B 1AGEA 5IHZB 3VD4A 1PJ9A 3RL1A 5J6HA 5DEZA 4HUUA 1MY7A 4ZMAT 5JQ6H 3NABH 1JYWA 5DRXA 2H26B 4JFHD 4ETYA 1VERA 2XY1A 4MMZC 2QQQA 3L5XL 2IAMA 5DMJB 1KTLB 2YZ1A 4M7KL 1TJIH 3FQRA 1KCUH 4HZAA 4U05A 1OAXH 1FAKT 1XCTA 4ZFZA 5L8KB 4XBEL 1LP9A 3OB8A 4Q9QH 4Y2DD 5MHSE 3BDYH 1QO3B 3CVHL 3HI6L 1AIFA 5A3IC 3C60C 4XP5H 5KVEL 4Y5VB 3CMOL 1UXSA 5CJOL 1U8NA 3KJ4C 3DUUA 3I02B 4OLVL 4QRSB 5BS0B 5F1OB 1H0DA 3MLTA 5KSAB 1JWUA 3GRWL 4Z7WA 2Z0BA 4MAYA 2DTSA 1G7HB 5FUZH 2ZCLH 3LY6A 1G6RH 1UJ3C 1G1YA 2DQEH 3QEQA 2QKIB 3VFGL 4AENB 5FYKH 1Z5LA 3T2QA 1IMHC 2JJTC 1P4LA 5I0DA 3SCMA 2Q6WA 1UA6H 4P2YA 1BD2A 3DX9A 4RCAA 1I9JL 3FQWA 4JFYB 4Q9RL 4OD3H 4PJGE 4PBXA 4QT5A 3MRQB 5HYJA 4J4PC 4FTVA 4PG9A 4DOHB 1UH2A 4FFWD 1QKZH 1XAUA 2H8PA 2VABA 2EYTB 4HT1L 3T2OA 5DJYA 4FABL 3IVKA 1B90A 5F7EH 5DRWB 4L9LC 4MDJB 1LEIA 3SDDA 3WSQL 1U95A 4Y4KA 4O51B 4ZSOE 4OB5H 4PJEE 4BA8A 3NCYS 4AT6A 2ADIB 4PRHE 3W81A 1HN1A 4HG4J 4JRXB 1U8HB 4J2XA 1JHLH 3QIWC 4QRPD 4GBXC 1YN6A 1H3WM 1S9WB 1C5CL 5D7KE 3PGDB 5IROA 1P2CA 4OUUB 4JFFE 4HBCH 3V6OE 2X4OB 3RRQA 4E9LA 1CVRA 1XF4A 2AK4D 4JKKA 4RWHA 5IBUB 2DLFH 3KYAA 5F1NA 3HR5B 1SYVA 1D6VH 5ID0A 1QLFA 4NC2B 4LSUL 1BVZA 2FHFA 1FYTB 4MA7L 4P2CG 1BVKB 1G0DA 3CK0H 1LO3H 4ODVL 4JAMB 3WV0A 2DDQL 3NCBB 1PYWA 1Z0NA 3IJYA 4M8QA 1JGLL 5TGBB 1U8KB 2IADB 2J88L 4LOUD 2OI9B 15C8L 1B0RA 1R5VA 4LSTH 3O6MH 4X5WA 3WMSA 5D4QA 4N0CC 4XNQB 2V9QA 4M5ZH 4QF1B 3K4DA 1MI5D 4LPXA 3LS5H 4PUBL 4U7KA 4RZCB 2PYFB 5KVGH 4M1CD 4JY5H 3E8UL 4ESKA 2MPAL 5AAMA 4LHUD 1Q72L 4KK8D 4RQQA 4GRWH 4H25A 5EWIH 4WFEE 2IALB 4HUVB 1WWAX 1NC2A 5KZCD 1IGTB 4MWFA 3IYLW 4XWGH 4YLQT 5F8QC 1IJ9A 1RIVL 3BZFB 1CDUA 5HY9B 2J6EH 4L3CA 4Z7WF 2NXYB 4NGHL 5IFAL 4BH7A 3OAYH 1MFCH 2DMBA 4LVOB 3OKYA 4S0TD 1N2RB 4P2OB 4P4KB 2IBBA 2IQAA 1YYMH 5C0RL 4WY7L 2VZOA 3ES6A 1X5FA 1B6UA 4HKXB 1ROWA 1LWRA 3S97C 5GS0L 4XB8A 1MPAH 2IFFL 2VLJB 4Q0XH 3V6FA 3I6LD 1SJEA 3GM8A 1ZA6A 5D71L 3RX5A 2R9HD 1CE1L 4HDIB 1OTSD 2DQTH 3HFML 1LE5A 3CVIH 1NFDA 3G6AA 3BP6A 4Z78B 2DKSA 4QHNB 4OLYH 3MRKA 4PRDA 2DL9A 4YHNB 1T1XA 3PGFL 1U8MA 4M7LH 5KOVC 3Q0HA 1ORSA 1EHAA 3VXSD 1RZJC 1R24B 3JWOH 3V95A 1RZJL 5HYSA 1ZLSL 4OCNC 1UM6H 2NZ9D 3CFJA 5MEND 2XKNB 3EYFA 4KU1A 5EULV 2F54D 3VJ6B 4K2UL 3NACH 4LDLB 3WFBL 4LSDA 5D2NE 1M7IB 1YEIL 5IB4A 3ARDA 5F7DB 1KEGL 3PIQB 4UMGA 3Q6FA 3IFLL 2OZ4L 4YWGH 3G08B 1PG7L 4Z7VB 3OKDB 1S9XA 4YDIL 4WW1B 3QUYA 4KKNA 2AP2A 2SEBA 4YGVB 2L4OA 1WIUA 1PEZA 4I3SH 1Z9OA 4L3EA 1F42A 2Q86A 1MFAL 4HLZG 1EEQA 2YD9A 2BNQA 4NNYB 5LAXB 4NKOA 4MDIB 1X7QB 3EDKA 3P77A 5B3NA 3N50A 3TNNB 3L3HA 4W6XB 1P4BL 4WJ5B 2R4RH 5IBLD 4C59B 4CDGC 4ELKA 5D8JH 4GKZA 4TPRH 4UAOC 1WITA 4OZFG 3CX5J 3OR7B 2IGFH 1MEXH 2BP3A 5DSCA 4OIIH 4Z77A 3LEXA 3CC5B 3GMOB 4Y16D 5FYKE 2V2WA 3S3JA 2EH8L 1ZHKB 4JFDA 5D7JC 1BQHA 2A2QT 1HZHH 3EOTH 3ILQC 3Q3GB 1FO0L 4DTGH 1HHJA 3MRNA 2F5AH 4MNHB 5ICYA 2VH5H 3BKCH 4JPVH 3PWLB 4PRPD 3H7BA 5F7WC 4K8RC 4J3UA 5IMMA 4K8RL 1I7RA 4XP9L 2BMKA 1F3JB 4QRRE 1FN4B 2FX7L 2PTVA 4K7PH 2ORBH 4WI8A 2NY4C 1A7PH 2CKBH 4I48A 2WWKT 5ENWB 1AI1H 3QQ9C 3HI5H 4MS8C 1LDSA 1P53A 3C08L 1HSBB 5C0ND 43C9A 4F9PC 3C5SB 5IGXH 3U9UA 2XNAA 3KPMB 2CDEA 5HGBA 4M61A 3R8BB 3V52L 1N4XH 4B41A 3WEXB 3QDMD 4K55A 4NRZA 2NW2B 1ZV5A 3L9RA 4OT1L 3BAEH 1RVFH 1IGJB 4GUPB 5JOEA 2BY1A 2EE2A 4TUJB 5IQ7L 1DBAH 1PW3A 2X4NB 3I6GB 4CW1B 4Z7OE 1CXEA 3QDHA 2CXKA 3T65B 1S5HB 2ZP0T 4UNVA 1XR8A 2FEDC 5JXEA 3EHBD 4ZFGL 2DQHH 3L7FB 3MROA 4PJHA 2N1KA 4NN6C 1VPOH 3ULSA 5IHUL 4KKCD 2R0WH 1BGXL 3FO9B 4G8EA 3DX8A 1CGTA 5F96H 4QHLB 3EO1B 3HE7C 5FYLH 5J12C 4W4NA 1T6WA 1D7FA 5DRNA 4BFIB 1QUNA 4GG8A 5BZDB 3ULVL 3O6LL 5IB3A 1AXSB 5D70H 3TZVB 7FABH 1UYWH 2HVJB 5E9DB 4G43B 2WK2A 1OP5K 4KH2A 4PJ7F 3NFPA 1A1MB 4GRWE 2ZJSH 2QSQA 1F8TH 25C8L 2DMKA 4IMLB 4QKXB 4R4FH 4RGMC 1TVDA 3GSUB 3DXAD 5IF0A 2BXYA 2EDJA 3SOBL 3TPKA 3SKMA 3DI2B 1D5IL 5T1DH 1IRAY 5KAQF 1AD9B 5CZXD 4FP8L 1TITA 2I07A 2K7PA 3L3IB 4P23A 5FK9B 2VZTA 1KXQE 2D7NA 5FYJU 1SM3L 2GJZA 2QHRH 4NT6B 3SGDH 1IKNA 4QTIH 1Q94A 4G42A 5DC0A 1MFDL 1JF1A 2RHEA 5LVEA 2FGWH 3C5ZA 1U8LB 3WUWB 7CGTA 2YS4A 1FP5A 5EN2A 1Q9OA 4M62L 4WHYH 5TDOB 1QRNE 2CUMA 1GGIH 5MEPA 2AEWA 5DT1L 1U9KA 3GGWB 4FQCL 4GAFB 5L0QB 4IBLT 1HSAB 1Y18B 1UZ6E 2ARJA 4X7FC 2GAZA 2AEQH 1YEEL 4R2GC 3CZFA 4YK4B 1WAAA 3KNBA 4DGVL 3DO7A 3SO5A 3IDIA 1CQYA 3SE3C 3QIUD 2Y06H 4PRAB 3N9GH 2A9ML 3K46A 5K33A 4YEFA 4HGWA 1P69B 1U2CA 3QEUB 1OTTC 3JTTA 1FZOB 5DK2A 1OQOA 3IDGB 4PD4J 4OLUH 3ZE1F 1BJ8A 4ZYKB 2DLIA 1MIMH 2Y9RT 3CH8A 2Z31A 3CCHA 5I2IA 5ESVA 1UH4A 4TVPE 5CSZA 5GJSL 4GAJH 4RMTA 5BS0E 4KK6C 3MRFA 4JM2B 4GG6B 4F7MA 1JMZA 3DPBA 1CTNA 5GGTL 2FLBT 3DROB 1FFPB 4PRIE 3GB7A 5BVJA 2PW2B 1UACL 3IGAA 3TO4C 4JG0H 2E27L 2IH1A 2DYPD 2XZQL 3R06A 1MSPA 4K7PX 1GAFL 2XPGB 4NP4H 4FXGA 4MA3B 2WUCH 3U36A 3WNNA 2FBOJ 5JO5A 1MCJA 2XT1B 3WFCH 2DL2A 2EDOA 1UADC 1NAKH 1FQ9C 3QFJD 5BRZD 2WWMC 1WWWX 4YBQD 1IGCH 5J4MA 1JZ5A 4GT7A 2BFVL 5KSBF 4PJ5A 2X09A 5D2LE 3NIGE 1D5MB 4MXVF 3RZCC 2VNCA 1EVUA 4PJFE 5C9JA 4KTDL 4G5ZH 4X4XB 4XAKD 3RL2B 3VWJC 4LCIH 3D6GA 3ZLQC 3U7YH 5JPNB 2HFEA 4G80B 1T83C 4TSCH 1I75A 3GMLB 3IDYC 1MCQA 1P1ZB 3IFNH 2W0KA 3UPAA 1FVDA 5IW6A 2J4WH 1ZHNA 3IAPA 4OF0A 5AAWA 1JPFA 1ZHLA 4HXAL 1QEWA 1B2WH 2I5YH 5F9DC 2W59A 4K7FA 5B4MC 5KN5B 2XWBA 4JCMA 2W65A 5CJBA 1U58B 4GMSL 3CXDH 3UTPD 4F9LC 4JRYB 2AQ3A 1DANT 3DRQB 3OJDA 3RWJB 3LV3B 4EUPB 3S5LB 5H2BB 4NBZB 1Q9LA 2VITA 3BD4A 2HP4A 2E8ZA 1IAIM 2IPUG 4UIMA 5C0AB 3QNZB 1LNUA 5CJXC 4PJXF 4U1HA 4J3XA 4OCSL 1N8ZA 3PP4L 5KW9H 3PWPD 5D9SB 3UX9B 2BHUA 4HFWA 4MVBD 3TF7C 2QSVA 3VXUB 3MRLB 1XGQB 2BC4A 2DQUL 1LMKA 2NY1C 3C6LB 2NY5C 2RQ8A 3QHFL 2NY5L 3ZDZE 5A16B 4BZ1L 1PZ5A 5I15L 2OYPA 1A3RH 3HE6B 5I18H 3P73A 4NO2A 4LCCC 5IVOA 3NPZB 1CFSA 4NQDE 4OFVA 2AJ3A 4DN3H 5J57B 1G7QA 2VN4A 1SQ2N 4R7NA 4IRSD 2V5SA 4DW2L 3E6HA 4P5KA 4P2QD 1E4XH 3E2HC 3QCTL 1QR4A 1MH5A 2NTSP 2X1PA 3QAZB 3D69B 3HRZA 1OLZA 2HWZH 2ESVB 5TQ0H 3QCVH 2VMFA 1RUMH 1CLZL 1BQLH 1RD6A 4NO0A 2VZVA 4ISVA 5CGMA 3HR6A 4MD4B 1OAYH 3QXDB 1GGUA 1OB1A 4XCNA 1IEBB 4RBPH 3AU1B 2F53B 2A6JB 4YJZL 5AUMA 1EK3A 3G6DH 4CADA 4JZJB 4U1MB 2K7QA 1JCKA 2BZDA 1DFBH 2V5MA 5ISZB 1EO8H 3GSNB 2VZUA 2D03L 2Z4QA 2BRQA 4X6BB 3RU8H 3C8HA 4G9FB 4TSAL 1S9YB 2CGRH 2EKSA 3CFBB 4F8QA 1EO5A 2C3WA 4NQSA 3QPQD 4MJIA 1OAUH 3GJEA 1JJUA 2QQNH 3M1BA 4ZUTB 2J12B 1I85A 2AV7A 4P3WA 1OD7A 3SDAD 2CLRA 5EIIA 4BSVA 3ZKND 2X4QA 3BHBA 4JPKH 2OTUA 3T4AB 3D3VD 4QXTA 1AGEB 3EYUH 3K4ZA 2AJVH 5A43C 2XTJB 3X12A 3QQ9D 1IAKA 3RVVC 3THML 4MS8D 1LO4H 3QJFA 2QQLH 3RL1B 5J6HB 1VKXA 1T1ZA 4HUUB 4UNTA 1U42A 1JV5A 2DAVA 1H3GA 4KK9C 5DRXB 5GZND 3RGVC 1G84A 3BRDA 2QBWA 4NWTH 2JJWA 3NZHL 2HFTA 3O9WA 3S4SG 3TCLA 3FQRB 4OBRA 1HK6A 3H3BC 1XCTB 4ZFZB 1LP9B 5DQDH 3UAJC 2PYEE 3QWOA 4JO2L 3DLQR 1AIFB 3VGAC 1P7KB 1S7XA 1YC7A 1UXSB 4G6KH 5SWZA 5D1XD 2CD0A 1G9MC 5SWSE 1RUAL 3DUUB 1OW0A 2KQMA 4OM1H 1QFPA 1H0DB 3MLTB 1JWUB 3JWDC 4RDQG 4CBPA 4XP4L 1HHGB 1T5WA 2CDGA 3BW9A 3JWDL 4MAYB 5C0CE 1HINL 4NQCD 2AEPH 3RTQD 4JHAL 2H2SC 2PN5A 4KUZH 2EECA 5GGRA 4LCYA 5DUML 1LK3H 3QEQB 3GK8L 1Z5LB 4GS7C 3HZYA 4JB9L 5LG1A 3IU4L 3SCMB 1TTGA 3WIHL 4ODTL 2Q6WB 3GMNA 4NIKB 1BD2B 3DX9B 4NUJA 4N0UE 1DVFA 3FQWB 5EZJA 3ABZA 4RA3A 4Q9CA 4QT5B 4U3XA 1IGYA 5C0EA 1OAQL 3LIZL 4FTVB 2FLRT 4JO4L 3CLFH 4K3EH 4PG9B 4C4KO 1F4WH 3TO2A 1MRDH 2MQCA 4XCYA 1H15A 1ONQA 3UPRA 3T0ED 2H8PB 5DJYB 1CD9B 4M6NL 3IVKB 4JQVC 4JKPH 3WNLA 3DETC 3STLA 4Y5YC 2LVEA 4L4VE 2CH8A 1V3LA 1KB9J 4M93C 1RK0A 1U95B 3KR3H 4XB7A 4Y4KB 5EPMA 1YNTA 2NY0C 4LSSH 3BOVA 4N90E 5HDQL 1CDJA 4AT6B 5C0DB 3UO1L 2PXYC 5DHYA 1MF2H 2FECI 3X13A 2YA0A 5FCUL 4XI5C 5GRYA 1YN6B 4JFED 2VTFA 4X5XA 1IGFH 4MNGE 2M8XA 5ICZA 1AE6L 2Q3AA 3KLDA 4Y2DA 3W82A 1P2CB 5JHDD 5DLML 2R29H 4QGTA 5DJ8A 2Z9TA 2BDNH 3B2VH 5DMGC 1J8KA 5I1KL 3V4UH 4JHWL 2B1HL 1AD0A 1YPZE 4NZRH 5CSGA 3SEPA 1XF4B 3LDBC 1IC7H 4HCRH 3MV7A 2EIEA 1SYVB 5ID0B 1QLFB 3AXLB 3WNOA 3BPCA 5HHVH 5TFSL 4YDLB 1F97A 1R6VA 3U0WH 4YX2H 4YFLF 1PYWB 3IJYB 4M8QB 4HK0A 3D18A 1I8LA 3TH2T 4UI2A 1BVLA 5DD5L 5C0BE 1MJ7L 4I2XA 35C8L 1B0RB 1R5VB 1F90L 4JJ5A 4WNQA 4R6UA 4WWKD 2AJZA 3QDGB 1YEHL 2XN9B 5AYQA 4GXUN 3EZ8A 2LV4A 5FM4A 4POZD 4F7EA 1A6VH 1N0XH 1NCAL 4KJYA 1OT2A 4ONFH 2YC1A 1M1SA 4H1LA 2XKSA 5I73B 1NSNH 2J7LA 5C0JB 3RVXC 5FO8A 2BRRH 1ADQH 1DBBL 4J3OC 2B4CC 2ZKHL 5IKCB 1NC2B 4U1JA 2B4CL 2ZCKH 2VAJA 4MWFB 2APBA 1MIEL 2OR7A 2WW8A 4LIQL 2A6KA 3MLWH 1FNFA 2OCFD 5E2TL 4PGDA 1CBVL 4L3CB 4M3JA 2OTPA 4BH7B 5BMFL 4OTXL 4ZXBD 4HIEB 4W4OA 1KIUA 3L3GA 4OF5A 2IQAB 4QRPA 4B7IA 3ES6B 3QXVA 5BJTB 1KLGA 5C09E 5K93A 1RHHA 3IF1A 1OHQA 4K3JL 3V6FB 2R0LH 3BEWA 4XMLL 5JDSB 1SJEB 1ZA6B 3WKNA 4LLYA 3QFDA 3RZCD 1IFHL 3B9KD 1V7ML 3A6BH 3RIFK 3C9NB 3TM6A 1LE5B 1NFDB 3G6AB 4F57H 3BP6B 4RMWA 2AK4A 4N1HB 4PGCA 4PRDB 5EUOE 2MCG1 3VRLF 4TNWK 4K9EC 1T1XB 4DQOH 1U8MB 4K9EL 1ORSB 3QUMA 3MLPA 2WIIA 3WJJC 4U6YA 1XGRA 5KVDH 5EC1A 3HUJF 5HYSB 3PWNA 2VDOH 2HH0H 3MNVA 1FFOB 4N9GA 3TA3C 3CFJB 4DWHA 4YO0A 2UZYB 3EYFB 5DEGA 1CI5A 4J3SA 2JCCE 5B4MD 5JXAH 1M4KA 3QG6A 3HAEH 3QXUA 4KQ3L 4Q58C 5IB4B 3ARDB 5ILTL 3TCXA 3Q6FB 5LXGH 1N0LA 3KYKL 4NKQB 1U8OA 4Z0XB 2W91A 4PJDF 1MI5A 2LU3A 1S9XB 2ZZUT 2EXWC 5D96B 4DN4H 4G8GB 1G9NH 2SEBB 2B1AL 4HZLA 2Q86B 1LEKA 2D2OA 4LHUA 2C3GA 1T0NB 2NX5E 2BNQB 4Y5VC 4E41E 1CDHA 2CK2A 5AG9A 1EEZA 2F8VA 3P77B 3C09B 3L3HB 3U82B 3WS6A 5GZOD 4TVPL 3WE6A 4ELKB 1GH7A 2IPKA 4CNIB 1DANU 5KSAC 4BFGA 5ERWA 4G7VH 4GKZB 1JVKA 4NQEA 5AWNH 1MREL 3KWWA 5DSCB 5EOCL 4Z77B 4HF5L 2NYYD 3LEXB 2N7AA 2ZWLT 4KRMB 5FAAA 2V2WB 2CDFA 3UJJL 2G75A 4JFDB 3DRTA 1E28A 2DQIL 1BQHB 4JY4A 4NQVA 4K3DL 2V7HA 4L8BA 3LS4H 4N68A 1HHJB 3MRNB 5ICYB 4ZOAA 4HUMB 4MQXC 3O2VH 3PXJA 3WFEH 4QCIA 3MXWL 2J8UF 4M48H 1P84J 3MLXH 5GJTH 1QZ1A 5IMMB 5EORH 1I7RB 1OAZL 3RY6A 2HKFL 2BMKB 1WT5A 4X7SL 3QQNA 4MSWB 2QV2A 2D7QA 4UILH 3VXSA 2B0SL 3GJFA 4IIQC 3ZHLA 3SBWC 3B43A 4J6RL 5SV4A 5MENA 4I48B 1KCLA 2FGZA 4H8WH 1OAKL 3KHOA 3OPZL