5DVNA

Fc k392d/k409d homodimer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvnA01
1XR8B 4JM2D 4ZFOB 3BIBX 1OP3K 4Y4KB 1CD0A 4L8BB 4I18A 5GISL 5I1JL 4KMQA 4P5MA 5DQDL 3MCLH 3TC9A 2YZ8A 4KJYB 3E8UL 5GJSH 4BUGA 4EXPX 1KULA 3TT3H 3D25A 3QO1B 5JORA 4ZS7L 2P8PB 2C3HA 3AGVA 1UACH 3MPCA 1HINL 1PEWA 4GW1B 2BSSA 3V6OE 4PJEA 3MLRH 5F6IB 1KTLB 2AJZA 3IDIA 5C86A 5D7KE 3LB6C 3MBEA 4CMHB 4ONGH 2WUBH 2GKIA 4X9FA 4XNQB 1V3KA 1SM3L 4JZJB 5DMIL 4OFYA 5TPWL 1ZEAH 3A6BL 1F8TL 5DJZB 3UDWC 4XNYH 2R23A 4PJ9B 4B7LA 1KJ3H 3CJJA 1T22B 2B2XH 3FQWB 1FL6B 3VMNA 4P9HH 3JWDH 4FXLA 3ALXA 3NZ8B 3Q6FB 5DEZA 3VFPB 5C70A 4M3JA 1AGEA 4IIQA 3DECA 4RMVA 2EDRA 2J6EA 1KG0A 5EIIA 4OQTA 4YWGL 4ZUUB 1H3PH 5D7JC 2R0WL 1S5IH 5DDHA 2WAHA 1ONQB 3P4MA 5EN2A 5J12C 2EE2A 1AGFB 5IW1A 2D0GA 5JUEL 3HI6H 4PGEB 4ZTOH 4LKCB 3U0TA 3GI8L 5HGBA 5E2JA 1LO3L 3LEYH 5IB3B 1Z6JT 1FE8L 4YXKL 4MQ7B 1R5IB 3CVIH 2X1OA 2FO4B 4WI8A 5C0BD 4LDEB 3QUXC 4PRAB 1T04B 4OZGE 1YY8A 3EYFB 3WD5H 4RRPA 3SCMD 5GS0C 3JUYA 3THML 1T5XA 1JWMB 2ADJB 5IHUH 5GS0H 4ZFGL 4MD5B 2X4RB 3UJJL 2F8XC 3K81A 4LNRB 1E4WL 4LSQH 3OG4B 1EHAA 1UB6A 3O3AA 1G7LB 4OD2B 1ZHNB 2E6JA 5H2BB 4IRZL 2DDQL 1PG7X 3QI9D 4I5BA 1XF4A 5DJ6A 1S7TA 4OSUH 3RWCA 3TIDA 4FXGB 4FFZL 3WNNA 1U8HB 5I19L 4DUWA 3MLUL 4KK9C 2DM7A 1DQMH 1IGYA 3IS0X 4PRIE 4LRIA 3H2WA 4JM2A 1RULL 1I9RH 4GLRI 5C6WH 3T0ED 4GAFB 1DQJA 1F3JB 3RY4A 1QO3A 3AROA 3AS1A 3V8CA 2MCPL 4JY5H 4NQSB 4PJCF 2HFFA 1TJGH 1BZQK 4R97C 4XBPB 1JTPA 1OT2A 2HJFB 2FLBT 3FN3A 3LS5L 4NRZA 4DGIL 3VRJB 3QRFM 1FNHA 2J8UB 2NX5E 2W60B 3LEXB 3CLEL 3MLWH 2E7CA 1HHKA 3RNKB 4ALAH 5JLZB 5HYQA 3QWOA 1IFHL 5BVPL 1HH6A 5B8CA 1EEYA 2XWJA 3DETC 1H8SA 3O41B 4Z0XA 3NFSH 3T2PA 5CD5C 1GC1C 4ONHA 4RMUA 2DL9A 1JNJA 1RZJH 4K7PY 2JB6B 4POZD 3L7FB 3PIQB 5EOCL 4YFDB 2R1XB 1J86A 3HMXL 1A22B 3CZFA 3B2VL 2AK4E 3BPNB 1RUPH 3DYPA 3P4NB 3N85L 3RX8A 1WFUA 3IU4H 3QUZD 3WYRA 5T1KA 5I1KL 1N3NB 2MPAL 4OGXH 5I66B 4NZTH 4YC2B 4OLEA 4H25A 4LEXL 1BHGA 4JDTL 3ARFD 4NNYA 4Y1AE 2FIKB 4NO3B 1NEZB 4PYGA 2Z31C 2WBWB 1KJ2B 3V95A 2WK2A 3I3BA 5F3BB 1UYWH 5GS2D 4PJ5A 5CJ5A 3O6KH 3SKNA 2NY4D 1J1OH 2DWDB 5BZDB 5A16B 5BRZD 4AMKL 4MQTB 4YBLB 1KPVB 8FABA 3W5NA 2AKRA 2YD2A 1F6AB 1BEYL 3JXAA 1ZLWK 4LAJH 3OKDA 2EH8H 3DYOA 4NQVB 2BNQD 4HV8A 3DUUB 2IAMB 5CEXA 4U7KA 3H7BA 5I71B 2B4CL 1EXUB 3H9SB 1BF2A 3FB8A 5C0BA 1JBJA 1JTOA 1I1AC 4U1GC 3RVUC 3FCTB 3V0WL 1B0GA 4OGAC 3B43A 2Z4QA 5C0DB 1R5WA 4YHIA 4IS6A 1NCNA 4P57B 5E9DA 3U2SA 1NJ9A 4P2RB 3SCMA 2EIDA 5T3ZL 3HLAA 5E2UH 1F4YL 3VW3H 4ODVL 1B6UA 3LKOB 3LRSA 2MHAB 2UYLA 1L7IH 1K4CB 1NFDE 3MRHB 4XAWL 5DQJB 1I8MA 1LEGA 5EO0A 4OCSL 1X3DA 4OZHA 3R1GH 1EHNA 4L4TE 4ZAKD 1UJTA 4X6DA 1R24B 1BLNA 5DJYB 4O2CA 3HNTH 1AXTL 1OP3H 1IEAB 1JF5A 4NQCE 5EUOB 4TVSa 1MHCB 3RIFK 5H35A 1MCJA 3NCFB 5SWSE 2DKUA 4JO1L 2NY7H 1ZXQA 2VN7A 4DEPB 1YJDH 2XTJB 3HZMB 3MROA 4KRMB 1P4IL 3UMTA 2ZUUA 4JZNA 1FZJB 3EO9H 1W0WA 2Q8BH 5K93A 1EH9A 2YEZA 4JFXB 3ULVF 4TNVF 3EO1A 3ARTA 2WIIB 4G8EA 2V5YA 2APXA 4CVZA 2NCMA 5D8JH 4UBDC 3OAZH 3LEVL 1I9IL 3KPOB 2ZSVA 4X4ME 4WNQA 4M93C 3HMXA 5MI0C 5E2WH 5AUMB 2DJ4A 3PQYE 1CG9A 2E7LA 1BD2E 2P5ED 1LDSA 4EDWL 1VPOH 4ZNCD 3FQUA 4KH2A 1U58A 4EN3B 2DB8A 5EU3A 2JJSA 5DJAB 1JNNL 4JFOB 5IFJA 5J13B 4X4XA 4XGZB 4G8GB 3LQAC 3UJIH 2D7MA 35C8L 4TQEL 1J88A 3BKML 4ZUVB 3WS3B 3EAKA 1MCPH 3HUJE 3LQAH 4XCCL 4M61B 4BZ2H 1MCIA 4FXKA 5AD0A 4UQ2A 4YH6A 3QUZA 2A77H 3CK0L 4HBQA 4PJXA 1RJYB 1A9BA 4HIHA 3INUL 4PJ8D 1NEZG 4HHAB 2FGWH 5J0BA 3DGGA 4HIEA 3HKFA 2AAVA 5ERWA 2YA0A 3AM8C 3JV6B 2V5RA 3OXSA 4LF3B 1IKFH 3C5SB 3MJ6A 4FNLL 5LQBL 5B3NA 3ZKQD 1UEMA 3S98A 3SKJH 4UZGA 4FQHB 2QQKL 5IESH 2JE8A 4Y4HB 3BP5B 3VWKB 3GK8H 1XGTB 3MGTB 2EXWD 2VAAB 3L7EA 3OF6D 3DO7A 4O2EA 4YPJA 5DD0L 1AY1H 2BSTB 4FQXA 1P7KA 3TJEH 2HVKB 2BNQA 1WCQA 5I17A 4HWEL 5IP4A 3HMWL 2EIZB 3GGWB 4WWKC 3BT2H 3SDCC 5HDLA 2GI7A 5E5RB 2XFXA 4LHQB 4Z7QF 3KPQB 3LOWA 4NZUH 3EO0A 3PABA 1P4BH 4I0PC 5ADOH 1XCTA 5DTFB 4KHXL 3RGVB 4ORGA 2R29H 3HR5A 2X2YA 5E95B 4R4NC 3VFGL 5GSVB 4YDJA 2GEEA 4JHWH 3L95A 2ILLA 2DYPB 5C07B 2EDDA 4NO0D 3LY6A 3TZVA 5C6TH 4GKNA 4LEOA 1BQLL 5B3JF 5TJWK 2X40A 2HFEA 3QG6B 5FK9A 3VGDA 4R4FL 5CUSL 2Q86B 4XPGH 3MRDB 5I9QB 4EI5D 4ZUSA 4CVWA 2ITDA 1G7MB 1YNKH 2BY2A 5A2IH 3HI5L 3GKWL 3S36X 2J8UF 4L29B 2DI8A 3SQOL 2R0KL 2VXVL 4P46C 4PRPE 2NTFA 5E56A 3RTQC 5E99H 2CLRA 1JFQL 3ZHDA 3EOBA 2P1YA 1U8NB 2XKNA 2R1WB 2EICA 5FA4B 1VGEH 2SEBB 3EYSL 1NBVH 3SEPA 4XP5H 5F88B 4XCEB 5FO8A 3UTQB 5D1XD 1MHHA 4NGHL 1IAIH 3WHXA 5CBAA 3MJGX 4XCYA 5KG9A 4IHOB 3FB6A 4PRDA 5D7IE 3TVMB 5D7SH 4A6YH 1H3WM 5FM4A 4C56D 1YEGL 1UENA 4NKQB 4D9RE 2EECA 1CICB 1UCBH 3BKYL 5ADPH 2A6DB 3F65A 1VADA 3VJ6A 3G9VA 1KXQE 3BKCL 5CJXA 3QFJA 5FOBB 2P5EA 4MYWB 4OLUH 3RWHA 3V6FA 3I02A 4QRPE 5E2VH 4KV5F 4X83A 3SE4A 5CLWA 5HYEA 2OK0H 3WL9A 3GMPA 1M05B 2EDNA 5IBUB 3T1FB 3WLBA 4D8PB 2HT3D 2QQNL 3KWWA 2UWEE 5LCVH 3W11C 3ULUC 3WEXB 5HGHA 1WBZB 3ZKMD 2QL1A 3B4NA 4HPOL 4HS8L 4JY4A 5JHDA 2E8YA 4O4YH 2H8PB 4JFDD 4P3WA 2WW8A 3B5GA 5E4EC 3SDDD 2F54B 1JHTA 1I9EA 2FEDD 3FAXA 1MIEH 2BVEA 3KYKH 2ZUWA 4GAJH 3MRCB 1GGBH 4PJ8A 5IJKC 3T0VA 3HRZA 4F9PC 4JKLA 5GGQH 1G7IB 3SDAD 2D9QB 4U05A 3ARGA 5DD6B 4TULL 4Y4KC 3GMOA 4LRNH 1CLZL 4QXTA 4Q9RH 1KIPB 3DV6B 1CIUA 2HT4C 3TO4A 2Z9TA 2X4SA 1BGXL 3S5LG 3OF6A 4NRXA 4M4RA 1KN4H 4L4VD 1U93B 4F7EB 4U1IB 1P4LB 1FSKC 3AS0A 3MV11 3U79A 3QUMH 3LQZB 5ITFB 3G08A 4G9FB 1WWBX 3IDUA 4P2QD 3U30B 4Z78A 5EUOF 1OTTC 5C0EA 4GBXA 1FG2B 1CCZA 1MREH 2V17H 3BQUD 4QTHA 3OX8B 2IFFH 3L5XH 4ZO8A 5DRWA 4PGJA 3AFLA 4YUEL 3T2NL 2GUOB 4FFWD 1RZGB 4D0DB 5GS3A 4MS8C 3DRQA 3EFFB 3WFCL 5K59E 2NY1B 3MLYH 3QP3A 2P8MB 1VEPA 1GGYA 2H32B 1SBSH 4KTYA 1QVOB 3CAFA 2ZCKH 3QHZL 1CZ8H 1GAFL 1OLZA 4NP4L 1FNEA 5K9QG 3CC5B 1H5BB 4MCZA 3O6FA 5FKPA 2ZUYA 1R3JA 4YHPA 4P0DA 5F9OL 5GJTH 1NBZA 4KK6C 2FSEA 5TH2B 4JO4H 5L2KE 4U6XA 4Y88A 2JK5B 5EC2A 4O00A 3O4OB 1OAXH 4R96B 4JZOB 1DSFH 2FEEL 5E6IC 2J88L 3CVHB 1PLGL 4Y5XB 5EZJB 2QKIB 3JV4A 3OPZL 4M7JL 4QY8B 1E4XL 2O5ZL 5IVOA 2B1HL 5I15H 4M6NL 1L7TL 1FZOA 1WZ1L 1CS6A 5EU5A 3GJFA 5EOTB 1JZ7A 2ZOKB 1VCAA 2XZCH 5E00B 4WY7H 3C2SA 3LSOB 3TH3T 4ODHH 3B83A 5EFIA 5CSBA 4IDJL 3SDYH 2A9NL 2ZUQB 2PCPA 3VFWA 1J1PH 1JUFA 4PJDA 5D96B 1J8HE 1IRAY 1N64L 1A0QL 2LAGB 3NACH 1SYSB 2AGJL 3D0VA 4CADB 2OQJA 1UWXH 3NTCH 3P30L 4KQ3L 1HK6A 3LIZH 4FRWA 1ZVSB 4DGVH 3D3VA 3PHOA 1E4KA 5IVNA 3K8LA 3K1DA 3RJDA 3RWDA 3UTSE 5HI3D 3WFHB 2YUWA 3GSOB 5ICXA 3G04A 3BP6B 1RK0B 2V5SA 1RUML 2JB5L 4HK0B 4RNRA 2VL5B 1MRCL 3GBNL 1CDGA 4WRLA 3SDAA 1QP1A 1ITBB 1LEIA 1QLFA 2FX7L 4IRSD 4NCC1 1ZT4A 3MJ7B 4PJFE 3FZUC 3MRPA 5CBEA 2KZ1B 2XICA 3CPLB 3QNXA 3QUKB 5MHSE 2DQHH 1U2HA 3HB3D 4OM1L 3WN5A 5C0RL 4Y5YA 1LK2B 4LLUA 4OLWH 1QRNE 3VMOA 1MWAL 3EDEA 5D1ZB 2VLKD 4L4VA 5J6GB 5EORL 4FQLH 5GGSA 1DBKH 1U3HC 3C09C 4OGYH 4QF1A 1T3FB 1P6FA 4AH2B 3C8DA 2DMKA 5DHYA 4P2QA 2P5WD 3BXNA 5HHNA 1ZVHA 3L9RA 1K4DA 1SJHA 1JGLL 1QNZL 3BPNC 5EZIL 2FJFA 4RAUB 5CIPA 5F9WB 1YNLH 3GMRB 5I1DA 2FATH 1BZ7A 3DUSA 4HULB 2JTDA 1AR1C 4MNQD 1DBAL 2ZJSH 1X5HA 1U3JA 3P9LB 1T2XA 1WEJH 1QEWA 2VRAA 1EZVY 1XIWD 2Y23A 1JNHB 3QUYA 5EN2B 3I6GB 5DUPL 1A7RH 3BGFB 1GSMA 1KPUB 3TF7C 4JDZB 3AXLB 1ZT7B 3WIHL 4OD3H 1L6XA 5TGBB 3LMJH 4PJBA 2IANB 1NCTA 2H1PL 5D6CB 3WNLA 4NM4H 3VH8A 5BV7B 3RDTD 2BNRA 4QLRA 1JP5A 4IOSD 2HT2C 3ROOA 4H0IA 1EO8L 2QV2A 3VXTB 2ATKA 1GH7A 1IVLA 3MCKB 2Z8VC 1P7QD 3O9WD 3FB5A 3JV0A 1KJVB 1Q9KA 4AG4H 5IBLC 4PR5B 3VD4A 3IKCA 5C0IA 2IBZY 3S35H 3FQRB 3RL2A 1MLCA 3IFNH 3VRIA 4KI5D 4WW1A 4XVSL 4ZOCA 5JOPE 3RPIA 1C5BH 2VYRE 2AABH 3ZT6A 2APWA 4YXHH 3B9EA 4I5BB 1XF4B 4I4WA 4OBSA 5C0CB 1JWSA 5C9JA 1JE6A 3STLB 4YDIH 2VH5H 1A3LH 5FEBA 3EJZD 3QNYB 3CU7A 4ZS6D 1CD9B 2ZP0T 1DBJL 4N5ED 3ZE0F 4HZAA 5FM8A 2Y07H 3UZEA 5BW7C 1PYWA 1MWAA 5D2NA 4M7ZC 1DQJB 5J6HA 4IRSA 4XNUL 1UVQA 5AYUH 5D9SA 4LK4A 4CW1A 4WFHD 1HKLL 4YPGA 1T2QL 2DQIH 1FPTH 2VLRA 3VI3E 3MA9L 3NIFE 3TT1L 2A6IB 4CDGC 4M43H 1HHKB 1G9NC 3IFLL 1F97A 4TRPH 2PF6A 2AK1H 5H8DA 4ETQB 5GGTL 5HYQB 2R56H 5EOQH 4HSQA 3VFRB 3QCVH 1S9YA 1HH6B 4C83A 4XMKH 2XWBB 2BJMH 5F44A 5C2BH 1J0JA 1FVCA 2BOCA 3MJ9H 4UQ3B 2XQBL 3S4SA 1D6EB 5D5MB 3C08L 2XZQH 2P5WA 4RBPK 1FYTE 4DGYL 2O5XH 5TE7H 3CZFB 3PWUB 1CD1A 5FA3B 5CP3H 3FRPA 4RZCB 1F4AA 4RGOL 2PO6B 3WIHA 1LO4L 2X9WA 3WNPA 3BP4A 3V5DA 2YXMA 1KIRA 4XPAH 4MNQA 4UOW0 4IRJD 1HXMB 3VGEA 3SY0A 4KMLB 4U6VH 5HHQA 1XIWA 4UINL 4GG6A 1QR4A 4F58H 1A6WH 3VXRD 4YLQT 4OZFA 2J5LB 1DN2A 3OXRB 1R3LA 3OKDB 3OAUL 3MRMB 3VWKC 3OR7B 1YQ2A 4XBEH 4L8CA 3Q5OA 4LDOB 2A9MH 1MNUL 1C7TA 3RFZC 1V3JA 1KBGL 3RDTA 3UEZA 3G6AB 1AHWB 3UYRH 1FFRA 4RRPG 2MJWA 2NXZD 4AZ8A 1AD0A 4HH9A 3U2SB 2CO6B 3SCMB 1P7QA 3O9WA 5HHMD 3HRPA 3BDYH 3RWIA 2EDOA 2QR0B 1INEL 1MFBH 3T4YA 5C8JB 3LHPH 1YEJL 4JAMA 2X4NA 1I8MB 5AG8A 3CFEB 4JFYA 4ZFFA 3C8HA 1NGXB 5DD1H 3QI9B 4O2CB 5EIQA 3EDFA 3HAEH 5DJ8A 2C3VA 2DI7A 2XZZA 3QDGA 2XWTB 4XX1E 3D0LA 4YGVA 2HTKD 1U8PA 4FZ8L 5JW4N 3GB7B 1IL1B 1MFDL 1A7PH 1FL5B 1OAKH 1OARH 2VXQL 2C1OA 3OKNB 3T0EB 1WWCA 3QH3A 1K5NB 5GGTA 4BK5A 3V7MA 3FB7B 2AXHA 3U9UA 1FRGL 5D6DA 3ZE2F 1W0WB 1MUJB 3VG9C 5CILL 3CFBB 4PBWD 2M2DA 1NUFA 5IWLC 2YBRA 6FABH 1R3IL 4BQBA 1CLYL 4Q58C 1CG9B 4ZYKB 3JTTB 5J57B 2CUHA 5FYLL 3VXNB 3NIGE 5ENWA 4U1SA 1T66C 5CZKA 1U58B 1ZS8B 5MEQA 1EFXA 4NNPH 4QXUL 1MJUL 2FB4L 1RURL 4MQXC 4NFBA 5HGDA 4BFBD 1OP9A 1CR9L 1I7RA 5L88L 4LSPL 4OIIL 3LPWA 5DI8B 2W9EH 4WUKL 3E6FB 2HJKA 2AQ1A 4NQED 3C60D 5FYJU 4XPTH 1GZQA 1KCKA 3QCUL 2YRLA 1GIGL 3DGGB 2P7TB 3MA7B 3ARFB 1ZWIA 3WXWL 4JM4H 4X5XA 4UB0L 5TQ2L 4FFVD 2NX5B 3RU8L 4LVOC 4QCIB 4JN2A 1BOYA 3VI4E 4G80B 2NY4B 4S0TD 2LVEA 5BRZB 4QEGA 3L7EB 3TNNA 3DO7B 4M03A 4NKDA 1P5VA 5CEZD 4OZ4B 5IVZA 2Z92B 3O8XB 4XPHL 3T0DA 5IEHA 1U6AL 1LHZA 1AQKH 4IOIB 3DVFA 2IQ9L 5LBSH 4ETYA 1JZ6A 2DS4A 4QOKD 4ORGB 3HR5B 1UH4A 4D9QE 1RZKC 2EYRB 4YBHA 4J4PD 4YDJB 4PGCA 5CEZL 3N1QC 5K9OB 3U36A 4CU7A 3GJEA 4BH8B 5J9PB 1A4JB 4BQ8A 5C09D 4OIAA 4HGKC 4HUMB 2VXTL 1TPXB 4JHZA 3L3DB 2HWZH 2DTMH 4EQ3A 5D7LE 1AXIB 5DRZA 4PJHB 3V5HA 4BKLA 2ITDB 1B4JH 4ZAKB 1WICA 2O26U 3OGCA 4XCFL 5JPMB 4KKAD 3WSQL 4GW5A 4Z0BH 4OV6F 3EYUH 2VDLH 5I73C 2O5YL 5FDWA 3AMLA 4XP6L 1VACA 1IGML 3Q6GH 5E2TL 1ETZB 2ZG1A 1J5OL 1VKXB 4IBLT 4WHTA 3ZMRA 1LK3L 2FYYA 3DOSA 1QBLH 5DJXB 5DK2A 4NC0B 4O5LH 1KCVL 2Y36L 3D87B 2AW2A 4KPHL 3R8BB 5KG9B 5D5MF 1QZ1A 4JFEA 4XNMB 1OTSC 3ARBD 3DARA 2V5MA 4JG0L 2HTLC 2DQJH 3LKQA 1FV1A 3PHSA 3DGCR 4Y4FD 4YHNA 3BPLB 1BJ8A 3MLTA 4O51A 1RSFA 1NFDB 1DQDL 1S9WA 4WW2C 6CGTA 1JNLH 1LVEA 2Z0BA 1R0AH 3LKSB 3QRGL 3QUMB 4PJ5E 4QXGH 4RBPH 5E1HB 5MEPB 5CCKL 3C6LA 3WL9B 3GMPB 2XNAB 3D48R 3B8YA 2FD6H 4NKMA 1OAZH 4L5FH 5DO2C 12E8H 3KDMA 3PWJA 3PWPE 2VERN 1W72H 5SWSB 4JFQA 2WBJB 3JWOL 5M7QA 3H9YA 3N0PB 3ZKXC 4OFDA 2Y06H 5DUML 4BELD 4YEEA 3ECBA 5E9DE 4PLOB 5CD3B 1XH3B 4HKJB 1CN4A 3X3GL 3MXWL 3QEQD 3PQYB 4X6FA 1BD2B 1WTLA 5T1LD 4APQB 2HMID 2NZ9D 3SO5A 1BM3L 5KS9B 1S7UA 4OZHE 4NJAH 4AJ0A 2LQRA 4NRXB 5ACZA 4X6DE 4JO2H 1BBJB 4Q9QL 4R4BB 2G2RA 5B4MC 1Q9OB 2A2QT 2Z8RA 1HSBB 3IDNB 4WIQA 5CJOL 4LLMA 2KBGA 1FAIL 1LE5A 1U8LA 3O81A 1J8KA 2GFBA 3RUGB 2V9TA 5DRNA 4YHMH 1LP9B 3MBEC 3V4UL 5FGCE 3KGRA 3HNVL 4J4PA 3FO1A 5CJQH 2R1YA 4ZPTA 5C0EB 3TIEA 4PJIB 4HS6A 4LSVL 2GIYA 4NO0B 5EU4A 2HAZA 4X80L 1JHKL 1G6RL 2VLJD 1XGYL 4HWUA 4OZGF 1VFAB 2X09A 1T7WA 4PREB 5EZOL 1NMCC 5F9WC 3QIUA 4EI5B 2FNBA 5JPNB 1U41A 2DWEB 5E8NA 4IIQC 4ZDHA 3U4BH 2EDQA 1XF5A 3W81A 2OTPA 1A4KB 1OCWH 1YNTA 4DVBB 4AM0A 5B38B 4LQFH 2ITCA 5D1XB 4CN6A 1DQTA 1J11A 1AGBB 3AMKA 3S37H 2V5TA 4Z7UA 5DC4B 2QADD 5DR5H 1FQ9C 1Z3GL 3EFDL 2HLFD 4ZODA 4C56B 2FLRT 1AIFA 3O2VL 5BV7C 5ANMA 2A83A 1OWRM 4JG1H 5SX4I 2PUQT 3I84A 2VDOH 2DQDL 5IT2H 1C08A 4FHBD 4CGTA 2RCSL 5GQBA 4L1DA 1IM9B 4KKBD 5BCAA 1G6VK 2VLMD 5F97E 3FT3A 1ZLSH 1SEBA 1IC5H 2WUCH 2PCPB 4XWGL 4CL7A 4RMQA 1HOCA 2DLGA 4PRPB 1G7HA 5T3ZE 1OSZB 1D5IL 3K1KC 5HYSA 2OQJB 3FO9B 1F3DJ 5D2LE 1M6OB 1FLRH 4JFDB 1JGUL 4I2XE 1KCUL 1M71A 3SDDB 1QSEA 5DSCA 3RWDB 1CFSA 5BQ7A 2CLVA 4NZRH 1ROWA 4L9DA 1UM5H 2EIEA 3MGOA 3GSRB 1I7UA 4AIZA 1T1XA 2ADIB 4OTXH 4Y7MA 4LRIC 4JM2C 1ZT4B 1AC6A 4ZUWA 3TN0B 3G9AB 2VDPH 1HSAB 4OT1L 1VFBB 3KYMA 4XNXH 1ZV5A 1RIUH 3TBSA 4X9IA 4UT6L 4HKXA 4RQQA 3QEQA 5ABDE 1DEEB 5T1LA 1YC8A 4HIXH 5DK3A 3T77A 4QRPB 1QFWM 3OHXB 4HJJL 1MCWM 1DFBH 1D9KA 3RAJH 4Y5YB 4I48B 5JW5B 2UWEB 4NZJA 1SM3H 3NCEB 3CX2A 4L4VB 5F89A 1G6RA 5TPWH 2L0DA 1CXEA 4PJHF 1D5ZB 3GEWB 5B8CC 5HHXL 5I1EH 1T20B 4HLJA 3VDCA 4N1EA 2D7NA 3IETA 3P73B 3OJDA 5DHYB 5FFLA 1Z9MA 3RZCD 1I3UA 2BXZA 3DSFL 2VIRA 1N6UA 1QLRA 1WIOA 1YEHL 3VXOA 3BQUB 1WBXB 3A67H 1SJHB 4H5SA 4HW6A 2CDGB 3F62A 2FJFB 2VLJA 1QKZH 5CIPB 1OAYL 2ORBH 1UC6A 3HC0A 3HC4H 1JZ3A 4Z6AT 3QFJE 3IDXL 5I1IH 4UV7L 4KZDL 3J7HA 2LV4A 1QEWB 4EUPA 5JUEH 5JXAH 4D3CL 4NWUH 1NFDF 1RMFL 5B38G 3PWVB 1RAMA 2D03H 3KPRD 1U8MA 4G6AD 5I8EA 2IH3B 3EHBD 3BSZL 3D39D 5ESVB 5JHDE 4S2SA 1DE4B 2A1WL 2BVUA 4W4OA 2H3NA 4Q6IB 2JCCA 4M7LL 5KSBA 3TNMA 4G6MH 3QIWA 2V6HA 4MMXC 5JR1H 3V6ZB 1ZA6B 2Q87A 3OTTA 2HFTA 2VABB 4YDKH 4MX7B 4R90H 3MTRA 2ATKB 5I74C 4UV4H 5F9DC 4I3SH 3I6KB 3GSUB 4Q7DA 3SCMC 3V4VH 1V7NH 3B3IA 4IRZH 3IKCB 5T1DL 5L9DH 5TQ0H 3BYYA 2CKBH 5JW4R 3ULSA 4CDHA 1YMHB 1WITA 4Z7NF 1HQ4B 2X4OB 4WW1B 3IJSA 1JCKA 4BM7A 5IJVB 1IZJA 1XF2A 4I4WB 3HCVB 5KS9F 1XCQA 5C9JB 5L2KB 5CGYD 5DF0A 3FFCD 1T0NB 1U2CA 2F58L 5DT1L 4MZ3A 5C0GB 1RJCA 3MRBA 3LS5H 4HEME 3QHFL 4MHHI 1NAMH 2AI0H 5J6HB 5FV1L 5B22A 3RUGF 4E0RA 1JF6A 1LP9F 4Y2OA 1YUHB 4LLQA 4CW1B 4FMKA 4C4KT 1AP2A 1VGKA 4KMTL 4YHKL 1A5FL 3RWEA 3QJHA 1Q0XL 4PJIF 3O3DA 2BVOA 4R3SA 4N0YH 4NFCA 2D4FA 1CXHA 4RIRA 3ZDZF 3MLVL 4KRPB 3TESA 2PTTA 1K8IB 1K9TA 3VFTB 3R8QA 4K3DL 2YMXH 2HKFH 5LJYH 2VLKB 1M7IB 3NZHH 1NGWA 1TJIL 3S6CA 3KNBA 4WI7A 2E7LC 1D3CA 1DL7H 1G7PA 2BHZA 3UROR 3I75B 3WFEH 4HFUH 4NYLA 1ORQA 4LP5A 3S4SB 5JHLL 3BGMA 2JJSC 3UTSB 1S9VB 2P5WB 4RFNB 4FN0A 3U6RA 3RZCA 3QEGH 4POZC 4OJFH 2YD9A 3GJFK 4XC1H 1TZGL 1B2WH 2Z35B 4EIZC 5FF6B 1LWRA 1FNFA 1IGCH 2CDEA 1OOAA 1LO0H 3QXAA 1JRHH 2YPLD 4MA8L 3TPUA 5EA0L 3QUZC 2FX8L 4M1DH 3P9MA 5LGHL 2CIIA 1B6DA 4JB9L 1JPFB 4HPYH 3EGSB 2C5DC 1OAUL 2R9HD 3BI9X 4KAQH 1J10A 4U1MA 4D9LL 2DQFA 4L9LB 4LDLB 4PJDE 1XEDA 2B4CC 3B2UD 5E5MB 2CH8A 3KPRA 1A14H 3CXDH 1FVDB 4G7VH 4HLZH 4LU5H 2UUDK 3D39A 2ZCLH 3C5ZD 1IBGL 3BISA 5MERB 1FJ1B 4Y89A 2EEBA 3O11B 4WUUE 3V0WH 4L8CB 1WTGT 5DURD 3PGFL 3D3VE 4HZLA 3O2WH 2JJVA 5T3ZH 3RDTB 4QXWA 2C7UB 3ZZ1A 4EI6B 2BHUA 4U7SA 1GOGA 5CHNB 4DW2L 1ORSB 5IEKA 2FR4A 3NH7L 1MHPH 5JA9A 1P1ZB 3K4AA 4N68A 5D7IF 5BO1L 4OFKA 1P7QB 2B0SH 3O9WB 4MWFA 4QO1A 3MOQA 1AGCA 2ICEA 1MJ7L 4UIKL 2Q7YA 2X1QA 3HN3A 4FQ1L 3T4YB 3RKDD 3TZVC 1I8IA 5F1NB 2CMRL 4FQIL 5I1LA 2E8ZA 2HVJA 4UOJA 3BHBB 1LO2H 1SMAA 1TPXC 5KAQG 5JQHC 1RJZA 4BSWA 4JO1H 5EC1B 1CL7H 2DMBA 3IVKA 4KVNH 4ZAKC 3CCHB 2BVYA 2F5AL 4JCMA 1NDMA 3FFCA 2UWEF 4K23H 4UDTB 1X4YA 7FABH 3BZEA 5IFAH 5EBWA 4LNVA 4MDIA 5GGRY 2AJXH 2P8LA 5T33H 4UUJA 5JIHA 3U9UB 2FJGB 3CSBA 1KEML 3GSQA 1QR1B 4PJGB 3BH9B 3S34H 4ZTPL 4R8WH 3L3GA 1JYVA 2L4OA 3G5ZB 4LCUB 4NN7B 3STBA 3O3UN 5E08H 2YBRB 4KROB 4X6CE 4R2GC 3RWFB 3BAEL 4L3ED 1L0XA 2Y6SD 5DXWA 1RJLB 3S4SG 5CJXC 3WXVL 5ENWB 3UC0L 2EDHA 3SE4C 1ZMYA 2VDKL 5SV4A 2C26A 3GHEH 4YR6A 3INUH 1I7RB 2LVCA 1BFVH 3JUZA 3SO3C 1MCNA 4XHQA 1SBBA 2XYCA 1KF9B 3UAJD 4D0BA 1TQCC 1TVHB 2F15A 4G8FB 1ZOXA 4JPWL 3L3OB 2BNRE 1U8OA 3KLAA 4KTEL 2RR3A 1F90L 2YPLA 2R2HA 4P3DA 1CF8H 3W5MA 1MH5B 2VQ1B 4B0MM 4CUCA 2Y9RT 2APFA 4Y19E 4CNIB 4J3WA 4PJ8C 3VFSB 4HFWB 4IRJB 5AG9A 2WINB 3MRJA 1RUQL 3ARGC 3WO4C 3KPNA 4F37K 4HUXB 3K46A 4S1RL 3VXRB 3HPLA 2CIKB 3TO4C 3C5ZA 3HZYA 5I75C 4H1LH 2FBJL 3TA3B 5IVZB 1LILA 1RU9L 4LHUD 4WFFE 2HFGL 5IEHB 5CEYA 4GQ9H 4PGBA 1U8JB 1I3GL 1UWGL 3QDJE 2GT9A 4JRYE 4YFLI 1XMWA 4ZQKB 3RNQA 1DLHA 2NXZB 4LLWA 1D5XA 2Q8AL 5D2NE 1JV5A 3QIBD 1QQDB 3AB0B 4Q9CA 4OF7A 4N0CD 5HHMB 1N7MH 2DLFL 3C2AL 3QDME 5FHBH 1H15B 1UZ8A 2ZSWA 1I9JH 4U3HA 1Q8MA 2VLRE 3H9HB 4E9LA 3NIDF 1QTYT 4H0GA 1L9NA 2GK2A 1W72B 3V5HB 5GGVL 2HRPH 2EE9A 4PV8B 4PV9A 5KTEH 3BMWA 5IK3A 3PGDA 4GSDH 4X0KB 4PS4L 3V5KB 1S7QA 4NHCL 2Y25A 3F6LA 4QYOA 4NDMB 1JHLH 5I6XB 4GUPA 1HH9A 4JFFE 2N1KA 4NOFA 2GSIB 1FBIH 4WO4A 2YD8A 3MRIA 4MNGB 1AGDB 1T1YB 1E6OL 4PUBL 3I50H 4WHTB 4JPVH 4FZEL 4U7MA 1IGFH 2DIAA 1BMGA 3O6FC 5K9JL 3DMMD 3SE8H 5CJBA 4H88H 4AEHL 4H0HB 4ZD3H 4HC1H 1FHGA 2EC9U 3CSPA 1JZ2A 1IAII 4S1SL 5C0ND 3J8F7 5DEFB 4IMLB 5IB4A 3L3IB 4XVJH 4Y0GA 1YPZB 3BVNA 3TWCH 2I60L 1KYOK 1S9XA 1FZMA 3AS3A 3OG6B 3NA9L 2FH6A 2EZ0D 3MLSL 3CSGA 3UJTL 1AJ7H 3UO1L 2R0LL 3C87A 3Q5YA 1BQSA 1OW0A 1JPTH 4MZ2A 1Q94B 1E6JH 5C1MB 1S9WB 4JKMA 4Y16D 4L3EA 3W9DA 2GTWA 1Y6KR 1GZPA 2NY5H 5F7HA 3B5TA 2DLIA 2Q6WB 4HS8H 2DLTA 5AZ2L 3IYLW 4GG6E 1DUYB 1U91A 4WEBL 4JHAL 1JPST 2HT3C 5IMOB 4PLKD 3NCYP 1YEKH 4NQDA 3GKZA 3F7VA 4EVNB 3T2OA 4JFQB 3ZKMC 5KBNC 1DN0A 2BP3A 1F58L 4NQEB 3C60B 1RQ5A 3R06A 5EOCJ 4K8RD 1I3RA 4TUKH 1NLBH 4O02L 4EOWL 4OZIA 1Z5LA 1C1EL 1NC4B 1L4IA 3WHE1 3WLWD 1CLZH 4MD0A 1WQVT 4JFZH 1MSPA 4HF5H 3SDAC 2UUDH 3VGBA 2HJLB 3TYGL 2VQTA 3SPVA 1EJOL 3OGOE 4XRCA 5HHOE 1X44A 4X6BB 2UZIL 4U1NA 4MB5A 2DRUA 4QTIH 1CK0H 3NCJL 4BZ1L 2IWGA 2JKXA 3VG0L 4BH7A 3LN4A 4X8XA 2NLJA 2C4FT 4Y5YC 1MLBA 2A0LC 3CH1B 3QDGE 3MRKA 3SGDI 2X44D 1NCBH 4K9EL 4WI3A 4KDWA 1DLFH 5IB1A 2Z31A 5DRNB 4BSVA 2EDFA 1I3VA 3MRFA 1HHJA 4QOKB 2WMPA 2VR9A 3I3EA 2XZAL 3QIBA 1CT8A 4HWBA 3MJ8B 4ZPTB 3PXJA 4RMWA 4HGWA 3O6LL 3VCLB 1GGCL 1CQKA 3E6HA 2NY2C 1KGCE 2VZOA 3OAYH 5C09B 2Y1VA 1J0ZA 1PY4A 3S9DB 4K7PH 4PD4K 4FFWC 4LARH 5EO9A 2GJ6D 3CFCL 2A6KB 1ZLVH 1NGQH 3GUTA 3MLXL 1N6QL 5KSAA 3P0VH 2GJZA 4XP9L 4ELMB 1QRKA 4ONOA 5MEND 3RVVD 2R2EB 1X6NA 2VO5A 1PKQA 4CBPA 2PYFA 3D9AH 3QUYC 3DMMA 1J7VR 4MJID 3T3PE 4LPXA 2O5ZH 3H0TA 3EYVA 3SBWA 3ARBB 3HHRB 1QSFE 1YDPA 2CK0H 2V7HA 1AIFB 3RX5A 1LDPL 5HDQL 3LPGA 5ANMB 4Y4FB 2B7DT 1N5AB 2QHRL 2HKHH 1GOFA 1CDIA 2LAAA 4L3CA 3MFFB 5GZND 2WNGA 1A21A 2LABA 2AP2A 3H3KA 1X4ZA 4PRHD 3QXDB 2AGJH 4RMTA 4X99B 5D7LB 2Q76A 1A6ZA 2J2ZA 3BRFA 2NXYD 2ZUSA 3FT3B 3VI3F 1J05B 3NN8B 3RA7L 2DN7A 4U3CA 3NIFF 1H9VA 4ZUTB 3RIAK 2EDEA 1KENL 1VFMA 3AC0A 1FFOA 4P4KA 1I75A 3F7YA 2MSPA 3STZB 3MRLB 3GFUA 3QULB 5EWIL 5DSCB 2BOBB 4EBQL 1EO7A 2VITA 3FHAA 5FO7B 2VN4A 4GFTB 2NQCA 5HI3C 2OSLB 3S7GA 3BE1H 2OBGA 4UT9L 4DZBA 3E0GA 2R69L 1TMCB 1QHPA 3HNSH 3NCYS 3U0PA 2BMKB 5D2NC 4Y2DD 1F45A 4K3HA 4IRSC 4NN6C 2V2WA 1I7ZA 4JHBA 3QEQB 1TETH 1XGPB 1KELH 1OD9A 4E42A 1E28A 5DJDB 5TF1H 2X4TA 1QSVA 1T5WB 5TE6H 2EDBA 3BIKB 3HB3C 2XRAH 1A7BA 1T89A 1K6QL 2ERJB 1T4KB 3PWPB 4XH2B 2V2TB 3AM8A 2AJYH 3C6SB 3HA0A 5IMMA 4KUCF 4KK5C 1JGLH 4XPFH 4JRWA 5CSGA 5IBTL 4HUVA 1KFAL 4QHNA 5D71L 2DM3A 4XMPL 5E94A 1OGTB 5FYLE 3ARDB 3X12A 3FJTA 4JFEE 3FT4A 3KLHC 4POYA 1MOEA 2AJSL 5ALCH 3SKMB 4H5SB 1JL8A 3BOVA 2FH8A 2CKBB 1B0RB 2VLJB 2Z8SA 1C16B 1VENA 3GSVA 1YECL 3C8KB 5ECJE 1YPZF 4J6RL 3VXQA 3M8OL 4QHKI 5M94B 4D0CB 5GZOD 2FX9H 1JWUA 3IAGC 4RFOH 1KLGA 4P5TD 1VHPA 4BZYA 4PPTA 3RRQA 3RL1A 3VGAB 1WWWX 4PY8J 1RUKL 5MENA 1RHHB 3QQ4A 1XIWC 2YUXA 5AAMA 3U4EA 1KTKE 4YHZH 3U7AA 1NAMB 3IU3A 4LPCA 3T4AA 4F7MB 5GRYA 1RIHH 4S2SB 4MJIA 3CFIC 3IB4A 1K3ZA 4IDLA 2QADB 4X8JA 4E41E 4XB7A 4OZFH 4YEFA 2OR9L 5LWYH 1ACZA 4ZG1A 2JCCB 4LCYB 5IFHH 3VXUE 1JF1A 3EZ8A 1KJMB 4NO2B 1TNNA 2W9DH 4PTTA 1VDGA 1ZHKA 4GS7B 3RDTC 4LCIH 1G1YA 3FQXB 5AZEL 1UG9A 3ULVL 2YD3A 1CTNA 2WSKA 1PQZB 1JGVH 4WU5A 2CJUH 1AH1A 5HSFA 3MX0A 4XVSH 5C0JA 3TYFA 3GSNH 3B3IB 1BVKA 4U6HA 3O9WC 1XGQB 1R3KA 5GHWL 4J8RA 5IMKA 4U0RB 5HYSG 1T21B 2R4SL 3AREB 1SQ2N 1ZSDB 4XI5D 1QFWL 5IMLA 1EMTL 4XXCA 2X7LA 3LKPB 2EKSA 3V52L 4HUKB 4KI5C 5DJCA 3UTPE 3MV01 5F7DB 3NIGF 1MCHA 1YY9C 1MY7A 4M48L 3IDGB 3T8XA 3T65A 1Q72H 3EW3B 3FN0L 5IGXL 3MLZL 1HKLH 2P24A 5HPOA 1ULVA 4J3XA 4OI8A 4K94H 1EVTC 5GPRA 3O4LE 2OR7A 2ADFH 3GO1H 3M45A 4N5EC 4X4YA 4MA1C 4YAQB 2IH1B 1DQQA 4LLQB 4JFHD 4Y2DA 2YPKA 2WWKT 1JK8A 3P0YH 1A02N 1CGWA 1EGJL 5D6DC 4MSWA 2H2SD 4XNZB 1AKJA 2QQLL 5FYKD 1LD9B 5EU6A 3NA4A 1FAKT 4DN4L 2ICES 3W0WD 2BRRL 1KCSL 4C4KO 1UM6L 3MV7E 2OJZH 2Y5TB 2E27H 1QBMH 3VI4F 5CP7B 2O61B 2CRZA 3LVEA 4FTVD 2BFVL 5KJRH 4O58L 1XR8A 1SY6L 4RWHA 4I2XB 1PGRB 4YHOL 1ORQB 4HJ0C 5FYKL 1KCRH 4ELMF 3OL2A 4KJYA 4PTUB 5I8KL 1W8OA 1AO7D 3WIIL 3PNWB 3BH8B 2ESVD 3QO1A 2P8PA 4LCWD 1GPOH 1PFCA 5FCUL 5M95B 1IGIH 4QRTA 3MRGA 4WHCA 3TEUA 4KHTL 3U1SH 5E8DH 4EUPG 4GW1A 5D72L 3N1FC 2BDNH 1KTLA 2EC8A 2NNAB 4X7FC 5KVGH 4HKZB 5IF0B 5IVXE 4N0UB 1YYLL 4IRJC 5I18H 4JZJA 1UXWB 4GXUM 3S88L 3K7UA 3ARPA 4RCAA 4PJ9A 1A6TB 2VC2L 1FLTX 4TPRL 1IC7L 4WU7A 3ARUA 4Z7VB 1QSEE 2VDML 5K33A 3GNML 2B5IC 3HFML 1T22A 5ALBH 3FQWA 3H42H 3NZ8A 3VFPA 3Q1SL 1KSRA 3BD5A 5SWZD 5CINL 5IIEB 3K8KA 4KKNA 3V8OA 2NXZC 4ACPA 2ZG3A 2J8OA 1UGNA 2UY6A 1J12A 4MWFB 3AB0C 4ZUUA 1HN1A 4KKLD 1FH5L 3Q3GA 3CNKA 1AGFA 3D18B 1I8IB 3HPJB 4Z7OE 4J3VA 4PGEA 3DJ9A 4LKCA 4PRBB 1CLCA 3VXMD 4LSUH 1WBYB 5IB3A 4UIMB 3PP3H 4ODTL 1KJ2L 3HZVB 4MQ7A 4XC3L 2VXQH 1BF8A 3DI3B 3ZT7A 1EGJA 2IC2A 1RZ7H 4PRAA 4YGAB 1KIUA 2YUZA 1T04A 3FFCB 4NZDA 3TGXA 5I6XC 4KJWC 1Y18A 3L3KB 5I1HH 3EYFA 3RBSA 3IJHA 1EO5A 1F4XH 2AJ3A 4DK6A 2HTKC 2VDQH 1BPVA 4MDIB 1JWMA 3U7YH 4PP2A 2YR3A 3DVNA 4KI1A 2X4RA 4KJQD 1WC7B 2Q1EA 3CMOL 4LNRA 1DVFB 4PB0L 1SY6A 4RISL 4XP1L 5KVEL 4HS3B 2IPTH 4H8WL 2BC4B 1G7LA 4OD2A 1ZHNA 1DJSA 5H2BA 1N4XH 4NRYB 3DHJA 4H1LB 5C08D 5GRJL 4QXUH 2VXUL 1M7XA 1U8HA 1OGAE 4JREB 3QPXL 1NL0H 4FTVA 5F9AC 5DS8B 2B39A 3AUVA 2V2XB 2E5EA 4OLXL 1YEIL 3ZDXE 1LO5B 1IAIM 1KIQA 3C6LC 3IRPX 4D2NA 1F3JA 2ICWB 3QZWB 2MMXA 3ARZA 4NQSA 4YR6B 3F7RA 1EX0A 4Z95L 2OL3L 3QEUB 4MB3A 4RGNE 5EPMB 2HJFA 5KSBE 3BUTA 3WXWH 5KZCB 3VRJA 3PV6B 4TNWF 2J8UA 5HPMB 2R0ZL 2YPLB 2R2HB 2W60A 3LEXA 4PJ7E 2YHGA 3H3PL 5L6YH 3RNKA 1QFUL 3ARYA 1I8LA 5JLZA 2RAMA 2DQTL 4K2UL 4NJ9L 3O41A 5D93C 1KN2L 3IXTB 5DZLA 4G7YH 5DFVD 4G8GD 3DSNA 2JB6A 1IT9H 2DIBA 3L7FA 3PIQA 4M7KH 4LSSL 5JO5B 3HPLB 5J3HD 3NAAL 3UYPA 3U9PH 1YQVL 3C5ZB 1GHFH 3P4NA 3P4OB 2RGSA 5DURB 3CFDB 15C8L 2IEPA 1N3NA 2JLLA 2QSCL 5GS1B 5I66A 3WJLA 3DXAD 1A1OA 3RNQB 3VXPB 4PB9L 5SWZA 4JKPH 2FIKA 4NO3A 1GGIL 1KJ2A 5T5FL 4Z18A 1KYOJ 1MFNA 3OB0H 5F3BA 2I9LB 1IM3A 2DAVA 1HWHB 4J4PC 5BZDA 4P59L 3JZ7A 4U1LB 4Y4HD 1Y6NR 1KPVA 1UZ8B 1O5DT 2PYED 1F6AA 5E6YA 3O3EB 1Q38A 2X10A 5T1MB 3LS4L 4N8CH 3U7WL 3CDYA 4NQVA 5FGSA 3KR3H 4ONFH 4PV9B 3IJYA 4LLVB 3DUUA 2IAMA 2I9TB 2AEQL 1LK3H 3QIUC 4GRMB 2GHWB 5FUCC 3H9SA 4KKAC 4R7DB 4WUUB 5DVKA 3FCTA 4ZOEA 5C0DA 1KB5H 2VAJA 3RGVD 4P23D 5JW4Q 1TCMA 1N5YL 5TDOB 4LKXB 4P2RA 1HDMB 4GW4B 4WCYL 4J3UA 3G6DH 5D2LF 4OGZA 3OZ9L 3LKOA 4HG4K 1VB9A 2MHAA 5ILTH 1K4CA 3MRHA 4H1LG 3ZHKA 5DQJA 5HDBE 1FZMB 3ARBC 1N0XL 5FIEA 3OKEA 3SN6N 3T0BA 1RIVH 1R24A 2VDNH 5DJYA 5DD5L 5GRVL 4Y4FC 1ZHBB 2NYYD 2OL3A 1IQWL 3S3SA 1IEAA 3MV9D 2F53E 5KVDH 3QDAA 5EUOA 3FO0L 3ZTJG 2COQA 1G9ML 1PY9A 3JWOC 3QZWG 4M6ML 1HKFA 1UA6L 4TSCH 5IKCA 3HZMA 5FGRA 4LVNC 4MXWL 1FZJA 5E24E 2ZPKH 2NW3B 4JFXA 4X6EA 1OSPL 4HUWB 1BJ1H 2WIIA 1DN0B 2VXSH 1CDCA 3P40A 3O3BA 1OPGL 1CICD 3PWLB 5IM7B 1HCFX 3KPOA 1OP5H 2XA3A 3G6JE 3UBXB 4Z7VF 4OZIB 1Z5LB 4QNPF 5AUMA 2YZ1A 3A6CL 1U9KA 3BZDA 4GAGH 4EN3A 1BBDL 2FL5B 3GM0A 2VR4A 4G6JH 4X6CB 5DJAA 3RBGA 4JRXD 4XGZA 4G8GA 3PP4L 4PD4J 1MCOH 5INCB 4PLNC 3PHQA 3WS3A 3DX8A 1P5UA 2NW2B 4NUGH 1FAIH 2HMIC 3V79C 4M61A 5FUOL 5I1CH 2NZ9C 1LQSR 4BH7B 2F54D 1D9KC 2W0LA 1C5CH 1MLBB 4LHUB 4OB5H 4DKEL 1Z0NA 1RJYA 3MRKB 1TTFA 1UWEH 3DX6B 4K55A 1A6UH 4HHAA 2QBWA 3OV6A 4Z7WE 4OF5A 4MVBD 2IG2H 5IB1B 3JV6A 3NPZB 4LF3A 4JPKH 3C5SA 2NZIA 4M1CD 1CT8B 4WJ5A 1A7QL 1AQDB 2RQ8A 1HIML 4Y19B 5ID1A 1EDQA 4TOYL 4Y4HA 4A2LA 2D0FA 3BP5A 3E6HB 1XGTA 3MGTA 3VWKA 2VAAA 4U3XA 1ACYL 3MODH 2WM0A 1NCAL 5CS7A 2ZOLB 2BSTA 2FZ3A 3VGGA 3LN5B 1Z9OA 1EAJA 2HVKA 2GTZB 1I8KA 1D6VL 2EIZA 3GGWA 1DQLL 2DICA 3QPQD 4KJPD 4XP4H 5DTFA 3RGVA 4P23A 3CDCA 2I07B 3VGAC 3WKML 1T03H 5L0QB 3V0AC 5GSVA 1BVLB 1CXKA 3ROLB 3DMMB 3MREB 2DYPA 3QDJB 3O2VH 5C07A 1TIUA 2EH7L 1OM3L 1PSKL 1D5BB 1FZKB 1G0DA 2I5YH 1JI1A 1YEEL 3Q48A 1TXKA 2GSGA 3F58L 3FO2B 3QG6A 5C0AE 2Q86A 4YQXL 4W4OC 3MRDA 2HLFC 4JQVC 2CDFB 3QDMB 1T0MB 3QIWC 4L4JA 4JN1L 4GS7C 4U1JA 4L29A 5JOEA 5IUSA 4Y16B 2EDLA 4HJGA 3MV9A 3O2DL 5JXEA 4FQ2H 5DMGC 4BFIB 3O6MH 5FA4A 1U8NA 1A6ZB 3CUPB 5L7XL 4BFEA 2SEBA 1ZANL 3KXFD 5F88A 2J4WL 4XCEA 4KKBC 3UTQA 1KACB 1XZ0A 4U0RC 4I1NB 4MAYD 1SJXA 5IQ7H 1FFOB 2F5BH 1UJ3A 3TVMA 3U82B 4ENED 1U95A 4F57L 1CICA 1FO0H 2A6DA 4DAGH 2ARJQ 2RHEA 3GRWH 5F1SA 4GKZB 4B53A 4UDUB 4L8DB 3MCLL 2R8SH 1A7NH 5GJSL 4L8SB 2GY5A 1M05A 3T1FA 3TT3L 4XHJD 4D8PA 1H8NA 4JRXA 3WEXA 1UACL 1WBZA 2AS5M 3ORJA 5JOFB 3D85B 3QO0A 4O9HH 3CX5K 1E28B 2CGRL 4LHUG 4XNZC 1HHIB 1AR2A 2M8XA 4UT7H 3MLRL 1FNLA 2UZXB 43CAB 4OLVH 5ICYB 2HH0H 4YE4H 4S1QH 2F54A 4LLAA 2CR3A 4ONGL 1WZMA 2WUBL 4OCRH 1CFQB 3MRCA 1MCFA 4DN3H 2IBBA 2VE6B 3N9GH 1G7IA 3BD3A 1ZEAL 1CE6A 4J12A 4XNYL 2VWEE 5DD6A 3SGKA 1MJ8H 5A3ID 2JJUA 4HT1H 1KJ3L 5DWUH 1YMMD 3OKMA 1OAYH 3FT4B 2AEPH 3RZCC 1KIPA 3KHQA 3DV6A 5D7JD 3TH4T 5DVNA 4F15B 2B2XL 4UAOB 5I2IA 5ITBH 4U2ZA 1KTDA 4P9HL 4WFGE 3JWDL 3T3ME 1TTUA 3FT2A 4OI9A 4OBRA 2I24N 1RMFH 1Q1JH 2GJ6B 3FAWA 5CMAB 3RVWC 3RWJB 4F7EA 4U1IA 1JWUB 3FN9A 1H3PL 1S5IL 4LGRB 3HZKB 3LQZA 3DUHA 5ITFA 1UQSB 3QUXD 4URTB 4G9FA 4PJCB 5MENB 4LLDB 4Q97A 4ZTOL 4NN5B 1MFEH 5GS0D 3IU3B 1FG2A 3LEYL 4NQDE 5E1AB 3EHBC 2DD8H 3O2DA 3OX8A 3CVIL 4XXDA 1IGJB 1MJJB 2GUOA 1RZGA 4HIJA 4D0DA 3GHBH 4K71C 2XT1B 1BQHA 1JF1B 4Q6YA 3WD5L 1ZHKB 3EFFA 4I77L 2CUIA 2P8MA 1YA5A 5IHUL 4LIQL 3UZVB 3UX9B 5BS0D 4K3EL 1QVOA 4PRHB 4N90D 3CC5A 1G9EA 1H5BA 4LSQL 4NT6B 3C5JB 4KK9D 4DKDC 5EULV 2NXYB 5IMKB 1JPGB 2Q3ZA 4YBQD 3KXFA 3OKKB 5TH2A 1HHGB 4OUOA 4X6CF 4MAYA 4OSUL 1CXIA 3BW9B 1RZFH 2EKSB 4WENB 4QRRE 1A8JH 4R96A 3BZFB 2GYSA 3PF2A 5ISZD 4JZOA 3IF1B 4LBEB 4RFEB 4RDQG 3CVHA 4Y5XA 1DQML 2QKIA 5EZJA 2JIXB 4QY8A 1F11B 2W0FB 4PYHA 4WWID 4G6KH 4GMSH 3E2HC 3QG7H 5EOTA 5FHAH 1QSFB 1Z2KA 2ZOKA 4DKFH 4JY5L 1WIUA 4Q0XL 5E00A 1A6VH 1TJGL 3LSOA 3MV8E 1EK3A 1U8QB 1Z9LA 1Q0YH 4Y2DB 3JTSA 1OAQH 4K3DH 3L1OH 3W9EB 4Z77B 5AEAA 1ZA3B 1SYSA 1TJIH 3MLWL 5FKAB 3MXVL 1MRDH 4LCCB 2DOCA 1KB9K 4ALAL 5C0FA 3NABL 3L5WA 4UNTA 5K9KB 3AAZA 5C0CD 4R26H 1ZVSA 1OTUD 2QSQA 4NM8H 3NFSL 5IV2B 1CWVA 2KKQA 3GSOA 4W70A 1IC1A 1RZJL 3BP6A 4MLSA 3GSWB 4HK0A 4RX4D 3T0AA 2VL5A 3IDYB 1HE7A 4FP8H 1RUPL 5SWQA 3MJ7A 1H0DB 5LGHH 2VMFA 3IU4L 3SJVD 1YMMA 3H3BC 5CGTA 2P48B 3DX7B 4G43A 4OGXL 4NZTL 4AEIH 3CPLA 3QUKA 1OAUH 5HYJE 4M1GH 1REIA 4N1CA 1JRHI 3MRGB 1LK2A 4QRTB 4KK8D 2H2PD 4PIRF 5D1ZA 4QGTA 4LSRH 1FDLH 1UYWL 3D2UB 5J6GA 1J1OL 3CXHK 4P5TB 1T3FA 4AH2A 2R9HC 3DROB 5HI5D 3K74B 4OGAD 3BX7C 2NR6D 1DANT 3HG1D 1BAFH 3B2UC 2OZ4H 3RI5F 3VXSE 4WU7B 3C5ZC 1QHOA 3SE9H 4RAUA 3SDXB 4K3JH 4P4RA 3S96B 2DBLH 1IE5A 2PO6D 3GMRA 5BO1H 1MF2H 5C71A 1MEXH 4KY1H 1F4WH 3VE0B 3B9KD 5E2UL 4OCWH 1RHFA 1DP0A 3VW3L 3P9LA 1XF1A 2CMRH 3BESR 1CD8A 1UKTA 1R5VB 1TQBB 2MQ0A 4RDQF 5J11C 4WTXA 2D4DA 4EDXB 1L7IL 1INDH 4TSBH 1JNHA 3I6GA 3Q3GB 5D7KD 3R1GL 1KPUA 3QFDB 4JDZA 3AXLA 1ZT7A 5TGBA 5EBGA 5AWNH 2A73A 3RKDC 3B9VA 2IANA 2GK0A 4JQXA 2W07A 4LAQH 2LU7A 3HNTL 2VDRH 3WFBL 5D6CA 4G8IA 4YZFF 1HYSD 1MCQA 4B41A 2Y7QB 3WDHA 1CL7I 5HXMA 1A1NB 2OJEA 4DOHE 1P6AB 5D70H 2NY7L 3WUZA 2FWOA 1Y18B 1YJDL 4WO4C 1AI1H 2YWYA 4E41B 4MQSB 3IJHB 3VXTA 3F12B 2AJ3B 3MCKA 5HD8D 2A74B 3EO9L 4PP2B 2CRMA 2F9BT 2Q8BL 3DVNB 1KJVA 3MOBH 4PR5A 4RSVA 5JA8B 5DQ9B 2VWEC 2X4QB 3FQRA 1IC4H 1UM4H 5F7KC 2RFXB 5MP6H 1KEGH 5E2WL 4MCYB 3W0WB 1FIGH 3N1MC 1DR9A 2EYSB 2X6MA 5C0CA 3STLA 1OW0C 4U1HB 2J3SA 4FTVB 1GOHA 3FOMB 3QNYA 4ZXBB 4JO3H 3UJIL 4RX4A 1MCPL 4MD4B 4JPWH 3GI9H 1KIQB 2OMBA 1DTUA 3WNMA 1F90H 4BZ2L 2P49B 5GSRB 3ES6B 3S36H 2A77L 3LD8C 1AO7B 3R0MA 2ESVB 2FGWL 3O4LB 4OUUB 5GGSY 4LCWB 3UAJC 3PE9A 1EEZA 2A6IA 1IKFL 4ETQA 2EDJA 3SKJL 3VFRA 2XWBA 3SDCD 4PLJC 5IESL 1HQRA 1KB5B 4UQ3A 3GK8L 3MV7B 1KCLA 4PJAB 4NUJB 2MKLC 1D6EA 4JE4B 5D5MA 3TM6A 2BCKB 1EUTA 1AY1L 1GC1H 1SEQL 1IQDB 3HG1A 3IXAB 5LGKA 3OKOB 3NFPA 4F7PB 3TJEL 2OXGA 4WFEE 5H37G 4PRID 1FNAA 3PWUA 2OYPA 5ESQA 4RMRA 3BT2L 2Q8AH 5FA3A 4WGWB 1ED3B 4NZUL 4RZCA 5F3HB 1GRWA 4AK1A 2PO6A 1P4BL 5ADOL 3WS6A 4XTRD 2R29L 3C2AH 1A1OB 1PVHA 5SWZB 4JHWL 3B9KA 5C92A 4UNUA 3T3PF 2NX5D 1HXMA 2WV3A 3ULUE 2ED9A 3A6OA 5C6TL 1IM3B 2ICWI 3RTQD 2PTUA 3QIBC 3VWJB 1RVFL 5DFWH 4PY8I 3V6OA 4HWBH 3KJ6H 4N0CC 4XPGL 5EU6E 4I0CC 3OXRA 2ZUXA 3MRMA 3OR7A 5DJ2A 5IVXB 4MA3B 3VXMB 3O8XD 3IJYB 2KQMA 3D5OF 3PJSB 1CLOL 5E99L 5F7FA 1B4RA 3KJ4B 3MUJA 3ZL4H 3G6AA 1AHWA 2NY3B 5KW9H 2AK4D 1YN6B 5BZWB 1M7DA 1VGEL 1NBVL 4XP5L 1IJ9A 2QSTA 5DC9B 5KSAC 4OCNC 1IAIL 4YK4C 3X3FH 4GRLB 1SJEB 4ZMAT 5D7SL 4Y1AD 3DMMC 3VD5A 2QR0A 3EIFA 5C8JA 5CGMA 1AXSB 1X6LA 1UCBL 3ZE1E 2R39A 5ADPL 3CFEA 5JQ6H 5AYQA 1RUAH 3SBWC 2CUMA 3G5YB 5SX5K 3OKEB 5FYJE 1NGXA 3SQBA 1ND0A 4TNVK 5C08B 2EZ0C 3QI9A 5I8CB 4H26B 4FFYH 4RAVB 5E7FA 4TVPE 5E2VL 2OL3B 4XVTH 1CGSH 2YKLH 3BUYB 4KTDH 2XWTA 3NPSC 5LCVL 3UTTE 4GXVH 4YJZL 1SVZA 3GB7A 3V7AG 1IL1A 3ULVE 1FL5A 1NUNB 3OKNA 1F58H 3T0EA 5IKCB 1HEZA 1K5NA 3WFDH 1QLEH 4O4YL 3FB7A 4OZGA 4LLYB 1EHLH 4TYUA 1VERA 1ZT1B 2Z93B 4X6EB 3RQ3A 2PW1B 1MIEL 4P4KC 1MUJA 4BSJA 3KYKL 5A2JH 1XT5A 2HT4D 4GAJL 1GGBL 3O3BB 3WMSA 3VRLF 1TCRB 3CFBA 5GGQL 3DTXB 2C1PB 3SKUD 1NBYB 5F96H 3SDXF 4HCRH 2OMNA 4K8RC 4ZYKA 3JTTA 3WLWC 3TV3H 4L4TD 1S3KH 4LRNL 3VXNA 5CAYB 4Q9RL 1NGPH 1VEOA 1ZS8A 1XGUB 1JI2A 4FABH 1OGAB 4F33B 4K9EC 3KYAA 1A3QA 4NQCD 3PHQB 4F7CA 4WV1B 2OX5A 3DX8B 2F8VA 1KT2B 5KSUA 2ZCHH 3LZFH 1KN4L 5SWSD 3BN3B 3MNWB 5BMFH 5DI8A 5IROA 3ARRA 1F6FB 1CI5A 2WBJD 3E6FA 4CVXB 4P2OD 3QUML 2XN9E 1ZHLB 3IFOB 3DXAB 1T89C 2P7TA 3MA7A 4M02A 4RGNB 2AQ2A 3IDJB 3ARFA 1W2KT 1WT5A 3K2UH 4K3GA 5EZLB 4MDJB 2V17L 1FN4A 2IFFL 2XV6B 3L5XL 2NX5A 1MCBA 4QCIA 2K9UA 4WJ5B 3LDBC 4G80A 2D7TH 3WDJA 3LN9A 3U0WH 3PQYD 3ZLQC 1BD2D 1EBPA 4APQD 3KYNA 5ID1B 4J3TA 5BRZA 2YOCA 4CAGA 4B50A 3I2CH 2NY6B 2PYEB 3IKKA 2BNUA 4KK6D 1I1FB 3MLYL 1XF3B 2FZ3B 4OZ4A 3GMLB 5BVJB 2Z92A 1SBSL 3O8XA 5TFSH 5EBMB 2ZCKL 4YHLH 1I8KB 3UBXI 1CZ8L 5HHPA 4IOIA 1P84K 1FO0B 4HIIB 3OKLB 5E6ID 3QSKB 4LPTA 1QFHA 4GQPH 5GJTL 4P23B 4JO4L 4HXAH 1EA9C 2EYRA 5B3JE 3HC3L 1YC7A 2XY1A 3RVVC 4J3SA 4MXQD 2OTUB 3EYQC 4DQOH 1OAXL 5K9OA 1CDUA 2WLZA 4BH8A 5J9PA 1A4JA 1A47A 3WKNA 1KOAA 1DSFL 5I1GH 1E4XI 2J8UE 2JF1A 3W39B 5F7MC 2GSGB 2XI9A 1TFHA 3L3DA 5I15L 4JQIH 4PJHA 4ZAKA 4AL8H 1MCEA 1BIHA 4DVRH 5JPMA 3VFOB 4WY7L 5GGRA 8CGTA 4U1JB 4LVHB 3D1MC 4ODHL 4HJGB 4TSAH 1DBBH 3MV9B 3SKOA 5JNYB 3SDYL 1J1PL 1ETZA 3CX5J 3A0OA 4IJ3B 1VKXA 3NACL 5IOPB 2K7QA 1MCCA 1PD6A 5DJXA 5ESAA 3RWGB 4BQCA 1IAOB 1XZ0B 3NTCL 1DDHB 4I3GA 4PJAF 3NCBB 2X05A 3LIZL 1UJ3B 4XXCC 4DGVL 1U95B 4XNMA 4HDIB 3ARVA 2X4UB 2LU4A 4N9GB 1V3MA 4HKBA 4TTGA 3M17B 2QJDA 2AV7A 1NFDA 5EUKB 1NPUA 2P46B 1AFVH 2P45B 3LKSA 3QUMA 1IM9D 3GSXB 5MEPA 1N59B 1U3HD 1T6WA 2E7BA 3NFNB 2XNAA 4LHJB 4WHYH 1K3IA 2DQHL 3M07A 1TVDA 3REWB 2XQYG 1EPFA 3E3QC 4JRXB 4ZNEA 4P49A 2F53B 2K1MA 4PRPD 4Y2DC 1HZHH 1RZIB 3ULUH 4OLWL 3QO0B 3DBXB 5A2FA 5SWSA 3NOIA 5JW3H 2HA1A 4FQLL 2WBJA 3SGEH 1DBKL 4W6YB 3H9SE 4UNVA 4OGYL 2D31B 5IVXF 4XCNA 1TZHB 1X4XA 4BFGA 3NGBC 1C12B 2PR4H 3TPKA 4P2RE 2F8OA 4Y5VA 2KDGA 4D9RD 4F2MB 4W6XB 4JR9H 5CD3A 1CE6B 1XH3A 3TN0D 4HKJA 1ZLWH 1YYMH 5DJ0B 3OKMB 3TBVB 3PQYA 1ZGLP 1BD2A 4LSTH 4UILH 4APQA 1YNLL 3OB8A 5I2IB 1E0OB 1KTDB 4QRPD 3UPRB 5KS9A 2AEIT 5GGUB 2FATL 3FT2B 1EFQA 2YSSB 3JV5A 2PXYD 3SE3A 3T1WA 2ZJSL 4PP1C 1BBJA 4R4BA 1X7QB 1WEJL 3SGDH 1Q9OA 1HSBA 3IDNA 5D1QB 1P2CB 5F6IC 5GZOC 5FYJH 1VFUA 3P9WB 1A7RL 3RUGA 3V9FA 1LP9A 1NC2D 4CMHC 4Z7OF 1LEKB 2XTJE 4OD3L 4TVPH 5LXGH 3LMJL 32C2B 4H20H 4JZJC 4PJIA 4Z7WB 3ULVC 4QGYA 4X7TB 3MUZ1 4NO0A 4NM4L 1MVUB 5C2UB 4PJ9C 4QHMA 4XXDB 1HHHB 2AEWA 1I1YB 3BFOA 4HIJB 1RI8A 1VFAA 1WWAX 3FOLB 1BQHB 4PREA 3QXWA 3U83A 4EI5A 5IB5B 1XR9A 5JPNA 5GHWH 2DWEA 4XAKE 5FO9B 2XQYK 1TJHH 5HTSA 4AG4L 3WE6B 3S35L 3DIFB 4JVUA 3IFNL 1KB9J 2HG5B 1A4KA 4DVBA 3KXFB 3KPSE 4WI2A 1FFNA 5B38A 2XA8H 5D1XA 5J8OA 1AGBA 1MQKH 4MAYB 1T2JA 1MPAH 4KVCL 4YDIL 2VH5L 1HXYB 4C56A 2FCBA 1QG3A 2H6PA 4LFHD 3ZDXF 2DQGH 1QA9B 2Y07L 4G5ZH 1HWGB 1WAAE 5IBUG 5C0AB 1NAKH 5AYUL 4FQCH 4HQQH 3QXVA 2WP3T 1WZKA 4ODSH 1IM9A 1OB1B 1OQOA 1CFNB 2DQIL 2IFGA 2X70A 1FPTL 3JTSB 3LH2H 4PJ7F 4PRPA 1OSZA 4NKOB 3RHWF 5HVHB 2X1XR 4TRPL 3FO9A 3CXHJ 2H2SC 4ZOAA 5C0FB 2AK1L 1YEFH 3L5WB 2R56L 1M6OA 5EOQL 5GRVK 4JFDA 3AAZB 3QCVL 1W8NA 3ILPB 5L2KD 5TDPB 2BJML 3SDDA 5C2BL 3MJ9L 5D7IA 3GSRA 2XZQL 4QRSB 2ADIA 1F2QA 4UMGA 4ZFZB 3I6LE 2O5XL 5TE7L 5C07E 3TN0A 5SWQB 1HSAA 1II4E 3PDGA 1VFBA 1YMMB 4YXLL 3BZ4B 4G43B 5D7JB 1DEEA 1JVKA 4OF0A 3TJHC 2BVPB 2WQ8A 4QRPA 5J12B 3OHXA 4KRPD 4I48A 3GBLA 1JPSH 5JW5A 1YYLH 4XPAL 1J8HD 2UWEA 1PKOA 3CD4A 4LASH 2XXCB 4KZEH 4U6VL 4GKOA 1I8LC 1D5ZA 1DBMH 3X14A 1UFUA 1T83A 1T7VA 4ZO9A 4F58L 1A6WL 1CYGA 3QUXB 1T20A 1NC2A 3P73A 3UTSD 3MRQB 4MJ6B 3PUCA 1MI5E 4DTGH 4XBEL 4HXBH 1QUNA 2A9ML 3BQUA 1BQHG 1WBXA 5CINH 1BWMA 2E6PA 2CDGA 3MZGB 3MACH 1RFDH 4P4RB 4JKWA 2YPVH 1A7OH 2H26B 4YC2C 3WHE0 5FECA 3WJLC 3KPMB 3ZYOA 5F7NC 5MHSD 4AEFA 3BDYL 2VJXA 5BS0B 4XMLH 4HX1B 1QRND 1MFBL 3LHPL 3PWVA 5HDBF 4XBGA 4MA7H 2G5BB 2IH3A 5J1TC 5ESVA 4WTZA 4G42B 4KKLC 5KVFH 4YBLC 1CQYA 2A73B 5DD1L 2XG5A 3IFPB 1UB5B 2GK0B 1S7XA 1J0IA 1DE4A 4G8IB 4G9DB 4V1DE 4Q6IA 1TITA 1INQB 4R97B 5ISZB 2IAMC 1WK0A 5I71C 2OJEB 4KKCD 3KJ4C 4ODWB 5C7XH 3V6ZA 1ZA6A 4OM0H 4JDVA 1A7PL 1OAKL 2FWOB 1OARL 4K7FB 2VABA 3BPOB 3CMOH 4H8WC 4MX7A 2FECI 1GVIA 4RISH 3WIFB 3VD3A 4H8WH 1CBVH 1FGNH 2ARWA 3I9GH 3I6KA 3GSUA 3F6IA 1G1CA 4UI2A 3MJ9A 3FKUS 2AJUH 1H3UA 2VXUH 4OFPA 2AJVH 3G6JF 1MCRA 1YMHA 25C8L 4EEEA 1EHXA 5DMYA 3AY4A 1HQ4A 2X4OA 6FABL 3L6FB 4ZSOB 5IJVA 2E7HA 1ZGLB 1G0YR 3HCVA 1B0WA 4WEMB 3ZE0E 5CP3A 4DZ8B 5L2KA 3BJLA 4NNPL 2VZSA 3BD4A 1T0NA 4G9FE 3HI1B 4DFIA 5C0GA 2MFNA 5IG7B 1CE1H 4CJ1A 4PFEA 4NKIH 2W9EL 3KPLA 4DEPC 2XTJC 1YUHA 3CMGA 3ISWA 1JMZA 2L7JA 3SJVB 3L5IA 4LVEA 4XPTL 5HHVH 2KL6A 1MIMH 4P3CH 4Z7WF 3MV8B 1EEZB 4X9GA 1YN7B 4KROD 1K8IA 3VFTA 2ARJA 4JM4L 5GRUH 4WI4A 1NKOA 2VLKA 1M7IA 3PV7A 1G9NH 2CLZA 2DQEH 3SOBH 5JOPD 1HQRB 1YQVH 1NBQA 3I75A 1YZZA 2H9GA 1CFTA 4EN3C 2GCYB 1NLDH 3UTSA 1S9VA 5KANI 5J13C 3HG1B 3NFPB 2YA1A 3G5XB 3F5WB 4M5YH 2XG4A 5T3XE 5ESQB 2Z35A 4GMTH 1W0VB 5J3HC 1AQKL 1ERNA 3ZKND 5FF6A 1AD9B 1YEDB 1OVZA 4KFZC 1JPFA 2LTQB 4LL9A 3EGSA 3HAEA 3B9KB 3RY6A 4BQ9A 1JJUA 2EE6A 4OLYH 1QFPA 4MHHG 4UTBH 4L9LA 1QRNA 3P11H 5E5MA 2AEQH 1FVDA 1L9MA 2DTML 4Y4HC 5MERA 1FJ1A 1BREA 3O11A 5DJ2B 4RWYH 2VUOA 3TA3D 5KOVC 5HVGB 4Z76B 3EYUL 2VDLL 1NMAH 3KAAA 4I9WE 1FYTD 4HBCL 2C7UA 2YK1H 4EI6A 4I8DA 2HTLD 5CHNA 5IW6B 5ETUB 1M7DB 1ORSA 3BKJH 3VXSB 3BEWB 4DK3A 4FQJH 1S8DB 4M93B 4O5LL 1FNGB 1P1ZA 5MI0B 1UH3A 3RGVC 4P23C 1MAJA 3QEHA 4OD1H 4S1DC 5L8JB 1NCCH 5I8OH 1EEQA 3I85A 4OAWB 4ZO7A 5A1AA 4AT6B 5F1NA 5BXFB 1G9MC 3DV4A 5CZVH 3FO0H 3BHBA 1NMBH 4NC2B 1G7JB 1JNLL 1ND0B 5I9QC 4PJEE 1IEBB 3FHQA 4I3RH 5EC1A 4KUCD 4QXGL 4Z5RB 3CCHA 3O0RH 4YNYB 1IKNA 3BEVB 4UDTA 4LVHC 4U49A 5JXEC 5E8PB 2FD6L 3ZE2E 4JY6B 1OAZL 4L5FL 12E8L 4LIQE 1HEZB 4J1UA 1W72L 2NY0D 3MBXL 5LAXB 5DVLA 2B1AH 4OZGB 2FJGA 4OLZH 2KQNA 2GITB 1QR1A 4PJGA 3BH9A 1UJ3C 3TVMC 1Z0MA 4CN1A 1MCWW 2Y06L 1XAUA 4FQPA 4OCXH 5ICZB 1QYGH 3G5ZA 4LCUA 1F3DH 2DL2A 1CICC 3RWFA 3DO3A 3OJ2C 4KRLB 1RJLA 4OKDA 2CXGA 1D5MB 4KXZH 4WWKB 2WWMC 3SDCB 4CVUA 3TBWB 5HGAB 4NJAL 3TBTA 3MBED 4I0PB 4XPBL 1P9MA 1NSNH 1WSST 4F7CB 4JO2L 3BWAB 3VA2C 2IANE 2GAZB 5KSUB 5GIRB 1P84J 4PRIB 4OFYD 3EJYD 4OCYH 1TVHA 2F19H 4G8FA 3L3OA 3GIZH 3U46B 1N2RB 2JELH 4S11A 3ESUF 5E7BA 3GMNB 3C9NA 4YHML 1MH5A 2VQ1A 1AE6H 1NC4D 1HIMH 2VB5A 4M7LT 4KUZH 1LE9B 3FONB 4CNIA 5CJQL 3BPCB 4TOYH 4NWTH 4ERSH 3VFSA 3OSKA 4MVBC 3MR9B 1ACYH 4HFWA 1FN4B 4IRJA 2WINA 4ZPVB 3SGKC 4P46B 3RTQB 4M1CC 1NCWH 2G60H 3KYNB 4U0QB 4HUXA 3MFGB 3VXRA 3EDKA 1OWWA 2CIKA 1NCDL 2BNUB 1BIIA 3MO1B 3TBYB 4F80A 5JDSA 3TA3A 4A6YB 4AENB 4IMKA 4NNXA 3U4BL 4HWZB 2VTFA 5HHPB 1U8IB 1NFIB 1U8JA 4X5LA 2WQRA 1MAKA 2AK4B 4ZQKA 2EH7H 1OCWL 3EJJX 4OKVB 3QPQC 4KJPC 4LQFL 1FORH 1QQDA 5F7WC 3S37L 2DQUH 5DR5L 3U30C 2F74B 1QD0A 1RZKH 4DKAA 4Y1AB 1H15A 4TUJB 4M6OL 1F3RB 5I0DA 3H9HA 4PY7B 4JG1L 1W72A 3FMGH 4PV8A 1S7VB 2VDOL 5IT2L 4NFDA 4TN9A 4X0KA 5GGRB 3V5KA 2J4WH 2NY1C 4NDMA 3QHTC 1ADQH 3SKOB 5E4EB 2GSIA 4MNGA 1ZLSL 1IC5L 2WUCL 4G6FD 2Z91A 1AGDA 1T1YA 5I16B 3MRNB 5D5ME 5E5UB 1NANH 3UPCA 1UKSA 2H32H 5DMKB 5DD3H 4ELKB 1H5BC 4ODXB 1MFAH 4F7TB 2BX5A 5ESAB 2W92A 1S7WB 1FLRL 3KLSA 5DEFA 3GBMH 4IMLA 5FYKU 2RBLA 3L3IA 3VFVB 4D9QD 4MAYC 1YPZA 2YD4A 3ZT5A 4ENEC 3O4OC 4NZRL 1EAPB 1UM5L 4HKBB 3X13A 4N0FB 4RGMB 5T3XH 4OTXL 4Y5XC 2AV7B 4U1KA 1Q94A 3CVHH 2VDPL 4XNXL 5D7LD 4L4TB 1RIUL 2VUYA 2Q6WA 1FL3B 2CGRH 1FSKB 1DUYA 1KC5H 3OAZK 4HIXL 1S5HB 4ESKA 2PNDA 1DFBL 5DHVH 3BMVA 2ZUQC 4XHJC 4NQCB 3RAJL 5D96C 2FBOJ 5IMOA 4X7SH 1JGEB 5L2JB 3UTTB 1MFCH 4EVNA 4N8VA 5HVHC 1FGVH 5JIPA 1EJ6A 5C0BE 4NQEA 4P2OB 5KSVB 3C60A 1BFSA 4XCNB 2FRGP 5I1EL 3W2DH 4X98B 1S7RB 5I30H 1NC4A 2B20A 4P9HC 1OQXA 2EXYD 5T1KD 3JWDC 4FQQB 4NBXB 4Y5VB 4QWWD 2IQAB 2G5RA 2VISB 5CSZB 4MJ5B 3A67L 2HJLA 3IS1X 5A3IC 5E8OB 1QKZL 5I76B 3MOAH 2QLVB 4J7RA 4M8QB 4X6BA 4PJ5D 1V7MH 2YWZA 2ORBL 3HC4L 2YD5A 1DZBA 4X9HA 5I1IL 3LKRB 4XWOD 3CH1A 3FL7A 1URLA 5JXAL 3HUJB 4NWUL 3PWPD 4PBXA 5D1ZC 3UP1A 1T1WB 1CFVH 5E6IB 2D03L 3T0EE 1HCVA 1A2YB 4QOKA 3V4PH 5F93C 5KVMC 3LV3B 4WHYG 3MJ8A 2XN9B 3ARDD 4YX2H 5LGJB 5E9DD 4I77H 3VCLA 2EYTA 4E5XA 4OF8A 4QHMB 1FNSH 4LIQH 2DQCH 1HNGA 4G6ML 2Q20A 5C09A 5EBLB 1UADC 5JR1L 4K3EH 4GG8B 2BK8A 4Q2ZB 4YDKL 4R90L 1XR9B 2A6KA 4GOSA 4UV4L 4I3SL 5F1IA 3L3JB 3V4VL 1V7NL 1TNMA 1WF5A 2M1KA 1MRFH 2OP4H 4ELMA 1KPRA 2G75B 5L9DL 5TQ0L 4M3KB 1H8OA 2CKBL 3GZKA 4JVPA 4YFLF 2BXYA 4PBVC 2R2EA 2J6EH 1PW3A 3RJQB 4OQTH 5I1AB 1FFNB 3MRRB 1X5IA 3BGFC 1KNOB 4MNHB 4YBQC 3ARBA 4JQXC 3RGHA 3CDFA 4PJXE 4Q0XH 3TCLB 3P77A 3EBAA 4NC1E 2H6PB 1J1XH 4Y4FA 1N5AA 3DHMA 4MAUH 5F7EH 3RY5A 3MFFA 5BV7H 1NFKA 1NAML 2AI0L 2DKMA 1F5WA 3BPOC 4QHUB 3QXDA 3CFJB 5F8RC 3MXVH 3QJFB 4X99A 5D7LA 5KOMC 2R4RH 3ZTNH 3NABH 2IALB 1U3HB 5BRZE 2X70B 3C09B 1J05A 3ARED 3NN8A 4HH8A 4N0YL 1RZJC 4ZUTA 5EB9A 2N4IA 1ZVYA 1JTTA 2XIDA 2IGFH 2WP3O 4P9MH 4ISVB 3FTGB 2YMXL 2BNQE 3WDIA 2HKFL 3STZA 3NZHL 3MRLA 1DL7L 3QULA 5GISH 5I1JH 2BOBA 4X9BA 3T0WA 3WFEL 5DQDH 5D7IB 4KGLA 1OTUC 1U8KB 4HFUL 5FO7A 1H3GA 5MEOB 2OSLA 3E8UH 3QEGL 5EH1A 4WDIA 3T08A 4OJFL 4ZS7H 1EEUA 2BMKA 1UKQA 4XC1L 1B2WL 1TVBB 3DX9A 1HINH 5EIVA 1S78D 1A1MA 1IGCL 1LO0L 1JRHL 1MHEA 3B8SA 1XGPA 2CQVA 2A38A 4M1DL 5FOJA 4NBZB 4PJHE 5DJDA 3EYOB 4YO0B 2PXYB 4HPYL 1PX4A 1T5WA 3BIKA 43C9A 4KAQL 5GGVY 4RAHA 5DHXB 5DMIH 3ULUF 5T3ZD 2V9QA 1C5DB 4FQXD 4KK8C 2H2PC 4PG9B 1T4KA 1MAML 3A6BH 3PWPA 1F8TH 4XH2A 2V2TA 3X14B 2HRLA 3S97C 2I27N 3C6SA 4HUUB 1A14L 3CXDL 4G7VL 4LU5L 3DVGB 1NC2B 2L7UA 1PG7W 2CRYA 2ZCLL 5HI5C 2V9RA 1OGTA 2NR6C 3ARDA 2ADGB 3K2MC 1A9EB 5DK0A 3O2WL 2XPGB 3SKMA 1Y0LB 2CKBA 1B0RA 3TZVD 3VFUB 1C16A 1IILE 4YWGH 2R2CA 3VFMB 1MHPL 5A2LH 3C8KA 2E6QA 2R0WH 2ZKHL 2PO6C 5FECB 4D0CA 3WS6C 2P5EE 2B0SL 4L3AA 2LTQC 1I4FB 4PG2A 3B9KC 5DGRA 1Z9SA 3GI8H 5EO1B 4OIBA 1LO3H 4XBGB 3WFBH 3ZE1F 1CU4L 1RHHA 4ZNEE 4BJLA 1FE8H 4Q74A 4YXKH 4B7IA 1LO2L 1NAMA 3V6OC 4F7MA 2OTWB 3BDXA 2J8HA 1YJDC 4CMMB 1K2DB 4M7ZB 3ZYJA 5HY9B 2J5LC 1JZ5A 1CL7L 1S7XB 4KVNL 4JQVA 4LCYA 4K23L 1RZ8B 3THMH 3QXTA 1KJMA 7FABL 4NO2A 4GAYB 1HYSC 4ZFGH 4U6YB 4OCMC 4JDVB 1AHWC 5IFAL 3FQXA 3UJJH 1GCFA 3K4DA 1E4WH 1PQZA 2AJXL 5T33L 4R2GD 1JMXA 3QA3B 2HN7B 3RIFF 4Z7NE 4JJ5A 3QFJD 2DDQH 3S34L 5HD8C 1XGQA 4R8WL 3PG2A 5DYOB 1T21A 2YS4A 1RK1B 3AREA 4FFZH 1WVZA 5KS9E 1ZSDA 5I19H 5DLML 3DI2B 5B21A 5E08L 3MLUH 3LKPA 2P44B 1JN6B 1F4HA 1RULH 5F7DA 1RV6X 1F02I 1NQBA 3KPSB 4MMZC 5JHDD 3IDGA 3QI9C 4D94A 5FB8B 3ZDYE 4M62L 4I13B 2MCPH 4LGSB 1HNFA 4XT1C 3RUGE 1LP9E 2W91A 3QNZA 3HUJF 3GHEL 1UWXK 1JZ8A 1BFVL 2E7MA 4DGIH 4PJIE 5F72S 3MMEB 2XXMB 3T0EC 4YAQA 3KPLB 3ZDZE 2IH1A 4X5WB 3CLEH 2AV1B 1DVFD 3ARGD 5FGBA 1BX2B 3MNZA 1CF8L 3TFKD 3FFDB 1LD9A 1IFHH 3VGHA 5BVPH 4AIOA 4UTAL 1FFPB 1OT1A 5INDB 1SYVB 3TO4D 2X5PA 1Q9WA 2ARJB 1J8HB 3K80A 2Y5TA 1B88A 1SEQH 3RP1A 5EOCH 5CP7A 2O61A 2CLZB 1NKRA 3HMXH 3S5LB 4JVWA 5D2LA 3B2VH 2H9GB 1CFTB 3N85H 4I2XA 2AQ3A 5D4QA 3UXFA 7CGTA 5I1KH 2MPAH 4FOMA 2DLHA 3MNVB 3VFNB 4PTUA 4LEXH 3RX7A 5FV2A 4JDTH 3PNWA 3BH8A 4GQ9L 5KZCD 5HJ3B 3GM8A 4C56E 4GBXD 5IROC 4YIQB 4PJFB 3ESVF 1RVFH 4AMKH 4NC1C 4XTRC 3HAEB 5IHZA 1G7QA 2NNAA 3E1F1 1BEYH 1N7ML 3ARFC 2I26N 5FHBL 1WT5C 4HKZA 5IF0A 4N0UA 1HILB 1QRNB 1EUUA 1I9JL 1M1SA 4WTZG 1UXWA 1CLOH 2WLYA 2NY4C 4GRWE 2B4CH 2HRPL 5J89A 3O6FD 4F3FB 5GS2H 4R9HA 5KTEL 5TDNA 1A6TA 4GSDL 5IB2A