3OB0H

A non-self sugar mimic of the hiv glycan shield shows enhanced antigenicity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
220
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2G12, light chain
publication title A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 220
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ob0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ob0H01
3MBEB 2MMXA 1BAFL 5D6DC 3WNLA 4JANB 1JMXA 2Q8AL 1U8HB 3RWEA 5DJDA 4NPYB 5J9PB 4XTRD 1QSEE 3MXVL 5IB5A 4JHWL 4NC0B 3DI3B 3NN8A 3ZMRA 4N8CH 4R2GB 1NC4A 5FO7A 3FRPG 4YUEH 3V9FA 4WFHE 4WCYH 5JO5A 5DMKB 3MRDA 3U36A 1K8DA 1MJ8H 4ZPVA 4D94A 1A5FL 3WLBA 3DJ9A 4GKZB 3BKML 1Q72L 3CD4A 2BK8A 4O2EB 5DJCB 5HGHB 2KL6A 2CIIB 4N0UB 2YSSB 2VZTA 3VXQA 1GC1H 4RBPK 3PP3H 4HIEA 1U8KB 4M61B 5HXMA 1C12B 1TJGH 4XMLH 4I0PA 3GSNL 2XRAH 3VFMB 1R5WA 4GRWE 4AJ0A 5IQ7H 3RWDA 2RFXA 3MA7B 4UDTA 2H41A 4PJEB 5HGDB 4MXWH 2XZCH 4WJ5A 4QY8A 2QBWA 3MR9A 3O6LH 5LAXA 3DV6B 2XT1B 5C0CA 4YPGA 1QR1B 1PQZB 4M7LL 4PBVC 5D2LB 1MRDL 1EEUA 5IW3A 5B39G 5C8JA 3OKLA 3WL9A 2NXYC 2VLKD 3W39B 1T0NB 4G8IB 2IAMB 1DQJA 4L8CA 3CNKA 4LGSB 1VFAB 2J8UE 2F5BL 3NIGF 4D9RD 2XWBB 5IQ9B 1FCGA 1I1RA 4C56B 3GNML 4ALAL 1OSZA 1KNOA 3KVQA 4TNWF 4Z7OE 3FO0H 1F11B 4RAVA 5IGXL 4OLUL 5JMRA 4OGXH 4CDHA 2GJJA 1UJ3C 5IB5B 5BRZB 3NN8B 4ZFFB 2AABL 1TVDA 2RBLA 2WIMA 5GZOD 5JHDA 1UA6H 5JOEA 3LN5A 3QSKB 1NC4B 3SKMB 1H8OA 1QG3A 1XF4B 5FO7B 3IVKA 5JXED 4WUKH 1CFQA 3RY4A 1RU9H 3QO1A 2R2EB 5KVMC 5DJAB 4H1LH 2HJKB 4OFKA 1TJHL 4ODXA 1F4WL 1K8DB 2AV7A 4KQ3L 4KI5F 3U4EB 2PYEA 3O3BB 3EIFA 3BEVB 1CFVH 5F71A 3D9AL 1LNUB 4XPHL 1CDUA 3CFCH 5GS1A 3CSGA 4TSBL 3KDMB 4UV4H 1FVEA 3QDMA 3RGVC 5K9OA 4FFZL 3P0YL 1R5WB 3BUYB 4R4ND 3T08A 1QQDB 4R4BA 3RWDB 4LFHD 1UYWH 4UDTB 5DO2D 4MGXA 4POZD 1PBYA 4WJ5B 2RHEA 3MNWA 5KSUA 3WIIH 3MR9B 2E27H 1BVLA 1E6JH 4HJJL 3ULUF 4E5XB 3WN5C 2A2QT 5C0CB 3UJJH 1RAMA 2F54A 4XNZC 1IJ9A 4Q9RH 3MLPA 3WL9B 1NFDA 1JHKL 4KUZL 1BBDH 5DJXA 3EYFB 1IC1A 3T4YB 1BX2A 4Y5VB 1EBPA 3RZCC 3UTPE 4ZAKD 2WBKA 4GAYB 2ITCB 4PRNB 3VXMA 5F97E 2VXSH 3OSKA 5CGYD 3FRPA 5BCAA 5M95B 4OKVB 2WV3A 1ZSDA 4KAQL 4KRMB 4KJPD 4MD4A 2F8XC 1HHGB 2IPTH 5DVNA 3WFEH 4G6KH 1CFQB 2XI9A 5FXCH 4OGAD 1MWAH 5J11B 3CUPB 3RUGA 1TQCB 4HJ0C 4CMMB 2XQBL 3Q5YA 2XWJA 4ODXB 4KKAD 4IJ3C 1I75A 4NQDB 2BVYA 3KWWA 2PYEB 4X6FA 4UIMB 2N7BA 3QP3A 5C07E 4MNHA 3SO3C 3PWPE 1X5FA 3T3PF 4KVCH 1UACL 1KELL 3QDMB 3V4VL 3V6OE 4RBPH 3TVMD 1MH5B 2G60H 3C5ZB 3SY0A 1WGOA 2D0HA 3RVVC 3FB6B 5K9OB 2KUTA 2EICA 3E2HB 4M1CC 2COQA 4PJ7A 4ISVB 1ZLWK 4F7EA 4XBPA 5B39A 3Q1SL 3FT3A 5BVJB 1DQMH 1KTDB 1TZGH 1N4XH 4OAWA 4UB0H 3I75A 2GYSA 5CKAA 1CIDA 4PLJC 5TGBB 5IOPB 5JHLH 3RWGB 3JUZA 1NFDB 3MNVB 5DJXB 1UH2A 2DYPA 3MOBH 4IRJB 1YJDC 4AH2B 4FFWD 4JPIA 3W2DL 1LO5A 2GJ6A 5FO9A 1RVFL 2D03H 3BP7A 3WHXB 2HTLC 1KCKA 2E8YA 1BWMA 4PJ8B 4X9HA 3JTSB 1OW0A 1UCBH 1OP3K 3MUHL 1JF5A 1A4JB 2BY3A 3KPRE 3MV8A 5I1AA 1IRAY 3RU8H 2IPKB 1HDMB 5T5FH 2W0LA 2VQ1A 5M94B 1HE7A 1CGVA 1CFSA 3JV4A 3DROB 5E5UB 4FQIH 3RTQA 5BZDB 3MJ8B 4O00A 1JNHA 5AZEL 5I8OH 1NAKH 3ZE0F 5MERA 1L7TH 2XWJB 5E7BA 3U0TB 3ABZA 4I1NB 4EI5D 3VMPA 3W0WA 3KYKL 4FQ2H 2DL2A 3DWTA 3WXWL 4OQTL 1CXFA 5D2LE 5C0AA 3NAAL 2CMRL 2R0LL 2FO4A 3QIUC 5D7LA 1KC5L 4I0KA 3TBSA 4WHDA 4LASH 1JPFB 1DCLA 3CSYA 4PB9H 4YFLF 4LIQE 3GI8L 4Y1AD 1YJDL 4TQEH 3C08L 4PJ7B 1F90H 1WF5A 1OL0A 3UDWC 2NX5E 4BZ2H 2DRUA 3VCLA 3QI9D 4ZFGH 1Z0MA 3QQ4B 5SV4A 5C6TH 3I75B 1FG9C 1FE8H 3K0WA 2VLJD 1FNEB 4LVHB 4Y2DD 5DD5H 3WCYA 2EIZB 3GJFK 1D5BB 2ZCLL 3VXSD 2CK0L 3I3BA 1MLCA 2PO6A 2P1YA 1S5HB 4JR9L 3ILPB 3X3GL 4HW6A 4IHOA 3QIBC 3SDXA 2YUZA 4NQUA 4G6MH 1YMMD 1Q0YL 5KANG 4Y89A 2PNDA 1QLRA 1GAFL 5FO9B 1H15A 3BP7B 3IJSA 3IXAA 4QOKA 5DVLA 5D7JB 4Z5RA 1RJZB 2DD8L 3OKKA 5KVGH 4OZ4A 1G7JB 1M6OB 1KN4L 3GSVB 5I1AB 2BOBA 4LEXH 3HE6C 2VQ1B 3MCKA 3JV4B 1RULL 5CLWA 1NJ9A 1OWWA 3D3VB 5DD0H 2N56A 1XGTA 1IKNA 4DCQB 5I1DA 5ESAB 1A1OA 1IGIL 1RJCA 3ARWA 4JVWA 5D1QC 3V5KA 1OAZH 4JFFA 4NZUL 4UQ2A 3OJMB 3UYPA 1S7UA 1WAAA 1Q8MA 1BQHG 1VSCA 1YECL 5C0GA 5IB2A 3V8OA 3IAGC 1PYWA 1T7VA 5D7LB 4ERSH 2P49B 1RUAL 3EDKA 5EC1B 5BO1H 3JWNC 3TFKD 4U6HB 1FYTD 1HN1A 4X9FA 4PJ9D 2VDMH 3HMXH 3O45B 4PJHE 4YIQB 1ZLWH 1WWBX 3WJJC 3MLVH 4F7PA 5JUEL 2DM3A 1HI6A 1KT2B 3JSSA 1A6UL 5LGHH 3CZJA 4G8GD 1EEYB 4XC3L 4N1EA 3SDAD 3QFJA 5DI8B 4N0CD 3OJ2C 4LKXA 1QRNA 2YD9A 1H15B 2BC4A 3MODL 4GW1B 3TV3H 5JR1L 3IJSB 3IXAB 5JA8B 1CZ8L 1DDHA 2EO9A 1IGCL 3OKKB 4NP4L 2XKSA 5E0QA 4JPVH 1AH1A 5LGKA 2VDQH 4PJCB 1YN7A 2CKBH 4GAJL 3EYSH 3HG1D 2BVEA 2H9GB 2AGJH 2BY2A 1NJ9B 3O6FA 4YDIH 4Q9QL 5FYJU 4NCDA 3B2UC 4P9ML 2KH2B 1HINH 1XGTB 2VLRE 3QUMH 5FGCE 2HLFD 1ZT1A 3PIQA 5KSVA 5BS0B 2FGWH 4J23A 2CLRA 3HC4L 4DTGL 1YEFH 2YK1L 2V5SA 4UQ2B 5I1JL 3L3KA 3S88H 4D8PA 4EN3A 2JIXD 1CICB 1WITA 5IB4A 5C0GB 3BZEB 5DT1L 2EC8A 4P2RE 3RNKB 3MLYL 2W0KA 3FL7A 3GHBH 1YNLH 3K4DA 1FVCB 3MLUL 3T4AB 3L3IA 3D39A 5FUCE 4FQPA 2J1KA 1CQKA 3P9MA 4OIIL 2I9LA 1H3PL 4YHIB 1RIUL 5C7XH 4LSVH 1RV6X 1A6TB 1SMOA 3RIFK 4JJHA 1SYSB 1N7ML 1TTUA 3V79C 1QBBA 2CIKB 4FQJH 2UWEB 3INUH 2NTFA 3QIWC 5DJ0B 4C57C 35C8H 5CEYB 3GGWA 2CSPA 3WD5H 1MRCL 2A74B 2WW8A 4WV1C 4QTHA 2FB4L 1KLUA 1T3FA 3BAEH 5C0BE 2JJTC 5E8NA 4ZTOH 2DI8A 4PJGB 3O4OB 3ARDC 3ARED 3OR6B 4K3JL 5SV3A 1A3LL 1H0DA 5CUSL 1MIML 4F8QA 1H8SA 5JQ6H 3HZYA 3N85H 3O11A 1C16A 3SGEI 3STZA 3V4UL 1MCPH 4DKEL 2Z31B 5D1ZD 1XCTA 2H1PL 2AK4E 1QR4A 5D7IF 4ZOEA 4XVSL 2OI9B 4N5UA 1TCRA 4XVJL 1U8JA 2CLRB 3M17B 3SKOB 2VYRE 3VRLE 5HDBF 5D1XB 4NC1E 1OP9A 3RVTD 2PKDA 4KJYA 2HA1A 3OKEA 5D2NA 1INQA 2D2OA 1LP9B 4TUJA 3QRFM 5LJYH 1JZ7A 3GRWH 4K2UH 1ZAGA 1MI5D 2IBBA 2I9LB 2ZUVA 3G6AB 1OM3H 1JPTH 2Q20A 3ALXA 1J10A 5HDOA 1V3JA 3PGFL 5KN5A 15C8L 1MCOL 3LN9A 3MRMB 3GGWB 4OZFA 3DLQR 3QQ3A 5EPMB 3PL6D 4WIQA 4K94H 2P8PA 5SWZE 1KLUB 1T3FB 2HKFH 5KSAC 4D3CL 4Z18A 1DEEB 5GRJH 5SX4I 3FCTB 3VFVA 3SGDH 4YLQT 3PV6A 3O11B 4S10A 2Z92A 4WFGE 3DUSB 3STZB 5BJTA 3MRPA 1IEBA 2ZKHH 5K9KB 4LPXA 2DI7A 4D9LL 4J3OC 2Z4QB 1KTKE 3KPSB 4CW1B 4ETQB 2ZSVB 3BPLC 3MO1A 4HUMB 3Q2CA 1F4HA 3IJHA 3LEYL 5I8EB 1U8JB 2CJUH 4MA1C 1T21A 1NC2B 2FL5A 3L1OL 5EZLB 2ARJB 3L9RA 3RWIB 4ACPA 2G5BA 5EU3A 5DSCA 2HH0L 4OF8A 3OKEB 3TZVA 4GAGH 1CFBA 3DXAD 4R97C 2UVFA 4MJIE 5LCVL 2IGFH 2ZSWB 5B8CB 4KUCD 3WHE1 3VWJD 2VQUA 1V5JA 3NPSC 2XG5A 2OXGA 2Y23A 2Y7QB 3BT2L 1LE9A 3C5JA 4OZFB 1XR9B 2DM4A 5DXWA 5GGVL 3QDJA 2P8PB 3MRLB 4ONGL 1I3VA 4CGTA 4QGYA 2NZ9C 4B50A 4X9BA 1D9KD 2KDGA 5I19L 3BRGC 1BZ9A 2DQEH 4X80H 1J8HB 5FYLE 1PKQB 4YXKL 3MRPB 1IEBB 1S5IL 3QNZA 3X11A 2H2PD 1MF2H 1HXMA 1U8OA 2R4RH 1FNFA 4WTZG 1EFQA 1GGCH 1EO8H 2JCCE 3RY5A 1Q9WB 3FQTA 3IJHB 4K3DL 1T21B 1AC6A 1SQ2N 3ZHLA 1GJIA 4D0DA 2QHLA 2ADGA 4OM0L 1J11A 2UUDK 2LFGA 4YO0A 5L8KB 3FT2B 1R3HA 2G5BB 3QHZL 4JZNA 3QUZC 3NGBC 1VFMA 2V17L 4UAOC 1JWUA 3TZVB 1QTYT 5GSVB 4FZ8H 3H9HA 2R9HD 1HXYA 3FQNA 4P59H 2XXCB 5BVPL 5ANMA 1MCWM 1KEML 4XGZB 5GZOC 5HHPB 4GKSB 1G7QA 4PJGE 5JXEC 1CD9B 4OB5L 4YHML 2EYSB 4BK5A 4QRQB 1R5VB 4IM8A 5FF6A 5HD8C 2KZ1B 1EJOH 1G7LA 3PHOA 1T0MB 4GW5A 5EN2B 3SDYL 2GFBB 1LE9B 3C5JB 5JORB 5I74B 4OZGE 1EFXB 1KENH 1SY6A 3QDJB 1TLKA 4JFPA 1INDH 1AIFA 4MNGB 3IFLH 2NY4B 5D7KD 1U8IA 3K2UL 4PUBH 5C08B 1OB1A 3MC0A 2E9WA 4I8DA 3NTCH 4UT7H 4K71C 2GJZA 1BF8A 5HHXH 5A43C 5MEPA 4WW2C 3C6SB 1ORSB 1VPOH 1RZJH 3D85A 4NNPL 1BD2D 1DBMH 1F58L 4PJFB 1EHLH 2GY7B 3WNKA 4JFYB 4U6XA 4Y5YC 1HXMB 3UTTD 1U8OB 2OP4L 1QSEA 2ZOLA 3RWHA 4F9LA 4DQOL 1AGDB 2E5EA 1NH6A 2H26A 4XCYA 1NUDA 1E4JA 3C2SA 2EXYC 4ZAKC 1LEIA 1NL0H 1DN0A 2P5EB 5GS2D 3TBVB 4UTAH 5I0ZA 3VI4F 2VDRH 4BH7B 1FGVH 2NY3C 5CGYC 5FAAA 1H3GA 4XNMA 3H9HB 4NWUL 4XXCC 4XNYL 5I16A 2Y36L 2L7UA 4KJPC 5LG1A 4EVNB 3LS5L 1XFPA 4X6DB 3MGTA 1N8ZB 2FIRT 3QUXA 1YEGL 5IJKA 4PJ5D 4PFEA 4OGAC 4YHYB 1W8NA 4L4TB 2NLJA 3VXUE 3MRRA 4YXHL 3Q6FA 5T3ZE 3NA9L 1J18A 4Q7DA 3CFDB 1T04A 1S9XB 2OMNA 3RVUD 1CLZH 4GUPB 4YXLL 5TE4H 2ESVA 2Z91A 4NZTL 3MMEA 3EOTH 4L3ED 1MUJB 4M5YH 4WNQB 1OB1B 3O2DA 2Q1EA 3HRPA 3TVMC 1U3HA 3IB4A 2BX5A 2EH8L 4JG1L 4EUPB 2VJXA 1RUQL 2A6JB 3QHFL 5GPRA 1PY9A 2HFFB 1KTLA 4H26B 4ZS6D 2MJWA 3CZFA 3WSQH 5AYUL 4JM2D 1HQ4A 3RNQB 2VISA 5JW4N 1ZE3C 4WO4C 4PJAF 3ULVC 4XMKH 1C1EH 1SMAA 3BMVA 4RFNB 3ULSA 3IDXL 2X4NA 2VXQH 4G6FD 4FG6D 4N9OB 5I1LB 4U1MA 5FCUL 4MD5A 1YC8A 1BVKA 4XCNB 3L7FA 3PWVB 3MREB 1L4IA 1A7PH 4EDXA 4YHZL 5ILTL 4ORZC 4LP5A 1BJMA 3GK8H 1NCBL 1WEJL 4G7VL 2X40A 5HPOA 3JWDH 4PLKD 3TBYA 2UUDH 4F33B 1FFOA 5C0FB 2OSLB 5IMKA 3WIHA 3RAJL 5HYJE 1U8LA 1ITCA 2BCKA 5DA4A 1A6VH 1OAYH 1U2HA 3QUYB 5F9DC 5I1GL 4U0QB 3UTQB 2VXTH 2R39A 2GTWB 3MTRA 4JVUA 4MDJA 1I7ZB 2DBLH 3CDGA 3DMMD 1J1XH 2QJDA 3CFKB 3UYOD 5I73B 2G9HB 4L9DA 5TE7H 3PGDA 4QLRA 1WWCA 1J8HE 3MRRB 3Q6FB 3DX8A 4MAYA 3VXPA 4ZSOE 4CVZA 3MJ7A 3ZKQD 2DLFL 3D48R 4HXAH 3ULVL 3IS1X 3BOVA 4E41E 2SEBB 1E4KA 3RWFA 1NCTA 3SCMA 2ESVB 2Z91B 4LCIH 5EO0A 4QT5B 3ZKND 4M00A 4X8JB 1MFDL 2X1OA 2RCSL 2MCG1 5DR5L 3OTTA 3RX5A 4OIAA 1X5LA 1UM6L 3LS4L 5CEZL 2X2YA 1BOGB 3EFFB 3GSWA 4RNRB 2MQ3A 4XCCL 3F7YB 1QBAA 3LKRB 5D5MB 5DQ9A 1HQ4B 4WFFD 2VISB 1XIWB 2HFGL 5EO9B 3RZWA 2X44D 4X4XA 4Y2DC 4MA7H 3W9EA 3MRFA 4LQFH 1H5BA 2D4DA 1HQRA 3MCLH 5CBEB 3GSQB 3SPVA 4U1MB 3BP5A 4MD5B 3DRTA 4Y19D 2AJ3A 3L7FB 1B0RB 3LHPL 3WFCH 4MQXD 5HDQL 2H32A 4AEHH 4OI9A 2GY5A 5ETUB 1OPGH 1FFOB 1KIQA 2X05A 1KN2H 1LMKA 1YPZA 3PUCA 1U8LB 2YWYA 1JIBA 1EAPA 5C07A 3VFUA 2W9DL 2ZPKL 3TH2T 3BKYH 2HYMA 4MNGE 3IDNB 4EBQH 4MDJB 4O02L 1JGEB 3CDGB 4NKIL 5I66A 4R7NA 3EYOA 3L6FA 3U0WH 3V6OA 1VADB 2C26A 5F70A 5T1LA 3B4NA 1P5VA 4OLZH 3CMOL 1AD9A 1RMFH 3WJLA 3BGFC 1VEPA 5E56A 2FRGP 4NNYA 4UDUA 1ZGLP 4MAYB 2G2RA 5SWQA 3H42L 2FATL 1U8PA 2ILLA 3LKOA 4CN4A 3AS2A 3C60D 2GIYA 2WNGA 1G7IB 5HI5D 3SCMB 1BBJB 5EBMA 2P24A 3S96A 4FN0A 5LVEA 2P5WA 1LO2L 1GC1C 3QWRD 3PWNB 3HE7B 2XIDA 4KQ4L 3KJ4B 4U1SB 4YDKH 3TFKC 3MLZH 5CBAA 2A6DA 1JF1B 3JVGC 4BH8A 3RIAK 2QQNH 5HYSA 4PJ9C 1A6WL 4G9FD 4HDIB 1HHHA 4FFVD 2VDPL 5J6HA 5IWLA 4YK4C 1U3JA 1QBML 1I7TB 5KS9F 3KPRA 1KACB 4LSQH 2FLRT 1H5BB 4F7TA 1R0AL 5ESVB 3VDAA 5IHZA 4WUUB 1F3RB 3SPVB 4N8CL 2NY7H 4N0CC 1Q0XH 1N6UA 3EYVA 4F37K 4Z7WF 1BGXH 2CH8A 3KYAA 2VTFA 5IF0A 3WS6C 1A7NL 5F9JA 1QKZL 3RP1A 2CRYA 2RIKA 3BVNA 1KIQB 1P4IL 4XPTL 5DRZA 5E94A 5EOCL 1YPZB 3KXFD 5HHNB 1UH4A 4XVTH 1UM4L 4WWKC 3VGAC 2IQAB 2OTWB 4HJGA 2HKHL 1IQWL 1C08A 2YZ1A 5E9DD 3T77B 2P47B 1R3IH 3EYQD 1GC1L 3EYOB 2D9QB 4JQIL 2Y9RT 5T1LB 1TJGL 2HLFC 1IVLA 3CFEA 5TPWH 4RFOH 3T1WA 5D71L 3SDDB 1U92B 2HN7A 5DHVA 3TJEL 1K2DA 1NMBL 2NX5A 4U0RC 1N0LA 4UDUB 3WLWC 5FGBA 4PJDE 3V52H 5IQ7L 4LPYA 3F5WA 2I26N 2QHRL 3WKMH 3LMJH 2HWZL 1PG7W 4OD1H 2A1WL 3FRUA 3O6LL 4OV6F 3T2OA 4W4OA 3S96B 1MVUA 1YQ2A 1K4DB 3FTGA 2WWKT 2I5YH 3S37L 2VLKE 2H6PA 1I9RH 1FAKT 4PGCA 4PRHB 3X12B 5CBAB 4NKOA 4D9RE 3ZE2F 3MRKB 5HYSB 3JTTB 3JV0A 4MCZA 4GG6F 5GRVK 3C9NB 3T0XA 1TVHA 2C5DC 3MROB 5IBTL 5J6HB 4H25A 5KVDH 2J2ZA 1T89A 3LZFL 4N0YH 5C09D 4ZD3H 5DMIL 3VFRB 1PEWA 3F58H 2ITDA 3DI2B 1GOHA 5JA9A 4M8VA 3U1SH 4K7PH 1FNGB 3EYVB 4NRZB 4V1DD 1U58B 3W9DB 5C0DA 4F57L 1CL7H 5F9JB 3QPQD 1NLBL 3DUHA 3O9WD 1VGEH 1U95B 1EH9A 1JPGB 4Z95L 1H3WM 4LKCA 5FK9B 5D7SL 5C0EB 1HKLH 1CU4L 2EE9A 2HFEB 2HJFA 1YEJL 3TBWA 4CJ0A 3F12A 5D1ZC 3SEPA 3GB7A 4TOYH 3DOSA 1UXWA 2A6KB 4UV4L 3CFEB 3GSNA 2W60A 4RISL 2LV4A 3VE0A 4X6EA 5DHVB 1N5YH 1Z9LA 1HOCA 4PJHA 3QJFA 1UYWL 2F53E 4QXGH 2R8SH 1NSNH 4J4PD 2EKSB 5IHBA 4BSVA 4LLYA 3MRNB 3NIGE 2F58H 1RZFH 3MRJB 3EO1A 3JV6A 5CSZB 4H20H 3FFCE 5EZOH 4PGZA 3L5XH 5AZ2H 4EDWH 3ARGA 3O3EB 1DFBH 3NCBB 4OZFH 1BIIA 4JO2L 4P5TD 2GHWB 1FZKB 4PGJA 1TVHB 4CVUA 1KTRL 2V5RA 2YKLH 4R90H 3QA3A 5AD0A 2YA1A 4S1RL 2WBJD 4OF0A 1EO5A 4DGIL 4O4YH 1T2QL 3U7YH 4KZEH 5IKCA 4WEBH 3SBWC 5EIIA 3PL6C 3CVIH 4PY7B 1P7QD 1UWXH 4MSWA 5DQDH 5HGAA 5CZKA 4OI8A 2IPTL 1HSAB 4KI5E 1L7IL 2VLRA 1HYRC 1MELA 4HCRL 3QZWG 3SGJC 5IBUB 5FB8A 3UTZA 3QEUA 1MQKL 3SDCB 1DBBH 5TQ0L 3LQZA 3FAXA 1CT8A 3H9SB 2DQHH 3ZYZA 1I8IB 3EO0A 3QEHB 1M4KA 4BA8A 5E4IA 1IQDB 2P45B 2Q6WB 3TBWB 4NSKA 3MV7B 5T33L 4JFDD 5D72L 2DQUL 1UXWB 3GBLA 3UPRB 1AGBB 3O8XB 1Q9OB 3TIEB 1BHGA 3FN0H 3MFFA 5D9SB 1HOCB 4EIZC 5HYIA 3QJFB 3P9LA 4TVPD 1EX0A 1U8NA 3LH2H 5J8OA 1MCIA 1DQML 1RK0B 2IQ9H 1HWGB 4HC1A 5E8DH 2YD6A 4KJQD 4GRMB 5JHLL 4L5FH 1EGJA 1C5BH 4RWYL 3OKYA 1UKSA 3H0TA 3PWLB 1BIIB 5C0BA 2VABA 4YDJA 1T5WB 2VAAB 3B9KD 1JPSL 4J3VA 4P23D 5DJ6A 5IIEB 4L9LC 1YNKH 3QA3B 5C9JB 2WP3T 1OTTC 1SBSH 5KAQF 1CGUA 1KB5L 4JO1H 4XNXL 2MCPH 3QCUH 4XPAH 5ENWB 2OLDA 4P0DA 1JFQL 2P8MB 1FV1A 1UCBL 5HI4D 5EIIB 3R8QA 3WV0A 4LSUH 2ZCHH 4U31A 4RCAA 2AK4A 1P6FA 2Y25A 5ID1A 5HY9A 3RGVA 1D9KC 4TULL 4NHCH 4OM1L 1KLGB 3G04B 4FQIL 4CNIA 3GZKA 4HGKC 4Y16D 1HHKB 4OLXL 4ZXBC 32C2B 1NANH 1ZVHA 5I8OL 1NUFA 1CS6A 1MCLA 5EFIB 3S36H 3T3PE 5JQHC 4TRPL 3WN5A 2Q8BL 2H2PC 4FQ2L 2DQCL 4NSKB 2BSTB 4D0CB 4FXLA 2MWCA 2NXYB 4FP8L 4JRYD 1LK2A 3IDJA 1VESA 1WCQA 3RZCA 4TQEL 1JV5B 3KS0J 1EJ6A 3QB7C 3UMTA 4LVOC 3MUGA 4LP4A 1U8NB 3FO9B 5KVFL 2ZUUA 1V8HA 2IBZX 1FRGL 2VLJE 2O5YH 1AQKH 2AJUL 1FE8L 1UJ3B 5GGTL 1P5UA 3VXSE 1DQDH 2QADD 4WGVB 2R9HC 6FABH 3VRJB 4YE4H 1I7UA 1CLOH 3H0TB 3T2NH 3BGAA 1RIVH 4BFIA 4YDJB 1YMME 2OK0L 3HNTL 1GOFA 1PGRB 1I85C 3FB7A 5JLZA 1SY6H 4XZUB 5FGRA 3TA3A 1ZHNB 4PLNC 4C55A 4TNVK 1Y6MR 5KVGL 1GHFL 1E27A 1IT9H 1FP5A 2GITA 3U9UA 4EUPH 3QZWA 5IFJA 3QT2A 5CHNB 2GAZB 3LIZH 2XA8H 3ZE0E 4NQXA 4YPJA 1DANT 4P2QD 5HVWA 5F9OL 4X7DC 3RGVB 2EDFA 3HPJA 1PG7X 4CVXA 3GMPB 4FXGB 4AEIL 4PJBB 5SWSB 3LQAC 2W65A 2GT9B 3TN0C 3P77A 4F58H 4OQTA 3IDGB 1RD6A 1G6RA 1MLBA 4MX7B 5CZVH 1NEUA 4RIRA 3BQUC 4KZDL 1SJVA 1MHPL 4MJIA 2BJML 3RZCB 4GRLA 2VL5A 2FJGA 1NFKA 5GGRA 3PWUB 1B2WH 3LCYA 1G0YR 4HMEA 1QSFA 4HF5H 2UV3A 4PV8A 4WY7H 4CMHC 4GRWH 1H3VA 4G8FB 2CXGA 3EDJA 4FXKB 1REIA 1J0JA 4ZNCD 1U8MB 3PABA 1H3UA 4L3CA 3FB7B 1XGRA 4PRPA 2JB6A 3O0RH 1OAKH 3LQAL 3BYYA 1JI1A 4PGDB 3TV3L 4CU7A 1O0VA 4PRIB 1ORQB 3O2DH 3BE1H 3CVHL 5GJTH 4I9WE 3DVNB 4K8RH 1N26A 2DQFA 4JPVL 3OBAA 4KK5C 5E2VL 2GITB 2AXFB 2EIEA 1LDPH 2APWA 4E0RA 5K59F 4D2NA 3OX8A 3NZHH 1EXUA 3HG1E 3QIUA 4M6OL 3SO3B 2JCCA 4MVBC 3PE9A 1TTGA 3FQRB 3QO0B 4IOFD 2E6QA 2F19H 3T0EE 4CVXB 2V5MA 4HPYH 1MAMH 3UDWA 2VKXA 4HKXA 1QFHA 3B8SA 4WHYG 4FQ1L 3OJDB 4IS6B 1BQSA 5A2IH 4JM2C 1HH9A 3AS3A 3P77B 4CL7A 5FUOL 1TETL 1D6VH 3CH1B 3WKNA 2OYPA 3T0DA 3I85A 4FG6C 5DD6B 4UV7L 1ZEAH 3VFWB 3WIHH 3REVB 1A14H 2JE8A 2LU7A 2JB5L 5CINL 5T5NG 4ZG1A 3KPOA 2X4PB 1J1PL 1QSFB 4YHKL 2XTJD 4DW2H 3EO9H 4YFLI 4Y4HD 1JF6A 5F7MC 3VD7A 4OZGA 2AK1L 3NFSL 2YD5A 5J3HD 1OHQA 1ETZA 1S8DB 4ZOAA 3RBGA 5CP7A 3EOBA 1FZJB 2WINA 3L3OB 2Y5TB 4QRPB 4ZQKA 1YNTA 3PABB 1ED3A 3B9DA 5D70H 2YMXL 3KYNA 3OKDA 5E6IB 3DMMC 4L3CB 4RAHA 4BFGA 4PRPB 4W6XB 1FN4B 5L9DL 4ZTOL 4KRPD 2JB6B 1IGTA 5D1QA 2PTUA 1JRHH 3C6LA 3N1MC 2YRZA 4ORGB 2ED9A 5FECB 5L8JB 2F15A 3VXRD 1II4E 4NYLA 4MZ2A 4YH6A 1IEHA 3HB3C 1QO3A 4L8SC 2YHGA 5GGRY 2A73A 2YPKA 5HHOD 4E0RB 3MNZB 1BFVL 5F3HA 3HPLB 3QIUB 5F7EL 5CMAA 1BOYA 3DVIA 4K94C 4QO1A 4KK6D 8FABB 5T3XE 3KPLB 4LLUA 1EDQA 1QFUL 2X4TA 2F74A 2DQTH 4EOWL 3WJJA 4CKVX 4OZIA 1GOGA 1QLEH 2H32H 4BQ6A 4XC1H 5KVEH 1V3KA 3CPLB 1YN6A 1HIMH 2H2SC 3PP4L 4JFOA 4PYHA 3QIBB 1UKQA 1MI5E 1WIOA 1MHHA 4Z6AT 3G6DH 3BD5A 1A4KB 1Q1JH 2BSSB 2Q76A 1A1MA 1QFPA 2I9TA 4MQXC 3HN3A 3VFNB 3UTSD 5F1KC 1I9JL 1A02N 5L2KB 2NY0B 3VXUA 1OAQH 1RZGA 1F00I 1IGYA 4JFXA 4KPHL 3I6GA 4XHJC 3REWA 4GAFB 4M8QA 3HE6B 5CP7B 4DOHE 2Z35A 1MFBL 2DJ4A 4ZQKB 5F9WC 2NY1D 1DVFA 2WM0A 5DVKA 1A6AB 1K6QL 3D2UD 5TF1H 1OAXL 4HS3A 2IBGA 4NN7C 1ZANL 3IJYA 1LHZA 1MIEH 2NXZB 3ZTJG 4RGND 1DLHA 4FQHA 1RUKL 5D7IE 1GGIL 4XP9L 4JO3H 3ZTNH 2C4FU 3FT4A 5I18H 5D8JL 2X4SB 4Y8AA 5IK3A 2NYYD 6CGTA 2DMCA 2D4FA 4UIKH 4AIZB 5J0BA 2NY5H 1KJMA 5HDBE 3EUUA 5JTWA 5E03A 5IEHB 4XPFH 1LO4L 2ZJSH 2W91A 2WIIB 2ZG3A 4DAGH 4ODHL 2CRZA 1U8QB 4U6VL 3QG6A 5ISZA 2BRRH 1JE6A 3S8WA 2F74B 5F7WC 2DWEA 3OKOA 4F8TA 2CLVB 4FFVC 4M6NH 4IRSB 2BDNH 1UEYA 4H5SA 4OZIB 4NFDA 1UB6A 4JAMA 3QIWA 3OGCB 4LQ1A 2VZVA 4OJFL 5IVXB 1LEGA 4LU5H 3KNBA 3S35L 1JHLL 3QR2A 4JFOB 5J6GA 1BQLH 4XBEH 1MJ7H 2I07B 3RDTD 3T0BA 4ZYKA 5E2UL 5I1KL 3HS0A 5BZWB 1Q9KA 2B2XH 4JM4H 4Y8DC 5H2BB 4JY5H 4LIQH 1NCCH 1YMHB 1FZMB 1ZHKA 3I6GB 1DBKH 1FNSH 5DC9B 2J4WH 5DHVH 1MCJA 4M8QB 4LLMB 4BSJA 2NTSP 5HYQB 1G7PB 2NY6D 4W81A 3VD9A 2V2XA 3HMWH 4KK9D 1HSBA 2AJYL 3ILQD 3X14A 4HS3B 1NEZA 2HT4D 2FX8L 2EO1A 3IJYB 4JY4A 4UT9H 2HRPH 5DUPL 1DLHB 4FQHB 4DGYH 1AXTL 1A3RL 2C4FT 5GS1C 2BNRA 2DDQL 4JHBA 4PJIB 2VITB 4HH9A 3FQWA 3VFGH 1E28A 3ZKSD 2GSIB 2A83A 3F7RA 4WHTA 4JDZB 1BAFH 4JRXD 3ZYOA 1WSST 5IV2B 2Q8AH 1IBGH 1FHGA 2VUYA 3QG6B 5ISZB 5GGSA 3MXVH 5FA3A 4JHWH 3CDFA 5MEQA 3DHJA 3OKOB 2QSCL 3QULB 2EXWD 4H5SB 1TIUA 1UB6B 1BFSA 3IFOA 5F1NB 2EEBA 1LEGB 1SYVA 1V3MA 2XNAB 4WV1B 1RZIA 3WFDL 5HHQB 1AR1C 1UKTA 4WFHD 5MP6L 3I02A 1D6EA 2BVUA 4WDIA 1A5FH 3OKMA 1AKJA 3DUUA 3G5VA 4ZYKB 1KEGL 3KS0H 3ARDB 1QEWB 4LLDB 5E00A 4P2OB 2ZWLT 3HS0B 3CFJB 4NN5C 5ID0A 2K1MA 1EJOL 4Z7UF 4JN2A 4N0FA 3GSNH 3TNNB 4L4VD 1VDGA 3QDGA 1CGXA 1G7MA 3NZ8B 5D7KE 2YD8A 3OXSA 1CDHA 1B9ZA 1I4FA 3BXNA 4NWTL 3SGEH 1JTTA 1HSBB 4C58B 3RVXD 3X14B 3DTXB 4M7LH 3EJYD 4GG8B 2LVCA 3L3DA 4U33A 1Y0LA 4Z0XA 2JJWA 1BD2E 1UEMA 4POUB 3I6KA 2BNRB 1HHJA 4J4PC 2F5BH 4HH9B 3UPCA 3UTTE 1IM9A 4LPWA 2A83B 2X4UA 3GNMH 1WV7T 4ALAH 5I6XC 1FC2D 5B38G 2PXYB 3PDOB 3GFUA 4OLUH 4OF7A 2ERJC 5GGSB 5FYJD 1N59A 1VERA 5CCKH 4KROD 3HLAB 1OGAD 2AABH 5GIRB 4K3EL 2WBJC 4ZUUA 5TE6H 3LN4A 1G0XA 5ADPL 4TSCH 1EHAA 1D6EB 1TJHH 1F4WH 3F65A 3UPAA 2BMKA 4Z76A 4KQ3H 1BZ7B 3IAQA 3L7EB 5KSAB 3G5VB 3U2SA 4Q6YA 5EZJB 2YBRB 4PJ5E 4NNXA 3D9AH 2PETA 5BMFH 1RK1B 4XPHH 4LSPL 4P46B 4QRRE 1UXSB 1YEEL 2VXVL 1KCLA 4ZTPL 5ADOL 4FFZH 3P0YH 3QDGB 5SX4H 3QNYA 4JFEB 3EJZC 1ITBB 2CO7B 1KJ2L 2EDYA 1G7MB 1FZOA 3FONA 3BPLB 4XAKD 1I4FB 3L3HB 3WS3B 1HK6A 2VLKA 4HJJH 5F7DA 2NZIA 4AEEA 4MA1B 3QXVA 4XNUH 2NQCA 1Y18B 1U93A 1JHKH 1W72A 1Y0LB 4KUZH 3BPOC 2AJZB 3BP4B 3G6JB 5HI3D 4DZ8A 3I6KB 3E3QC 1IM9B 4NHUA 3GJEA 4FNLL 1ND0A 2PTTA 4XMKL 1MY5A 4KJQC 3DETD 3VI4E 3QJHB 2Q3AA 2VXQL 1EEQA 2MPAL 3G5ZB 3IXTA 1OTSD 5GGVY 4OZHB 5JXEA 2X09A 4P23C 4UTBL 3NPSB 4KAQH 1NMCC 3CGTA 2UY6A 3U6RB 2PO6C 3P4NB 3LEXB 4ZUUB 1T1XA 2BZDA 4NFBA 3FB5A 1E4XL 5IW1A 3TBTB 1W0WA 4Z7WB 4DZBA 3M1BA 1K5NA 3IAPA 5LKNA 5EBWA 1CDBA 4Z76B 3OZ9L 3D0VB 4JGUA 4Y4KD 1JJUA 3K4ZA 5EIQA 2DBLL 1DP0A 3ZLQC 4P4KD 4Y16C 3AVEA 1UJTA 3HC0B 4WW2A 3PV7A 1ZHLA 5DGQA 3QDAA 3LEVL 1CD0A 4TVPL 1KELH 3V4VH 3PWPD 4PJEF 1WZMA 4BQ8A 4L8DA 4Y5YA 2HJLA 4MQ7B 4WU7B 1WZ1L 3FONB 4MA3A 2W9LA 1YA5A 3U83A 3MBED 5C3LD 3ZO0A 4G9DA 4PJAE 4ZAKA 4HWNA 2ICES 5B38A 4L1HA 3NVQA 3T0AA 4ETYA 1AJ7L 3PG2A 4R2GD 1CDYA 4PJXE 4JZJB 5TDPB 3QUZB 3NGBB 2ICWI 3RWCA 4UAOB 5DLML 5FM4A 1J8KA 4MNQA 2PTTB 4Q97A 2AJXH 2QADC 2VN7A 1EZVX 3PHQB 1GH7A 4QHUA 1S9WA 1SEBB 4KC3B 3IXTB 4Y19E 1CVSC 3O41A 2D31B 4MAUH 1B4JH 3AB0C 5H37G 3MYJB 3UX9B 3WFCL 3HCVB 5IMMA 1IAOB 4S1DD 1M7IB 5BW7C 3B5GA 3MA9L 5AZEH 3TESA 4DZBB 1OGTA 5EBWB 1UQSA 3GO1L 3TLRA 5IBLD 4LL9A 4X5XB 5FKPA 3KYKH 3STBA 3ZSTA 2EYTA 3BKYL 1XEDA 3R06B 3RIFF 4UMGA 3WXWH 4EBQL 2VAJA 3S5LG 1RURL 4OQTH 3TVMA 4K71B 1JUFB 4JREC 3NAAH 3QQ9C 1G6RH 2R0LH 2FYYA 1QOKA 4OLZL 1J0IA 3ZT5A 1DUYB 2GK2A 2P4AB 1X5ZA 4R3SA 3VFSA 3GI8H 5DQJB 2XZAL 1S7VA 5I9QC 1YJDH 3PJSA 2IAMD 4L8DB 4Y5YB 1TZHA 4DKFL 3C08H 3WEXA 1CGSH 1IM3B 3WFHA 2XQYK 1JGLL 4K7FB 4C56D 4G9DB 4EN3C 2D7MA 4YDKL 5IVZB 3V4PL 2UYLA 3MLZL 2XTLA 2ZCLH 4ZAKB 2CK0H 3SJVA 1TVBA 4G9FE 4ZFOL 1F02I 2A9NL 4JR9H 4F7MA 5BRZD 4X6BB 3X3GH 4CADB 1L6ZA 1GVIA 2ID5A 3NABL 5FHAL 1HH6B 2NY3B 3D18A 1Q0YH 1OAUH 1NC4D 2IH3B 4H0HB 1HILA 1GAFH 3OXRB 4MNQB 3UBXB 2VO5A 1QPXA 1SJHA 4LSQL 2DD8H 5EA0L 3T2QA 1S9WB 3ARXA 3N50A 4NO5B 1KN4H 2BVOA 2NY7L 2R0ZH 1SEQL 3FAWA 3BISA 3G5XB 3KLAB 1BGXL 5IROA 1RULH 2AXGB 3OKNB 2ZUYA 4EI5A 3SE9H 1ACYL 3QXDA 1UGNA 4M1DL 3KXFE 4NZJA 2R1YA 1IGIH 1IILE 1UQSB 1ZWIB 5H8DA 1B0WA 1FNLA 2DAVA 2VH5H 4NZUH 4XCEA 3OG4B 5E9DE 2NW2B 1FIEA 4J3TA 4M7KL 2EYTB 4ZO9A 5F8QC 3BX7C 1HKFA 2X4OB 4HIIA 4IOFC 2VQTA 4Y1AA 2OX5A 3BIKB 5DEGA 1FFRA 4HQQH 1O5DT 5DK0B 3LRSB 2FJHA 1RUAH 4R3SB 5EULV 1CK0L 4CU8A 2VLLB 1EMTL 1S7VB 3PJSB 4WO4B 43CAB 4B5EA 1HNGA 3LMJL 4Y2DA 1MRFL 4NRXB 1J0ZA 3M8OL 3WFHB 3VXSA 3O6ML 1NFDF 3QAZC 2Z8RA 3T65A 5LWYL 1FL3A 3TP4A 2FLBT 3ARFB 5JUEH 4LOUD 1OT2A 1YMMA 3QRGL 5KS9E 1A6UH 2C3GA 1R3JB 3SJVB 4XC3H 4ZUTB 1FG2A 5D2NC 4F7MB 4OLYL 3VFTB 1RZ8B 2AEPL 2XTJC 4AEFA 1FLRL 1A7RL 1UCTA 5C09E 4KV5F 1VGKB 3MODH 1F42A 5A2JH 5JR1H 1DBJL 2VDNL 1CZ8H 5GGUB 1NGXA 4IIQA 5DMGC 4FZEL 4NP4H 2FWOB 4KY1L 5FA4B 1FFPB 2BVOB 4NQDD 5F89A 1NMAL 1R24A 2NCMA 2XFXA 4V1DE 4KRPC 4GAJH 4WW1B 4XVUD 4Q58C 5DZNA 2PCPB 4LSTH 1ONQA 4ZFZA 4Q9QH 1CL7L 3NH7L 3E1F1 4P9MH 3TWCL 3QXDB 3S5LA 3NFNB 3GSUB 1D5XA 1P6AB 3C5ZD 3HC4H 1P1ZB 4N8VG 4DTGH 5A40E 3QXWA 3BW9B 5I1JH 1XCQA 2C3VB 4KK6C 2AKRA 3T0VA 4CVWA 5DT1H 4Y1AB 1FYTA 3RI5K 3MLYH 1L0QA 2C9AA 4PJ9A 3ZKMD 4PJ7F 3PXHA 4P49A 3L5JA 1NLDL 4NDMA 3MLUH 4HX1B 4NJAH 1N5YL 3MACL 5CIPB 5DJ8A 4OIIH 4LGPB 1H3PH 4LRNH 1RIUH 3ZE2E 4IRJD 5FDWA 3C2AH 1P7KA 2F58L 4GG6E 4G8GA 5F6IB 1N7MH 1AO7B 2K3TA 3SDAA 3T65B 5T3ZH 3NMEA 4FQQB 3FFDA 1Z9SA 4R96B 4PJ8D 2VLMD 2EDJA 2YR3A 4JJ5B 4ZDHA 5AAMA 1MRCH 3B3IB 3DBXA 4F15C 3GSOA 4GMSL 3S4SG 2FB4H 3DURA 3BRDA 3IKCA 2DWDB 3E8UL 3WNPA 5IHUL 2ARWA 2ENYA 1HHIA 2HVJB 1J86A 3U7YL 4K3JH 2LABA 4BELD 1PW3A 1ZGLA 3U46B 4NC2B 5CUSH 3CU7A 3HG1A 1SHMA 5EU6E 2AS5M 1DBAL 2NY1C 3OB8A 3V4UH 4DKEH 2CDGA 5KG9A 5IFAL 3GUTB 1JWSA 5F89B 1ZT4B 3RX8A 5INCA 1LO0L 2DQGL 2NW3A 2IFGA 1B4RA 3BGFB 4WHYH 4AY0A 2H1PH 5CFHA 4ZFZB 5JPMA 5FHBH 5LBSL 4RGNC 4XVSH 1JZ4A 3GMOA 3V6ZA 2JIXA 1D5XB 3OHXB 9CGTA 4NQVB 2DQHL 2NYYC 1QUNA 4HG4J 4HHAB 4R4FL 3U7WH 2AQ2A 4LHUG 1C5CL 4JY6A 1YEDB 5C9KA 1JNLL 4JFDE 1KPUB 4LCWB 3VH8B 2EIBA 3MV9B 3CU1A 4PJ9B 1AGFB 3RPIA 4ZPTA 2A9ML 4TVPE 5GRYA 3DVGB 1LD9A 3F6IA 3QEQB 4EQ2A 4N5ED 1Z9OA 5B4MD 5FCSH 2FZ3A 5DEFB 4G8GB 1IGJB 3E0GA 1ZLSH 4D0BB 2A0LD 3DRQA 5D7JD 4QHMA 3PGFH 15C8H 2VUOA 1MCOH 3SDXF 3TJHC 1JN6B 3D69A 2V2WA 2AEQH 3AREA 3GIVB 3QPXH 3CH8A 4HV8B 5DDHA 4AL8L 5JOPE 1RY7B 4D3CH 4JFZL 2IANE 3D3VD 4ONFL 4MA8L 4WWKB 4G42B 5EC2A 3VGAB 3WDJA 1RHHB 2HVKB 4WI3A 1ZGLB 4NM8L 5D1ZA 4I2XB 2NY6C 2W0PA 4Y5XB 5I17A 4KK9C 4N8VA 4HPOL 4NBYB 2CDFB 2HT4C 1X5IA 4PREA 1FL6B 4HCRA 3C5SA 4U0RB 4AT6A 1NGWB 3NIDF 4K3HA 4H1LB 1WAAF 4MXVF 4OCMC 2JIXB 3VGDA 2IPUG 3OWEA 3L1OH 4MDIB 3D1MC 2IMNA 2DI9A 3CK0L 4EZMA 3VG9C 4JY6B 3FMGL 1JYNA 4JRYE 4R8WH 5DRNB 1MI5A 3BGMA 2HH0H 5E08L 4HWBL 4PY8J 3LOWA 1OARL 2IF7A 4L1DA 4NUGL 1KXVC 4KTEL 4X4YB 4L29A 1XF1A 3ECBA 3B2VL 3QCTL 4P4RA 3IFNL 5L0QC 4F9LC 5MENB 5LCVH 3HZKB 2UWEF 1FBIL 1XT5A 1E4XI 4FMFA 3ZDXF 2DBJA 1T22B 2FZ3B 2FEDD 3JWOC 1I8KA 3VGHA 1GXEA 3PL6A 3S4SA 1JK8B 3BT2H 2R2CA 6FABL 3C8KB 1KCVL 1AGEA 5GGVH 1CXLA 3ZTJH 4HD9A 1A7OL 5GRUL 4ONGH 5FYKE 4MMXC 1FFQA 4UUJA 5TFSL 1KB5A 4MJ6A 2NNAA 4K9EC 5D7IA 5I19H 4Z0BL 5DJYA 4DUVA 2OQJB 4X7TB 4U1HA 5BS0D 1IT9L 4KMLB 4YXKH 1GYAA 1S5IH 2DF3A 5FYLD 1T1WA 3Q3GA 5I17B 1CICD 3RVXC 2X7LA 4PREB 2AJSL 3C5SB 3VRIA 2F8VA 1UZ8B 1YC7A 3QXUA 3EDDA 4EKXA 2WP3O 3GMQB 3AY4C 4K3DH 3ZKXC 4OGYL 2DLHA 1U3HC 5CILH 1X5HA 3JWOL 4K8RC 1A1NA 4OM0H 3OB0K 4F58L 4O2FA 3CXDL 1RZKC 3DIFB 4FQXD 4KK8C 1LP9F 3AUVA 4ODSL 3DXAA 3MLTA 3PQYB 3GSXB 5CZVL 1GIGL 3QHZH 5JXAL 1X7QA 4K23L 4YDLC 1IL1B 1NFIA 3ARTA 4KKBC 4P5MA 2R23A 2V17H 5EBLA 3VWJA 4L9LA 4NQEB 3CCHA 3V5DA 1KEMH 5AYQA 4P4RB 4WI7A 3LKPA 1Z5LA 1PZ5A 4IDJL 1B2WL 4K9EL 3HC3H 4N90D 5F7UA 4OB5H 1RI8A 1DQTA 4FFYL 2OCFD 1I8KB 5GGTA 2YEZA 1YY8A 5GSRB 4WVRA 3E6FA 3SDYH 5I1IL 4TTGA 2Q7YA 2QKIB 1C7TA 2PN5A 3HI1B 1D9KA 1AGEB 4G80B 1M71B 3CJJA 1FAIH 3NFPA 3VXNB 1I9IH 5CSBA 5CD3B 2FEEL 5F3BB 4QCIA 1OAKL 1GGBL 2Z31D 4UUJB 1NUGA 4EI6B 3O3AA 2QSTA 2NNAB 1JYVA 2D7TL 3ZT6A 3O2DL 3P73B 5ICYB 5A16A 1W72H 4CN6A 1DJSA 1RZKL 4KHXH 1F58H 1FO0L 4JEGB 1LILA 3SOBH 43C9A 5JDSA 5F9AC 5D1XD 1T1WB 3MV9E 5DFVC 1RUML 1U6AH 4YAQA 2XN9B 5FYJL 2OP4H 2CRIA 4HPYL 4ONOA 1E4KC 4P3CH 3CX2A 4HG4K 4DQOH 2YXFA 3BSZL 4OSUL 1QSVA 2QSQA 4NO3B 4ZUSA 4WTWA 3UEZA 1A1NB 1U91B 4HZLA 2ZG1A 1D6VL 5D96B 2X1PA 1MREL 3DXAB 1X4YA 4QWWD 1FVDA 1I1CA 4P5MB 1S7QA 2R23B 4HUUB 1OTSC 5EBLB 4WGWB 1ZEAL 4IMKA 4NWUH 4JHAL 2Y36H 1CG9A 4BFBD 3LKPB 2XTJE 1PZ5B 3M07A 3LS5H 4EXKA 2JJVA 1KV3A 4DW2L 3QH3B 1YEGH 2YRLA 5GS3A 3UROR 1FIGH 1RJLB 5EUOB 3VXOA 5EORL 4YXHH 3ESUF 3CX5J 3RIAF 4M5ZL 5IB1A 1R3KA 2DQJL 3NA9H 4Y4KC 4RRPG 3TYGL 3IETA 3WXVL 2ATKB 5D70L 3SQBA 5HHME 1IAKB 4YXLH 1EVTC 4ZXBB 5K59E 3QYCA 2C1PA 4NZTH 5JPNA 2A77L 4QXTA 1JRHL 3EFDH 3VXRE 2UZIL 1BD2A 3KPSD 2R0KL 3CVHA 3IU3A 2I25N 3H9YA 2OTUB 5C2BL 2EH8H 1YEIL 1XGQA 1MCNA 4JG1H 3UTTA 3P11L 1RUQH 4KGLA 3QHFH 1H3TA 1NC2D 5TDOA 1CIUA 4F37F 5AYUH 5E8PA 3BUTA 3MBEC 5KANI 5C86A 1LWRA 2V6HA 2XACC 3OF6D 5AEAA 3IDXH 2AV1A 1I8MB 4LVOB 1R3LA 1N5AA 4WI2A 1J05A 1EHNA 4MB4A 1ZLUH 3BN3B 3ZDZF 5ICZB 4R2GC 1P4LA 2WMPA 1FNHA 2EDDA 4FRWA 1HYSC 4YHZH 5ILTH 1ZGLM 1UVQA 1T80A 1FDLL 4P5KB 1QLEL 1WEJH 3OB0H 5DVOA 3O4LB 2NY5C 1G9MC 2VDLL 5E8EA 3IF1A 3QWOB 4ONHA 3VFOB 3DGGA 4RFEA 1NBZB 4PJ5A 1A8JH 5HYJD 3H7BB 4I18B 1NBYB 5I1GH 3PP3K 3UTSE 4QRUA 4LDOB 4PTUA 4UOW0 4S1DC 3GMNB 1KCUL 1OAQL 4ZS7L 1WIUA 2Z8VC 2ICWA 4WU5B 4LVNB 3Q0HA 5IBLC 4LLQB 2F8OA 5IB1B 1R3KB 4L3EA 1J8HD 4JB9L 2DLFH 3ULVH 3B9VA 1T20A 2V9RA 3T8XA 2FGZA 1KXQE 4E41D 4YHNA 2C1PB 2XICA 4PD4J 3RFZC 2YUVA 2Y6SC 4YNYA 1MFDH 4XPBL 2RCSH 2W0FA 4PJFF 1A0QL 5DR5H 3TN0B 5D6CA 4JM2A 3ZYIA 5GS0D 3RA7L 1UM6H 3LS4H 4JO3L 5DS8A 5FOBA 5TDOB 5DRXB 5H94B 3KPQB 4QRSA 2CKBB 4XCCH 2DJSA 5DJ2B 3VWKC 3BQUB 4QYOA 3BDXA 2NY5L 3H2WA 2ADJB 1G9ML 2HFGH 1WBXA 1EAJA 1WWWX 5ALBH 4RMVA 1QVOA 2EECA 4ELKB 1R3LB 4W4OC 3TT3L 1J05B 4RDQF 2BRQA 2BDNL 4HIJB 1T1ZA 7CGTA 1UB5B 4CMHB 3LHPH 5HDQH 3NCYS 5L8LB 2EDHA 4P57A 5CJ8A 1S9VA 3L95B 5I2IA 3SN6N 3W11D 4EXPX 1A22B 1VFBB 3DMMA 4I3GA 4X6DF 4ONHB 4XXDB 1MJ7L 3DGGB 1EFXD 2W9DH 2RGSA 4Z8FL 2QQQA 4O02H 2P44B 4NKIH 3FQUA 4RRPA 3BH8B 3UJIL 2NY4D 2FHCA 4ELMA 4HIXH 5C08D 4L8SA 5EU7E 2EEAA 2ORBL 1AHWB 2APFA 3CMOH 2ICWB 3KLHC 5B22A 1JL8A 3BZ4A 1VA9A 2GCYB 5CIPH 2H3NA 1K8IA 1KCSL 3H42H 2FATH 1I7RB 4PJAA 3HMWL 2C3XA 2E3VA 2OR7A 4ZNEE 3GMRA 8CGTA 2N1KA 3DV4B 1JZ5A 1LO2H 2P46B 3MLWL 2W0FB 4KQ4H 2YPLE 4JM2B 3EDFA 4PJXA 3U4BH 2IMMA 5FYKU 5I8CB 1A6WH 4QRSB 5EUKA 4I13B 1I1YB 1XF3B 5HYEA 2VDPH 2P5ED 4QYOB 4JRXE 4NQSA 1QBMH 1EEZA 2JJSC 4YC2C 5H37H 4YBQC 1G0DA 4Y19A 5CEXA 4FHBD 4LOUC 5E6YA 1FL5A 1IBGL 3HR5B 1R0AH 4HLZG 4N68A 3FQXA 4H0IA 1MHCA 1VHPA 4HAFA 3ARGC 2WUCH 5E1AB 2BNQB 1CD1A 1A7NH 1MCRA 1QKZH 2CPCA 2APVA 4PR5A 4L4TD 4LCCB 2E7LC 1P4IH 4XPTH 3MUZ1 5EOCH 4AZ8A 3DMMB 5DRWA 1UM4H 4NRYA 4CUCA 1S7WA 2HKHH 1IQWH 2E6PA 4FABL 5IESL 3FQUB 5JOFA 4JQIH 1NANI 2XV6B 1V05A 4ELMB 4KU1A 4HKBB 3CX5K 4L4VE 1G7HA 5D71H 3C5ZC 3TJEH 3LKNB 1NMBH 3CLFH 5IM7B 2QHRH 4FTVB 4QGTA 3QWRA 2HWZH 3R0NA 2A1WH 3GMRB 3GBML 2ICWJ 5EU4B 3AM8A 3TC9A 4G9FA 3S37H 3UC0L 1EUUA 5I30L 3UAJD 3VFPA 4KKCD 4XH2B 5D5MF 1BLNA 5FUCC 4X7EC 4X99A 5E8OA 2X70B 2K9UA 3HAEA 4X0KB 4X6CA 5DURB 4U3XA 3QNXB 5IBTH 1DQLL 5ESQA 4YFEA 2GTZB 1EEZB 3FN3A 3LZFH 4HWZA 4NQCA 5BV7C 5DMIH 3VA2C 3V6BR 5FYJE 3IDYC 4GSDH 5DJDB 2FJFA 3RWEB 1OGAE 3KPMA 5CCKL 3QUYD 1CTNA 2Z8WC 4LLVA 4UU9A 3KXFA 1JZ2A 1NBQA 2X5PA 5TE6L 3MYZA 4F57H 1NLBH 4TSCL 4PR5B 5JO5B 4Z95H 5E9DA 2D0GA 3MRDB 5F9WB 5DVMA 1AY1L 1OF2A 2YS4A 3DX7A 4ZPVB 3U36B 3L5HA 5DRWB 4M7JL 4Z7UE 5D7SH 3UCRA 1Y6NR 1JYWA 3WLBB 4BM7A 1TCMA 1N64H 1CU4H 1HEZA 3HUJE 1YEJH 1EIBA 1S7WB 4A6YA 2X4QA 1A6PA 3RVWD 3TGXA 2Z93A 1BEYL 3VXQB 2ZUSA 5BMFL 5JOFB 3MRQA 4O9HL 2ESVD 5LGJA 4HIEB 4DVBA 5I1CL 3PWJA 4RISH 4I0PB 1JGVL 5CJOL 5GZNC 4J8RA 2RFXB 4XAKE 4OCXH 4PD4K 4NM4L 2F53D 4NC1C 4QY8B 1DSFL 5BV7L 1XIWD 4ZO6A 5LAXB 1W0YT 5KS9A 1ZHBA 4LVHC 4YPGB 4HC1L 4XNUL 4TNVF 1VFOA 3BZFA 3UBXG 5C8JB 3OKLB 3FFCD 4WI5A 3VFPB 1EGJL 2CR6A 4NT6A 4JCMA 4JO2H 4KWUA 5E1HB 1DQJB 4L8CB 3ET9F 5C09A 4N5EC 3WE6A 4X6CB 1NKOA 3HAEB 3HZMA 1N2RA 2ADIA 3MFGB 1F45A 4JKKA 4S1RH 1BREA 1OSZB 1KNOB 2A0LC 5D7JC 3IS0X 4NQCB 4DGIH 1T2QH 3VG0L 4RAVB 5DZOA 4V1DA 2FEEI 1T1YA 2ZOKA 1MEXL 3O9WA 5JHDB 1P69B 3LN5B 1L7IH 1UWEL 1LEKA 3IVKB 1YPZF 3BEWA 3I3DA 4KI5D 4HCRH 3QO1B 2P7TA 3P30L 1WZKA 1T83A 1MQKH 1J5OL 1OF2B 5BXFA 2AV7B 5TQ0H 3GMLA 3VMOA 3TA3C 4M93C 3T3MF 2EYRA 5T33H 4PG9A 3F7VA 2XY1A 2R1WA 4LMQE 5D72H 1WT5C 4X5LA 2DQUH 2PW2A 5GS1B 1KIRA 1FVEB 4OTXL 4J4PA 1KG0A 1NKRA 2DS4A 3HE7D 1C7SA 3K7UA 3ULUD 2G75A 4J8RB 4R4BB 1KJ2A 3G9AB 4M7ZC 1D5IL 3MNWB 4G6JL 1P84J 5KSUB 1VACA 3KYOA 1BVLB 1J0YA 1KULA 2F54B 4E42A 2IC2A 4G5ZL 4RWYH 5DD3L 2GSGA 4I3RL 1JTPA 1KIPA 4WUUD 5DWUL 2WBJA 4H8WC 5KAQG 2O5XH 3MLXL 1JPSH 1BX2B 1ADQL 3HZMB 4BZ1L 1NGZA 4GRLC 4PRAA 4WI6A 3V0VA 2FEDC 1S9KC 3VXMB 4I3SL 3E6HA 3PNWA 1P7QA 1KB5H 2W92A 3WIFA 4PGBA 2AJXL 4XNXH 3NCEB 4QF1A 4G7YH 4HS6A 4MB3A 5CJQL 1JFQH 2KBGA 2VZ1A 4MAUL 1B4JL 1F3JA 4NN5B 2ZOKB 2LU3A 1ZSDB 4N0UE 1JRHI 3P9WB 4MD4B 2K7PA 1CE6A 4TULH 4OM1H 1P2CA 1P53A 1F3DJ 4OLXH 5T1LD 3UZVB 5EG6C 2BHZA 3RUGB 3SDDD 2NY2B 3G5YA 4UINL 4B7LA 5DK3A 1E0OB 4FTVE 3V0AC 4JFDA 1L0YA 4PJEE 4TRPH 2FCBA 3KWWB 2Q8BH 2DQCH 4X6FB 5DJZA 4DVRH 2KQNA 5T1MA 1PAMA 4PG9B 4PRBA 1G6RL 3KGRA 1ODAA 4MNHB 4FP8H 2H45A 1KIRB 3ME0A 4LAQL 4H8WL 3U9PL 4PRHD 3SY0B 4ZOBA 1EK3A 4HWUA 1G9NC 2G75B 3ALWA 1CGSL 1TNNA 4XP1L 4F7EB 5B39B 4XBPB 5I6XB 5F72S 4FQXC 4DJMA 2O5ZH 3FT3B 4C56E 5KVFH 4DK3A 1Q9LA 1JNJA 1FRGH 4OAWB 2ERJB 2AJUH 2B1HL 5GGTH 4P23A 3B9KA 4E42B 5KJRL 4BZYA 5BRZE 2DYPB 2OK0H 3HNTH 1NGZB 1OAUL 4JPIB 2PF6A 4PRAB 4TTDD 3TT1L 3V0VB 1M7XA 1LO5B 2GJ6B 4G3YL 3B83A 1P7QB 4U1LA 4TN9A 3LY6A 3R1GL 5CZXD 5FYLL 4XHQA 1GHFH 1OD7A 2OZ4L 2E9BA 3MV8B 4HAGA 4Y16A 3WO4B 5J12C 2R0ZL 3WUWG 2EEDA 1S9YA 5F9OH 5JZ7D 2UZXB 2Z31C 3J8F7 4I5BA 1CFSB 5EWIH 3RTQB 4AEIH 3SE9L 2OI9C 1G9NL 1A6ZA 1JNHB 3F7QA 4WHCA 1X5KA 4P9HC 5MERB 3C6LC 5DTFA 5IHLB 1MAKA 2X89D 2VH5L 1NDGA 5DGRA 4JRYA 1B0GA 1TPXB 3IDUA 5D1XC 3W0WB 5DJZB 3U0PA 1EPFA 1WICA 4JGJA 5C0CE 1YQVL 5C0AB 4PRBB 2C1OA 3BPOB 2FO4B 4HQQL 3BPNC 3TBSB 4JZOA 4X4ME 2HMIC 4HUKB 3X13A 3GBNL 2E7MA 4KZDH 3CSYB 4IRZL 1MHPH 2BJMH 1PG7L 3NCYP 2HTKD 3N1GC 3AS1A 1IFHL 3VCLB 2C7UA 2MQCA 3A6CL 2VMFA 3MSPA 1LE5A 2Q3ZA 4NUJA 4P23B 4WWID 4J12A 4DK6A 3KLDA 1MLCB 4ZFOA 2PO6B 5ITFA 5JHDE 1CLYL 4HUXA 4IHOB 5BW7A 2I27N 3SDXB 2DLIA 1MFNA 2NR6C 4LNRA 2ZNXA 4M3JA 1QLRB 3LQAH 3RBSA 4EIGB 1AE6L 4JLRA 5C6WH 3WDIA 4P9HL 5IW6A 4QOKB 4Z5RB 1BJ1H 4P2QA 3CVHH 5DYOA 2VDOL 2EDQA 4OZ4B 3SDCD 4NQDE 5E2VH 3SKNA 5J1TC 2PYEE 1S7TA 3H9SD 4I9WD 4B7IA 1ES0A 1L6XA 1S9YB 4M6OH 2BOBB 3FZUC 3MV7D 1RHFA 3MCKB 5I1HL 4LSTL 2R29H 2YRPA 1DVFC 3QDME 2D7PA 1A6ZB 3T0ED 2RQ8A 5I1DB 4NCC2 4Q2ZA 1A1OB 2BVQA 3O8XD 5GS2H 2BHYA 4FQ1H 4JFFB 2R2HA 3V5KB 5L6YL 1B0GB 1S7UB 4HFUL 1BP3B 4QTIL 5FUOH 4NCC1 3U0PB 1TETH 4TUOA 1XGPA 5IB2B 1EERB 5F7HA 2C1OB 1WWAX 2BVPA 3VXTA 5E24E 1PYWB 1J12A 1NFDE 4OUOA 3X13B 4UV7H 3O6KL 4NJAL 3RY6C 4R26L 1OSPL 2JB5H 5CINH 3WHE0 2BFVL 1WBYA 1P84K 4LRNL 5A2FA 2QADB 1J1PH 4YHKH 3C2AL 3NIFF 1Z6JT 3CMGA 5A3ID 4GBXD 1LE5B 2IJ0C 2VLME 5T3ZL 4F7PB 4KV5E 2AK1H 1J0HA 3NFSH 1HI6B 4NQTA 3RL2A 4WEMB 4FQLL 4ZFOB 3CFBA 3O2WL 1JMZA 3QHTC 3I2CL 5ITFB 3QFJB 2YMXH 4LKXB 3OJVC 5BOZG 5L9DH 1ZA3A 5IG7A 2VERN 4S2SA 1QRNB 3WUWA 4JLRB 2BC4B 2MOVA 5IW6B 4XBGA 4P2QB 1DDHB 5DYOB 4TPRL 2FH6A 4JREB 3SKNB 4OV5A 1BFVH 4PG2A 4KDTC 3UZQA 1YN7B 5F7EH 4HK3J 3CDCA 4PJBF 4Y4FC 3TEUA 2LTQC 1JI2A 3O6FB 2NXYD 5FHBL 5I9QB 3BKCL 3BESR 5D93B 1BQHA 5T3XD 1QFUH 5GS0C 5E99L 1ZT1B 3PIQB 5KSVB 4PJ7E 4GXUM 3X3FH 5F1IA 4OFYD 3IDMA 3U7WL 3MJGX 5F8RC 4EOWH 4S1QL 3L3KB 4D8PB 3MLRL 4EN3B 3A0OA 3W5MA 1A64A 5IB4B 2OJEA 3MRBA 3KHQA 1JGUL 4OD3L 3VXTB 1BM3L 2B39A 2AP2A 1EO7A 3PP4H 3EDEA 4LCUA 2KKQA 3L3IB 3D39B 1X5JA 3UZEA 4Y4HA 2QV2A 3P9MB 4U7KA 4PV9A 1I9JH 3W11C 1ZLSL 1GGYA 4KPHH 2NTFB 3ARBD 4V2BA 4NO2A 1IC4L 1WJ3A 2V5YA 2EDRA 2JK5A 3FB8A 1MFBH 2AEQL 4QTHB 4NIKB 3QPXL 4XCFL 2K7QA 1I1FA 1K6QH 3VXRA 3S3JA 3D3VE 1OAXH 5E8NB 5GS0L 1FH5L 2FBJH 2FX9L 3D5OF 5HHOA 1ZANH 1TDQA 3FO1A 4U1KA 5SWSD 2JKXA 1RUKH 1GGIH 1H0DB 4XP9H 4ODVL 3HZYB 1HNFA 4MHHI 4NBXB 3LSOA 5D8JH 1C16B 3MRHA 4HT1L 4ZUWA 2EE3A 5F7KC 1FORL 3EYUL 4OFVA 5D7LE 1XCTB 1LO4H 1YEKH 4ODHH 4U6VH 2MHAA 1TCRB 3AXLA 3LDBC 4O58H 4YDVA 4YQXL 1RFDL 4LHUD 3QAZB 4GH7B 4L3AA 2VR9A 4R8WL 4KJYB 3IFPA 4OJFH 3TCXA 4NZDA 4PB0L 3S35H 1JHLH 3OGOE 5D2NB 1IGFH 1INQB 4O51A 4TUJB 4XTRC 3UTSA 4M4PA 3KR3L 2R56L 5E2UH 4P99A 4XAWL 5I1KH 3ARVA 4I48A 4QOKE 1BECA 1IZJA 2Z0BA 4XI5D 4XP5L 2EE2A 4PRID 4LBEA 5AWNL 4AENA 4DUXA 4C54A 3D2UA 5KN5B 4NO2B 4KRPB 3QQ3B 4PJCE 4XWOD 1CFTA 5J1AA 1GZPA 3VU2A 2AJYH 1WISA 2AAVA 1TZIA 4OT1H 2FX8H 5HHOB 1PDKA 1YYML 5KOVC 5IR1A 4M1CD 5BS0E 5JNYA 5ICXA 5DUPH 4GOSA 3NIDE 4LRIA 1AXTH 1A3RH 2AEIT 4NGHL 3VFVB 5HHVL 1WAAE 2DDQH 3PV6B 4MXVE 2Z92B 2E9JA 3LSOB 3MRHB 1W0VA 5BJTB 4QKXB 5KSBA 1K3IA 1JZ6A 3HAEH 4EEEA 3MJ9L 5FEBA 1F3DH 4X98A 5I0DA 3UAJC 3MO1B 5A2KH 4Z7VA 3I9GL 5F7FA 1BFOA 2FL5B 3PGCA 5CILL 1NAMA 3VDBA 2QSCH 3CIQA 3L9RB 3LVEA 2HTLD 4LPVA 5KOMC 2UWEE 3RDTA 3ZDXE 5EU3B 5DSCB 4HWBA 3WFDH 4F15B 1F4YL 4YZFF 2CLZA 5MP6H 3FJTA 1KOAA 5D4QA 3QUYC 4HS8H 3MGOA 4GMTL 4MWFA 5J06A 1KEGH 4QRPD 4N90E 5E6ID 1S3KL 3HC3L 4A6YH 4PRPD 2MTPA 2E6JA 7FABL 1FYHB 3RHWK 5L7XL 3OAYH 2WBWB 1X5GA 2HLAA 2ED7A 5IEKA 1OLLA 4J3XA 1FFNA 3OL2A 2WLZA 2J5LC 3BPCA 1FAIL 4ZNEA 3RVWC 1I9IL 3BP6A 4NWTH 4YHLH 2VIRA 3CLEH 1TZIB 1LK3L 3TCLA 3IGAA 3MJ6A 5FIEA 3MRGA 5ICXB 1BZ9B 4R4NC 1M7DA 4W6WB 4RGOL 4HKZA 1W72L 1AR2A 3T1FA 4POYA 1J87A 4KHXL 5DO2C 4MJ5A 4F7CA 4JRXA 4POZC 5MEOA 3SOBL 1W0VB 4E9LA 3QNZB 3HNVL 3X11B 1K3ZA 4UT6L 2HG5A 1U6AL 2P8LA 4U1JA 5FFLA 1LP9E 1X5XA 5T1KD 3D87B 4P3CL 4GW4A 1ZVSA 2EDKA 4JPKH 3FQTB 3QIBD 1MJJA 3NACH 3WO3B 4OZIF 3D6GA 5IVXF 4D0DB 2ADGB 2Q86A 4K3EH 1IAIL 5L2KD 4OFDA 4YO0B 2NY0D 1R3HB 4JZNB 1NCDL 2CDEA 5ADPH 3BMWA 4WTXA 2FO1A 1JWUB 5A1AA 1SVZA 1HXYB 3FQNB 1TJIL 2UY7A 5ANMB 3HE6D 4CJ1A 3OR7A 3GIZL 5LXGL 4K07A 4PYGA 1G7QB 4DFHA 4L4VA 4KI5C 5IT2L 4RQQA 4LSPH 1A3QA 5FF6B 4IBLT 1AI1L 1G7LB 3PHOB 1FIGL 2NXZD 4GW5B 1YEEH 1V7MH 4KKAC 3TPKA 2VXVH 4ZTPH 5GGQL 5ADOH 4QRRD 5AUMA 1KJ2H 1QFWL 2A6IA 2IALA 4JFPB 1Z2KA 3S9DB 1AIFB 5BOPA 3KPSE 1U8IB 4RSVA 3BDYL 3AY4A 3EFDL 2XWTA 5CGTA 3DSNA 3Q5TA 1EV2E 4OLVL 4PJIF 2DLTA 2GJZB 3TCLB 4WTZA 3ULUC 2J8UA 5MEPB 4HKZB 1MFCL 2ATPA 3H3PL 3T1FB 1MCDA 1FO0A 3D85B 4ZODA 3BHBA 4IRSD 1UFUA 4BKLA 4U2ZA 1OQXA 4FNLH 4U6XB 4U2YA 3HNSL 5HJ3A 4U1JB 5E5MA 1UC6A 4PBWD 1OGAA 3L3GA 1OP5K 1QSEB 2ZOLB 2FHFA 3PF2A 3RWHB 5H35A 1AFVL 1BMGA 1W8OA 5L0QB 2MPAH 4U6YA 4X9GA 1F6LL 2YWZA 1MCQA 4XCYB 2H26B 4UTBH 4FOMA 4FFWC 3L5WA 4JFHD 1OWRM 1LEIB 1DN0B 2ZP0T 4F80A 1E4XH 5TQ2L 1MNUL 3HUJA 4O2CA 4XNMB 1CXIA 3OZ9H 5I16B 5EO1A 4M3KB 5C0JA 1JGDA 5CP3A 3B2UD 4HK0A 3MGTB 3THMH 1CBVL 2ICEA 3QUXB 3ULUL 2B5IC 1N6QL 4GRWB 3LQMA 3LEVH 3SDDC 2NLJB 4TVPH 3O3DA 3A67L 5IROC 3BZDA 1PKQE 2QR0A 4Z78A 4EI5C 3JXAA 3GSRA 2WAHA 1D5ZA 1WZ1H 3QFDA 1MCKA 1T04B 3AMKA 5I76A 1WFTA 5IMOA 4RX4D 4LSRL 4ODBD 3ZL4L 3MMEB 1UM5L 1VEMA 1U3HB 1F6AA 4GT7A 2DIBA 4U7MA 4B53A 5J57B 1YEHL 2ATPB 1PKOA 1AJ7H 1KTLB 3QI9C 3CZFB 2W9EH 2VNCA 3ZDZE 1FPTL 4YDLB 1U9KA 1WBZA 4HLJA 5DLMH 1VB9A 5ALBL 1WQVT 1GZQA 1DE4A 3ULSB 2X4NB 2DQDH 4HKJA 4F2MA 2L7JA 3ESVF 4GJTB 4ODUA 4OCNC 1BVKB 3ARDD 2XPGA 4LHQB 4EDXB 3L5WB 4P2OD 3SHSA 3RI5F 5I15H 3TBYB 1NGQL 4Y4KA 3MA9H 3GJFA 4PBXA 5IMKB 5EU5A 3GO1H 1KB9J 4P4KA 5DFWH 3QBTB 2BCKB 1IARB 3MXWH 3QDJE 3VGEA 2LQRA 1V7NL 4IIQC 5DK2A 1IC5H 3LKSA 1URLA 1RURH 3PWPA 5CKGA 1P4BL 5C08E 1IEAA 4HIXL 3PGDB 3V6FA 3O3DB 2BOCA 1T2JA 2XZAH 1IZKA 1T7YA 2QR0B 4C4KO 4PJFE 4KI1A 3DX8B 3VXPB 4CVZB 3CC5A 3MJ7B 4DKFH 3MBEA 2BNRD 1D5ZB 3QFDB 1JNNL 4LEOA 3K8MA 5I76B 5IMOB 4KHTL 5J1SC 2KZWA 4HXBH 3RWFB 1JGLH 4NPYA 5J9PA 5EO0B 3G6JF 5AG9A 5ALCL 2PXYD 3V4PH 3R0MA 4XP6L 2HTKC 3U4BL 3IT8D 2A9NH 4B41A 3GSWB 4UQ3A 2P5EE 3NABH 5FHAH 5DMKA 2N4IA 5DQ9B 1K4CA 1MCWW 4X4XB 4GKZA 4OZHF 4O2EA 3W9EB 3MRFB 5DJCA 2IEPA 1UWXK 5EA0H 2EDTA 2CIIA 1F2QA 1HQRB 2YSSA 3BP5B 3SDAC 1MCEA 4NN6B 3H7LA 1OP5H 4M61A 5KSAD 3DRTB 1C12A 1QNZL 4X6DE 2AJ3B 1SEQH 2WUCL 4X9IA 2XPGB 4UILL 3VFMA 2H32B 4M03A 5TJWK 4L4TE 4P46D 1ACYH 3MA7A 4Y4KB 4M1DH 3VD3A 4PJEA 3SDCC 3CDYA 5DMYA 3DV6A 3X17A 5J56B 1JHTA 2EDOA 4JFED 1EAPB 5C07B 1PQZA 5D2LA 3VFUB 1QR1A 4M7KH 2IG2L 5DK2B 4XWGH 3LKSB 5I66B 4R7NB 3L6FB 4S0SD 4OCSL 3W39A 4G8IA 2IAMA 2J3SA 3T0EC 1XH3A 1VFAA 1AD9B 2XWBA 5IQ9A 3V6FB 1CK0H 4ZO8A 3VWKA 4NNYB 3CLFL 1EMTH 1IE5A 4C56A 1DR9A 2G2RB 5SWQB 4LEOB 1F11A 1MRFH 1U8PB 4NO0D 3LKOB 3M8OH 2C4XA 1IM9D 4OGZA 3O6MH 2P43B 3N9GL 2HP4A 4OCYL 5EBMB 2P24B 5LWYH 5BRZA 2P5WB 4ZFFA 2YD4A 1QYGL 3QRGH 4MCYA 2A6DB 3SKMA 4BH8B 1XF4A 4MHHG 1N0XL 3EJJX 4OLYH 4UQ3B 2R2EA 1HHHB 2AEPH 5DJAA 1FLRH 2HJKA 5A3IC 1A7RH 4GBXC 1K4CB 3U4EA 3S6CA 1DBJH 2VDNH 2DTML 4P3DA 3KPRB 3O3BA 4FZEH 4GSDL 4F7TB 3BEVA 4KY1H 5IHZB 1LNUA 3UYRL 2PTVA 2NZ9D 4JKWA 3KDMA 1NMAH 4UOW1 3DPBA 4AQ1B 1U3ZA 2DLGA 3BUYA 5IF0B 3AREC 4OCWL 3NH7H 1QQDA 3TWCH 1ZS8A 1HCVA 1OY3B 3P0GB 3BVNB 5GQBA 5DRZB 5E94B 1KYOJ 3BYTA 2DOCA 2DKSA 1JHTB 1N64L 2GQHA 4E5XA 4HJGB 4WW2F 1ZTXL 2B7DT 1C08B 2ESVE 2ZCKL 4X4MA 3EYFA 3T4YA 3TO4D 1XH3B 1NLDH 4Y5VA 4XT1C 2HN7B 3VWKB 1G6VK 1K2DB 2NX5B 2ITCA 3MACH 4GAYA 4PRNA 1GCFA 2JJSA 3F5WB 2FBOJ 5D5ME 3RVTC 4OCXL 3K80A 3LKQA 3QUZD 5GISL 4BFEA 3TM6A 3FRUB 3SE3C 1KBGL 4OKVA 2QQKL 4JPWL 4MZ3A 3BJLA 1MVUB 3FTGB 2H6PB 4PGCB 4MCYB 1HHGA 1KSRA 4NKOB 1ERNA 1MPAH 5F1OB 2AQ3A 2GKIA 2LE9A 4GMSH 4MCZB 5A2LH 5HD8D 3CUPA 4QHLA 4QXUL 4DN4H 4CMMA 3D25A 2E7LA 3E8UH 4H25B 3B9EA 5IHUH 4NQDA 3ARBC 2XZQL 4GS7C 3V2AR 4P3DB 4UIMA 4LPUA 2ITDB 2VC2H 1DBAH 5EU6D 5IFAH 4P48A 4RZCA 3T0WA 5T3XL 1LO0H 1MH5A 2DQGH 3C5ZA 4G43A 3MCG1 3FB6A 5C0DB 5LBSH 4ISVA 1KB9K 1ZS8B 3A6BL 5BVJA 1PD6A 1KTDA 2FDBP 4LKCB 4GKOA 4NJ9H 5I71B 4R4FH 2HJFB 5DUBA 4P2RA 2RJMA 5TGBA 3F12B 4J7RA 1C5CH 5IOPA 3RWGA 1JNLH 1AGCA 3GB7B 4N1CA 2RB8A 5B3JF 3MNVA 4Q0XL 2Z8SA 5JIPA 1FSKB 3IU4L 4JKMA 3ULVF 3ULUE 3GSNB 4IRJA 2W60B 4AH2A 1C5DA 2A9MH 3VE0B 4X6EB 2EXYD 3OG6B 4ENED 3SKJL 1IAII 4PJHB 5JIKA 4YC2B 3TF7C 4PP1D 3WHXA 2NY3D 4PJ8A 4BSVB 3JTSA 4GKNA 1BF2A 3LKQB 4LLYB 5B21A 4JG0L 3EO1B 3JV6B 1A4JA 4MNQD 2F5AL 2W1NA 2IPKA 1HDMA 3BRFA 3ARGB 4WUUE 1ZOXA 3P40A 2I24N 4TUKL 3DROA 1WUNT 4DKAA 4KTDL 1T7XA 3HR6A 2O5XL 5BZDA 3MJ8A 3VWJC 4QHLB 4AL8H 1F6FB 3D25B 5AD0B 4YFDB 4JFZH 4XI5C 5JOPD 2GW5A 2VE6A 1A21A 4ONFH 3U0TA 4MA8H 1CXHA 1YPZE 2IAND 4G7YL 4S0TD 3V5HA 5IKCB 4NM8H 1QFWI 1ZLVK 4XWOC 3PHSA 5ITBL 2N7AA 2JELL 4MSWB 5C0ND 5HGAB 4RZCB 1PLGL 3T3ME 1TTFA 2EH7L 1JPFA 4HPOH 4G43B 2VLRB 5FGCB 3U48A 3AROA 2PR4L 3KPNA 5KTEL 2VDKL 5DMJB 5FB8B 5JW5A 3UTZB 3QEUB 4WFED 1Z3GL 3QQ4A 3LQZB 1CT8B 2P42B 3EO0B 4WO4D 3ULVD 1NAMH 1FNEA 4P2RB 5DUBB 3RX7A 3BH9A 3CK0H 4DVRL 2NPLX 2D0FA 2EIZA 3FMGH 2QQLL 1D5BA 1AGCB 4XRCA 2P5WE 1S5HA 3ILPA 4PRHE 5E08H 4HWBH 3ARFD 1OARH 4UZGA 5C0IA 1C5DB 4NUGH 4KTEH 1E6OH 3SJVD 1KXTB 5CEZD 3MFFB 1F2XK 3MOAL 3B2VH 3QCTH 3IFNH 1MVFA 4AQOA 3P9LB 4MJ4A 5D7JA 4MYWB 5T1DH 2O5ZL 1RJZA 1FBIH 4LDEB 3AGVA 1YUHA 5BV7B 1WCBA 4GKNB 1G7JA 1M6OA 3IDYB 5IMLA 3P4LA 3GSVA 5HGGS 2AW2A 5FUZL 4TYUA 3MLSH 4AIXA 2B1AL 5SWZA 1KCVH 5C0BB 3D3VA 2VABB 5E6IC 2X42A 1A7OH 1ADQA 5DJ6B 5GRUH 4IMKC 4DCQA 5ESAA 3UO1L 2R0WL 4P2YA 5FYKD 1NGYA 5TFSH 4OCLC 2VE6B 4Z0BH 1KFAL 1O7VA 3V5HB 4PIRF 3C87A 3WFBL 1FV1B 2LU4A 2AXJA 1INEL 1BJ8A 1WT5A 2YD2A 3MBXL 2EKJA 2AK4B 4MS8D 5CD5D 5EC1A 5ID1B 5HY9B 4CNIB 4U6HA 2AJSH 5EWIL 3BKJH 1KYOK 4JKLA 2VL4A 3KPNB 3LD8C 5JW5B 3O45A 2R1XA 4YIQA 4OGYH 2OJZL 3JWOH 5LQBL 2R69L 3WN5B 3BH9B 3CXDH 4XNZB 4ODSH 1KT2A 2UVEA 2OL3L 1LQSR 4XRCB 4N9GA 5EZIL 1EEYA 1AO7D 1GIGH 5JXAH 4OIBA 4RAUA 4K23H 1LK2B 3O2VL 4YJZL 1K9TA 1H8NA 3IDJB 5DI8A 2VXUL 5C0IB 2LAAA 1T6VN 2BY1A 4GW1A 4IDJH 3MUGB 4K9EH 1YYLL 4KXZI 1YUHB 1I8LA 1WCBB 2NY0C 4FFYH 4RA3A 5IMLB 1F8TH 4PJCA 4NFCA 4DWHA 3ZYJA 5I1IH 1JWMA 1I7UB 5SWZB 25C8L 2H9GA 4BFIB 3CXHJ 3VW3L 5JLZB 4XPGL 1QP1A 4PRDA 3ELAT 1M1SA 5BS0A 1GGBH 1X5YA 1NGYB 2Y5EA 2D7TH 2NXZC 3TA3B 1MHEA 4M93B 4IJ3B 5EOQH 2J8HA 1I1AD 1X6NA 1Z9MA 3H9SE 1CICA 2VZSA 1E27B 4M62L 2OZ4A 3BZEA 4PLOB 3U9UB 1RZKH 3QZWB 5IFJB 3RNKA 2WUBL 4KTYA 3RVUC 1FO0H 3MV7E 1QLFA 4NQXB 1ZLVH 1FVCA 3T4AA 4OD2A 1FGNL 1RUMH 4LCWD 3HPJB 2R29L 3MV9D 3R8BB 5FYJH 3UP1A 5F7YC 4YHIA 4M7ZB 1A6TA 2W65B 4FQXA 3BSZH 4OSUH 1BIHA 4L8BA 2R1XB 4ZS6C 1SYSA 3UJTL 4UOJA 4IRSC 2CIKA 2UWEA 3QEQD 4LARL 1T7WA 5DJ0A 5CEYA 4K7PX 1MREH 5EB9A 4FQCL 1G6RB 2CK2A 1MLBB 5I75C 2A74A 4N9GB 4QNPF 4RAUB 4RIRB 3WNMA 1IGML 4KJWD 3DECA 3WDHA 3QG7L 1PEZA 1WFOA 4MJIB 4GRLB 5CGMA 4JHAH 4PJGA 2VL5B 2FJGB 4OZFG 4M48L 5GGRB 3OR6A 1EA9C 5CP3H 4FA8A 4PV8B 4PLKC 5KZCB 1JVKA 1XGUA 3I6LD 2CRMA 4WWKD 4NOFA 1ACZA 3ARUA 5EORH 1OP3H 4M5ZH 1JWMB 2DQJH 2Z31A 4HBQA 3TYGH 3QXAA 4U1GC 5FGSA 3WXVH 3V0WL 2BP3A 2VSCA 1XGRB 3RPKA 3ARQA 4OCRH 4PRDB 5HHMD 3M17A 2A77H 3SKOA 4KH2A 2UZIH 2R0KH 1MHEB 3WLWD 2BVTA 5D1XA 5C2BH 2FD6L 1OOAA 1YEIH