4TS6A

Crystal structure of the rim c2a domain from drosophila.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
PIEGRLQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAHHILDDEAEWYQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Rab3 interacting molecule variant 2
publication title Crystal structure of the RIM C2A domain from Drosophila.
rcsb
source organism Drosophila melanogaster
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ts6A00
2X38A 4LDCA 1DJXA 3QR0A 2EP6A 3F00A 4L23A 3RDJA 5EDSA 2UZPA 2A4ZA 3IM1A 3R7RA 3APFA 2WXNA 4L2YA 4TUUA 2LHAA 1DJGA 4WWPA 3DPDA 1UOVA 3OHMB 5G55A 2ISDA 4F91B 3LJ3A 4FJZA 2CJSA 4LCVA 4PS3A 2WXHA 4TV3A 3QARA 3DBSA 2QZQA 2WXIA 4OVUA 5G2NA 3KWTA 5KJ7E 3KWUA 1UOWA 4GNKB 2N1TE 1A25A 5CCJA 2CM5A 4V11A 4ANUA 1E8ZA 3ENEA 2NCEA 2CM6A 3IBEA 3QR1A 4KZ0A 4AJWA 2DMHA 3PREA 3NZSA 2YRBA 2WXOA 1QATA 1E8YA 3N5AA 1TJMA 2WXMA 3L9BA 3L08A 1RLWA 2CHDA 1E8XA 4EZLA 3PYCA 2K4AA 4WWNA 3GPEA 2CJTA 2Q3XA 5JHBA 3TJPA 3RPBA 4AOFA 3W57A 4FA6A 5H4ZA 1YRKA 4WWOA 4QJ4B 4TS6A 3F01A 4PS8A 4Y1TA 3S2AA 2ENQA 4DK5A 2ENPA 2QZ5A 4J6IA 4WAFA 3TWYA 2K45A 3PRZA 4KITB 3SD5A 1RH8A 4NP9A 3MJWA 1WFMA 4KZCA 4BGDA 2K3HA 4FJYA 1W16A 1QASA 2WXKA 2ENJA 4WEEA 2CHZA 3HHMA 2NSQA 3NZUA 1WFJA 4Y1SA 5H4YA 2WXLA 2Y3AA 3W56A 2JQZA 4F1SA 4A55A 2WXGA 3ZVVA 5CCGE 1DJWA 3ZW3A 4QJ3B 3ML8A 1DQVA 3ZIMA 4HLEA 2B3RA 2Z0UA 1DJZA 1E90A 1DSYA 3HN8A 1BCIA 3L13A 4IHBA 4URKA 3L4CA 2RD0A 1UGKA 4ANVA 4FHJA 4GB9A 2WXQA 2FJUB 4QJ5B 3PFQA 2WXFA 1HE8A 4HVBA 4FADA 3JZYA 2BWQA 2R83A 4JPSA 5JHAA 4NS0A 1E8WA 4OVVA 4XE0A 1BDYA 1W15A 2WXPA 3M7FB 3HIZA 2YOAA 4IQHA 3R7QA 4ANXA 1RSYA 3P2BA 4G11A 3T8MA 4XZ4A 1CJYA 1GMIA 2V4LA 2WXJA 5CCHE 3L54A 4XX5A 2WXRA 4NPKA 3CSFA 3OAWA 5T8IA 2CHXA 4FHKA 2CHWA 4L1BA 3F05A 3APDA 4F92B 3QK0A 3B7YA 3L17A 4DNLA 1DJHA 2FK9A 1BYNA 4PS7A 3ML9A 4ICXA 3QJZA 4LT7A 1DJYA 2K8MA 2ZKMX 4EZKA 3FBKA 4EZJA 4QAMB 4FULA 4FLHA 1V27A 2D8KA 3L16A 1DJIA 3APCA 1E7VA 4ICWA 3TL5A 3PS6A 3QAQA 4ANWA 3FDWA 2KI6A 2Q0ZX 4BFRA 1TJXA 4F93B 2DMGA 2NQ3A 1K5WA 1E7UA 2A5UA 3NSJA 4MJJA 4NPJA 3F04A 3CSTA 4L1LA
chains in the Genus database with same CATH superfamily
4ALAH 2DQUL 4WW2F 3CSYA 3IAPA 4FCAA 4PRIB 5DJCB 1G1KA 1OP3H 1RUKH 1U2CA 2FDBP 5LWYL 3RDJA 1CXHA 5CJ8A 4ELMF 4UTBA 5KSBB 5C86A 2XG4A 2J55A 2OW7A 1CDYA 2AF2A 2EYSB 1FVCA 4XNYH 3EJUA 3FU6A 2LLNA 4K71B 1M56B 2ZD0A 1U95B 3O9WD 2WUBH 4OZHE 5DGRA 5GZND 4ODVL 3T2NL 4YNYA 1K6QL 3II1A 1LNUB 2DMBA 3NACH 3W0WB 1YEIH 3VX1A 4ZOBA 2QV2A 1BZ7A 4RSVA 1WWBX 4UQDA 3QR1A 3ETBJ 1FC2D 5FFGA 4LLMB 4JAMB 2ZTBA 4G6JL 3EUDA 1HQ4B 2B2XH 3L1OH 3VFWA 4JLRB 4AIZB 2XIBA 3TFKC 5T1LB 2WVSA 1I8KB 3EJQA 3GZQA 3KXFE 1NCDH 2F7IA 3QFDA 3KLQA 2ZOLA 3HLAA 2X4RA 3QG6A 2BCKB 1UTDA 2GKIA 4N90E 3PLYA 2P45B 3BAXA 3EJJX 4U1KB 3KPLB 2IJ0C 4O9HL 4WAFA 4YJZL 1CFVH 3F83A 3KPNA 5EBWA 5AFAA 1HWWA 2XN9D 3E0GA 4ZQTA 2K3HA 2AXJA 5DFWH 2J8UE 1UJTA 4Y2OB 3D51A 3PWLB 4Q2ZB 1W0VA 4FMFA 5DTFB 4ZRGA 4H8VA 1PAZA 1S7TA 1IC5H 1AZUA 1MXDA 2G3MA 4PJ8B 3FFCD 3TYGH 5EU6E 4ZW5A 1NGZA 1SYSA 4XWOC 1RP9A 3VFTA 3TN0A 3RFZA 2CO6B 4FQXD 2P1YA 4K8RD 1SY6H 2EDRA 5CJOH 3VVVA 4B97A 1FG2B 5HHQA 1ZS8A 2R2BB 1YMMA 2XZCH 4WNSA 2KUTA 3CDZA 3FTGA 4XP4H 2YPVL 2OXGA 2H7WA 5KWYC 2ZWYA 5LQBH 1DSWA 3HNVL 1JPGB 2SEBB 1H9DA 5E99H 1OSZB 2AJYH 1J18A 5TE6H 4KUCF 5TE7H 4OJCA 4BH8B 2BP0A 4H1LG 4XCNB 4PJBE 1I7ZA 2UXTA 3BIBX 2DI7A 1URIA 3NZ8A 4QRSB 4XP6H 5DD0L 1OM3H 4Q52A 3MCLL 3AXHA 5JA8B 4PS7A 2GAZB 1GL4B 1LYQA 4X4YA 1FO0H 1A3RH 43CAB 1JI1A 2FQFA 1PAMA 5DHMC 5I16A 4IRZA 1WE5A 1XT5A 1RUQL 1AXSB 1FAIL 5DUJA 3E7JA 3UTPD 4HJGA 4N9GB 3Q6GH 1DQMH 1MVUB 4LAJH 5B1BB 4NAJA 4OM0L 5F1OB 3FB8A 3I9IA 2NX5D 4AL8H 4EDWH 1KULA 5CAYB 4K15A 3L3IA 5IP4A 3N6YA 1SYVB 1XEUA 1XH1A 4XR8C 4NO2A 4KROD 4YL4A 4X6DF 4N5ED 4IOSA 3KLKA 2NY1C 4CMHC 5C09E 5MEOA 1VB9A 1HX0A 2NR6C 3BZ5A 3RFRA 4EE2A 1DLHA 1EV2E 1Q38A 4NWUH 5JXAL 4ZX3A 2O1AA 3IMSA 1M4KA 5E9DD 4ZX5A 2EDDA 2E46A 1U58A 4QT5A 1JZEA 4YSPA 3RFZC 4TNGA 3RHWF 4G7YH 3FFCE 1TJMA 5F7UA 3FHQA 3DV4A 2UUDH 4IGBD 3C09C 5PAZA 4PJ9A 3K2MC 1IEHA 4F33A 1T1YA 1TU2A 3VXMD 2ZOTA 1I7UA 1U8PA 2Y9RT 4LRIC 1G6VK 2MHAA 1TETH 2JFCA 3DVIA 1RERA 4YVNA 1TXKA 2AEPL 2BVUA 2HVBA 2ZXBA 5HYQA 3RZCB 4UDTB 1GIGH 4EI5C 1F5WA 5JORA 5AZ2H 5E2UL 4ZW6A 2D7QA 3F85A 1BZ9A 1X5MA 3E6FB 2YARA 3MRFB 5GJTL 3QUML 3VFVB 3K2UH 2VE6B 3D69B 2VIRB 3FQUB 1RZPA 3WY3A 4ZFGH 4M6OH 5IW6B 1QFWM 4B7IA 3CD4A 2HKAA 5F3HB 1HHGA 4RZKA 2ZYRA 3G6JE 2BSDA 4MXQD 2UZIH 4Y4KB 4Q9QL 4XBGB 3HN8A 1QYGH 1TLKA 3BAIA 1Y07A 4E36A 4XHJC 3VNZA 1E9OB 4FRWA 3CFDB 3OPZL 2X4OA 3BH8B 5JQIB 3D6GA 3G5ZA 3CFEB 3G04B 4LMQI 3ZZ1A 1MCNA 1PZBA 2QVMA 5FOJA 1DZBA 4BKLA 1DO5A 1E67A 4XWGL 3REWA 3QNZA 2XQYG 5IESH 2NT1A 5D7LB 4EN3B 3EFOB 1T20A 2HKFH 4PLJD 4AQEA 1MFAL 3G08A 4IM8A 2VR4A 4AMXA 2ADGB 3RVXC 1YMHB 3K5SA 4L8CA 4RFEB 2E7DA 4JFXA 1OT2A 2BC4B 4NPKA 2W94A 3QDAA 4O5LL 2DS4A 1NL0H 5GS0L 5EBGA 2MCMA 3ILEA 1G9NH 3V0DA 5TH2B 3L9YA 3ABGA 3LIZH 3P4NA 1H15B 1M1XA 4C59B 4XPBL 3IJHA 4Z7NB 3L95A 4NQQA 2WZAA 4MNGA 1BJ1H 1L9NA 4QXGL 3ZTJH 1DBAH 3JVGA 4HD5A 2QQQA 3D0LB 5E9DE 4GXFA 4HIEA 5MERB 5FYKD 1YZZA 2VR9A 3I2CL 4G8GA 5DVMA 3IGFA 3UYPB 5I1CL 4PJ9C 4TKWA 1XF3A 2A2QT 4TSCL 2IALB 2BZCA 2HT4C 4LIQE 4G1MB 4AITA 3VXME 2VZSA 1D7CA 3OKKA 4QXVA 1BQKA 3CX5K 2WXNA 2AK4D 1X5LA 1UKSA 1W8EA 4OD1L 2R1WA 3T0EA 2QKSA 5IUCA 1M42A 4UUJB 3VRIA 5K9JH 4MS8D 3U1SH 4BE5A 5IG7A 2EDLA 3HC4L 4Q0XL 1VKXB 1D3CA 3LEYH 4G9FD 4V1DB 2OMTA 4TMPA 1NTDA 1DUYA 5FOBA 2AEQH 2H26B 4OGAC 3PQYD 1FNSL 4N8PA 3V4VL 1CU4L 3ULSB 4CN4A 4JFFB 3TWCL 4GBXC 1KCVL 1GC1H 4X5XA 1IM9B 2DTML 3MR9B 3N41F 4ES9A 1J1PH 1ZCRA 3DX2A 2DH3A 4M3JA 4WWKD 2GI0A 2NW2B 3INUH 4DKEH 3S97C 5LN4A 1BXXA 4HG4J 1P1VA 2DMCA 2VITA 4GSDH 3D4ZA 4YK4B 1HTYA 4GG8B 4NQDE 1RZGB 4RX4D 5HJ3A 1MNNA 5KS9A 4ZUUB 1NGXB 4I2XE 4YFLI 3HZYB 1YYLL 1GJUA 3B6SA 4AJYV 1IVTA 3EYSH 4Z7OB 3FH5A 1BFOA 1A1OA 1A6AA 2HLAB 3O6FA 3JVGC 2CHNA 2XNAB 4L9LA 3N1MC 3AQXA 1X5JA 4ZD3L 1DUZB 1AHWC 3ZZQA 4QLWA 3PAYA 4L4VD 4KQ4L 3VFSA 5FYKE 5D70H 4TLUA 1EVUA 3DX7B 2Q9OA 5CU5A 5IFJB 1V54B 3TEWA 4MXVF 3BT2L 4OUUA 5IVXF 1J1OH 5T5NF 2OA9A 4UZGA 4PH8A 1Y0LB 2Z31D 4U1MA 4DKFH 3L2NA 2X1XR 4RIRB 1AG0A 4K94C 1JZFA 3L3JB 4JFYA 2AK4E 4RESB 3E8UL 3OKDB 2GT9A 4YC2C 2VXSH 1D6VL 3JV0A 1HCVA 3QFJE 4X4ME 1UFUA 1XQ4A 2FT8A 5ICXA 3STZA 3VSUA 3JV4B 1QNZH 3VW3H 2R4SH 4FJ6A 2KKQA 4G9FE 2HVJA 4AYMC 1OB1A 1M6OB 1QRNA 4KI5D 3SHSA 1UB6A 1RJZA 3PQYE 2B1HL 3U36A 1CYWA 4OF5A 2P5WA 4GOSA 5TDNB 1QSFE 2ZUSA 5IKCA 4NCC1 3D0VA 4M7KL 3IMUA 4Y19A 3U9UB 3SKOB 4R6UA 1T7WA 5DJDA 4NRXA 1BW8A 2A77L 4XVUD 2QZQA 3V8CA 3NVQA 3LQAL 3QEUA 3GBML 2A9MH 2H47C 4GP4B 2Q87A 1SDYA 2WGNB 4G8EA 3PJNA 3CFNA 4FCHA 3ZE1E 3QUYB 2FL5B 4X4KA 1MLCB 2EO7A 5DD1L 5LNEA 2FECI 5A43C 4JHAL 4NEHB 2MQGA 4AYBA 1U3HA 3TPKA 2IIJA 4YBLB 3MOAL 4I85A 4LPXA 1CT8B 4X6FA 2WBJA 3GJFK 2YQ3A 1BD2B 4L4TA 1Z1WA 4LKCB 4X9BA 4YDLB 4G7QB 2AJUL 1MCEA 2WWMC 2VDPH 3BP4B 3TEYA 4L4VE 3DHPA 2BHYA 1N3NA 2CK2A 4Y4HA 2DQHH 1PZ5B 3A4DA 1B2WH 1CDGA 2Y7OA 2H0FA 3SDYL 4LFHD 4UILL 4HUVA 3DIFB 1IT9L 4DP6X 2IG2H 1ACZA 1OANA 4XP1L 4YE4H 5E6UB 3BZ4B 2G2RB 4NPYB 5I24A 5J6GA 4NN5C 3BDBA 4U1SA 4AC2A 3C5ZD 3VDAA 1IC7H 3O3BA 5F3BB 4GW4B 1RZFL 1YUKB 2X4QB 1I85C 1I75A 3BIKA 3FT2B 5B7FA 2NY7H 1E5YA 1JCKA 2V3FA 2YK1H 4P2CG 5SWZA 4R26L 3LNGA 3MLWL 2BXYA 2HH0H 1NIEA 1ETZB 2W92A 5GGQL 1AO7D 4IKIA 5KTEH 4NP4L 2D7NA 1JF1A 2GBTA 4IRZH 5H2BB 4H20L 4WUUA 3RDTA 3EOBA 3VXSB 4G8FB 4B96A 3EO0A 3VGHA 5LBSA 1YECL 4JFQA 1H9VA 5DUPH 1ZLSH 1SPDA 1Q9LB 3KPQA 2ZUTA 3KPMA 4HIIB 1G4RA 1TFHA 2EE2A 3RRQA 3KVDD 4G6AC 3QA3B 1D5IH 3FQWA 1DANT 1CGYA 1R3IH 5K59F 1F2QA 3FB5B 1JPSH 5FWQA 3K6SA 2R0KL 3DXAB 4BZ1L 1HHIB 3BRDA 3JTSA 4OV5B 3SJVB 4ZAKD 3BVWA 1PDKB 1BAFH 1BA9A 4NO0B 1U3HC 4R4FL 2MSPA 3EGXA 3OAUL 5EZLB 3U83A 2X6UA 3MLVH 4JANA 5LJYH 3IJ9A 2BK8A 3P73A 1P7QB 4N8UA 2PNDA 4FG6C 4LDEB 1VCBC 1MXGA 3LCYA 3ULVL 1HN1A 3WKPA 2O6FA 1TYJA 3EBHA 3VTAA 1NJ9A 5DHYB 1U8MA 4Y4HC 3HZVB 1AS7A 3NSDA 3QDGD 5AKSA 1V7NL 1Y6MR 1JGLH 3HC0A 2BSRB 3O0LA 3F6JA 1F8TL 3QEGH 4PS4H 3UTQB 4XMTA 5I76A 4HXAH 2Y69B 1QSVA 2Q7AA 4OCMC 5IR1B 2Z7YA 3OKEB 4OCSL 4YHNA 1E3XA 4B53A 1R34A 1P4IH 2WOYA 3SBPA 4NBZB 1U3NA 2Q6WA 2CDEA 4FTVD 4XNZB 1T4KB 4AOFA 1PKOA 1CK0L 2E4FA 4AYFA 2VDNB 4IW4C 4FTDA 4BZ2A 4FQIH 3EO1A 4EMZA 4QHLA 1OSYA 3EOYG 5LNGA 2BIMA 1JZ5A 1CE6B 1AO7E 3KLAB 3RDTC 3HG5A 3NCCB 3SSGA 3QI9D 4OJYA 2YQBA 3OGCB 2WXKA 5LXGH 4W6WB 1HZLA 3BSZL 4BHUI 1XWVA 1G7QB 5DEFA 2NTSP 4KK6D 3MUUA 1BVLB 1KZQA 1MFEH 3KPSD 3V4PH 4CC0A 4D0CB 5AYUH 4NNPL 2BSTB 2FHFA 4YHKH 2DJSA 3SDXF 1SEQL 3BFQG 5AYQA 3TV3H 3C6LA 5CEYA 1WFNA 2BFVH 2EEXA 1C5CH 4ESKA 1Z66A 1BYPA 1CDIA 1KBBA 3O4LD 3SIKA 4JHWH 4PJIB 2BOCB 5F89A 5T33H 4CAGA 3SQBB 2FJGA 1FL3B 2YR3A 1U4FA 4FZEH 4HKBA 5EBMB 3STLA 1SN2A 2WBXA 3VACA 2BOLA 1KIQB 3PWJB 4MA3B 3NUKA 4MVBD 3TBSB 1DVFC 2CO1A 2KLSA 2VUYA 1S7RB 4XN7A 3RL2B 4HLZH 2ZKHL 2WV3A 5F7FA 4MTMA 3JWNG 1FGNL 5I8EB 4A68A 2F8IA 4J4PD 1MWAL 3WENA 3MV9B 1ZSHA 1CE1H 4MMXA 1NUFA 2APXA 5C9JB 3UJIL 1G9EA 4LFHG 3UZVA 1K4CB 3QDGE 4R90L 4OZIF 3MV8A 4KJWC 4Z3EA 4H7VA 3MO1A 4IDJL 4R4BB 1UH4A 4MHHI 5DS1A 5LG1A 4KY1H 1SFHA 2DMKA 4P59L 1B0GA 2XVGA 4LCUB 1H8LA 4QHUB 3NIDE 4K7PX 2APSA 3IDMB 3LRKA 1E5BA 3KLSA 3THML 1TNMA 1LHZA 4JO2H 3LPOA 5ESAB 1JRHI 4ZUWB 2I9LA 2DLGA 2JKXA 3TCLB 2PYED 4JDEB 1AQKL 1H6TA 3GSXA 1URZA 2Z35B 4FTVE 4WI3A 3RYMA 3BI9X 3B37A 3H0TB 3O11B 4LVOB 4RZCB 3S9DB 2A4CA 5ENWB 1O9ZA 5JIMA 1UOVA 4J3OH 4F91B 3NCFB 4WCYH 4IU3B 4N2LA 3QJFB 3QARA 4PRPA 3GHBL 2XKSA 4U31A 4N0FB 4JG5A 3QWRA 4IJ3C 4R2GD 4GKZB 3PWPB 4NGHH 1GW0A 1OP3K 5ILTH 3HI1B 1KLFB 3KYKH 4UB0H 3UP1A 4E5XA 4B9KC 3PL6D 1WK0A 3D2UD 4WI4A 3J07A 4AYEC 3X2QB 4C56B 2V6HA 5K9OB 3KPSE 2GHZA 1AQHA 4NM8H 2ZJSL 4ZXBB 3O4OC 4GEIA 3P9LB 1LP9E 2E8YA 4OLUL 2AQNA 2WYHA 3MLRL 4DERA 2XBZA 3IDNB 4QYOA 3S2AA 5T1JA 4KDTA 3O4LE 4OT1L 1KIUA 4LSQH 3Q6FA 4LRNL 3UL4A 1DTUA 1GHFL 3QZPA 3VMPA 1RUPL 1O0VA 1V3KA 1BAGA 1G7HA 1KB9J 4FQPA 3AB0C 3VD0A 5EA0H 1U93B 5DEZA 4AWJC 1TYRA 3BC9A 1K8IA 4F8PA 1GJIA 1R4XA 4XNQA 4MMXC 4XE5B 4XOCA 2PR9A 3CZEA 4M5YL 2V3DA 2OMNA 3BRFA 4JR9H 3UBHA 5GS0D 1ZIAA 2BNRD 4WHTA 2J20A 4BH7B 1AS8A 1FN4B 3TIDA 4CC1A 4NKMA 2IPKA 5D2LB 3IU3A 1FV1B 4OJFL 1R19A 1W6WA 1OGAA 1HH9B 4QY8B 4GIAA 3BQUB 3EO9H 1X9UA 3AACA 4KMTL 2QT6A 5DJAB 4LSVL 5EEZA 4A2FA 2R69A 3R19A 3ZBMA 4X7CC 1NIDA 3QXTA 5TGBB 2WAHA 5D2NE 1BIIA 1G7PA 4MYWB 1AY1L 5B38B 2HN7A 4DZ8A 2HX7A 3FONA 4D3CL 3ELAT 1SN0A 2OSXA 4ICXA 3U2IA 1RPKA 4M4RB 1MQKL 1X44A 3P40A 4LBEB 5FYJU 5FCUL 4LOVA 5E2TH 4R5VA 4WQOA 3GM0A 1G7MB 3ZHLA 4UINH 1ODAA 2A4EA 4ZPTB 4OD3H 5EULV 4OBSA 4UQEA 3WFHB 2C9VA 2H6OA 5E2VH 2EIZA 1R3KB 2QR0B 4PP1C 3WNJA 2HPOA 2B4CC 4L1LA 1U21A 4EQ2A 1J8SA 5C0EA 4Z7UB 4RMUA 3MLSH 4FA7B 4HUMB 4Z78A 4U0QB 3ECBA 4PG9B 4QLRA 2IDSA 2XFGB 4TUUA 5ESVB 2MMXA 4GIOA 4HIPA 4XBEL 1NGQH 2ED6A 3K4ZA 4MX7B 4WI9A 8FABA 1SOKA 4P2AA 1N59A 3OF6D 1IFHL 1IGCL 4TNVF 3GSWB 3QG7L 3VH8G 4D94A 2VR8A 3B9KA 4W81A 5E1IA 3QJOA 4ZUVA 1YO4A 1ZE3H 4YDKH 3WLBA 3P4MA 5GGVL 4C4KT 2E27H 1WEJH 3QXAB 1BQ5A 5EEWA 5BQ7B 5HSFA 1SJXA 4HJ0C 1IBGL 2AANA 2BNRE 3RPBA 1IGYA 3W57A 5H37H 1P4BL 3TZVA 1ED3B 3MODH 3WJJA 3MRGA 1XIWA 3GRGA 3VD3A 3E9UA 1QBAA 4XVJH 5GQBA 1PD0A 3IJSA 4HKXA 1AIFB 2H0EA 3MJWA 3EDEA 3C8DA 1TKWA 4ABVA 3D87B 4GKSA 3MGOB 1OAYL 1ACCA 3ESUF 2VN4A 1WBYB 1IGML 2YBRA 5E00A 4A55A 1ROWA 2WLJA 2GW5A 3KPRD 4YZFE 3MGTB 2ZCLL 4JQIA 3BPNB 1QO3A 1CGSL 3QDJD 3L4CA 4JZNB 3KLDA 1NKGA 3WN5B 5C0BB 2GJ6B 4WLCA 1CPUA 4PAZA 1ZHLA 3APNA 4GUCA 1OLZA 1LILA 4FG0A 2APTA 2P24B 1AJ7H 3QCUL 4NS0A 2J6WA 4J3TA 5JW4R 2H4EA 3WIHH 3QORD 3LZLA 4I3SH 4M8VA 3SE6A 1JD7A 3DMMC 4PJ5A 1MAMH 5CCHE 2M83A 4XH2A 2OTWB 3BEWB 3C5SB 4LF3A 4NHCH 2CDGB 4M1CD 2ZT9C 4JFUA 3GS4A 3NSYA 2J72A 3SKNB 3M6DA 2ZCHH 3ME0B 1NFIB 2CQVA 3EH5B 1RZKH 4LLYA 4QAMB 4YUEL 2HG5A 3NZHH 4N0CD 3B9KC 3Q1SL 1KJ2B 3RBSA 4F7MA 5I17A 1E27A 3X3GL 5IGXH 1D2OA 1N64H 3GIZH 2V9UA 1J0JA 4I9WD 3DX9B 3EHBB 1E4WH 5L88L 5EN2A 1PZSA 2UY7B 3IMWA 5AKRA 1XIWC 3TA3D 1KPVB 1SMAA 5D1XD 3FSOA 5GSRA 1KXQE 1KELL 4KWUA 5BRZD 4PD4J 2CGYA 4PBDA 5D7IE 2IAMC 2PTTA 2Y1ZA 1O5PA 2VDLL 3K1KC 4JO4L 2W0FB 3VGEA 3D50A 5ALCL 2AK1H 5FHBL 3T3ME 5L4IA 4BZ2H 2Y06L 3L9EA 4KK5D 4GSQA 4HJJH 3TONA 1IKNC 3IJ8A 3MJGX 1S9XB 5E2WL 1KGUA 3ZHFA 3VQ1C 4B9FA 4CVWA 4XP9L 4UIKL 3DGDA 3B9AA 4Q74A 4P2OA 3QDJE 2ICCA 4GRWF 5E1GA 2C9RA 2LOEA 3QAZB 2WLYA 5GRWA 3GK8L 4L29B 5TFSH 3WFDH 2JB5H 3S6CA 4ZFQA 3TBBA 5GS1B 5AZEH 4GAYB 4KITB 4N8VG 2BHZA 2EKJA 3O8XA 1KFGA 3QIUB 5CN3A 4KH9A 1D7DA 1PU0A 2PW2B 3X13A 4F15B 2ZXDA 3D39B 4X6EA 2ZCKL 1QA9A 2WN2A 2QADB 4ISVB 4U3SA 1CD8A 3AS2A 2ZXGA 1QI4A 2FEDD 3D09A 2YOCA 1I3VA 4J12A 2FX8L 4UV4H 3QIBB 1EDYA 2CJUH 2Y0SA 4JDVB 4PJEE 5F9AC 3BAWA 1DQJB 3F2LA 3QZWB 1RVFH 4FFTA 4C4BA 3V6OA 2E7LA 3TVMD 2NMSA 2OP4H 1T21A 3NCEB 1Z2KA 3LS5L 2WXFA 3IPFA 3IRPX 1ICTA 2CAKA 4F8NA 1KIPA 3MOBH 5DRXB 2K6ZA 1JZIA 5I75B 1GCFA 4K3DL 5AVQB 1LWHA 1M2OA 4L0PB 4GLRI 2O6PA 3LRSA 4FXKA 5KS9F 3HI6L 3EAKA 4IRSA 25C8L 1F86A 1W15A 3EOTH 2WLZA 1SM3L 3ROLA 4U0RC 4I18A 3ERXA 2WZPA 4ATWA 4MNQA 3MLTA 5ADPL 1K3IA 1BJ1J 4I9WE 1QR1B 3X1EA 3VXQB 4QIRA 3DJTA 3A22A 3MRKB 4GMTL 2P8MA 3UZEA 2VAAB 5F9DC 2D2CC 1CR9L 2P26A 5D1XE 2WAQA 1MFDL 5BRZE 1AZZC 1R6VA 3MLUH 1A6UH 1PF3A 4ILDA 3S2CA 3ULVD 3C12A 1TVDA 2AHIA 1A7OL 1A7RH 3BFOA 3ZMEA 2XQBL 3VXTA 4WY7L 1N0XL 4XN4A 1PCXA 3Q13A 5C3IA 3GBEA 2OI9C 4S1SH 4WGVB 2MKLC 2XA8L 4P2OC 4QTIH 5BV7B 3OAZK 1S8DB 2AAVA 5L7XL 4IU2B 1WFTA 1R3HA 3L3OA 3VRLF 2CDFB 3N0PB 3MRQA 4ZO6A 3ZDYB 4U3CA 4Y89A 4KJQD 3VWKA 3SBQA 3CCHA 2XTLA 3T6ZA 4YGVA 3A3YB 4LVHC 3OX8A 4HBQA 3O8XC 1LQBC 3GI9H 2HAZA 2OSWA 3GYRA 3TJEH 2J5LB 4OAWA 5BMFH 4KZEL 2IAND 2UWEB 2VLJA 3PWUB 1S9VA 1GSKA 1D9KD 4G5ZL 3K7UA 1E2WA 4H25A 3SOTA 5EBLA 4M56A 4LB8A 1FNGA 1VFBA 5IHHA 4W6XB 1FAKT 1GMEA 2AGJL 5CD5C 2CCLA 2VSKB 2FIRT 5DQDH 3I85A 3V7MA 3S48A 2E7LC 4UT9L 3V6OC 3V5KB 5I8OH 4FFZL 5ITBL 2VQ4A 2F7RA 3RIFF 3K8LA 3V0EA 2OMYB 3QO0B 1INQB 3IPEA 2P80A 5KANG 1LE5B 1TIUA 1YEJH 3RL1A 2G3NA 4NAQA 4TS6A 1KTLB 4IRSC 1B0WA 1C08A 1QX1A 4OCWH 4QOKA 3VFGL 3WUWB 2IADA 4I18C 1YEHL 1N4XH 3GD1C 1GYCA 1ORSB 2NY5C 3HS9A 2AQ3A 4AKPA 4A39A 3MBWB 4Z5RB 4YHYC 1UYWH 5DR5H 3ZTCC 4N86A 5GGRY 3KHQA 1EVTC 1WAEA 2XY1A 3NP3A 4NNXB 4PRHD 4OF0A 4HWZA 3UGUA 3HHMA 4TQHA 4YHML 3IK2A 3UZEC 1MEXH 2Y3AA 3VI3A 2OZNA 3ASNB 5CUSH 3VDCA 1N6QL 4WK2B 2OMWB 5IB2B 5IW1A 1IIKA 1A14H 3A6OA 2DF3A 2VN6A 3O2VH 1NBVH 2IOIA 3GPSA 5ICZB 2E3VA 2R69H 3SY0A 4HPYH 1P6FA 4XXDA 5E8OB 1TZHB 2Y2TA 3L1EA 4JB9H 4NUPA 4ZOCA 2NY2D 2VMEA 5FO7B 4CSTA 3ULVE 4F7CA 2YJQA 1I53A 4YEFA 3CAFA 4BYHA 4BKTC 1HAWA 3QPQD 1LWJA 4ZFFA 1F13A 4Y4FD 4AJ0A 2IO5A 5C71A 3QH3A 4Y16D 2RACA 3V0JA 4L5FH 3L3OC 1KJ3L 4BA8A 4KNQA 1PIGA 1FE8H 2WJ5A 4U1JB 4DPCX 4BRVA 2A7BA 2FYVA 3MRDA 3RTQC 3MXVH 1CIUA 1OAZH 4I3RL 4P4KD 1SDDA 5CJQH 4ZTOH 1NGWA 3IDXL 5T3XH 3DO7B 2DQJH 1M05A 3B56A 3QUGA 1OLLA 4IBZA 2IANE 4DEPC 1WFOA 1S9WA 1WUZA 1AGBA 2BFGA 3EOAA 3HA0A 3KYOB 3U1PA 4APQD 2AABL 4A63A 1PG7X 3NSJA 3A6BH 3MXWL 1MJ7H 3R0NA 1U42A 1CLCA 3PNWB 2IBZY 1BEYH 2X70B 2NY0C 3NYKA 1NUNB 3TBCA 2EVFA 4E42A 1WIPA 2HZHA 3K0YA 4NO3A 4U1NA 5EFIA 1A1NA 3UMTA 3V10A 1C7SA 4PV9B 5F1IB 5GSVB 4GXUN 1MVYA 2AJ3B 2CLRB 2D03L 2IMNA 2JXMB 4HWNA 1QLEL 4IBLT 5F9OH 4IKNA 2OMUA 3M1BB 4I8DA 1CTOA 2F7PA 1OWRM 1AI1L 3MBXL 3ORJA 4UIMB 4PJCA 2CR6A 1U8NB 1R33A 1TTCA 4MSWB 4NC0B 3V52H 5CCJA 1ADQA 1LVEA 2PYFA 4KZ0A 3D3VD 1ZWIA 4LU5L 2L04A 2WN3A 5JPNB 1D5BA 2XT1B 1CLOL 3ECWA 4M61B 3FOLB 2C34A 3ZRFC 1QI5A 4LVNB 4HSCX 2Q3XA 4DVBB 1WYJA 4XAKD 2X89A 3ABKB 1NAMB 3CN1A 4ZI8A 3P0VL 2YGNA 4OLZH 1L5GA 2XWBB 1MCPH 5D1ZI 5PCYA 5KSVB 1BFVL 1KJMA 4JO1L 5IFAL 2DLEA 4UDUB 4MNHB 3DX0A 3UCRA 5IQ7L 4JRXE 1WC7A 3MLYL 3Q2CA 4ZNEA 2C1OA 5I71C 3LS4H 1JHKL 3SPHA 1GA2A 2EDKA 4HEME 2B15A 4IBQA 3BDYH 4XVTL 3QGVA 2O93L 5FUCE 1NDGB 4QDGA 3K5RA 4M1GL 3ZE2F 1WAPA 2C7UB 3D85D 3PU7A 1DBML 1AYOA 3VWJB 5K9KA 2A6DB 4M62L 2VJXA 3VRJA 5CCKH 5K39B 1KLGA 4IMLB 3IRCA 1X4YA 4YXLL 5BOPA 4XNXH 4HGMA 4DW2H 4AQAA 5KBMA 3L48A 1IAIH 4KXAA 4PREB 2WXPA 1QSED 3DX8B 5BVPL 5IROA 2OTUB 3CSBA 4H1LB 4L37B 4DCQB 2OPCA 5IK3A 2V17L 1XF1A 1JGDB 4YIQB 4AGNA 4P99A 4H2CA 3UGXA 3F58H 2V2XA 3WMQA 4I0PB 4JJHA 5TF1H 5DGQA 1W2KT 4Z77A 3NJIA 4LSRL 1HCZA 3GSVB 4X9FA 1S7SA 2QQKL 3K91A 4L3CB 1ZGLA 5CD3B 2H2SC 4Z76A 4P8QA 5B8CA 1S78D 2NZ9D 1U41A 5HI5C 1VDGA 2NYZA 4HXBH 1NWPA 4TVPD 2W0KA 5MP6H 2VXUH 4PV8A 5I1EH 2I24N 2R1YB 1PD6A 3DVNA 4QWWC 1LD9A 1NEUA 1DDHA 4DK3A 4N2HA 5F7EH 5J4MA 4EO5A 5KJRL 1JNLH 4GRLB 4XAWH 1YN7A 4AVJA 3C9NA 3OLDA 1YYML 4KAQH 2YA0A 4PYHA 3PV7A 2X87A 4CNIB 3WLWC 3PG2A 1EGJA 1KNOA 4XAKE 3NFNB 5C0CA 4RRPA 1F6LL 5JHLL 3AG1B 3VFNA 1KCWA 1KB5B 2WVVB 3GB7A 1L0PA 2WANA 4MXWL 2Z34A 5LGHL 1HWHB 5DI8A 1GJWA 4ALAL 4YDJB 4UM9B 1KV7A 3V6ZA 1H6FA 5EUOE 5AVYB 1Q4NX 4PRIA 5KVMC 1WP6A 2NSXA 4TF4A 2E0PA 4WGWB 3FU5A 5A6IA 1HSBA 2GTWA 4H0IA 1FSKC 2BSEA 2LGNA 2N01B 2XV2A 4XNYL 5EOCH 15C8H 5A6MA 5HD8D 2WUBL 2WJ7A 2YQGA 1U95A 3NACL 4HPOH 1PEWA 1HESA 1YEIL 2VLKA 4F27A 1IAKB 2QSCH 1LNUA 2CWRA 4JJ5B 1TQTA 1EMTH 2DPKA 5KYUA 4PJBB 5C09A 5AW0B 1XCWA 1B3IA 5IROC 1BLNB 3CN0A 3EJTA 2KLRA 1PYWB 2B2XL 3L1OL 1B9ZA 4LLMA 4JAMA 1ZDSA 2EDHA 1HQ4A 1QSEE 2EDTA 2NNAB 5G4OA 1F42A 1QASA 4JLRA 4AIZA 4IHOB 1EXUB 1NCDL 5TD4A 4HHAB 3VE0A 1OTSC 1I8KA 4GP5B 1WFUA 3V55A 1D5MA 5B3JE 5FFLA 2FR4B 1XH3B 2BCKA 5E56A 4AK2A 1JHLH 2QGDA 3U30B 3VSVA 3FTVA 4U1KA 2D0GA 2RD0A 3KPLA 2N7SA 1PNDA 1JK8B 3BN3B 5E8DH 4JY6A 3MTXA 4AVKA 5I6MA 3AWGA 2K70A 5LB1A 4FADA 4TVPE 3LIUA 4U7SA 4WJ5B 4EXKA 4P5TA 3PWLA 3NIGF 1IC5L 2DIEA 3TYGL 2G0KA 3GZPA 1HC1A 1FNFA 3T2OA 5F1NB 3F12A 2G75B 4PJAE 1SY6L 1RZQA 2XN9B 1WZ1L 5CJOL 5EF0A 4XT1C 3RWEB 2DEXX 2BP3A 1J0HA 2XZCL 4LCWD 3WMSA 3IMBA 4ZQKA 1FG2A 1G7JB 1W9XA 2R2BA 5DUMH 2AJZB 4PHXA 4XP4L 1M7IB 1S5HA 4OQTA 5LQBL 5E51A 1IARB 3OG4B 5E99L 2AJYL 4FLHA 1ZTXH 2HKHH 5TE6L 1BF5A 4JK0D 3B43A 1OSZA 5TE7L 2X6BA 3LKSA 3FSZA 2HJKA 1IJNA 3Q43A 4HFWA 4XP6L 4BH8A 5DMKB 5DLMH 1G6RA 4MGXA 1JI2A 4P9HC 4XCNA 5HJGA 1OM3L 2WK2A 3L2LA 1U8LB 4K71C 5J6SA 1DJXA 1PZCA 2XXGA 5DJZB 2GAZA 4HA1A 1FO0L 9CGTA 1I7RA 4QXTB 3VFMA 1AOZA 1UQSB 3E2HB 1OM9A 43CAA 2EKSB 1K2DB 4DFIA 3H53A 3ARGD 1R24B 3WCYA 2KH2B 3S35X 2C9AA 3Q6GL 1CC3A 3EJZD 1BMWA 2EUZA 1DQML 4N9GA 3FK3A 7FABH 4EUPH 4XO3A 4Z7WA 4EDWL 1D5RA 3EXLA 1KACB 2LV4A 4XZUB 1HOCA 1PW3A 4M4PA 3HZKB 2Y2WA 3V0VA 3QEQD 4XXWA 1E5UI 4G80A 4AH2B 2VZ1A 2FX9H 2ESVD 3NABH 5GS2D 2EDFA 4CA4A 1Z32X 2L7JA 1BQLH 2J5WA 3O2WH 2GC4C 4GW5B 4NWUL 3H9SE 2NX5B 2ZYHA 3ARTA 4NQTA 3IAGC 3WNOA 2ENQA 1J0YA 4LLUA 3GTTA 1L0XA 4PJGA 5JW4Q 1U2HA 4HWEH 4KROB 3RU8H 1PGRB 3NN8A 1ETJA 5I5JA 3ZQWA 1HEZB 3DSNA 1TZ8A 4PY8I 1TETL 3V5HB 1J8HB 3BKCH 3Q8EA 2H2PC 3ATBA 5E9DB 4KNTA 4BFIA 4G82A 4LCWE 1GIGL 3L13A 4OV6F 2CG9X 3CBRA 2ZOKA 5AZ2L 4J27A 4M8QB 1L6PA 4IGBB 3GLAA 3K2UL 5BOJA 3CN4A 2GCYA 2H9GA 3E6FA 3P69A 4HCGA 3VXMB 4LHUB 4M6OL 3VFVA 2W65B 1KT2B 2VE6A 3D69A 3FQUA 4GAAA 5DEGA 1T0MA 2UZIL 4PGJA 5F3HA 1U8CB 4NQDA 1JF6A 3BUIA 2R39A 5HVHB 2OFQA 3E6HB 4ZSOE 1NMBH 5ANHA 3NCJL 3FXIC 5EO9B 1E9OA 2V8LA 2VMFA 2GBVA 2I60H 2CO7B 1TFPA 4BXVA 2DIJA 3FRPG 2GY7B 4JCWA 4WIQA 4O2CA 3MQIA 5IESL 1HL5A 3DTXA 2ZIDA 2HKFL 4JFDB 4FULA 2YC1A 5HYFA 2D8KA 5HHOD 1CDBA 4TNEA 3VD7A 2LU3A 4XXWC 5DC0A 4V2BA 3FT3A 1YMHA 4RFEA 1MUJB 1NL0L 1JL8A 2ZYSA 3QEQE 3T09A 1G9NL 5KSAA 3K71B 3LIZL 2X38A 4MAYD 2ESVE 2YBGA 3WO3B 3W9EB 3OGOE 2WQXA 1KBGH 2LFGA 3LXCA 3QQ9D 1MHCA 5B7MA 3OXSB 5JMOC 2DYPD 1PCSA 2EICA 1DBAL 1ZHNA 3BHBB 5HBBA 4RCAA 5KW9H 3QFJA 4I2XB 3H7BA 3D0LA 4YLCA 1T80A 3RVUC 1UA7A 4NC1C 2ZP0T 5MERA 3UYPA 1OTUC 2DAVA 4OCYH 4A6YB 4XBPB 2PXYD 5D1QA 2NDFA 5C1MB 2FCBA 3RUGE 5IJVB 2LLGA 3VGAB 3QDMB 3ENEA 1UWEH 1H5BA 4HUUB 4Y2DD 2KLTA 2HMID 3RKDC 3RZCC 1QSFA 5BOZG 4Q89A 2OQJB 3GHEL 1IEAA 4HP5A 1ZIBA 3JT0A 3RE0A 3U1SL 4ZK8A 2FWUA 5C0ND 4I77H 4H8PA 3UMNA 3A23A 3TO4B 2A9BA 3LEYL 4KUCD 5HGDB 1KBWA 1GVIA 4G70B 5C0DB 5EU7E 3RVWD 1E0OB 2AEQL 4HSQA 4V1DA 4Y4KC 4ELME 2AK4B 4AUUA 2CKNA 2H1PH 1DBKH 4V33A 4WK4B 3PGDA 3VB9A 4KQ3H 2VUOA 2PCPA 4B9CA 3LDBB 3VCLB 1PSKH 3LNIA 2G3XA 1GC1L 4TRPH 1SXAA 1KY7A 1CICD 2WMPB 3HNSH 1DVQA 2BNUB 4G9FB 4C83A 2WM0A 3BJLA 1ZHBB 3MR9A 1J1PL 3N0AA 4KX9A 2YPLE 2JKSA 3MV01 2Q86B 5DVKA 3INUL 3PQYB 4EN3C 3LTVA 3BPCA 2JJSC 4DKEL 2NW2A 3DURB 4GSDL 3RWCA 5HHOE 5HGBB 5EDXA 5I1DB 1BVOA 3NQIA 4FP8H 1SJEA 3AABA 3QJQB 4R7DA 2XYCA 3H4FA 4NJ9H 1FYTA 3IGUA 4LKXB 1XGQB 4TQPA 3LN5A 1EEQA 4H0LC 1WZLA 5B1JA 3EYSL 3ARFD 2HJFB 3I50H 4HK3J 1OGSA 4PIBA 4AZ8B 5C0JA 1V10A 3T9WA 3ZKXC 1R47A 2HLAA 5IB1B 3R4RA 1UKTA 4LCYB 3S8FB 1UASA 1EHXA 3B7YA 4MB1A 2C1PB 2X0WA 3UC2A 1SHXA 1MPAL 2K8MA 5AUMA 4J1UB 5ID1B 1I1YA 1CDCA 1EGJH 4AENB 1MCHA 4JKPH 4U6VL 1J1OL 5BNXD 3MRCB 4J2QA 1H5BC 3OQRA 4DKFL 5CJXA 5I0YA 1Y0LA 4A2DA 2VMJA 3UTOA 4HIJB 4HAGA 4RIRA 1NCBH 2L3BA 2WIIA 3GIVB 3L3JA 4L4VB 4OF8A 5FXCH 3OKDA 4WU7B 4M9OA 4UTBL 3UERA 1UUNA 1QNZL 3KCWA 3SCMD 2R4SL 3VW3L 3APFA 5A2FA 4NQXB 5C8JB 2CPCA 3JV6B 1NCNA 5JXEC 1WD8A 2Z31B 4QCIA 3JTTB 3KLHC 3AQYA 2EIDA 2GUOB 1JFQH 3WEXB 4OD2B 4B41A 3EBIA 4PW3A 1IAOA 1FNEB 1N5AB 3C60D 2WYIA 5EB9A 4BHUA 3MLPA 1J5HA 1M71A 4DAGL 1SOXA 1HYRC 4DPBX 2PO6D 1MREL 4RWHA 5IJBC 1BREA 1ZLEA 3QQXA 2DBJA 3FKUS 1VFAA 4DQAA 2A9ML 4YK4C 4U1GB 5F6HI 5JW5B 4CADA 2TAAA 5DVNA 1H3VA 3HE6A 2J4WH 5TE4H 1QOKA 1M1SA 3OJ2C 1UD5A 3DK2A 2CRYA 1OAKH 5DWPA 1MLCA 3RWFB 5GRZA 5KAQF 1NCWH 4S0HA 1BMGA 3ESPA 1OAUH 4WFGD 1CLYH 4ZMTA 1CT8A 4KVNH 3KWWB 2WW8A 3KMDA 2EXYD 3J8F7 4LKCA 4OGYH 5BPPA 5IJDC 1XF4A 2VDPL 3KM1A 3BUQA 4LPCA 1S7XB 3OBAA 4FLRA 2DQHL 3VI3F 3VTMA 1PZ5A 2P9RA 2Z92A 1JV2B 5CJXC 2R83A 2X0UA 2IG2L 4ORZC 1GYUA 1EAQA 1THCA 4YE4L 4A2GA 2R2HB 3DIFA 1OSPH 1E4XL 1OK0A 2G2RA 1JZ6A 1UFGA 4P23B 1IC7L 1RIVH 1SHWA 1JVOA 2EECA 3O0RL 5DZJA 1HQRA 3FCTB 2F74B 1G6RH 2FYYB 3G9AB 3T0XA 2NY7L 5GGSB 3IJ7A 1PKQE 2X4QA 3U25A 3U4AA 3QWOB 2YK1L 3ZRSA 2BP8B 2VZUA 3F7PC 2HH0L 3KGSA 5KTEL 4LT7A 3GSQA 4LEXH 4IRZL 1CMOA 1I9JH 4JJOA 3C5ZB 3F62A 2AJSH 1N8ZA 2XTJB 3ILPB 1OF2A 1LE9B 1L7TH 2BERA 5DUPL 4PG2A 1ZLSL 5KBNC 1C5DA 4UMGA 3ARXA 4NHUA 4B7LA 4HIIA 2RH0A 1AO7B 1D5IL 4FXGB 2GK0A 1R3IL 3O6MH 3QA3A 5LDUA 2QV4A 4U6HB 3DHMA 3W81A 1JPSL 2AV7A 1B9KA 4JN2A 1O7DE 2VC2H 4MA8H 5E8NA 2HRPH 5DHXB 1FVDB 4XPAH 3BMVA 3VD4A 2OV0A 4LIQH 4X8XA 3QUYC 1BAFL 1HHIA 1NKRA 3A4EA 2ENYA 1C8PA 1KPUB 1VEOA 3MFFB 3RVVC 4KY2A 3QWNA 3UJJH 3MLVL 4NNYA 4JY4B 4YBLC 3EFFB 4W9DC 7PCYA 3S4SA 1SUHA 1S4IA 4PJ7E 1SHMA 3PREA 2HTLD 5IV2A 4WFGE 4Z7VB 4YDLC 1IEBA 1YPZB 1XGZA 1KTJA 2NPLX 1UD3A 1UM4H 4PJCF 1G0DA 4HCIA 5DHYA 1CD9B 4PS4L 1UXSA 2LVEA 4JKWA 3WTWA 3UTQA 1IQWH 4OCRH 1RHHB 2X4NA 3OB0H 4Z0XB 1T5KA 1P4IL 3WS3A 4CSZA 4OM1H 1ACYL 2NXYB 1G7IB 4AEHH 5LCVH 1TOXA 1T4KA 3ML8A 4N6RA 1SLXA 3FO0H 1MW3A 3SBRA 4GUPA 1NPUA 1L9MA 3EJCA 2R4RH 3HZMA 2CLVB 3NIDB 3CLFH 2YLHA 4EIGB 2RAMA 5LXGL 1CE6A 2ZWKA 1NOAA 5F9JB 3QUZB 2NNXA 5KEZA 1G7QA 1MFEL 2QTVA 2YD1A 3V4PL 4W9LC 5AYUL 2OL3A 2DKMA 2WKLA 4W4OA 4YHKL 5HVFB 3TV3L 4D0CA 5HVWA 4IQHA 3BVNB 4ELDA 4R0LB 1R5WB 1V8HA 1FL6B 2FEEL 3N44B 2BFVL 1C5CL 3ZKMC 3QI9B 2WO4A 4JQVA 3DBXA 4JHWL 3VXRD 3NBNA 3DRTB 4PJIA 2J8UF 3KM2A 3KPSB 4FZEL 1NC2D 3DOSA 4LOFA 1FL3A 1S46A 1LP9B 4OZ4B 3ETTA 3SYAA 2BINA 1KIQA 3PS6A 2H6PA 1SBSH 4Z3JA 3TBSA 2Q0ZX 4J3UA 1QHQA 2FO4B 3CDCA 4N2CA 3RL2A 3J27A 2VRQA 4LGPB 3I6GA 3OC5A 4IBWA 1CE1L 1JGIA 2OYPA 3KBPA 4QGYA 3U46B 3QR0A 4L8BB 2Z0BA 4K2UH 4FN0A 4HCFA 3MPCA 4PLNC 5I1AA 1K4CA 2WBWB 2VQUA 3GFUA 1LK3H 4B95C 2CUMA 2BVPB 4MXVE 4NAMA 1RAMA 5IVXE 4KY1L 4JQXC 5J3HD 4TUJB 2CJSA 1RULH 3VH8B 1CXKA 3HRPA 1U8KB 5I8KH 3SE4A 2DJ4A 4JO2L 4QHUA 5K69A 4IEFB 3TX4A 3IDMA 4N0UE 2OSLB 4XNZC 4ZUWA 3TCLA 4L23A 4NN7B 4WDIA 1A4KB 1QFWH 1OPGH 4NFCA 5FM5M 2Z35A 2BCMA 2CRMA 3O11A 3OJVC 4WCYL 4MWFB 4JPVH 2FLRT 4N0YL 4PJFB 1MI5B 4WW1B 4YEEA 3DDFA 2NY3D 4RAVB 4DWHA 1JZ2A 1J05A 1TZGH 3B2PA 4JKNA 4NGHL 2PYEB 5ILTL 2F8VA 4UB0L 5D2NB 3KYKL 3LZNA 4GG6A 4GKZA 3PWPA 1NUGA 2WNWA 5DD3L 4W4OC 1KLFA 1X5ZA 5FB8A 1ITCA 4NM8L 5E94B 5FDWB 1JZJA 5K9OA 4JPKH 3MUZ1 4N3TA 4OI7A 4ZXBA 3PWVA 3WTTA 1TEYA 3I6KB 2G9HB 2GSIA 2K9FB 2BDNL 2BOBB 4IJTA 4MMZA 3L2MA 4PGDA 1DVYA 2YA1A 3IDNA 4LSQL 3K8MA 3PL6B 3D2UB 3VXRE 4GEJA 4XP5H 5EIIG 3V7AE 3FQYA 3LHAA 5DHDA 5HYEA 3DRQA 3IJYA 4MD4B 5B22A 5TK2A 1U93A 2C9UA 5DVLA 4WI6A 4DO6A 1KGJA 1A3QA 4Y5VB 4G72B 3VU2A 3CWGA 3V6FA 4ENEC 4JR9L 3B3BA 4MASA 3VX0A 4M1DH 4KTDH 2VSMB 4B60A 3MREB 1B0IA 3ARDA 1GZQB 4N68A 2B3IA 1FN4A 3N1FC 4FFVC 4KJPC 4OZFA 1AS6A 4HWUA 4WZ9A 4X99A 1NC4D 1BWMA 4KMQA 5AW5B 4QXWA 4PCTA 1Q9OB 3QUXB 1SXZA 2AJVH 1CFMA 4M29A 4UBDC 3MFGB 4NQUA 4JRYB 4B0MB 4UZUA 4AMWA 1VADB 4M48H 1PJWA 2JB6A 3MA7B 3HB3C 2P5EA 4LVOC 5TGBA 5I66A 1XR8B 1J5OH 2EDXA 1RP8A 2MTPA 4NQSA 5GGRB 5D6CA 4OLVH 2CCVA 3POCA 3UG5A 3F00A 1I8AA 3LPPA 1RIHH 5E2TL 3HBQA 3EF7A 3GLZA 4B9GA 4UINL 2WLMA 1MCDA 2JMRA 1G7MA 4OD3L 3IDGA 5E2VL 3QEHB 4ZPTA 2VR7A 3WE1A 1KYDA 4ZXBC 1R3KA 2QR0A 1BVKA 4W9ZA 3U4EB 3K6OA 4F9LA 2CXKA 1ANUA 2DQFA 3MLSL 4KKQA 5EH1A 5IEHB 4MMZC 2RIKA 5IBLD 3V7AG 5GZOC 2YIHA 2VL5B 1JV5B 4XODA 4UI2A 2QVIA 5CMAB 1NGQL 3H2PA 2W07A 5ESVA 4AE0A 5C2UB 4FQLH 2O5XH 4Z7WF 5HI4D 1K8DA 3MX0A 4N8VB 4CMMB 4UQ3A 3DPBA 3AGVA 4YO0B 3ZHKA 3V4VB 4WFHD 2EABA 3K74B 1P7HL 3NRPA 8CGTA 4YFLF 5ECJE 2OJEB 3QXDB 4PMFA 4YDKL 5MEPA 3OR6B 3BDXA 3R18A 3UPRB 2E27L 1WEJL 2ENJA 3X1FA 3ARDC 2K6YA 1WFJA 2NYKA 1GGYA 2OR9H 3TH4T 3MODL 2UXFA 3VFUA 3BJ91 4JPIA 4PJGF 4RQQB 3Q8BA 4KKBD 4XVJL 5IT2H 2C4FU 5FKPB 3UGEA 5FM5O 3ESMA 4WNQB 4FHJA 1AIFA 3DO4A 4LHQB 4XWOD 1JPFB 5I0ZA 1HSAB 4XTRC 3G5XA 2X7LB 3CXHK 3JZYA 1INEH 2IVFC 3MGOA 4JPSA 4H8QA 1AANA 1WBYA 3KPOA 3CQFA 4Q9RH 3FQXB 1DEEB 1R3JB 1V3MA 5IB4B 1AQ8A 2NY4C 3CFJB 4DFHA 2YSSA 5CSZB 4R7VA 3T3MB 1Q9KB 3VTTA 1CFNA 1SF3A 5DMGD 5F7KC 3NCXA 4PJEA 5C6TH 2LU4A 1AJ7L 2D31B 4C4UA 4ZMWA 2P24A 3KPRB 3WIHL 1YAZA 3BZDA 4OGQC 3VGBA 3NA4A 3VMOA 5AQ0A 5DQJB 3JWDC 5CP7A 3SDXE 4LQ1A 2ED8A 2LT9A 4DH2A 4XGZA 1P69B 4NHCL 1BOYA 3B5HA 2OTWA 2NLJB 1VACB 3HN5A 2X0VA 4XOEA 2CBOA 2ZCHL 2OJZL 3FU3A 4FL4B 4QJ3B 4YWGH 3SKNA 1IBBA 5L8JB 1RZKL 3ME0A 1WQVT 4X4ZA 5AW1B 4CVXB 1A47A 1NFIA 2ATPA 2VLLA 1YNKH 1TQCB 1X5IA 4LLDB 4MJ6A 3BUPA 4XBMA 5DRWB 3IVKA 1O6TA 3NZHL 4WV1B 4CU8A 3K6IA 1MSPA 1YY8A 4BGLA 1KJ2A 5ACZB 4WFHE 3DGCR 5HGAB 5CEXA 2XJLA 3GIZL 3TXAA 5E4OA 3UFIA 1XXDC 3ATFA 3WFEH 4JCMA 1E4WL 3DHJA 4FMKA 3S3BB 3DX9A 5C6PB 5KVEL 4B9IA 3LPGA 4Z7NF 3CZNA 5C0AE 3BZEA 1OCRB 3ZTJG 3DX6A 3BN9C 4OZIE 2A9NH 2X4SB 4BCXA 1MW1A 4P57A 3HNVH 4M00A 2XWZA 1T1XB 3TN0D 3FU7B 1GTNA 2AK1L 1XZ0A 4BZ2L 4X0NA 2H3NA 3ZTEA 4GUOA 2GJPA 5KYYB 4G7SB 1YMMD 3IGKA 2YAQA 5D1XB 4I1PA 1S9XA 1REIA 3BESR 5BRZB 3O6KH 1ZD6A 1E9QB 3BPNC 3ZYOA 3GLDA 2PWGA 2Q8AH 1ODUA 3DNKA 5GRXG 3WFDL 1A22B 5TFSL 2DQIH 5CHNA 1QBMH 1RUAH 2JB5L 4HSAC 4AKOA 2OL3H 3A4AA 3PJLA 4L29A 3NJMA 5AZEL 3BX7C 2BVOB 4LPWA 4GAYA 2NXZB 1DQDH 2P43B 1FZMB 3UPCA 2V7HB 4HMCA 3QIUA 1GY2A 4A7SA 2ICWB 3VXPB 3UH8A 4Z0BH 1N0LB 2FHCA 4OLYH 5BUGA 4ZG1A 1KCKA 5IVOA 3L5XH 3H3BC 4TLTA 4KHTH 4UV4L 5E8EA 1EZUA 2J44A 1ASOA 2CJUL 3GBDA 3PDGA 4ZO8A 5D71H 1RVFL 3QIBA 3BD3A 2OP4L 1DQJA 5F93C 1ET8A 1TO4A 3HPJA 3MOBL 2CHWA 5FV1L 4F92B 1M9WA 2QL1A 1A9BA 1QPXA 3QBTB 4S2SA 1AP2B 4LOEA 1UXMA 3X14A 4EZKA 4IOSD 1NAKH 3AU1B 3EHBC 4Z7OF 4R97B 3TGXA 1S3KH 4NC2B 1V55B 1QR1A 2AEPH 5L0QB 2EUWA 3MRMA 1ASPA 1HINH 4I89A 4MZ3A 4PJXB 5LVEA 4XX1E 1RZJH 2YXVA 5DK3A 2Z65C 3HG1E 4PJDB 4RDQG 3MLUL 1A6UL 1F90H 2X4UA 2CBTA 1UOKA 5AL0A 3S8WA 1LO5A 3QUMH 4KJYA 4OFVA 2MCAA 5GJSH 3TNNA 4PJ9D 2HVKB 1A7RL 3DX3A 4ODUB 5EIQA 3HNTH 2ARJA 2J1XA 1I8IB 5D1ZA 3D25B 2YD2A 1X6NA 1YMME 4S1SL 2BNQB 4PS3A 4QTIL 3NSCA 2FLMA 4EAEA 4IBUA 3V95A 1S8DA 4FQHA 4J39A 3QAZC 2N1TE 2MPAH 2CM5A 4JRLA 5FO2A 5FECB 5GGUB 3QFGA 5L6YL 5GS1C 1AC0A 5SWQB 1YY9D 4RDBA 2V9RA 4HUNB 2XQYK 2X9XA 3TJEL 1J8RA 4HULB 5BMFL 1MZYA 3QIUC 1WCBB 1IAMA 3T3PF 2UWEA 2VNCA 1T7ZA 3PWUA 2E9BA 3EG9B 3MUJA 2QADC 1B0RA 2B08A 3FTXA 4FI6A 2IDCA 2GSGB 3U7YH 4AQ1A 4DK5A 1XD1A 2AC0A 4X7TB 3D30A 4HGWA 3MV11 5DQDL 5IHBA 5D93B 3QIBC 5I8OL 3T71A 3QYNA 4AXWB 2IANB 4R7NA 3ES6B 3CFIC 2FHBA 2CPUA 1OHZA 3A24A 3OSVA 5I75C 1YEJL 1DJWA 2ZUQB 5LUMA 2EIEA 5GRVL 4KNSA 1LE5A 4OCWL 1A4JB 4G8IB 2MPVA 1KTLA 2AQPA 4X5LA 1N4XL 4PCYA 3WUWA 2X6AA 1RK1A 4UQIM 4ELKB 3KNBB 3T77A 4QRRE 4P9ML 1G0XA 1UYWL 1ORSA 3BW9B 3QC5X 5DR5L 2GEQA 1U30A 3GXFA 4XX1G 3QT2A 2Z8VC 3APMA 2X12A 4OZFH 2P44B 1MEXL 5I9QB 1GZPB 2DBLH 4NNXA 3HS0A 4JRXA 3KGUA 5DC2A 5CUSL 1SMDA 1Q9WB 5AAMA 4NFDA 1A14L 1N8OE 3DGGA 3O2VL 1NBVL 3QZNA 1FPTH 1JXDA 2ZP8A 3OKMB 4G8GD 5KANI 2R69L 3QB7C 4HPYL 1H6UA 3AWFA 4X5QA 4YPGA 3A4FA 4JB9L 3O45A 1AR1D 1KXTB 4YL9A 4PRHB 5D1ZC 5FO7A 4YSRA 1U8JA 3RJQB 2ZSWA 4NKDA 2MWCA 4QRBA 3BCDA 1IVLA 3EFDL 2W9LA 4J28A 3T0ED 3U6XA 4XVSH 5BV7C 3IXAB 4L5FL 5DEJA 3LN4A 3WFCH 3TNMA 3ZDWA 3N40F 1FE8L 1MWAB 3C2AH 1MFCH 1T2XA 2NY2B 2YA2A 2OZ4A 3MXVL 1L0QA 1CO1A 1OAZL 4G43A 2X4TB 4ZTOL 5T3XL 1XTLA 1VF5C 2WQ8A 2DQJL 3GMNA 4Y4FB 1E43A 3DO7A 1WLHA 2A9DA 1J5DA 4Y16B 3F5WB 3U79A 2UZPA 3HHSA 4AQ1C 2ICWI 2VO5A 1OE2A 3FN9A 5AD0B 1YYLH 4TN9A 2G4GA 3A6BL 3TTYA 1SQ2N 1MJ7L 3P3TA 5BUPA 1JWSA 2K0RA 2NUTB 4P4KB 4D8PA 1M53A 3MRBA 3L4VA 4CN6A 4P2RA 1ZLUK 3HAEA 4KPHH 1M9SA 5SV3A 1R5VB 3VD5A 5J1TC 3RX5A 1E5AA 1O75A 3G5YA 5F7LB 2CKBA 4APQB 3GI8H 5F9OL 5K5YA 5F1IA 3CDGB 6CGTA 3GZOA 2AJ3A 2JXMA 4NKOA 1NFDA 1R3LB 4IKLA 3M1BA 5EU5B 4FA6A 2EH8H 3HS0C 4IK6A 1INDH 3OKLA 4QRUB 3O6FD 3V52L 3CU1A 5I1JL 4F58H 4L3AA 3SKJH 4MNGE 2H0PA 5EUOA 4TTDC 4ODSH 4PVLA 5ES4B 5JPNA 4M61A 3CC1A 4G8GE 2I9TB 2CHZA 3VG0L 1S7VB 5CBEB 2WWMD 2ITDA 1LO4H 4KDWA 1AGEB 4DVBA 4OLZL 5IHZA 3VD2A 3PWNB 1MCPL 1TVHB 5I8CA 2AV1B 3Q7JA 5KUMA 4MD5A 3TYFB 4MDRA 3CZSA 2FJSA 4KTEH 1E90A 1OXYA 1OT1A 2XWBA 3LRGA 2ERJB 2HRHA 3D3VB 3O6LH 4N2KA 4BFOA 3FUNA 1QEWA 3OB0K 2XIIA 3LS4L 2BVQB 5CLWA 5A2CA 4ZFOL 1HE8A 4ZTPH 1IV8A 3BDYL 4QF1A 1YNLH 3FO2B 1A4CA 1JTPA 1G4MA 3ZR5A 4GRWE 3Q0HA 5TDOB 5BS0E 2QMKA 3MJ7B 2P7TB 1QRND 2C7UA 1YEFH 1PY0A 1ZKAA 2DZEA 3LQAH 2WXJA 5DO2C 5CCKL 1P1ZB 3I02B 2P5WD 4HKJA 5C0RH 5IMKB 1KYOK 3IGAB 2B77A 4XNXL 5K39A 2NYYC 4R5TA 4K7FB 5D96B 4IMLA 4DW2L 3H54A 4ZYKA 1D7FA 4Y19D 1IAIL 3B2MA 4AEIL 4PCSA 3GSOA 4HV8B 1M2VA 5DJYA 3IPBA 3DX8A 4JHAH 3WIFB 3FT4A 1HE7A 3CHOA 2O5NA 4H1LA 4PRBB 4L37A 5FK9A 3F58L 3SGKA 4DCQA 3ULUC 3U6RA 2A74B 1JGDA 4YIQA 5TF1L 2LU5A 3WGVB 6PCYA 1XGRB 4XC3H 1ZVSB 4PJIF 4JE4B 4YLBA 1WA1X 2HWZH 7CGTA 5KS9E 4GAFB 3CSGA 5TJWK 4F3FB 5J9PB 1UXWB 3QS2A 5LKNA 3DTUB 3CZJA 4G5AA 1QVOB 2R7EA 3HE7A 4HXBL 5GRYA 1WF5A 1I3RA 2A6JB 1U3HD 5EU4B 5MP6L 2VXUL 3KGTA 2JELH 3OM3B 4UILH 1EH9A 1MLBB 4HLZG 2YGOA 3SYQA 5I1EL 5I0DA 2DWYA 5EU3A 4Z7QF 2WBJD 2R1YA 2QLYA 4W9HC 4L4TD 5JPNC 4XAWL 2NY6B 3RWHA 3Q8FA 2OS7A 2YEQA 3AJ7A 3L1GA 3L4WA 4KAQL 4LVNC 4W9GC 1UM6L 4Y4HD 2VDMH 1SN5A 3GRBA 1MFBH 4CNIA 4LNVA 3HRZA 3MRPA 5I6XB 4ZMNA 1QATA 1JG9A 5DURD 1UJ3B 5GGQH 5J6HB 2AMGA 1MF2H 4BUGA 1BPVA 2JCCB 4F7EA 1E8XA 1VFMA 2WVVA 5I6KA 1SQMA 2E9IA 3M07A 4MD0A 4PJAB 4MJHA 2BIOA 3BVUA 3KDMB 5HDBE 4NIYE 3ILQD 4KBPA 4G6FB 1P0SE 3PGCB 3W82A 3WNPA 3CHSA 3VRLE 5EEUA 2KQMA 2BPBA 1OQOA 2ZF9A 2FGZA 5EOCL 4ZS6D 2VDRH 1NBZB 4JN1H 15C8L 5SWZD 2CNZA 1E30A 5EOTA 4JG9A 4QRTB 3NCMA 1KYAA 2QSCL 3QRBA 4DOHB 4WUUD 3RDTD 1EMTL 4MDIB 3IN0A 2P5WE 3P4OB 5IB5B 4GG6F 3I3DA 4JJ5A 5IQNA 3LKQB 1UZ8B 4LPVA 3WEMA 3H9SA 2AVGA 4Y19E 2J6EA 2IF7A 1BLNA 3UBFA 3FUDA 1PYWA 1A6WH 2YAMA 4HS3B 4FYRA 1SRDA 3GXDA 4NQEB 5F7WC 1KTDA 2NNAA 3LMJH 4WFED 4IHOA 4I0PC 1W0WA 2UVEA 1EXUA 2DB8A 2E56A 2R9HC 1IFRA 3NFPB 2C3HA 3DHUA 4BELD 1CF1A 1JHLL 2ADIB 1ZLWK 1AD9B 3HE7C 3AM8C 1Y18B 1P2CA 3UG4A 3EGDA 1XZWA 3FRPB 1KSRA 3AREA 3ZZLA 3F05A 3PF2A 3NSFA 4Z3IA 2WLIA 3UBXI 1GGBL 3QRGH 1HH6B 4NT6B 4OCSH 4OH2A 5EUKA 4LOUC 4ZTEA 4U1LB 1GGIH 2WTOA 3WTUA 4GRLC 5I15H 4JEGB 4Y1AE 2EVJA 4L4TE 3KS0J 5I26A 5K9QI 2WB1A 4DUWA 2AITA 5AOKA 4OFIA 5DS8A 5DUML 4TYUA 5TK4A 4POZD 1L9PA 1EQWA 1JNHB 4GYBA 4NQCA 4CILA 1AOHA 1G7JA 3EGSB 3HUJB 2XBDA 3DYPA 4MAUH 4M6NH 1ZTXL 2HKHL 1KBPA 1IM3A 4JO5A 4GS7B 5DLML 4ZUTB 1CTNA 4WTQA 4LCWB 3X12A 5KSUA 1MHEA 3T8XA 4AM0B 1F4YH 5DMKA 2AKRA 4MJID 3DWTA 3GRWA 5SWZE 2QGBA 3QQDB 3EYVA 4LCCB 4MCZA 4ERSH 4LCIH 1HS6A 5HHXH 3BWZA 4EIBA 2VDLB 4WUUE 1MCJA 2WXMA 4I5BA 1BQRA 3MROB 7FABL 1NICA 4IS6A 4I87A 2B7DT 3C6LD 1TZIB 3CE1A 4ZSOB 1E4KC 5AOJA 4MBOA 1XF2B 1I8LC 4WFEE 2FVNA 3HZKA 3IT8D 3NABL 2D4DA 3ARGB 5LNDA 4UYPA 3U30C 4FJYA 1NDMA 1BQLL 3GUTB 4LBAA 3C5JA 3O2WL 2WTPA 4KXCA 4JBSA 2VSCA 2N3JA 1XGTA 5CJ5A 2K7QA 3QEQB 3WDIA 4HWEL 3RGVA 4JO8A 2ESVB 1DEDA 4F2EA 1D6EB 4FQJH 1UT9A 1TTGA 2GYSA 1SMOA 4JUTA 1GSMA 3B2UD 3BKCL 1J12A 3MV8D 2EE9A 2BX5A 4AE1A 1J8HA 3QYMA 3KYNB 5KVEE 3SKMA 1YG9A 1E5ZA 1R0AH 1SEBA 2RFXA 5J1AB 4UV7H 3P2BA 1PLBA 1TQSA 3Q01A 2JV6A 2OZ4H 2Y36L 1JCVA 4XCEA 5GGTA 2YPLA 1TJGH 3RY6C 4RAHA 2OJ1A 3N3EA 4LHUA 1B6UA 1KT2A 1DVZA 3TM6A 4EZMA 4MKMA 5C0IA 1EO8H 3ZE2E 3F7KA 3F7RA 1KCSH 4H8WH 2IDFA 1Q1JH 4WKZB 3MA9H 3MKGA 4OLUH 4PRPD 1DL7H 1JPTH 5FHAH 4OF7A 2WHVA 1NMBL 3SDDA 3E2HC 1T3FA 2IMMA 3QWRD 3B5TA 4PJEF 4ACPA 3P77A 4X8CA 4Y5XB 2I60L 1KG0A 4LHJB 3SGEH 4IOIB 3CSTA 3S96B 2YD5A 2EC8A 1ORQB 4Z3TA 1A0QH 5JPMB 4JFDA 5CS7A 2CKBH 5I0XA 4L1HA 4FYQA 3T4AB 5GXBB 3OG6B 1KFAH 1RL1A 1E6OL 2JJVA 1XVSA 3BEVB 2CH8A 3II3A 4JFHD 5FO8B 3OZ9H 3U0WH 1WISA 2OX5B 2VM3A 4I48A 4X0KB 2KDGA 5KJ7E 1KBGL 2CIIB 3DOHA 1ES0A 3P2DA 3M17B 4YZWA 1MY5A 4OJFH 4JG0H 1S2EA 5FCSH 4D0BB 1KBVA 3AWEA 5E1HB 5BUAA 5KW9L 3MRHB 1V3LA 5KVFE 3CN3A 3WELA 5IF0B 2WZ0A 5DD6B 3UTTE 4N5EC 4H40A 4MAYB 3TT1H 4OCYL 5JR1H 2XVBA 2L0DA 4ONFH 1WG3A 2COVD 3MMEB 2HUEA 4A6YA 4RAUB 4P2QA 4NFBA 4XBPA 4K9JA 4NLAA 3UP6A 2XOTA 4HJ0D 1IU1A 3MU3A 4ONOA 2DYPB 2ENSA 3FULA 3MV8E 1Z6JT 2MQ3A 3QDMA 2GJZA 2Y25A 1A1MB 2YD4A 5I0VA 1OGAD 2V7NB 1OWWA 3GJFB 3AXLA 5D6DA 1FVEB 4YDVA 5IMLB 2VQTA 1ID5I 3LXBA 2R0WH 4IGBC 2Q2EB 1TG8A 4I77L 1G87A 4NO5A 2YAHA 3BCFA 3DIVA 2PXYB 5F8QC 5JDSA 1U33A 5EMYA 1XF5B 3TO4A 1Z9MA 1WA0X 4Y2DB 4QRPE 4URKA 3H7LA 5C0DA 1DBKL 3TCTA 3JWOC 1IKFH 4KQ3L 3SDCA 1FQ9C 4OFYA 1C7TA 1F3RB 1PSKL 1TYEB 5HVHC 5JW3H 3SQRA 3QULA 4PRPE 2HUHA 4TRPL 3VCLA 3LZOA 2I7SA 5FW6A 3IE9A 3BGMB 3HNSL 4PSPA 3Q2LA 3V4LA 3PDDA 2UY6B 2WMPA 3CMGA 2Y1YA 2X28A 3I9GL 1BVNP 4M6AA 4TVPH 5DRZB 3QNYB 2J8HA 3IFNH 3BP7A 3S3SA 1NCAL 3RURA 2VABA 2AAAA 5AG9A 3QP3A 3QG7H 2XBTA 3DURA 1JAEA 4RGND 3UACA 5CSGA 4HJEA 1FCGA 4OCLC 2PLTA 1BLIA 1J9CT 1CFSB 2VMCA 1CICB 3EXJA 1QI3A 1BYNA 1KBKA 3A47A 4NJ9L 1XSJA 2D3JA 4Q8BA 2OMZB 3GGWA 3Q8CA 4JFHE 4LKXA 3I50L 4OQ1A 3MAWA 4PLJC 1P4BH 5A16B 1NPNA 5F7HA 3GSNA 4KC3B 2MRYA 5T1MA 3MLXH 1IBHA 3B9KD 2FQGA 4LCYA 1FZJB 1EFXB 2ZG1A 4JM2A 3M45A 4U1IB 3NIGE 4XB7A 4X6DB 3D7PA 3ZUCA 3ARFB 4GFXA 1EGJL 5ID1A 4JKPL 1IGMH 3CC5B 2X3AA 2ORBH 5B1JC 3VGAC 4M43H 3O3DB 3TZVD 3BVXA 1XIWD 4FXTA 4F7PB 1NWOA 4DKTA 1CL7I 5D6DC 1UEMA 1NCBL 4AV5A 1OGAE 3NIFF 3ZJAA 3MBEB 4M5SA 3CUPB 3DV6B 3ZDZF 1QLEB 4WU7A 2YMOA 1WIOA 3TO4C 2YEZA 5FGSA 2WTRB 5J5EA 1O6SA 4NQXA 5C8JA 3HC3H 3GSRA 3DKHA 1JFQL 4FYSA 1ZA3B 1H3PL 3BH9A 5AAWA 1C1EH 2GUOA 5C7ZA 4FQCH 4F7KA 3LDBC 3WEXA 3GXMA 4WWOA 4MS8C 4UTAA 1FNEA 4E5XG 4Y88A 2H45A 5KBLA 5F96H 5LGJB 1PKQB 1N5AA 2DH2A 4L5FE 2J6EH 1UZ6F 4NDMA 3DJZA 5DJ6B 2ROXA 2IDQA 1KCUH 3SZ6A 4PJ7A 2UWEF 4N2NA 2WXLA 4PJ5D 4JHVA 4KRLB 4BK4A 3GEWB 1B6DA 5C07E 3C60B 1PNCA 4PB0H 4RGNE 4TSBH 3NK3A 2D9CA 5TE4L 3IJEB 5IMMA 1OAKL 3QNXB 1OVZA 3CQPA 3Q8AA 4HHGA 5L88H 2OK0L 2UZXA 1Z9SA 1AZRA 1EA9C 3W11C 3B7RL 3MJ8B 1JOIA 1NCWL 3LD8B 2FB4H 4HDIA 3TOPA 1E8WA 1KELH 1OAUL 3GMOB 3NA9H 3SYCA 1DVSA 3FZUD 4W9CC 2AXHA 4KVNL 4LNRB 5E4IA 1LO2H 2XSKA 5ID0B 5JW4M 4OGYL 3RPKA 1NEZA 2ZPKH 4RFNB 1ZXKA 2NCMA 2X9ZA 1CQYA 2QSQA 3BAJA 1BOGB 3PP4L 5DC4B 4DP2X 4CGTA 4L05A 4LSPH 4JZJA 1QEXA 2QBWA 4OI9A 1JV2A 4O2EB 1VKXA 3TO2A 4NZ8A 1G94A 1OSPL 3O3UN 2HLEB 4X7SH 1YDPB 4UQCA 3JXAA 3TPUB 2ICEA 3KWXA 3L16A 2BVEA 3VFOA 1RIVL 4ZOAA 1TLMA 1Y1UA 4PVMA 4P23A 1G6RL 2V33A 4HQQH 5GHWH 1GKOA 2WNKA 4PY7B 1VCAA 2A5UA 4FDWA 5E9NA 1XL6A 5GGSA 2DIAA 5AAWC 3QWOA 4FKKA 3CZFB 4KHXL 3WNKA 2BP8A 4LEXL 1I9JL 4P2OD 4X2UA 1URLA 3NG5A 4Z23A 1CIDA 1USQA 2AJSL 2YD7A 4MQSB 3G5VB 5E8PA 3ILPA 1L7TL 5LHDA 1AG6A 5HJBA 1LE9A 5JLZB 2O4EA 3D5OF 3UIYA 3G3LA 3O8XD 4KI5C 1WS8A 5H35A 1UXLA 3PIQA 3O6ML 5AG8A 4FXGA 5DA4A 1A25A 1LTXA 1JPEA 2EQDA 3BPOB 3RZWA 2VC2L 2HRPL 3L7FB 3PDOB 4U1GC 3HI6H 3NPSB 4XPAL 1VHPA 4GW1B 25C8H 4KKNA 2YRZA 3VMNA 4LIQL 3DX1A 4JFOA 4JPWH 2WLLA 3GEFA 4WU5A 4AQOA 2GFBA 1KPUA 3N42F 4XVUC 1C12B 3ULUF 1MCWM 2XWJB 3EFFA 4P07A 3CLWA 1CR9H 1ZHKB 2P3YA 3L3DB 3U9PH 1G9MH 1ONQB 3PAUA 1WAAA 4IRSD 5T5FA 1NFDF 1ID2A 5JUEL 4HH9B 2WZPD 3QJUB 5D55A 1UM4L 4FYTA 1A9VA 4L3EA 4J23A 3VVWA 2XQBH 1X3DA 5KZCB 4XC1L 1NH6A 1GRWA 4GT7A 2HFGH 5DZAA 4HJTA 5EIIB 5JO5B 5I23A 5FGCE 1IQWL 2KPNA 4OCRL 5EUOF 2OMXA 1CXLA 1XL4A 2XA8H 2E7CA 1P53A 1TJIH 1Z7JA 2XA3A 4XOBA 3SYPA 5JQ6H 1IBFA 5BXFB 3EW3B 3JWNC 3I6LD 4OM1L 1XMWA 4AVIA 1Q90A 2MTAA 1NQBA 1F3JA 1VAHA 4P23C 4HVBA 1FNLA 3CVCA 4AEHL 3MCKB 1CVRA 1P4LB 1XXFC 1EXHA 1ETA1 4NRYA 3KVQA 5LCVL 1A9EB 2IGFH 3FO0L 5IVXB 4QKTA 5F6IB 1ZT7B 2BH0A 1ZA6B 2YS4A 2JKJA 3M7FB 3QO1B 2R4RL 4NSKB 1MCBA 3WDJA 5J7CC 4UANA 4OLXH 4BFFA 2O26U 4QRAA 2CLVA 3CLFL 1UA6H 3CVHH 2XTJC 3HKFA 3VWKD 2WVUA 4MJ5B 4XNMB 5F9JA 1Q0YH 2CBQA 3QUZA 3ZTNH 4YXHH 2CD0A 4IKJA 4XCYB 5GPRA 2KS0A 1E28A 1UB5B 4EDXB 4FQQB 1S9YB 4ZZKA 3BYYA 5TTRA 4LLAA 1OCWH 4FXGC 3VUAA 1P6WA 2VLJD 3RIAF 3R0MA 3WSQH 1U92B 2XPGB 3X1BA 3LKNB 1IL1B 4YSDA 3ZYIA 3VXUA 3TEZA 3V0IA 4CW1B 4LEOA 3MNWB 3ISYA 1ZLVH 4HUXB 1P84K 1KWKA 4AK1A 1QQDB 4K3GA 1QAWA 4KKAD 4LPTA 5DK2B 4PM1A 3FTSA 3ARPA 1SBSL 4OZ4A 1EEYB 4RA3A 3V6OE 2P80D 2R1XB 2X1PA 5C3TA 4AKQA 3MTRA 4QOKD 1FO0B 1IE5A 4RFOH 4AYGA 1PZAA 1SJHB 3CMOH 2NW3A 3B7TA 3S37H 1NC2B 1QSZA 4K2UL 4ONHB 4PR5B 5EO0A 1VGKA 2M1KA 2EDMA 2FRGP 3LVTA 3MGAA 4R4ND 4WTXA 4L8BA 3U46A 3WO4C 5INDB 1JZ4A 5HYJA 4MNQE 3W39A 1BG9A 5EO1B 1LK3L 2R8SH 1HHJA 3NESA 4P46A 1T1WB 3AG4B 3NJJA 3FQRB 1RULL 4JREB 2K4AA 4DP1X 1AMXA 1RY7B 4TUJA 3PABA 4ZMAT 5I8KL 5LAXB 2HB0A 4JFVA 2NXYC 4ETQA 4QJ4B 4Q6KA 4DIXA 4X5WA 1YEEH 2FJFB 3O3EA 1QFWL 3DX4A 1OPGL 5K33A 3L45A 5HGGS 1M7DB 1HNYA 1EDQA 2JSFA 3U4BH 4OFKA 1W0YT 3L7EB 4MWFA 3FSWA 1O9WA 2WQRA 3BLKA 3CVIH 3NDYE 4KO5A 4KU1A 4PJFA 3L6FB 3GMRB 1TZGL 1MI5A 5GIRB 4AG4H 5EF1A 3OLGA 3QUZC 1DQVA 4RAVA 3T1FB 2GG1A 2HFFB 5FA4A 2BVTA 3AUWB 2Z93B 1N7MH 1BG1A 4G9DB 3UAJD 4JUSA 4JPKL 4QJ5B 5FDWA 4R0LC 3E38A 2VR5A 2JLLA 2Y1AA 3ALPA 3R06B 1GW6A 4ZPVB 3QI9C 4OZGB 2NY3B 2HFEB 2H8PB 3K6NA 1JGVL 4KK6C 3HJ0A 2DQGL 2Q3AA 2E75C 4FNPA 4XP5L 1G1YA 2UYLB 1CQKA 3FT1A 4H26B 2AZUA 5G5DB 3L54A 3GSNH 3OD3A 2BW4A 2GITB 1I8UA 4OF6A 3QQ3B 3UPAA 1WWWX 3AUVA 2M26A 3U0PB 5I2IB 1EBAA 1JGEB 4NJAH 4B6ZA 4Y5VA 3UDWA 2XWXA 5IQOA 4X6CA 1AXTH 1QZ1A 1KPRB 2W0LA 4M1DL 4GFTB 3TC9A 3FOMB 4KTDL 5F88A 4ZODA 2H2SD 3P0VH 4FE9A 4CSSA 2KERA 4MVBC 3IGLA 4XCCH 3BAEH 4BWUA 2A6KB 1QG3A 2R2EB 3VI3E 4WI8A 4U4IA 3ATEA 4JO3H 1JK9A 1E9PB 4J4PC 3BQVA 5DF0A 2AJVL 4PWGA 1AHKA 2E5EA 3QUXA 4I13B 2EZ0D 4JRYA 4W93A 4M48L 2X89D 5TQ0H 4TNFA 2W9EH 4WWPA 3R8BB 1VADA 5H8DA 5KJ4A 3QIWB 1SUJA 2BRQA 4E41E 3LPWA 3LSOB 1J5OL 3FSVA 4Z1PA 1NC4B 3V9CA 4J6RH 4OLVL 2ZOWA 6FABH 3HMWH 1H3TA 1KB3A 2Z7ZA 3D12B 4TQEL 4KGLA 1RIHL 1HVXA 4PGBB 2OYLA 3Q5TA 1MJJA 3VM7A 3D0AA 2FLBT 3JYCA 2ADJA 4EI0A 1IGIH 5C7XH 2XWDA 2F5AH 2V2WB 1YEKH 1PEZA 2HYMA 4PTUB 4P5KB 2UZYA 2O6CA 3CHPA 4GI6A 1KUMA 3IFOB 4R8WH 3WYRA 2X05A 3U4EA 4ZMZA 1IGJA 1CB4A 5IEHA 1HK6A 3X17A 5FFOA 5FLVA 1W72A 1E6JH 3PL6C 4O51B 3LH8A 5E9AA 4FQLL 2O5XL 1T89C 5C0AA 1MCCA 5IROD 5CIPH 4EUPG 4M5ZH 3SDXB 1X7TA 3UAEA 3MNZB 4I88A 5DC9B 4N8VA 3UX9B 3Q3GB 2QGEA 3HS8A 4FNSA 4Y5VC 1D5XB 1PX8A 3UDWC 1GAFH 1YUHB 4I3GA 3OKYA 5CEZL 1GKEA 3QXDA 1HXMA 3OR6A 2E6JA 3T0DA 3UPRA 1OV8A 4S0SD 2VERA 1CG9B 1VZHA 2IH8A 2OR9L 3AT9A 5EN3A 3UIZA 4PJCE 2X44D 5F1SA 5IT2L 2YPKB 4AGPA 2PABA 2I85A 2X2YA 4MXWH 2DI8A 2Q5BA 1FZKB 5CWSB 2FIKB 2MCPH 32C2B 3QUXC 2C4FT 4OUOA 5FKPA 2N59A 5A2AA 3CV5A 4JGJA 2YFNA 4HOZA 4FXLA 4UM8B 1JPFA 4R3SA 1INEL 2PW1B 4GT0A 1HSAA 1T03H 2FK9A 5C0CD 4Q9RL 4Q97A 1N2RB 4WWID 2FNWA 3QJZA 3KAAA 4N1CA 2A0LD 2GVYA 2ZP9A 3WD5H 1EO7A 1H6EA 5IB4A 2EXSA 5F3FA 5C70A 3QUKA 12E8H 4K0OA 4ZNEE 1I9IH 1P7KA 1P5UB 4U3XA 1FGVH 4JZOB 1V3JA 4HEPA 3IF1B 3OQ3B 5C6TL 3TBTB 4QKXB 3DLQR 4LQFH 3WEBA 1H0DB 4FERA 4UNIA 1QRKA 5IZ7A 2BSED 5AB1A 4A7TA 3JVFC 3V8OA 4AIXA 1RZ7H 3OLEA 2R23A 2VLKD 4QRFA 3CSYB 1X5GA 5C09D 4LCVA 2NLJA 3OMNB 4YWGL 3LRLA 2XG4B 2JI2A 3FJTA 3WHXA 3S98A 1FVCB 2K3TA 1YNKL 2NR6A 3FO9A 3ABLB 3FQ1A 4LLDA 4CVXA 5DRWA 2Y23A 3HG1A 1DE4A 5BZDA 5ELIA 5T5FH 4WV1A 1J0KA 1FL5A 3NCBB 4HS8L 1L3NA 4NZDA 1BZ7B 4QO1B 4BSWB 1XGYL 1XCTA 2ADFL 2X1OA 1WZ1H 3WFEL 3TBYA 3VFWB 3X11A 3HFFA 1X4ZA 2B9AA 3SPCA 4LRIA 4MA7H 3EDKA 1S3RA 3OAYK 1CGUA 3GO1H 3SGDI 2ZOLB 1Q8MA 3HLAB 4P5TD 2A9NL 3QG6B 3BWUF 2CK0L 4LESA 5CP3A 1U6AH 2WNGA 4EI5A 1W8NA 5D5MA 2FNBA 2XUWA 2PPAA 5IQ9A 1T1XA 3KPNB 5EBWB 1QP1A 3IWUA 3A0OA 3F6IA 4PLOB 2K7PA 4LAQH 2X53A 5FKAA 1M7UA 1WSST 2ZX8A 4AZUA 3FHAA 5C0CE 3O6KL 4FEIA 3UOAB 1S7TB 1NGZB 5J57B 1E9QA 2Q8AL 3VFTB 4XN8A 3TN0B 4U7MA 3NJXA