4TS6A

Crystal structure of the rim c2a domain from drosophila.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
PIEGRLQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAHHILDDEAEWYQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab3 interacting molecule variant 2
publication title Crystal structure of the RIM C2A domain from Drosophila.
rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ts6A00
3L16A 1E7UA 2EP6A 3FBKA 3QJZA 4BFRA 3OAWA 4AOFA 4F93B 3W57A 1DJWA 2WXGA 4GB9A 5G55A 2RD0A 4F91B 3GPEA 1DJHA 4PS3A 4OVUA 4A55A 2X38A 4LDCA 5EDSA 2Q0ZX 4LT7A 4NPKA 2N1TE 2K45A 4DNLA 4TV3A 2R83A 4ANWA 5H4YA 3APFA 3HHMA 5G2NA 4HVBA 4TUUA 2K8MA 2CM6A 3T8MA 3DPDA 3N5AA 3ML9A 2K4AA 4GNKB 4QAMB 5CCGE 1UGKA 4KITB 4QJ5B 3QR1A 3TJPA 3ML8A 3W56A 1HE8A 4TS6A 1DSYA 3TL5A 1DJYA 3HN8A 4DK5A 1K5WA 2KI6A 4G11A 2WXFA 3NZSA 3R7RA 2CJTA 3NZUA 1DJXA 4NP9A 4J6IA 1WFJA 2Z0UA 4LCVA 1E90A 3B7YA 4L2YA 2QZQA 4PS8A 4XZ4A 4WEEA 4FJYA 3RDJA 3APCA 3HIZA 3L9BA 4ICXA 3QK0A 4WWPA 2BWQA 4L1BA 5T8IA 3TWYA 4AJWA 3ENEA 1DJGA 1W15A 1RLWA 3QR0A 3RPBA 4F1SA 3KWUA 2NCEA 2CHWA 2K3HA 2CHXA 2CHZA 2NQ3A 2Y3AA 1GMIA 3IBEA 2WXMA 2WXRA 1YRKA 2A5UA 4QJ3B 4FA6A 4EZLA 4HLEA 3PFQA 2ENJA 1E8XA 2WXNA 3P2BA 4FADA 4XE0A 5JHAA 1V27A 3L54A 4ANUA 4ANXA 3OHMB 1E7VA 2WXLA 2LHAA 1BYNA 3NSJA 5H4ZA 2WXHA 4WAFA 1BCIA 2UZPA 3KWTA 3PREA 4FLHA 2CM5A 1DJIA 2YRBA 3PRZA 3QAQA 1E8ZA 1RH8A 4ICWA 4NPJA 4NS0A 1CJYA 2D8KA 4FHKA 4JPSA 2WXKA 1TJXA 3CSFA 3FDWA 3F04A 2ENQA 2V4LA 4WWOA 3IM1A 4IHBA 4IQHA 4EZJA 2ZKMX 4V11A 4BGDA 1QASA 4Y1SA 1BDYA 2WXIA 3PS6A 1A25A 3SD5A 2QZ5A 1QATA 4MJJA 3ZIMA 2FJUB 3DBSA 3ZW3A 2ISDA 2WXPA 3CSTA 4URKA 1W16A 2A4ZA 1DQVA 3F00A 1RSYA 3F01A 1E8YA 4L1LA 5CCHE 2B3RA 4L23A 4FHJA 2CJSA 4QJ4B 2CHDA 5CCJA 4F92B 1DJZA 4Y1TA 5JHBA 2ENPA 3LJ3A 1TJMA 1E8WA 3S2AA 2WXQA 3L08A 2DMHA 4PS7A 2WXJA 3L13A 2FK9A 2DMGA 3F05A 1WFMA 3L17A 4WWNA 4FULA 2JQZA 3M7FB 3PYCA 1UOWA 3ZVVA 3QARA 4ANVA 5KJ7E 4EZKA 3MJWA 1UOVA 3R7QA 2NSQA 2Q3XA 3L4CA 3APDA 3JZYA 4KZ0A 4XX5A 4OVVA 2YOAA 4FJZA 4KZCA 2WXOA
chains in the Genus database with same CATH superfamily
3ZR6A 3FU8A 1IB5A 3V55A 3H9SD 1QSVA 2VSCA 4CRPA 2YR3A 3AWGA 5SWZB 3EZJB 5AL0A 4AEEA 4PD4K 4DQOH 4E9LA 5C0AB 2IDSA 2VDPB 3LRLA 4OVUA 1SFDA 5CP3H 3SYPA 1P7KB 4LDCA 5T5FH 3VMOA 3BP4A 1LO0L 3SPHA 1HHJA 4A37A 3IDGA 5GSVA 2DQDL 2K0RA 5KVDH 4ORGB 1HHKA 2JLPA 4XPAL 1EEQA 1M1XB 2HJLA 4BA0A 3L1EA 3RWIB 3VI3B 3QDJE 4J3OC 7PCYA 1W91A 1NC4A 1DSYA 3FUFA 4F37F 3PGFL 1ERNA 2HFEA 2BOCA 1UEYA 1D5ZA 1U6AL 4IEFA 1TQTA 2BK8A 4UOJA 1WFJA 1J0JA 4NWTH 3FZUC 5D1XA 2WP3T 4P5MB 5D4JA 4JDTL 2CWRA 3WE1A 5GZNC 1FNEB 3QNFA 4N0UA 1IBHA 3DGGA 4P05A 1HEZA 3P4NB 3P3SA 1OGAD 5DURB 4BFKA 5FLVA 1EXGA 4KPHH 5IQMA 1BQUA 1SRDA 4I4WA 1OGTB 2AJ3B 3D05A 3L7EA 5D6DC 3VH8G 3FYEB 1KPRA 5FYKD 2KDYA 3KW7A 2AJZA 2HT2C 4JQVA 1MFCL 1OTSC 3GD1C 4C4KO 4MA7H 4IM8A 2XKSA 3V7MA 3BUYB 3I3EA 1DVQA 3IB4A 1HCZA 1UWEL 2D73A 3I6LE 1KCLA 4P46D 5DVMA 4I5BB 4DKFH 5IB3B 4GBXB 2BIPA 3MODH 5GGSB 1UD2A 4G6FD 3QJHA 2XA3A 5IEKB 1PNCA 2XKNA 3G5ZB 4MJID 4ZD3L 1XB3A 2ZUXA 3K71B 3DMMC 4IDLA 4QHKI 4JM4L 1B4LA 4LARL 3D3VB 3QYNA 1BQLL 3SD5A 5D1ZC 1FO0H 4R2GC 3HG5A 3F6JA 2KMWA 3GJFK 1QFPA 2AK1L 2MQCA 3BH9B 1WF5A 4QRRE 3CSYA 5DUMH 4QRSA 4AV5A 4XCYB 1BVLB 3BPCB 3LHAA 5LBSH 1MCQA 3VFTA 3OKMB 1PS3A 2A0LC 2ZCKH 4JO8A 4OTXH 2GVYA 3BD4A 2NY1D 1IGIH 2DJ4A 1U4FA 2YWYA 3VQ2C 2EDNA 1GAFL 1X5MA 1F8TH 1ZCRA 4Z95H 4YHOH 3BKJH 3ZYIA 3PV6A 3ZLQC 1UB5A 4U1MB 2X09A 5B38A 2LVCA 1T7YA 2WUBL 4PAZA 5A2KH 1AOHA 4QXUL 1JBJA 1PCXA 4BIKA 3J8F7 2PWGA 3BPNB 5I30H 5I1GL 2ITCB 4YFLI 2W60A 3VFUB 2VABB 4ZTEA 1CICB 3RU8L 4GKNA 4E68A 1RUKH 3CXDH 3QJFA 1COBA 1HXMA 3T65B 5D7HA 1SXZA 3K2MC 1CXHA 1IKFH 4YK4B 1MXDA 2Q3ZA 4AQAB 5KYXB 1FQ9C 4HCRL 2XG5A 2FX9L 2N1TE 1TENA 1JZ6A 1L0YA 1YEJH 2BVEA 3PHAA 1OAQL 3DURB 3U0WL 2DYPB 1HEJC 4TF4A 4NN5C 3MX0B 1CTOA 5DJYB 5D7LE 3VXUA 1A6PA 3P9MA 1TJHH 5DRWA 5GIRB 3VD9A 4CVZA 4M1GH 5E8EA 3CZNA 3KJ6H 4HXBH 2DD8H 2KZBA 4M3KB 3BUDA 4P4KA 4XMVA 4J8RB 3I74A 1XHHA 3NEEA 1NKOA 1T03L 3UFIA 5FGCE 3EOTH 3MUY1 3CU1A 2GUYA 2A6KA 4XBEH 4NQVB 3VFWA 3N44F 3VD4A 3Q05A 1JF1B 3H2WA 2NXZC 3U7WH 1RUPH 4G9DB 5GGUA 4HIPA 2Y7NA 3VSQA 3Q8BA 4J23A 4L05A 3HC4L 5AVUB 2BVYA 4GS7C 1BFVL 1JXDA 2O4EA 5FK9A 3RNKB 3IDUA 2X70B 3SKOA 2ENJA 3DJRA 4MNGE 4ZI8A 2H1LM 1MQ8A 2X2IA 3TCLA 1YPZA 1PW3A 1P4BH 5KWYC 2HKHH 2X1XR 2JIXA 4JCWA 4DN4L 1QQDA 3OKKB 5ANHA 1I1AB 2VR4A 1G6RB 1LO2L 4IIZA 3ASWA 3MBEC 3DX7A 5KYWA 2VDPH 3MMEA 2L3BA 1QI5A 3C6LD 3K72B 3LTVA 1PJWA 3NCYP 3E1F1 4ZSOA 3BVVA 5FO2A 5IB2A 4CSSA 5FO9A 3H55A 4HKXA 4U6YB 1NGPH 1HQRB 4G80A 2APSA 4HGWB 4PYHA 3AU0A 1DQTA 4JDZA 2Q76B 3I02A 4W6YB 1A6ZA 5AKTA 1DANU 2Z3FA 1UD3A 2MQ0A 4KVNL 2PYFA 5DR5H 1K2DB 1DBKL 4TNGA 5DK2A 3RHWF 2ODIA 4PJBA 3T0WA 3ROLB 3ULUL 4KK8D 2Y7QB 1EVUA 2HVJA 4OZIA 3QYMA 3AZUA 4FQXC 2PWDA 2XSKA 4RGND 5EC1A 2ZNXA 4Q74A 1QRKA 4UNIA 3KYAA 4QRQA 1NQBA 4N2AA 3SO5A 4POZD 4QO1B 1WCBA 5JXAH 5EIQA 1EO7A 5IVXF 3RFZB 3UJIH 4X99A 2AQRA 4JL1A 3EYVB 2IANA 4PQXA 4PJFF 1IM3D 1JS4A 1I8IA 3JV5A 4LESA 4P9HL 2H5UA 4TVPD 4RH4A 2D9QB 1IU1A 1JN6B 3IJSB 4DNLA 1UZ8A 1JHTB 4MQXC 1P2CA 2VIRB 2ZWLT 3M1OA 5IUCA 3VGHA 2QDVA 4NRXB 1LQSR 3RWEB 1AZCA 1CC3A 3FT9A 1NUDA 4ILDA 2LU7A 1R0AL 1TKWB 4XXDB 3VWJA 3AQZA 2QSVA 1IV8A 1XSIA 2PETA 4XPTL 1YNLH 1BZ7B 3I9GH 3V6OC 1P4UA 2CUAA 4JR9H 1G7HB 4AZ8B 2KZKA 3JTTA 4NP9A 3QBTB 5CEYB 4XT1C 2R1XB 1PG7H 4BGLA 5KBLA 2FGWH 4JFFD 3ELQA 4UDUB 5IWLC 3CZGA 2ICEC 3DO3A 4OJFL 2NY0C 3ILPA 3O4LB 3QHTC 4GUCA 5F7AA 3RDJA 4AEIL 5HYSB 4JFOB 3PGDA 4FRWA 4JO4H 4G7QB 1EDHA 2JJSA 3GSOA 2X4OA 3PL6D 1L6XA 3QWNA 4RGMB 3TN0A 4NHCH 1TDQA 2EVGA 3HC2A 2NUPB 2P7TA 3QWRD 1HKFA 1MRFH 3W3BA 4KNSA 1NGWB 3ZDYF 4L8CA 2AKRA 2LU5A 5DZLA 3KZ8A 3NJVA 1U3NA 2XQYK 4UOZA 4HAGA 5AD0A 3W5NA 4JCLA 2R0KH 3IU3A 4TNFA 3SYAA 4AYGA 5JNYA 5J11B 4LBEA 2KBGA 4ANXA 4MNQD 4HWNA 4D0BA 3WSQL 2QVKA 3JV6A 3BXNB 5CUSL 4JPVL 5D1XE 1F2QA 3KLDA 1S9KC 5L2KD 1J5HA 1GZQA 1RK1A 4L8BB 5EPMA 4HETA 5MENB 4WFEE 5D2NA 3PRZA 4TUJB 4DN3L 3HE6B 3LXBA 3JBG7 2AAAA 1YEIL 3SZ6A 2VERN 3BUQA 4I88A 3U7YH 1OE2A 1FRGH 4U3SB 3RIKA 3HS0C 5D8JH 2XTSA 1L7TL 5DD0L 1RPQA 1BFOB 2DL2A 1QR1A 2XVBA 3FQUB 3L6FB 3BZFB 1XF2A 4KQ4H 4UTBL 3WEBA 2DMBA 1HHHA 3F7RA 4D2NA 1MIEH 2B4CL 1CDBA 4TNVK 3QG6B 4GFTB 1DCLA 4N0YL 5C0BD 2DMKA 1S7WA 3V7AE 4AM0B 3IFPB 3QT2A 1U93B 1R34A 4I9WD 1G1CA 2AGJL 2DM4A 4HHGA 4LRIC 5E8DL 4MMZA 3T6QC 1AP2B 3N1GC 2IWGA 1SY6A 3P77B 3TIEA 2GITB 3BKCL 4FOMA 3OVUB 2J88L 3BEWB 4K5MA 1M2VA 1N6QH 4IS6B 2JQAA 3L1OL 3LPPA 2MTAA 4WI6A 1JZ7A 4MAZA 1F45A 2VLRA 3CFBA 2CGZA 3VCLB 3AS2A 4XZUA 5HDBE 1FNSL 2VYRE 4HV8A 3IBOA 2J1YA 4W9DC 1DP0A 4DAGL 4P5KA 4LDOB 4QTHA 2VTFA 1XGRA 1INEH 3S5LA 4JFVA 3O81A 3U79A 1MLCB 2IGFL 2WW8A 2QHRH 1U3HB 1G6RH 3KNBA 4ZO8A 2EE2A 1EEYB 3HE7B 3ZZQA 1XIWB 5I8CA 5D7IF 2DDQL 5LDUA 2WOBA 1RHFA 2OX5B 1NAKH 4RGOH 4DTGH 5D5MF 4P57B 4RAVA 2HLFC 4HKJB 4BFFA 1S7VB 4L29B 1G84A 4KTDL 3HS9A 1MJ7L 3MHZA 4BZ1H 2JWYA 3S4SB 1T6VN 3WY4A 1ACYH 2J12B 1AXTL 1T1ZB 3NRFA 3C6SA 3WXWL 5BS0B 4K3GA 3QFGA 1FNHA 5JUEL 4PJEB 1W15A 4HK3J 1JK8A 1F58L 2HPOA 4N8PA 3W5MA 3BH8B 4HS8H 3EYOB 3P4OA 4NZUH 2XA8L 1UVQA 3TBBA 3VXUE 4NHUB 5DA0B 4K7PX 5JQ6H 2YD7A 4PJHB 1P7HL 4HHAA 5HHVH 1NPJA 2VWEE 5SWQA 4UQ2A 4LP5A 1AY1H 4XNBA 4W9CC 1I82A 3N0PB 3D0VA 3ZDZF 2FHFA 3MACH 1A64A 3X13B 4NNYB 4NJ9L 2XRAL 3CJJA 3O3EB 3MUGA 1DJIA 2J71A 1ECYA 3STZB 3UROR 1YY8A 4DO6A 4FXKA 2O5XH 3AQDA 1FLTX 3VJ6A 1S7UB 3L95B 4M6NL 3GI9H 2B39A 2ZKMX 1O6TA 1O9ZA 35C8H 4ZW3A 3NCMA 5GS1A 5C9JB 5HGAA 1ZANL 3LIZH 1MAMH 3PWLA 4Y5XA 1CN4A 1T0NB 3EYQC 5FYLD 3D25A 4EMZA 1D5MA 1FJ1A 1BHGA 5EORL 1NBVL 3F00A 4K71B 1YPZE 2Z8WC 5HDQH 3SGDH 3TH2T 1YNKH 4N1CA 4E5XG 1DDHA 3ZUCA 3VWKC 2BSED 2GTWB 3E6FA 2O6CA 4MAYD 2VW7A 2YN5A 3GIVA 3O11A 3VXQB 1IEBB 2EVIA 1NGQL 3CTTA 5HYFA 4W6XB 5AAWC 1UQSA 4GI8A 4ES9A 5LWYL 5DZ9A 4XMLH 1L6PA 3CDYA 4WKXA 2E4FA 4K07A 4ZSOE 1WISA 2BP5M 3H85A 4YGVA 3HR5A 4N8VB 3VE0B 1R46A 2V5MA 3B9KB 3S36H 4JBSA 2BZ7A 5FECB 1QLEH 4FQJH 3TZVA 2V5SA 2CA4A 2H0JA 4TOYH 4IGBD 4FN0A 3DUUA 4BFEA 3HBGA 1BVNT 5C70A 5ITFB 3TPKA 1QFWH 2EDBA 5ETUB 1LHZA 4NP4H 2DTSA 5E0QA 4U6HB 2JNZA 1I8LC 4OFKA 4PJBE 5ESAA 3UPCA 4RNRB 1S7XA 1S5IL 3V5DA 2MOQA 3DROB 4OZIE 5J8OA 1Z6JT 1LO3L 4P2YA 4OIIL 2QQQA 4LLAA 2PWEA 1TJGL 2EDYA 1DVFA 2XFGB 1CFVL 4JG9A 4PP1C 5F7KC 3TT3H 4UQDA 4IOFD 1Q90A 2PW2B 3T6XA 4MBRA 4JFQB 3DJSA 2IANE 3SSGA 4B9KC 4D9RD 5HVGB 3WN5B 1J8HE 4E41B 1UJ3B 2YN3A 4NNPL 5IB5B 4WENB 2VDQB 1PZBA 3OSVA 4ICXA 5EBLB 4DW2L 3AU1B 4IKIA 2FJGA 1NPUA 4WI4A 3PQYB 2ZP8A 3MCLL 1OEZW 1IAMA 2X7LA 5J57B 1TVHA 5IFJB 3OLIA 3O2DH 1SN0A 1JXKA 2WQUA 4CC4C 3O6FB 4FQPA 2XWCA 3SDYH 2CO1A 4WY7H 4JM2C 2VDMB 3EFDL 1BD2B 4WU7B 3IK2A 1XR8A 5KYYA 1MDAA 1MWAL 3RZCC 4F7EB 1SXCA 2P80A 1G5AA 4XPBL 4Z3EA 3HVDA 3O9WC 3LNIA 2BHFA 4HWBL 3M07A 5JW3H 3BRFA 1CFNB 2WXHA 3CX5K 5DMYA 1AJ7L 2EIEA 2G3ZA 4ONHB 3HPJB 2J6EH 3OJMB 1KLGA 5BW7A 2RHEA 5AAMA 5C97A 3REWB 2VW4A 2OL3A 3M17B 2OYMA 2O1AA 1JGIA 1SMAA 2E5EA 2YUZA 1X7QA 2BHYA 1I4FA 1F6AB 4HT1H 1XD1A 2G9HB 2Y06L 1JGVL 2GSGA 3VD2A 2BJML 3KR3H 5ISZE 3QDGD 4Q56A 1BM3L 5FM5O 1PQZA 1QBAA 1QWHA 2I32A 4RWYH 2DLTA 1MFEL 2I69A 3FT3B 4AW7A 3BP7B 1E8YA 5E6UB 1BOGB 1DJZA 3ET9F 1JHKH 2AEQH 1ADWA 4M1DH 4Y19B 3R1GL 4S10A 4Y16A 5I1HH 5D2NE 3V4UH 4EN3B 3ZRFC 3CZSA 3GGWA 2E7MA 4LBAA 2YC1A 1W72L 4O9HH 2XG4B 4HZLA 1DFXA 3ZPDA 4F57L 25C8L 2VDOL 4FKEA 4X4YA 1CDHA 4YLBA 2JQMA 1KJMB 1CLVA 4YXHL 2CE6A 5EH1A 4UV4H 3P30L 3FL7A 1GYUA 4KRPB 2X2UA 3GPEA 4YXLH 4LF3B 3N1QC 3KL0A 1JL8A 5J56B 4X6DF 3WNPA 1OHQA 4Q52A 1D7FA 4IBZA 4X9YA 1DSFH 2C34A 3F85A 3K1DA 1UM5L 2MSPA 4NGHL 2DQHH 4PRBB 4Q6IB 4UIMB 2EYTA 2J7LA 4JHAL 4N0RA 3UACA 4P59L 2IPUG 2WLMA 5FWRA 2GAZA 3MRQB 4A7GF 1L0XA 4O02L 2ZYRA 4KKRA 2I5YH 5CIPA 2W65A 1NCWL 2BSDA 2D3LA 5CLYA 5ICZB 5IVXA 3ERXA 3LS5H 3QIWD 4RMRA 1JZ2A 4BZ2L 4G42A 3IPFA 1X44A 4X8JA 1IE5A 3Q8FA 1VERA 4J1UB 4PJFA 4EI5B 4OQTA 2P8LB 4APXB 2IV8A 4Z7WF 1P5VA 3B7YA 1ZTXL 3HA0A 4EQ3A 3BVTA 1UATA 4LPYA 3KPLB 3B7SA 3WNNA 2W9LA 2HTKD 3PNWA 4K94C 4APQB 1NKGA 4NN7B 1BAFH 1OP3H 4XRCB 4M3JA 3Q01A 3GO1H 4JFZL 4X6FB 3SE4A 3EOBA 4CAGA 5LJYH 2WB1A 2XWXA 4OCYL 2FO8A 4BEIA 1SXSA 3A4AA 3D09A 3HLAB 4HPOH 3RTLA 1E4XI 3SE9L 1NCCH 2YD4A 4HIHA 2VM3A 3L2NA 4G6MH 3SDAA 1JPGB 4YDZA 1E7VA 2WXLA 3VYOA 4XO8A 4ELMA 2ZICA 1AKJB 2UY7A 1UT9A 3MGTB 3FUIA 1FL3A 4DP9X 3DVNA 2E7BA 3WNIA 4FHKA 5TE4H 4EBQH 2ARWA 1CVRA 3MRJA 4E36A 5ACZA 5KSVA 2BIIA 2EEFA 4WHYH 4V2CB 2H6UA 3EGDB 1HOCB 4XC3H 3QEGH 3T04D 2IAMA 3JT2A 4YL4A 2W59A 1M53A 1PZ5B 2JJUA 3QXDA 1EWHA 1M7XA 4JG1L 3G6DL 4PB9L 5IBUG 3C09B 1KSRA 1K4CA 2A77H 5E6IB 1CYXA 3AXIA 1XGTA 2E47A 2XNAA 4XP9H 1WBXA 4Y5YC 2H8PB 1CXFA 2CIKA 5C09B 1A9BB 1EFQA 3CCHB 5B22A 4WHTB 5JLZB 4IK6A 4HUWA 4BHUA 3MGOA 3NJLA 4QI3A 1H5BB 1G9ML 3ARDA 5FYJE 3MLUL 3ATBA 2CLRB 2BNRA 1J1PH 4MKTA 2VDQH 1C5DA 1GC1H 2BX5A 4UZGA 2NSQA 4JHWH 3DX9A 1WICA 2IALB 3EJRA 5GGQL 1DVXA 3UYRH 1BF8A 1RZKC 3OAZK 4LCCA 1EA9C 3ECBA 2MHAB 3UBXI 4OH2A 1BZQK 3BVUA 4OD1H 3RTQB 2EXTA 2FJHB 4LSRH 4G2AA 4BSVB 4MB3A 2B77A 2VDMH 4OCWL 1OWRM 3GJFB 2OXHA 4HA1A 4I1NB 2DM3A 4HUKB 1NCTA 3L7FA 5EOCH 5ILTL 3RX9A 1LEIB 1KC5H 2DW5A 3JZ7A 4KKZA 2YZ1A 3LZLA 1VKXA 1E3ZA 5IHHA 1A8JH 4P3CL 1CIDA 1V3LA 4J6IA 1X5XA 4JMXA 4GBXD 4ZX6A 3WS6A 3D39B 2JB6A 4AH2B 1YG9A 2VE6B 1HNGA 5I9QC 5CSGA 3N91A 4MRBA 5F9OL 3D3VD 3TO4C 3J2PA 5I1EL 3T09A 1KXTA 3P0VH 1SJHB 2UXFA 5D7IA 1EZSA 4D8PA 5IJKA 1LDPH 3IAQA 4X98A 3LXAA 1FGNH 3MNZA 5DLML 2Z64C 2WBWB 3K4DA 1R19A 2ZOOA 3DIFA 4XTRD 3RJQB 1Z9OA 2ZCHH 4ANUA 1U8MB 4DWHA 4FD0A 2BMKA 3CSGA 4K73A 4N5UA 4YZWA 5KS9B 2NDFA 2OMZA 2YSSA 5E1HB 4N68A 3AC0A 4XVJH 1J8KA 3PABA 4YDIL 3NG5A 3C87A 4QHMB 1F56A 1KEML 4YHPB 5AB0A 1P5UC 1UGNA 1CICD 1KTDB 4RMQA 1AR2A 5EU6A 3S34L 3EO9L 3FH5A 1RIHH 5T33H 3BHBA 4YHKL 2Q6WA 3TEWA 2ORBL 4XNMB 2W91A 3PV7A 3DBXA 5IKCA 1JZHA 1J5DA 2F74A 5E8PA 4BH8A 4PVBA 5B38G 5I1KH 2BSRA 3H9SA 1ZHLB 1OAKH 4F7CB 4PVNA 3NJFA 1FFTB 2AF2A 5MP6L 1K5NA 2YFNA 3DK0A 2DMHA 1FI8C 1MN4A 3DYPA 4O5LL 3V8OA 1BMWA 3ISYA 3WJJC 1IIIA 3KVQA 1U8PB 1YN7B 4AYBA 1E6JH 3FUKA 2NY3B 2HJKA 4P2AA 2V5RA 3D4YA 1X5ZA 3LNEA 5L4FA 4PJDB 1A7QH 3EG9A 3N06B 1K8IA 2XYCA 3Q3GB 3SD2A 1UB6B 3TV3L 1U92B 2CD0A 2JI3A 3OJ2C 3VFRA 4P2OB 1VF5C 4J3SA 3S9DB 3D9AH 4EIZC 5A3ID 2VQTA 1FVCB 5DMIL 2DEXX 1CDGA 4ZPVA 4JG5A 1H6EA 3V4VL 9PCYA 1ZT4A 5H8DA 1BSIA 5A7BA 3V0VA 3MRNA 3KPQA 4N85A 3IKKA 5AVVB 3RNQB 5C3IA 4YXKL 1UKSA 3O2VH 5FKAB 4FQ2L 4GAGH 1BIHA 1EANA 5TGBA 1GS8A 1D5IL 1Z0MA 1JWMB 4WWKB 2CCLA 1A6UH 4HJJL 1KELH 2RGSA 3AREB 3R18A 4X5XB 2UXTA 3VTMA 3MRBB 2BVPA 2O5YL 4UCFA 3RY5A 5IQOA 1IGTA 4P46A 3HMWH 2BDNL 2X4SB 4GFXA 3CFCH 4G1EB 1P9MA 4M03A 2DQEL 2P9RA 2RTTA 3RDTA 4ANKA 1WRFA 2ZQKA 1I8KB 2CO6B 2ZONA 2YAEA 5J6GA 2WYTA 4G8IA 1Q0XH 4K7PL 1WBZB 3K6IA 1NJ9B 3IBEA 3U1SH 3EYFA 3REVA 4MJIA 1CXIA 4WFFE 2I9TB 5IVXE 4YX2L 4DKEH 4WV1B 3SE8H 4PD4J 2VXSH 4AV4A 5DEGB 1AGFA 3CMGA 4IRZH 2Y23A 5K69A 3GS7A 4PJFE 4K5OA 4R90L 4BCXA 2GFBB 4LLWB 3B3IA 4OZFA 1B0WA 2QLYA 3I50H 1VACA 1YJDH 3VA2C 1EO8H 2NRDA 1QZNA 1T5KA 1ZEAL 2C8NA 1YMHB 3MLRH 1RUQL 3UIYA 1JYWA 4XXWA 3RVTD 3FTSA 1YNTB 5PCYA 5BVPL 1NGYA 2DM7A 3R8QA 1KGJA 4G1MB 3ULSB 3GJFH 3LQZA 4LCUA 5CJQH 1XAKA 4J6RH 3PS6A 3PHQA 2F5AL 3DOIA 5DHYB 2NUTA 1T5WB 4C8XA 4PRAB 3RL1A 3WYRA 2NLJA 1GGTA 4N5ED 3MRKA 5IBTH 4LNRA 2EKJA 4TQHA 3QYCA 4JGMA 5HHNA 4P4RB 1RV6X 3T1WA 2DICA 2ICWB 4UT7H 3IAPA 1TEGA 4ELME 4OCNC 4IU3B 4OD2B 1L9SA 1MCHA 4OKVA 3QQDB 3T2QA 3ZDYE 1MCKA 1JRHL 1AI1H 3L3JB 4DOHB 3FRUB 5ESVA 2CAKA 3MRHB 3UTTB 5CZRA 2MNUA 2JKSA 4HYTB 1MCPH 3BESR 4F7KA 5DMGC 5BUAA 3SGEI 3QQ4B 3SQBB 3O4LD 4PGBB 4NZTH 1ZSDB 4IBQA 2J6WA 3KL3A 4Z7IA 3HZYA 3G5YB 5FS5A 4ZRGA 1QKZH 1CDYA 1VB9A 4AKOA 4H5SA 2BERA 3IF1B 5F9JB 3ZBMA 4ATWA 1CLOL 4YWGH 4ELKB 1PZUB 1YQVH 3OB8A 5GRYA 3THMH 4CC1A 4ONGH 4GNKB 3BWUF 1ZHKB 2BNRE 3LVTA 1N68A 4L5FL 4MXWL 5E6ZA 1CGSH 4X9IA 5T1KD 4DO4A 4U1LB 4DIXA 5E7FA 4ZYKB 2FQFA 3UOAB 4AITA 1QUNB 1AQKL 1JZJA 4QDGA 4O00A 1YEKH 2BPBA 4YAQA 3U9PL 3QJTB 4L2YA 4WI9A 1IRAY 2QVTA 3HE6D 4X6DA 3QR2A 2E27H 2ADIA 3C5XA 5I75B 2F0CA 4GKSB 3U2JA 2OTWA 1KDIA 5DTFB 1AFVL 2CO3A 4JO5A 1E40A 2D0HA 4BFJA 2ZUQB 4A7GA 5CGTA 3B6SB 2WNWA 3OKNA 5IEHB 5JIDA 2FNWA 5EWIL 4ZMYA 4J4PD 2WIIA 2C9PA 3C6LA 3PWNB 1SN2A 3U4BL 2YXWA 2Z8SA 5E94A 5A43C 4CSZA 2OQJB 3MRIA 3O6ML 4Z7WA 4G71B 2OI9C 4ZUUB 1H9VA 1G7JB 1H8LA 5AG8A 3S88L 3WS3B 4QHLB 1FNGA 4B0MM 4AEFA 4NC0B 3ZE1B 2X4RA 1A21A 2LLGA 5GS0D 4AW4A 1I8UA 3KDMA 3HFMH 3QAQA 5B1BB 4GY4A 2X4UA 5F7LB 3OKEA 2VKXA 2FL5A 3C60A 5L9DH 3GWJA 4K8RH 2H0PA 1RURH 3VXOA 4F58H 3NRPA 4N6QA 2FWOB 4FFZH 4XP5H 2R4RL 5BZWA 4NO5A 2IH8A 3UL4A 2G0KA 5FA3A 3UGUA 3BZ4B 4FTDA 5DEZA 1P6WA 5IQ7H 5D9SB 3NUKA 2OMWB 3UTQB 2X4NB 3I3DA 3TYFB 4E9QA 1U3HD 2H1PL 3O4OC 3STBA 2Z0BA 3HE7D 4XMWA 2X87A 1TZ8A 4O2FA 3B34A 4I85A 3FU5A 4A63A 1UOWA 4G8FA 4X8CA 4C47A 1I7UA 2O6EA 5I66A 1EMTH 4YL9A 4HX1B 4WI8A 5GRUH 3T3MF 3QJZA 4K3EL 3SGKA 4CSPA 4F93B 5C6TH 5JPMB 2RD0A 5BS0D 4OCRH 4PW4A 5I76A 4A55A 4W4OC 4E9RA 5IESL 2VQUA 2ZXBA 3TF7C 4H13C 3HCVB 3IETB 3PAYA 4MHHG 5EUKA 4XAKD 2ATKA 1ZVSB 1XCWA 1YEEH 5AVYB 3PL6A 4V33A 1M6OB 3KYNB 3F62A 5E5UB 3LZNA 4LVNB 2QR0B 4OZGB 3FFCB 3DX1A 2OXGA 2PO6A 3QWRA 5B39B 4LP8A 5GZOC 3DO7B 3T1FB 3AT0A 1UUNA 3P11H 5F6HI 3TA4D 2GI7A 5D7KD 3SDXF 3ARGB 4LCWB 1NFKA 1R9FA 1BFSA 5CEZH 1CLZH 3AY2A 3FONA 4MAUH 4QF1A 4QLRA 3GKWL 4MNQA 3L3OC 4JPQA 1RZJL 3ZTCC 5DUPL 5L2KA 5KW9H 1REIA 2B2XH 3BPOB 2PPAA 1XQ4A 4E9YA 2XETA 1J11A 2C3WA 1ZA3B 3CIAA 3OHXC 1ZE3C 4F2EA 4TQEL 4IMKA 3DJ9A 5CMAA 1JWSA 3VI3F 4CJ0A 2Y72A 1JWUA 4K94L 5F88A 2WQAA 4KXAA 5E8NA 3CBKB 1CE1L 4HUNB 4PU2A 4WO4C 3T4AC 2JKIS 1ID2A 2FTAA 3A4DA 4L8SC 4R7NA 3T0BA 3GBNH 1NCHA 3MQIA 5C0BA 4JN1L 2E7LC 2GJ6B 5DJ8A 1KGIA 5JIIA 2VSDA 3B9KD 3F04A 4WFGD 1KFAH 2Z93A 4LLDA 1D6EA 3O8XD 1RJLB 3WFCH 2R27A 2J8HA 2PP7A 4MJIE 5KBPA 5EEWA 1FV1A 4MDRA 5JORB 2E8YA 4U05A 1KJ2L 4X6BA 1KLFB 1H3XA 2ED8A 2MKLC 3HRZC 3QFJD 4LASL 5KSAB 2DKMA 4B9JA 1GXEA 4RX4A 2ZP0T 4OSUL 2D9CA 3S37X 4F2MA 4OBSA 3WLBB 2L8AA 4D94A 2GBVA 3RUGB 2D31A 1UXSA 5IFAL 4P23B 1ZLVK 2AQPA 5IW6A 1IBGL 4AQZA 1KBPA 1NUFA 4O2EB 3HUJA 3TFKC 3IXTB 3RAJL 3DV4B 4U1SB 1W0WA 5AOIA 5LN4A 4DEUA 4W9KC 4X7DC 3ZSTA 4Y9FA 3QCTL 1D6VH 4LEEA 4AOFA 1MNNA 1AYOA 3MLZL 3OTTA 2A6JB 5K39A 1X4XA 3T08A 3GSNL 5HI3D 1EUUA 4LPTA 4RMUA 1NCUA 5C0RL 4ERSL 3MJ9L 5B1JC 4J3VA 2R0LH 3SYOA 5JXED 3PQYD 5FF6A 3NCFB 4JLRA 2QQLL 1UOKA 1MQKL 4PWFA 4IIQA 5CJ8A 5IMLB 3O6FD 2OCJA 3W11C 5KJRL 2F8XC 4PCKA 3EJZD 1Y18A 4JQVC 1RZFH 3FOMA 5T1MB 2OYLA 2WWNA 1SYSA 4HJTA 5H35A 2L7JA 2HRLA 1WGOA 2E76C 1WWAX 2Z7WA 1GHFL 3EYSL 4FQIL 1E90A 5E4EC 2FBJL 3ABKB 3OX8A 5J1TC 2ERJB 4M3HA 4FJYA 1E9QA 1VDGA 1AGBB 1D5XB 2APFA 3RY6A 4P5TC 4NDMB 3UZQB 3KLSA 7FABL 4GMTL 5CS7A 3BP6B 3S97C 5GGRB 3IVKB 1HXYA 1KB5A 3NSCA 1HSBA 1CZ8L 2HLEB 3LD8C 2NY5H 1GTFA 2A9ML 4FNRA 4PS4H 4QJ3B 1DUZA 1FUNA 3GBLA 3GMOB 4GQ9H 4DPBX 1FYTB 4ZFQA 2BSSA 3F8UB 3QZWB 2YO3A 3UO1L 1IBBA 1QABA 4Z7VB 1PEWA 2NSMA 4L3EB 3C08H 4ZXBB 1NL0H 4EN3D 5DHDA 3ALWA 2DLHA 2IDCA 4X6DE 4G8GB 3NACL 1JV5A 1Z32X 2Z8RA 4ODXB 2IQ9L 1KIUB 1O75A 5AEAA 3RKPA 2V2WB 1NICA 3H7LA 2JCWA 5F7BA 2BNQB 5FYKL 2LT9A 4Z7NB 3C8DA 2BSEA 1CT8A 2AQTA 3NMEA 5GGVH 2WWOA 3CSFA 1DBBH 3O3BA 3P0GB 4G5AA 4R7LA 2JTDA 3DARA 5D1ZI 1E4WH 4S1RL 4OKDA 3S48A 3UTZB 1JXFA 4KRPD 3VYPA 2F5BH 2NNRA 5F96L 2QKIA 2R29H 3F7PC 2X1PA 4ZMPA 5K9QI 3AABA 4Y2DD 5HHMB 4Z7WE 5CINL 3JSSA 2IO5A 4PJCB 1C5CH 1URZA 5JDJA 2OMUB 5J89A 1MH5A 1LE9A 4F24A 4KU1A 1E6OH 1BAGA 2XVLA 3NZHL 3AMKA 4KKBC 4DEPC 2PPCA 5EO9B 5BO0D 3EGSB 1RFDL 3ZKXB 3QCVH 3M1BA 2V2TB 3KPRE 3FU3A 4X6EB 2DQFA 3AGWA 1N5AB 1T3FA 2BC4B 1PLBA 2Y1VA 2X28A 5IVZA 1T20A 2OR9H 2EDQA 4JPWH 2EH8H 1RU9H 4JRFA 4ZFFA 3JVGA 1CG9B 3NJKA 4KK6C 1Q38A 5CP3A 3ULVC 5T5FA 2WN2A 5FO7B 3TEYA 5I17A 3JUZA 4LU5H 5DZOA 5FDWA 4UQ3A 2D0FA 3QPKA 4QEGA 4BDVB 2YQ2A 1JVKA 3N2JA 4MA3B 2C3XA 4K3JL 4BBWA 1C8QA 2JXMA 3D85B 3QIBD 4N2BA 3OAUH 4A7UA 3QZBA 3HNSH 2XTJC 3LZOA 3UBXB 4QT5A 5J9PA 3X12B 2X6UA 4FA7B 1FC2D 4AT6B 1JAEA 1KTLB 2IBZX 3X11A 5CJXA 4B0MB 4NSKB 4PCSA 5L7XH 4WJG3 4UM8B 3TJPA 4L0YA 3VW3H 3MREB 3DHJA 1CL7L 3FN3A 4LCIL 3NJMA 4XGZA 4Z18A 5ANMB 4WJKB 3SKNA 3OKDA 1ADQH 3KPOA 4MSWB 3C8KA 1AKJD 1T66D 1YUHA 5TQ2L 1A7PH 1A4CA 1M9WA 3S96A 2V2XA 2YXMA 4KDWA 1BZOA 3G7TA 1L0PA 2YJQA 2Z92A 3UPRA 1GVIA 5F9AC 1SVCP 1DQIA 3SYCA 1F0LA 4B9CA 1MUJB 4U0RC 4AJWA 4UT6H 3KVPA 5CKAA 3Q6GH 4NCC1 3X1EA 1UKQA 4DVBB 1FH2A 4Z7OB 1TTUA 4KUZH 4ZX3A 3JWNG 1ZLUK 43C9B 1SHXA 2MCG1 5I5JA 5ALCL 3OXSA 1UHVA 2OM5A 5C09D 5A2LH 5IHUL 3VD1A 1OP5H 3BZEB 1WTGT 2HRPL 2VDKL 2J1XA 2Q8BL 3LKRA 4NO2A 5KVFH 4UDTB 4OLVH 1HVXA 4KVCL 5E70A 4MNQE 2CXKA 3GMPA 5HYQA 1FO0A 4BSWB 4KBPA 5L2KE 5CWSB 1I7RB 3NZ8A 5FX3A 2E6PA 1E9OB 3F6LA 1UH3A 4NRZB 2BY0A 3K2KA 1SLVA 4J7RA 5DJ6B 1ZHNA 5E8OA 3LAFA 2XBDA 5IROA 5DO2C 4C54A 1FVDB 5LBSA 4N0FB 1ES0A 2W9EL 1TZIB 3BWZA 1J0YA 1JGDA 1OP4A 1DQVA 1K3IA 3MRCB 2WCGA 5T5NF 3L4TA 4NIYE 3FTVA 3N9GH 3LJ3A 3ILDA 1HX0A 5I5RA 1EJOH 3LV3B 3MGAA 3PJLA 1I1FA 1LTXA 2WXJA 3K6NA 3PDOA 3H2QA 1M56B 1CIUA 2P5EB 5AVZB 3UDWC 1GCYA 4A2FA 1TCRA 4X9BA 2HG0A 1YECH 3M7FB 3VWJC 4I9WE 5LGJA 3GZKA 2UZXB 4TUOB 1F4XL 5DJ0B 1JMXA 3QNXA 2XXFA 3D39D 3T0EC 4XCFH 1KGCD 5FHBH 3ZR5A 4ZUSA 4YPGA 2VB5A 2YPLE 1YDPA 3WO4C 3QIWA 4HOWA 2COQA 2WTPA 1MCOH 4YS4A 4HIJB 1FORH 1RULL 2F53D 4F2ME 1L5GB 5CHNA 1H6TA 2VN5A 4LVHC 2PP8A 4R4BB 4FFVD 3VD5A 5FOBB 3V6ZB 3UCQA 2HVKB 5IMMA 4GW5A 1X5IA 2CLZA 4BCZA 2YAOA 1SEBB 1Y7VA 2YKLL 3GSWB 1TSRA 3HUJE 3IS1X 4M6MH 4GW4B 2GJRA 4F80A 2XV2A 3E8UL 4KUCD 3WHXB 4TVPL 4ELDA 4HG4K 5DYFA 4PRNA 3VGFA 4Q8BA 4KMLB 3MRFB 4KDTA 5CSBA 3EUDA 4FHBD 2XLLA 3AAZA 3KS0J 5IT2L 2OMTA 4OF5A 2WMPB 1JF6A 1X5KA 1SYVA 1LEGA 2RBLA 1KOAA 3HJEA 3RIFK 5MERB 1F90H 4UI2A 4GG6A 2IWKA 5EU3A 2FX8L 4YFEA 4ODVH 4YE4L 2F08A 3TBSB 4FFYH 3CXHK 1FGVH 3I6SA 2EIJB 4OLWH 4WJ5B 3RA7L 4N2EA 5CNHA 1N59A 1ZT7B 1DQQB 3WE6B 3PAZA 4MDIB 2HX7A 4GXUM 5IB1B 5SWZA 3VXRB 2WWMC 5DZAA 5EZLB 5C0AA 4OCMC 5CZVL 4U1JB 3NJIA 2GPZA 4OM0L 1AZRA 1LO0H 1MNUL 1LM8V 2ZCZA 4S0HA 2P4AB 2DQDH 2NY3D 2WQVA 4M43L 5LVEA 2E9BA 2AJSL 3HHSA 1RK0B 1TNNA 4XPAH 1XMEB 4GRLB 4PJEF 1M1XA 4BA8A 1F97A 1FL6B 4DFIA 1OHZA 4R96B 5DWUL 4WI3A 3RWIA 3VI3A 1XTLA 3GKZA 1QATA 3PGFH 4PJHF 3W9EB 3H3BC 1FNLA 1QVOB 1U6AH 4P2OD 1ZGLM 4JDTH 4NC1E 4N2CA 2D7TL 4P5MA 1UXLA 1BBJB 2R15A 3BZDA 1LWHA 2VOTA 4W9FC 4X6CA 4JJHA 1FNEA 1MWOA 3O2WL 4F9PA 5FYLE 4HSCX 5F89B 4YQXL 3P4NA 3TO2A 3U82B 3MLWL 4YVNA 3Q44A 2DOCA 1EFXA 1OGTA 1XF5A 2AJ3A 1K85A 3J7HA 2OMXB 1DVUA 5E1QA 2D7NA 4I7ZC 3I9AA 2XV6B 4ODSL 4UU9B 4WWKD 3OAZH 4PH8A 4JO2L 3BKML 1D7BA 2MKWA 2ZX6A 4JQIL 3LRSB 1C12B 4NN6B 1E2WA 3BVNA 1MG2C 4FFWD 1AANA 4NQSB 4E9WA 1ODUA 1UWEH 2RMNA 3WUZA 1TYJA 2L0DA 3SE3A 4I5BA 3UTSB 1CFTA 2WNKA 5CD3A 4GBXA 1RI8A 3QVAA 5GGSA 1CFSB 3FXIC 5TJWK 2ZAIA 3FPXA 4ZD3H 3WFEL 3G5ZA 3IMWA 1LLAA 2H26B 3T8MA 5KVEL 2HYMA 1MFMA 3LNDA 3MXVL 4JM4H 2HKAA 4LARH 4UANA 1V8HA 3D3VA 2WLZA 3BQUB 2VN7A 1XGQB 1FH5L 2J21A 2Z31B 3GTNA 2AK1H 5FOJA 1HINH 1V5JA 1JF5A 1GRWA 3BN3B 4N2OA 3BH9A 1OCOB 2X12A 4AX3A 4BKTC 4LSVL 4XCYA 1BVLA 5HYEA 3OKMA 4FLSA 5KVDE 2DIEA 1GAFH 2H3NB 4N4YB 4FXKC 4MX7B 2C9QA 2J8OA 4NQEB 2WSKA 3DGDA 4XOAA 1DQML 5EULV 1ZXQA 4PW3A 4FA8A 5CEZD 4U1MA 3E2HC 1RZ8A 2WUBH 3RJDA 4ZO7A 2ZX5A 4QXUH 4OZFG 3IS0X 5I1GH 3P40A 3DETD 1YRKA 3AS0A 3KLAB 3ZKQD 4S1QL 2FT8A 3B7RL 3B2XA 3OKYA 2ITCA 1W6WA 3VFUA 2V3EA 1CICA 3ARZA 4LAQL 4GUQA 2FSEB 3WIAA 4HD9A 5DJXB 3T65A 3VB9A 2D4DA 3I6KB 1CFQA 1VCBC 1J1XL 4WUUB 3V9CA 4AQAA 2K70A 4HCRH 2FX9H 3BYYA 3D6GA 4G9FA 3FOLB 4EUPB 1OAQH 4UF7C 3DURA 2DYPA 4GKOA 4XE5B 1CJYA 1CU4L 4TSAL 5I1DB 2D8KA 1WJ3A 4MA1C 3QJVB 3UTTD 3MX0A 5DJYA 3U4KA 3FTGB 3IDMB 2X4PB 1VHPA 1JG9A 5GIRA 2F9BT 1AGDB 2XZZA 3TZVC 1KZYA 4AJVA 2EEBA 1JRHI 4ADIA 3CQFA 4YGAB 4WGVB 3OJDB 5L4MA 1Q94B 4J8RA 4Z3GA 1MW3A 3ZHKA 1T03H 1AC6A 1S3RA 2G2NA 4JFPB 2ZKHL 1RSYA 3EBHA 1ZIAA 4ZTOL 3PDGA 3S37L 5D4HA 4NQVA 5SX5K 5JHBA 3CFEB 4OGAC 4Y7OC 1JF1A 3TLRA 1TT6A 3QQNA 4RDQG 3MO1B 2XPGB 4LSPL 2GIXA 1X9RA 1F11B 3HC4H 1ZV2A 2EYSB 5C0JB 2WPGA 3PYCA 3GXUB 3GLDA 4QMEA 2R4SL 1JZ4A 1BFVH 4G7RB 3GLZA 2C5DC 3RNKA 4N0CD 5LGYA 4L1HA 1WEJL 4AYSA 2IG2L 2HX8A 3LZPA 3TP4A 4HEPA 3ME0B 4XR8C 4DN4H 3V5KB 4NQUA 3OKKA 3SDCB 1LO2H 4E9SA 1I1AA 4JRXB 2RH0A 1INQB 1G6RA 5K93A 1WIPA 1VSCA 3FB5B 1B4TA 4TV3A 4X9HA 5IBUB 2ATPB 5FW8A 3JV4B 4OF0A 4YBHA 3K72A 3B5HA 1ONQB 3CSPA 4HJ1A 2OTUB 5DD3L 4U6YA 1J48A 1UGKA 1HQRA 2QLVB 3GHPA 4A7SA 4HGWA 4ISVB 4DK5A 1N5YL 4BZ1A 3CN1A 4QKTA 1ZV9A 4YDMA 5M95B 2Q76A 1A6AB 1Y6MR 5D4QA 4KVNH 1I9EA 2Y07L 4Z0BH 2FQGA 2AZUA 4A66A 4MMXB 4JS7A 5KEZA 1DBKH 1K2DA 2CK2A 3FUHA 5BW7C 3ARFD 3BSGA 4Z77B 3ULUH 3BLBA 2X9YA 2Q7YB 2EXSA 3PP4L 3ARSA 4BRJA 5IVOA 2HA1A 2VC2L 5T1JA 1O9WA 3I75B 1GYWA 4K9EC 4QO1A 2P52A 3T3ME 5KAQF 2KLSA 4Y88A 3WIHL 3RFZA 2BIQA 4WSKA 3GSQB 4BH7B 3C2SA 3EYVA 3QJSB 4KXBA 4XNQB 3P73B 4P9HH 5LAPA 1GCFA 5ID1B 4Y16C 3LVEA 2F7OA 4R7DB 3MRRB 1JN6A 4P2CG 3IJSA 4ABWA 1JHTA 1E8ZA 3DV6B 5K59E 2VIRA 2HB0A 2EDWA 2WD0A 5K9OB 4NRXA 1I8MB 3LIZA 3RWEA 4GG6E 1R0AH 5DCCA 4X7CC 3BFQG 3EGXB 2VQ4A 3L3IB 1JZ8A 1TKWA 2GY7B 2DM2A 4XXDA 5EN3A 3SCMB 4C55A 4NUPA 3TJHD 1DCEA 4XPTH 3QAZC 5F7DB 1BZ7A 2KERA 3OGCB 1G7HA 4MA7L 4AZ8A 4KY1L 3QEUB 5CEYA 2R1XA 5SWZE 4W9IC 4GQRA 5C0AE 2YOCA 4MQ7B 4OJFH 4I89A 3A6BL 4AEIH 3T8VA 1OAUL 5FUZL 4ZFGL 5HYSA 5LGHL 4LLMB 4JFOA 1SJXA 1JD7A 1XGUB 4XVTL 2NX5B 3RY4A 2NUPA 3FFCD 4HU2A 3POHA 2R9HC 1NGWA 2OTPA 5CD5D 2C7UB 1ACCA 1XEDA 3VI3E 8FABB 4LCWD 5JPNB 1IVTA 2AV1B 2OMNA 3SPIA 3WSQH 5CUSH 4JPVH 4POYA 4E9XA 1KPVA 3SO3C 2Y22A 3BXNA 4KO5A 1KBVA 4QOKD 2PTTB 4X6CE 4L8BA 1JUFB 1TQVA 4DN3H 4F9LC 5MENA 4TUJA 3HE6A 1YEIH 1SQ2N 2N0MA 3SE4C 1TVDA 5CLWA 1MZZA 1QAWA 3OC5A 3ULVL 1WZMA 2NT1A 3W0WB 3DDGA 4U3SA 1G9EA 2A6DB 4EUPH 3FO9B 2XPYA 1L7TH 5DD0H 5F3BB 2ENSA 2YHGA 3Q7JA 1A4KB 1BFOA 4XNXL 3WCYA 3L6FA 1MCSA 3BZFA 4UTBH 3SDAC 5L2JB 4JJ5B 1TZOA 5J3HD 2B4CH 1E5YA 1V55B 3PAVA 4J4PA 3DO4A 5INCB 4NZFA 3N6YA 4N0YH 3QG6A 3RVUC 1IKFL 1T22B 2GJ6D 4W9ZA 2G3XA 4AM0A 1FLRL 3IFPA 2LU4A 3PDDA 1U93A 5DC0A 3D18B 3O2DA 2AGJH 5E8DH 2DQJL 3BFOA 4AYFB 3L1GA 4L1BA 1ZA6B 1WS8A 4EKJA 1X5JA 2G30A 1G6VK 1AP2A 4B60A 1ZGLB 2H2PC 3UTOA 3BKCH 5CGYC 4HEMA 3P77A 3SN6N 1A9EB 2J88H 2GITA 4ECNA 2IAMC 3L1OH 4Q9QL 4XB7A 4ZUWB 4IS6A 5ICXB 5KSAD 3RWDB 2XWTB 1JXGA 3MRLB 1T1WB 1CLCA 5F3FA 1AD0B 2LGNA 1F5WA 2J6EA 3PWVB 3VCLA 5EF3A 1FNSH 1A3RL 1RZPA 2E3VA 3EOTL 3LNFA 2PF6A 2V17L 4DAGH 1JDDA 2ROYA 3CH1B 4ZODA 4EN2A 1AO7B 2IGFH 3IMUA 3QUKB 4QYOB 1J5OL 2CCVA 1MLCA 2FUTA 2NR6C 1U3HA 1LXMA 4P2QB 1SLXA 4HDIB 5EN2A 3RVXC 3HZVB 1EEYA 3HE7A 3OMZA 1SUJA 1XIWA 2DDQH 2ZPKL 2GIMA 4AVKA 1P84J 4LCCC 1SEQL 2IC2A 3ZW3A 3LH2L 4BYHA 2OX5A 4ZPTB 1KACB 4KTDH 4HSQA 4L1LA 4P57A 1MJ7H 1MHHB 4HKJA 1S7VA 4L29A 4MBOA 1IVLA 1W72B 4M5ZL 5DJDB 5J12C 4KUCF 4YNYB 5EA0L 1AXTH 3S4SA 1KTBA 3L4ZA 4NAJA 2VDOB 4G9FE 3WXWH 1T1ZA 4FQ1L 3L08A 5JUEH 3QNYA 2IEPA 5F21B 5BS0A 1F58H 2X44D 2JCCF 4PJEA 4YSQA 1BLIA 2XA8H 4XCNB 3BH8A 1W0YT 1BJ1H 1IO4C 3HHRB 3OLEA 4NHUA 5K1VA 1MFDL 4PJHA 5D6CB 5E5MB 1KB3A 3I9PA 1YEWA 1AQHA 3ZE0E 4XB8A 2UYLB 1A8ZA 1F1AA 3WS6C 5HGBB 2Z4TA 1NCBL 2ADFL 4O02B 4NJ9H 1XZWA 4NNYA 4S0SD 4ADGA 3N3EA 4HISA 3O3EA 4PSPA 5JHMA 3L3KB 2UVEA 4Y4FC 3STZA 2FLBT 4LOUD 2EO1A 3HNTL 1PG7W 1DZBA 3MUJA 4M6NH 4R6UA 3MCG1 2ZUSA 1S7UA 2AQSA 3L95A 5IJKC 2K4AA 4Y4HD 4QAMB 3O41B 3LN9A 4GKLA 2B59B 1ZANH 2FQEA 2HUHA 5C9JA 3FQXA 4XX1E 5D70H 4B9FA 3DRTB 3BVWA 4U3HA 1AZNA 1T0NA 1NBVH 4G8GD 5EORH 1TQCB 5EEYA 1BQHB 2EIBA 3OF6D 4PJDF 5DSCB 1NOAA 2BNQD 5C86A 2B5IB 5T3ZD 2GTWA 4OQ1A 3VXQA 1NGQH 1O7DE 1CLYL 1IEBA 3QUXB 3VUAA 5LWYH 4NO0B 3NPZB 3WI9A 1ET7A 3BGFC 3BGAA 3DWTA 2NXZB 4AQEB 2X1QA 3NP4A 3E7JA 3MCYA 3N85L 5HHMD 4N8VA 5C0DB 4TL5A 3VE0A 2J8UB 4P04A 3UAJA 4AWJC 2EDXA 4L37B 4XHJC 3TV8A 5FECA 1BQKA 1J10A 1IC0A 4U33A 1S9WB 2OW6A 1X7SA 1NEZB 1YYLL 4JR9L 4BXVA 3NABL 4JE0A 5ITFA 3VFNB 4G7SB 5ETUA 2J5LC 3AJ7A 3QFDB 4U6HA 1QSFE 3UEQA 3ZRSA 4RNRA 1S5IH 2GK0A 1KYOK 1LO3H 3EH5B 3FDWA 3DROA 3IDYB 4OIIH 1MI5E 1TJGH 3MVSA 5DZPA 1CFVH 1JNHB 2A7BA 4GUPB 3KGUA 3IT8D 4NQTA 3QUZB 3SDDB 3DXAB 3FH8A 4OLZL 2PW2A 1NAML 3D85D 4JFQA 5HHOB 5F0PB 5AQ0A 4MD0A 2VR3A 4NNPH 1ZLVH 1D7DA 2TRYA 1UJ3A 4E41A 5BCAA 4DW2H 1QFUL 5ESQB 4DUVA 5EBLA 3FH7A 3AU1A 3MUZ1 5B3SB 1JGLL 3PQYA 3MCLH 5E51A 1YNTF 2EEAA 5SX4I 5IFJA 3R7QA 1XH3A 3O6FA 3PPSA 2OSYA 2YQBA 3EFDH 4X5LA 1QO3B 3CVHL 4LOFA 1UD4A 1BD2A 1MWAH 3IRPX 4HUCA 4WU7A 3UBFA 4XPBH 4F7EA 1WSST 4W9HC 4HWBH 4AG4L 3FQ2A 2JJTC 3PHSA 2WHVA 1AJ7H 1CFNA 2F6AA 4M02A 2YXVA 5E1IA 1QZ1A 1P9MC 3RDTC 1AOZA 2EJ1A 1G0XA 1AHWC 3REWA 5EO0B 3K2UL 3M17A 2JKJA 3T6VA 2FSDA 1EHXA 2A9AA 1WZKA 1F6AA 1JGVH 2Y06H 2EEXA 9CGTA 2G9HA 1AH1A 3QR1A 2BJMH 4A2LA 1NLBL 1RUAL 1BM3H 2E46A 1G7IA 3D5OF 2JMRA 4GIPD 1II4E 1MFEH 4G6AD 4XNUL 1DJXA 1PY9A 4JDVB 2N3JA 3BP7A 4R0LB 1ID5I 1BOGA 1AHKA 1ODAA 4JKMA 5HHQB 2AVFA 3PJSB 3R1GH 4GSUA 4XXWC 5F8RC 4Y19A 4AGNA 3ZTJH 5MENE 1FVEB 1HYSC 3CVCA 4EN3A 4L8DA 2D7PA 2WM0A 1NC2B 1WA2X 3QXAB 2ICEB 3GMRB 1W72H 2EICA 2NY0B 4F1SA 4BV1A 1OM9A 3OG6B 3SGJC 4TNVF 2XG4A 4F57H 25C8H 2VDOH 3BYTA 3QHZL 4JRLA 3X17A 2VQ1B 4YXHH 4B7LA 1KJMA 4ALAC 3P30H 4D0DB 2EZ0D 1YZZA 2NYYC 4DTGL 2C1PA 3QZPA 2F1AA 4LF3A 1BYNA 1JPTL 2P5ED 3ZSSA 4L9LB 4NGHH 4LSSL 4DK3A 1UM5H 4F5CA 1A2YB 1OSYA 5BXFB 4JHAH 4Q6IA 4PRBA 4N22A 4P59H 4UIMA 3A4FA 3BWAB 5E23A 5GRJL 4O02H 5HVHC 3MRQA 4KKCD 5E2WL 4MMYB 1NCWH 5IR1B 4HEME 1YYML 2EE3A 4EI6A 5ICZA 2J43A 4BZ2H 1WAEA 1OQXA 4O58L 5E4OA 1ESOA 4EI5A 1ZTXH 5DUBB 5FDYA 2P8LA 3U7AA 5CCJA 2HVBA 3MROB 3KPLA 3QA3B 4PFEA 3AMLA 5IHWA 2IH9A 2VMFA 4QY8B 4OCXL 2OZ4L 4APQA 4ZAKC 2A38A 3ZE1F 2YPVL 4C4KT 1RZIB 3ISRA 3OJVC 4JFZH 5D1QD 4X6FA 2EECA 3B4NA 3VTTA 4O51B 2CGYA 1ORQB 3VQLA 2F8IA 5HY9B 4OCYH 3RI5F 3SE9H 4PJAE 5CGBA 4PG2C 2WWKT 3V4VB 4CU8A 4OUOA 1GA2A 3AUWB 1HNYA 1JPGA 2CUHA 4MGXA 2R1WB 2YQ3A 5DRNB 5MHSD 1AKJA 2BVOA 3UAEA 1E5CA 3MGTA 1OKEA 4KKLC 5BS0E 4AIXA 4PJEE 2AXGB 4N1EA 3DPDA 3ZQ9A 4JUSA 4PJHE 3VXRD 1HOCA 2ADGB 2NY6B 2RQEA 2YKKA 4PLJD 4JG1H 2F54B 3JWOC 3G6DH 1PZ5A 4PB9H 1IMHC 3NJHA 3EOYG 2X42A 3CBRA 4M4RB 5DA4A 5JHDD 4X0NA 5E6IA 4CN1A 2IH3B 3KGSA 1QLFB 2UV3A 3P2TA 3BGMB 1W0VB 5C7ZA 5I0VA 1TZHB 3QUML 4TNWK 3T71A 3A47A 5EU7E 4N20A 5C09A 4N90E 1AZBA 3NFNB 3Q8AA 1D2OA 1N0LB 3CCHA 4NM8L 3C60C 4L4VB 4WHTA 5JLZA 4S1DC 2PW1B 1MSPA 4XVUD 1G9MH 5G4OA 3RGVB 3MLUH 1DJGA 3CHRA 3QULA 4WK0B 1H5BA 2FT6A 4S11A 1ZLUH 3ZRCC 8CGTA 1PLGL 2CLRA 5BRPA 3NCJL 4HJIA 1S46A 4IRZA 3ULUD 4KJWD 2OAAA 3RPIA 3H42L 1KN4L 2EDDA 4PGEB 5GGQH 1B6UA 2BSCA 2IALA 1M4KA 4XOBA 4OZGF 3FF8A 2CH8A 2MPVA 3CLWA 5FGRA 1MCIA 1SFHA 1ZV5A 4AKPA 4NPYB 5F1KC 2XPZA 3KLLA 3RTQA 2MQ3A 1MHEB 2FJHA 4OCWH 3NSJA 4PRID 4BSVA 3LIUA 1IAKB 3ES6B 4ZW7A 3GJFA 5DRXB 2A9BA 4K55A 4JQXC 4NPJA 1U8HB 2YSTA 3NQIA 5ILTH 5ABAA 1FAIL 3H6JA 5JHDA 1LEIA 5F44A 4EZJA 5EEXA 1LD9B 5DXWA 3NIFE 1EHLL 4P3CH 1ZY9A 4ZNEA 3SGKC 2QEJA 5DEFB 4WFGE 1T7VA 4GXUN 5FLUA 4PY8I 4UB0L 3UTSD 5GS0L 1KBKA 3L9EA 3AM8C 1ULVA 4K3HA 4OAWB 3TCTA 4MB1A 1KTKE 4NBYB 2B3RA 1O9VA 1P4IL 3UXFA 3U4EA 3ZTNL 1MELA 5C07E 4AH2A 4RRPA 1G9HA 2O30A 3GTTA 3HBZA 3NN8B 4H8WC 1UTDA 2VE6A 4KKAD 1MW1A 5F9OH 3DUHA 1E9PB 3VWKB 3TF4A 4I13B 4W9LC 5I1EH 1U30A 4QAWA 2ITFA 3BQUD 1J1OL 3H6AA 1TUPA 2RIKA 2Z31D 3VFMB 1SJHA 2PO6C 2PWFA 3X14B 4CA4A 2DH2A 5DLMH 4M62L 4UM9B 2V6HA 3AS1A 5TTRA 1WAPA 1X7TA 4KI5E 1U8MA 1TQSA 1BYPA 2NDGA 1H0DB 3QORB 3QHFL 4PGZA 4E41E 2ZUYA 5KS9A 1BFTA 3F7KA 2LVEA 4YDIH 5H4YA 3RUGF 2WBKA 4AUJA 5G2NA 1KEMH 4PIBA 2IDUA 2YMXL 1HH9B 4OD3L 4QHMA 4D3CL 4YHPA 4IMKC 3S34H 1B2YA 1KTDA 3EO9H 4YHKH 2ORBH 1HI6B 2ADJB 4Q9RL 1AYRA 2EE9A 2BCKB 2KI6A 2XY1A 2O6PA 4FG6D 1BD2E 1CDUA 4TLTA 1HKLL 4L4JA 3ZXAC 4AIOA 1ZHLA 4KKQA 3S0PA 4GP8B 5MP6H 4O5LH 1XH1A 2SEBB 5TD4A 5E00B 4PJ8B 4K9JA 1MCCA 5KANG 4F20A 1YN7A 1DUYB 3B2VL 4GP4B 1LL1A 2R59A 3PE9A 5HD8D 4AC4A 2LLNA 2CIIB 1N2RB 4M29A 5F7HA 1Y0LB 5JIHA 3NCBB 3NCWA 4U7MA 1HNFA 3HB3C 4KROC 4PJDA 3ESMA 3TV3H 3Q3GA 2WK2A 1UB6A 2DZEA 4NC2B 1E5UI 1S8DB 4I2XE 4JM2B 4PTTB 3B2PA 5DF0A 5L4JA 1UWXK 1X6NA 3FT1A 3QS3A 4P2OA 3OKLB 2IADB 5DMIH 5AW1B 1Z5YD 3RZCB 1FVCA 3GSRB 3V4VH 3ARBC 4Y19E 4RFNC 4CNIB 3ARPA 3O9WB 4FFZA 1T2QH 1UH2A 5GJSL 2ARJQ 1E67A 2QGDA 1AIFB 4TULL 5C0NC 4WWOA 4YXKH 3RNQA 3ALPA 4Y1AD 1KNOB 4FQ2H 5FKAA 1XCTB 1Z3GL 5EZOL 1UCTA 1D5IH 1MFAL 2NY7L 2VNCA 3NCCB 3GRGA 1JWMA 1S7TB 4JRXD 4WWKA 5J1AB 4ZX5A 3OBAA 1KXHA 4Z7VF 2XX0A 3AREA 5GISL 1NDGB 4X5XA 2O5YH 1QWNA 3MRBA 5MEOB 1A4JB 1T4KB 4IIQC 4WK4B 2BDNH 2M1KA 5CLXA 2X4SA 3IFOB 4G1EA 4LQFL 1MVUB 1NIEA 3HZMB 4Z7NF 1I8KA 4K7PH 2CO6A 1FSKC 4EBQL 4DETA 2HLAB 2BCMA 4YX2H 1JYVA 2I9TA 2CMRL 5LCVH 3PXJA 4K15A 4Q0XL 1FNAA 1EO5A 2DLEA 2F19L 4L0ZA 1OGSA 4OFVA 5DEGA 5F7YC 2OSWA 1N26A 2AQ1A 4R90H 5JQIB 2GFBA 4LLWA 1HCVA 2WQSA 2A2QT 4PJCF 3RY6C 3FB6B 1ZKAA 1XR9B 1ZEAH 4OFQA 5HSFA 4XN2A 3LPOA 1RUQH 4YSCA 3EDEA 5BVPH 2D7MA 3U48A 5F7FA 1OF2B 3UMTA 1YNTA 4XP1L 4KKPA 4LVOB 2AMGA 2K8MA 3GK8L 4EEEA 2X2JA 4PJIB 2X9ZA 2EILB 3K6FA 3ULSA 5I5MA 2FJFB 2HT4D 4JY6A 3VU2A 5F3HA 2F5AH 3NQKA 5EF2A 2OPCA 1P69B 4JZOB 1DJYA 4NC1C 1T5WA 3IFNL 5BOPA 4PRAA 2QADD 4A2MA 3IFLL 4R4ND 4TVSa 4P4RA 4NUJB 2ICWA 2DKSA 3FQNB 2VDML 4W9EC 1H8SA 4JGUA 4IU3A 4OD2A 3TWYA 3SCMD 3QQDA 1JRHH 2XDHA 1HOEA 4JUTA 1SQMA 4D7BA 4C59B 3MNDA 3CGTA 5KBNC 1GMIA 3HLKA 2COVD 3L3JA 4WW2F 2QKIC 4PGDB 1SDYA 3TNNB 1M6UA 1MPAL 1QRNB 3MRHA 3UTTA 2QTVA 5JZ7D 1CB4A 3CPLB 4PW9A 3SQBA 3QQ4A 1JZ5A 2H41A 1NCJA 3Q2NA 4PGBA 4JE4B 2IIJA 4Z7UB 3V0JA 4MVBC 2YQGA 3G5YA 1ORSB 1Z9SA 2NX5D 4JFHD 5C09E 1DE4B 5F9JA 4FEIA 4LIQL 1CLOH 1CD0A 4NS0A 4MB4A 4ELKA 2AJYH 4HS6B 1KJ2B 3ROOB 5IMKB 4L5FH 1PZ2A 1ZLEA 4MXWH 2R8SL 2PPFA 1ZHKA 1M1SA 3JVGC 3Q48A 4KVPA 3B2UD 3M88A 4U1LA 1BBDL 2WGXA 2G5UA 3C9NB 4ZYKA 3DRQA 1AQKH 1E50A 1QEWA 1TXKA 4Z7OF 5HYSG 1QUNA 1DN2A 5D5MB 4FLRA 5F1SA 3WAKA 4LK4A 4Q6YA 4IJ3C 2E86A 5SX5H 2HPTA 4TQ8A 4X4MA 4PUBL 4NRYA 4Z3TA 2V33A 2FAUA 4C58B 1KB9J 4GKSA 1PAMA 4PV8B 1TJMA 3W0WD 1AFVH 5KN5B 5DTFA 4DZBB 2HRGA 1Q9WB 5EBMB 1DEDA 3IAGC 4MFHA 3BCFA 3B6SA 5T5NG 2FWLB 1XT5A 3VG0L 4WCYL 5EWIH 5IEHA 3V79C 1XZ0B 3GSNB 3CZEA 4Z9KB 3U4BH 4J3OD 3KWWA 3PWNA 1GZPB 2NZ9C 5E08L 1R3IL 4ZNEE 3O6MH 4HFUL 4A2DA 3OR6A 3S88H 2BP8B 3QI9B 2OQJA 4ZUUA 2NSXA 1SZNA 2BOBB 5AKRA 3WS3A 4U0QB 1XF1A 3FZUD 1ZK5A 4QHLA 1O7VA 3E6HB 5GZND 1I9JL 3FCSA 2FZ3B 2OBGA 2UUDK 1BIIB 4LLQB 4M1CC 3KWVA 4AGQA 4OR1A 5KSBB 1PZCA 4W93A 2UWEA 4TM9A 5GGVY 2R4RH 4W70A 5FM8A 3G6JB 2HT2D 2CRIA 2P3YA 1JHLL 1OTSD 2W07B 4FP8L 4ABVA 3TEXA 3VGGA 3JTSB 3BZ4A 1QWUA 1FZJB 2XTLA 3JV0A 2Z0UA 1R33A 2OCCB 4F7MB 5D9SA 1GKOA 2OMWA 3UTQA 1AO7D 4A1RA 1TEYA 2H1PH 1XCQB 3GRBA 4P2QD 5KS9E 1SGKA 4PWEA 43CAB 1GW0A 2YAPA 4NQDB 1UD6A 5IROC 1OGAB 1EHKB 4NB7A 4QXWA 3QPQC 3OB0H 5E6YA 1WFNA 2XT1B 5D1ZD 1PX3A 2HFFB 2LU3A 2P8MB 4R2GD 4GAGL 4K3EH 4HX1A 3QNZB 4H0IA 3NJGA 4FNLL 4UINL 1KWKA 1S7RB 4LMQE 1K9TA 5JPMA 1DEEB 2X4TA 2A0LD 3S3SA 3QRFM 5IESH 4HWZB 4CL7A 4PR5B 4RFOL 1JMZA 4A7QA 2N7SA 3CFIC 5IW1B 3HCVA 3IETA 3V0HA 2QV2A 1U41A 3S8WA 1QP1A 2R29A 1OT4A 1VCAA 1ZVSA 4LLUB 1TU2B 1M6OA 5KOVC 1KIRB 2QR0A 3FFCA 4OZGA 3S4SG 4AUYA 1Q1JL 3K81A 4KMTL 5B39A 4X4ZA 1BLNB 3BJLA 3T1FA 5C6PB 2F7QA 3IMTA 2VXSL 3DO7A 5E2TL 1SXAA 4N87A 2DYRB 4PJDE 1XH2A 3ARGA 4LCWA 3L45A 5ABDE 2MFNA 4W81A 3GKWH 4E9VA 3MKGA 4N1HB 1WZ1L 3CV5A 4WTZG 5BOZG 1RZJH 1A4AA 1A6VL 1RJCA 5JOPE 4B9ZA 2Y25A 3DPBB 2Q5BA 3GLEA 1HC1A 2B9AA 2V7NB 3WNLA 3KYKL 4FULA 1ZA3A 2APXA 5DK3A 4TQEH 5I0XA 4H8PA 3ABGA 4QIRA 4XX5A 1BJ8A 3TURA 2H3KA 4K94H 5K9KB 5HP5A 3KVDD 4KK5C 4KDTC 5EUOB 3MAWA 2RALA 1CE1H 2I26N 3ULUF 4RA0C 4NO0D 3WJLC 4E2OA 1F3DH 3EJQA 2NXZD 2Q0ZX 4JN1H 4BUGA 1IILE 3FTUA 5C0CB 3W39B 1E43A 2GJ6A 3G5XB 3O6LL 5MI0B 1ADQA 1A7BA 4ADJA 1RJLA 3QDMA 2OJEB 2Y36L 4MQTB 2KLTA 2ZXWB 1NCGA 1KJ2H 5JORA 4LASH 1KLFA 5KSAA 4TKWA 4OSUH 5FR3A 4UT6A 2JSFA 1MEXL 3S3JA 2H2SC 2DL9A 3WLBA 4N8VG 1RHHB 5IFAH 4XNYL 3RUGA 3MBED 3L9BA 3U6XA 3BAWA 1CGUA 4P23A 3MLTB 5TE6L 5MEQB 1IBGH 3VACA 1E28B 3RAJH 4O2EA 4G6JL 3DV4A 1R3HB 2VDKB 4U1SA 2Q7NA 1KYUA 4A2HA 4OFPA 5HHOD 3VDAA 3QCTH 5CEZE 5IIEB 3BO8B 3MLZH 4M61B 4XPHL 3GSNH 1YMME 5C0RH 2A6JA 4ERSH 3MJ9H 5DZNA 4JJOA 1HH6B 2VLMD 3GQFA 1Q9OB 5H4ZA 3H54A 2QQLH 1KEGL 1MQKH 5IMLA 2QMKA 5KJRH 1TIUA 4FQXD 1DANT 3WY3A 1HESA 5T1MA 4EVNB 1EXHA 3EUUA 5GHWL 4BK5A 2KS0A 2WXIA 2KPNA 3QDJB 1PAZA 4YBLC 4DOHE 3CFNA 5I73B 1UASA 3UTTE 1ETB1 1GHFH 3EYSH 4FQIH 5I8KL 1HHGA 3SE3C 4EIUA 2FBJH 4YSDA 1ASOA 1BPVA 4GBXC 2CHDA 2Y6SD 3UJJL 4N9GB 2ZAHA 1IL1B 1SNRA 5E9DB 1AGBA 1D5XA 2Z9TA 7FABH 4GMTH 1KGYE 4NDMA 2MRYA 4PLKC 4MQXD 4F37K 3BP6A 1CZ8H 5GGRA 4HSAC 2W1NA 3RX5A 2A9MH 4GPVA 1KDJA 4FFTA 1R75A 8PAZA 4F2FA 3CSBA 1T04B 3G6AB 4NUGL 4RGNB 3BSZL 3ZT5A 3GMOA 5A1AA 3UO1H 1FYTA 3EJUA 1IM9B 3QZWA 1H8OA 5DGRA 3KG5A 2CU9A 3GSXB 4Z7VA 4L3EA 5LHDA 2FT7A 4X4ME 4ZXBA 4BFIB 3NACH 5DRZB 1NC2D 2IQ9H 4G8GA 4BM7A 4ODXA 1I1RA 2NY0D 1OZTG 1KIUA 3DSFL 3MSPA 4AMXA 2JE8A 5FYKH 1NPNA 3IGKA 1IM3B 2QGCA 4QTIL 4BQ9A 3RGBA 5KSUB 3GBDA 4F33A 2E7CA 1A6TB 1KCUL 3CQQA 3N5AA 4S1RH 3ZDXB 1SHSA 4L3CB 4YZFF 4DKTA 2UZIL 5F96H 2WOYA 3UTZA 3T2OA 1OW0A 3C5SB 2DIBA 4XO9A 4YK4C 5C6TL 4MB5A 1A3ZA 2OMUA 3L3HB 3NZHH 5I6KA 1UFUA 1S7SB 5CFAA 3ZE1E 1RFDH 4FFYA 2BSTB 4JFFB 2R69H 3EGSA 4RWHA 1J0IA 3AQYA 2V2TA 2K9UA 3ENEA 2VUKA 1U2HA 4XVOA 1N5AA 2E74C 4JVPA 2BC4A 1A1MA 2UWEE 4KXZH 2QBWA 3K46A 5LBGA 1V54B 3HVNA 4WI0B 1CG9A 4NBXB 1SDAB 3MXWL 4FYRA 2YFOA 5FO7A 2DEYX 2FIKB 4NZRL 4AGPA 3IMSA 1G7MB 5AW0B 1S3KL 4BDVA 4K3JH 4DCQB 4MA3A 3LPWA 1TTAA 5KAQG 3D85A 5TDNB 5FM4A 3LX9A 5I6LA 1A0QL 1EAQA 3X12A 4AT6A 2DQGL 1KTLA 5J6SA 4MXQC 1O5DT 4WSGA 4BJLA 4MTMA 4NSKA 4GKZA 1IBDA 3B83A 3IJEB 4UM8A 1EXUB 4LCIH 1CL7H 3MREA 2KT6A 3V4LA 2ZX9A 5ANMA 2C3HA 1CWVA 5TQ2H 1IKNA 1E4KC 1I1AC 1O7DC 5J5EA 1G9NC 2FLMA 2FR4B 4PV1C 2EUWA 1U21A 1C8PA 1XXDC 4E0RB 4NEHB 3D33A 2FYYA 2XXMB 4J8QA 4WFHD 1GGIL 3A23A 5FGSA 2FIRT 3O4OB 4OF7A 3ZVVA 1Z2KA 2F54D 4DVBA 2VW6A 2UY6B 4HPYL 3HC0B 3L4CA 3CFMA 4ZUVB 43C9A 5ALCH 4R5TA 4OZGE 3FFCE 1T0PB 4JFEB 1MCNA 2WCPA 3AWFA 3FB7B 2FBRA 3VSUA 2R51A 2VT0A 2HLFD 2HRPH 4PCTA 2VDKH 3BZEA 2Q8BH 4YDKL 2Z7YA 4L4VD 4LCWE 5G55A 3L3DB 4RA3A 4OUUB 4KVCH 4Y8AA 3H3KA 1JI1A 2W0PA 4H8VA 1IGCL 4UDTA 3UAAA 1RZ7H 4CGUB 4IK7A 2ZWZA 4N8UA 3B8SA 1HZHL 3OPUA 4BSWA 3WEXB 4HVBA 5CWSA 1I7RA 2G2PA 2Y0SA 4LSTL 3ZKMC 5DJ6A 3ETBJ 4NRZA 1JV2B 3ULAB 3GRWL 5TH2B 2BLFA 5B7EA 1JTTA 3BT0A 3RFZC 1GZHA 3X3FL 1FVDA 4N0FA 2W9EH 5MEPB 1TZIA 5GQBA 2ZWYA 1TMQA 4ODTL 5HVWA 5DGQA 3Q9PA 3TVMB 3MRCA 1OOWA 3B9AA 4M9OA 2GIYA 4MJ5B 3MJ7B 3D51A 4WF7A 2H45A 1E30A 1NGZB 3GDCA 3LV3A 5E03A 2BWQA 4YSTA 2P5EA 1JZEA 1F41A 5IZ7A 3L3OB 5TQ0L 1BECA 1IC5L 2V3DA 1NUNB 3TU6A 1F4XH 2FEEL 2X9XA 2UZXA 4LZKA 1OTTC 2CO7A 2BS9A 2K78A 3QDME 4TUOA 4P0DA 1D9KA 2EXWC 5DJ0A 3RHWK 4HCRA 4MCZB 3NAAL 2ZOKB 4FADA 3EYQD 3MBWB 2GT9B 3EO0B 5KG9B 1OIOA 4J3OF 5C7XL 4BINA 1KUMA 1RULH 3VWKD 4HIJA 3DGCR 1FFPB 2PLTA 4RGMC 1CVSC 1L5GA 4GRMB 4MZIA 4R4BA 2Y2TA 3RUGE 4OB5L 4KTYA 5BUPA 5FOBA 3V6ZA 5CCKL 2HVKA 3EIFA 4LSDA 4UUJB 2YKLH 5CEXB 1SEBA 1BXUA 3GSWA 3DJZA 2CPCA 4QRFA 4GW4A 3GMLB 3E8UH 4MDJB 2IJ0C 4TVPH 4OLUL 4PN6A 4NKOB 1PD1A 3WHXA 3QORD 1MG3C 5KVFE 4CVUA 2VDRL 3E9TA 2VN3A 3KD4A 3MRFA 1CXEA 5IT2H 1X6LA 4ONFL 4LQ1A 3HRZB 1CR9L 2WMPA 3B5GA 4N26A 4EJ1C 2CNYA 4KJPC 3EXLA 1QBML 1K3ZA 1HHJB 2FX8H 4MAYB 5IMOA 1MREL 4YE4H 2BH0A 3TBSA 3RA7H 1U91B 1EEZB 1X5AA 4PP1D 4WJ5A 2Z7UA 4KZ0A 5DUJA 2JKRM 1Q4NX 1ZT7A 4KY2A 1DQQA 5C8JB 5IGXL 2WXOA 3WE6A 4QXTB 4MDIA 5FUOL 2OK0L 4YHYB 4LPUA 1TFPA 5IB1A 1B0RB 3VXRA 4XN1A 1D5ZB 1EGJL 3LXCA 5CZVH 5EZLA 3CFDB 2V8MA 4B9PA 1V10A 4U1JA 3BAXA 5B8CC 1YEFL 4OM0H 1JDAA 4DKDC 1MNUH 1WC7B 4IGBB 3GSUB 1WZAA 4M43H 3VG9B 2AJSH 3MV8B 1ZK9A 2Y7SA 1LDSA 4JHZA 2OMYB 1RK0A 2J25A 2VLJB 3P0YL 4GRLA 4EO5A 2L04A 1GW6A 3NIGF 1FL6A 3FW6A 4R96A 4EOWL 3PP3K 3MRPA 3W9EA 4JM2D 4UQAA 2AJZB 1FYTE 1QVOA 4JREB 5DVOA 3ASNB 2QPEB 5F1NB 1QSED 2D7TH 4Z7VE 3RZCD 2AXWA 4L3EE 3ZL4L 3L5XL 5LNDA 1BBJA 3GTVA 3O9WD 3O2WH 3V8CA 3CFKB 2VC2B 4G8GE 4YQXH 2DWTA 5F89A 3ZX1A 1EV2E 3MLWH 2FECI 4Z7NE 1USQA 3U0PB 4UQEA 2XKNB 4P49A 3HE7C 3KWUA 4P5TB 2DQCL 1Y1UA 1KYFA 1XIWC 1E3FA 2B20A 1DBML 1RVFL 1T4WA 3MJ8B 4ODSH 4JO2H 5LBVA 3BKMH 4JQIH 1IBFA 1T7ZA 3LRSA 4PRPD 2VAAB 5LXVA 4NQSA 5HHME 3TS8A 3VGAB 4QUOA 5EEVA 3MTRA 3LZQA 1CI3M 4YEEA 3TNMB 4X7TB 1OE3A 4QRSB 3UTSA 5GS2D 1CFSA 3EF7A 1B3JA 3OD3A 3WFEH 2ZD0A 1A3LL 3V0AC 4H8QA 5KVEH 3MXVH 3AFLA 1CF8L 1TZGL 2H26A 4MJ2A 2W0FB 1AGCB 4U1HB 1TJIL 3AITA 3ZT7A 1FH5H 3LCYA 3BQUA 4MYPA 1XGQA 2Z31A 2F7RA 2J8UF 3ECUA 4KV5F 3IGUA 4YBQC 5EU7C 2MJWA 4LSVH 3QDGB 1Z5LB 3FRPG 1C1EL 4XO3A 2M2DA 2HMID 1ZDSA 3JQOB 3BAJA 4IJTA 2H3NA 4R8WL 4MX7A 2CBQA 2ZSVB 2DMGA 1DQMH 5EIIB 4NQEA 4DEPB 5DLLA 2WAQA 1GPOL 1KY6A 5DJAB 5AVXB 4PY8J 3MJWA 4LB8A 1PKOA 1WGVA 2I60L 4GH7B 4S1QH 4Y9EA 3WMQA 4HUUB 3KLAA 1XV8A 3VRLF 4FYSA 2FATL 4K71C 4LAQH 1V7ML 2QMJA 5ANME 2DQUL 2FSEA 3QQ3B 1MDTA 5DJXA 1C9SA 1J1XH 3GUTB 1F4HA 3I6KA 5EC2A 4WUUA 5ENWB 2WNXA 2Y7OA 2EO9A 3FOLA 5AW9B 4IU2B 4EUPA 1OAYL 3P3UA 2WZ5A 1CU4H 4TSAH 2C4XA 5FEBA 3SJVB 3G9VA 5I1DA 4ETQB 4UTBA 1MFUA 5GGUB 1QRND 2WY3B 3FTGA 1I3GL 2XTJB 2X4PA 3IDMA 3UAJC 2XQYG 2AC0A 3LEYL 4M7JL 4Z7OE 1P7QD 3ILQC 1AGDA 4GAYA 4ZTPL 3OQRA 3OJDA 1Q94A 2WLKA 5DZVA 2ZKHH 3JVFC 4JFPA 4ZTOH 5C0GB 3S37H 4U1NB 1CE6B 3S3DB 1MCOL 3CFEA 3IGFA 5D4IA 4HPHA 2D3NA 3QUGA 1I9RL 5AENA 2W95A 3MO1A 2XPGA 1XB6A 1F11A 3LEVL 2EYSA 5C0JA 5AW4B 4G83A 2R4SH 1E4XL 1S9XB 5AFAA 1I1YA 2IH1B 1J0KA 4NERA 4U0RB 1JP5A 4YJZL 3K8LA 4XXCA 1WEJH 4KI5C 5T3ZL 2IG2H 1ZTMA 4KTGA 3GMMB 1RQ5A 2GJJA 4JDZB 3ME0A 3R0MA 5G5DA 1UJ3C 3FS9A 4YE0A 3K7UA 1J8SA 4PRDB 1S7QB 3V5KA 4D8OA 4ZO6A 1GC1C 3SDCA 2N01B 4JRXA 1PLCA 5HJGA 4D7PA 2TAAA 3FB5A 2WYHA 3QCUL 2ATPA 3DVFA 3QRBA 1GJIA 3JV4A 5EG6C 2P5EE 1B4JL 1ONQA 5DD3H 1FG2B 3GHBL 4ZMZA 3O6FC 1G87A 4N2GA 2YK1L 1MCWM 2NXYC 3A0OA 1N5YH 4ISVA 5JIQA 5CSZB 1RJYB 3E9UA 1U42A 3FCGA 3MJ6A 2Y07H 3SDXB 2WXPA 3HAEG 5JW4Q 5DHVB 3LKSB 3VFPB 3IKCB 4MMXA 4I48B 2WVUA 1J8HB 2CXGA 2YAFA 4Z77A 3N55A 1T83C 4LFHD 3PP4H 1CD8A 2PCPB 2Q7YA 1QPKA 1VGEL 2MEJB 4HJ0C 3U2SB 2FEDC 4RZCB 2QGBA 2VC2H 4KQ3L 5JIPA 4ANVA 3VTAA 1F4AA 4ZZKA 1BJ1J 1IJNA 1TO4A 5AUMB 3WIHH 5EMYA 1YO4A 3CFJB 3V0EA 1BP3B 2G3MA 3GSQA 1ZSHA 3OAWA 3RIFF 4BFBD 4BH7A 1EUTA 1JVOA 3V52L 2ARJB 1OF0A 3JTTB 4XNQA 3P73A 4OLYL 3EDFA 4YHIB 3T0EB 3WBDA 1IBZA 3MLXL 3T6ZA 5JW5B 3W38A 3HC3L 3WO4B 1B3IA 4R7DA 4NQDD 4ZNCD 3MRRA 3Q06A 3UG4A 3T6WA 2B15A 2ZE0A 3DV6A 5K9OA 1I8MA 4LVHB 2VMDA 3BSHA 3EGXA 4H0LC 3NA9L 3L3IA 4YSEA 3VFSB 4FDWA 3SCMA 3AADB 3QEQE 2NZIA 4HCFA 3N42B 3VXSB 1YLBB 5F7DA 1T21B 3FQ1A 4KY1H 1ETJA 5ISZB 2JFCA 1K5WA 3OGCA 3QEUA 1GMEA 5I82A 3VRIB 5JNYB 3VXRE 1AVAA 2A9CA 3X2QB 4JFYB 3L3GB 3A6BH 3JV6B 4MQ7A 4D0BB 1GGYA 1UEMA 1YEDB 4NKMB 3RZWA 1IGJB 1OAUH 5FUZH 5LGHH 4B6ZA 5E7BA 4ZFGH 2QGEA 2MPAL 2H9GB 2ZXCA 3QO1B 4GIAA 1RK1B 2AK4B 4LLMA 3QDHA 4G6KL 4XVTH 2VM4A 3JUYA 3T77A 1XGUA 1RLWA 2NX5A 2CDFB 2J2ZB 4UWQB