4TS6A

Crystal structure of the rim c2a domain from drosophila.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
PIEGRLQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAHHILDDEAEWYQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RIM C2A domain from Drosophila.
rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
molecule keywords Rab3 interacting molecule variant 2
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ts6A00
4FJYA 4KZCA 2BWQA 3L54A 2EP6A 3NZUA 4ANVA 4URKA 1BDYA 2A5UA 4PS8A 2DMGA 4TS6A 2RD0A 4G11A 3L17A 2ZKMX 4XE0A 3QK0A 4WWOA 1DJGA 3W57A 4QJ4B 3M7FB 3HN8A 1E7VA 4MJJA 4KZ0A 3L16A 4FA6A 2ENQA 3OHMB 3KWTA 3ENEA 3OAWA 3TJPA 1E7UA 4FULA 2NCEA 4ICWA 2UZPA 2D8KA 2Q3XA 3F00A 1DJXA 1E8WA 4AJWA 1RLWA 3MJWA 4NPJA 5H4ZA 2ENPA 1E8XA 3CSTA 5G2NA 4WWNA 4FHKA 2LHAA 3FDWA 4TV3A 4PS3A 4WAFA 1K5WA 4WWPA 4FJZA 4FHJA 4DK5A 1WFMA 4F92B 4XX5A 4ANXA 1DJYA 2R83A 5JHBA 1DJWA 3F04A 4FLHA 3L08A 1TJMA 4ANUA 2WXIA 2NQ3A 3FBKA 3TL5A 4FADA 3IM1A 2WXOA 5CCGE 4L1LA 4L2YA 3DPDA 4F91B 5EDSA 2K45A 4OVUA 3ZW3A 1DJHA 3IBEA 4IQHA 4XZ4A 3L13A 1HE8A 3QARA 2WXPA 3R7QA 3JZYA 2WXMA 1UGKA 1QATA 2Y3AA 3L9BA 3RDJA 2CHDA 1WFJA 2CJTA 2WXHA 2A4ZA 2N1TE 4DNLA 1DJZA 4EZJA 5JHAA 1CJYA 3F05A 3DBSA 2K4AA 1E90A 4J6IA 2JQZA 2WXRA 3PYCA 4IHBA 2WXQA 1GMIA 2QZQA 4Y1TA 4ICXA 2ISDA 3APFA 2CHZA 3ML9A 4JPSA 3GPEA 4ANWA 3TWYA 5KJ7E 1BCIA 4GB9A 4QAMB 3PFQA 3HIZA 1W15A 2WXKA 4L1BA 2WXJA 4QJ3B 4WEEA 2KI6A 2WXGA 2ENJA 4L23A 1TJXA 1QASA 2WXFA 4F1SA 2CHWA 5H4YA 2CM6A 4TUUA 4LCVA 1DJIA 3SD5A 3KWUA 2K3HA 2FJUB 3PRZA 2Q0ZX 2CHXA 3P2BA 3QR0A 3PREA 3RPBA 1UOVA 3N5AA 2CM5A 4HLEA 3HHMA 2WXNA 5T8IA 3ML8A 1DQVA 4A55A 3W56A 1DSYA 3ZVVA 1A25A 3CSFA 3NSJA 4V11A 3R7RA 2FK9A 3L4CA 2K8MA 3QJZA 3APDA 4GNKB 2YRBA 4NP9A 4NPKA 1W16A 4QJ5B 3PS6A 3S2AA 4F93B 5CCHE 5CCJA 4BGDA 1RH8A 3NZSA 4PS7A 5G55A 2CJSA 3ZIMA 1E8YA 2B3RA 4NS0A 4Y1SA 3T8MA 1E8ZA 4HVBA 1RSYA 2YOAA 1UOWA 4BFRA 2DMHA 4EZKA 4LDCA 3QAQA 1V27A 3LJ3A 4LT7A 4OVVA 2NSQA 2QZ5A 2X38A 2WXLA 4EZLA 4KITB 1BYNA 3APCA 3B7YA 1YRKA 2V4LA 3F01A 3QR1A 4AOFA 2Z0UA
chains in the Genus database with same CATH superfamily
3B9EA 1P4LA 4JRFA 3ZJAA 1TVHA 3MLWL 5C07E 2ZAIA 5I66A 4PJFB 4UQBA 3L9RA 4XE0A 1KGYE 1UM6H 2JFCA 2E0PA 5AW0B 1ZLWH 3S96B 1NBZB 5K9OB 1PYWB 1SDDA 3CFQA 3LS4L 1BZ7B 3F84A 4OLEA 2W95A 3ESVF 4P2QB 4HK3N 1ZIBA 1NANH 1YEHL 2PPAA 4XMLL 4ODXA 4P2RE 4JFED 2CUHA 4MNHA 2RCSL 1MAML 1CLCA 4NPJA 4X4ME 2YSSB 2EXYD 5C0AE 3GBEA 3BUQA 1XEUA 4F57H 3ZHLA 4GMSH 5BVJB 4MVBD 5DHYB 4KQ4H 2E7LA 3WEXB 2BP0A 3CLFH 4ZRGA 4AYGA 1MFBL 3H2PA 2B4CH 1P4IH 4MQSB 1R3HB 2BHUA 1QZ1A 4B0MM 4Y16A 3ELAT 3O2WH 4RDBA 5FDWA 2OR9H 3HRZA 2MNWA 4YSSA 2H2SC 2K78A 3ZMNA 4HEPG 3S0PA 2XG4A 5AOJA 4KHTH 1AD9B 1H15B 1RPKA 6FABH 1QR1B 4R7VA 2W0FB 5B3JF 3AY4A 1T1YA 1P2CA 4U31A 3DHJA 3RZWA 1M05A 1JNHB 3PWJB 7TAAA 1QTPA 3QZWG 1T03H 2X89A 5IOKA 3RWJB 5CBEB 4HCFA 4G9FD 4BXSV 1P84K 3ZGIA 1ZOXA 3ATFA 4JM2D 4KXBA 1G7MA 2L0DA 5DVMA 3MLRH 5EBMB 2VN6A 3QWNA 5GS0H 4WHTB 3VRJB 4CVZA 2PABA 1BBJB 4HUXA 1ZY9A 1KTLB 3DUHA 4J12A 2CHXA 4MNQB 3KYNB 1MHCA 3IDNB 3BKCL 5LWYL 2FEEI 2D3NA 1IZJA 5I1KL 2X6CA 4UU9A 4FTVA 2X28A 3EJSA 5JIPA 3DV6B 4R7NB 1H3XA 4HUWB 3M88A 4I8DA 5E4IA 3STLB 2EYTA 4R4FH 3A5VA 3D05A 3IKKA 4WJKB 4L29A 4LCIH 4N90D 4C4KT 2ZE0A 4UQ3B 2BSDA 1XB8A 3MOAH 2BXZA 4XVSL 4KI1A 1RSYA 2HT3D 2AF2A 1WWCA 3BUBA 3H85A 1K5NA 3G5YA 1TLMA 3HR5A 5DMIH 5F3HA 2B08A 2BRRH 2OMUA 5FO2A 3IS1X 2NSQA 3ARXA 5H37H 1RJYA 3TO4A 2PCFA 1QPKA 3MLVL 4WCYL 1E6JH 2DBLH 3D85D 2E86A 5FW7A 1JCVA 1RZ7H 4P4KB 1CFNA 4YHLH 3T2LA 1QI4A 4NN7C 3NG5A 4J27A 1ASPA 4F20A 2N7AA 1SJEB 2AVFA 3CHXA 3DO4A 3QQ9D 3FU7B 3TZVC 2GJ6E 3IRPX 4K3JH 1AD0A 1DVSA 4QLWA 1BMWA 4OCSH 5AALA 1GKOA 3U2SA 4MDJA 2BNQE 3FQNA 3SZ6A 3ZRCC 2EDYA 1BOYA 3OR7B 3RL1B 1RULL 2D3VA 3II2A 2XIBA 4W4OC 5DHVH 3VFGH 4BZ2A 2FZ3A 1B90A 5GSRA 4MD5B 2AJZA 1YQVL 3AQDA 3BGAA 3OKOB 3CZSA 4HFUH 3HG4A 2P5WE 3LV3A 2XFXB 2P80A 1KN2L 1ZPUA 3D3VD 2OMWB 5PCYA 3SSGA 4FADA 1SLXA 2QGDA 3F6LA 5TDNA 4NUJB 3TF4A 3N0AA 1JHLL 4HIQA 4P2OB 3IMRA 4YIQA 1L7TL 2QVTA 2ZOTA 3RDTA 3EJYC 1CGUA 1MG2C 3VFPA 3E9TA 2CJTA 1WFJA 4AQ8A 3VH8A 4PJHA 3F12A 1B2YA 2E27L 4DP6X 5CF3A 4G9FA 5HYQB 4G6JL 4L4TA 4BQCA 3I02A 1SNRA 4ANKA 3WDHA 4MTMA 2VDLL 3TO4B 1A2YA 3Q13A 3RZCB 5KYXA 1PY0A 3GPEA 5IHBA 4QDGA 5HYSA 2DWSA 2VCOA 4HF5L 2NW3B 3LKQB 4XCCL 3SKJH 2ROYA 1E4KA 4G6KH 2C9RA 1BREA 2P8PB 4JZOA 1INEH 5I75C 3VRIA 3UJTH 3T4AB 4LVNC 3WCYA 3FT4B 3PWNB 3WLWC 1W0WA 4N8UA 3T3ME 4QHMA 2C3VA 2MSPA 2ZP9A 1JV2A 1SDDB 5HD8C 4JRYE 5A6IA 2X53A 5DEGA 4KUCF 4L9DA 3S37X 4LEOB 1AS6A 3GMOA 2B14A 1DUYA 1JF5A 2QSCL 1EH9A 2ZUWA 1TJGH 5FHAL 2NSXA 5DQJB 4M02A 3N50A 1A4BA 4LPCA 4F8LA 4ISVA 4XP5H 1AKJB 4G8EA 2R0LL 2YUVA 2PXYB 3QIWD 5BCAA 5AAWA 2WOYA 3JYBA 3UTTA 4DP5X 3MRNB 4J23A 3VVWA 3WS6A 4JL2A 2VGLM 2XI9A 4TUJA 5GPRA 1KB5H 5I1JL 3K71A 4R97B 2C5DC 3EYFB 3E2HC 5IVXE 4K7PY 1I1FB 3UERA 1PKOA 2EDLA 2UV3A 1I1AB 4G6AC 3IKCA 3IDXH 4G42B 2NMSA 2RD0A 1B0GB 4PRIB 5J3HD 1EEYB 5HHVL 2IAND 3OHXB 3HMXA 3VI3B 1G7JB 2ZCZA 4EVNB 1A02N 4X98B 3Q06A 2HLAA 3CSYA 1B0IA 4N85A 3PUUA 2W07A 3GRBA 3ZY7A 2KL6A 4KO6A 1U8OA 3OKOA 2R4SL 2A6DB 1ZHBB 4ZUWB 5DHVB 4D2NA 3DOSB 2IGLA 4IOIA 5EBGA 4WJG3 4K5OA 1JZ4A 1NFDF 5SV3A 4LF3A 1Z9SB 1KJMA 4ALAC 4YDJB 2VDKH 4AYMC 5ACMA 4MRCA 2X1WL 2QVKA 1KJ3L 1KLGB 2Z31A 2FYYA 3IWUA 4IRSD 4X0KA 1AIZA 3DX8A 5KANI 4HC1L 4ENEC 4OH2A 1DQDH 4L9LA 1HE8A 5E2VL 2WZPD 4PJAF 3GXNA 1A2YB 4OFKA 5DWUH 1H6TA 1FC2D 4K5NA 1PSKL 1BBDL 1MCCA 4O58H 5EPMB 4XNQA 4JREC 3Q05A 4WI0B 5TE4H 4WY7L 4CAGA 4M56A 4AGQA 4Y2DA 1Q1JH 4KQ3H 3W9EA 2RALA 4OV5B 4PGEB 2EYSA 2IXQA 5EU5B 4XP4H 5JW3H 5DMGC 3HI5L 3R8QA 4FFTA 1OTSD 5KSVB 5F6IB 2OSLA 5D7KD 3CSPA 4OIIH 1EXHA 3ZTDC 3SCMB 4Z3TA 3N3EA 5DUBB 1MIML 4KTDL 1TEGA 3L6FA 2VRKA 1QSFA 3ZKXC 2XRAH 4X6DB 4MSWB 3L3JA 3E8VA 3MYJA 1OCCB 1A1NB 2NY6D 2P46B 3RBSA 5C2UB 4KZDL 2HT3C 3HC2A 1TFHA 4B0MB 1G87A 3M7OA 3NJLA 2K8QA 3UMTA 1OALA 2Y72A 5HHQB 3R7RA 3SQBB 4F7TA 3V5HA 4OJEH 5MP6L 1V7MH 5T3XH 1A66A 4G8GB 1GHFL 2RFXB 4BRVA 4XH2B 1PKQE 5I18L 5I24A 3QXDB 5LCVH 4RGMC 4DOHE 1IFRA 3ULVH 1A7RH 4I0PA 3LS5H 2F58H 4JFVA 5C0JA 4XMVA 3HLAB 2XZZA 3WAKA 5J11C 1A6AB 4P5TB 4X83A 1VKXA 1IC1A 2Y06H 5J1AB 4LKXB 1TVBB 1BZ9B 5KANG 5D96B 1W9XA 1A0QL 2XWZA 4BWWA 1H8LA 2F0CA 3QH3B 2XXMB 1UD3A 1U8OB 1AO7E 3OXRB 3ZKND 4B9PA 4QRUB 5LXGL 4FFZA 3EG9A 2FWSA 5C0BA 2OAAA 2V33A 4AQEB 1WWAX 3W57A 1JE6A 3FUKA 3X13A 5A3ID 1SQ2N 2N01B 3Q9PA 5SV4A 5LNGA 3FULA 1MI5A 1AO7A 2J44A 4HUNB 3S96A 4P2RD 2QTVA 1N7MH 4OSUH 2PO6D 2O1AA 5HDRA 2GTQA 3W9DB 1MCDA 4H2AA 1UA6H 1VENA 3GI8L 4YQXH 3ZN6A 3E2HB 4PIRF 1QLRB 3HPJA 1KXTB 4KK8D 5D1XD 4NQXA 4XNDA 1CDBA 1FVDB 1QA9B 3PWVB 1TYJA 1TFPA 2GCYA 1MCWM 4FDWA 1FF5A 1AHMA 4OFYA 1H3TA 3NA9L 3OZKA 5EUOA 3AXIA 3H1ZA 1GXEA 5FHBH 3F04A 1CYGA 4LCWB 4ANUA 4LRIA 2L3BA 3I6GB 4KK6C 1MWAL 2X2IA 3G3LA 5HY9B 3PAUA 3C2SA 1DFBH 5MHSE 1YNLH 1TYEB 2HTLD 4WU7A 1T7WA 2I07B 4EDWL 1DQQA 1VEOA 3WNPA 4X4YA 5EOCH 4PWEA 1ORSB 3N9GH 4A2HA 3NCJL 3HAEB 3H42H 5A2CA 4W6WB 1WTLA 3MVSA 4LLDB 4LPVA 5I30H 1ZA6A 4FC3E 4WFHE 4F57L 2VWEC 3QDMA 3V4PH 4DPRA 1OT4A 1W0VA 4ZG1A 5D6DA 5DHMC 1VSCA 2DH3A 4AW7A 2L4OA 4KMTL 3Q2NA 4JKNA 3X2QB 2B5IC 3ABLB 3WEOA 3GK8H 3D2TA 3Q43A 1YNKH 3RFZB 2BS9A 3MA9L 1TTBA 2ZNXA 2BY3A 1OTTC 1U0QA 4QY8A 5CBAB 2VLKB 1WIOA 4YO0A 2R2BA 2OMVB 2P8MA 3HS8A 3QEHA 1HS6A 2Q7NA 1Y0LA 3Q01A 4L5FH 2EO1A 2GIXA 4Z7NB 4CC4C 4H1LA 4GI6A 5JXEA 1ZHBA 2WYHA 3T6XA 4NLAA 1AC0A 5D2LB 3ZZQA 2KPNA 1QA9A 3PWVA 5SWQB 5MERA 2WNGA 3HG2A 2ZJSH 3V4UL 4M62H 4OGZA 3R8BB 3H3PH 5HHMB 1KJVA 3QWRD 4ODBD 3BP7A 1FNHA 5GRXG 3GB7A 3ZE2B 35C8L 1ACCA 1NGYB 1FIGH 1Q4NX 3NEEA 2F19H 2O5ZL 1NSNH 3K6SA 5CMAA 4WKZB 1LEKA 4X8GA 3GXMA 5J11B 1JI2A 5B39G 1VZIA 2QDVA 4BIKA 1QRNB 4DP7X 2BY0A 1BD2E 4XRCA 4N6QA 5D6CB 3RY6A 5TK4A 5CIPH 2XHNA 3OPUA 4HH8A 1ZANL 2PCFB 2JF1A 4YE4L 4PWHA 2ICCA 2OZ4H 3HUJA 2JI1A 5J4MA 4N0UA 3QISA 1BD2A 3QFDA 2NNAB 3FB5A 4JO5A 4XXWA 2FJSA 3ZMRA 4KDWA 2RQ8A 5HI3D 4U3XA 1A3RH 3IN2A 2B2XL 5C0AD 2H0JA 5AENA 2F8XC 3P3RA 1MVYA 3FAWA 3H3PL 2E7HA 3U4BL 1SXBA 2ID5A 4Y5XA 3OSVA 3QCVL 4K4KA 3FB7B 2Z92B 1CF8L 1LDPH 4HJIA 1BV8A 3N85L 2YWZA 2YZ1A 1IFHL 5DCCA 3L3JB 5DI8B 3BGFB 2DWDB 1NAKH 2J8UF 4Z7UE 2XWXA 3QEQB 2VJXA 4Z7IA 4U1KA 1ADQH 5TDPA 3TWCL 1S5IL 5IBLC 3ULVE 2XQYG 3MROB 3CDZA 3BP7B 3K81A 1WQVT 4PYHA 5GGVL 3SODB 2AZUA 3VXRE 1IT9L 1E5YA 4S2SB 1VFOA 5J13C 3CMOL 4PJHB 1SVCP 1S7RA 1XB6A 5EA0H 1MAMH 4F15C 3D48R 3MUGB 3VJ6B 4OI8A 3PFQA 2VZ3A 4DKDC 4LKXA 4GSDL 3BN9D 4F27A 4WFHD 4N1HB 1DLHB 4BA0A 4HJJL 1YUHB 3KHOA 4LSUL 3IB4A 4HK3J 3GEWB 4M29A 4F1SA 3DA0A 5DFTA 3E6HA 3FPXA 2W65B 2AMUA 3CFJA 1MLCA 4L1TA 3OMNB 3VMPA 2ALAA 4KMTH 3ZZSA 3VD5A 1OWWA 4R0LA 3CIQA 4EXKA 5IMOB 2AEPL 1MREL 4MZ2A 1DBAH 1N64L 3PGDB 1Q9LA 4F7KA 2AQ2A 1Q0EA 4HKXA 5DMGD 4Y7MA 2IGTA 3D0VB 3BLKA 3LSOB 3PABA 4PJXF 4LMQE 3DUSA 4G8GE 1PZ5A 1KXTA 4U7KA 4HOZA 3WO4C 4OD3H 4U6HB 4U1SB 1TEFA 1NCIA 1UUSA 2JIXD 4B9KC 2AP2A 3SDXA 1CL7I 2CDFA 5CP7B 3PJNA 4PJ8A 4F37F 3QFJA 5DC9B 2GJZB 3QNXA 2VR3A 4HQQL 3E9UA 4N2LA 1NSNL 3CDYA 2B16A 1IE5A 2UX7A 4NO0A 3FFCD 2GJ6A 2H26B 2XZAL 3R1GL 4Q56A 3OJVC 4CU8A 1BECA 4J1UB 1X3DA 5D1QE 1NFIB 3T2PA 2Z8SA 3FRPA 4HU2A 1A4KB 5F0LB 15C8L 2CK0L 3BAIA 3KWTA 4WK4B 4GQ9H 5F71A 3QUML 2YHGA 3IFOB 3VTAA 12E8H 3CX5K 4HX1A 3AS1A 2GBAA 4Y4KA 1FZJA 2JK5A 2FEDD 3NRPA 4AQ1B 2DTSA 1FYTE 1DQLL 1DVYA 4YXLL 4A63A 3AVEA 1BSIA 2XVKA 2FEJA 1ZT4A 3ZPDA 1U91A 2ARJB 3I9GL 3IGFA 2BVYA 3NSCA 3PWLA 4FFYA 4MA3A 4N2BA 4HU8A 1S9KC 4TRPL 1IM9B 2I9TB 3BYTA 4UILH 1PAZA 1I1FA 2R69A 3QULB 5IHWA 2UYLB 4C59B 3KPSA 2NTSP 1K4CB 4M6ML 1XGRB 3QUXA 4R5XA 5EZOH 4U6HA 2IAAC 2D7NA 2WUBL 3EOTL 4YEFA 6PCYA 4L4VE 4WI7A 3VI3A 3D18B 4M5YH 4BINA 1YEFL 1XR9B 1FCCA 2AJSH 2OPCA 4ZMQA 2WN3A 5IHZB 1FSKC 1BFOA 3O9WB 5F89B 4WTZA 4I3SL 5F9WB 2G2RB 1XCQB 3EFOA 1E28A 3B2VH 1EA9C 1IC5L 2CO7A 3L3IB 4JZJA 3RWEB 4PGEA 1W15A 4CMHC 5AVRB 4Z1PA 1GZHA 4R0LB 4PBXA 3RYMA 3ULVC 4FLOA 2QKIA 4NSKB 3HZMA 4JFDB 4JANA 3S34H 3I6KB 4KPHL 1J9QA 3QQ3A 4PRHD 3N43F 3AW5A 3MXVL 4KO9A 1Y1DA 4LSUH 4MNQE 5E70A 3RVWC 4FLRA 4QRQB 3FU8A 4YFEA 2GEQA 1XCTA 3L5HA 3U46B 4ATWA 5JOPD 3CPLA 3V4PA 5BXFA 2NW2B 2ZPKL 5EDXA 3IWVA 1CQYA 1N6UA 4UTAL 2X42A 1BAFH 2DYRB 4RGMB 5G55A 1LHZA 1CCZA 2CJSA 4X6BB 4X6CF 3TBBA 1M2VB 4HVBA 1TQUA 4PJEB 3D85B 4NQTA 3QE5A 3RGVB 3K1DA 5CZVH 5ID0B 3U4AA 5FA4B 2VXVH 4OVVA 3TNMB 2WJ5A 2ADFH 2QZ5A 4TNGA 3RAJH 3SDAD 4O2CB 5IJVB 3NJMA 1E4HA 3C8KB 3UH8A 4N24A 3S36X 2UZIL 3QI9B 1XGPB 1CXIA 1QR1A 1A7PL 3CFEB 1F1DA 1OB1B 3RGHA 3D06A 3T4AC 1ASOA 4XHJD 2BSBA 4EI5D 3EIFA 1E5BA 4KJQD 1GW0A 4NQEB 5B38B 3TEWA 3QIBC 4JRXE 3NZ8A 4Z3JA 1NIFA 3U7YL 5SX4H 1OGAE 1NGPH 1G6RH 1WZ1L 4KNQA 1AG0A 1R3KB 2WVVB 4GRWF 1X7QA 2DQMA 3L16A 3LIZL 1TPXC 1TZGL 2R4RH 3EJZC 4HXAH 2ZCHL 3KS0J 1S7RB 1CMOA 4MCZB 3CFUA 5AKVA 1JPFB 2EIMB 4HBCL 1S9WA 2IOOA 3NIGF 3TA3C 1WZAA 3ZLQC 1WAPA 2A9MH 1EHAA 2IQAB 2IQ9L 4ZSOB 1MCOL 1WIPA 3DETC 3NIDB 3BPCA 3L9EA 1TQBC 5G2NA 3CFDB 4OZ4A 5IBUG 4KK5D 5HYJE 2YXMA 2EDHA 2H32B 3VACA 4DK5A 1SDAB 5L4IA 2R0ZL 2BVUA 5AL8A 2HVJA 3QG6B 4JKPH 2UZIH 5LXGH 3MJ9H 2MH4A 3VQMA 2PTVA 2P5WB 1PEWA 1U36A 4UOQA 5KSAC 3GSUA 4Y2LA 1BZQK 1QSED 4IQHA 3M86A 4S1QH 2B0SH 2OMXB 5BS0E 1AMYA 3VSTA 4X7TB 1QNIA 5CN2A 2A6JA 1QLEH 1K5NB 3HR5B 2GJRA 4QGTA 1I8MB 1XR8A 4X5LA 25C8L 2WXRA 4Z0XA 3UGUA 2WM0A 3CVHH 4IU2A 1LP9E 2WQUA 3BVDB 2UVEA 3GHPA 4NQDD 1IM3D 1M2OA 5A2BA 1W72H 2VT0A 2ICEA 5CLTA 3SGEI 1BJ1H 3FTWA 3MI6A 4GP5B 4N3UA 2XNAB 2KPWA 3DRTB 1I9RL 1ZLVH 1ZHNB 3ARGB 3BKMH 3WTWA 4NO0B 2IH1A 1XEDA 3BPNB 4R2GD 3V4PB 2GAZA 4JO1H 1VGKA 2BERA 2DQGL 4V33A 2E47A 1E4JA 3MRGA 1E40A 3OM3B 4TQEL 2YXFA 4W6XB 2EVHA 4ZAKC 3T77A 1XSIA 3RGVA 2M1KA 2H3NB 4FI6A 5AZ2L 3D3VE 4JFDD 1ONQA 2JV6A 5TE6L 2R2HB 3C12A 3DYMA 1MAKA 1O6SA 2ADIB 2BIMA 3OQRA 1BM3L 1NAMH 1U58A 3A21A 3NCYS 4KWUA 3HZVA 1CXFA 1L0PA 1T1YB 3BGFC 3KYKL 4ZMOA 1OB1A 2UXTA 1NFAA 5SWSB 1NFKA 4XB3A 4KH9A 5EO0B 3E6FB 4NUJA 5B39A 3HZYA 3JWDC 4F3FA 4JO3H 1EEQA 1T7YA 5CBEA 4GKNA 4KZCA 1ZS2A 3X3GH 4X9HA 1CG9A 1F90H 2N0KA 2J1YA 1J87A 3JVFC 4ZFZA 1JPFA 1QBBA 4KO5A 3JV4A 4WWOA 2AQ3A 5KYXB 4PWGA 2NYKA 1N70A 2DQEL 3HN8A 3RWHB 3IDGB 5EIIG 2ENQA 1BFOB 4JFFE 2YFNA 4ICWA 3MRLA 4FL4C 4YJZL 3QCTH 2DM2A 2E7BA 4Q74A 4G8FB 2P8PA 4PLNC 4GKSA 5DRNA 5ESVA 3LXUX 4M7LL 2EDDA 4AKQA 2X12A 1AGCA 2GIMA 4GQPH 4YUEH 2EUZA 1QO3B 3HC3H 3EYSH 5GGVY 5AQ0A 4N90E 5FA3A 4KV5F 1UXSA 1FO0L 2GTWB 2VZTA 5EUOF 3IJHA 2R0WL 1RJYB 2WTRB 2CPCA 1M71A 2E9IA 4J7RA 2QFPA 3TBSA 1HWGB 3MOAL 4DGYL 1FUNA 1TU2A 2VLKD 4X5RA 3S5YA 2AQTA 5MI0B 4DKTA 1KPRB 2TSBA 5J0BA 2HFEB 5JPNB 5IY5B 1PS3A 5IZ7A 4L1SA 1LP9B 5I1GH 2R9HC 4NYLB 1NJ9B 2P9RA 3SPIA 1S7UB 3S88L 1O7SA 2RA1A 3T3PF 5GRZA 4AIZB 2XXFA 4Z95H 4AT6A 1VFBA 1EQWA 5EEYA 2DMKA 5LXVA 3U7WL 4GAYB 1FH5H 3LPWA 1LWJA 3KBHE 1CG9B 1EPFA 1XD1A 5ERWB 2XZQL 1QLEB 4P99A 3ATBA 2ED7A 1B2WH 3EHBB 3EYSL 5AD0B 2BSTA 5DJ2B 3TU6A 2X9YA 2JJVA 1WWWX 4LCCB 2ZD0A 1G94A 1Q0YH 2XN9B 4M4RA 2JCCE 4KO7A 3PRZA 1DE4A 1TO4A 1WTGT 5KJRH 1KB9K 4X5WB 5KOVC 3FFDA 4TULH 4UDUA 5DK0B 4U1HA 5K9QI 1IKNC 1RJZB 3NT0A 3WIFA 1U58B 2C34A 3WUWB 1U3NA 3JUZA 2PMZA 1NWOA 4Y89A 1QFPA 4ZMZA 3VFSB 1Y07A 3BT2H 1OPOA 3NCJH 1F4YL 2VE6B 4N9GB 5EA0L 2G0KA 3CVBA 3WXWH 3OJMB 3HI1B 3VD7A 1KUMA 3O81A 4O5LH 2G3MA 5E6SB 5F7AA 4F3FB 5I19H 2HKHL 3NDYE 4DW2H 1YQ2A 4YL4A 4WTWA 5IEKB 5FYJL 1S9VA 3IJEB 3N44B 1MJJB 2BFGA 1U8KA 1AY1H 2FHBA 3MZGB 1CK0L 4PLJD 4K9JA 1BA9A 1KELL 2OL3A 2EH7L 3GSUB 4PJ7E 3WN5B 3VGBA 2UX6A 3BKCH 2DI7A 4Q52A 1FFNB 5CINL 5T1LD 4UT6L 4MXVE 4Z7QE 1OSYA 3ZL4H 1SOQA 1NGQH 3NJGA 4QXGH 3MLSH 1BXAA 4PJBB 43C9A 5HDWA 1S7UA 3IDYC 4ZFOL 5IBLD 4CN4A 1SFHA 3HUJF 4KU1A 5IMLB 2X2JA 2VH5H 5HI5C 4PCTA 1P4UA 2CAKA 3NESA 3OAYH 3I6LD 2NOYA 2YAMA 3ZE1E 1QAWA 3KPRD 4WFFE 4Z7UA 4ZSOE 4WWNA 2JK5B 3C2AL 5I15L 4L8BB 4Z7WF 3BOVA 3IRZA 4WWPA 4B9ZA 3ARFD 3LEYH 3T0WA 2IALB 5FKAB 5BUGA 2KZBA 3WUWA 3BIAX 5ICZA 4L1LA 1A21A 4KDTC 2Y22A 4Y9FA 1X5ZA 1EHNA 3T0XA 1AP2A 1XH0A 3B7UX 2PF6A 4L37B 4X6CB 1GOGA 5KJ4A 1MWAA 1NCDH 3F5WB 4TKWA 4HD5A 1KBGL 3UTOA 1A7OL 1O7DE 1SXCA 2AJVH 3B7TA 4GI8A 1VFUA 5FDWB 5T1KA 4AV0A 4Z6AT 2R2HA 1PZCA 1Z32X 4DPBX 5ERWA 3C60B 3SPCA 3MV8A 4DKFH 3NN8B 3KLAA 2AK4B 3DSFH 4OCYH 4JR9H 1N67A 4JDZB 4MX7A 4HG4J 5KYYB 1F8TL 3DTXB 4GUPB 3MJ9A 2W07B 5B3SB 1SRDA 3CTTA 1F4HA 1UH3A 2FBOJ 3MV8E 1GGCL 2PPCA 2AXGB 2K7QA 4G6MH 5F1OB 3HMWL 1BQLL 1OK0A 3QPKA 1JHKL 3V0WL 5FR3A 4JZJB 1CDIA 2CPUA 3IJYA 4ZX6A 4HSCX 3I6LE 3QR0A 2ITFA 2ODIA 4U3SA 1FVCB 4OKVB 1FV1A 4PJ6A 3LQZB 1IGFL 1OAQH 2IPKB 5CZXD 3QJFB 4ZUUA 4JHZA 4UDTA 5GGVH 1JD7A 3UIYA 4I4WB 4ATTA 1PY9A 3SDXE 3V7MA 4DPAX 4AE0A 4NWTL 2HTKC 2RAMA 1J0ZA 5ID1A 2VO8A 5J3HC 1UZGA 3K2IA 4H4NA 5HPMA 1FFQA 5DS8A 1KIRA 3C6LC 1S7SA 2M2DA 4QHUB 2C9PA 5KSBB 1AE6L 4Y5VA 4XNAA 2YKLL 1N0XH 1G9ML 1ORSA 4LL9A 5T1DH 3WS3A 1NCCL 1R1CA 1J8HE 1BF2A 3EFFA 3UAEA 5CGTA 3STZB 3NTCL 3RBGA 1ZXQA 4Q6IB 4XWGH 3HPLB 2IG2L 4O2EB 2WLMA 3O4LA 3S35L 1EHKB 4GAAA 1PGRB 5J6HA 3QRFM 4LCWD 1QFWM 2C9XA 2F54E 2EKSA 2H0PA 3QDMB 5LBSA 3TM6A 4NQEA 5B38A 4EXPX 4PGDA 4ENED 5E2WL 1JZ2A 3H8NA 3D8MA 1PY4A 2NT0A 3H9SB 3FT0A 3TJEL 4PFEA 2F54A 2E9BA 4M1CC 3SBPA 1QFUH 1IIIA 1SJHB 2Z1PA 3M07A 3UTPE 5H8DA 1RY7B 3NUKA 4Q58C 1QVOB 4XB7A 2F1EA 3LQZA 3RJOA 3WIHA 4XGZB 3ZDZB 3WN6A 4FQCH 2H32A 2QTEA 1HKLL 4WF7A 1RJZA 3C8KA 4WW2F 1EFXB 4ABQA 2AKRB 2C26A 2YS4A 3SD2A 3SBWC 2VXSL 4P2CG 3PF2A 3MV7A 5MERB 1LE9B 1HHJB 2MCPH 1VHPA 1ACYL 1JWUA 2ZCHH 1DTUA 2GJ6D 3BD4A 2YQ3A 1A3QA 2X9WA 4FJ6A 4GKLA 2M8XA 4PJXB 1A4AA 4GQ9L 5AVYB 4QOKE 2BNQD 1XF2A 2H9GA 3HNTL 4QHUA 3RZCC 2QADC 1E27A 4N8PA 1NCAH 4PJ8D 3GSNA 1ZLSH 2D0GA 1JGVH 4ZXBC 2KDGA 4NFBA 1KTRL 4LLVA 5DJCB 4HSAC 4MNQA 4NRZB 3W11D 2DJMA 5ACLA 2NQCA 4JAMB 4IRJB 4OM1H 3SD5A 3CBKB 1TG8A 2BO0A 5AW5B 5MEPB 3RFRA 5D2LF 3VG0H 4PBDA 5I0ZA 2XQBL 4L0PB 3VFVA 2X7LA 1NC4B 4NM4L 1E2VA 4KC3B 1XZWA 2FCBA 2BVPB 2IWEA 1EHXA 1OM3L 5JR1L 4M9PA 2V2TA 4DEWA 1L9RA 4P2OC 3QC6X 3IBOA 3IMVA 2O6PA 1MZYA 2A6IB 4NPKA 3POHA 4DVRL 1RVFL 4WI2A 3MCLH 2EDFA 3NZSA 4JPIB 4P9MH 4PRAA 3HCVB 4C56B 2X4NB 4PRNB 1W0YT 3GMLB 2N4IA 1DFBL 3GMMA 1KCWA 2FLMA 3KBFA 4PRBB 1H3PH 1X5AA 3OKNA 1GC1L 2WCGA 4P4KA 3EGSA 3GTTA 3NK4A 4N0YL 4QHLA 4JRXA 4Z7QF 2FGZA 1RLBA 2EDRA 2QPUA 3MRIA 2EH8H 4IRJC 2OYKA 4P9HH 2XN1A 2CO1A 2ZOUA 1AKPA 1PD0A 2HG5A 3LZPA 4XE5B 4AV5A 1T5XB 1DJGA 1OWRM 2VDQH 3CZEA 3ILQC 4M1GH 4JG1L 5EF2A 3MO1B 1HH6A 4LBEB 4TNVK 4LCYA 3GHBH 5FV1L 3VYPA 5BZDA 5C7ZA 1OM3H 1RZKC 1EMTH 4OT1H 5BJTB 3ENEA 1A7RL 1AR2A 1KV3A 1DBKL 4AKOA 2J8UB 1DBAL 1BVZA 3N1QC 3MCKA 1PG7L 4V2CB 1MIMH 3DGGA 4FYTA 4LPWA 3IJYB 2BW5A 1BFVL 4U3CA 4YH6A 3IFNH 5C0GB 4AGLA 4Z7WE 4LARL 1USQA 5C0AA 5HVFB 1E30A 1IKNA 3CN4A 1BYOA 2XWCA 4R4BA 4ZTOH 4HLJA 4GKNB 2WZAA 4PRID 4UV4H 5K9KB 5MEQB 3H9ZA 4J3SA 4PV1C 4JFTA 1ZT7B 3N06B 5HI5D 3U7YH 4WNJA 3HG1A 1V7ML 2W9EH 3TBSB 3RZCA 3LRMA 4BFIA 3FL7A 3AGWA 1BVLA 4MQ7B 4PJCE 2G4GA 4JG5A 1UFUA 2MCPL 3D5OF 2CDGB 4WI0A 1BD2B 4ONGH 2Y5TA 2V5MA 5D5MB 4DO5A 4ALAH 1IM3B 2EDTA 1LO2L 4A7GA 1CD1B 3OR6B 5C08D 4AVJA 4DO4A 3O4OB 2VN3A 2B20A 2H1LM 4Z7OF 3OMZA 3BZ5A 1MWAH 2HG5B 3N41F 5IHUL 4JKPL 3KJ4B 4TPRH 3WEXA 3L2MA 4LEOA 3EBGA 2H1PL 4NKDA 4OJAA 5AD0A 2O6EA 3PAVA 3ULUL 3BVXA 1VGEH 3JTBA 3WNNA 5EHFA 4YHKL 3MLTB 4WDIB 1RKRA 3MKKA 2V8LA 3MCKB 5F96L 1J0IA 1B4JL 4ETYA 4GW1A 2PXYA 3TN0A 4IU3A 2J8OA 1N7ML 3EFDH 2OI9C 3KE0A 4OSUL 2X6BA 1LLAA 3MRBA 3DDGA 2VERN 3WG7B 3TOPA 2VDPL 2NY5L 4IRZA 4KVPA 2JJUA 4ABVA 4O02A 5E2JA 4D9RE 1S5IH 4N9OB 4I85A 3C6LB 2E75C 4LL1A 1XIWA 1NM9A 1EFQA 4UT9A 5CD5C 1PZDA 4PH8A 4P2QD 5FHBL 3D4ZA 4BYHA 1K2DB 4KVCL 1YYLL 1G4RA 4HALA 3PXJA 4CVZB 2R2EB 2P8LA 2XBDA 5FM5M 2O26U 3ARUA 3F7KA 3LHPL 2QFRA 3GZOA 5EG6C 4S1RH 2UXGA 5KVFH 4X42A 5EV7A 3P3UA 3QO1A 4X50A 3OHMB 1WISA 4N2KA 4Q9RH 1CB4A 2C7UA 43C9B 2XV0A 1E7UA 2XPZA 3UGEA 3LIZA 4MNQD 4XTRD 1LE5B 1Z9SA 3V0VB 2B9AA 5E9DD 5F7WC 2Y25A 2X2UA 2PKDA 4DCQB 1A22B 2W80C 3KYKH 1S78D 3G6AA 4IBWA 1QEWA 4NKDB 5EO1A 3X1EA 4ZNEA 4M6NL 4LCWE 2E76C 1CFTA 3QQ9C 1MW1A 1K9TA 2X3AA 2YMOA 5DD1H 3VQLA 5HBBA 2G3XA 4ZTEA 1MI5D 2X4TB 3WFBL 5C1MB 1SQMA 5FYJD 3N40F 1OCRB 4PVNA 4MD5A 3QDJE 5I1JH 4C4BA 2NNFA 4XXCA 1J1OH 5FX3A 2EYSB 5EU5A 3B1TA 3AM8C 1A3RL 4ZMTA 1GGIH 5DRZA 5ETUB 5GGQL 3VX1A 3TIEA 4KGJA 5I8KH 1E90A 2FWOA 5CJBA 5HDBB 4HIJB 3SDYL 4OIAA 2W91A 4L3EA 5FAAA 2XTLA 1AE6H 2YRPA 3JWOH 4YIQB 1DUZB 1WAEA 2FSEB 3VFPB 3B2UC 4R4ND 2PPEA 2FB4H 3EGXA 1R34A 2CWRA 4E9WA 4HV8B 1DQTA 1U8NB 3OX8B 2KERA 4APQD 4GFXA 3QIWC 5F7EH 4YUEL 5IK3A 4UANA 3T65A 1P7KB 2JKSA 2P8LB 1A1NA 5CO1A 4OF3A 5EULV 3MYZA 4CNIA 4XXCC 1WBXA 1S3KL 1G9NL 2A9ML 1UQSB 3FTUA 1I7RB 2K6WA 1KXVA 5C3IA 3UYRL 5DZNA 2P4AB 4NN5C 5IREA 1LVEA 4U6YA 4E0RA 5AKRA 4XOBA 2ZUXA 1UZ8A 2YEZA 4HUUA 5DJZB 2NX5A 4XVSH 1KGIA 1LO0H 1TCMA 2AJXH 3FUHA 4ZW7A 1UH4A 2EEAA 4MJHA 1ZD6A 5EU7E 5IB2B 3B2MA 5DA0B 1RH8A 2WLJA 4GT0A 4J3OH 5E94B 2AK1H 2DQIH 4ADGA 2WINB 3U7AA 3FUMA 4BRJA 4R7NA 5D2NC 2WGNB 4Y2NA 3DHUA 1IV8A 1D5IH 4OLWL 2WXLA 2F1AA 4M1CD 3FUIA 2VNCA 4MAYD 5EOCJ 3L1EA 4Y19D 2NUTB 2WQSA 3PDGA 3EFOB 3IMWA 1UZ6F 4JE4B 3RWEA 3V4VL 1PFOA 2IDSA 2ZX6A 1U4FA 3REVA 5IQ7H 2XC8A 4ZJ9A 4JE0A 3D7PA 5HVWA 4XNYL 4IIZA 2NY0D 2OM5A 2VN4A 4WUUE 1FNSL 1WC7A 2VZOA 4NKIL 5BO1L 1F58H 3C9NA 3SE3A 2DKSA 3BUDA 4N2NA 2H3KA 2EACA 1AAJA 3QJHB 4KZ0A 4XCYA 3DECA 1I3RA 3GMOB 3O2DL 4QXTB 2VXTH 4IRSA 4WFFD 3HBZA 4GBXC 3S3BB 4I4WA 5C0DB 3ARGA 1O6VA 1VEPA 3NPSC 4LESA 1G7PA 3NIFB 4AW4A 1N5YL 1IBGL 2BNRA 1L9SA 2VSCA 2IADA 4FHKA 4ORZC 3U83A 2NDGA 4E9TA 4M6OH 4ONHA 5F93C 3DJZA 1JXFA 1HHHA 1DJWA 1OP5H 4D0BA 1UZ8B 5DJZA 3G5YB 2OMZA 3IFLL 3UZQA 3L7FB 3NEOA 5HYJA 3U0WH 3P9LA 3FO1B 3HE7A 4XZ4A 5LG1A 3QQ4A 1YPZF 3EJCA 5EOQH 1FNAA 4D9LH 2WLZA 1MUJB 3IDUA 4AGPA 4EZJA 3VD9A 3VD0A 5J6GB 3D34A 1LO5A 4MWFA 4DJMA 3EBAA 5D1ZA 1N0LA 3CMGA 4QO1B 4NQSA 2ATAA 5AVVB 2JH2A 2F53A 4P2OA 4RFNB 2I5YH 4YPGA 1FHNA 4M8VA 4JFQA 1JRHL 3FCSB 4RMUA 3DURB 4GS7C 3SCMC 4F5CE 4HUKB 1QWNA 4POYA 3UTQB 4M43H 3C2AH 2VDNB 2ZAGA 2F19L 1VADB 2CKBL 3F6JA 5DEJA 1TZAA 3MRPA 1N59B 3GHBL 3HFFA 1R0AH 1RPQA 1DQJB 2GBVA 1X7SA 3IDMA 5JPMC 4R90L 5CJOH 5C6TL 5CFHA 1LK3H 2R1YA 3D3VA 1DBKH 2P80D 5DJDA 4TVPD 2VXUH 3II3A 1LO3L 1UACH 3VNYA 5ECJE 5DZAA 1UWFA 1JWMB 5GZOC 2CK0H 2UXFA 3MLYL 3PGDA 1OCOB 1XT5A 3B9KD 5IR1A 2MNUA 1BQSA 3D51A 2A83B 3L5WA 1J1PL 3O6LH 1MVFA 5F0MB 2IGFH 4Z77B 3AXHA 1BVKB 3RVXD 2IVFC 1UOLA 4TSAH 3TONA 2WIIA 1AGFA 4YHPB 4BFBD 4IU2B 4F15B 3DXAD 5ENWA 4HFUL 3HMWH 3UL4A 4AOFA 5KVGH 1MFNA 1A6WH 5DUBA 2HT2D 2DQJL 5I6MA 4IRJA 3CVHL 2X2YA 4G11A 1UD4A 3OKYA 2Z7ZA 4FMVA 5DSCB 2EDMA 1P6AB 3D4YA 3OHXC 4JB9H 4UYQA 3G08A 4DH2A 2IH1B 1ETZB 4PGBB 2A9BA 1OL0A 3ZX1A 3DIVA 1A14L 1Q72L 1IMHC 5DUPH 1QKZH 5SWZD 1AXSA 3M1OA 5I23A 3ILDA 3EH2A 1JZ7A 1FRGL 1QACA 1DVXA 1MRFH 2YJQA 2AZAA 3ARDD 3EZJB 4BXVA 4C83A 3O2DA 2OZNA 4NZFA 4W6YB 4XI5C 5FYLH 4MAUL 4Y8AA 1M7DB 4YXHH 2FATL 4Z7VF 2XN9D 3MRHB 4WAFA 1JMXA 4MJID 4P5KB 3QO0B 4HC1A 2E5EA 1WT5C 1W6LA 3LPFA 3UBGA 3UTTB 1J9SA 2WXIA 1NIBA 4PRDA 3OC8A 3IAGC 3S3PA 2B59B 2IBZX 3BPOC 2YXVA 1CFQB 3A6CH 1SOXA 1KYAA 2LU3A 4Z7VE 5E6IB 2WYZA 3BVNB 3EH4B 4CL7A 1LNUB 3CC1A 4PJDB 4QYOA 4HUMB 5JZ7D 4DNLA 3K5SA 3FK3A 3KPRB 3IRCA 4JM2A 1JPGA 5AAPA 4S1DC 3EYQC 2CIKA 5K9KA 5MEQA 1QRNE 3B37A 3P02A 4MNGA 4I0KA 5E08L 3X13B 2FIKB 2X89D 3QUHA 1PCXA 1N10A 1G7JA 5GSVA 1MFAL 4JJ5B 4QXGL 6FABL 3MFGB 1ID5I 4YX2L 1MHHA 3DXAA 1KTLA 1H3GA 4KJWC 4X9BA 4DWHA 4G1EB 2YLHA 5LGYA 5HGHA 4JFDE 1YMMA 3AG2B 2KI6A 2X4UA 3P77B 5JIHA 5B7MA 1RD6A 1BGXL 2ORBH 4KK9D 3VD4A 3FUFA 3QG7L 5EU6A 4GPVA 3L9RB 5IJKA 1YNTB 2QADD 1HAUA 5ALBL 5T3ZD 5IJDC 2E6PA 5ISZE 1ZA3A 3VFWB 2DQDL 3GSRA 5HYEA 5DVLA 2MOVA 5F7DB 4XBGB 4HFWB 4LLMA 2B15A 3WI9A 3WFCH 2D9CA 2FE0A 2P52A 1BXXA 1YY8B 2GY5A 1XBRA 2ATKA 4FG0A 4FZEL 4K94L 2Q6WA 4LSPL 1M71B 2I7SA 3GMQB 1KXQA 4WDIA 3DVNA 1AIFB 2R2BB 3BSGA 3D39A 1Z9OA 2MOQA 3C08H 4MMZA 3VRLF 5EPMA 2ZOKA 4FG6C 1KN4L 4WGKA 4E9LA 4PJ7A 3X11A 4F9PA 2NYYD 3QIUC 5JNYB 2EDWA 2OMNA 1A0QH 5GS1C 3LEVH 2WZ6A 2KZWA 3KYAA 4ZUVB 1J1PH 4X8JB 3RIAK 1KJ2L 1NCUA 1MNUL 3BE1L 4X80H 2CK2A 4DFIA 1YEEL 1XDTT 4Y16B 3FONA 2YUZA 4OZIA 2WLHA 3KL3A 3TA3D 3V9FA 4MZ3A 4BD4A 2V3EA 2N7BA 1KZYA 1HYSC 5J1TC 3K4AA 4OJDH 3DJRA 3RVTD 1JOIA 1OSZA 1N0LB 3JV0A 1NKOA 2E59A 1JNHA 4GUPA 1ILSA 4ZFFB 1P4BL 5IKCB 3M8OH 1ZT1B 5CEYB 4YPGB 1UD8A 3BQUD 4LSVH 4MS8C 4XC3H 5I16A 3QDGE 4M00A 5E99H 1R9FA 2CLVB 4DUVA 1PW3A 5E6ID 2QVFB 5LDSA 2AQQA 3ARGD 4IGBB 1P5UC 4P06A 5D1ZD 3HB3C 2XRAL 3SGEH 1TJMA 1JF1B 4P04A 1NDGA 4NHCL 5E8DH 2JWYA 2CRIA 3FSOA 2GTZB 3DJSA 3R0NA 4I77L 4Y9BA 4ZO6A 4JFYB 5AYUH 3RNQA 1KWKA 4PWIA 2AABL 4Y9GA 5F7UA 4MAYB 4BSVA 2XTJE 2Z7UA 3FT3B 3MRRB 5I30L 4RMTA 4XN8A 3W2DH 2F5BL 4F1ZA 5AG8A 3US1A 1SYVA 7PAZA 3KL0A 5EFIA 1DEEA 3VMNA 3UZVA 4HIXH 1ADQA 4ZUVA 5D4IA 2CGRL 2MQ3A 3O0RH 3ZU8A 3OJDA 5ADPH 4X5QA 5DU7A 1AR1B 4W9IC 4Y5VB 3H53A 1U30A 3NSXA 8FABA 2F68X 3NEXA 4H13C 2ENJA 4XOEA 5G4NA 1ZHLB 4AKPA 3BW9B 2HFGL 5I8CA 3SE8L 3MXWH 4UI2A 4NC0B 5ITBL 3GO1H 3A4DA 1JERA 2HAZA 4R5TA 4XAKD 2O30A 1XCXA 3HHMA 2A73B 5E8NB 1D7FA 3T0EA 2XTJD 2CD0A 1KCBA 4M62L 3GKWH 4K3DL 4M8RA 3ZKMD 1QHPA 4ZFGL 2FO8A 1CI5A 1NL0H 4M6OL 4HPYH 1SXZA 4JHUA 1IGYA 4FX5A 1PZ2A 4UILL 1TTFA 5F8RC 2KC0A 3SCMD 5IGXL 1JZ8A 2XG5B 3S8WA 3E3QC 5KZCB 4OGXL 1ONQB 4PWJA 1XHHA 4HETA 1ZVHA 3GRWA 2BM3A 4KKCD 3VGEA 1QNZH 1QP1A 1CICC 4WV1C 1NQBA 4EVNA 3LNFA 2IH8A 2R39A 4AQZA 5JOFB 5KS9A 3AABA 5IESH 1T6WA 3HZYB 4JO2L 4QYOB 2YPLA 1IGIL 1NEZB 2E8ZA 2JE8A 1KENH 2ESVD 2OTWA 5CN1A 1T1XA 4DGYH 1WD8A 3K46A 4YDLC 5E56A 4L18A 1E27B 2L8AA 1KDIA 2P43B 5ICYA 3MLZH 4MJ5A 4B41A 1ICTA 3H42L 2OMTA 1X9QA 2H2SD 3LPPA 4NX0A 1BQHG 3SO3C 4TUOA 1FYTD 5KTEL 1RFDL 4WQOA 2WGXA 1Y0LB 2UZXB 2OK0L 1J8KA 5H37G 1K8IA 3OWEA 5C92A 3MREA 2Z93A 4X99A 1KYFA 3IF1B 1U3HB 1EHLH 1LMIA 3TT1L 1OGTB 2JSFA 2WKGA 3QZWB 1TJIH 2F2HA 4X6FB 3QDJD 1BAFL 2BX5A 4PY7B 2FLBT 1AZVA 1UYWH 1D5BB 4L8CA 2HYMA 2IANB 3DMMA 4N0CC 1KBVA 1B9ZA 2L7UA 5IESL 4L4VA 4J4PD 3ZZLA 5DEFA 3HW7A 4Y19B 1Q94B 2N59A 2Q6WB 2VLJD 2WXHA 3QNYB 3TS8A 3W1ZA 1XXDC 5BMFH 5KN5B 4IBVA 1T04B 3L3HA 5JHDE 1PTZA 3Q1EA 2GT9A 2J88H 3HC0A 1T7VA 2BY2A 3NK3A 2HFEA 4X6EB 4EI6B 2YKLH 4MJ6A 4ZAKA 1MAJA 4OFDA 3EW3B 4OUUA 4EUPG 3VWKA 3PWJA 1L0QA 1NDMB 3S98A 2LU5A 4Y2DC 3T6WA 2JIXA 3D69B 4K0OA 3VE0B 2OMYB 2X1QA 1E9OA 2G2RA 4QI3A 1X5GA 1HZHL 1JSYA 4NNPL 3FW6A 1A7OH 5DJ2A 5FECB 4X6DF 4X98A 4F8PA 3W56A 1ZT1A 4FF9A 4I48A 3T0BA 4RBPH 3IAPA 3B2DC 3PPSA 3BZEA 1R5VB 4M5SA 2HPTA 1E4XH 4QRPD 3X1NA 3QUZA 5FK9B 1ZLUH 5C0FA 1NEUA 2L7JA 4A39A 2BOCA 1XIWD 2Y6TE 5D5MF 2IANE 3QDJB 4M3KB 4M43L 4HAGA 3K2UH 4AX3A 4YMPA 1TQVA 1LK2A 3VD1A 4HXBH 4IGBA 1WH0A 3T6VA 1MXGA 4L4VB 1L0YA 3CHSA 4PP2A 4TVUA 3T8XA 3U9WA 1MJ8H 3VXOB 1F6FB 4KK5C 1G7MB 2PO6C 2PXYD 3CDFA 3JV4B 4WENB 1T89C 3QUYD 3MRPB 4HKJB 1AZCA 1NIEA 4M7JL 3S48A 3DI3B 2Y2YA 3GC3A 2G30A 3KWXA 5BZWA 4UV7H 3QI9A 1QZNA 3QUMA 3P40A 1M6OB 1EERB 3WTYA 4YDVB 5ESVB 4ZTPH 2H1PH 2WNWA 5FOBA 4YHNB 2YD2A 5I6LA 5CP3H 4WEUD 4NUPA 3VG0L 1SJXA 3F7VA 3B6SB 4X8CA 3K2UL 1FBIL 5KTEH 3F7YA 4G7RB 4EOWL 2FBJL 5F9JA 2MHAA 4ZS7H 1DQQB 4G7YH 4KOBA 4FRWA 1BM3H 1NAML 1KEML 3AREB 4GXVL 1PNDA 3RZCD 4MXQC 4JB9L 3QYNA 5TQ2H 1CBJA 1URIA 2ZSWA 3K72B 3KYMA 5DYFA 1BD2D 1ZA6B 2EXYC 4ZW6A 5FO8A 2VLRA 3J27A 5T1MB 3KEDA 3HNVH 4G43B 5IW1B 3FTVA 1MVUA 3F05A 1UWXH 4QMEA 2SEBA 4PJ9C 1FPTH 5BW7C 5ALCH 4GAYA 2QMJA 2VRQA 3KAAA 4EIBA 4ZMNA 4BZ1H 2XQYA 4QOKB 5LVEA 5D55A 3V9CA 1NCBH 2YFOA 3BZ4A 4UYPA 5EU4B 2O5YL 4FNRA 3SPJA 2F7IA 3QYCA 3I02B 3EJPA 2DL2A 3C6SB 1HZLA 3PNWB 2D73A 3KJ6L 3MFFA 4N6RA 3V4PL 5TE7H 2BHYA 4L05A 2M83A 3OXRA 4CSZA 1NCHA 1KCSL 4KY1L 4AEIL 2GVYA 3K3QA 3SHSA 4N8CH 2ETWA 1I7ZB 2G3NA 3RB5A 4UTAH 2F74B 4HIEA 3QJUB 2X4SA 4KHXL 3CSBA 4BHUA 3L3OB 5C08B 4FQIH 5KYWB 2APSA 4PJDA 4KI5C 2WUCH 3FUNA 4HIHA 2JB5H 4XODA 5IB5A 1FZKA 5EU3B 4U6TA 3S4SA 5BW7A 1N8OE 4MNGB 3U9UA 3P4NB 4KNTA 2Q8BH 1KEGL 3BQUC 1KJ2A 1ES0A 1BG9A 1R3LA 2BSSA 4X4KA 4PJ7B 2BVQB 1D5BA 4OCXL 4L8CB 4OCLC 3K72A 2F5BH 1U8PB 2NY6C 3C09B 3KYMB 2F8OA 1JK8A 3IXAB 2ICWA 5DHEA 3IGKA 3QEQD 3FTZA 4R8WH 1VCAA 5FA4A 3KHQA 5AW1B 2FSDA 3HJEA 1FN4A 3CQPA 1BW8A 3JTTB 1CO1A 1D5MA 1HX0A 4NERA 2PNDA 4RWHA 1FLRH 3B7RL 1JV2B 3MV7D 2CO6B 3EGXB 1U6AH 1WAAA 1XV8A 1SBSH 3H56A 5E6YA 1KG0B 3OHXA 3N42B 4DVBA 2I26N 5CWSB 3MNZA 1DJXA 5D93B 2C9QA 2F5AH 3DI2B 3CPLB 1ACZA 4N6RB 3QI9C 2ENPA 1QBMH 3GZPA 4M3HA 5B38G 3VFUA 1R3KA 1IJNA 2WVVA 3DSFL 4OCYL 3UOAB 5JQ6L 1KMGA 1M53A 3QJOA 1XH3A 3DX7B 3K0WA 4JKLA 2FJGA 5DD6B 2BNQA 2RCSH 3I75A 3CZKA 3V52H 4TUJB 1B4RA 2X4SB 2Z64C 2BFVH 2PO6A 1JVLA 1CF8H 1FYTA 1ZRUA 1AO7D 4PJDF 4IDJH 1UEMA 1I9IH 3F2LA 2MEJB 4G9FE 4MNGE 1KLGA 2Z31B 4JKWA 5IB2A 1IBHA 1BFSA 4FNPA 3CCHA 3QT2A 4R3SB 4W9LC 5C0BD 1XGUB 4KXDA 3CG8A 4KH2A 5DS2A 4GSQA 4JBSA 1URLA 5D70H 1CLYH 3S7GA 2K4AA 5DJ8A 3VXME 3QRLA 1E9PA 3U6XS 3QDJA 1QQDB 1A6UL 3O6KH 1GIGL 1KGCE 1P5UB 4OM0L 5HDBF 4PJHE 4EPSA 4MA8H 2A6DA 1MCRA 4ZMVA 4EQ2A 4NENB 4YXHL 3VXOA 5KAQF 4XCEB 2HRPH 4LAQL 4L23A 5FGCB 3HTLX 3Q2WA 1O5PA 3SCMA 1KC5H 3FB6A 4DKAA 4UAOB 2FJUB 3ZIYA 1NWPA 4RAVB 5F7YC 1JFQL 43CAB 1MEXL 4JFPA 1JXJA 5BS0D 1NGZA 3L1OL 4WY7H 3QG6A 4CBPA 3PIQA 1NFDE 3LNGA 5F6HI 1ZDQA 3G5VB 4KROB 1ZWIA 4Z78B 2WCPA 3EYVA 3MRMB 1I1YA 3O3UN 3BLBA 4NZDA 4QJ5B 3O3DB 5T3ZL 3SPGA 4LNVA 2VR7A 4ZS6C 1JPSL 4OLXH 4HH9A 2UY6A 3WKPA 4AQAB 3I9AA 1P1ZB 2PWHA 2J12B 3DBXB 2CIIB 3ZHKA 3RIAF 5E9DE 3HE7B 3LKOB 5C09E 4H40A 3B7YA 3DMMC 3QAZC 3KBEA 4JFOB 1L0XA 1O6SB 1IAIL 1GGIL 3SYOA 3WIAA 4F8TA 1G7HB 1WIUA 3MV8D 3MRKB 4E9YA 1EFXD 1GVIA 3OKNB 3FQTB 2VLRB 2XPYA 4FQCL 5CWSA 4B7IA 2JKNA 5MP6H 8PAZA 5TF1L 1AGEB 1WBXB 4K55A 1BWWA 3FTGA 3L1FA 1FSKB 3CFCH 1VGKB 3QPQD 2AAVA 4WHYG 3CN1A 3R1GH 2PR9A 2YEZB 4HUUB 3HC3L 3MKGA 1VADA 3A67L 3UZEC 4TUOB 4HS6B 5I1DA 3QQNA 4NBXB 3MX0A 4R7DB 1G7IB 3UG3A 1DJSA 1JAEA 2FD6L 2J8UA 3KZ8A 3CC5B 1KB5L 5AVUB 4UNIA 1MPAL 1E2ZA 4CGTA 1Z9PA 3CCHB 1Z0MA 3IPBA 5EOTA 1LWRA 1SLWA 1Z0NA 3MRJA 5D4QA 2BNRE 2VN5A 3V4LA 4L8SB 1CICA 4WV1A 1P2CB 4NUGL 1DBBH 4KROD 3OB0K 2ZKHL 1I1YB 3OL2A 1Q38A 2WZPA 2IALA 5I1GL 1TTCA 1NGWA 1O7VA 3VFNB 2N1TE 3KCWA 1D9KD 2EE0A 4I18B 4OJCA 2PWGA 4PJGB 4J6IA 3ZTNH 2UWEF 1NCCH 4YFDB 2GUOB 2J1KA 4NCC1 2HRLA 5I0WA 1D5ZB 5IF0A 5GS1B 3P0VH 5IHLB 4E5XG 3NABH 3A67H 4Z0BL 1PG7W 3RDTC 1TMQA 1T1ZB 2WXKA 3IGUA 4Z5RB 2VMFA 2WXGA 4E2OA 3WJJA 1FG2B 1QKZL 2C3WA 5AWNL 5DGRA 3EDDA 1AOHA 4H8UA 4L1HA 1HQ4B 1P5VB 4LKCA 3P4OB 4ZFQA 4NQCB 3KWUA 4MA1C 4PW4A 1M56B 4QT5B 4ZOAA 3FQXA 5I8EA 5JPNC 1N26A 4AUUA 3FB8B 4LAQH 1KGWA 5AYUL 4TNVF 2V3DA 3O45A 2EC8A 1A4KA 1TT6A 1EAQA 2ARJQ 1E6OL 3UC0H 3UCRA 4KJPC 3WV0A 1RZPA 1JRHI 1BPLB 1CLZL 1A9BA 1OZUA 4GBXA 5F3HB 3WIHH 2DM7A 2OMUB 3OKDA 1X4YA 3V2AR 1Q1JL 4KQ3L 5J5EA 4JVUA 3MRHA 4ZS7L 5KBMA 5EB9A 3RRQA 2AXJA 1BEYL 4JPWH 4JLRA 5DS1A 3D0AA 3FF7A 3I2CL 5J6GA 1UKTA 1G1OA 1PU0A 3MLUL 3Q2LA 5JIMA 1GJIA 3MNWB 2YXWA 3T0AA 5F6IC 1V27A 3HKZA 3J2PA 3KR3H 4ZFOA 4AIXA 2NY6B 3BWAA 2VDLH 3DX0A 3CVHA 3BP4A 3RWCB 2EABA 1EZVX 2A1WH 2I24N 1P7QB 5FKPA 1C5BH 1OAKH 1RUPH 4W9HC 1D6EB 1U8KB 1IGJA 1VRSA 4H20L 2VAJA 1OE3A 2X4QA 3MUY1 4UNTA 4CW1B 1IX2A 3M7FB 5EWIH 1A4JA 5GHWH 3TFBA 3TCLB 1QWUA 2FQEA 1ED3B 1TZ8A 2VMCA 5LG6A 1FIEA 4K8RC 4BM7A 4CMMA 3JUYA 3V5DB 3FO9B 1T66C 1FO0A 1YA5A 1TQWA 5LB1A 1N2RA 2EIKB 2QKIB 3ZDYE 4HWEL 3PP4H 4PAZA 2XZQH 3TT3H 2C3VB 3F7QA 4CC4A 1HOEA 1D9KC 1QR4A 4IOSD 1CFVH 2R83A 4RFNC 4IGBC 3FB7A 3RTQA 5L0QB 1T83C 4O00A 3RWFA 5I0VA 1QEWB 5EZJB 4Z7UB 5SWZA 5CN3A 5IVOA 4LCIL 3RA7H 4TULL 1QRNA 3FBQA 1UATA 4HHAA 3ARFB 1R5WA 3QB7C 5CSGA 1EK3A 2DN7A 3TN0C 2OJ1A 1F6AB 5JHAA 4U1GB 1HHGB 1P6FA 3FO2B 4I0PC 2BIHA 1CR9H 4N0UB 4MMZC 1JD9A 1SF5A 1MN4A 3AB0B 3GJFA 5T1MA 4P3CH 3G08B 1E6JL 2FUQA 4FFVD 4FS0A 2DQIL 2WQAA 3LN9A 1IBBA 4EIZC 2I60L 1X6LA 1KCUH 4M7LH 1IEHA 5J12C 3HRZC 1N18A 1JGLL 2DIBA 4KMQA 2IWGA 4APXA 3M8OL 3B8YA 1A3LL 1D6EA 2NY7L 1T4WA 3VWKC 4TTDD 4AC4A 1NCTA 2NY3C 3F8UB 4FQ1L 4GG8B 5CSZA 3GGWA 3VX0A 3FU3A 1P7KA 4UUJA 1DCEA 2HB0A 3QDGD 4HIPA 3MN8A 1ZHKB 2AS5M 5TGBA 1L6PA 3GSOA 3V6ZB 3CDGA 4PRPE 1CQKA 3TH2T 1FO0B 1HC1A 2QPSA 3MRBB 1PNCA 2VL4A 3MNWA 5J56B 3MRNA 3QYMA 4RFOH 4BZ1L 2J2ZB 4XP6L 3LZNA 2GITA 2VXTL 3PHSA 4LF3B 5HHME 4BUQA 1K4DA 5E2VH 1C5CL 3TCXA 3VXQB 4ADIA 3WY1A 2YO3A 2YOAA 1DVFB 5BV7L 2NT1A 5D2NB 2A6IA 1B0GA 1FNGB 1KXQE 3UJJH 2X38A 1JIBA 3HS9A 4KKPA 2DDQL 4O02L 4N86A 2Q8AL 3HUJE 4XP4L 1HE7A 4PCSA 3G04A 4CW1A 1BVNT 5E2UH 3N1MC 1EJFA 4FKEA 1X7TA 3GS0A 5DS8B 5C9JB 3IEAA 5TH2A 2YD9A 1TTRA 32C2A 1GS6X 1NCDL 4W81A 3VFRA 2I9LB 4Y2OA 4S1SL 2IPTL 1IQDB 2AFNA 5AEAA 3V0VA 4IBTA 2V9QA 1OK8A 2VDNL 2XJKA 2NZ9C 3GRWH 3TJPA 5SX4I 2NRDA 3MTXA 1INEL 4Q6IA 5M94B 2ZYSA 3WLBB 1ZPLA 2B77A 4CC0A 5D96C 1YEJL 1FIGL 3MODL 1YLBB 4NC1E 5FFOA 1TTGA 1W91A 2KQMA 2F53D 1KY7A 3KLQA 4GW4B 2I7OA 4J3OG 4LNRB 4LPTA 5HGAB 3WFCL 2VJ0A 4G72B 2Q8AH 5I6OA 3TBWA 1SN0A 3V6ZA 4EI5C 2XBTA 5DZLA 3ULVL 2WXOA 4N0RA 3QRBA 2K45A 3CQFA 3D0LA 4IS6B 4LASH 4M5ZH 4M7ZC 4OVUA 5BUAA 3JWDL 4ZYKA 1JHTA 4PI0A 5CFAA 3EOBB 2FL5B 4NZ8A 2H4EA 4O9HL 5HYJD 2PETA 4GBXD 2IAMB 4JM4H 1DVFA 3P2DA 4OJFL 4FI7A 4GY4A 4P3WA 3B5TA 4XN5A 1Q9WB 2ADJA 2X4RB 2ZP8A 5IFHH 4LCYB 4IKKA 2B4CC 2CR3A 4ZPVA 4BWTA 4P59L 5JYLA 2D0FA 3H55A 3GDCA 4ZX5A 3ZHDA 5AW2B 4PLKD 4S1RL 5KVFL 2R0KH 2B3IA 2V2WA 5TGBB 3ZTJG 2XA8H 1TQCC 5IQ9A 5H4YA 5K93A 1RUAL 4WEBH 3MLXH 1BQHB 2DKMA 4YQXL 3F64A 3P2BA 4NSKA 1TZIB 2XN9E 1I8UA 5L4MA 4YOKA 3QIUD 1N59A 2AAAA 4XWGL 2QSTA 3C5SB 1T22A 3SE9H 4XN4A 1HL8A 1UXWB 1GYVA 7FABH 3ZYIA 5KVDE 3RNKA 3KLKA 3EH5B 2K8MA 5IVZB 1N19A 2ZYRA 4NDMA 2ZKWA 5CILL 4O4YL 4E9VA 1SXSA 2VDPB 3LPOA 4BFIB 4RBPK 4JUTA 5K9JH 3VGAC 3G5VA 3C5JA 5G5DB 2Z4QA 1BF5A 1BQRA 2X44D 1P5UA 5JYMA 2XN0A 3MV9D 2XVGA 1UM5L 5E1IA 2VLJE 4BK5A 4B7LA 2YAQA 3ZRSA 1RERA 2J6EL 4L3ED 3UBXI 1F4XL 2WBXA 1UHVA 5AVWB 3A6OA 4B53A 3A23A 2AGJH 1M9WA 4O02H 5HJBA 1UD6A 5EH1A 3FXIC 5I8CB 4ZPVB 4HKZB 3HPJB 3PQYA 3WIIL 3PHOA 5GGRA 4AIZA 3SPHA 2WBKA 4ODHH 2J56A 4ZNEE 3KGSA 5CZVL 2CDEB 2JCCB 4APQA 3RFZA 4AIEA 3MAWA 4APXB 3WNIA 2VDNH 2H2PD 3H54A 2DYPA 3HOGA 4D0BB 3D0LB 1Y18A 2J71A 4IS6A 3ARVA 3ZTCC 3U2SB 1YEIH 1S5HB 3PGFH 4G6FB 4ENZA 4JHVA 1QFOA 2NXZB 2KMWA 3RIFF 1GYAA 2NQ3A 1TKWA 2CSPA 4FFVC 4DCQA 1JPTH 4JPVL 4WRLA 3ZW3A 1ITCA 2GSMB 2HVJB 5LGJB 2ZXWB 4H1LH 1SGKA 3I2CH 1JI1A 2K3TA 1UGKA 3OMAB 1JV5A 4B9GA 3FFOA 1AGEA 5CZKA 3O3EA 2VMEA 1FAIL 3CXDH 3DURA 1IAKB 1A1MB 4RNRB 2HPOA 3IJEA 3Q8EA 1E43A 1J5DA 1TCRA 3BUTA 5J6SA 4XNZB 2V5TA 3BQVA 4NOBA 4DKFL 2FWOB 4OZFB 1DQLH 2B8OT 2CNYA 3U4EB 5I1DB 5CIPA 4AQ8C 1LEGB 4LLQB 3RHWF 1NOFA 2EVIA 3GTVA 4JDEB 4YHKH 3QA3A 1E50A 4LQFH 5E00A 5E9NA 5D1ZI 3L4ZA 4N2CA 3IMSA 2OTUA 1J48A 2NYYC 3MV11 3OR6A 3VRIB 2ZXCA 2IAMD 5DK3A 1EUTA 1UB5A 4JNXA 4JY4B 5DQJA 3OAUL 4JFHD 3EYOA 4BZ1A 5C0AB 1KCRH 1JG9A 1J18A 5IT2H 2ENYA 4PRPB 1A9EA 1DLFH 1R33A 2CH8A 4K9EL 4LHQB 3KDPB 4LQ1A 4Y1AE 3BN3B 4UNVA 3F7YB 3N42F 4LSVL 2AMGA 4I18A 1V8HA 1L3NA 5ENWB 3AM8A 3QIUB 4HJEA 5B1JA 1JUFA 5I1IH 1THCA 4OB5H 4MYWB 3F6IA 4L3AA 4KKZA 4JGJA 3OLIA 5GRVK 4I5BB 4MASA 2GBTA 3U0PB 3QORB 1EEYA 4HWBH 4UOW0 1BLIA 2E8YA 4YLQT 4G5ZL 5TK2A 3T9WA 5IW1A 3EHBC 2R27A 3KH4A 3NZUA 4BSWB 3U25A 2APVA 2DQ6A 4EEEA 1RJLA 5B39B 1HCFX 2A5UA 4AXWB 1JFQH 3HG1D 4XPHL 1IU1A 1JXGA 1JGDB 1RURH 2DQUL 3EF7A 3KPMB 2WZ5A 4NM4H 5C71A 3PV6A 2WWNA 1IIKA 2J21A 2DB8A 2X4RA 2ADJB 3O45B 1L9OA 4WO4D 3ZL1A 3NN8A 3TO4C 2MCMA 3DOSA 3MUGA 4X5XB 3VJ6A 1V3KA 4QCIB 2DICA 3KCPB 4LEBA 2HH0H 4ZX4A 4AMWA 5E08H 2C7FA 5E9AA 1KYOK 2AI0L 1U21A 1ND0A 4N2HA 5BVPH 4XP1H 3RPIA 3QEQA 1UH2A 2AKRA 4Q9CA 5FK9A 3PGCB 4G6AD 4A38A 3ARBC 4HF5H 2HJKB 4Y9EA 1FFTB 4YSPA 1KPVB 5IBTL 1TNMA 1VB9A 2AITA 1NAMB 4H8VA 5E5LA 3PGFL 3CHOA 1RZJL 4UMSA 3F12B 4JDTH 3WTXA 2IDTA 4W9JC 1FAKT 3GSVB 3FQWB 4P9HC 1OAXL 3PAZA 3A6BL 5I8OL 1FVEA 2IDFA 4L9LB 4GO6B 3LKPA 4DUWA 3QQDA 3T71A 1MIEH 3KDMA 1U42A 4GUQA 3HS0A 1CIUA 4XO9A 3WEAA 1LQBC 4DP0X 3HBQA 4J3UA 2UWEA 4K7PX 4GRMA 3X3FL 4S0HA 1QRKA 1A4CA 4FFZH 3MA7A 3GUTA 3G6JA 3ULSA 1CLOH 1G7PB 1SBSL 5D7IB 4MB3A 4NQDE 5IFAL 3FFCB 1O5DT 2XVBA 4OZHE 1DJIA 3LOWA 3FCSA 3QXAB 3S6CA 1W72B 4RAUB 4PBWD 4EDWH 4ETQA 2B1AL 4CRPA 3RE0A 3T65B 5EBMA 3P30H 3QJVB 1OAUH 3A22A 4LRNH 5M95B 4G8EB 1FBIH 1UQSA 3CIAA 4F9LC 1TU2B 3ASWA 1LO4H 3X11B 3FOMA 3MRQA 5C97A 5HHQA 4Z7NF 3OAUH 3VQ1C 2JI2A 3MGTA 3SOTA 4Z23A 4ZMWA 2QJDA 4Y1SA 3TIEB 1QBLL 4M5ZL 3MLWH 2QADB 4QGYA 3WNOA 5E7FA 1CLYL 4PEEA 3FJTA 1UURA 1MCLA 3KM1A 4P23C 1UT2A 4XMUA 2LLGA 2ZUSA 3MR9A 2BWQA 3ARGC 2XQ0A 3QHFH 1KCLA 1JV5B 4OI7A 1OGAD 4JK0D 4IRSC 3IVKB 4AI7A 1PEZA 4FLSA 4NHCH 5HVHC 3QR2A 1S7XA 2AQ1A 3S4SG 4A04A 1AACA 4LL4A 1DQDL 1G9MC 1GPOL 3TBVA 1C8PA 5DHVA 1VDGA 1S7TA 5F1IA 3VWJA 4XNXL 1PJWA 4U1JA 3L5XL 3FHEA 5MHSD 2V0AA 1ODUA 2B39A 1N5AA 5KYNA 4RX4D 1X44A 4HJSA 1W6WA 2I85A 5IFJA 3QDMD 4HWZA 1UCBL 1NZRA 1PZBA 3BCFA 3HE6C 1RP9A 3V0FA 4C57C 3UAJA 3AU1A 4U1NB 5AOKA 5LAXB 5HJ3A 1CVRA 4QXTA 4KHXH 4X7EC 1G6VK 4ANXA 4FZ8L 2FAUA 2PYEE 2QSVA 4L8BA 2WANA 1U8QA 4Y19E 3QDAA 2I69A 4LCWA 1LEIB 3VGGA 5F7BA 2YR3A 3L9BA 2BIIA 3LNHA 1YEEH 4HH9B 3N40P 5EC2A 4JG9A 5IOPA 5A16B 5H2BA 3T3PB 5ACZB 1CD1A 2H45A 1O9VA 4Y2OB 5AUMA 4C56A 1G5GA 3GSNL 2ISDA 3O3AB 2VQUA 3VXTB 2IAMA 4JCLA 3B7SA 3PWPA 1R5IA 1UFGA 2HFFB 3QQ3B 3QWOB 3KWWA 2NR6C 1TSHA 4KX7A 3WE6A 1Z2KA 3FQ2A 1HJCA 1X5KA 1LK3L 3QORC 4W9FC 1VFAB 1SY6L 2KZ1B 5SX5K 15C8H 4CVXB 1MHHB 5HVGB 4X4ZA 2ICEC 4YSDA 3V5KA 2ZF8A 1IEBB 3KMDA 1NFDA 2PTTA 3P3SA 5CJXC 5F1IB 1X5JA 2EEXA 2FHCA 3TXAA 1G6RA 4TLSA 1DQVA 3EAKA 4L8SC 5SWQA 1FL3A 3NFPA 1PDKA 4XAWL 3T2NL 3KG5A 3L4CA 3MDJA 3KNBB 3RKDD 2D03L 1RZFH 4PU2A 1K72A 1PKQB 4L1DA 4LHUG 1EJOH 5D7SH 3QZNA 5INCB 4XMZA 3QWQB 3LPGA 2RGSA 2RH0A 2EYRA 2EDOA 1YY8A 3QAQA 2J1WA 5E4OA 3DRQA 3M1BA 4PJIB 2EDKA 2J8HA 4AG4L 3V7AG 3WXVH 4G2AA 2WUBH 3ARDB 3HI5H 1O0VA 3ISWA 4O2FB 5F9AC 2DYPD 3B9AA 1AJ7L 3B1UA 1USZA 4DK3A 2EO7A 3CLWA 3V10A 1ID2A 3Q7JA 5E2TH 4MCZA 1KWGA 4N2GA 3V6OC 4ABUA 2GSIA 4IBQA 3VXTA 2PW2A 3W82A 2LTQC 1N5AB 3EO9H 2J5WA 1QMUA 4GUOA 3FFCE 4UTBL 1AXTH 1J11A 3BVTA 2LVEA 4WIQA 5D1XB 4JFFB 4DTGH 3ABZA 5ALCL 3U6RB 1XTMA 2HCZX 1GPOH 5AAMC 4YAQA 3EXLA 3L48A 4PGDB 4R5VA 3MGOB 3D39B 4NKOB 2CMRL 2ICWJ 2QPDB 5DJ0A 4G71B 4LCUB 2GW5A 5AOMA 3HN5A 1WA2X 1QHOA 3KJ6H 3O41A 4F7MA 4PMEA 1CGYA 1AG6A 3L08A 3CX5J 1AQDA 2F1BA 4R90H 1E9QB 1X5HA 4ZQKB 3SKMA 5IHHA 3K74B 4PW9A 1OQXA 1R47A 1TQSA 3R7QA 5KN5A 3QO0A 5TD4A 1OANA 4J3OD 4IU3B 1R24A 1XF1A 3QORD 4P5TD 3EO9L 4A68A 5AFAA 5I71C 5TTRA 3RX9A 5I1EH 5AB2A 4OUUB 4JQVC 1UXMA 1MKFA 3GBLA 1QFUL 3T0ED 3T0VA 2IGFL 3TYFA 2A74A 4XNQB 5I8KL 1XWVA 5DMIL 4BK4A 3HIZA 2R56H 1RURL 3RB7A 3HS0C 5JW4Q 1HEJC 1F45A 1TVHB 1F3JB 3IFPA 4I2XA 3O2VL 4NQCE 4GXUM 1S5HA 2O5XL 2Q7YB 4KRPC 1KIUB 2VXSH 4U4BA 3UACA 1M1SA 1U3YA 5JHDD 2X70B 4HGWB 3BKJL 3BWSA 3KEHA 4GQRA 3ZT6A 2PN5A 3ETBF 3NIFE 4P5KA 4DGVH 3I85A 4HWEH 1EEUA 1E3FA 1PYWA 3GJFH 1V5JA 5IWLA 1PKQA 2YMXH 3BW9A 2ADIA 4ZNCD 1TJIL 2B1HL 2IO5A 2LQRA 3ECUA 4PI2A 3HNSL 2C9AA 3ARBA 3QDHA 2D0HA 3TA3A 2PUQT 1QSEB 2P7TB 4GRLD 3UYPB 4PYGA 2GABA 5J1SC 4Z3IA 2Z65C 2XCMC 2YPKB 4PJXA 1DEEB 1RUQH 4PP2B 3T8XB 3ECVA 4BZYA 2UY7B 4HS8L 3LCYA 3AACA 1G7QA 4CVUA 5D6CA 1L9TA 4POZC 1CE1L 2XU9A 3I9PA 4OQTH 2CKNA 2K4WA 4QRSB 1BP3B 5JIIA 3B83A 4PRBA 4MB4A 5E4EC 2NW3A 3CAFA 2H47C 4K71B 4Y4HB 1I8KA 1VKXB 3O3BB 3GIZH 1X5MA 1JGLH 5B8CB 4XN9A 4WLCA 5D9SA 1NJ9A 3ZE0B 3AB0C 2BJML 4GRLB 3K8MA 4FXKC 2Q2EB 4WI8A 3ARRA 4P9ML 3H7BB 3V4VA 4ZUSB 1TMCB 3ZTJH 3ASNB 1DANU 3E8UL 4FMKA 5T5NF 4KJYA 2CO6A 1YMMD 4NAMA 3PY9A 1FJ1A 5C0RH 1NBVL 5I1CH 5CD5D 4XN1A 4AL8H 4MJ5B 3IJHB 4ZFFA 3GMQA 4GQZA 3S5LB 4K71C 3AREA 3ZL2A 1MW3A 2AXFB 2JTDA 4G5ZH 1MG3C 3NCFB 4RZKA 1I7RA 1UM5H 3GMMB 1HWHB 3MC0A 4IKNA 2VJ8A 3PGCA 1T6BX 4XMKH 2DQJH 4XBPA 1JXKA 4M6AA 2OL3H 1BIIB 5TE4L 5TE7L 4X8XA 2ZWKA 3RDTD 5JHLA 4HKBB 3ECWA 4XZUA 2NLJA 2VSMB 4JFQB 2DEXX 5FKPB 3X1FA 3Q8FA 5JXAH 3OV6A 4B9CA 1R3IH 2UY7A 5CLWA 5B7EA 5HYIA 2IQ9H 3ZUNC 2YQ2A 4GKZB 3DIFB 3ET9F 3WTSA 2YPVA 4D3CH 1F2XK 1XCWA 3TEUA 2ZOLB 3LEXB 5IM7B 5DUJA 1EGJL 2DL9A 2OJEB 1R75A 5JW4N 4Y8DC 3ARDA 2X9XA 2VKWA 4WW1B 2B2XH 1THAA 2CO7B 2OMBA 3DX9B 4FP8L 3DGGB 4K3DH 2BIQA 3P2TA 4PJFA 5FGCE 3THMH 5LUMA 4OGYH 1KGUA 1H8OA 1MCSA 1UOVA 3HZMB 4JFDA 3L5JA 4X6DE 3NA4A 1GKEA 4YDJA 4KTEH 3VRLE 5IMLA 1J05A 1GZQB 2CKBH 4JKKA 5AKSA 1ZHLA 4XP9H 1EZLA 1I3GH 1ZJBA 4KJYB 4YPJA 1DSYA 5JMOC 1ILUA 1PMYA 2MPVA 3PP4L 1BVKA 4HJ0C 1DN0A 3QFGA 2IOMA 2A6KB 3NABL 1FNFA 5IEHA 5DT1L 5EEUA 1T04A 3TO4D 1T0NA 1H3UA 3RFZC 1GYWA 5CP7A 2RR3A 1ZCRA 2JMRA 2DIEA 4HIIA 5C07A 1IGIH 2G60H 4UM8A 5E9DB 2AXHA 3FN3A 3F01A 2XG5A 4RMSA 5AKTA 1IZKA 3ULUH 1Z6JT 4P3CL 4B95C 2YQBA 1KIPA 4PSRA 1AFVH 3APMA 3UTPD 3P9WB 1SBBA 2DQCH 1LO4L 1SN2A 1LM8V 3UO1H 5JA8B 5IT2L 5T1DL 2YGVA 5FDYA 1B9KA 3AROA 5F7FA 4LSPH 4IHOB 3LQAH 4FULA 4HCIA 1F02I 3O0RL 3TN0B 5IP4A 1CT8A 4F2FA 3SQBA 2LOEA 5BZWB 2AJSL 4Y4FA 4IRJD 2FLRT 2Z0BA 5PAZA 1E8XA 3MGTB 1IGFH 5E2WH 1AS8A 1MCWW 3UAFA 3WL9B 4JPQA 3IDMB 2OBGA 1ZLVK 1C5BL 1OAKL 4R7LA 2FX9L 4JN2A 5I1CL 5C0JB 2DMBA 1OW0A 3JSSA 5I1AA 1FH2A 3ULUF 5DJDB 4RWYL 1WGOA 1U3HA 3VW3H 5HP5A 3QARA 1FGNH 3L7EA 2VISB 1CFBA 5ISZD 2BVEA 2G2PA 4G3YH 2IFGA 5IVXF 3WIHL 4RGNB 2NXYB 1AY1L 2A4CA 4CVWA 3TYGL 3F85A 5IGXH 3LRGA 1EXGA 3SO3B 2XY2A 2ZUQC 3KL5A 4U0QB 1D5RA 2C7UB 4UAHA 2F58L 4HT1H 5D7IF 4MVBC 4EJ1C 4NPYA 5MENE 2UZYA 5HI4C 5T5FA 2XOTA 1W2KT 1QUNB 1CI3M 2CHNA 2DAVA 1EDYA 1CFNB 1WBYA 3O4LB 1N6QL 1I8KB 3LQAC 3T3MB 1NPNA 5FEBA 3SDAC 1CFTB 3LZOA 3CZGA 4OFIA 3ARSA 1IAMA 2BHZA 4MQTB 5BZXA 2Y7NA 2QHRL 3AT8A 4MHHG 1XX9C 2F61A 2WXNA 1CU4L 4EI5A 1H3VA 2ORBL 3RWIB 3FQXB 2BS71 4FERA 1NFDB 5I8EB 3SGJA 1KIRB 1FHGA 5TF1H 2UY6B 3IETB 4ONFH 1MCJA 2XBZA 1HNGA 4N2DA 5CR8A 2Q5BA 5AVQB 3T0EE 5B8CC 1Y7VA 2GK2A 5CCJA 5MEOB 3U7WH 3HZKB 4HIXL 3FONB 5AZEL 3WKYA 1COBA 3SPVB 4J28A 1W8EA 4NJAL 1TZHA 4MLIA 1NC4D 2WQVA 4U49A 5KYWA 3EXJA 4PJIE 3BZEB 1W80A 4FFZL 4DVRH 1JBJA 2X4OA 3TV3L 1YEFH 3I9IA 3FT2A 3APCA 3K5RA 4P57B 2XUWA 1MH5B 2X6VA 1CFQA 5JDSA 4UCFA 4PJIA 5DFWH 4CADB 3LEVL 3PQYE 4MA8L 1WAAE 1KJ2H 3BE1H 3ETSA 2WWOA 4IHOA 5A2AA 3VDAA 2G9HB 4JL1A 4P59H 5GZNC 2YGPA 3ARQA 3JBG7 3H3KA 1CU4H 1IAKA 4OCRH 2GSGB 3GT6A 1Q8MA 5MENB 1AZUA 3GLEA 3ALWA 3M17A 2VW6A 1CDCA 3DIDA 4U0RC 5FYKU 4O5LL 1ACXA 3MRFB 4P5TC 3AWEA 2NY4B 3K2MC 1AXIB 1CWVA 3KXFB 1A4JB 3TCLA 4QRBA 3P73A 2VLLB 1VJSA 4I48B 3INUL 4NZUL 5AVTB 5I74C 3BKJH 4AQ1C 3P77A 5A2IH 1P4BH 5C7XH 3QIBA 4Z8FL 2GTZA 5T5NG 1DZ0A 4WTXA 4NDMB 2NDFA 2EIBA 2VTFA 3CH8A 3HG5A 5B1KA 3FQ1A 5BRQA 3VFVB 2VISA 2FYVA 4DP1X 1HHJA 3FT4A 1E4WL 3PWNA 1A6TB 4BSVB 5KSBF 4W68A 2BNRB 3UADA 3EYOB 3WNLA 2HMIC 3B6SA 3LXBA 4KZEL 5L6YH 1JN6A 5CGBA 4L4TE 3DETD 1AQDB 3U30B 4DTGL 2VUYA 1VERA 4AGNA 3MBEA 5KSBE 2WTRA 2D4DA 1AIFA 1ZJAA 4MMZB 5J57B 2C4XA 2NX5D 4A7TA 1FGNL 1KPRA 4IJ3B 1YEWA 3GHEH 2HX7A 1KG0A 3DX2A 3ML9A 2DMCA 4R96A 1OAZL 5CEZH 4K2UH 3INUH 2QGEA 1E5UI 3CFMA 2BNUB 4X9FA 3U1SL 1HQ4A 1JZFA 3Q3GA 4GG6B 4MRBA 5L2JA 1YYMH 1TZGH 2IMMA 5B1BB 3ZO0A 4H8WC 4NWUH 4LRIC 2GIYA 3H6JA 1XH3B 3DX7A 4K3HA 1D2PA 4UQAA 2BNQB 3VM7A 1Z5LB 1WFNA