4TS6A

Crystal structure of the rim c2a domain from drosophila.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
b'PIEGRLQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAHHILDDEAEWYQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab3 interacting molecule variant 2
publication title Crystal structure of the RIM C2A domain from Drosophila.
rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ts6A00
1QATA 4Y1SA 4QJ3B 1CJYA 2UZPA 2WXNA 3TJPA 3CSTA 4L1LA 2K4AA 4KITB 2Q3XA 4LCVA 2ENJA 1BYNA 3JZYA 3OHMB 3HHMA 1DJZA 4J6IA 3IM1A 1DJIA 4V11A 4NP9A 3IBEA 3P2BA 2CHDA 3DBSA 4FADA 2QZQA 2B3RA 2DMGA 4BFRA 5T8IA 1E8YA 3B7YA 1DQVA 2ISDA 3MJWA 4NS0A 1RLWA 1DJWA 2CJTA 2WXPA 3ZIMA 3QJZA 4F93B 1W15A 4LDCA 4ICWA 3APDA 4GB9A 3S2AA 4AOFA 1BDYA 4WWPA 3CSFA 1UOVA 2FK9A 4IHBA 3F04A 4ANUA 4QJ5B 1E8ZA 1DJGA 3N5AA 3DPDA 2WXRA 4G11A 1DJXA 3ZW3A 4BGDA 3QR1A 1QASA 3PFQA 5H4YA 3PRZA 3TL5A 1UGKA 2WXKA 3NSJA 2WXFA 3TWYA 3HIZA 3QAQA 4TS6A 4QAMB 3FDWA 4XZ4A 4WEEA 4WWOA 1GMIA 4FJZA 4EZJA 2WXMA 3QARA 1DSYA 3L9BA 3ZVVA 5G2NA 3L16A 1A25A 2A5UA 3FBKA 1HE8A 1K5WA 3PS6A 4TUUA 3W56A 4A55A 2BWQA 1TJXA 2WXLA 2CHZA 4FULA 1V27A 3F00A 2CM5A 3NZSA 2ZKMX 3KWUA 4TV3A 2N1TE 1DJHA 2KI6A 2WXIA 2WXGA 1RH8A 3PREA 4KZ0A 2Y3AA 4GNKB 3L08A 1BCIA 4XE0A 2X38A 4F91B 4WWNA 3L17A 4XX5A 2CHWA 5CCGE 4LT7A 1DJYA 4FLHA 2D8KA 3W57A 3L13A 4URKA 2WXOA 2WXJA 3LJ3A 2K45A 1E7UA 5JHBA 4F1SA 3KWTA 3L54A 3ENEA 1WFMA 4FA6A 3ML9A 4ANVA 5KJ7E 3M7FB 2A4ZA 4L1BA 2NCEA 1E8XA 4DNLA 2RD0A 3T8MA 3SD5A 4AJWA 5EDSA 3R7QA 3HN8A 4FHJA 5H4ZA 3RPBA 2DMHA 4PS7A 1TJMA 4HLEA 2NSQA 2ENPA 3QR0A 2CJSA 3ML8A 4KZCA 4QJ4B 1RSYA 3F05A 1E7VA 4MJJA 4L2YA 4HVBA 5JHAA 4Y1TA 4OVUA 2WXHA 1UOWA 4FHKA 2NQ3A 2CM6A 3APCA 2JQZA 5CCJA 2WXQA 1W16A 3PYCA 4NPJA 2Q0ZX 4JPSA 4F92B 3R7RA 4FJYA 1YRKA 2CHXA 2FJUB 4DK5A 5CCHE 3OAWA 2V4LA 4WAFA 4PS8A 3RDJA 4ANXA 4EZLA 1E8WA 4EZKA 2ENQA 3NZUA 3GPEA 3QK0A 3APFA 4IQHA 3F01A 1E90A 1WFJA 3L4CA 4PS3A 5G55A 4L23A 4ANWA 2YOAA 2YRBA 4OVVA 2K8MA 2LHAA 2QZ5A 4NPKA 2EP6A 2K3HA 4ICXA 2Z0UA 2R83A
chains in the Genus database with same CATH superfamily
2ZCKL 4XP6H 4XXCA 1IM9B 1ACXA 4XO5A 1K2DA 1DVFC 2EECA 2L7QA 3IJHB 4KK5C 1CF8L 1SHWA 3U1QA 5GGSY 4HCRH 1HHGB 1UB6A 2WQVA 3V5HA 4PJCB 3QXTA 1VFBA 1BZ7A 1SN2A 3MLVH 4TUKH 3ISYA 2XNAB 3TCXA 3UTSB 1XIWA 5CNHA 2R2HA 5JOFA 4PN6A 5EO1A 1IVLA 4HW6A 5JW4Q 4ZFZA 3ZZ1A 4YFDB 3W9DB 4H2AA 4QHMB 4HS8H 5ESQB 3ZT6A 2NPLX 2EUZA 4CN6A 5I74B 3HS8A 3BWUF 3LEXB 3GXNA 4QAMB 2WWMC 1HIML 2NUTB 4URTB 2VXUH 3QNXA 3HHSB 4JO2L 1WBXA 2C4FU 1HNGA 5MEOB 1XGYL 3MACL 3VM5A 3VXUD 4RISH 3ZDXE 3QI9B 4N6RB 4GAJL 4AGPA 3SDCD 5AW7B 5EZIH 1F4HA 1KENL 1F6FB 3LH9A 3ECWA 2FSEA 4ODVL 2R69A 3MN8A 1RH8A 2L04A 5DD5H 1TMCB 4GLRI 1BM7A 4IBZA 3T3PE 1JBJA 3JV6A 3SKJH 5I15H 3T4YA 2DMCA 1LK2B 4QWWD 3KWTA 2ATAA 5JMRA 3QQ9D 4FG2A 4KVPA 3HC3H 3JV5A 4DP9X 4AEFA 4PSRA 2L8AA 2Z31B 3VFWA 1KEGH 2HG5B 2NYYD 1XEUA 2CO4A 1OANA 4HLEA 2BWIA 1URZA 3LEYH 4LP8A 2A74B 3B7UX 2PTTB 4NO2A 1ZIAA 3CG8A 4Z3TA 2HSIA 2KPNA 4NFDA 2WXHA 3MV9E 4KTEH 2VAAB 4HAFA 3N42B 3WE6B 5LG1A 3L4VA 3UP1A 4X80L 4NQSB 2BXZA 1MREL 5ERWB 1ID5I 1M56B 4A63A 5HYIA 3KW8A 2WZPD 1F90L 2BNUA 3BVDB 3BGFC 4ZW5A 2FBJL 4K8RL 4DPAX 1RUQH 4RH4A 3AGWA 2F53E 2OX5B 3RA7H 4M8QB 2GSGB 4M61A 4JDEB 4YDIL 1KV3A 2DF3A 3AUWB 5KANI 3VGFA 3F7YA 1P69B 4XB7A 2MQCA 3MBXH 3HFFA 2B1HL 3K6SA 1BREA 2J43A 1VGEH 4NI3A 4N0FB 1J18A 2XN9E 4XNXL 4ABUA 3JXAA 3NK3A 1NANI 3T4AB 1CXIA 1QHPA 2VLJA 2X6AA 4M5SA 2R4SL 4YHOH 3I02A 1IGIH 1VZGA 1URLA 4J3OH 4NBYB 2J25A 5FUOL 4CA4A 5DJ8B 3OSVA 1UM4L 2AI0H 3QDJA 1BQHG 1MCDA 1XD1A 5H2BB 4CC4C 4PU2A 4AQ1B 4IRJB 2FE0A 4XPFH 4MYPA 4OIFA 4RFEA 5TE7H 2NY3B 5HHMD 4F37F 4OD3H 4YAQB 1FWXA 2ENSA 2PWGA 5FW7A 1I3RA 2X70A 5IGXL 4G59C 4YDVA 2PXYC 5DZ9A 4M62H 4F2EA 2ETWA 4TNVF 4MJ4A 3MCKA 4P9ML 5T3XH 1CR9L 3SDXF 2GJJA 2KDYA 4ZQTA 5LAPA 4HJ0C 2IV9A 2VH5L 2AEWA 3ORJA 5HBBA 1CICA 4H1LB 3SN6N 4BQCA 4ZMTA 5J6GB 3ULUL 5GJTL 2VDLH 2VXQH 4U6YB 2Y5QA 2G9HA 3C5JA 4PJHF 1SEBA 1BVZA 3P69A 3WLBB 3S88H 3VWKA 1J0HA 4R96B 1BM3H 2FR4B 3LKNB 4M7ZC 1FNFA 3UACA 1T03H 3CSYB 4GIOA 1BMGA 4U1IB 1I4FA 1BIIB 1RIHH 2L4OA 2XXCB 5F0LB 1WBYA 5HY9B 1I8LA 4AMWA 4AC4A 3F2LA 1RIUL 1OZUA 4IGBB 4I1NB 3BP6B 2KUTA 5GZND 1RMFH 2C1OA 4RFNC 5MEPA 3TWCH 2WYTA 1Q9OA 1S9VB 2ZG2A 1AMXA 1RJCA 1G7JA 5CJOL 1SM3L 5D1ZD 3LZFH 4JFSA 1M7IA 5CSZB 3FSOA 1XH3A 4ANXA 2FO8A 3QWOB 4XNMB 1TNNA 2D0FA 2H4EA 3NRQA 2XWBA 3FQXB 4NPYA 4MXVF 1JZ5A 3ULVH 1AG6A 4RGNC 3NZHH 3GIVB 2QPDB 4QOKA 3K1DA 4XO3A 4O02H 3I84A 4P2RE 3QH3B 2JKIS 5IW3A 5A2BA 3WS3A 4MJIB 1ZOXA 2DQHH 1NCNA 43CAA 4K0OA 2N7SA 3HZVA 1AH1A 3ROOA 4LHUB 1JZEA 3CPLA 3RFZC 2CHDA 3UAJA 3BUDA 2AV1B 1CFTA 3VRIB 1BD2D 1UJTA 3FTGA 2ICES 2YPLA 5D9SA 5KJRH 2A4CA 3ALPA 4FFWC 3HE6B 3B2PA 2AXGB 1UH2A 4XPHL 5EA0L 5I0WA 3MKKA 3GNMH 2BW5A 2A9NL 2CALA 2IBGA 5FYJH 3CMGA 4FYTA 2DL2A 4NQXB 3D05A 5J13C 1QSFA 2NNAA 1C1EH 2XC8A 2P43B 2DRUA 5E6ID 1ZEAL 3B3BA 1JNNH 1FA4A 1A6VL 1TVHA 3VVVA 4R5TA 2VISB 3KPPA 1DZBA 2QVIA 5D1QB 3P4NA 3P3UA 4CJ1A 1TZOA 3MBEA 4MGXA 4WKZA 4WWOA 5I1JH 5FB8A 1MXGA 3DK0A 5DD0L 4H26B 1KGJA 5CBEA 3H9HA 1ZTXL 3OR7A 4Y2DA 5JUEL 3UTZB 2LTQC 2QELA 2I24N 5F7BA 1PX8A 1F4AA 1Q9WA 3U82B 5ALCL 5B4MC 4X9GA 1FVEB 2DH2A 3L7EB 3F85A 3RKDC 4IEFB 3LNGA 5KTEH 1SYSB 2BCKB 3IRZA 5IK3B 1U30A 4A7QA 2X0WA 4YLQT 3DNKA 1HWGB 2BSED 5GGSA 1RU9L 1P1ZA 4PJ7A 5LNEA 1UZGA 5E9NA 4BFBD 2VL5B 1U41A 1E2ZA 5EORH 1U6AH 3FFDB 3L5WB 3RIFF 4WFGD 4N2NA 3RJDA 2R69H 5IEKA 4BZYA 3PL6A 1OSZB 3RG1C 3TT3L 3OAUH 2PO6B 2VW7A 1J8HA 3LAFA 3ML8A 2EEFA 1CE1L 1EQWA 1X7QA 3FQUA 1SYVA 1E3FA 1FL5B 2P8LA 4MZRA 3REWB 3UYPA 2KZKA 3BAWA 2NY2C 2KKQA 5TDPA 1FDLH 4WFHE 4PGBA 4PTTA 4O5LL 4JREB 5E94A 4LFHD 1MFVA 5EBLA 3RWGA 4K5NA 4EN3D 4HV8B 1U8JB 3KNBB 2ZCHH 5C0BB 5AOMA 4N0CD 2F1EA 1DVUA 1VHPA 2J2ZB 2OXGA 3MRCB 4UM8B 1HU8A 3T0EB 3I85A 1YMMD 4B9YA 3KYNA 5FYJE 3FRUA 5D8JL 1F58H 5LXVA 5DUPH 3FQRB 5DFWH 4HHAB 5HYJA 2E59A 1JXDA 3F64A 2OULB 3RDTD 1NWOA 3O6FB 4G8FB 4Q9CA 1QMUA 2Y07L 3S2CA 1KLFA 2IBBA 4JDVB 1S7XA 4TTDC 3M17A 3MRKA 4YHIB 3VRJB 3SOTA 1LO5B 1P84J 1K4CA 3TJHD 3KBHE 4ZUUA 1JGDB 5I8EA 4OCLC 2HJKB 2DQTL 1XGRB 3SCMA 4ZOCA 4GBXA 2DQDH 3B2UD 4YHYC 1IBDA 2DLGA 3ZE0F 3IXAB 1MFDH 1HHIA 3D2UB 3OAYK 2JCWA 1L5GB 1EHNA 3VFVB 2LR4A 1A65A 4IHBA 4B5ZA 3NJVA 4HJJH 1UH4A 2DWEA 3FB5B 4IMLA 4YL9A 4TQEH 1J1PL 5HI4D 3MHZA 5C0CA 3TFKD 3PRZA 3DGGA 3L1OH 4HK3J 5F1OB 3F7KA 1XL6A 3O3DB 4WW2A 1KFAL 2GJ6A 3UCRA 4QEGA 1QSZA 5CLXA 5DLML 2N56A 2X9XA 3GEFA 4RWYL 5IQMA 5IJDC 4XR8C 1S7SA 4G9DA 4WTZA 4Z76A 3QPKA 1E4KC 2C8NA 1AD9B 4IYKA 2OM5A 3SPVB 1XGQB 4H1LG 1BPLB 1NPUA 3I9IA 3MLYL 2CHZA 5INCB 4F3FA 3OB8A 1KIRA 2OMTA 4JPWH 5KVEL 5A16A 3ZL1A 5IHZB 3OV6A 5I18L 3MOBH 4Y2OB 4L05A 4QXGL 5F7HA 3CE1A 4LF3B 4UQAA 1X7TA 3BP4A 3P1VA 4WI6A 1DVFA 1JZHA 3QXDB 2PR4L 3V9CA 5C0GB 3BN9D 2OSLA 1ZGLM 1A3ZA 4MA1B 1A4AA 3ARTA 3SJVA 1KWGA 4FF9A 3Q6GL 4IW4C 1NCOA 1WZKA 1OAZL 4LIQE 3MXWH 4A7GF 2VZ3A 1OPGL 1I7UA 2A38A 3NJFA 5HP5A 4HZLA 3V4VH 1D3CA 3E9UA 4RNRA 3NFNB 3P9MA 4I4WB 5GGVL 3V8CA 1H5BC 3S36X 3MO1A 2VJ0A 4W9EC 3BRDA 1TLMA 4HCFA 4A6YB 5F3BA 2YD8A 4NQCA 3WKMH 5EZLA 3ZDYE 2Y69B 2PPEA 4OGAD 3T71A 2KC0A 1CLYH 5IMOA 3DOSB 2DWDA 2JJSC 4HFWA 4KK9C 2Y7QA 3B3IA 4JW3A 3APMA 1EDHA 1NUDA 4AGQA 4PS3A 1MCJA 3SE4C 5DFTA 1H3PL 1F4XH 4OVVA 4OJYA 1A4CA 1M9WA 1QQDA 4M93C 4LLDA 4OKDA 4MNGA 3WL9A 3C5ZA 1BECA 1GJWA 2BSRA 4LHUG 1MW3A 3UMNA 4ZTPH 2IGTA 1G4MA 2JXMA 1CN4A 4DFIA 4QHLA 2VLJE 2BOCB 1KB3A 2FWOB 2ZKHH 2BNRB 3GLZA 3P2BA 2DN7A 5ALBH 4M7LH 4ABQA 4OCWH 4XO4A 3VW3L 4HA1A 1NFIB 2MKWA 3P3TA 3E38A 3JWOC 3QDJE 1BLIA 2O4EA 3AG4B 3ARFB 3BD4A 3R19A 2EIMB 1XR9B 3V6ZB 4H88L 1DUZB 1BVOA 4X6EA 2C9RA 4C83A 1UWEL 1CLZH 2PMZA 4I0PC 1QBLL 1NDGA 2DBLL 1MFBH 5I1DB 2FHCA 5DSCA 3SBQA 5G5DB 1I1CA 3SDXB 2R29A 4FXGC 5I0DA 1IB5A 3MA9H 4K3EH 4N28A 4PB0H 4AQZA 4GKNB 4EZJA 2ZX9A 4RGOH 5PCYA 4B96A 4R7NA 4Z3HA 1GGYA 1KY7A 4P49A 4OGXL 5AEAA 1VFMA 3QUZC 3WBDA 5FECB 4PJHB 1JV2B 5DDHA 3WTSA 1ICTA 1M71B 2YGVA 1CYWA 4RRPG 5K33A 3F00A 3CVHL 5EC1A 3WNMA 3NJGA 1OQOA 2A6KA 4UAOB 1WT5C 4DKDC 4YWGH 3VXPB 4YZWA 3L5XL 2YD7A 2HMID 4KI5C 4NZTH 3SO5A 5AG9A 3G6DL 3U6RB 2K45A 4IKLA 3SE3C 2QDVA 1LILA 1C7SA 4QXUH 2FGWL 5EH1A 3D5OF 3N6YA 4PJEF 1PMYA 3QQ3B 3QCUL 2YRLA 2K1MA 2X9YA 5DC4B 1VKXB 4MX7A 4EI5B 1M05B 4P2OC 1RKRA 5EDSA 4YEEA 2VRQA 5EMYA 1C12A 4FNRA 3GSNB 2D73A 3MLUL 4QJ4B 5EN3A 3UTQA 2Y36L 3OXSB 1AOHA 1M6UA 4MJJA 3HA0A 1FZKB 5AAPA 3V6FA 4DZ8A 5KN5A 2WVSA 4UOW1 1RURL 4CC4A 2LFEA 3CVDA 5AOLA 1JZ4A 4ZSOA 2CLZA 2ZOLA 4QOKE 1MVYA 1V7NL 3TVMC 2V4LA 3KLHD 3ABKB 1A1OB 4DKEH 3GK8H 3HG5A 2CWRA 5GGQL 3GPEA 4I3RH 1RZIB 2BW4A 1EXGA 4N0UB 1EAPB 3ZKND 1DUYA 1CGUA 1MW1A 2HWZH 3VE0A 4M00A 3X3GH 4MNHA 1VFOA 2YPLE 1XV8A 4L8BB 4PJDF 4FG6C 3LMJL 2CD0A 1DVTA 2UZPA 1K5NA 4ODXB 5CLTA 3B9KC 1YY8B 3T0AA 4PJAF 3PJLA 1JDAA 3PWVA 4FI7A 1PKQB 3DOIA 4ODTL 2ZYHA 3TX4A 2W95A 3BGMA 1U3HB 1QSFE 4FADA 4D0DB 1EVTC 4IKJA 4PREB 4LL4A 1MQKL 5I0YA 4WIQA 3LQAH 5KZCD 5CZRA 2QSTA 4FQ1L 4HYTB 1BAFL 2O26U 4LPUA 1XGPB 2X44D 5CZXC 4BFIB 1TNMA 3MXVH 4YQXL 5FLVA 5HJ3B 3VG9C 5DZPA 2WXRA 5I73B 4WUUB 1TZHA 4U1JA 3GFUA 4PCSA 4U7MA 1JDCA 1JNLL 4GFTB 3CIAA 5B8CB 2P8PA 4ZUTB 3WDHA 2YOCA 4HISA 4X5WB 4P57B 4AUUA 1YEDA 1MXDA 3RWEB 4WHYH 3HZKA 2XPZA 3IPEA 2ZCLH 3EJZC 4K9EL 2FVNA 4L3CA 3ZR5A 1IM9D 2KLSA 3T2QA 1U8KA 2Y6SD 3RB7A 4ZW3A 3S37L 4FQXA 2CBPA 1VFAB 2F08A 4X5PA 4YPGA 4PJ7E 4TRPH 1QRNB 4N2EA 4S10A 3RHWF 2XZZA 2Z91B 1HINL 4CU6A 2BJML 4M6AA 1QO3A 3EH3B 3OKDB 4JFWA 2CA3A 4QRPB 3VXRA 3ZLQC 3D18A 2XCMC 4PM1A 3SDDC 4F8PA 1J8HE 1MKFA 1XL4A 3AREB 1LDSA 5TPWH 2PTUA 3ZDXF 1HS6A 4ZFGH 1HVXA 4YC2B 1TJIL 3RWHA 4WVRA 4NI6A 4FQHB 1E4XL 4JFXB 4PD4J 3MJ6A 4YK4B 5D93B 3VNZA 3G9AB 2G75A 2RD0A 5JO5A 3IVKA 1T21A 4S2SB 3HS0B 1BAWA 3FQTA 1LEIB 3AS3A 5C71A 2NXYB 3MI6A 3OJVC 4EMZA 1NMCC 3TASA 5C08A 1B3IA 1H19A 5CEZL 3BH9A 2C9UA 2DM4A 4MHHI 5HYJE 4I85A 3RGVB 2ZWLT 5SWSA 4K9EC 2QPFA 4K23H 4M1CC 4DVRL 3DUHA 2VITA 3HAEA 1Q0YL 1X9LA 4GQPH 4XP4H 1G87A 4E9QA 3GB7A 1CVSC 1R3JA 4ANWA 4A2GA 5EO9A 3ZE0B 2K8MA 2WO4A 1LO3H 2ZOWA 3T8XA 2QSCL 1F56A 4R6UA 3BO8A 5G4MA 1HSBA 4CU8A 1BZOA 1A7NL 2Z31D 3UX9B 3FYIB 4O9HH 3BWSA 5ADOH 3TH4T 3QHTC 5C0CE 4FFTA 3SKOA 1OM3L 1A0QH 3DYPA 3GI8L 4IK7A 3OKMA 2GJ6E 5TF1L 5I2IA 2VM9A 4XH2A 2HYMA 1B0IA 3NAAL 3SGJC 2V33A 1QTYT 3FSZA 4LHJB 5JNYB 1CFBA 1C5DA 1R34A 2QVTA 4EUPA 2W65B 4BDVB 4AW4A 1QASA 3LDBB 4L1DA 3T6WA 5DO8A 5AQ0A 2JJTC 1F8TL 5HGHA 3AQZA 3BPOB 4LDOB 4R90L 4EIGB 4M6OH 2Q6WB 3QJRB 4TVSa 3PGFH 5A6IA 1GRWA 3W37A 1XWVA 1T1ZA 4PVMA 4KJYA 4EDXA 4FEIA 1OCWL 4HXAL 4WI8A 1F4YL 4W81A 1FFPB 2E7HA 2O6CA 3FF8A 3K2UL 4AENA 3UPRB 2Q1EA 2HPTA 1WEJL 1ZVYA 1UADC 4B41A 4Y5VC 4MAYB 4N68A 4EOWL 3ME0B 5DK0A 1SHMA 3SJVE 3Q2LA 1HIMH 2R29H 1TG8A 5KSUB 2OW7A 4K9JA 4PFEA 4YGVB 2FJSA 5EF3A 1XGYH 2YLHA 2O5ZL 3MACH 2E3VA 3F12A 3UYOD 3HUJA 4OCNC 1AR1B 1BA9A 4Z95L 1KLGB 3H9SB 3V7AG 1JHKH 3WHE1 1QBML 1OT1A 5JW4M 4R4FH 4MVBD 4ODVH 1ORQB 3IJSA 4NQCE 5L6YH 4QRBA 3A3YB 4XBGA 4J1UA 1PS3A 1KJ2B 3FT3A 3FT1A 4MSWA 3MV01 1PSKL 4JPIA 3VU1A 3AAZB 4JK0D 4N22A 4G70B 3PU7A 2P28B 4MNGE 3LD8B 1LO4L 2TSBA 4GAYA 1BF2A 5TDNB 2EDRA 1J0KA 3GT6A 1SXNA 4LLMB 5C07B 4FZEL 2IOMA 2RA1A 3JV4A 3RWFA 5CR8A 1QFWH 1EEUA 3SBWC 1AO7B 3I75B 4ELDA 3BZEB 4JHWL 2DLFL 1FJ1A 1SZNA 1MH5B 2H6PB 4M4RB 3IJ9A 5HYQA 2I9LA 4BK8A 2IIJA 4NDMA 4G8EB 4QD2E 5C7XH 2Q3AA 5KBDA 4DSYA 3WXVH 1KXTB 4FYRA 1QNZL 3F8UB 1E4HA 1JWUA 1F86A 3BUYB 4GRMA 2YMOA 2EXYD 4TL4A 2VR3A 5IROD 2X1XR 4IGBD 4AH2B 1DE4B 4YDIH 5CZKA 1S2EA 1EVUA 3K6NA 5ESVA 2B1HH 4ANUA 1DN0A 3GRWL 1GZPB 5FGSA 15C8H 4PRPA 4HEMA 2YXMA 4ZPVB 3VFSB 4BQ8A 3WCYA 4ZX6A 3OMAB 2GC4C 3FT4B 5DR5L 1AGEB 2ZX5A 2PWDA 3TA4D 1XMWA 4NAMA 1A6WH 5IMMB 3HI1B 2R4SH 3M86A 3TV3H 3NIFF 3G5VA 1DZ0A 1BMWA 2HJLB 5FUOH 3TN0B 3IK2A 4FABL 4OGYL 4PJEB 2M26A 3SE4A 4G6KL 4LHUD 1MY7A 1A4KB 1JPGB 5DHYB 4KKCC 1TTRA 5DC9B 3SDCC 2EQDA 4DO6A 1HAWA 1EX0A 4ES9A 5ABZA 5F0JB 2NW3B 3DHJA 3PP3K 5E08H 1JWMB 3HE6D 2FWLB 1D2PA 1M7UA 2CHWA 3RVWC 3UG4A 5IGXH 3OR6B 1ERNA 1FFOA 2L3BA 3C6SA 4X2UA 3DROA 5AKRA 3BAKA 1JXFA 4Z77A 1JZ2A 2NY0B 1ZXQA 4PB9L 4ZDHB 2DQFA 1S7VA 1AVAA 4ANVA 3MV7B 1JGUH 2VH5H 1YEEH 4XO8A 2GK2A 3MUHL 1RAMA 1DQJB 4ZSOE 1BQLH 4YXLH 1T89C 3MJ8B 5D1QD 4G3YL 4XCFL 1FRGL 2V5SA 4DH2A 5B39A 1IC7H 1BVKA 5GJTH 4I0PA 4Y9CA 5BNXD 5EOCL 4HSCX 5DYOB 2X28A 4Y8DC 1D6VL 2VE6B 4NENB 2Y1YA 4U1HA 3R8BB 1TTBA 3S36L 2I85A 3APCA 4PJDB 1WJ3A 5FM5O 4FXGA 4JFHD 3KYMB 1GW6A 4LL9A 3OSKA 4FLOA 4TM9A 1R3HA 2C3WA 4PJAB 4XTRD 4XNDA 1FGNH 1KCUH 4LVHC 5IMKB 3PDGA 3VWJA 1OSEA 3QRLA 5IQ9B 1NAML 1X7SA 1KB5L 2MNUA 3QUXB 2FHFA 4NNPL 3QUZA 3B6SA 1E90A 3FCTB 2BSSA 5C3TA 5ICZA 2Y7SA 4NGHH 3WFHB 1ZV2A 1K8IB 3AVEA 3H56A 3IN2A 5CFAA 1IBYA 2XN0A 2WXNA 1TEFA 2BP0A 2CBTA 1WT5A 4Y5XA 3MRPA 3HAEH 2BS8A 4MMXC 1CMOA 4H0HB 1U8OA 3GBNH 4DESA 3AGVA 3HLAA 3BAXA 3EIFA 1WAEA 4XWGL 2H0FA 3SE3A 4KRLB 3TYFB 2BY2A 2ATPB 3PQYB 1IGTB 2VO5A 2O6DA 4LL1A 3U0TA 4A68A 2AVGA 1F6AB 4Y4KC 3GPSA 3FXIC 4KVNL 3THMH 3QEGL 2VZ1A 1J87A 4MD0B 4ODHH 5AKTA 1OB1B 3DX6A 3QIWD 3DJ9A 5C0BD 2VL4A 3TESA 1G6VK 3OX8A 4X8JB 2WJ5A 4U7KA 1E65A 3ZQ9A 2LU4A 4PTUB 3UTPE 3BC9A 1KCRL 2YPKA 5BS0B 4KXZI 2A9NH 3LN4A 1N0LB 2HFEB 3A67L 5EZPA 5B1BB 2IAAC 3TVMA 1IQDB 5G2NA 2GITB 3VXRE 3ZDXB 4BFNA 2AK1H 4OD1H 4PG9B 3G7TA 1ZEAH 1JZFA 2BRRH 1A6VH 1D5ZB 3CVHA 2X4NB 2LOEA 4NRXA 5EOCJ 2Z9TA 1OALA 1NGPL 2ORBL 5E7FA 3VFMB 1JTOA 4QCIB 1AS6A 4KH2A 4HUVB 1GZQB 5CIPA 1OK8A 3QAZC 1ESOA 2V8LA 2QKIC 3B9KA 3D2UD 3L3JA 3FUMA 4GKZA 1JI2A 1T6BX 1AHWB 4JKNA 4J7RA 4UANA 3STLB 3MLWL 2XQYA 4U2ZA 2FX8L 5DJXB 4BHUI 4M9OA 4OCSH 1J1XL 3O8XA 3PP4L 1OWRM 2W9DH 1W6WA 2PWFA 4A2HA 3A6CH 4G43B 3MNVB 4FHJA 2C7UA 1V5JA 5SWSE 2C7FA 4GIPD 5KJ4A 5D7JB 1YMHA 3D25A 4AL8L 2W94A 4M7JL 2XJLA 3BFWA 3ESPA 5J56B 4A7SA 3WU1A 3FOMB 1MRDL 1L9RA 1NCJA 3H55A 3KLQA 4UQCA 4DGYL 5GZNC 4EDWL 5FPIA 1Q9LA 1COBA 4NPJA 4PRHA 3K4ZA 3HB3B 5J6SA 2ZF8A 1CG9B 2Q76B 3KPRA 3C5SB 1CE1H 1KLUB 1PU0A 1KYDA 1GZHC 3KPMB 4H8WL 4XOEA 4AVHA 1PQZB 1ACCA 2B16A 3F5WA 3CZNA 2A9ML 3O2DH 5D70L 1MCSA 1IBBA 3EHBD 2WLJA 4ZFQA 1C5CL 3O81A 4RVBA 1DDHA 4O5LH 2F53B 5DMIH 1NOAA 5DJYB 4LEXL 2JTYA 5HHNA 3ILQC 3W81A 1IC5L 3TYGL 3L95A 3HR5B 3BAYA 3BDBA 2YUVA 1OW0C 1ZGLB 3FU3A 4LCVA 1Z5HA 3DX9A 1BYOA 4L8SB 1MCIA 2CKBL 4JUSA 2CQVA 2NNCA 4MA3B 4HWZA 5AYUL 1O7SA 3NEEA 3SHSA 2XN9B 1K4DB 1REIA 4BH7A 4HD5A 1NBZB 3T1FB 3T0WA 4HJUA 3BLPX 5FA3B 4MA7L 3IDYC 2IC2A 3ESNA 2DJSA 1YJDH 2VDQH 5I6LA 1G1CA 1ODAA 1VCBC 4Z7UA 5C0EB 4RDQF 1T6WA 2PR9A 4YDLB 1XMEB 1KFGA 3LVEA 4QTHA 1CDJA 1H8NA 2B2XH 1UYWL 4ALAC 1GC1L 2UZYB 1J0JA 2GUOA 5CINH 3ESMA 5HGDB 1U8LB 1YNLH 2J3SA 4H8WC 1DQQB 4D9RE 1L9MA 5HDQL 4MDIB 1J1PH 5K9JL 1UXLA 3HUJE 1SUHA 1YVLA 3EFDL 3BT2L 1CD0A 1A7PL 2X2HA 2HX7A 5DFVD 3NP4A 1SDYA 2ARJQ 2BNRD 2EDDA 4Y1AA 3KYOA 5DLMH 1MHPL 1ZA6B 3BVUA 3EYVB 4HIJB 4TV3A 1NEZB 1N6QL 1KTLA 3QEUA 3VGDA 3AM8C 5K9OA 4PGDB 3ZUNC 4AEIH 4NQEA 4WJ5A 1RJYB 3ABZA 1DL7L 5DQ9A 3RZCC 5LLIC 2EUXA 4YXHL 3LNHA 4ATWA 4UV7H 4AVIA 4PJ9D 5E5UB 5I8CA 1UJ3A 4WWKB 4LVNC 3DSFL 4Z78A 2ZQKA 1IO4C 2PCPA 1GC1C 3EG9B 3KGUA 3VXMA 2BC4A 2MQ3A 1BMZA 1E2VA 1JSYA 3QUYC 3PAYA 1OAZH 3E2HC 3IDIB 1T83C 4WO4C 2Q9OA 5I30L 2ZUWA 5DQJA 4OI7A 2JQZA 4HBQA 1KCVH 4HKZB 3JWOH 3FUDA 4PBVC 2FSDA 4QNPE 1FFNA 4K73A 2XIDA 2OTPA 3X2QB 1N59A 2ZE0A 1NCBL 3G5ZB 3NSYA 5EIQA 2X2UA 3C60B 4EZKA 3B7SA 3IETB 3FU8A 1ZT4B 2PUQT 5EU3A 3SDYL 4K5OA 5TF0A 4P2RB 3H2WA 2ADGA 3MJ9H 1SVCP 3VQMA 4JCLA 3BEWA 1M3JA 4HH9A 3FONB 1XAKA 3MRIA 4BZ1L 4EI5D 2EILB 2V3DA 3FZUC 2LAAA 3LXBA 4ZMVA 1JK9A 4PRPE 4HEME 5DZOA 1PJ9A 5HVHB 2W1NA 3IGFA 4M03A 5EZOL 5H94B 3WKQA 3MAWA 3CZJA 5DJAB 4FNTA 1Z1WA 1M9SA 3N91A 3NIFB 4JVPA 4RETB 3DV4A 4L37B 1RK7A 4FFYL 1PLCA 2ZCZA 3EF7A 5E8PA 3QB7C 3UROR 2DQ6A 1ES0B 5K39A 5EOQL 4XPGH 2RALA 2LLLA 1PYWA 2P4AB 4YX2H 1BWWA 3ISWA 3DVNB 2V5TA 5FKAB 5KVEE 5MHSE 1O6SA 2DIJA 5FO8A 3DUUA 4HS6B 3QA3A 4C47A 2L7UA 1AQDB 3D85A 4Y9FA 3KDMB 4G80A 3QORB 3RTQB 1FN4B 1VACB 2CR6A 2MOQA 4JBSA 2GAZB 1NJ9B 1SQMA 2ARJA 2Z92B 3BESR 3IDUA 2O6PA 4M1GL 1P7BA 4TUUA 1UACH 4FTVA 1NCTA 3WIFB 3KWUA 2MNWA 3HPLA 3S48A 4MB3A 1JOIA 2XBDA 1DSFH 3RL2A 4OGXH 1JD7A 3AQYA 1IJ9A 3BLKA 3BQUC 1PY9A 4NKDA 1Y6KR 3BOVA 1ZLVK 1E6OL 2V2XB 1WCQA 2VN7A 4FG4A 3UO8B 1VPOH 4YXKL 4E2OA 1OP5H 1CT8A 3BN9C 3CVHH 5IB5B 1RJLA 2RTTA 4NYLA 3ZL2A 3IE9A 5C6TL 3FFOA 4JVWA 4WUUD 4JY6B 4PJ7F 5J89A 1LEKA 2OYLA 1DBAH 2EEDA 3L5XH 4K3GA 1G6RH 4UDTA 5DGRA 4F7TA 2VOTA 5KG9A 4N26A 5D4JA 2QT6A 3G6DH 4EF3A 1ZT7A 2IALB 3WLWD 1FNGA 3OPZL 4FXKC 3PUUA 3O0RL 5F7UA 4L0YA 1N3NB 3FT2A 2XG4B 4K15A 4KKBD 2NQ3A 2ZP8A 4NZUH 3QS2A 4L29B 5DEFB 2JIXB 3EFFA 4X7SL 4G6ML 1KYOJ 5D7LD 3X1NA 2DDQL 1QRND 3MREA 4WV1A 1QW9A 5JIDA 5IHHA 4Q6YA 6FABL 5FW8A 4PY7A 3V6BR 1K2DB 1KBWA 1U8IA 3RU8H 5J9PA 2JJVA 1UB6B 1D6EA 3V5HB 2J21A 3SDCA 3UH8A 1PD1A 1VFBB 1BZ7B 3MRRA 3V55A 3DV6A 1V7NH 4NCC1 4GW4A 1FSKB 4JKWA 4X8GA 3V4LA 1A6PA 5LGJA 1KBPA 1QFPA 1XIWB 3JZYA 2R2HB 4IHOA 5JOFB 3EO0A 1G5AA 5EO1B 2E86A 3GZOA 4C4KT 2GIXA 4ZFZB 2NXYD 1FO0L 4L2LA 3QJUB 3QZWA 4OZ4A 4JN2A 1EJ6A 4DETA 3MTXA 3G5WA 4QGTA 3JTTA 3GRWA 4XBEL 3RGVD 3CCHA 1T89A 1EMTH 2DQUH 3UCQA 4NJAL 1J11A 1WBXB 2FIRT 3V0WH 4BCXA 2EH7H 5LXGL 4LCUB 1V54B 2XX0A 2HVJA 3QEQB 2EKSA 4OCXH 3CH8A 1IBGH 2LU5A 2NYZA 3LY6A 5C0NC 4J3WA 4XXWA 4DQOL 3H6AA 3VQ1C 3QUGA 2PETA 1U8MA 3VXTB 2FSEB 2UX7A 4YFLF 3UOAB 4WW2F 3O41A 1ZTMA 1LE9A 4FJZA 2WM0A 4NN5C 5BO1H 1KG0A 4J28A 1HYRC 3CVCA 3JV6B 2WZPA 4M3HA 4KKAD 3QQXA 2QGEA 3EOTH 5I17A 1MWAA 5B7EA 4NRZA 3SO3B 3QDGD 1JG9A 2FO4A 1EIBA 1F4WH 1UEYA 1EZUA 3FAWA 4K9EH 1JZJA 2B5IC 5M95B 1KOAA 5I82A 5C6PB 4UT6L 4MMXA 3MX0A 4FLHA 3D52A 2VDPL 4G72B 2IBZX 4NO2B 1NMBL 1UEMA 5HHPA 1IT9H 5A1AA 1KDIA 3VSVA 5JR1H 3H53A 3LKSA 4HWEL 4PRHE 5H37A 1H8LA 4AYFA 3CDGA 3FUNA 3QJHA 4XPBL 3KPRE 5C70A 4ZMYA 4X98A 1ET8A 4PWEA 4N0RA 4TSAL 4PP1D 3CAFA 3S98A 3SGEH 1T04A 2CUAA 4FQCL 2APBA 2O5XH 1MQ8A 4PVLA 1GVIA 1S7QA 2JV6A 4MAYD 4HIPA 2CA4A 2J4WL 3GC3A 4BQ6A 1KB5A 4M61B 2VABB 4G82A 2QHRH 3MUGA 4BJLA 2HRLA 3MNWA 2QPSA 3F7YB 5DK2A 2Q87A 1TTGA 2AS5M 3P4LA 3ZY7A 3IS1X 4ZQKA 3P77A 1OAUH 3SPCA 3K6SB 4BFKA 1MSPA 3H9SD 5I1CH 2ZUVA 4J39A 3RX5A 4KFZC 2WV3A 1Q0YH 4PRNA 3CFBA 3E80A 1U0QA 2XXFA 2WN3A 3QO1A 4UYQA 4M56A 5FUCC 4N2KA 4Z7UE 1FV1A 3I02B 4J6IA 5GS0L 4NP9A 2FJGA 1D7BA 3DBSA 3IYLW 1Z2KA 3QDJB 3X3FH 2UWEA 2QSCH 4NS0A 1CGVA 2NY1C 5F7EH 2VZVA 1R17A 3K2KA 4PRIA 3E1F1 1NPJA 2J1ZA 4CKVX 4RFEB 2XN1A 2O30A 1R5WB 3AU1A 4JY5L 1U8PA 4HUCA 3GJFK 5JHLL 5KVDL 1ZA3A 5F72S 1I3RB 1OM3H 3W0WD 3QZLA 2ZONA 2X70B 2IQ9L 2DYRB 3H3PL 3DPBA 3Q43A 4OW6A 4YDVB 4ERSL 5D6CA 4XN8A 2CO1A 5GZNA 2JTDA 3MCKB 1F3RB 4Y1AE 4JO4H 4WJKB 4DGIL 1USQA 5FCUL 3L4YA 2BRQA 3CFMA 1CICB 1QFUH 4XNQA 5D1ZA 1GHFL 1A4JA 4GYBA 5F71A 1HC1A 3P30H 4IKNA 3GDBA 4RESB 4NQEE 4UTBH 2Y6SC 4WKXA 4YGAB 3IF1A 5E9DA 3RIAK 2G9HB 3C5JB 4KJQD 4S1RL 3FU0A 4OTXH 5A2KH 1SEBB 3AITA 3E8VA 1LTXA 4WSKA 3VGBA 1BAGA 1XF3A 4YVNA 1MIML 2O72A 1TENA 2RCSH 3FTSA 5GS0C 1I4FB 1OT4A 2ADJA 1OW0A 2Z4QA 4U6XA 1WBYB 4W6YB 5KW9H 3QCTL 4FL4B 4F2FA 1CFVH 2I5YL 3VXME 1OVZA 1QYGL 2B0SH 4U1MA 1B2WH 3TEXA 4UNVA 2C1OB 5F96L 3ZL4H 2FEEL 5MEPB 3TU6A 2OCFD 4RMTA 2A4ZA 1Q9OB 1ITBB 1CGXA 1G7JB 4FERA 2BHYA 3NTCL 5CD5D 2ZXBA 1XH3B 5C2UB 2H3KA 2HLFC 1YEJH 5D7EA 3DMMC 1SOQA 1PBYA 2ZF9A 2XWBB 4M43L 1Z9SA 5E56A 3TN0D 3RJOA 5HDLA 2VN3A 2VR5A 3LQZA 4HIXL 1ZLEA 2LABA 5IFAL 3OKLA 3WS3B 2EVHA 3DBXA 4FGMA 2VC2L 4N2LA 43CAB 4EZLA 4UM9D 3KPTA 3AADB 3ROOB 2VLRA 3QK0A 2WBWB 3HMWL 3CPLB 1XH2A 3EJPA 3DHUA 1CGTA 1CFTB 2CCLA 3OB0K 3FTGB 2NY0D 2YPLB 4WFFE 5D9SB 1UD4A 2WO2B 3JSSA 3MV7D 1UVQA 1Y1DA 4OUOA 3AM8A 2CKBA 3UFIA 1UTDA 3GMRA 1TJGL 3EAKA 2N7BA 4KH9A 1QSFB 2NNAB 3JUYA 3EH1A 5CZVH 5D7SH 1EBPA 5F3HB 1T66C 1MRFL 1TVHB 2OMNA 1GGBH 3ILEA 3POCA 3KPPB 4KUZL 4YHZL 1HNYA 3P4NB 3HTLX 3FH7A 3MBEB 5DQDH 4WKZB 1PZ3A 4ICWA 5FB8B 5ACLA 1JE6A 1S5IH 2R8SL 2Y4SA 3H9HB 3OR7B 4Y2DB 3TS8A 3N5AA 5ICXA 1I82A 1QSEA 4ODBD 3V8OA 3QUYA 2X1QA 1ORSA 1Q9WB 4WO4A 4F9PC 3AUVA 4KTDH 2YKKA 4YFEA 5E2TH 4LOEA 1MCOL 2EIEA 4FTVE 3MBWB 4MKMA 3VM7A 3HI6H 3MYJA 5I1IH 3B34A 4EN3A 3IJEA 2ICWJ 2WLKA 4NAQA 1KT2B 4NBXB 4PWKA 4ZMQA 1L0PA 3UEQA 4PJFA 1GGCL 5EN2A 5CGTA 3PV6A 4GO9A 4JDZA 4S1SH 5GGSB 3Q5YA 4Z7IA 1P1ZB 1BZQK 4PJ7B 5DR5H 2MKLC 4B53A 1T0PB 1KTBA 2J8UA 1X4ZA 2XVKA 2CHNA 3CDZA 3RDTA 1TU2A 3PQYD 2VDKL 2VN5A 2Z8WC 5IEKB 3MLXH 1JYWA 3PL6B 2AV7B 2GBAA 2RQEA 3LH2H 3W11D 4LHQB 3OG4B 4G6KH 1ILSA 1X7QB 2N3JA 3FQUB 4WI2A 1SYVB 2P8LB 3AROA 3QG7L 4RBPH 3UYPB 3QC5X 1LJMA 2G0KA 5KYXA 3ERXA 1MWAH 5TDPB 1KPVA 4X6FA 3ES6A 4PGBB 4PTTB 2WWNA 2X5PA 5E94B 5EBLB 3RWGB 5DJ2A 5HPOA 4B3VA 5BS0D 2OXGB 3CFUA 4R3SA 2CDFA 5DWUH 3KYNB 3FRUB 4OLUH 4P5MA 4HVBA 2EDNA 3IPFA 3HVDA 3ZE1E 1SOKA 3AB0B 4DGVL 1QEWA 2CM6A 4OCMC 5HYJB 4D7PA 1YECL 2JE8A 2VUYA 5CBAA 4WNSA 1KLFB 2YAMA 1AHKA 1PZSA 3IDXL 1S7XB 5EOCH 3M17B 1CU4L 3MRKB 1PG7W 3MODL 1A47A 4LSVL 1D6VH 1K4CB 1NMAL 3S36H 4RDQG 1FAIH 4MXWL 4Y5YA 1P6AB 5AAWA 5I8EB 2WO3B 1I3GH 1F11A 2R1XA 4GBXB 2VLMD 3KW7A 1HHIB 3LOWA 5ENWA 2JI2A 3GLDA 4K4KA 3D34A 3LRSA 3BQUA 2P80D 4N2AA 3U48A 2DWEB 4IMLB 1A14L 2D7TL 4HUMB 5D7JD 5C0CB 3WV0A 2EDLA 5IROC 4ZFFA 3DGGB 3KL0A 1ASPA 4DERA 4WW2B 3QHFH 2QV4A 1JHLL 3LKRA 2GJ6B 1CLOH 1KN4H 3OMZA 4FFYA 3LPWA 4M8UA 5K5YA 2EYRA 4GUCA 2CLRB 1H9DA 1B3JA 3N41F 3CGTA 1SF3A 4WWPA 3VSQA 1S7SB 4G9DB 2F1AA 4UQ2A 2ZAHA 1UT2A 2Q2LA 3LEVL 5EO0A 4Z76B 1I1AD 4FXKA 4HJGA 2V9RA 3I50L 5TJWK 1NC2B 2HRPH 2ZNXA 3ETSA 4F3FB 1KIRB 1ZLWK 2JELL 4AI7A 5A16B 4N8PA 3GHBH 1VENA 3SGKC 2H2PC 1NL0H 2PYED 2YXWA 2JI1A 4UV4L 1KJVA 2A9CA 2FEJA 4Y89A 4PPTA 1JGVH 1AXTH 4RIRA 3BP4B 2O5YH 3P73A 4ANKA 3IAGC 5HI3C 1DVFB 2XXMB 3GXIA 3QT2A 2OSLB 1L9OA 1Q0XH 4JDTL 4DO4A 5DTFA 3KJ4C 4BV1A 3SJVB 2AC0A 3RNKA 1J0YA 4A37A 1QZNA 1SHXA 5TQ0L 2XN9D 4KMTH 3PREA 4C4KO 4HZLB 1AYOA 3FTXA 3PHOB 4POZD 4J4PC 4D2NA 3RWDA 3WFCL 4RNRB 3FAXA 4QTIL 2AXJA 5GSRA 3P9MB 4ZXBC 4TPRH 1N19A 1EV2E 5I1LA 1N7ML 3HUJF 3C09C 3CUPA 2ORBH 5SV3A 2D3VA 5F3BB 2K8QA 1T3FA 5HGGS 1B0RA 4NQCB 3VNYA 1M2VA 4NRYA 1YA5A 5EZLB 2HVKA 4OF7A 2P5PA 1YYCA 1KXQA 1AY1H 5SX4H 4ORGA 1JV5A 1MCHA 1NUFA 5DD3L 5ANHA 2DWDB 5IMOB 4HFWB 1NQBA 2Y7QB 3TEYA 5HHME 4YNYA 3GJFA 5T3ZH 4KK6C 2WBJC 3VYOA 1UOWA 1JPTL 3X1BA 1AYRA 2JWYA 1QQDB 2V6HA 4LLDB 3WL9B 4MNGB 1R3IH 3C5ZB 2BSRB 4MBOA 5B1CA 5DZLA 1MNUH 4KX7A 4QUOA 1F1GA 2JXMB 2YGPA 1BZDA 1V7ML 2GQHA 4QHLB 3GZPA 1D5RA 3X1EA 3GS0A 1WF5A 1S9WA 1XBDA 1RUML 5AVRB 1NZRA 4ALAH 1SXCA 2A1WH 3HRZC 5GHWH 2UWEE 4DP2X 1HKLL 1F45A 3OKNA 4PRIE 4H8WH 1X5ZA 1PZ2A 1YNKH 4X6EB 4DVBA 2A9MH 4QNPF 4WWKD 5D70H 2I25N 3US1A 1FO0A 5FS5A 1J12A 1GY2A 2AKRA 5FA4A 1DJIA 4IRSC 1OSPL 4NM4H 3DO7A 2WZ5A 1Y7VA 4JB9L 1GKEA 2IGFL 4JR9H 5DSCB 3TYGH 2NDGA 2XZAH 3FN3A 5JA9A 4YSUA 3ZIMA 1NAKL 1LQBC 1T7VA 4FQLL 4XAWH 4R7NB 2AZAA 5ETUA 3VXOA 5AYUH 3BAEH 3QIWC 3BGFB 1SBSH 5DDHB 5DK3A 1W0VB 2CBQA 3GXDA 3F7QA 4GRLC 3RI5F 3FK3A 2H32A 4J3OD 5E9DE 5L2KA 3T2NH 1OF2A 4J3UA 3AG3B 4Q0XL 1OOWA 4Y2LA 2KMWA 4RGMB 5EC1B 2A6KB 1MIEH 4GOSA 3S6CA 1TLKA 2PPFA 2H1PH 4LNRA 2AQQA 2IMNA 3O2VH 3JV0A 1GC1H 4K2UH 5E6ZA 3BVWA 2R9HD 5T3ZE 3L4TA 1E6JH 3N06B 4MX7B 4UT6A 2E7LC 4KZ0A 5T3XD 3PV7A 3FN0L 4IBYA 4UZGA 2FIKA 25C8L 1C12B 1ACYL 3D8MA 2KBGA 4YDJA 4C58B 4HQQL 1R0AH 3V6FB 1XH1A 2WVVA 3Q13A 4I9XA 4J8QA 4X9BA 4DZ8B 5KN5B 1N6QH 3U7WL 2FX9H 2X53A 5EOTA 1UD3A 4ZSOB 2HKHL 2ZOLB 3I9AA 4TN9A 4P46C 2ZOTA 2EKJA 4X9IA 1EBAA 4A6YL 1DL7H 2BS9A 2ZPKL 4BEIA 4R5VA 2J7LA 3INUL 3ILPA 3QORD 1UH3A 3RTQD 4YXHH 4CN4A 4Y1TA 3REVA 2PXYB 2C3VA 1AI1H 2BVYA 1DUYB 3GWJA 4HPOL 4LOFA 4PGEA 1I8IA 3PYCA 3FO0L 3V4PH 4MNHB 3WY2A 4HJEA 2BDNL 4F33A 2P49B 2XWTA 1K5NB 1P4UA 2ICEC 3HC0A 1KIPA 5B38A 1CTNA 1IZJA 3IWVA 4P59H 5AYQA 3PWVB 3HZ3A 2B9AA 4FEMA 3ROLA 5I30H 1JPST 4WHTB 4WHYG 3BGMB 3Q48A 4XMXA 4HG4J 5KOMC 3KDPB 3H8NA 5EZJA 3K71A 5E51A 3OWRA 4P99A 1PNDA 2K3HA 1B0WA 4A66A 2MSPA 2R83A 1R4XA 3FMGL 2DWXA 3SPHA 5KYYA 3ULVD 2Q8AH 2Z6FA 4M7ZB 3BW9A 2Q3XA 2WBXA 4P5KA 1AFVL 4LEEA 3RJQB 4CNIA 4G8IA 1SPDA 3SDYH 3Q0HA 5J3HC 5I24A 4YZFE 1TZHB 4KI5F 4YHLH 3VD2A 1QSEE 4U1JB 1DQDH 4WTZG 2VDNL 4V1DD 4RFNB 1KGWA 1BXVA 2P8PB 3FTYA 2EADA 5CJQH 4WFHD 3BJ91 5JHLA 5BMFH 1YEDB 2JIXD 3HZKB 3I2CL 1NBVL 4QHNA 4L3CB 1BWMA 1U8KB 1ZHNA 3DIVA 4PJFE 4XHJC 1I3VA 5FYJD 2IH3A 3DMMA 4APQC 4FQXB 4YHNB 1BEYH 3OKKA 4YPGB 1MCCA 2QQQA 3QYNA 3VFNA 2COQA 4DP1X 3QO0A 2J1YA 2J8UE 1E27A 1ZV5A 4RWHA 1QO3B 2A0LD 1QLFA 3VXRB 3D18B 1WWAX 4N8CL 4R4ND 4EI0A 3UYRH 3KM1A 1M1SA 3QP3A 1XIWD 4GXUM 4XC3L 5I1AA 3RWHB 4ONGH 1OAQL 3QBTB 1LK2A 5HTSA 4UINH 1TJHH 1JZIA 2G75B 3OKYA 5JO5B 2EUVA 2OKMA 3IVKB 1T21B 5EUKA 5I6XC 1FIGL 1KEML 2AABL 1IFRA 3FQTB 5AOZA 5JPNC 3WEBA 4NOFA 4FD0A 4KY1H 5BVJA 1XAUA 5C08B 4F1SA 4EO5A 5J13B 5GGUA 2QGDA 4KWUA 3BH9B 2ICWA 1JVOA 2N01B 3SPIA 3QEQD 4X83A 2X40A 1BQRA 2ATKA 5SWSB 2VXTH 3M46A 5LGHH 4OZGA 2A77L 3HAEB 1W0WA 2AEPL 5E1GA 4YXKH 3V4UL 4KROC 3WE6A 3GXMA 1CYGA 4JANA 3GB7B 2LTQB 2AW2A 5KBNC 1CO1A 1R3JB 4YR6A 5EO9B 1AJ7H 2KLTA 4QRAA 3A22A 1Q72H 4BKLA 2BVQA 1G1KA 3ARDD 3T8XB 2WNXA 2CR3A 3BO8B 5CMAA 2ADFH 1A2YA 1HSBB 4Y16C 1MNNA 2OX5A 1L6XA 2HH0H 3UABA 3NEXA 4XPAH 4LCCA 4Q97A 3MROA 4JDEA 1WFJA 5DS8A 5CSGA 1F1AA 3SKOB 4BCYA 4LZKA 4OJDH 3SGDH 1DBKH 3EBAA 3JWDL 3FHEA 2E75C 3LRMA 4UNUA 4XMZA 4B5EA 1A7BA 3N41B 3NGBC 1K3ZA 4MAUH 3OKMB 5I2IB 2NY4C 4UQEA 4IRZL 4R2GC 3TBYA 3U9UB 5E00B 5F9JA 2IBZY 4Q8BA 4EUPB 4MZIA 3EOAA 2SODB 1GYUA 4NKOA 2NY7H 3RY4A 5HGHB 3MLRL 2OFQA 2NY2B 3VXNA 1BZEA 1RLWA 3IU3A 5I9QB 2EJ1A 1T1ZB 3RGHA 4KJYB 4JM4L 4EDXB 1GGIL 1EWHA 4P3CL 5H2BA 4HKXA 3T0VA 1MJUL 3GIZL 2JKNA 4Q89A 4PHXA 4AENB 4B95C 3DPDA 4OB5L 1FG2A 2XYBA 4Z7UF 1EO8L 1GJUA 5IWLC 1LXMA 1XT5A 1QI3A 1Q1JH 1DVSA 2G5RA 3BZFA 3L7FA 4MA8H 4PG2C 2DBJA 2JKRM 4OT1L 3NSJA 5DK0B 5C0RH 3MYZA 3C2AL 4UNIA 1L3NA 1UKSA 1ZSDA 4Z7NE 5HHVH 4Q9QL 1ZS8A 2BK8A 2WB1A 3F12B 4MQSB 3HUJB 4LARL 1CDGA 2XTSA 3D9AL 1UXMA 4LQFL 1XGUA 1JJUA 3W56A 5IREA 3WIHA 3ARRA 4U6HA 4AMKL 3EYUL 2H6OA 4PW9A 1EGJH 2UZIL 3H2QA 4U6YA 1XB3A 2R0WH 3QDJD 1X5HA 3J07A 4FQ2L 4XBGB 1BIHA 4OLXL 4J1UB 3WFZA 3BFOA 2AJZA 4F37K 2VR9A 3G08A 3NCBB 3FT3B 2BZCA 1RY7B 2X6BA 4NUGH 4MSWB 4JPIB 2BH0A 2XWCA 5IROA 2WP3T 5CAYB 4TNVK 1DANU 5KBPA 3BP6A 5F9WC 2D03L 3RVXD 4GAYB 4DUVA 3QXAA 2VDPH 2DM3A 2IOOA 1LYQA 4NXKA 3WLWC 1ED3A 2XRAH 3JV4B 1E7VA 1NKGA 4Z3JA 1EHLL 3Q2NA 4LSPL 5IVZA 1NCGA 2G30A 4KJPC 2UXTA 1FJ1B 1U3YA 4NN7C 2FEDC 3P40A 4UIKL 3POHA 3DO3A 3E6FA 1VERA 4NKMA 5DEZA 3SGKA 2I9LB 2OI9C 2WVTA 4M7KL 5K59E 3S9DB 2NY5L 3GIVA 3BN3B 4HOWA 4NDMB 5CEYA 3TO4D 4D9LL 3C5XA 2EH8H 3H2PA 4HWBL 2VDRH 3Q1SL 4HJIA 1JWUB 3V2AR 4WK0B 1L7TH 3RUGE 4O51A 3N1MC 2DICA 3ESOA 2EVFA 2FLMA 3KBFA 4JG1L 3FCSA 4PLKD 1WICA 3LSOA 3FKUS 2N1KA 1OP4A 3Q01A 4J4PA 2VQ4A 2WWOA 1C5BH 3VH8A 4ZXBA 1JTTA 1DN0B 3ARSA 1UATA 4PRPB 3QJOA 3QXUA 1G9NC 5CN1A 2XIBA 2PWHA 1RLBA 4JQXC 5L2KE 5J3HD 2EXWD 1OHZA 4PCKA 3CU1A 4WY7L 3VGEA 3HNVL 3OZ9L 3P0GB 3WNLA 3G5VB 5GS0H 4D8PA 1J86A 1OCOB 1I9JL 4H26A 1MVFA 4POUB 5AVTB 2WBJA 4RMUA 2WXKA 2J5LC 3HVNA 3NYKA 4M93B 3UAJD 5E8DH 1JTPA 2A6IA 2HP4A 5FM4A 5EIIA 2ZG3A 1IGFL 1AANA 4JY5H 4N2DA 2D4FA 5BZZA 5JHLH 2DKSA 5CILH 2A6DA 2MPVA 1FFOB 1HL5A 3C6SB 4QLWA 1FE8L 2XTJC 3DVIA 3DROB 5DU7A 4HGWA 1CS6A 2H47C 5EBMA 1ULVA 2BCKA 4Z77B 3BSHA 4GEJA 4PR5A 2DQFB 1S7VB 5T33L 2UUDK 4JAMA 5FOBA 3HRZA 2K6WA 1P4BL 4PV9A 4YUEL 2VL5A 3FRPB 5IG7A 2YZ1A 2F1BA 4ZYKA 2G4GA 4P2QA 5B1AB 1JHTA 5HJBA 5B39B 2QPUA 1BVKB 1MZYA 4JPVL 2X09A 4I0PB 1R6VA 4MWFA 1JMXA 1G7LA 3GMOA 1BGXH 4GXFA 1SY6L 4IRSA 4OJEH 4FNSA 4Y2DD 3HAEG 5TGBA 4U1HB 4YHKH 4FKHA 4JVUA 3OG6B 4Z3EA 5C2BH 3O9WC 1WWBX 4FXGB 1KJ2L 1KTDA 2KLRA 2DD8H 2XA3A 1R3HB 5EU4A 2X05A 3T6XA 3QCTH 1UC6A 3NA9L 3M1OA 3VWJB 4NX0A 3ZT5A 5KSVA 2CRZA 2PP8A 2XQBH 3QIWA 3QUZB 4G8GD 4CJ0A 5F96H 4LSSH 4UM8A 2LV4A 4GRLA 5ICZB 4CVUA 2V9UA 4NZJA 4ZO9A 4W9GC 5HYSA 4GSQA 2WAHA 3EFOA 4PRAA 1OD9A 1ZWIA 4CVXA 2EICA 2NY6B 4FNQA 1NCDL 2BP0B 3ARBC 4HUWB 4Y5XB 3GLEA 3MRPB 3PDDA 1AQHA 4UILL 4XBPA 4HKBA 3P0VH 3D69A 1U8OB 3FL7A 4OM1L 4RA3A 3WO4B 5C0JA 3HLAB 5HDBE 4PRBA 1RXLA 2NYKA 5KYUA 1CDYA 4H0GA 1UT9A 4JGUA 2PKDA 1RZJC 5C6WH 3HE7D 3ZE1F 5ACMA 2DEYX 3U0TB 4EUPG 4HGMA 5IV2A 1JGDA 1KJ3L 3B5GA 1HHHA 2VC2H 2E7LA 2WW8A 4ONFL 5KVDE 3WTTA 1H0DA 1MFCL 2OW6A 3DX6B 3IGUA 4G5ZH 3WAJA 3D2UA 3IMTA 3I3DA 3UGUA 4FDWA 2W0KA 3OX8B 3WG7B 3OJ2C 1NA8A 4R7LA 4DFHA 2ERJC 2CCVA 3KS0H 3L1EA 1JRHL 3C9NA 5HYJD 3X14A 4H40A 2YPKB 4U0RC 4LPYA 2IDUA 3MV11 2FYVA 1WV7T 3OZLA 3LN4B 4P46A 5E7BA 5ITBL 4OY9A 3TVMB 3ASNB 4IJ3C 3ZJAA 3PFUA 1YCSA 1JXGA 3ZO0A 2VR8A 1MRFH 3CVHB 5B3NA 3KJ6L 1RFDL 3GJEA 4NRXB 3LPFA 2E4TA 2D2OA 2WXFA 3ZTDC 1B9KA 2V17L 1BX2A 2E76C 5CIPB 1JGEA 2IADA 1N6UA 3UL4A 3SY6A 1GOHA 2X12A 3B9KB 1DSYA 2ICEA 3GEWB 2FATH 2HB0A 1IFHL 2BMKA 3L3JB 5BUAA 4JM2C 4GKZB 1K5WA 1DQKA 1DYZA 4A55A 5FK9A 5CLWA 1NKOA 3EOYG 3CU7A 3MRDA 5C0CD 3ZGIA 4TQIA 3OD3A 4L5FL 1GS6X 1Z9LA 1PDKA 3O8XB 4MZ2A 1P1VA 1ADQA 1YEIL 4LDLB 4ZZFA 4AUYA 2C7UB 5LAXB 1RUPL 2LLNA 1KGXA 4OZGE 4YL4A 2VO8A 1DJYA 1YMHB 3D25B 4GSDH 3VG9B 4XBPB 5I71B 1MFEH 2XV3A 4NJ9L 2YSTA 3NFNA 4LEOA 3VFTA 4B9CA 1TVDA 1LO2L 1NKRA 3QPQC 3WIHH 5JIPA 4KPHH 4I1RA 4PVBA 1NC2D 4MCZA 4PRHB 3NJHA 4XI5D 1AIZA 4P07A 4A6YA 2D7QA 3KPRB 1JZDC 4O4YH 4UQIM 3K91A 4PJ8C 1DBJH 1KTKE 1CIUA 3F5WB 3FUFA 4WEMB 2VQUA 3FB7A 2EYTA 5BXFA 1HTYA 4XBMA 5L9DL 1DDHB 3CZKA 4LOUC 1GPOL 3PY9A 1CFNA 2X87A 5HHNB 1E4XI 1WD8A 2GFBA 3CN2A 4HWUA 5F9OL 3L95B 4HMDA 1OM9A 2MCPL 3KPNA 4R26H 3IMRA 1QABA 4GXVL 4P4RB 3CH1A 4IMKC 5B21A 3MA7B 2QQNH 1C16A 4Y4FC 3DX9B 2APFA 5A6LA 1X6NA 4HFUH 3MV8D 3U6XA 1PY4A 1UWGH 3SE9L 3K2IA 4HWZB 2CUMA 1YECH 2VGLM 3ZRCC 4ZNCD 3QYCA 1KELL 5DT1H 4BH7B 5BVPL 5C8JA 2WLZA 1O7DC 1VCAA 4M5YL 3IDXH 4JS7A 5IQNA 1MCNA 2P1YA 4L1LA 1T1YA 1AMYA 3MODH 5SX5H 2H0JA 2AXWA 4LSVH 3CFCL 3KPSA 4Z7UB 5JPNA 2WWMD 1KB9J 3QHZH 4PCYA 5FYJU 3V6ZA 3IXTA 1NMCB 3J8F7 4HP5A 4JO3H 3UBFA 5EEWA 1XBRA 3HOGA 2E27H 2X4UA 3IB4A 4K94L 2GUOB 5A2AA 1FIEA 5FHAH 3V5DB 3OMIB 2C5DC 1FFRA 2UWEF 4PJ9A 1MCRA 4XVSL 1JZ6A 1A14H 3L5HA 3QJSB 1S8DA 1DJGA 2OTUA 5EU6A 5JIMA 4LO9A 4FRWA 1HZKA 4AM0Q 3VCLB 1N4XH 3K0YA 3R18A 2OK0H 4TTGA 4HF5H 2HRHA 4Y1AB 3KYOB 1TCMA 2J6WA 4XCNA 3QEUB 1YNTA 4N2HA 5KOVC 2X7LA 5L8JB 4LCWD 3LEVH 5K9OB 4Y16A 3I50H 5JZ7C 4HZAA 4NQEB 5DRZA 4P05A 5DQ9B 5B39G 1LO0L 4KZEH 4XP9H 4UV4H 5I8CB 2DTML 4Z78B 4GG6A 2X38A 5GIRA 1M3IA 1ZSHA 1WUNT 3NJXA 2BC4B 4YJZL 3BX7C 2BVUA 5B22A 4FKEA 3GTVA 2P8MA 1ZDSA 4MDJA 2R56H 4XP6L 5CEXA 4GUPA 2OMWA 2JJUA 1FHNA 4UIMA 2F54A 1HEZA 1UQSB 1FFNB 4HCRL 1NFKA 2FBOJ 1N7MH 3WUZA 1KIQA 1N59B 4ZS6C 1P5VA 3MLVL 4TUKL 3D4YA 4NZDA 3IJYA 3ZKMD 5IWLA 5EU3B 4CC1A 1MI5D 1LLAA 3CHPA 4LMQE 4PG2A 1Z5LA 2LLGA 2ADGB 3ABGA 5IFJA 5I8OH 2VQTA 4N0UA 1I9RH 4FFZH 4F8TA 4HH9B 5BW7C 2CMRH 1PD6A 3MRIB 5I5RA 3DLQR 5E8NA 1JPEA 5CLYA 4TL5A 4FQIH 1JK9B 4QRRD 4U3CA 3WY4A 1JNHA 1ANUA 1PKQA 2VXUL 3IE4A 3HHRB 4JRYD 4IRZA 1IQWH 2E9WA 3DV4B 5DF0A 3PPSA 3G6JA 4JMXA 3FQWA 5E8PB 1O75A 2ENJA 2WP3O 4I8DA 4M9PA 4Q4EA 5EZIL 4WHDA 5K39B 5KSAD 4CSPA 1PYWB 5DD5L 4JFUA 2EZ0C 2Z34A 5A2FA 1O6SB 5FO8B 2CRYA 1HOEA 3DUUB 1R19A 2XWJA 3QA3B 2PXYD 3SKJL 5I15L 1T1WA 3NCYP 4UQBA 3PIQA 3U4EA 5IJKA 1E4WH 4JFHE 2VR7A 5HVGB 3D85B 4ACPA 4KV5F 2EAEA 2Y3NA 3QQNA 4G80B 5B8CA 3AT8A 3KLSA 4HJ0D 4C56A 4AM0A 5DVOA 3ZKQD 1E28A 2ARJB 4ETQA 4YZFF 1KEGL 1HWHB 1SOXA 3CZEA 4FTVB 1PW3A 2CGZA 2GABA 2W9LA 4N0YH 5FIEA 2X9ZA 3HPLB 1Q9KA 1CZ8H 3EADA 5D7LA 3RL2B 2EDKA 3CX5K 2XQYG 4HLZH 5CP7A 4P2QE 4NKDB 3EYSH 4KTEL 3HJ0A 5LQBH 1I3UA 3PS6A 1CT8B 1HZHH 4PJFF 1RJLB 4Q0XH 4NYLB 2BY0A 1V27A 1PZDA 5CF3A 4FC3E 5IW1A 1LEKB 1X5YA 3S3SA 1AC6A 4FLQA 3OQ3B 1J5IA 3AWFA 3ARZA 4UDTB 2J8UF 4F7TB 4FQHA 4P4KC 5KG9B 3QIUC 5CM1A 2VKXA 1ZT7B 1A8JH 2EIZA 1FNGB 1OLLA 1RUQL 1V3KA 2DB8A 5DCCA 1MJJA 4LSUH 3RA7L 1HN1A 1G9HA 1MCQA 1BJ1H 3NCYS 2GIMA 3W39A 1A66A 3U4BL 4JQXA 3RHWK 4LBEA 3VD4A 3WKYA 3EFFB 3L2MA 2WCSA 3MBXL 3UTPD 5BUPA 1ADQH 4RGND 5DEJA 3MREB 1TYJA 4WV1B 4BQ9A 3IGLA 5I75C 4TVPH 1BFTA 1VGEL 3ASWA 4PY7B 3RFRA 1U8IB 3VXRD 5J9PB 2WTOA 3ZE1B 1OTUC 5CJ5A 2JKJA 4BUHA 3LZPA 1D6EB 4ZX3A 3SDCB 1OP9A 3MRRB 4YHOL 4RZKA 3DV6B 1IGIL 4GW4B 2FJUB 3EJJX 1RULH 2J1WA 4QHKJ 2P5WB 4FFWD 4M6ML 2AI0L 2VXVH 5LGJB 1YUHA 2BVPA 4IHOB 3EO0B 2VUKA 4G9FA 4XPFL 3DDGA 5CN2A 2AEIT 1U8CA 2MJWA 3QZWB 4KGJA 5C08D 4OZ4B 2V9TA 4JN2B 3OWEA 3QDGA 1BBDH 4BSWA 2YA2A 3JTTB 1SQ2N 2F5BH 4F1ZA 2VERA 4ADIA 4Z5RA 4M5ZH 5SWSD 4M62L 4OIBA 3VYPA 3E3QC 2QTEA 4BIKA 4PWJA 3B9AA 5T3XL 1LDPH 2D31A 2ZWNA 3K6OA 2EKSB 4PV1C 2W60A 4NO0D 4EPSA 3B7YA 4X8CA 4A7TA 5C0AD 1FFQA 1U8MB 2EEBA 4OR1A 5D1XC 4F8NA 3K2MC 1KN2H 5FWRA 5B4MD 4AYSA 3O41B 3PAZA 4KDVA 2VXQL 2VDLL 1LE9B 3ZT7A 1KG0B 5DMKA 1U8QA 3RKDD 3S88L 3X12A 1MHHA 3FCUB 1BM3L 4ZBJA 2NLJA 2VDNH 2Z8RA 4QRSA 5DJCA 4JRXA 3BRFA 1T03L 5A6MA 5I17B 2WIIA 1RIHL 1MWAB 2EDOA 2WWKT 2ZSWA 3BUPA 3E0GA 4NRZB 1GGTA 1UXWB 2FO4B 4MAYA 3NACH 1NWPA 5FGRA 1GR7A 3ARBA 1OL0A 4N9OB 5CJBA 1A6AA 5EEXA 4TVPE 4IOIA 4MMXB 3MX0B 3TWCL 4XN1A 4NQUA 2IV8A 3KLDA 3UZQA 2DLHA 5IEHA 2WZ0A 1TJXA 1VRSA 3LZFL 3LKSB 4G7SB 3UJJH 4XAKD 3S97C 1E67A 1U8NA 5IOKA 4I87A 4Z7NF 4AYFB 3CDGB 1SN5A 4N8CH 2VMFA 3QJHB 1ORQA 3KXFD 4BE5A 5IHUL 2OP4L 3ULVL 4X98B 3NZHL 1SNRA 5DD1H 3T6QC 2VB5A 1FUNA 1OAQH 4MNQA 4O02L 3U0WL 1X9QA 1T04B 5D1ZI 1J9RA 1D5BA 4UT9H 2DQHL 1S7QB 1E8XA 4OZHA 5ELIA 5DMYA 5TE4H 4ADJA 1ZK5A 1KB5B 3DETC 1E3XA 5HHMB 3MUGB 4UB0L 3MNWB 2ZOUA 1PLGH 4LESA 5DK2B 5KJRL 2PWEA 3J2PA 4TTDD 2PCYA 2IDFA 4ZQKB 3W0WA 3TT1H 2BLFA 3P77B 1KTJA 3GNML 4NNYA 3B83A 4P5RA 5DC0A 2X0UA 2O5NA 3EJCA 4OCRH 5FYJL 3T0XA 1BXAA 3MLTB 4PRNB 1MHEA 3CFBB 3F6IA 1C1EL 4OCYH 2PW1A 3QAZB 3QO1B 2QKIB 4NZ8A 3P11H 3VRLE 1JNNL 1FH2A 1K85A 1E8WA 1J0IA 35C8H 2K0RA 3KPSE 4MXQC 2BP5M 1FV1B 3K72A 2DWTA 1AQ8A 4GMSH 4MD5A 7PAZA 1YPZF 4BH8B 1J0ZA 2FJGB 5JORA 3ARPA 4WF7A 2X0VA 5I1JL 5FFOA 3MRMA 2UWEB 1JI1A 2QGBA 1OE3A 2OJZH 1HT6A 2Z0UA 4PRIB 3BUYA 3RIAF 3ARGC 1IKNC 3UBXA 3CSTA 3UO1H 1EHAA 3FUJA 3H3BC 1E4JA 2XKUA 1DE4A 5K59F 3AU1B 5EBGA 5TQ2H 1IL1A 3N40F 3IM1A 2TRHA 5EU6E 1MPAL 3DPBB 2I7SA 2W91A 5T5NF 5KTEL 2O6FA 1A9EA 5D6CB 4UU9B 4IJTA 5JMOC 4KOBA 4FQQA 4XNQB 4PJ8A 1A4JB 3ATFA 4J3SA 2CDEA 1U6AL 2AJXH 5EORL 3VUAA 5HI5C 2XFXA 5E9DB 3IF1B 2R69L 2CXGA 3VFPA 1O6TA 5LBGA 2NDFA 3OAUL 1PEZA 2IG2H 4P3CH 3QI9C 1XGZA 1XF3B 2ED7A 4ZJ9A 4G7YL 2EO9A 1SUJA 5KBLA 4CKQA 5A7EA 2ADJB 4GG6E 2Z4QB 4U6XB 4L18A 4IMKA 3QRBA 4Y4FA 2H8PA 1QACA 1FDLL 5KWYC 2ZX8A 4UM9A 2VJXA 4PJ5D 4U1MB 4XNUL 4BFOA 2ZCHL 1QI4A 4PRPD 1B0GA 1KXVC 1ZCRA 1ZE3C 5FGCE 3GI9L 1F58L 3IDYB 3W9EB 4KZDL 1UASA 2F54E 4LQFH 1KGCD 3ZOAA 3EGSA 5GPRA 1KC5H 4AMKH 4YBQC 3T3ME 4KK9D 1RIVH 1Z9SB 2WC7A 1UA3A 3IMUA 3WUWA 2D4DA 3LN5A 5MHSD 5BQDA 4FQ2H 2A74C 4KC3B 3UDWC 1G0DA 1E9PB 2OQJA 3LQZB 3RPKA 4N0UE 2QVFB 3OKLB 1CFSA 2BVTA 4OFPA 3DBXB 4XNYH 2DQDL 4JM0A 2VLRB 5IMKA 1MFDL 4L3ED 1IAKA 4TUJA 1G9NH 2VSMB 3QUML 4ZO8A 3UTOA 2WLLA 2WQWA 2I9TA 2LAGB 1PKQE 1W16A 1D7CA 3TF7C 4IBVA 1RQ5A 4F92B 3VA2C 3ARDC 4TQEL 1GIGH 3V7MA 3JVGC 2CKBB 3QZWG 5D71H 3O2WH 4AQ8C 2FECL 3GMRB 3L1OL 2RHEA 5ISZD 3TXAA 4HT1L 3D4CA 5J11C 3ALXA 4I0PD 3D4ZA 4AZ8A 3IT8D 5HJGA 3RZCB 1CBVH 1XQ4A 4G8AC 5FO9A 4M7KH 5JW5B 2VSKB 4LVNB 3ZQXA 3C75A 3QE5A 4P04A 2P26A 4IOFC 2WLIA 4YDNA 1LEGB 1F0LA 4OBSA 3T4AC 4JPWL 5ICXB 1HL9A 3Q7JA 6PAZA 1QSEB 2EIKB 5HDBF 2WAQA 3MOBL 3QUYB 1ORSB 3QUZD 3E2HB 4WO4B 3NFPA 3UZEC 1OB0A 4LPXA 3ZHKA 2VR4A 3MYJB 4PQXA 4JRWA 3QZBA 4K55A 1P7QD 5D7LE 3IJEB 4PTUA 3RE0A 2FB4L 5EV7A 2J55A 4ONHA 4AQ1C 2CRMA 5BS0A 2UXGA 4PJFB 2FWUA 3MXWL 5EN2B 3PV6B 4JDZB 4KI5D 2QV2A 2CGYA 3U7YH 1IQDA 4OLWL 4QHUA 3V4VL 5JHDD 3CBRA 1WWCA 4PG9A 2MCMA 4QKTA 2ZUQB 2J8UB 3CDZB 3UTTB 2X4NA 3BVXA 4HCGA 1TU2B 3RDTB 3OZ9H 1FPTH 3PWPD 5AALA 1E5CA 3VMOA 1DFXA 5JOPD 4HUKB 2DQMA 4I2XA 4NQDA 5BRZA 3ZHDA 3HC4H 4HPYH 4PJGA 4P2OD 1ZAGA 2DZEA 1U93A 5H37G 3WKML 4W4OC 4FI8A 3B2DC 2WXLA 5KYXB 3EDEA 2WYIA 1XSJA 3TBCA 1KPVB 1V3MA 2UZXA 3ES6B 1EUTA 3STLA 2WXIA 3D33A 5DJ2B 4RMBA 1M7XA 4EQ3A 1A1NA 5D5MA 2V5YA 4ACTA 1F4XL 2NZ9C 3R8QA 3NOIA 4JFZH 2CDFB 4R3SB 4WO0A 5CXPA 5EUOA 2CH8A 3Q3GA 5J7CC 2P80A 3TVMD 4P5MB 4PGJA 4ZTPL 4KRPC 5KJ7E 1QEWB 4JNXA 1RZJH 2NCEA 4HCRA 4DW2H 2QFPA 5DUMH 3DA0A 5CBAB 4JPVH 3RPBA 2IH9A 2VZOA 5ALBL 1TO4A 3WFEH 4OCWL 5I26A 4FG6D 4KO6A 4TQ8A 4OZGF 3B9KD 4ABWA 3DTDA 1I1AA 2XXGA 1EHKB 3HG1A 3AXLA 4Y5YB 4IBSA 5DZNA 5CCJA 1F11B 2R1XB 3MKGA 1CLZL 4LP5A 2YFOA 5L88H 1WVZA 2YO3A 1UKQA 3QDGE 5ENWB 1ROCA 3LKQA 1MFBL 4RMVA 2PYEA 3LRSB 3BQUB 1AD0A 3NPSC 1L9PA 3IMVA 4P2YA 3TO4C 3MA9L 5CZXD 4K3EL 4PB0L 4ZFFB 4RGOL 4HX1B 5FYLH 1IM3A 1IKFH 5I5IA 3LKRB 1GCYA 3MRHA 4B9GA 1B4RA 2EYRB 4GP8B 4DPCX 3EJTA 1ZVSA 3QIUA 1BYNA 1T1XA 4ETYA 4UQ2B 1YYLL 5EO0B 5EEZA 1JYVA 1MAMH 4FXKB 4HJGB 4OFIA 3VMNA 3EJZD 3DWTA 3FQNB 4JRXE 4YWGL 3GSVA 3U1SH 4KUCD 3T5WA 3LRGA 2YR3A 1XSKA 2OMBA 1U58A 1FVDA 2KQMA 4NZTL 3ATEA 1MFCH 4GB9A 2XYCA 2VLLA 1KJVB 4M6NH 4QXUL 4RIRB 3MUUA 3GYRA 3P73B 3BAIA 4P5TC 3NIGF 4WI0A 3V0HA 1KCSH 1N64H 1UG9A 5DTFB 3SDDD 3TA3C 3V6OC 1MCFA 3N9GL 5D7IA 3RNKB 3S0PA 2G3NA 3MZTA 1JF5A 4Z7NB 1J10A 5ITBH 2G9KA 3JWNC 3WTUA 1OCCB 2H2SC 4XN4A 3L9BA 3RWDB 3EYVA 5GSRB 2F58L 3LPPA 4J3BA 1NEZA 1I53A 3DARA 4DT2A 5I1LB 3KR3L 1JL8A 4PGDA 1ZANH 2CO2A 4I77H 4GKLA 5HXMA 2OJEA 4OBRA 1GXEA 7CGTA 1T3FB 2ZKMX 1B0RB 1MWOA 1M2VB 3GK8L 4NRYB 2HVKB 4OZHE 3MVSA 3LHAA 4LCYA 4I3RL 3II3A 2DQEH 3IKKA 3IBOA 4ORGB 1JV5B 1GTFA 1NGQH 4M1DH 1KZQA 4WWKA 2HWZL 4M1CD 2X88A 1A21A 1WFOA 5DA0B 3GJFB 1Z66A 1SVZA 3W0WE 1MLCA 4FMFA 4RSVA 2DKMA 5K9KA 5FYLE 5LUMA 1YG9A 5D1XA 1XB8A 3LXAA 5GJSL 3QJFA 2WWKO 5KUMA 3V0IA 1YPZB 4Q56A 4XN7A 1S9WB 2YQGA 4NQED 1OE1A 3T0EC 5T1JA 2J44A 3MXVL 1RZ7H 1VF5C 4B6ZA 2BX5A 4NT6B 1ZJBA 2N59A 2X4QA 3OKNB 3WENA 4BA8A 3IMSA 4DKFH 4YEFA 1UFUA 2O93L 2B5IB 3O11A 5J1AA 1N8OE 3O6FC 1FO0B 3HFML 2IWFA 3B1TA 5FA4B 5L9DH 1DVYA 4OF3A 3APFA 2NOYA 1UD6A 3DO7B 2BIMA 1T6VN 4XMPH 1B90A 1Z9PA 5CWSA 4EVNA 5C0DA 1K6QH 3N3EA 2ZCLL 2B15A 2MCPH 3HE7C 3TNMA 4PBXA 5TFSH 2F61A 4Y0GA 4LRIA 1OP3H 1A9BB 3WJJC 3O6MH 5ETUB 3VXOB 2JF1A 1F3DJ 4L37A 5DZAA 4M02A 2OR8A 1KELH 2M83A 3BIAX 4AIOA 4PGZA 4X8XA 3DTUB 5L2KB 4E5XG 2H32B 4E9XA 1OF2B 2VXQA 2R2CA 4ENEC 3CFCH 1P4IH 1G5GA 3ZZSA 5TPWL 4ZFGL 2B20A 4LNRB 2XOTA 1OAYH 4D0CB 3D30A 2PYFA 3VFRA 4FNLH 3D07A 2FNWA 3RTQA 4L5FE 5T1DL 1P6WA 4HPHA 3RX8A 2C26A 5HHQA 2XG5A 3ZTNH 1G7HA 2R0LH 3MLZH 3PG2A 2J5WA 2NX5A 2VDPB 3B37A 2FIKB 3GS7A 5DA4A 4YDJB 4R83A 3CXHJ 4GP4B 4HJSA 2GKIA 2XU9A 1GY1A 3JVFC 4K23L 1VFUA 4NKIH 3BP5A 2JKXA 5J06A 2BFGA 2NY1B 1RSFA 4XP4L 5EOTB 1QKZH 1ZRUA 3F7PC 1I1FA 3K5SA 4MA1C 5F7DA 4AYDC 4YHPA 4B60A 4CSSA 5KZCB 5JDSA 2E9IA 3KYKH 1DLHB 4ATTA 4O02A 2WNWA 1LO3L 4AJYV 2VDRB 3D85D 4DUXA 3DIFA 3ILPB 4HEPA 4NC1C 4PJAE 3ENEA 3OF6A 1KNOA 5ES4B 4OJFH 3REVB 3KH4A 2C3VB 4PGEB 3WNPA 4KDWA 3K6IA 1I8IB 4V1DA 5L4IA 3KCPA 4NQVA 3B7TA 4CW1A 5IIEA 3P4OB 4O9HL 2XWTB 2V7NA 5ADOL 1L7IH 4MDRA 4Y7OC 3QR0A 3HC0B 1KIPB 3A4FA 4H0LC 3ROLB 4JO8A 1OCRB 2OMZA 4XN5A 1TTFA 3O3UN 5EZJB 4K7PH 2ISDA 3K71B 3PHQB 4TSCL 3CVBA 2XIIA 2FEEI 3SBRA 4ZTEA 5KYYB 3N2JA 1S46A 4KOCA 3AABA 3ECUA 3BW9B 3PQYE 4Z3GA 4P5KB 3GM0A 3BDYH 3IFOA 3B43A 2EDQA 5HDBB 4S0SD 4M6OL 1NGZA 2BP8A 4G8IB 3PGFL 4CNIB 3US0A 2XLLA 2LVCA 1WZLA 1T7XA 5DUJA 1CGWA 2D0GA 4ORZC 3GRBA 2LHAA 3V0EA 3BRGC 1TEGA 4LGRB 3EH5B 3AJ7A 1QTPA 2RJMA 4ZMLA 4JMNA 3ARFC 4QHNB 1F1DA 1GL4B 4F2MA 1IEHA 3UGXA 1I1RA 1A3RH 2R29L 3CHXA 1ZHNB 5BS0E 1I9IH 1UENA 2BY3A 2IH3B 3DMMB 4NP4H 5DVMA 1ML0A 1P6FA 3OKKB 3ZYOA 2LU7A 2PPDA 3GTNA 4LCUA 1AQMA 3QEQA 1OK0A 3VFNB 3QO0B 3UDWA 1E27B 4KKCD 1BPVA 2L7EA 4QF1A 1JHKL 2KERA 1QLFB 1SGKA 3APNA 4I2XE 4R4FL 1YY9D 4NQDE 3TM6A 3VXTA 5BRZE 4CADA 2P5WD 5TE6H 3QWQB 4JCMA 3O6LH 1G7QA 5L6YL 3DURA 2H41A 3RVWD 2A99A 5I1AB 1NLDH 3NCJL 3ZMRA 5ICUA 4OLEA 3CHQA 5CUSH 1VJSA 1ZT1A 2GSIA 3LB6C 2LQRA 2VLME 1KUMA 3ARDA 5EUKB 1AZUA 4KU1A 3JVGA 1YEFH 3UPCA 5D5ME 5F7KC 1J8KA 1HE7A 2JB6B 5EUOE 4RSYA 5BVJB 5GGUB 4YSPA 5D2NC 2LGNA 2ICWB 2CM5A 3MDJA 2DTSA 3CXDL 1BBJA 3D50A 5CKGA 5F7NC 2N1TE 2OA9A 2ATKB 4RFOH 5E0QA 1U91A 4ZMZA 3KWWA 1QFWL 4OZGB 3SB3A 4F7EA 1W0WB 3SYCA 3UC0H 1RHHA 2H6UA 4GG8A 4JQIA 5I23A 1FL3A 2ILLA 3BYYA 4KHTH 1DQLH 4JANB 4B97A 1S9KC 2GG1A 3I6KA 1GAFL 4KRMB 4O2EA 5JQHC 1EXHA 2LT9A 2MTAA 4JFPA 2OTWA 4YR6B 3HG1E 3CV5A 2ESVB 4GRWH 3MC0A 3SODB 1T2QH 4FYSA 5C7XL 3WXVL 4N85A 4BKLB 5ILTH 2BVQB 4U4BA 5F21B 2VC2B 3S3PA 3ALWA 5CMAB 4ZOAA 2HLEB 1A2YB 4H25A 2VDMH 2PYEE 1T0MA 4H5SA 4LCCB 2BIPA 2VABA 3MROB 3QUMA 2DJ4A 3U4BH 3O6KL 5DS8B 4DN4L 4ZMXA 4S0HA 5L4JA 2YUWA 3ZKMC 1C08A 2Y5EA 3VD0A 1QOKA 5L0QC 5I6MA 5T5NG 1AG0A 2J20A 3ETTA 1UT1A 2IOIA 15C8L 2CGRH 2EINB 3CZFA 4TXVB 1GGUA 2XA8H 3OAWA 1WE5A 5AVWB 3F62A 1OEZW 3L9YA 3TBYB 4Y4KD 5F9JB 2R0ZH 4LLAA 4ZODA 5D6DC 3TPUA 5E24E 2CK0L 4NHCH 3EOAB 4NKOB 1A6WL 3TV3L 5KSBA 3VXNB 1MCWM 4FKKA 1CF1A 1PIGA 3IU3B 4GEIA 2VTFA 2PP7A 4A39A 3E1ZA 3TJEH 1U3HC 5I8KH 3P2DA 3M45A 4M6MH 3RZWA 3CNKA 5DYFA 3NIGB 4HKXB 4OQTH 2XPYA 3VRLF 2GT9A 1FG2B 4GAGH 5KSAC 2GIYA 2H26B 2EDHA 1R5WA 1XZ0A 3H9ZA 2NT0A