2I25N

Crystal structure analysis of the nurse shark new antigen receptor pbla8 variable domain in complex with lysozyme
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
RVDQTPQRITKETGESLTINCVVRDSRCVLSTGYWYRKPPGSRNEESISDGGRYVETVNRGSKSFSLRINDLTVKDSGTYRCKPESRYGSYDAVCAALNDQYGGGTVVTVNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords New Antigen Receptor PBLA8
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding
pubmed doi rcsb
source organism Ginglymostoma cirratum
total genus 31
structure length 114
sequence length 114
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i25N00
3ZYZA 2FL5A 2BOBB 1EAPB 1MFDH 4TUOB 2QKIB 2CRYA 5IW1A 3GGWB 4OGAD 1UB5A 4TSBL 4YE4L 4L8SB 5DJYB 2AABL 1ZT4A 3EJZD 3DTXB 4GG8A 5FKPB 3T08A 3CSYA 5EZLA 4XP5L 1J8HB 4PJ9C 1JPTH 4NQVB 3KPNB 5GRVK 4OJFH 2QQNL 3T4YB 3KYKL 5E2UH 1CCZA 3IDNA 3TN0C 1RURH 3DSFL 3UTSB 1EHXA 2R1XB 1NGZB 3F65A 4NYLA 3FCTA 4Z7WE 3T0ED 1YEFH 2FZ3A 4YHZL 4U3HA 3VDAA 4R8WH 2LQRA 4ZAKD 4QEGA 5DUBA 1NGXA 4DKAA 2CSPA 4F15B 5HHXL 2C4FU 3AREB 3O3DB 1ZGLP 3PQYD 1WC7B 4PS4H 3IJYB 2V17L 4XPHH 4J1UB 3ZHLA 2BVQA 2VN4A 5TE7H 4XXCA 2NY0B 4TNWF 3WFEL 3MGAA 4C83B 4M7KL 5F89A 2P45B 4X8JA 4Y4FA 4WNQB 3BUTA 4XPFH 4WFGE 2CJUL 5FYKD 1QYGL 2VLKD 4JM2B 1HXYA 2YMXH 1A02N 4WUKL 1OSPL 1YZZA 1DZBA 3HUJE 5F71A 1NLBH 1J10A 3AAZB 5C07D 5D7JD 3SDXA 5EDXA 2HFGL 5L88H 4LSDA 2CKBH 1YMME 1DE4B 4DUXA 1QQDA 2PTTB 3L6FA 3S36X 4D9RE 2Z93A 4L4VB 4ORZC 4JLRA 2X1QA 4FFWC 3CZFA 3MFGB 1MI5E 1K8DA 3KR3H 2PTVA 3HC0A 1MVFA 1GZPA 4NGHH 3VWKA 4XXDA 4C56A 2HRLA 4L4TB 4PJCA 4PJHE 4XP6H 3UJIH 3Q0HA 4OF0A 3SCMD 2DJSA 1F8TH 5CD5D 4XCYA 3MLSH 4ZO7A 4YPGA 5EU4B 1I9EA 4Z7UF 5JOPD 4N1EA 4PRIE 5BV7C 2ED9A 4M7JH 1VFBB 4GMSH 3AS1A 3HE7A 3LKSA 3BIKA 4YDLC 3VWJA 1QO3A 4QXUL 1GC1H 4GRLC 3O8XC 4Y4KD 43C9B 4EJ1C 4OZHF 3TZVC 4G8FA 3HLAB 3VRIB 4MJ2A 3SOBH 4U0RC 3D0VB 2NY1D 3SJVB 2QHRH 3NIDE 1DJSA 4OZIF 1XH3B 2NY4D 4L9DA 1MCJA 5CWSA 2DWEA 3GBNL 2YD5A 1NFDF 4KMQA 1CD1B 4UBDD 4HSQA 4PRAB 4QRUB 3X3GH 1U8IB 2R0WH 3ULUE 4Z78A 3NGBC 5I76B 1F6AB 3RBGA 3PHQB 1EBPA 1KNOA 3THML 1DVFB 1FH5H 2HJKB 3WFBH 1FJ1B 2OQJA 2LTQB 1MJ7L 3P73B 2X42A 4ELMF 4LARL 2AQ1A 4EN3C 5ICYA 1JRHH 5KOVC 4E0RB 1TETL 2R4SL 4KGJA 3RPKA 3QP3A 2DLGA 3NVQA 5D93C 3QUKB 4D0BA 1KGCD 1T03L 1IT9L 5EZIH 1FFOB 2BSRB 3D39D 2BOCA 5I1AB 5C9KA 3HAEA 3KJ6L 1KPUB 1RULH 2EE6A 5AYUL 3QDGA 5DDHB 3GI8L 4MVBD 1NFIA 2ZG1A 1YC8A 4MNQB 1MJJB 4Z0BH 4ERSL 1S7WB 5TE6L 5F1KC 4OD2A 1BQSA 5KG9B 3T0AA 3JVGA 1DBBH 1TVHA 1YMHB 1RHHB 5IHZB 4Z77A 4MXWL 5CJOL 3SDAC 2GCYB 3VG9B 3UBXI 1M05A 4KUCD 4UIMB 1V8HA 2XRAH 1MCLA 3PNWB 4OD3H 5CJ5A 4XBPB 4UDTB 2C5DC 4JO1H 3HE6B 3BIAX 5M7QA 2ERJB 1BFOB 3RVVC 4KZEH 2FDBP 2DLFL 1KN4H 1R6VA 5EUKB 4BSVB 3KLAB 5I1JL 1JFQL 4OCXL 4PJEF 2FB4H 2LV4A 3P30H 3UBXA 3NACL 5JORB 5J8OA 2EE3A 4KVCL 2XWBB 3RDTD 4GXVH 5DMGC 3ZE2F 3GSNH 4QXTB 4MLIA 4LCCC 1T7VA 4G6JH 4NKOB 2VH5H 1P4LA 3OAZK 4Z7QF 1ZT7A 3O9WD 1A9EB 1LP9E 3QUMA 2NXZC 1IAKA 3V4VH 3WE6B 4R7DA 4OCNC 2G9HA 2VXVL 5J1AB 3B2VH 6FABH 4LLUB 3T0BA 1FYTA 4M1CD 5C0JA 4HMCA 2YC1B 3GSNA 3VXOB 2VXTL 4L3EE 2CH8A 4LSRL 5HYQA 2BC4B 4LSTL 4C55A 2G60H 4X4XB 3OKMB 2NY5C 3P0GB 1A7RL 1IAIL 3RX8A 4MD0B 2X4OB 2VERN 1A9BA 3KPOA 4M4PA 5JIIA 4HUVA 3VXUD 3VDCA 2AJUL 5HJ3A 1S7QB 4M7ZC 4K8RC 2H26A 4WUUB 1JYWA 3WUWB 4WW1B 2BNUB 1JGDB 1HH9B 5GSVB 3ZDZF 3HI6L 2CGRL 4DKDC 4U1NB 1T2XA 2EEBA 3DJ9A 1B88A 4CN4A 5FA3A 5T1KA 2D9QB 3LRSA 4K3JH 3VFNA 5J3HD 1BD2E 1X5IA 5ENWB 4O9HL 2XQYG 5FO7B 4XMKH 1KB5B 3CFBB 1U6AH 2B4CH 5FUZL 2PO6D 2VDOH 3W81A 1B4RA 3RZWA 2VL4A 2NY6C 4YH6A 5KVFL 3EOBB 5GGUA 2BERA 2XZZA 1B6DA 4JM2F 5DFVC 1RAMA 1F02I 4MJ4A 1NCDH 4XNZB 1D5MB 3QIBB 4ZD3L 4K23L 5B4MD 4BQ6A 3MCLL 3GMOA 1CDJA 1OAQL 3S36L 4YGVB 3QRGH 2W92A 2FD6H 1ZT1A 2B2XH 4HBCL 5D2LE 3GM0A 3MXWH 4IOFD 3I3DA 3MLRH 5GSRB 3VE0A 1I8LA 1R5IA 1HKFA 4MQ7A 2PKDA 1UFUA 1YEGH 1S7TB 5DJ0A 3BHBB 1UEYA 3O3BB 2F9BT 5D1QB 3EUUA 5IGXH 4GBXC 1XF3A 2YD9A 1IC7H 3MO1B 5F1OB 1HI6A 1IZKA 3SDXE 4DGVH 1PQZA 1RI8A 3FN0H 4CVZA 4RFOL 3X12B 4LHJB 3LKNB 1RZ7L 2OLDA 3KS0H 1ES0B 2Q8BH 1IAOA 1LO3H 2W91A 1JWMB 3BP5B 4MX7B 4ZAKA 5IG7B 2UVEA 4MAYC 2DICA 4P5KA 4UTBH 4XP9H 1NJ9A 2CDEA 1D6EB 1Z3GL 1DN2A 3QIWC 1F4XH 5KZCD 1KT2B 2E6JA 3RRQA 3TWCH 4LEXH 4IRSB 1MHPH 3P77A 1LMKA 4C56E 2CIKA 3JTSA 4KWUA 3PDDA 4Z7VF 3X3FH 3MV7D 5EU3B 3NH7H 2HT3C 1FFNA 3K4ZA 2Z92A 2AK4D 1LEIA 2AERT 4WVRA 4XBEH 2F54D 4AJ0A 2XI9A 3VFVB 2NX5A 4JHBA 3FQXA 5IBUG 1U8KB 1AJ7H 4MCYA 5BVPH 4NWTH 1FVEA 3PF2A 3MRPA 3OKYA 1U92B 2MQCA 4P0DA 2HMID 2IBZY 5ETUA 4B5EA 1KXQE 4XVUC 4X5WA 3CLEH 15C8L 2F53D 3OZ9L 3X11B 4GQPH 4PJIA 1RJYA 4BFBD 4HXAL 2J4WL 4RMSA 4R7NA 1N7ML 4F57L 1XGYH 1JPTL 1JPGA 4J3UA 5IWLC 1D6VL 4WI5A 3U79A 3MOAL 3GMQA 3O4LB 3WO3B 2AEPH 4R6UA 5E1HB 4DZBA 3S97C 1FSKC 4XNYH 4XVTL 3B83A 1N0LA 5F7MC 5C3LD 4TSAH 2X4NB 1AQDA 2ATPA 2EYRB 2WBJB 4HUNB 4GS7B 4Y5VA 3ZKXC 2WBKA 1QFOA 4NSKB 1AP2A 3U46A 4PV8A 3OXSB 4NO2A 4DEPC 3TVMA 4UT9L 4EVNA 2FLBT 1GGTA 5E9DB 4LBEB 3ALPA 1Q9LA 1JNJA 1ZA3B 3U9UB 1H5BC 1R5WA 4P9HH 1P7QA 5JIPA 5TF0A 1QBML 1V7NH 4P2OD 5E8NB 4PJ5B 5MENA 1R3IL 3RNKB 3DMMA 5DWUH 3CLFL 1MFBL 1NANI 4S1RL 1A21A 1LK3H 2AXHA 2NY3D 4PP1C 1HSAB 4MA8H 3R0MA 4NWUL 2BVEA 5JPNB 4ZFFB 3RKDD 5C0BA 2IAMC 1MH5B 5D5ME 1LO0H 3I6GB 1PKQB 3KPSD 4NZRH 1FVDB 2GK0A 5E8PA 1PEZA 4NQED 2VAJA 3MODH 1UGNA 3L5XL 1I7UA 3MLXH 5JLZB 2P5EE 5JXAH 4XH2A 4KRPB 1ZVYA 5IROC 5IW6B 4QRPE 1I3RA 3UJTH 3PXJA 2V9TA 4R4FL 1JWUA 3GSRA 3HNTH 4IRJB 2D7QA 1V5JA 1EEZB 1EO8L 3QDHA 4P3CL 4U1HA 5KSVB 4U6HB 2R1YB 4XWOD 4U2ZA 1WQVT 2OP4H 3B9VA 3L3KA 1OLLA 4KI5C 5IEKB 2OYPA 3VI4E 3ECBB 4GSDL 1FYTE 1B0RB 4JDVA 4P99A 2AV7B 3NCYS 3NCYP 4M43L 1FAIL 5E6ID 1GC1L 2O26U 4G6AC 5KSBA 5EU6A 4JEGB 3TO4C 3ZKNC 1HHHA 3FFCD 1F90H 4HUXA 3BQUC 2YSSA 1UH2A 1T1WB 3U82B 1PX4A 4F7MA 2NW3A 4BELD 1KEMH 1CZ8L 1TZGL 1JZ7A 1Q9OB 4N8VB 1KTDA 5FYLH 2N4IA 5KN5A 2Y07L 4APQD 3WKMH 1HINH 1WIUA 1Q9KA 4HGWA 5CP3A 2VABB 2FIRT 3UTQB 4X7DC 2Q87A 1JCKA 4HBQA 3EDFA 2OL3B 1CFSA 4NNYB 3RDTA 2SEBB 1GGBH 1WWCA 1RMFH 1A0QL 4GXUM 3OKLA 3D6GA 1IGML 2HVKB 1IEBA 5T1DH 3QXVA 1UENA 3O9WA 1PSKL 1MELA 1CN4A 3QB7C 2OMNA 5CIPB 3RX7A 4OT1H 4YXHH 2VZ1A 4IIQB 3MV11 2NXYC 2ZSWB 1C12B 1AXTL 2FHCA 3T2NL 2V2XB 1UVQA 1XGTB 3G04A 2AVGA 4OFDA 5FDYA 5E5MA 3LS5L 3PWPB 2IF7A 3MREA 1G7IA 5I1KH 4KXZI 1HWHB 5D6CA 4ONGL 1K6QL 1BVKB 1KEGH 2DTMH 4YXKH 3VI3E 1TTFA 3ARFC 3G6DL 4K94H 3CVIL 1EFXD 4UQ3B 3U4EB 1N4XH 4X5XA 2A6JA 3MYJB 4GW1A 4EI6A 4P2CG 4RAVB 1AKJA 2VUOA 2IANA 1K5NB 3ARYA 3M17B 4JO1L 4EI5D 4BZ2L 2DQHH 3B6SB 1P4IL 2ZKHH 3V5DB 2W9DH 4GRWE 4YHIB 4KZEL 3QUML 2O61B 5HY9B 4KKBC 5BVJB 2G2RB 3FT2B 3P30L 4YDIH 2YZ8A 2R0LL 1TCRA 3OR6B 5FUCE 1D9KD 3QUZD 1UYWL 4JJ5A 2XNAA 3F12A 4X4YA 4R2GB 1QFWM 3GSNL 2VAAB 5DMJB 2VLJB 1J1PH 1SY6H 5E8OA 3RX5A 4NKMB 3PQYE 1TPXC 4RAUB 4NCC2 1H15A 3L3IB 5HDLA 5BCAA 1AHWC 1WK0A 3SDCD 3RIAF 4QCIA 1YDPB 43CAA 2ZCHH 3LEXB 4P23C 5F9DC 3C87A 5IQ7H 4LLVB 1CU4L 5JW5B 3JTTA 5IMKB 5FYKE 2VLKE 3FKUS 1F6LL 4RGOH 1FV1A 3IDXL 4YX2L 5EH1A 1JUFA 2X9WA 2NX5E 4Z5RB 3LN9A 1CGVA 2AW2A 3JWNC 4ZS7L 4N9GB 3AMLA 2APBA 4NFBA 4FTVB 2XZCH 1EMTH 4QKXB 3LVEA 1NBZA 5DMIH 3U0TA 4U7SA 5CEYA 3UMTA 2EXWD 4LLAA 3UTSD 5BXFA 2XICA 4FQCL 2OR9L 2DAVA 1OAYL 2D7OA 1KXTB 1BIIB 2VL5B 1NC4B 4N0UB 1SBSL 3RP1A 2QQLH 4QRRB 3FAWA 3VXSB 4F37F 4F2MA 2AI0H 3BEWB 1MCPH 2NQCA 2VDKH 5DVNA 1EAJA 5K59F 5ERWA 5FKAA 1UB6B 3U9PL 3ARED 2EXYD 1YY9C 3BAEH 1UXWB 4UV7H 4LQ1A 5T3XH 3MA7A 1MPAL 2VQ1B 3QZWB 3SO3B 5JIKA 5C0EB 2YD2A 4ZG1A 2IGFH 2NY0D 5DZNA 1S7SB 3MV8A 4JFFB 3WEXA 2FR4A 2X1WL 3ZKSD 1E6JL 2DQUH 1EHLL 3FB6B 1YEKL 4PY8J 4PYHA 1MHCA 2D0FA 4EXPX 3O3AA 4XXCC 5I18L 2Z35B 1KIUA 3VFWB 4S1QH 4UB0H 3UAJC 4YPJA 3IU4H 4Y4FC 2GSIA 4XCCH 2YKLH 4PG2A 1WZ1L 2F53A 2YXMA 1X3DA 2D31A 5DTFB 4IM8A 1CD9B 4DQOH 5DI8A 5IJVA 4RFEA 5DK3A 4E42A 4BK4A 5E4EB 4L4VD 1I8KB 5IB3A 4XPBL 4CAGA 3KPPA 3QNZA 3QIUA 1P7HL 4F9PC 1QPPA 4GMTH 2XWTB 4JY5L 3BEVA 4NN6C 2ZCLH 4AEIL 1HZHH 4HF5H 4HV8B 4ORGA 3CVHB 1ACYH 3RUGE 5MEPB 2DQJL 1W2KT 4L4TD 3ARGB 3ZYJA 3HZMB 3GMNB 2BSSA 1KGCE 3A6CL 4GW4B 4XP9L 3D39E 3GJFB 8CGTA 3VWKC 5FYKL 3PV6B 2WANA 1GL4B 4P57A 5SWZA 3TWCL 1PY4A 5DJ8B 3D69A 4LEXL 2C1PB 1AXSA 2UVFA 35C8L 3C60A 3LKOA 3JXAA 1T89A 2J1KA 2P8LB 5JDSB 3NH7L 3HZYB 1U8PA 2QQKL 3VWJC 3LMJH 1NEZA 5EBWB 3BI9X 3SJVD 3O41A 1YY8A 5I75B 5LWYL 3OJDB 2OTUB 4FQJH 4NPYB 5EU6E 5KBNC 1RJZB 3EYSH 1FZKB 5DD6A 2PN5A 4I48A 5D96C 1KLFA 1JHLH 2OXGA 3D85A 1A7QL 1WIOA 4XMPL 1NMCC 4EOWH 4OM1H 1DVFD 3FB5A 1GC1C 5I1HH 2XWJA 3MR9B 4NO5A 4HKXB 1ZLSL 4QTHA 1ZANH 5LG1A 4KTDH 2N7BA 3OQ3B 1OT2A 5DUML 1HILB 4N5ED 1T04B 2IALA 4TULH 2XT1B 1R3HA 4KZDL 1AGBB 3MRJA 2R0ZL 3OAUH 5AG9A 4M62L 2HN7A 1EPFA 3C2SA 5EC1B 1U3HC 3BH9A 2NZ9D 3ARDD 5I1LB 5D2NB 1MCCA 2IH3A 3FFDA 2VDQL 3OKNA 1QBBA 3CX2A 3F5WB 2DKSA 3V7AE 4MCZB 3V6ZA 1HNGA 4MNQD 1BQUA 5E2WH 4MLSA 3BZEB 1U8MB 3MV9B 4Z7UA 1VFUA 1SEQL 4I1NB 5E4IA 4CN1A 3T09A 1JYXA 1OWWA 5IR1A 4P2QA 1MCOH 1W72H 3U4BH 3DX9A 4U6VH 4PGZA 5GZNC 2QADB 4JKLA 1BEYL 5CZVH 3RWGB 5HYJB 1P4BL 1Q0XL 4KTEH 1WVZA 2VDRL 4OZHA 3KPRA 2I5YL 4JHAH 1YECL 5ELIA 3OR7A 1ITBB 3JVGC 4J6RL 3BRGC 1UJ3A 1RFDH 3VXUE 3WIHL 4OZIA 5BS0A 1NQBA 1P1ZB 5E6YA 1DTUA 2Y7QB 2MWCA 1W72A 1ZOXA 1ED3B 2NY2B 9CGTA 1NFDA 3EDDA 5I6XB 4HWZA 1LK3L 4OCMC 4X6DB 1I3VA 1FFQA 4HPOL 3HE6D 3L3JB 3CDYA 4XP4L 2D9CA 1AY1L 1F58L 3HI1B 4KK5C 5B38B 1QZ1A 2PYEB 2VXQL 1T1ZA 5J89A 2WWMC 2HH0H 4MA1C 5ID1B 2BJMH 3DRTB 1MFCH 1QEWA 3TCLA 1SJHB 1BX2B 5HGBB 2HG5A 4MXQD 4ELMA 2V5RA 2CXGA 3QQ3B 4TSCL 5F7YC 3BT2H 1S7UB 2W65A 1U95A 4IMLB 1KCRL 1FN4B 5JA9A 3O11B 1UKTA 5JXAL 5LCVH 1JHTB 3KAAA 4NO0B 3DECA 3QCVH 3UJTL 2I60L 2O5YH 3ISWA 3VCLB 1U58B 1Q94A 1KCVH 3MROB 3P9LB 3P3YA 4FNLH 4HXBH 4L8BA 3ORJA 1WICA 4PJAB 3AGVA 4LSVL 2A6DB 5HDBE 2RBLA 3BP6A 1U93B 5EB9A 2XY2A 1UM6L 1S9VB 3SGDI 4N1CA 1EFXA 3HRZA 5FM4A 2AXGA 3NFPB 4WUUD 2A6KB 4ZMAT 4AENB 5B39G 5TPWL 1ZEAL 5ACZB 3WL9A 2F5BH 4KDWA 2NNAB 4PJ9B 1HSBA 3HS0A 1ZA6B 1M7DB 1MHEA 1NAML 2YPKA 1S7XA 4OI8A 1AGFB 3TN0B 1VFAB 4HPYL 4G3YH 4YXLH 3WJJA 3QDJA 5DYOB 5EO9B 1IAMA 3DVNA 4D9LL 4OQTH 4XPAL 4LU5H 2YUVA 3LQAL 4DGIH 4LAQL 3RY4A 1RJLB 3WXWL 4Q9QL 4LCUB 3TBSB 1G7QB 4PJEA 5DEFA 4JZNB 1QHOA 1U91A 2F19H 3BW9B 1E6OL 5BQ7B 2AJSH 1DBJH 2F8VA 4YAQB 3WHE0 3GMLA 4ODXA 3IF1A 3SE4A 3PIQB 3IXAB 3HMXA 4KY1H 3MV7E 3UTPE 2A38A 3TV3H 5C70A 2BOBA 1EAPA 2B4CC 3W2DH 2QKIA 3BVNA 3SKMA 4EUPH 2AJYL 2F54E 3I9GH 4OB5H 3BPOB 1OARL 4L8SA 1BHGA 5GGQH 1G6RB 3IXTB 5FYJD 4G9DB 4BZYA 5FKPA 1NCCL 1J8HA 3HMWL 1I8LC 3KPNA 3CH1B 5D1QD 4YDJB 3DVGB 3FQNB 1BQHB 1AQKH 2F53E 2PR4L 4YHLH 4XB7A 3GFUA 2W59A 3S34L 2YK1H 3RVUC 1IEAB 5JW4N 4P5MB 3WMSA 1T0NA 2DKUA 4GFTB 3VD5A 4KVNH 4JPIB 3PP3H 2W9DL 3ILPB 2HKFH 4Y5YB 1YQ2A 4JR9H 4P46B 4P48A 2M26A 2P49B 4J1UA 4IRSD 4YBHA 4UINL 1TVBB 3DO7A 4DUWA 3GSQA 1BBJB 2HT2D 1YPZB 1J1PL 4JVWA 4R0LA 1DQML 3K3QA 5EZOH 5BV7B 5C09B 4JM2A 3WJLA 4YDLB 3FZUD 3ARXA 4GRLB 1JI1A 1VFOA 2WQ8A 5F6IC 1F3RB 4A6YB 1QLRA 4OCWH 5HXMA 4WFED 3AAZA 4U0RB 2XQYK 4MDIA 3QQ4A 4OZFG 2HKHL 2G5RA 3EHBC 3WIFB 1I7ZB 1DE4A 3V0VB 4OUUB 3NGBB 4UTAL 1WTLA 2RQ8A 4N0RA 2GYSA 2PW2B 2VC2L 2LABA 3O4LD 3KPSE 4FFVD 1ZS8A 3PGFL 4EN3B 4YIQA 3KXFD 4LLMA 4TVPD 3CMOL 4L4TA 3NN8B 4DGYL 2ZNWA 3H42H 4U6TA 3SE3C 1OAZL 4NOFA 3IDUA 1MJUL 3L3OB 2WBJD 5FEBA 3QI9C 5EC2A 1JZ6A 3CFEA 4UV7L 4JPWL 4XBGB 5SV3A 1YNTA 4IMKA 4Y5XA 4Y5VC 4LHUB 5CP7B 1DBKH 4Q0XH 1CDCA 3IJSB 3CK0L 4XZUA 4Z7VA 4JG1H 3VRIA 5GS2H 3TVMC 3E3QE 3SJVA 3RL2B 1RY7B 1XR8A 2IBZX 2A74A 3DUSA 4MSWB 3BD4A 1VACB 4PJ5D 1JVKA 1I3GH 5INCB 3ARUA 1XCQA 5HHOA 1RJCA 3WLWC 4OQ1A 4QRUA 2YPLA 4U1GC 3SDAB 1O5DT 3MRKA 3O2VL 3FFCE 3ARBD 3UCRA 4QOKB 4BQ9A 3DMMC 3IJHA 1FJ1A 2H2SC 3MNZB 3RA7L 2P43B 4GOSA 3MNWA 4AL8H 4ZNCD 2IQAB 4P9HC 5IOPA 3S88H 7CGTA 3MZTA 5IB1A 4F9LA 1UWGH 1IC5H 4TYUA 4HULB 5DS8A 3LRHA 1RSFA 5KS9B 1KJMB 3G6JB 1AO7A 2W1NA 3DV6A 5C2BH 2JIXA 1FFOA 2BSRA 4Y19B 3DRQB 1JTOA 3MACH 1ZAGA 5I1AA 2DD8H 1K3ZA 1KPUA 4GKOA 4KRPD 1IZJA 4ONHB 3MGOA 4LCCB 1CE1L 1YEJH 4H20L 5DJAA 3S7GA 3MRLA 4IRJD 4PJAF 3NIGE 5TDOB 1E4WH 4OF3A 3KGRA 1QBLL 2FH8A 3U36A 1S7WA 3RPIB 3VXTB 4YHPB 1YUHB 3ALWA 3KLHC 4NRYB 4PLKD 1KYOJ 1T66D 4K3DH 4FS0A 1NH6A 3C5SB 3Q1SL 5E2TH 4B53A 5E2VL 2AKRB 3ARTA 4JAMA 5HI5C 2APVA 5JQHC 3STZB 2FSEA 4PGDA 1EXUB 3O3EA 3TFKC 3V7AG 3WSQH 4HAGA 1R24A 5I66B 3PHSA 1BREA 4M7ZB 4RRPA 4DFHA 3QXUA 5D7SL 1QUNA 4UDTA 4LGRB 2BHZA 2BSTA 1ONQB 3NMEA 1QRND 4XNXL 2EKSB 4GKSB 4GUPB 4BSVA 5D6DA 5D1XC 2XN9A 4OM1L 2GFBB 5DLML 1E4JA 3PL6A 3FO2B 4YBQD 5C08B 5CGMA 2CK0L 1FG2B 1CGTA 1MREL 4RWHA 1S5IH 1N5YL 3P40A 3QDJE 4NKOA 2VZVA 3JV6B 3ESUF 3MRCA 5BOPA 3WE6A 5GGVL 5ICXB 1N2RB 1X4YA 5J1AA 3BKJH 4LLUA 2NY6B 4PJEE 4WI8A 3EJYD 1JF1B 1ADQA 3RAJH 1C7TA 3BIBX 3VXOA 3LQAC 3ZE2E 4JKPH 3KLSA 3PWPD 5D1ZB 2G75B 3SQOH 1G9EA 1LEKB 1UM5L 1PZUB 4NKIH 2HTKC 1KB9K 3CJJA 3NA9H 4H1LG 4MD0A 1FL5A 2QBWA 4ODTH 1HCVA 5CAYB 1ETZA 4HWEL 3DROA 2F5AH 4R9HA 1LEGB 4DAGH 3GMPB 1S7QA 1MCOL 1W72L 3GRWH 4LGSB 1UA6L 1SVCP 4WUUA 4ZYKA 3MXVL 1YN7B 1MWAB 4WW1A 1JGDA 1RZGB 4U1LB 1A6TB 1DUYB 2CD0A 4LCYB 5IHUL 4U1NA 3V4UL 3UYRH 3UO1L 5AWNL 5DD5L 3DURA 3QXWA 3S37H 1UADC 5K9JL 1KPVA 3R06B 4X7EC 1OGTB 1PD6A 4GBXB 3PGCB 4KAQH 1MLCB 3GRWA 1HKLH 5F9JB 1KPRA 2VLLB 3UTSE 5FO7A 1Q72H 2GJZB 1KB5A 2KH2B 3L7EB 3ZDZE 2IPUG 4HUMB 2NYYC 1KIRA 1BZ7B 3KYMA 4P9ML 4K94C 4MAYB 4GQ9H 1YNLH 3EOBA 1KN2L 4FOMA 1YPZF 3R1GH 1LO2L 5T1MB 3FQWB 4R2GD 1A22B 4DKFL 5I1CL 3T1FB 5JOEA 2A6IB 2ZUWA 4M7LT 2ITDB 1NLDL 5LVEA 4PP2B 3D5OF 4S1DC 3EO9H 5DVMA 3QIBA 2DM7A 5DVLA 3IKCB 1B2WH 1G9MH 4YGVA 5F1IA 3WN5A 4F7TB 4ZTOL 4E5XA 1KCVL 4L1DA 1D5IH 4DVRH 5GSRA 2VN7A 5DK0B 2RHEA 4XNUH 3WFZA 1JGVH 1BBDH 1S7TA 4URTB 4V1DB 1H3GA 5JIHA 2HA1A 5CINL 1JGEA 1NGPL 2M2DA 3LH2H 4OFVA 4FTVD 3G5YB 4MJ6B 5D70L 5GRUH 3T2PA 5IHLB 1HYSC 1A7NL 4F7EB 3BPLC 2JCCB 2N7AA 5FCSH 3GIZH 5HHPA 4LPTA 4L4VE 1JWMA 3ULVD 1NC4D 4TOYL 5IG7A 1QRKA 5I19H 1TTUA 2HLFD 4QRRD 1T80A 3VXSD 2Y06H 4RSVA 1RIUL 1D6EA 3U0PB 4FQQA 2EH8L 1FSKB 1KT2A 2Q76B 1ACZA 3E8UH 1EERB 2E7BA 4L4TE 3VFPB 2X4SA 3HMXL 2Z31C 2W0PA 2GK2A 1NMBL 2IJ0C 3ZHKA 3ZKXB 2J8UB 1RZ8B 4RGNB 2ICEB 4DEPB 1GCFA 5DJZB 3ZYIA 3WHXA 1U8KA 3QR2A 2HVJA 4ZQKB 2DQFB 4LHQB 4N0CD 4BH7B 4LLQA 4YHNA 2J8HA 2BRRL 3K81A 3SJVE 4KC3B 2E7CA 4OB5L 2OJEB 1DBAL 3EIFA 4R3SB 4M6OL 5KJRL 1RIVH 3REVA 3VXRD 2FBOJ 5DJXB 5KS9F 4PG2C 1MRFH 3G6JF 2D7NA 4TPRL 3V6FA 4NQXA 2E9BA 2W9EH 2FJHB 2IAMB 3EO0B 3AU1A 3GKZA 3ARZA 4P2RA 5E0QA 3PP3K 1D5XB 1IGIH 5ALBH 4KKLD 4XNQB 2VKWA 5IQ9B 3EFFB 2Y6SD 1TLKA 1OGAB 3T04D 1TMCB 3ARWA 3QIUC 3ARGD 2JJWA 2WINB 4JM4H 1FGNH 3GSWA 1UWXH 1DBML 2EYRA 3MJ6A 4WCYH 1ZHKB 4EBQH 2HKFL 2WUBH 4NSKA 1A4JB 5JQ6L 2ADIA 1F97A 2YA0A 2MPAL 4PIRF 1C5BH 3B9KD 4JFDD 5LQBH 3FB8B 5A2KH 2AK1H 4WTXA 3TYFB 5DO2D 1KENH 1VESA 3CSPA 3WNPA 2W60B 5E9DA 1AD0A 5C0IA 4MNQE 1ZGLB 1I9RL 1MCBA 1KFAL 5MEOA 5GGTA 1FO0H 2EZ0C 3IRZA 5SWSD 1BAFH 3C60C 3C09C 5J1TC 3RNKA 1QSFB 1NC2A 4M9PA 4CVXA 5FGRA 3ZL4H 3TO4B 1Q1JH 4JDTH 1B0GB 1H3TA 2HTLD 4ZFFA 1QFUH 3NCCB 4FQHB 1FO0A 1R5VB 5H94B 1MH5A 2XZQH 2FYYA 1MAML 4WU5B 5BZWB 3K0WA 4PRPB 1V7MH 3VGBA 5ISZD 2D0HA 3UTZA 4ZDHB 5EOCH 1DDHB 5KOMC 3QO0B 1IJ9A 3GI9L 1S3KL 3DYMA 4L5FH 3UC0H 1NANH 5F3HB 5KSVA 2R1YA 3TJHC 32C2B 1UM4L 3QHZH 2NXYB 4HS6B 3D2UA 3ECBA 3FQTA 1B0RA 2YWYA 4P4KB 2AV7A 3MV9D 4Y0GA 4G8GA 5SX4H 5JHDA 4X8XA 3V8OA 4R4BB 4LFHD 2VDNL 3E3QC 1EGJH 1X5HA 1TXKA 4HQQH 3L1OH 5GISH 5HYJD 3VRJB 1T1WA 2IPKB 5LAXA 4QWWD 3VFOB 3KS0J 1U8HA 2DS4A 4JY4B 4HHAA 4PTUA 5GZOC 2JELH 5KW9L 5I8KL 5F21B 5DHVB 2AXFB 2A9NL 3JWDH 1Q9OA 1T21B 3QUYA 4N8VA 2NY2D 4WUUE 3DLQR 3SN6N 1RUKH 1EGJA 1TQBC 1FL6B 3GIVA 1UJ3C 2GTWB 4XI5C 2EDHA 3CUPB 3MRDA 4UT7L 3UTQA 3VFMA 4LK4A 1AE6L 2P7TB 1MCKA 1Z6JT 4I0CC 1FFPB 5DR5H 1OAUH 12E8H 4HIJB 5F7DA 2HVKA 3I02A 1UWGL 3MRFB 3E2HC 2BMKB 1FNGB 3HC4L 5CIPA 5GRZA 1T3FB 4WHDA 2HJLB 5C0AB 3T4AA 2VQUA 1PG7H 1PLGL 4RWYL 3BP7A 1L0XA 5FFLA 4NO0D 1XGTA 2CUHA 1YEJL 3P9MB 1I4FB 4W70A 4OLUH 4HIHB 3UP1A 1B3JA 1OB1B 1TPXB 5FK9B 2A77L 4ODBD 1AHWB 4OAWB 5DSCB 1P6AB 4OIIL 4PD4J 4P59L 1ZWIB 4DCQB 4P5TB 4X9HA 1IMHC 4QF1B 5KVGH 1X5LA 4P23B 2DQEH 3MLVH 5TDPA 5JW4Q 1IM9B 5HHVL 1JWSB 2K1MA 3F58H 2JCCF 2EC9U 4M1GL 1NGQH 4NZTL 5ADOL 5DMKA 5FYJE 3FQRA 3ZZ1A 4HH9A 2X4RA 4RAVA 2BXZA 5FM5M 4I0PA 4PJ9D 3SDDB 1NUGA 4M7LH 4Q58C 3GK8H 2GT9B 3M17A 3PWUA 4GG8B 1RUPH 4FQPA 3TN0D 3SE9H 4LASL 3PWNA 5EZLB 2O61A 4FABH 2GITB 3BRFA 5IF0A 2HWZL 2G2RA 4QXGH 5FGCB 2VZOA 3LV3A 3IDNB 3EYFB 3WJJC 1ADQL 3DSNA 3JUYA 3FCTB 2RCSH 2VAAA 5J12C 2FZ3B 2VLJA 3MSPA 4F7PB 5FXCH 1JF5A 2YOCA 1LNUB 2AJXH 4J2XA 4NQSA 4RAUA 3L3IA 5DUBB 1NGXB 1B90A 1V3LA 3MRRB 4W6WB 3WS3B 4BFEA 2FO4A 2X4QA 5L0QC 3R4DA 3RAJL 1X44A 4H8WH 2MQ0A 2YA2A 5JW5A 5IMKA 4FZ8H 3SE4C 3SKOA 4Z8FL 2BVQB 4FXKA 4NDMB 3V4PH 5IKCA 3A6BL 4OLEA 5F89B 3QFDA 2WW8A 4WFEE 2FECI 5ABDE 4FTVA 3RL1B 1HXYB 4L8SC 4MA7H 2APFA 1XFPA 1JJUA 4OFPA 5INDB 1KB5L 4HC1H 2VRAA 3UYRL 2VL5A 2EDTA 4N0UA 5F97E 2Q7YA 2J6EA 1JV5B 4FQXA 1BQLL 4FFWD 4X7TB 3KNBA 1QQDB 3L6FB 3O4LE 1OPGL 2X09A 2Z93B 3D3VD 3IYLW 1UB6A 4HC1A 4JLRB 2ZJSH 3SGJA 3KXFE 4TVPE 3N0PB 1UXWA 3CZFB 2P1YA 2VQ1A 4MZ2A 2XXCB 1NBVL 4F15C 1JZ2A 1K8DB 2CKBB 4A2MA 3HC0B 5BMFH 1D7FA 4NJAH 2YRLA 5MP6H 4M1DL 1MFAL 1S7SA 4JFFA 5DQ9B 1ZLUH 4LVHB 4PJCB 4KKAC 2DMBA 5FYJL 5C09D 5C71A 4W4OA 4XCYB 1G7LA 4YPGB 5E9DE 4GRLD 1MCSA 3L5WB 3O8XD 2ZOKB 1WAAF 4R0LC 1F3JA 4FQ1L 3TH2T 3TZVD 5A2JH 4KHXH 4JM2C 3LKSB 3WJLC 3BIKB 3C2AH 3AS0A 5LKNA 1BM3L 4PJ5E 5I1GL 2YA1A 1JGVL 4G8FB 3WDJA 3AXLB 4MQSB 2XZAL 3DVFA 4JVPA 4JFZH 5D96B 5CEZH 1J11A 1I8KA 1INQB 3GSUB 4WI9A 1N59B 5GHWH 1NMCB 2J88H 4NP4L 4M6NL 1G9NL 1NSNL 1EHNA 5AZEL 3OX8A 5D71H 2XWTA 1PKQE 4Z78B 4AQ1B 1T83C 1BECA 4C54A 2H32A 4EN3D 5EWIL 1SHMA 4NO3A 1SYVA 5I19L 4S1SH 3HZMA 3LN5B 5GJTH 3GMNA 1Q0YL 4GW4A 4IDLA 1KF9B 1U3HB 5ICYB 5I30H 4LEOA 5DJ8A 2YHGA 2EE2A 2VLME 2UWEB 5FOBB 2ZUTA 3WXVH 4D0BB 3FOLB 2ITCA 2BOCB 2P8LA 2IQ9H 3HAEB 1XF4A 4LHUD 3UTOA 3S6CA 4M3KB 3CX5J 3QDGB 4OBSA 4W4NA 3SKNA 1NFIB 4JKMA 4IMKC 3CZJA 2EEDA 2W07A 2V5SA 5E6ZA 4Y5XC 2V5MA 2VSDA 4BKLA 3SGKA 2BVPA 4NPYA 1RJZA 3SDAD 4CDGC 4OD2B 1GGYA 5L2KD 4DVBA 1R3JA 1TVHB 3L5JA 4QOKD 4Z77B 3I50H 3GHBH 5EIIB 5JMRA 1CL7I 5CILH 1IGFH 4TVPL 1M05B 5GGSY 2ESVB 5TJWK 1QRNE 1KLGA 1PZ5B 2EIZA 1HILA 2QR0B 1MRFL 4WHTB 3RVVD 1T04A 3N85H 1U8JB 3RWJB 1JYVA 4FXGB 4Y1AD 2C7UB 3LEYL 3PV7A 4K3HA 1UWXK 4MA1B 2BY2A 1NAKH 4Y19D 5EC1A 3RZCA 1WFNA 3D25B 4F9LC 1S7RA 3IU3A 5DMGD 5I1LA 5TFSL 2ZPKH 2MOVA 3F5WA 2NXZD 5KVEL 5GGTL 4EBQL 3MCKA 2DQGH 2F8OA 3MV9A 3DX6B 1P4LB 3O2WL 1ZT7B 1S9YB 5BZDB 1T22A 3PWPE 1H8NA 2G9HB 5FCUH 4FMKA 4DWHA 5HHQA 1A3RH 3O6LH 3RWGA 3S3PA 5C0JB 5C9JA 4PLOB 4KJPC 1FNLA 3GSNB 1DQLH 1X6NA 2J5LC 4EIGB 4U7MA 2X1PA 5HYQB 5T1LA 3S8WA 2Y7QA 3VG9C 3CXDL 4K8RD 3MOBH 1R3KA 1XMWA 3KPOB 4NJ9L 2DM3A 3T65A 4IHOA 5HJ3B 4HDIA 1MHHB 2PYEA 1T1YB 4WU7A 2NPLX 5IFHH 2H26B 1CFTB 2DI9A 5ID1A 1LE5A 5C08D 3DRTA 3FQUA 3MRBA 2ERJC 5A3IC 1BX2A 3QQ3A 3EYUH 5D6DC 5FA3B 5L7XH 4JO4H 5C0RL 3PL6C 4LSQL 3WUWG 3LRSB 4YDVA 4IMLA 1FN4A 1MLBB 1EBAA 3SGEI 1Z9MA 3DVIA 1ZVSA 1FZMA 2NY6D 3TIEA 3WDHA 4ISVB 3KPMA 3F7PC 4OIBA 1IKNC 2VLJE 1U58A 2C3VA 3P9LA 5DFVD 4Z6AT 4HZLA 4PJAA 4RA0C 1H0DB 1AGEA 2O5ZH 3PHOB 2R8SL 3LKPB 5A43C 2C1OB 1NCTA 1S78C 4PRNB 3DBXB 3VGAB 3VGGA 4O2EA 3V52H 5F7EH 4HW6A 5DXWA 1FIGH 2QSVA 4KQ4H 5JUEH 2DQTL 1EGJL 2A6KA 4O02L 4G6KH 4AENA 1CBVL 2IG2L 4KMLB 3OBAA 5HTSA 1SEBA 4H88L 5EORL 2NNAA 4B41A 3VE0B 4IDJL 3TLRA 1D5BA 4FN0A 4PJ7F 4FTVE 4OD1L 4GBXD 2BDNL 3JWDL 4FMFA 1AGFA 1NUNB 1VFAA 2HT4C 5BO1H 4J3VA 4NC1E 4X4MA 1MCDA 1YYLH 3HG1B 3NFSH 3CCHA 4KRLB 5I17A 1XF3B 1RJLA 1RK1A 4HFUL 5HYSB 1HI6B 1H3PL 3ULVE 4N0UE 1BP3B 3T8XB 3TBSA 3ZYOA 4QRRE 4CVZB 12E8L 4MAYD 3VXSE 3NAAH 3DWTA 2A2QT 3U6RA 1U9KA 5BQ7A 5BRZA 1P5VA 4WHYG 3QIWD 3MRGB 5J6HA 1CGYA 3EZ8A 4P5KB 1OAXL 5CJXA 2JF1A 4GKNA 1X5KA 2Z91A 3PIQA 1PG7L 2CDEB 1TZHA 3EOAA 5I1DB 2A9ML 5IMLA 1HK6A 2D4DA 1NGYB 5EOTB 1IGCH 2HT3D 4JFFE 3P77B 2DLEA 3QULB 4GAGH 2BNRD 3QDMD 5HGDA 4MJIA 3JV4A 1ZTXH 3QIBC 1KTLA 3QJFA 1FFNB 3WN5C 2Z92B 5F6IB 1IGYB 1VGKA 4XPTH 1LEIB 3KG5A 2GTZB 3LN4B 4AK1A 3MX0A 1G0YR 2XFXB 2Z8WC 3CH1A 5E70A 4JO2H 4YDJA 3F58L 4Y4HA 3FQNA 4GG6F 4MCYB 1NGQL 4CNIB 4XVUD 3WNMA 1FVEB 3ARQA 3MRPB 4JHWH 3WFDL 1IEAA 5KSAA 5ADPH 1CDIA 2YEZA 1IILE 4ZOAA 5F6HJ 3SDYH 4X5WB 4M7LL 3WNNA 1L6ZA 1SMOA 3KPLA 3GO1L 1T0PB 4PJIB 3E1F1 1RJYB 5I9QC 3ZDYF 4Y5YA 5E2JA 1OW0A 1TCMA 4P46A 1JPGB 2UWEF 1IAIM 2VXSL 4AM0A 1G9NC 1TVBA 5FGBA 4IEFB 2RCSL 3K1DA 4J3TA 4DZBB 3HI5H 4X6CF 3DXAB 1YPZA 1A8JH 1X5AA 3QI9B 3U7WL 4WWKC 3LOWA 4OLWL 5C1MB 2ZCKL 2K9UA 4Y2OA 3T0VA 1F4AA 4GRLA 4UT6H 2X44D 1S7VA 3Q6FA 4Y5VB 2I24N 1EO7A 2B1AH 3LKRA 2WQRA 3U46B 4PV8B 2YBRB 4NO2B 3TVMB 1IEHA 4PUBH 4EVNB 3EFDH 3O0RH 2IPUK 3AM8A 3MFFB 3QEHA 4TUKL 1E4XL 4PJBB 4B0MM 1I7ZA 1R5WB 1T0MB 5TQ2L 1P7QB 3QNXB 3ZT6A 1X6LA 3QHFH 4OUUA 1IKFH 2J6EL 3ZO0A 4PP1D 2BSED 5MENB 1URLA 3B9AA 3DMMB 3CXHK 2PW2A 1L7TL 2C3XA 3IS0X 4LOUC 2FECL 2H1PL 2IAMD 4D9RD 1N6QH 5IM7A 3GMRB 3T3PF 5A16A 4FP8L 2AJVH 3G08A 3WD5H 5EA0H 2GY5A 5C0BB 1OGAD 1QFWH 5JR1H 1LO4L 4JG0H 1C5CL 4UIKL 3I2CL 4J3WA 2X5PA 4CU6A 1GAFH 5E8PB 5EBMB 1ZLUK 3AB0B 2ZJSL 4YLQT 3OPZH 4N0YH 1XGPB 1YEHH 4X6FA 5D2NE 1FNSH 4JGMA 3QCUH 3IFNH 4GS7C 4XH2B 4LHUA 5CP7A 1CE6A 3IJSA 2OK0L 1I3RB 1T7XA 4I8DA 4F3FA 4L3CA 3GSRB 4KI5D 3V5HA 2ICCA 3RL2A 4TTGA 3MV9E 4G42B 4XVJL 3DHMA 3V5KB 4HMEA 5D72H 4MSWA 4N0FB 2UZYB 5INCA 5AZ2H 1EZVY 1ZLWH 4G6AD 1OVZA 1QSFD 1HE7A 4XP1L 3TO4D 4JDVB 3BKCL 3NPZB 3ZKND 5HYJE 1CWVA 3ZSTA 2DMCA 3BQUD 4QOKA 1FRGL 1F3DH 5KSBB 4X0KA 1FZOB 3FO1B 3MNZA 4AMKL 1HHHB 1FLRH 4HUXB 5L6YH 4JFZL 3CVHL 4X6DE 3SEPA 4HKJB 4F7MB 5D1XB 5KS9A 4ZNEE 1FE8L 1G7PB 3G6JA 3H7BB 3MUGA 2PYEE 4OGXH 3DRQA 1A3LL 1MEXH 3NTCH 3CFJA 3PWJB 4QHLB 4F7CA 1DQTA 1Q9KB 4ONHA 4LKXB 4QNPF 3TESA 4LCCA 2VNCA 3OKOA 3T0DA 3CIQA 2Z9TA 1HCFX 3BMWA 5TDOA 2WSKA 3QWRA 4Q9RH 2EYSA 3VXTA 4YHPA 1YUHA 1IEBB 1WBYA 2NXYD 4NRYA 5I2IB 3JBG7 3B5TA 3VD3A 1R0AL 4E41A 4XCNA 3SKUD 1J0YA 5DRZB 3LY6A 2ATKA 2P24B 2FEEL 5A2LH 3STZA 4N68A 1EXUA 4PJAE 5LJYH 1YEEH 3VD7A 2PXYB 3BD3A 4Y2DC 5HVGB 1QG3A 1L9MA 1YYML 3K4AA 5D6CB 3ARFD 1ONQA 3G6AA 3CU7A 2W9LA 4HJGA 3C8DA 2EKSA 4GUPA 2O5XL 4Q74A 2GFBA 4BQCA 4GLRI 1EUUA 3FO2A 3QUYC 5CCKL 1FG2A 5CILL 1IGFL 3K8MA 5L8JB 3BMVA 4X5XB 3FO0H 2A6JB 3UPAA 1CL7L 4HWUA 5IT2L 1FYHB 2IANB 3BYYA 4KKBD 4OSUH 5ICXA 3WLBB 5HDQL 1N2RA 2IPTL 3SY0A 5IFAL 3JWDC 1WTGT 4NC2B 5C0AD 3QXAB 1UZ6E 3HKFA 1JF1A 2EDRA 1S8DA 1UKQA 1RK0A 2DI7A 5FYKU 1E0OB 3L95B 4OCYL 5D1ZA 2G75A 2EDOA 1LEKA 1TCRB 4WTWA 4JFOB 4JJ5B 3MLUH 2XNAB 3F12B 4X4YB 3UZVB 4TN9A 3B8YA 4YHKL 4JVUA 2DBLH 1IBGL 1M7IB 1FPTL 4DTGH 4POUB 5E8OB 1TIUA 4MB5A 5ILTH 1OLZA 1LEGA 4P23D 3GMPA 1H15B 3PDOB 4YZFE 3MLZL 3GNML 2X89A 4NQUA 5J7CC 1IM9D 1CF8H 1E27A 2JJUA 1YN7A 1MWAA 43CAB 3O6LL 4PJFF 4RQQA 5CHNB 4S10A 4Z76A 1A6TA 4Q9BA 1BMGA 5C86A 1DQLL 1I9JH 5DQDL 5ANMB 3ZDXF 2CIIA 2WV3A 1OGTA 1FV1B 5JDJA 3PGCA 4DKEL 3ROLA 4GAJL 1OD7A 3BSZL 4OCRL 2KDGA 3AFLA 4I3RL 2VLLA 3BPLB 4WEBL 1DQQA 1IE5A 1HHKA 2GJZA 5I71C 4I0PC 3L7EA 1NBZB 1BZ7A 3U0TB 1T5XA 1EEYA 1MIML 2EDJA 3OHXB 3QQ9C 5CEYB 5BXFB 3GHEH 5T1MA 3FQWA 4JO4L 3T1FA 1ZMYA 4AT6A 5DEGB 4WHCA 3NABH 1YY9D 3BWUC 2ITDA 4FQ2L 2VDML 1PW3A 4ZFOB 1A2YA 1JP5A 4O00A 1F4YH 2Z31B 4HT1L 5M95B 3IKCA 1A47A 3PWLA 5CSBA 1YPZE 3MA7B 5IESH 3NBNA 5C09E 4PJBF 5DK0A 2XTLA 1TENA 4U6XA 2R4RL 3RVWC 4M6MH 4V1DA 5F7EL 3UAJD 4JO3H 1REIA 3BJ91 3QZWG 4Y4FD 2Y5TB 1MHCB 1N0XH 3S35H 1MVUA 1VERA 4KQ4L 4MJ6A 1LWRA 4F7EA 4UV4H 1RVFH 2JCCA 2XACC 2EDFA 3HNSH 3WCYA 2AEQH 3BISA 4G8IA 5AUMA 4ZO9A 2VDLH 4H8WC 2D31B 4WHYH 2OR7A 1I3UA 1INDH 4RDQF 1MIEL 1OWRM 7FABH 4RFEB 3U0PA 4XB8A 1YYLL 1UH3A 1C16A 5IB3B 3KPPB 4FQXC 5F3BB 3FO9B 4FXLA 1QLEH 3VFPA 4LP5A 4CVWA 1U8OA 4XCFL 3QIUB 3VFRB 1UH4A 1K4DB 1MJ8H 1JNLL 3BEVB 3SGJC 1WFUA 3VWKD 3IDGB 3IB4A 4LLWB 1AI1H 4LIQE 2ICEA 3L3GB 3IAQA 1A6UL 4X6EB 3RNQA 3SO3C 4R26L 1G6RL 5J57B 2BSSB 5DJZA 3ZLQC 1KG0A 2JK5A 4FFYL 4ZQKA 2DQFA 4P57B 2AP2A 5SWZB 4ZOBA 3EGSB 1AXSB 1HYRC 3ALXA 1IFHH 2YUXA 3LB6C 4GAGL 4K3EL 4W4OC 5DD3H 5K9KB 3VWJD 3LQZA 3C60B 1QNZL 1CLOH 3C09B 3LKOB 5KTEH 2E27L 1AIFB 3EOTH 3QA3A 4R3SA 4YBLC 5CKGA 1FGVH 4PGCA 1A6ZB 1XGUA 4YEEA 3O41B 5L2KE 2EH7H 1YY8B 4QOKE 4HK0B 1T2QH 3EO0A 3QG7L 3K1KC 1Z2KA 4I48B 5H37G 4WJ5A 3RGVA 5E4EC 1X5XA 3D85B 2FX9H 4NBXB 3V6OA 2FX8L 3PE9A 2E8YA 3STBA 1CGUA 4JQXA 5I8CB 3M8OH 3FB5B 3O6MH 5KS9E 3G6JE 4QTHB 5DA0B 5IVZB 2D7MA 5BV7L 4JY6A 4Y19E 3TA3C 4NQDA 5DD0L 5JOFB 3U7YH 1U3HD 2IALB 1X5FA 4HCRH 3TYFA 5ITBH 4JJHA 2W60A 2HN7B 4OM0H 4A6YL 1A4KA 3BH9B 1FHGA 1C08B 4MWFB 3FFDB 1NCBL 2IEPA 3QDGD 3LS4H 1JN6B 5EU7C 4DN3H 4Z95L 5GZND 3T0XA 2DQCH 4PJHB 4Z7UB 1WAAA 4U1KA 3SKJH 4W6XB 5TE4H 2VLRA 5E99H 4P2QB 5I75C 3TPKA 1CDYA 3EFDL 4FQHA 4ODSH 3SGKC 1R5VA 3DX9B 4KRMB 4LNRB 5CJQL 5H94A 3QEUA 4LL9A 4QHUB 4U1JB 4WU5A 3QPXL 1J1OH 3H9SA 4OZHB 3HZKA 3KPRB 1KELL 3OR7B 4HJJL 4PRPA 4LFHG 3JSSA 1JTTA 4OZIB 4TRPH 5BS0B 4ZDHA 4KK5D 1W72B 1NFDB 4HWZB 5DVKA 5C08E 1DDHA 2YPVH 1GGUA 1UEMA 3QO0A 3RVXC 2DDQL 1FBIL 3E2HB 4OKVA 3E6HA 5F3HA 2PUQT 2HP4A 5I15L 2AGJL 4UI2A 32C2A 3RZCC 4JFXB 4ELMB 2HG5B 4HS6A 1GAFL 3P9WB 2DF3A 5B38G 4I3GA 3NCEB 2ORBH 4P4KA 1JGUH 3U1SL 1MNUH 3ULSA 1CFQA 1OTTC 5T5FH 5JNYA 2IFGA 4NRXA 1Z0MA 4YHYC 3IFPA 5ESQB 3MBEA 4N8CL 3QCUL 3IFNL 4UUJA 2PETA 5JW4R 4NZUL 5F96H 1FYTD 4ZFGH 4NM8H 4NZJA 5EOQH 1DCLA 5T3ZE 3MV01 2RFXA 1AFVL 2ICWA 3VFOA 4D0CB 4L8BB 4JY4A 1JPSL 3EYQC 2WUCH 2QADC 3V2AR 5AZ2L 1Y6KR 1I1CA 2AXFA 1QVOA 1A6VL 5C0GB 2KL6A 4PJXF 2B1HL 4C57C 4KPHH 1JNNL 5GS1B 4XVSH 2GTWA 3CUPA 2H6PA 1AGCA 2P7TA 5I6XC 3HRZB 2CMRH 2AXGB 4PLJC 3L5HA 5DFTA 3V79C 5L6YL 4RBPH 1A1NA 1KBGL 4WI3A 2IADA 3B43A 3WL9B 4NT6A 3D87B 3B2UC 2CDGA 2BMKA 1FNGA 1FORL 2F58H 3HS0B 4MNHA 1NKOA 2OL3H 4O2CA 5C0AA 3BDYL 3LZFH 4PGJA 5D9SB 5J12B 3PXHA 3IS1X 4PG9B 3QCTH 3HRPA 3LIZL 1I4FA 3FMGL 4HIHA 2R2HB 4S2SB 2WIMA 1J8KA 5F7LB 5GGRB 3PDGA 1B4JH 4OAWA 5DSCA 2ICES 3C8HA 4OLYH 5CKAA 1TZIA 4P5TA 1A6AB 3IAPA 4MDJA 2NTFB 3NOIA 3W11C 3LDBC 1J0KA 5FHAL 1OAKH 1DANT 2A1WH 4WWID 5IBTH 4FZEL 4ODXB 4K8RL 1WCBA 4WDIB 2NW2B 3TT3L 4LVEA 3OB8A 2D03L 4YHMH 1DL7H 1YEEL 4JFEB 5IUSA 2ZUSA 1O7SA 4EZMA 2VO5A 1LILA 3BVNB 3SKMB 1PFCA 3KDMA 4V1DE 2EDDA 4KROB 1BJMA 4ZOEA 3SDDA 5HD8C 2OXHA 2GT9A 4PV9A 3IGAB 1DSFL 3UROR 2JCCE 3FRPA 3RWEB 2LVCA 4YGAB 2GITA 3RVUD 4EUPB 3VA6A 4X80H 5GS0L 3EYFA 1OP9A 3VFTB 5IVOA 1CFVL 2VWEC 3OGOE 4F7PA 3CFIC 1LNUA 5GRVL 1BQHG 4XAKD 3T3ME 1T0NB 4HLZG 3MMEB 3FTGA 5KVMC 3P4NA 4YHOH 5T3ZL 3MRRA 3WS3A 3HFMH 2CLRB 2H8PA 1OM3L 1HIMH 1LDSA 4KJQC 3UXFA 3WBDA 4KRNA 2BCKA 4H5SB 4KUZL 4U1SA 5CJXC 4B50A 2J8UE 3IETA 1MWAL 1UT9A 4G6MH 2FGWL 4RGNE 4NDMA 3DO7B 3GSQB 1BOGA 5IP4A 4R0LB 3P0YH 5ILTL 1JE6A 4XC1H 3PWVA 4F58L 4O58H 2HRPH 3O45A 4JB9L 3RL1A 3BPOC 1CF8L 2NX5D 1ZLVH 1EDQA 3EHBD 1CR9L 1QLRB 4I3SL 5INDA 4XC3L 2OM5A 2Q8AL 3OKEA 5I74B 3QEQA 5LGHH 4MDIB 4L9LA 3BYTA 3QQ4B 2MNUA 1R3LA 4PB0L 4Y4HC 1JV5A 3UJJH 4LVOC 3C6LA 4S0TD 4G7YL 1JPFB 4X7TA 4PJ7A 4F9PA 5I1IH 5KSAC 2QL1A 5E94B 2I9TB 1I9IH 2RGSA 4GAFB 1XF5B 5I1EH 2OTWB 5J11C 4PR5A 1F4WL 2XKUA 1OGAE 2XPGA 4Y5YC 4UOW0 2CKBA 4CUCA 1OW0C 1ZS8B 4P46C 5DQ9A 4YIQB 4LLMB 1IL1A 3HC3L 3DXAD 5IBLC 1NCWL 3BP4A 3QI9D 4DW2L 3M1BA 3O81A 1PYWB 5FGBC 2CLVA 2X6MA 5JW3H 2VR9A 3L5WA 4PJHF 2ZOKA 3T77B 5EG6C 3V0WL 5EC2B 25C8H 3CFEB 4JRXB 4KI5E 4MS8C 2D7TH 1LE9B 2CRIA 4I0KA 3TVMD 4P3DB 3SE8H 1YNTB 4NKQB 2IMMA 1CK0L 4Y5XB 1CS6A 5K9OB 4W81A 4XZUB 1MRDH 4LGPB 1KC5L 1QSFE 4Z7VB 3AXLA 4K7PH 4NUJB 4MD4B 3WLWD 1P7QD 3P11L 1G0XA 1XR8B 4JPVH 3OMZA 1INQA 1KCUH 2NY7H 3GSUA 2A74B 3DUSB 1N59A 3AM8C 4G7VH 4LHUG 5MEND 4KHTH 1RUQH 1XCQB 4NUGH 5HHOB 3DMMD 3K2MC 1NMAH 2YPLB 4G5ZH 2H9GA 4GG6A 4PRHA 2H2SD 3MRKB 2E7LC 4I18B 2BRQA 3C5JB 3NCJL 4N1HB 1CYGA 2GJJA 4XNMB 5KVDH 3IJHB 4PRPE 3LN5A 5C0BD 1JRHI 3AY4A 3ULUF 1INDL 2WBWB 3MPCA 4AG4L 1J0IA 3MNWB 1GGCL 2PW1B 2DQDL 2EC8A 1U3HA 1KJ2H 2WZPD 5IOPB 5IB1B 4L8DA 5IMOA 5DS8B 5FECA 2UWEA 4O51A 5FOBA 1AO7B 4QRSB 3DV6B 2JIXB 1M6OB 3FOLA 1FDLL 5FAAA 5CMAA 1WT5A 2MCPL 2OR8A 2X4TA 2Y5EA 3MGOB 5DJAB 4X6CA 3KLHD 3MRLB 2R56H 2OZ4H 1BFTA 3H0TA 3I84A 5CS7A 3U36B 1IQWL 4LCIL 3KJ4C 8FABA 1KCLA 5DK2A 4K7FB 2XA8L 5HI5D 5GXBB 1RU9L 1OL0A 1BJ1J 5H37H 3TFKD 3Q6GH 2J5LB 1J9CT 4Y16A 2FATL 2LVEA 4MAUH 3GMMA 2OZ4A 4JAMB 5EU6D 1SM3H 1QSEA 2FSEB 4YWGH 4PGDB 5EIIA 1Q9WB 5L2JB 3VMPA 1HQ4B 3OSKA 3O3EB 5TH2A 2ESVA 1DFBH 1EJ6A 3BX7C 3MOQA 3QG6B 2RAMA 3VFUA 2JE8A 1R24B 3C5ZC 1PZ5A 4U49A 3O6KL 2QR0A 4WHTA 1JHKH 1CLYH 1U8JA 3RWJA 4FXGA 1DR9A 2C7UA 1C8PA 1GHFL 5D1XD 3IFLH 5F7KC 2BSTB 2B0SL 3CMGA 1CGSL 4KK6C 4PB9H 5K93A 3D25A 1BGXL 1JGLH 4HS8H 3S3SA 3C08L 3H2WA 3TBTB 2XN9B 1GPOL 4LSPH 3O6ML 3PL6B 3KYOA 1BPVA 4EDWH 4RMWA 4HG4K 4LSUH 4QRTB 5C0AE 1A14H 2FJFA 3DX6A 4YFLF 1IC4H 3MRCB 1S9YA 2E6QA 5BZDA 1GVIA 3DV4B 5LGJA 4FA8A 1EZVX 5JZ7C 4QO1A 3VRLF 3UZQA 2HTKD 1MRCH 4M48H 5SWQA 4CJ0A 1LP9F 3MC0A 2P5WA 4NNXB 4ZUTA 1IM3A 1MQKL 3VG0L 4WI7A 1EVTC 2V9RA 3Q2CA 1HOCA 2VISB 4GH7B 1FL5B 1E28A 3VMNA 4WW2A 1ETZB 3DROB 3SKJL 3UPCA 1ORSB 3PP4H 1MHHA 5T33H 4JPKH 3RVTC 2O93L 5GGVY 1T1YA 1AC0A 1CFTA 4ZYKB 2R0KH 1CICB 5CLWA 3WHE1 1CVRA 2M8XA 4OLZH 5EO0B 4G8EB 2VXUH 3ZTNH 3DURB 1KPVB 1DQDH 3UTTA 1GGIL 1AKJD 3K8KA 1EJOH 2IAND 4UDUB 5HSFA 1MLBA 2NYYD 5FGCE 1KPRB 5TF1L 1AGDB 3MLWL 4RA3A 4U6YA 2J2ZA 4ISVA 4BSJA 3D0LB 4DK3A 4MQXC 3INUH 1KIRB 1N6UA 3LKQB 3KYMB 4CN6A 5I73B 4XAWH 2GW5A 5LBSH 5GS0C 1H0DA 3PHOA 3LKPA 4HK3N 1OQXA 2C1OA 4PRNA 3DBXA 4S1DD 4NM4L 4BQ8A 3BDXA 5D1ZC 1WBXB 5T5FL 2FWOA 1RIHL 3ZTJG 4WI4A 1M4KA 1J1XH 1TNMA 5F96L 4ZFGL 1CVSC 5F1IB 3WN5B 4X5LA 1WEJL 3TNMB 4E5XB 4OFKA 1F00I 1TJHH 3P0VH 4ODVL 3H8NA 4YK4B 4HKBB 1YN6A 3DYOA 1HYSD 1LDPL 1IQDA 4WFFE 4RBPK 4LRNH 1JZ3A 3BE1L 3GSVA 3HG1A 1JGEB 5HYSA 1YQVL 2XOTA 2BNQB 5DJ2A 5ESVB 3A67L 3OF6A 4OLVL 1EVUA 3T8XA 1Z5LA 4I2XB 2IH1B 2AJ3A 4Y89A 1ZK9A 4F8QA 3VFGL 4LKCB 5I9QB 5HHPB 2VDPH 4AEHL 1A6WH 5C6TH 4RZCA 3JWOH 5F8RC 1IGTA 1VPOH 1RD6A 1CTNA 3MRGA 1JI2A 1UCBH 2P8MA 4RISH 5B21A 4XRCA 5DURB 2Z8VC 1BZ9A 4FQQB 5I1DA 2I07B 3BZ4A 2Z31D 2WLYA 1NGYA 5EOTA 4OLXL 1W0VA 1L0YA 4HX1A 4WWKB 4PJCE 3QULA 2HAZA 1K85A 2X4SB 2WMPA 3K80A 4O5LL 4MYWB 3T0EB 3UTPD 1H3UA 4WTZG 3RU8H 1IGYA 3MV8D 1JBJA 2GTZA 1VCAA 3LN4A 5BW7C 2ZUQC 1YNKH 1QA9A 5GGRY 3LHPH 2XFXA 1DLFH 5EZJA 4MMXC 3WHXB 1RUAL 4BH8B 3LEVH 4CNIA 2HVJB 4YHML 3MA9H 4M5YH 4WY7H 3VGFA 4PJFA 3KPQB 4OI7A 4LLQB 1QKZH 1IC1A 1MFDL 3FAXA 5GRXG 4YHNB 4X7SH 3BZDA 4XGZB 4D0DB 3VGHA 3TJEH 1WZKA 4HLZH 4F8TA 3BKMH 4QTIH 5FO9A 5L9DH 3REVB 1JL8A 3Q5YA 4ALAH 2VLKB 2Y1VA 4OJFL 3V6FB 5E2UL 1BFVH 4NQXB 3U0WH 2KUTA 4KKCC 3RWIA 1FZJA 1RURL 3AU1B 2EDQA 4JRYA 4P2RB 3SE3A 5C0NC 3QIUD 3VH8G 1YEFL 2QEJA 5J56B 3B9EA 4WI6A 3DXAA 4R8WL 1QBAA 5C07B 3QI9A 3ZDYE 4X98B 5HHNB 4KJWC 5LXGH 3GSWB 2UWEE 4PREA 1G7HB 3RY6A 4XX1E 5F7NC 4D3CH 4HIEB 3S5LB 2ADIB 2MTPA 1VB9A 4RGNC 4PS4L 5SWZD 2YBRA 4XPHL 4U2YA 3QDGE 4NC0B 2EC9T 1CLZH 1F2QA 1AD0B 2EZ0D 5TE7L 5DJCB 3MFFA 5C0IB 2H2PC 1ZLVK 3C60D 3C8KA 4PJBA 1VA9A 5FM8A 1T0MA 3QNXA 5MEOB 1G7JA 2C3GA 4XC1L 1Q38A 1P84J 4XPFL 4K71C 3MJ8B 2DQIH 1EFQA 1G1YA 3ARVA 3F7RA 1NC2B 2YMXL 4CVXB 2ENYA 4BM7A 5HPOA 2WP3T 4XTRC 3GMRA 2JJTC 4LLDA 1NLBL 2ESVE 3D85D 5AAWA 1FO0B 5L88L 5DD1H 1NCNA 3TYGH 2CKBL 3OKKB 5C0CA 2FYYB 4CGTA 3QFJA 3ZKMC 3HR6A 3RGVC 5CSZB 2Y25A 5B22A 1KSRA 3V6OC 4XPGH 3BGFC 5EBMA 4JQXC 1I9IL 2NY4B 4ZXBA 1WSST 2M1KA 5D5MF 1OF2B 4EXKA 1XGPA 3UTZB 5I1EL 5JXEA 4OZGB 3KR3L 4N5UA 1TFHA 4JQVC 2XQBH 3TJHD 4NGHL 2VR4A 4MXVE 4XP6L 4JQIH 3UJIL 4W68A 3I3BA 5GRJH 3DETC 4G42A 3V5KA 4N0FA 5SV4A 3HNVH 1F8TL 5C2UB 2ZUUA 3MLSL 3CNKA 1GH7A 3D2UB 3S96B 5FA4A 3FQTB 4M7JL 4GMSL 1L7IH 4XCEA 4LQFH 4Y2DB 4Y88A 4P2QD 4G8GB 2DJ4A 1JNHB 1UG9A 3BDBA 3VI4F 1K2DA 3IRPX 1FZOA 1OHQA 2VZTA 3FO1A 4DOHB 5JHDB 1CDBA 1S5HA 5GZOD 4K7PL 1IVLA 3SOBL 5FO8A 2X1XR 1UACH 5LAXB 1N6VA 2QHRL 3EBAA 3KPRD 4ZOCA 1VGEH 1YJDH 2NY7L 4HKJA 1U8HB 3TP4A 1GYAA 4HHAB 5D1XA 4PTUB 1G7PA 3H7BA 4XI5D 5BS0D 1EK3A 1NMAL 3QUYB 4G5ZL 3X3GL 5EN2A 3NCBB 1CFBA 2R0WL 4XHJC 5F7FA 2X7LA 4FG6C 4AIZB 3PWJA 3GIVB 4QHLA 5IW3A 4LKXA 1N64H 3MLPA 3MRDB 1FH5L 3EO1B 3VFMB 3WFBL 2NLJA 2DIBA 4YFDB 5F7DB 4UILH 3F8UB 4DFIA 1UCTA 3I02B 5I2IA 1JRHL 2UZIH 3H3PH 1WFTA 5DRZA 2P24A 5EZIL 2J12B 4QNPE 3V9FA 3T4AB 5FYJU 1OCWH 1C1EH 2Y36H 3BP7B 4YR6B 1RULL 4P4KC 2B8OT 4OV5A 2PXYA 4YJZL 2OZ4L 5T5NF 3MBEC 1RZKH 1ZXQA 4Z0BL 3FJTA 4BYHA 3TIDA 3EYVB 3V0AC 4YDKH 1DBBL 5TDPB 3GUTB 4G9FA 3VXMA 5DMKB 3FQRB 3GKWH 1GIGH 4ZUUB 3EZJB 3VI3F 2WP3O 4HH9B 2X4RB 2XRAL 3TNNA 4FQLH 4OD3L 5I71B 5IVXB 1JHKL 3OXRA 3EYOA 4I0PB 4ETYA 4HKZB 3HG1E 2BZDA 4TSBH 3WLBA 3PWUB 4YE4H 2AABH 1U3JA 3QXAA 3QDJD 3PWNB 4U1MB 1KN4L 3VXNB 5IF0B 3Q5OA 2FB4L 2XV6B 2VYRE 3L95A 3LV3B 4XAKE 4BQBA 2QQNH 3KYKH 4EDWL 2NZIA 4JFOA 4JREC 3DSFH 4GXVL 5DHXB 1A14L 3IDYC 4G6JL 2VH5L 3CD4A 1M7IA 4YHZH 3V4VL 4NQSB 3PDOA 3B2VL 6FABL 4P5TC 2FO4B 2X4QB 3AS3A 5CHNA 5HHXH 1ZVHA 3UYPA 2PO6B 5CUSH 2HJFA 5ANMA 3SHSA 1SY6A 3W5MA 3SKOB 2V17H 2G60L 4FXKB 5DZOA 1X5ZA 5IKCB 4GAYB 3WFEH 4D8PA 2Z4QA 3IFOA 3QFDB 4M7KH 1CQKA 4PJXA 3PP4L 5T33L 1J8HD 4LCWA 2CJUH 3SDDC 1VEMA 3BESR 2CXKA 3OHXA 1CT8A 2F74B 4J3SA 4WUKH 1OSPH 1F45A 4PJIE 1GZQA 2Q7YB 3DYPA 5J13C 3O4OC 5DEGA 4K3JL 4FQXB 4RX4A 2HFGH 1FNFA 4JZOA 4YEFA 3KNBB 2WIIB 3ZTJH 4ZFOA 4B7IA 3NIFF 1CG9A 1HHJA 4PGBA 4KDTA 2Z31A 4Z7OE 4XMKL 3KHQA 1U6AL 2B4CL 4CKVX 3DXAE 2VDOL 3OAYH 1PBYA 4KKAD 4MB3A 1D5ZB 2W0FA 1FCCA 3WNKA 1L0QA 1CGWA 5CZXC 2Y5TA 1NGWB 4RMUA 4JM2D 4QGYA 1NCDL 4POZC 1G7LB 1MUJB 2F15A 3LD8C 3BPCA 1F3JB 4YBLB 5E24E 4PJBE 1N8ZB 3QRGL 2FD6L 2B2XL 3MXWL 3MLRL 4M8QB 3WS6C 5MENE 4QXUH 3GSXA 4Y8DC 3CPLA 4QHKI 1TJGH 1YEGL 2BVYA 4JN2B 4NQTA 5JHLH 2AK4B 4M61A 4L9LC 5A2FA 3QEGH 5IGXL 5HI3C 1IC7L 3C6LC 5F3BA 3FO9A 4DGVL 4OZGF 1EO5A 3GBNH 3FN0L 5C0BE 5DRWB 3VFRA 3FONA 1K4DA 3OX8B 4QYOA 1J7VR 2Q8BL 4JFQA 2H32B 1LO3L 3TA3B 5C6TL 3JWOL 3IDGA 4NO3B 4LLWA 1SYVB 3L3GA 3THMH 3H3BC 4X6EA 3O6FA 3QWOB 5HYIA 2DOCA 3BJLA 4UTBL 1I1AA 4Z7WA 2XA3A 2EDKA 3BXNA 3MUZ1 4LARH 2QHLA 4LVHC 3RUGF 1F4XL 4LEOB 5BJTA 2NMSA 2CLZB 3EGSA 1MHPL 3BPNB 5J1SC 1TETH 2R4SH 4HAFA 5K9KA 2IMNA 5DFWH 3NZ8B 2ITCB 1T03H 1IT9H 3X3FL 1XF4B 1AIFA 3RQ3A 1DEEA 3KJ6H 4CU8A 3UYOD 3SKNB 4UAOB 1A6ZA 4XBEL 5AYUH 4Q6YA 1V05A 3GI8H 2X1OA 1WZLA 4BKLB 3HAEG 2BVPB 4HK0A 1AJ7L 5BVPL 4NWTL 4NHUA 5KSBE 5D4QA 5HHOD 1MCRA 4ERSH 2YPLD 5TE6H 1A1OB 4DVBB 2OTPA 1R3JB 4HZAA 5I8CA 2I9LA 1L9NA 4X7SL 5GS2D 1BWWA 1AXIB 3CLEL 4TTDC 4KUCF 4MXWH 4XHQA 5IVZA 2H3NB 1KLGB 4LLYA 1BVZA 4V2CB 2EIZB 1XGYL 5JOFA 1WIPA 1VDGA 3WNOA 1XGRA 1OP3H 1GOHA 4ODUA 1BFVL 3EOYG 5F93C 3U0WL 3AY4C 5F6HI 1AO7D 2AEPL 2JIXD 2NY3B 3TBWB 2RR3A 3RZCB 3P4MA 1MCNA 1S7RB 3IU3B 4XNYL 3FOMA 1C08A 1WJ3A 5FYLE 4MWFA 2DLFH 1JFQH 4TSAL 4OCXH 1AD9A 1MI5A 2R23B 5JO5B 1JN6A 2IFFH 4YHYB 1WT5C 3NACH 1J05B 2P48B 5TDNB 3MCKB 4KVCH 4IJ3C 4PJHA 4NQEB 1VKXB 3C6SA 3UBXG 4KJPD 1PGRB 1T22B 2OBGA 1ZHLA 4LNRA 5HHQB 3IVKB 4QHUA 2VXVH 1HEZA 4P9HL 4U1JA 5C9JB 4J4PA 1V7NL 2QJDA 3ZSSA 5IVXF 1U2CA 4Y16C 2VXTH 5T1LB 3KVQA 4LSRH 3W39A 5DWUL 1KJVA 4LSTH 3ULUH 2FCBA 2EDEA 3B5HA 1R3KB 3VMOA 2XG5A 1IAIH 4MA8L 3T65B 4IHOB 5A3ID 1U3YA 4HDIB 4DN4H 5C7XH 5E6IB 3Q5TA 2AJUH 4QY8A 4WU7B 2XN9D 4I5BA 1LO0L 3PL6D 1LE5B 4NZRL 5TQ0H 2IANE 3FQUB 3MRBB 2UY7A 1U3ZA 4JFXA 1EUTA 4L29A 4PJGB 1RPQA 4S11A 3HI6H 2CGRH 3MODL 4H0IA 4KJYB 4LF3A 4YDVB 3L3HA 3MLXL 5J06A 5ESQA 1H8OA 1F11B 3NFNA 3U4AA 1ZVSB 1FZMB 5FDWB 1I1RA 3ESVF 3TIEB 3SPVB 3X14A 3KPMB 1GOGA 1PKOA 3HNTL 1S78D 4WO4C 5E03A 3GBLA 2C3VB 1XIWA 3LDBB 4D0CA 2Q20A 5FUZH 4HZLB 2OP4L 4LMQI 1AGEB 4C58B 3DI2B 1OTUC 5KVFH 5C0GA 5TGBB 2DYPB 2KBGA 4O2EB 5FGSA 2ZUXA 3MZGB 5GS1A 1AC6A 1NCAH 5ANME 4LSSH 5HDBF 4PFEA 5DHVH 2EDNA 4WW2C 4G43B 1F90L 5GIRA 4ZD3H 3MCLH 4K2UH 2HT4D 1OAQH 1SEBB 3S36H 2CK2A 2C4XA 4HBCH 4QLRA 1D5BB 1KEML 4MGXA 4ENEC 5FYLL 3OG6B 3KWWA 5AAMA 5E95B 5D9SA 3WKML 1HINL 4PG9A 1FC2D 3CCHB 2ENSA 5I17B 1RK1B 2CUIA 4WEUD 4XMLH 2R2HA 4S2SA 4HFWB 2LU3A 5GGRA 2V7NB 1GGBL 1HH6A 1RMFL 5E8DH 3U6RB 4RFOH 5FB8B 1A6AA 5A2IH 5T1DL 1J5OH 2UZIL 1RZ7H 3RGHA 2NTFA 5F72S 5BRZB 1T20B 1VADB 4OQTA 5MERB 4OT1L 2EYTA 5J6HB 4YXHL 1OTSC 2NW2A 4WDIA 4GKNB 4PJDB 2Z91B 1FAKT 1F2XK 4OFYA 1J0HA 1TZHB 3EOAB 3VGAC 1J86A 5IMLB 4X6BA 3QIBD 1Z3GH 4JFEA 3RWFB 1LP9A 2HLAB 3MV8E 1VENA 2UYLB 5HGDB 5I1KL 4MJIB 2JJVA 4H26B 2BVOB 3JV4B 3ZE1E 1KTLB 1P69B 3QJFB 1KEGL 3IGAA 5CBAB 1VGKB 4BUGA 3RWEA 2DTML 4YXKL 1A7BA 4JZJB 3SDCB 4K94L 4EUPA 4Y4HB 2BNQD 4LVOB 2DLHA 5C92A 1FP5A 1N4XL 4NHCH 3VFTA 3TBYA 5KSAB 4ODWA 4PRBB 4FQLL 4BSWA 5HI4C 2YEZB 1CFNB 1ZHNB 3MMEA 5J11B 3KPLB 15C8H 2DQHL 3OZ9H 2ZKHL 2CLRA 1MCWW 4UU9B 5DURD 2MHAB 3NZHH 2FIKA 4HXAH 4U05A 2J4WH 4F57H 1N7MH 1WWWX 1X7QA 4H5SA 2RB8A 1BD2A 1MCHA 1D6VH 4OZ4B 4YDIL 4AM0B 4WWKD 3MOAH 4CBPA 1T5WB 1FFRA 1SY6L 1S9XB 3S98A 3T0WA 1P7KB 3JWOC 4XVTH 5SWZE 3UDWA 1S9WB 4TNVK 3STLA 2DLTA 1GRWA 3QO1A 3WKNA 1S7VB 1C5DB 3Q6FB 2ZCHL 2R1WA 4GXUN 3LKRB 5IQ7L 1F4HA 5CUSL 3H6JA 4RGOL 3HZVB 1WLHA 4UT9H 3QEHB 2XY1A 1JPFA 3CDFA 5ECJE 1T6VN 2GAZA 1P2CB 4LOUD 5IB2B 3AROA 3HPLB 1T83A 5D2LA 5E94A 1QBMH 2I9TA 2YS4A 1PX3A 2ICWJ 2XZCL 1EMTL 3CFDA 2PCPB 1XF5A 2OTWA 4ZFOL 5DMIL 1R3IH 4OTXH 3CLFH 1MFBH 1GSMA 5IM7B 4S1RH 4P2RD 4ZPVB 4NN5C 1KACB 5A16B 3G08B 4NWUH 3RWHB 1JK8A 2QQLL 4A2LA 2ED8A 3OAYK 2DMKA 4HS3A 4HWNA 2QTEA 2Z8SA 1OD9A 2IWGA 1PYWA 2AI0L 4Z7NF 5DC4B 1MCPL 5HBBA 2VDKL 3T77A 5EBLB 3IDIB 3BAEL 4JRXA 4ONOA 1LE9A 2YWZA 5T3XL 4X6FB 3I75B 4P3DA 3L5XH 2Z0BA 1LD9B 1TNNA 3OB0K 3RY6C 2BP3A 4RDQG 5E9DD 1CE6B 2IGFL 2ZSVA 5CEXA 5K9OA 3JV0A 3KJ4B 4NUJA 4F3FB 4L3CB 2XIDA 4MD4A 2DQUL 3V5HB 4ZUWA 1XAUA 4R4FH 2XTJC 4Z7UE 5DJDA 5E5UB 5J9PA 2KZWA 1JMXA 1EO8H 4P3CH 4P2QE 2GI7A 4S1QL 3GBMH 2VITA 4UB0L 1WITA 1NC2D 3IU4L 4Q97A 5E08H 1JTPA 4I18A 3C5JA 4XCCL 4GSDH 4Q6IB 2YKLL 4OZHE 4IS6B 3KPRE 3C5ZB 4XNMA 3RJDA 1I7TA 4M43H 1G6VK 4X0KB 1FAIH 2APWA 1NFKA 2Y23A 1NL0H 4OZIE 5BS0E 4DQOL 1TJGL 4PJGF 2PW1A 1NFDE 3CFCH 5JHLL 5IK3B 4EQ2A 4NKDA 1I8MA 3QEGL 3QNYB 3MUGB 4QRSA 1M6OA 3BRDA 1CZ8H 1TZGH 4GMTL 2ZCLL 3CFJB 3AB0C 2Y07H 1HZHL 1JYNA 4F7CB 4ZXBC 4ELME 4HF5L 4X9FA 2VLMD 1F6FB 1ACYL 3OKOB 1LK2B 1FC1A 1X5GA 5JXEC 1Y18B 5GJSH 3BWAA 1M1SA 2VZSA 2EYSB 3HAEH 2JTDA 4K7FA 1A0QH 1WBYB 2NR6C 3D2UD 4P49A 1IGMH 1SMAA 3NIGF 4E41B 4KDVA 4M8VA 4XCNB 2LU4A 1PSKH 2ATKB 2B39A 4Y2DD 5ACLA 4G8GD 5JHDD 1Q9WA 5L2JA 1JZ8A 1HQ4A 5CBEA 3ARDB 1AXTH 3QG6A 3S4SB 3T2NH 3LMJL 5CGYC 3LS5H 3Q3GB 5F9AC 4FQJL 2K3TA 3EYSL 3G6AB 3QUYD 4ONGH 1K6QH 1JHLL 5DT1H 5D7LB 4HJGB 3TBTA 3U2SB 3QRFM 4EOWL 1OP3K 5LGKA 2V5YA 1OOAA 3F7VB 5I1HL 3L9RA 1CXEA 3G6DH 3VFSA 4LMQE 3CVIH 3WO4C 1ZANL 4YNYB 5EFIB 4KTDL 4QRTA 5F70A 2QSCH 1A3QA 5I16B 4HWBH 4PJ8C 3MNVB 1YJDC 4TULL 1IKNA 4PJDF 5D5MA 3DV4A 1MOEA 3OAUL 2ID5A 4I4WB 5IMMA 2AEWA 3SY0B 4TUJB 4F33A 1A5FH 2EDLA 1U8QB 4BZ2H 1P4IH 1B0WA 1I85A 1S8DB 1KJ3H 3QUMH 1RK0B 4NNXA 4HWBA 2A83A 2P5EA 4Z7QE 2IFFL 1WCQA 5E2WL 3I6KB 2R0LH 2R9HC 4QRPA 2VISA 2DL9A 2VOTA 1UYWH 3V8CA 2PXYC 4LNVA 2KKQA 3VRLE 1D3CA 4MHHI 1ORSA 4PBXA 1ORQA 2EDXA 4JFEE 5EUOB 1N3NA 3U4BL 4RCAA 5GRYA 4U6VL 1E27B 1CICA 2JJSA 1KIQA 5CZVL 4RQQB 1KTRL 1QFHA 4KTEL 4Z76B 3QPQC 2WAHA 4JHAL 5EO0A 3OKDA 4G8EA 1RFDL 3WFHB 2CIIB 5KAQG 1CU4H 4HMDA 2IBGA 1J8HE 1XR9B 1RZKC 4I0PD 3ROLB 3ULUL 3IDXH 4UDUA 4LPVA 4YX2H 1G0DA 3MLYH 4Z9KB 3QQ9D 1DQQB 1AGDA 1HHKB 5C3TA 1YC7A 1L4IA 5HPMB 4DN4L 3D0LA 3QUXA 4X99A 2X9YA 4ZS7H 5C7XL 2K7QA 1W0WA 3LKQA 2LE9A 4O2FA 4MA3A 2HH0L 1T5XB 1EEYB 2BJML 1MFCL 5TQ0L 2GJ6B 4M4RA 2VLJD 2OR9H 4FQCH 3RTQA 2WNGA 3BT2L 1XGQA 1XF2A 1OAYH 4AT6B 1WBXA 2AEIT 1SBSH 4RMVA 5LCVL 1SQ2N 4M6AA 3QHTC 1M71B 1A2YB 3QCVL 5KSUA 4NNPH 5IFJB 3CDGA 2O5YL 4HGMA 4K3GA 3PWLB 3TNMA 4KTYA 3RVWD 3U9PH 2ZUQB 4FNLL 4HXBL 2E5EA 1ZHBA 1MPAH 4HKBA 3LPFA 4U6XB 1QR1A 1MCQA 1E6JH 1EHLH 3VXPA 5B39A 1MVUB 1NCAL 1YEKH 4GW5B 4LSSL 2BNQA 5ESVA 5K33A 5I18H 3SBWA 4I2XA 2IH1A 4ZSOB 4LKCA 4FQIH 4G8IB 4K2UL 5AUMB 2F5BL 4S0SD 1BLNA 5J0BA 4PYGA 4GRWH 1WZ1H 3BO8B 4FQXD 5F7HA 4G3YL 1DQJB 4YXLL 3WV0A 2I07A 2B7DT 4OQTL 4LU5L 4DGIL 1C16B 2FHBA 3FT3B 3ELAT 1HHGB 4XMLL 4WWKA 4XPBH 1U8OB 1CXKA 4CL7A 1CDHA 5E8DL 2F19L 4KDTC 3FT4A 5IB5B 3T0EA 2AJSL 1DBJL 4NN7B 4JY5H 4AEIH 1J5OL 4JFFD 2DRUA 3BH8A 2DB8A 3RNQB 4JRXE 2DQJH 3EDEA 4MJ5B 1KIPA 4Z0XA 1KG0B 2JK5B 3LB6D 4BH8A 3A6CH 4KY1L 3E6FB 5GS3A 4X9IA 5FYKH 3KPQA 3TV3L 3JV5A 3PQYA 4Z7VE 5K9QI 1UZ8A 3W2DL 3DX7B 1T7YA 1I1FA 4P4RB 4K71B 3GB7B 35C8H 1JZ4A 3I9GL 3DUUB 3LQZB 2XYCA 4XGZA 4D0DA 5GGQL 3MUJA 3QA3B 1RHFA 2AJZB 3L7FA 5HHOE 3D18B 2YPLE 3HHRB 3TGXA 2BVUA 4PGCB 3KHOA 1XGUB 2QQKH 3S9DB 2VLKA 1RZIA 1H3VA 5F1NB 5LWYH 1AQKL 4EKXA 4YHLL 4NHCL 3RGVB 1QSZA 4WJ5B 1NEZG 2YK1L 1KYOK 4JANA 3BGFB 5C07A 5D7JA 4QGTA 1EIBA 1A7QH 3T2OA 3TA3D 4XMPH 5JPMA 2JKXA 5CEZD 4X98A 5HHNA 1K9TA 1G7HA 4G80B 4KVNL 1AO7E 1QSVA 3B3IA 4HIEA 4M3JA 3S5LA 4BFIB 4JY6B 3NZHL 1ZLSH 4NQDB 4JR9L 2ADFH 3S37X 3P4OA 3O6FC 5DUMH 4AH2A 3ES6A 4U3CA 5DJCA 4OZFH 2XKSA 4KZDH 1I1AC 5B8CA 2I26N 2R0ZH 3T1WA 5B3JF 4M62H 1A4KB 3LSOA