1F2QA

Crystal structure of the human high-affinity ige receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
167
Chain Sequence
KPKVSLNPPWNRIFKGENVTLTCNGNNFSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human high-affinity IgE receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT
total genus 32
structure length 167
sequence length 171
ec nomenclature
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f2qA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f2qA02
1BM3H 4G6JL 1H5BC 1ZT1A 4XPAH 2BVOB 4HJGB 3D25A 1G9NL 5GS2D 1I3UA 1N59A 4I13B 1D9KC 4JRXA 2OJEB 1GL4B 4Y8AA 3HNSL 3TA3C 3BZFA 1BX2B 3DVGA 2YEZB 2NX5E 3MGOA 2VZSA 3UAJC 4GQ9H 1U8MB 3DSFL 25C8H 1C5CH 5IMOB 4NJAL 5DXWA 1EZVX 1GAFL 3PF2A 4M1CD 4HX1A 4OV6F 4H0HB 2BFVL 2W9EL 5CJOH 4WWID 4ODSL 4LEXH 2X9WA 1J88A 2DIJA 4X4MA 4AG4H 3CUPB 2QLVB 5I15H 4XVTH 1TZGH 1MHEB 1JWMB 1JYXA 4Y4FB 3NTCH 4P5TC 2F19L 4CVUA 2GJ6B 4AEFA 3RX7A 2ADFL 3BQUC 4YHML 3CVHB 4U1KA 2ORBL 3S37L 3AXLB 2X4PA 3O4LB 1JN6B 3HS0A 1U91A 3OR7A 2Y9RT 2FJHA 4ODTH 2PW2B 2XA8L 1D5MA 1RK0A 4FS0A 5GS1A 3W9EA 2FGWH 5IV2A 3DBXB 4U2YA 1ZANL 3JBG7 2NY6B 3BD4A 3EO1B 3HUJF 4FN0A 1ZE3C 1OWWA 3GO1H 5AG9A 3RPIB 1CXHA 3BYTA 4KI5E 1GOFA 1K4DA 4YXLH 3LEXA 2WWKO 5EU7C 3T77A 5D6DC 3GSQB 2HTLD 3U0WH 3S35X 1CGUA 4XCNA 1B0RB 3FO2B 3I2CH 5DJYA 3NFNA 3O3EB 2JJWA 4XXCA 3GKWL 5AYUL 1YZZA 1WBXA 4OLUH 1BQLL 1QA9A 1QBLL 4NJAH 1UB5B 1IC4L 3AC0A 4MDJA 2FSEB 3KYNB 5ELIA 2EIZA 3VFTB 3F12A 5HY9B 5E8PA 1JF1B 1DP0A 1I8MB 4G6AD 1MJUL 4YHLH 2ICWJ 5EFIA 3VFNB 3QDJE 1FDLH 1PZ5A 3LKRA 2AGJH 1XH3A 3UJTH 2CH8A 5I1HH 1TTFA 2APTA 1INDH 1DEEB 4OCXH 5BXFA 2OK0H 4HUXB 4Z0BH 4Z7OE 3V6OC 5DVLA 4KQ4H 1LO0H 2HT3C 2PO6A 4TOYL 1AXTH 1CFVH 2E8YA 4EBQL 1FFNA 5ITBH 1J87A 3LKNB 2O5XH 4YWGL 5HHPA 3QIUB 1OD7A 2BVEA 2PW1B 1CFQA 1DBAL 2D31B 4Y19A 2P5WE 3B9KD 5T3ZH 3QUYB 3HE7B 3GZKA 4NZTL 5DJAB 4M1GH 3OJVC 4TYUA 2CDFB 3PGCB 1W72H 1KV3A 3D3VE 1FFPA 3W9DB 3OG6B 1LDPH 4Z77B 1FYTB 3CXDH 1OAYL 1D3CA 2NZIA 2X70A 4PUBH 3BFOA 1YN7A 3Q2CA 2LVCA 1XGUA 1D5IL 2IBZX 5FA4A 2XRAH 3C6LC 4AENB 3MFFB 4NNPH 1SJVA 2PF6A 1UADC 5CP7B 2NY3D 5IKCA 3MRBB 5IWLC 3HI1B 4FTVD 3FT4B 5INCA 1MHHA 4PB0L 3RUGF 3CFCL 4PJAB 4XP9L 5I9QC 4AL8L 1FG2B 3L5HA 1PGRB 3WS6A 1F3RB 1BFOB 5E8OB 3O4LD 43CAA 1S78C 5I19L 5EZIH 5GXBB 4O00A 1HKLL 3BPNB 5JXAH 3O4OC 1YPZE 5HY9A 1N5YL 4PBVC 4IM8A 1ETZA 4LVEA 5IIEB 4CNIB 3T4AB 5FV1L 3SDDC 4NQSB 1I4FA 2CDGA 5JXAL 5DJXB 4O4YL 3ZSTA 4O2EB 4LSRH 2CJUH 4D9LH 2DL2A 5IMLB 4FQXD 3U7YL 1ZHKB 3UDWA 4R2GD 2DLIA 2P44B 2PXYB 4YHOH 1ZTXH 3V4UL 5GRWA 1U3HD 1Q9OA 4MAUH 3QCUH 2V5RA 3AY4C 2HFFB 3UXFA 1T2QL 1TJGL 4A6YB 4DKEL 4POUB 2NMSA 1YQVL 3S37H 4OZGB 1O7VA 3D39B 4G9FA 2UYLB 1NKOA 1WIOA 4DTGH 2YN5A 5TGBB 4HS3A 5AZEH 4KROD 5JW4Q 4Z7UE 5KG9A 1FNEB 3HE7A 3QEHA 1FE8L 1MREL 4QYOA 3X11A 3ARFC 4LRNL 1C08B 1Z2KA 2R1YB 2A6IB 4M1GL 2HMID 5DHVH 1NMBL 2YSSB 3IDXL 1Q9OB 1KJVB 5A2LH 5GHWH 4R2GC 1JPFA 3AGVA 3LZFH 2UY6A 3RU8L 2X10A 4FQXC 1NQBA 1B0GA 4NZDA 1MF2H 3JTSA 1F2QA 1AXSB 1YECH 1NGQL 4PRHA 5E2TH 2YD1A 3TIEB 3QULA 3MLSH 1ORSB 4MLIA 1FO0L 5FIEA 4ODUA 3QNXA 4OD3L 5JW4M 1LO0L 2AAVA 4ODHH 1EJOH 1H5BA 1RZKH 1LO2H 4NQEA 1XR8B 5KS9B 3RWFA 3TCLB 5J12C 1AQDA 5HD8C 1L7TL 3JV5A 3OHXB 3CLEH 3TLRA 4MA8H 5IGXL 4JVPA 1G0XA 3T0EB 1A6TB 1MPAL 5DT1L 4LEOB 3MPCA 2P42B 4BSJA 5IB3B 2E7CA 1ND0A 4G6JH 5CZKA 4X9GA 3IDUA 2FX9H 3ZDYF 4KRMB 3B2UD 3KPSA 4HWEL 1J5OH 2HG5B 4DVBB 2ATPB 2XT1B 5EU6B 1PSKL 4LLQA 3VE0B 2F53B 3KPRD 3L7FA 1WJ3A 4LARH 1OTTC 2IPKA 1UA6L 3BQUD 4UIMA 5BVPL 4P46D 3P73B 4PJ5A 1MRFH 2V9RA 4BH7A 4NN7B 3QJFA 2HFGH 3MZGB 4JZJC 2UWEA 4PTUB 2EYTA 3QRGL 3S36H 3FN9A 4AT6A 3HNTL 2FIKA 3WXVL 1RIVL 3GSNH 3TH4T 4RQQB 5D70L 1NANH 3S35L 2ICWI 2SEBA 1W0WB 3TVMA 1OT2A 1XAUA 2V2WA 4P2RD 4UIKL 4XAKD 1B90A 1MAMH 1CLZL 2A83B 1Q9WA 5HYSG 1XCQB 3GSNA 3O6FC 3QCUL 1UB6A 4YQXL 4ZG1A 1AGCA 4OKVA 3DLQR 4EDWH 4OAWA 1L4IA 1ZTXL 5SWZB 3H3PH 5EUKA 4UOW1 5D2NE 2H45A 1U8HB 5DC4B 3MV9A 1WEJL 1RJZB 2PYFB 2BNQE 2DKUA 3P9MB 1U6AL 1P84K 5F96L 1DQQA 2VXVH 4OCMC 1MFAH 3FTGA 3C5JA 1CLOH 2DJUA 1MIEH 2C7UB 3OSKA 4GRWH 5I75C 3RL2B 1T89C 4PRAB 3FQXB 4F8QA 3GSNB 3IU3A 1LP9B 3LS4H 4UUJB 3MUGB 4X8JA 1O0VA 1BQHA 1UVQA 1U41A 5A2KH 1A7QL 1C5CL 4KV5E 4YNYB 1W8NA 2EC8A 3S5LB 2Q86B 3S96B 3L3KA 4ONOA 4PPTA 1W0YT 3TBTA 5FYKE 4X98A 4NOBA 5IFJA 2AEWA 4JFDB 4D3CL 1R3KA 1JVKA 5INCB 1FIGL 1Q0YL 2CXGA 3FT4A 1G6RA 5DA0B 2F74A 5GGUA 2QQLL 3DBXA 3H42L 3NACH 3KLDA 4LHQB 2FH6A 2AXFA 1KJ2B 3JXAA 3TF7C 3O2WL 3MSPA 4PRHD 4JCLA 4OLXL 4RGOH 4YX2L 5HDQL 1JZ3A 4L1HA 2D0FA 4TQEH 4MD4A 2MQ3A 3EDKA 4W6YB 4N8CL 2OZ4A 3PWUA 4I18B 3QPXH 4XNQA 1QBML 3K4AA 2CKBH 5JLZA 3SKMB 4JKWA 1KIRB 4P2OD 1M6OA 1AE6H 4HPYH 1TVDA 1LK3H 3TWCL 1WSST 3MOQA 2FJGB 3U82B 4QRRB 1CGXA 4YDLC 2XZAL 4R2GB 2H26B 2ARWA 2R2EB 2DKMA 3CUPA 4JE4B 3VI4E 1FH5L 4WFFE 2HVJA 3G6JE 4PJDA 5D4QA 1GPOL 3X14A 4Y16C 3H7LA 1W0WA 2MNUA 2YRLA 3PQYB 2ZNWA 5HGDA 3V4VL 4YAQA 3ALPA 1N6QL 1CGSH 3KHOA 3LRSB 4KRPD 5DJ8A 4ZQKB 1KTDB 1OTSD 1JF5A 3HPJA 5E00B 4QT5A 5HHQA 3DVFA 4JQIL 3RVWD 4CN1A 4TOYH 2R0ZL 4HCRH 2NW3B 3EW3B 3OXSA 1ED3A 1UJ3C 1PDKA 3ZHKA 1XH3B 4LAQL 5IWLA 1DZBA 4UIMB 4U6HB 4UOJA 4JG1L 4P2OC 1U93A 3P0YH 3FTGB 3VG0H 1YEFL 2EH8H 1AGFB 3O3AB 3GJFK 1EEUA 5JNYA 5J13C 1AC0A 1PW3A 4OI8A 4X7SL 1IAII 3CPLB 3KHQA 5FF6B 3HFMH 2Y7QB 4QXTB 3WJLC 3ARZA 3NH7H 4JPWL 3B9EA 1JPGB 1D9KD 3L95A 3VD4A 1F4AA 5CD5D 4KKBD 1QOKA 4I9WD 5C0JB 4JO1H 1KEML 3UCRA 1QBLH 4D8PB 2DQDH 4ZUSA 1BF8A 3OG4B 3WSQH 1XGTB 3OJMB 4DGVL 2PR4H 1HXYA 4P2QA 5FA3B 1F6AA 4K07A 3VFPA 4H1LA 2DM3A 1CD1B 4EVNA 1FL5A 4JM2C 4AENA 4JANB 4RGMC 3NCJL 2NY3B 2ZUUA 4L3ED 2HT4D 4FTVA 2CK0L 4WO4C 2UUDH 1RK1A 5IF0B 2Q87A 3VXQB 2CIKA 3DV6A 2VDOH 4NP4L 4ZUVA 1QSED 5ANMA 5IVXE 3UBXI 5B3JE 1JBJA 5CSZA 1FRGL 1LEGA 2ZJSH 1EA9C 1U91B 1P6AB 4MCZA 1XIWC 4ODTL 3SBWC 3ETBF 4H20L 1JNHA 1YMME 1PG7X 2HP4A 3BD3A 4XBPB 3MYJA 4I4WB 5IVXA 2FWOA 3B9KB 3O4LE 2H2SD 3E3QE 1P5UA 4K2UL 1I8LC 1H3UA 4CU7A 4J7RA 4FQ2L 1T0MA 4I0CC 3CCHB 1TVBB 1BVKA 2EE6A 3BKYL 4V1DD 3WYRA 1T0NA 5F71A 2D03L 3T1FA 4QRTB 4Q6IC 2OXGA 3HCVA 4JFPB 4PRIA 4KROC 3FQTB 3MV7A 4JQXC 4OZFB 3M8OH 1QUNA 1S7UA 3IJSA 3VMNA 4ZNCD 1JI1A 5C6TH 4WJ5B 2BDNH 5CD3A 3WXWH 3QUMH 1J11A 4KKLC 4K3EL 4O2EA 4WY7H 1G1YA 2LU4A 4QXUL 3CK0H 4PR5A 3QBTB 3GSXB 2V2XB 2GT9A 4HK0B 4LU5H 1RUQH 2MMXA 1MIMH 3MRKA 5MHSE 5AWNH 1TQBC 3ZKNC 3OB0K 5J3HD 3RY4A 1FVEB 2R1YA 3D0VB 2XN9B 4OT1H 3T4YA 4DGIH 2VDOL 3WXVH 5D8JH 4K8RL 3LRSA 4NC2B 4QWWC 2A9NL 4D0CB 1D6VH 2V7HA 1MCWW 3NIFE 5HHXL 2XFXA 1YUHA 2VLLA 3LPGA 4YPGB 5TE7H 4AJ0A 4TSAH 5CINH 4ONFH 1MRFL 4LK4A 5DEFB 2BVOA 4PJGE 4ORGA 3V9FA 1ES0A 2YS4A 3EYVA 3RHWK 3GB7B 4MVBC 1RUPL 5I71B 3JWNC 1DSFH 1Z3GL 5KSBE 12E8H 3TP4A 3BIAX 5BOPA 2IQ9H 2VSDA 3GSVB 1GZPB 1YEDA 3Q3GB 5E5RB 4R0LA 2CUMA 3IF1A 2NY3C 1OARH 4QGTA 3LQAL 3ZSSA 1JTOA 3TO4C 5ILTH 1PEZA 3SGKC 1K6QL 3WL9A 5SWSD 2H9GA 2VR5A 5I8EB 2R29L 2VH5L 2HJFA 3QDGE 4XRCA 4LLAA 3G6JB 5KW9H 1G9EA 1BGXH 2BK8A 2X4QA 5CGMA 1QBBA 1EJOL 1TLKA 1NMCB 3PQYD 5FGBA 3HRZB 5CBAA 3RWCB 4U3XA 3VFOA 3ZT6A 4JR9H 4R0LB 3OKMA 3BKMH 4MJIE 2E7LC 1GGIH 4OCNC 3CVHL 4DOHE 4ZO9A 1HOCB 3VH8B 5JORA 1KLUB 1WT5A 2VXTL 3A67H 5CAYB 4N8VB 5EIIB 1BJ1J 1RIHH 2P7TB 3GSOB 4JHZA 4D9RE 1RZGA 4YHPB 5MENA 3TO4B 2EZ0C 4J3XA 3RP1A 4NWUL 4F7CA 4L9LB 4LGPB 5M7QA 2GHWB 3TPKA 4M7KL 2HRPL 4GMSH 2CDFA 1WGOA 2DYPB 4P2RE 5HHMD 1IKNA 2QADB 4N8CH 2B2XH 1TFHA 2A9MH 3ARXA 3FRPG 4YX2H 4L1DA 3DXAB 4PJHF 1WBXB 2DQGH 2N1KA 4KY1H 4ZO6A 1MCWM 3RX8A 1D6EA 1SQ2N 2VAJA 3MLVH 1IEAB 5CEZD 1KCUH 4ZUWB 4I3SL 5CJQL 4L9LA 4D3CH 3J7HA 3VXSD 4MVBD 1EPFA 2NY0B 3GSWB 5EBMB 3KPQA 2K1MA 3MA9L 3MLUH 5F9DC 4PY8I 4TTDD 1T4KA 4AEHH 1XIWA 5JTWA 4QXGL 4UB0H 2O61B 3VRJB 3A67L 5C0BB 1FPTL 1UVQB 4M9PA 3L7FB 5KZCB 1A1OA 1ORQA 5KVEL 4GW1A 4HUKB 2OQJA 1J8HB 4RSVA 1U6AH 4Y2DA 3HE6A 3MRJA 3QIUD 4P2RB 1MI5D 2ZCKH 2ZPKL 1ZT4A 1UM4L 1OP5K 1ED3B 3H9SA 4MNGB 4P5MA 3RZCD 3BHBA 1KJ2A 1DBML 2A83A 2F58L 1M7IB 2R2BA 1MLCA 2E7MA 2KZ1B 2W38A 1QSEE 3DYPA 5I75B 3B6SB 2NW2B 4Z95H 4P5KB 3GFUA 4Y5YB 5KW9L 1F3DJ 4LKXB 1CLZH 4OKVB 1HZHH 2FBJL 4GXUM 1UQSB 4K3EH 3ZMRA 5TDNB 4IOSD 4BJLA 4F2MB 4OF7A 2CQVA 1U3HB 3GSVA 2IPTH 5F9JB 3VW3H 4NO0B 4DOHB 2J6EH 4LGSB 4L8DA 1IQDB 2VAAB 2PNDA 4GRLC 3F7QA 2MHAB 3F7VA 4GT7A 5HGDB 1KPVA 3MLZH 1U8IA 2VB5A 4JKKA 4G6AC 1WTGT 5ACZA 2J2ZA 2AK4B 2Q8BH 4NUJB 3MUY1 2L7UA 4JM2A 2A6IA 1U58A 5C0RH 2D2OA 4DW2H 1UZ6E 4JLRA 4WNQA 4NRXB 3S4SB 3OB0H 1FSKC 1HHJA 5HHXH 1CFVL 3W81A 4X5XB 4KHXH 2XN9A 2VDRL 4RISL 5JUEH 4BELD 4U3HA 1IJ9A 2F54B 4HPOL 4PJGB 2V2WB 1I7ZA 4OT1L 3DRQB 3T4AA 3N1PC 4WO4D 4K23L 5FEBA 5EC1A 5JW5A 1YEGL 3DMMA 1C5BH 3MRPB 5ENWA 4JFQA 1N0LA 4AZ8A 2UY7A 2Y25A 4ELME 3ESUF 3QHFL 4ZXBC 3JWOL 3OKOA 4N0CD 1JMZA 3SGJC 1EGJL 4AYFA 3PV7A 5IHBA 4U6YB 5E9DD 4KJPC 1KT2B 5CEYA 4RWYH 1TZHB 3L3DA 5DD3H 1IZJA 3WN5A 1F6AB 1JHTB 3SDCD 2DQUL 3NZHH 3OAZH 1BD2D 2IH3B 3KNBB 3A0OA 1NBZB 5AYUH 2WIMA 3GKWH 1Q9KB 5GHWL 1X4XA 2VXSH 3KYOB 1FAKT 1LP9A 4ODWA 4LLQB 3GI9H 1CD9B 3BP6A 1WIUA 3NFSH 2YXMA 4OCYL 5GRZA 4CAGA 4ZNEA 2FB4H 3RTQA 2H9GB 3D2UD 5ISZB 3EYOB 1AD0B 3GMNA 4EI6A 3FFCD 3SE3C 3RWDB 2VKXA 4HV8B 1IAIM 5D2LE 4I4WA 4JCMA 5HYSA 2ZNXA 5GIRB 4OQ1A 5F8QC 1SEBA 5IW6A 1NMAH 1KELL 1KJ3H 1XGYH 4PB9H 3VRIA 1EUTA 4DN4H 3GGWA 2DLEA 3VWKD 5BV7L 4OUOA 5DQDH 5MERB 5IJVB 1ZHKA 4OF8A 4K94C 4UI2A 3MRCB 3GJFA 1AXSA 4ZUTB 3EAKA 4WW1A 2EYRB 1ZA3A 1MQKL 5DHVB 1U8JA 3HLAB 4QRPA 4YFEA 4Z76B 5BS0B 1UKQA 1P84J 4ZSOE 3VMPA 1FORL 1WCBB 2VDNL 4OTXL 1DLHA 1S9VA 3CFEB 4X80L 1SEBB 5IW6B 4ZUSB 4OLWH 4C4KO 3N0PB 4X5LA 4KTYA 5IHUH 4Q9CA 3DO7B 5CKGA 3BSZH 2VDQL 1U8OA 4JRXB 4M7JH 2VXUL 1GAFH 1S8DA 4L8BA 4N8VG 5C09E 2Z8SA 4QTIL 4JJ5B 3LOWA 4HWZB 3WBDA 4PY8J 1I7ZB 1LDSA 4PJXF 1QR1A 3HI6H 4OZGF 3I9GH 2D7QA 2P4AB 4JPIB 2APWA 3C6SB 3S88L 5EU6A 3C5ZD 5J9PA 4ZXBB 3BAEL 3BGAA 3HAEH 4I0PB 3RJDA 1BWWA 1X5GA 3VFUB 2BXYA 5B22A 4BZ2L 1KTLB 2LU3A 4PLJC 1CU4L 2QSCH 2GSGA 1U8IB 3SDDA 4LASL 3CH1A 1VEMA 3ZTNH 1AIFA 3P0YL 5DUML 2H8PB 2VDKH 5IR1B 4RFOH 1IC1A 2DQHH 4GKZB 2F74B 5GGUB 1MAKA 1T3FB 1BLNA 1VESA 2VZOA 2R1XA 1NFDF 4GAJL 3MBXH 2HN7B 1H8SA 4JPIA 3NGBC 5GRVK 1T7ZA 4ETQA 5DQ9B 3WUZA 1T20A 3GEWB 5E95B 5JMOC 4JY4A 1XGUB 4LPVA 5BV7C 3KYNA 3S5LG 2B0SL 1NGXA 2F5AL 4X6CF 4QXWA 5FHBL 2NYYC 5ICZA 1W72L 3O41A 4WW2A 4MWFB 5E6IC 2ZOKA 2QSVA 3EYSL 3S3PA 3B4NA 4OTXH 1G1CA 3LV3A 3QFJA 1KTKE 4B5EA 4Z7VE 1JYNA 2D7OA 1MFDL 4K7PH 1HHKB 5FUCC 2BSRB 4OSUH 2I26N 3C87A 1PG7W 2PUQT 2EXWC 3HB3D 3QCTH 2WM0A 3STLB 4FFZL 4MYWB 1RK1B 3I02A 3TT3L 3N50A 4RMWA 4YQXH 3BPLB 2EDEA 3S7GA 1F4HA 3TVMC 3L3OB 1FFRA 4WUUA 4Z0BL 1RFDL 3I6GA 4LSVL 3LEVL 4CMMB 1ZGLP 1LGVA 1SEQL 4OLVL 2VIRB 3MO1A 1OAQL 3GSNL 2SEBB 1LO4H 3T3PE 1CU4H 2CKBB 5KZCD 5IVXB 4S1RL 4MJIB 3N1MC 3MRLA 1HCVA 3VFOB 2G5RA 2AABH 2OJZH 4ODUB 3DHMA 2APBA 4P46C 4R7NA 4WCYL 4M43L 5FUZL 1XGPA 2DWDA 1SY6H 2HKHH 5IT2H 1KCVL 2AQ1A 5C0AA 1LVEA 1VHPA 1CQKA 4CW1A 3UP1A 1D5BB 3VFWB 1KUMA 4EKXA 3WE6A 5H94B 4P49A 1CDJA 3NPZB 4YHIB 3T0ED 4PJGA 1EGJH 1QSVA 4PRBA 1G7PB 4LOUD 3EBAA 3HMXH 4OZHB 1ZS8B 4Y2DC 4MXWL 4ELMA 1ZA3B 1LILA 4WIQA 5KVDH 3S36X 1DE4B 1XGTA 3HI1A 3QWQB 2ZUTA 3V0WH 4R7NB 1CLYH 4RRPG 1FN4B 2P8PB 4PJAA 2DQIH 1MY5A 3CLEL 2A1WL 1DR9A 4P9ML 3DX8A 2R0KL 4WU5B 2ZCHH 5CEZE 1CFNB 1RPQA 4M4RA 1NCWL 4XBGA 2OSLB 2DF3A 1KSRA 3ARFB 2RCSL 2HVKB 2JCCB 3W9DA 4KXZH 1T2XA 3MLPA 4XP5L 4YHMH 4NN5B 2QHRL 4W6WB 4JZOB 1EDQA 2QADD 3LV3B 5EC2A 3MNWB 3CFIC 1S7WA 4MJ6A 3CFDB 1WFUA 3L5WA 3B3IA 4BFEA 1X6NA 1ITBB 3JWDH 4NKDB 2HFGL 5CBAB 3NFSL 4LLUB 4NC1E 2GAZA 1UFUA 4Y1AD 3TN0D 5J6HA 1YQ2A 3ULVD 1MHEA 4F57L 2GITA 4ELMF 5T3XD 5MEQB 5JOFA 2R1WB 2IADB 3NCYS 3RWIB 1A4KB 1BFOA 4G8EB 43CAB 2R69H 3LAFA 1INQB 4F9LA 5B39A 3GMQB 1V7MH 3O6KL 1JUFB 2WWKT 2PO6B 1HDMB 3OQ3B 5I30L 1JWSB 5FYLH 3L7EB 1KCSH 2C3HA 3QHZL 3ARED 3P3YA 1BBJA 2B4CH 3CXHJ 4PJFB 2Z31C 3QH3B 1Q8MA 15C8L 3TPUB 3TBSB 2DN7A 1IGML 5IB1A 5BW7A 5EOCJ 5EOCL 4GG8B 5D7JB 1L7TH 4HIHB 3PL6C 3OB8A 3GUTA 3WIFA 5HHOE 2W0FB 5JOPE 1RZKL 2FR4A 3MV01 4LSTL 4XVUD 2CMRH 3TNMB 3SKOA 1U58B 2FATH 4P4RB 1UKSA 5DR5H 1I1RA 1P4BL 4WUKH 4QWWD 1NUGA 4MJ4A 4JKMA 2D4DA 3WNNA 3QNYB 3RWJA 5J11B 4HUUA 3TO2A 3SDCA 4XPFH 1UB6B 4MJ2A 4D94A 1XR8A 4MA1C 4XNUH 4ALAL 3KPQB 1U0QA 1X5XA 4BZ1H 3HG1A 5EUOA 3UZQA 1GGTA 1F97A 3A6BH 1PKQA 2R0LH 4LRNH 3K4DA 2JJTC 1LO4L 2BMKB 1F4YL 3GBMH 3V8OA 4LSSH 3DMMD 1G0DA 4S0SD 1DQDL 1NCAL 4LCWA 4KY1L 5HHNB 2DTSA 5C0CB 3U0TA 4QCIA 3Q0HA 2X5PA 4I8DA 4GFTB 3O8XD 4PUBL 1S7WB 4MJ6B 4RNRB 2BRQA 3WHXA 4JVUA 2WBJD 1ZLSH 2VUYA 3TA3A 4H88H 4JG0L 4ODBD 5EBLB 4FQQA 4OZGE 5F9JA 4WFED 2IALB 3P9LA 4ISVB 3ULUE 1VEOA 4ONGH 4U7MA 3CFJB 1GGCL 5DJXA 1OPGH 2Y36L 1QBAA 4KROB 1RJYA 4APQB 3KNBA 4NCDA 1AQKL 3PHQB 4X9IA 3IFNL 5L88L 1WCQA 1A6TA 4KKCD 4ODWB 2EXWD 3HB3C 4NBYB 4S1DD 3WFCH 3ARDD 2HTKC 2AV7B 1E28B 3SGDI 4I0PC 4HG4K 4RWYL 2EYSB 3R8BB 4ONHA 1CT8B 2Z8WC 1ZKAA 3BKCH 3HUJE 4XP6H 2OQJB 3CH8A 5EZIL 5DZNA 4QRPE 1T03L 3T2PA 4CKVX 1MRDL 2Q7NA 2VDKL 5DRZA 5DUMH 2VH5H 5C0JA 4OFDA 4WHTA 5IM7B 3GMRA 4JEGB 3JV6B 4POZC 5JO5B 4K9EL 1HXYB 4YHNB 2FO1A 1FZMA 4N0YL 5GGVH 5GS1C 3O6KH 1Y18B 3VXUE 3D3VB 3GM8A 4KJQC 4X7CC 2E9WA 3UJIH 5DZOA 2IQ9L 4JO2H 3LQZA 3VFSA 2V5YA 3VXTB 5GS0C 3IDNA 4IRJB 4J4PA 3ZDZF 2Y5TA 3L3GB 2ZOKB 3ZE1E 1L7IL 4KK6D 1I3RA 3L9RA 3QFJE 3PNWB 3FOLA 1INEL 4URTB 3ARQA 1LEIA 3MGTB 2IH3A 5HVHB 1EHXA 4YXKL 4NWTH 1RJCA 3PWPD 3HC3H 1NFDB 4FQJH 4JM4L 2XA8H 1KBGL 3QQ4B 1QFPA 1EAPA 4MA7L 4GKZA 5GIRA 5DUBB 3WEXB 3FCTA 3V52L 1RUQL 4IRZL 4EXPX 4HFUH 1F6FB 1T7VA 2X1WL 3CH1B 4MQXC 1EK3A 1U8LA 3FQTA 1J0YA 4OZFA 5CILH 4CJ0A 3ARTA 4G42A 4FRWA 3VA2C 2DQEH 4GAGL 5EORL 3P40A 4JY4B 1DQLH 3KDMB 1VFOA 1ZT1B 2OTUB 1HYSD 3BHBB 5A16A 3O8XA 4NQXA 4NRYB 3K1DA 1GZQB 1Y6NR 4C57C 4Q9RH 4LVNB 1A7PL 1FV1B 1AI1L 5SWQB 4ZDHB 4QHUA 4I2XE 2B1HL 1JHTA 4FG6C 5GGRB 4U0RB 1WT5C 3QT2A 4YC2C 4O2FA 2X42A 1HI6B 1AGEB 3VWKB 5I1IL 4PRBB 2W91A 4OM1L 4ZUWA 4B41A 3F12B 4YZFF 5F3HA 3QULB 3MRIB 5CZVL 2AABL 2GY7B 1WZ1L 1YN7B 4MS8C 1S9YB 1C5BL 5DJCB 5FM5O 1MI5B 1TZIB 2BNUB 4G43A 4XMPH 1LP9F 1QSEB 1G7IA 2VWEE 5D7IA 1G84A 1YEEL 4LKCB 2CLRA 3LRHA 4G9DB 5CFHA 3CX2A 1UH4A 1JRHH 3GBNH 4PJ7F 4J3OC 1RQ5A 5CZVH 1GZPA 4PYHA 3CDYA 5DFVD 5GS0H 4FFYL 2NY5L 1H3TA 1C8PA 3I6LD 3JTTB 4LNRB 4PJCA 2XWTB 4X6FA 5C6TL 5B4MD 5ITFB 3O11A 5BRZB 5FB8B 4DCQB 2C3GA 3BH9A 2DQCL 4L8SA 5I1AB 1ZXQA 3BD5A 2JF1A 1G9NC 1IM9B 1HIMH 4IEFB 3VDAA 5ICXA 5F1IB 1UXSB 1CR9L 3BDYH 3CPLA 4P99A 4U6TA 3LEYL 3K2UL 2KBGA 3ARGC 4GQ9L 5C86A 2YUVA 1R24A 1J18A 2E7LA 4TSBH 1NC4B 1URLA 1UACL 3RGHA 3SE8H 2MWCA 2E6JA 4IRZH 3BGFC 1H15B 1QRNB 2ZPKH 2AKRA 3DV4A 4MA7H 1U8NA 1FZJB 4HK3J 1Z0MA 1KIQA 3PGFL 4KK8C 4L4TE 2IAMD 2IAMB 4LLDB 2Q7YB 1PX4A 2V2TB 3H6JA 5F1IA 3OAZK 1CD8A 5F7UA 4DGYL 5JHLL 3HI6L 5I18H 5J1AB 3BT2L 2H41A 4FNLH 1WFOA 3G08B 4NN7C 4AEIL 4GRLA 4WFEE 2F9BT 5C0DB 2PTVA 4NO3A 4LP5A 3RHWF 1C5DB 3T1WA 1EFQA 5JPMB 1ZK9A 2P8MA 3TT1H 3DHJA 4MZ2A 5JZ7C 2DLFL 2HJLB 2JB5H 5DMJB 3U6RA 5TQ0H 3QUXC 3AREA 3KAAA 1FVCA 4FNLL 2IADA 3BT2H 4UV7L 1FZKA 1A0QH 1M71B 1FJ1A 5DA4A 4GSDL 3OF6D 4FXGB 2M26A 2LAAA 1MQKH 3NH7L 4L9LC 3TCXA 4KXZI 1YDPA 3TEUA 5K9KB 1ZLVH 4WI6A 4P3CH 3NAAL 5D7IE 3ZLQC 4B7IA 4MAYD 5FO7A 5ID0B 1NPUA 1NGPL 4FXLA 1A6UL 4ZS6D 5HJ3B 1LEKB 2B2XL 3FB6A 5FCUH 3FB5A 3PWVA 2EO9A 5GS0D 4YHPA 3IKCA 4LQFL 4Z78A 5AAWA 4UQ2B 4HCRL 2YZ1A 4WY7L 1VDGA 1A1MA 5C6WH 4ODVH 5ESAB 4GH7B 4P2QB 2BOCA 2XKSA 5FA3A 4P2QD 3IU4L 1MHHB 5KSBB 1YN6A 5DVOA 4HIJA 1VERA 3MV8A 2A6DB 2Z91B 1MLCB 1PQZA 1MIEL 5D1XB 3EDFA 3CSGA 3MJ9A 5ADOL 4WFGD 2DQCH 3FQXA 4YLQT 1KPRB 4R7DA 4HQQH 2CDEA 1MFCH 5IB4B 5C08E 5BV7B 5DUBA 3WEXA 3DYOA 1J9CT 3KLHD 4M5YL 1FFQA 3IKCB 4JR9L 4GQPH 2Y72A 3AB0B 4ZOAA 4J6RL 1A14L 4FFYH 1H3GA 4ESKA 4D0CA 1UWEL 3VFGL 2FH8A 4POYA 4HX1B 3GSRB 1X5YA 4ZTPH 1JRHL 4RMTA 1FO0A 1U8KB 4JFFA 3BRDA 4BFIA 1HINL 4JDZB 3GJFH 1MY7A 4R96B 2H2PD 4NM8H 4Y5XB 4PJXE 2V7NB 1DEDA 4P57A 3S36L 1NFIB 4FG6D 1X44A 3ARBA 5C8JB 1NCBH 5T3XH 4WEBH 3QIBB 1QNZL 4NJ9L 3SDDD 3NCJH 3MO1B 1RZGB 3U36A 2X4SB 4H8WC 2M1KA 1DDHB 2ESVA 4HIHA 5CD3B 2R2EA 5EU6D 3G9VA 1ZHNA 5D96B 1JF6A 1ZVHA 2LFGA 4NBXB 1NCTA 4GG6F 2QQQA 3MV8D 4CDHA 2WINB 1QLRA 5DVMA 3MJ9H 4I2XB 4V2BA 2BCKA 2UZIH 2Y06H 5IEHA 4QEGA 1RMFH 1HHGA 4KKNA 2OTWB 3IS0X 3GHBL 3KPNA 2EH8L 1VACB 3T4YB 5FKPB 4BSVA 3TC9A 3GMRB 1A7NL 4Q6IB 1OGTB 1W72B 4U0RC 3VI4F 1UWEH 5LBSH 1G6RB 2AVGA 2IAND 1FO0H 1NCUA 1T21B 1Z6JT 3C9NA 1K3IA 3TH3T 2C1PA 1CFTA 1KF9B 4KK5C 5MI0B 3D69B 1TCRA 1EFXA 3V4VH 3MLWH 3X12B 3H2WA 1HHIA 3IDXH 3PDDA 1F11B 4NNYB 2HVKA 4LIQH 2Y5TB 3ARPA 4XC1L 2GK2A 3EO0A 1QSZA 3WNPA 4JFPA 1UWXH 1ZMYA 5E08L 3H8NA 2A38A 1PYWB 4EUPH 1VSCA 4PGEB 3BI9X 5D5MF 3N1QC 2BVYA 2RFXB 5IBTL 5AZ2H 4GS7B 4X5WA 5FYJD 3BUYB 5E94B 5ALCH 4I48B 4ZFOB 2BNQA 4IS6B 3PWNB 2CKBL 5KG9B 1MCOH 5C1MB 4MD5B 3P0VL 5D5MB 4G42B 1IGCL 4WTZA 3NCFB 4NO5B 1A9BA 2IAMA 1NC2A 1G7IB 5D7IB 1VKXB 4P9MH 3KPOA 3NFNB 5E9DA 1FRGH 1MFNA 4J12A 4MNQA 5M94B 1OAZL 1Q9KA 4XCYA 3WE6B 4NRZA 1JTTA 1TTGA 2IWGA 3QB7C 2MSPA 1IBGH 5C0DA 4OCRL 3RWHB 4ODXA 1F13A 2NW3A 1L6ZA 1HEZA 2C26A 2V6HA 4N5ED 3AS3A 2Q6WA 1U95B 1I1AD 2E9JA 4LCWE 1GGUA 4FQLH 4MSWB 4XI5D 1P7KA 1DL7H 4GW4B 5TFSH 2PTTA 2JTDA 4ZFGL 1FQ9C 2RB8A 1KIPB 3LS4L 3ZYIA 1QKZL 1KN4H 2EEDA 3PV6A 1HSBB 5DC9B 3X14B 1DQQB 5FYKD 2ICEA 3SKOB 1AGDA 1NMBH 4X6DF 1RZ8B 1DBJL 2OJZL 2EDKA 2FBOJ 3OR7B 5F1KC 1U3HC 1W2KT 3QUZA 1KB5H 1SBSL 1CE1L 4ZFFB 4XAWH 4UT7H 3QG6A 1S7QB 5GQBA 1OAQH 4NN6C 5L7XH 5I17B 1FVDB 4OZFH 1MUJA 3R1GH 4LCUA 4PJEA 4TPRH 3KPMB 5CILL 2MQCA 3RTQD 3D0LB 4QTHA 1SMOA 5TE4L 1D5IH 2BOCB 1NGPH 4TRPL 1NLBH 4KPHH 4NQEB 2A6JA 3QSKB 3NAAH 4C56A 3QCTL 1DQDH 2GTZB 2I9TA 5CGTA 5C07A 3KVQA 1EHLH 1YEKH 4K9EC 5ANME 1FYTA 4KZDL 4HFWA 1Z9OA 1ERNA 3OXRA 3RZCA 4LSRL 7CGTA 1WAAA 4ZNEE 3VWJB 4KVNH 4KAQH 5DMIL 5CCKH 1DBAH 2DLFH 3NZ8A 3HE6D 2E27H 4NM4L 2Z35A 4D8PA 3KYMA 4Q6IA 1KIRA 1OQXA 2JK5B 5J1TC 2B0SH 2F5AH 4KQ3L 5DLML 2APFA 5DHYB 1AE6L 5JDSB 3VDCA 4BQ9A 2YMXL 5TGBA 3WIFB 4HJGA 1BIHA 5ETUB 3WFHB 3UJIL 3TJHC 2W60B 4PJBF 2JCCF 4DGYH 1BFSA 4LLWB 3W82A 4IDJH 5B38B 2VWEC 4RGOL 4DGIL 4P4KB 1HI6A 3IDIA 1CDYA 1YYLH 3MOAL 1V05A 4WI8A 3RY6A 3MZTA 3O3BA 5I1HL 2BZDA 2AGJL 5ICYB 3VU2A 3AMKA 2KDGA 3HC4L 3ZDZE 5FGRA 3P77A 4MJ5A 4BFBD 2YC1B 1JGUH 4P9HH 1RZ7L 2W0PA 1HK6A 2ESVB 3RVTD 2GJ6E 4G7VH 2XN9E 3I9GL 3W11C 4DAGL 2DLTA 4L3CB 4F7MA 4HMEA 4BQ8A 2RAMA 4ELMB 3MJ8A 4LVOC 4P2YA 4HBQA 1FLRH 1IT9H 3LEYH 4LDLB 5D7JC 4I9WE 1NUFA 4UDUA 4HKJB 3FONA 3O6ML 3P4OA 4EDXB 2VQ1B 4N0FB 4R4NC 3GMOA 3O9WA 3K46A 5ITFA 5E9DB 1S9KC 2RHEA 1QO3A 5D1XC 2HLAA 4B0MM 2PO6C 1JNLH 4K3DH 4YXLL 2HTLC 4OGXH 5DYOB 3WCYA 4HS8L 1JN6A 2R0WL 5BJTB 3O4LA 3ZKMD 1MREH 2IQAA 3W5MA 3MRMB 3H3PL 2O5XL 2OL3A 4GAGH 4S0TD 4QYOB 3MNWA 2YK1L 4MQTB 3X11B 1A6ZB 3D9AL 3F6LA 3U46A 2AXJA 4Y2DD 5F88A 3TJEL 3IFPA 5C3TA 2MCG1 3PDGA 1KJ3L 1XGYL 2WBKA 4PB9L 3G9AB 3DUUA 2KZWA 1SYSA 1ZA6A 3RIFK 2JB6A 5JR1H 5F7DB 1DLFL 1LWRA 5FECA 2ZJSL 3HC3L 4KI5D 3QDAA 4Y4FD 5C70A 4WENB 3MBEA 3WJJA 1F4YH 4HIJB 4NP4H 3PUCA 4U31A 3EZ8A 4Z77A 2JIXD 3IT8D 2IANE 3OBAA 3QXUA 4LAJH 4P2QE 1U8MA 3QNXB 4YHYB 4U4BA 3MR9A 4UILH 1AR1D 1FGNH 5DS8A 1I9IH 1UH2A 2QBWA 2D7MA 1K8DB 4OZHE 4CUCA 4PTTA 2VN7A 4Z6AT 4RMSA 3ARDA 5I1IH 4NQCE 1MUJB 2HT4C 3AAZB 3DGGA 4L29A 3FQRB 2P5WA 1T2JA 1PG7L 5K9OB 3B5TA 5FYJE 1N8ZA 4E0RA 2Z9TA 4YXHH 3O6MH 3ULVL 2AXGA 4M1CC 4LLMA 1RUKL 2E7BA 2MPAH 1P4IH 4HWEH 3KPOB 5BOZG 4OM0L 4G8IA 1I9IL 4WCYH 4TNWK 4RFEA 5CSGA 2HG5A 4DVBA 1ZWIB 3DI3B 4K9EH 4PJDF 1EHNA 2RQ8A 1Q94B 4YE4L 2XQYG 2ZKHL 4CADB 1QPXA 4N1CA 5I16B 1H3XA 3QI9A 1GVIA 5JR1L 2R15A 4P59H 3X3FL 1GYAA 3W2DL 4KHXL 5D5ME 4LCWD 3BKCL 4XP6L 2ADGA 4P46B 1JZ6A 3NCYP 1KPVB 1EO8L 2BY2A 4KMLB 3BMWA 4YHYC 1MCEA 2BSRA 4NQVA 3RPIA 3RWCA 3D9AH 1NFIA 4LSPH 3H9HA 4LPUA 2ADFH 1EFXB 4YXKH 4PGDB 1Z5LB 2ADIB 1MCPH 3OGOE 1IAOA 2EDDA 4KRPC 5HDBF 5C7XH 2E7HA 4U1HB 5AUMA 5I8CB 8FABA 1MJ8L 3OV6A 3JZ7A 1NGZB 5DRWB 2ATKA 2VUOA 4D9QE 3C2AL 5GJTH 4NSKB 4U1KB 3GRWL 4HXAH 2WIIA 3MNVA 2CLVA 1XEDA 3PHOB 3G5XB 3MV7D 4Y4HC 3AM8A 3W39B 4ERSH 3MJ8B 3QUYD 3BH9B 5F93C 3DSFH 4ZOEA 1S7RA 5C07E 3FOLB 2OTWA 5F9WB 4LCCC 1NMCC 2BHZA 1BQSA 5HYFA 3V6FA 3LKOA 5T1LD 5EO1B 4KKAC 1JGVH 2I27N 5KJRL 3U4AA 2R1XB 1INDL 3HPLA 3RNKB 5KVMC 3LN4A 3GKZA 5D93B 3U9UB 3PQYE 32C2B 5KTEL 3NFPA 3TYFA 4YH6A 1G9NH 4QRUB 1CLYL 4AIZB 2XWJB 5K33A 4LCIL 5FUCE 3MOAH 5D2NB 2P1YA 1XT5A 4JN2A 4FQCH 4FTVE 4HT1L 3VCLB 3MC0A 3O8XC 5EZLA 1FPTH 1KN4L 2YWZA 4HS6A 4P4KD 1RULL 1R3HB 3FO2A 5DJYB 2Y6SC 5I71C 1EEYB 1MCJA 4JRWA 5L88H 3MA9H 5EZJB 1CGYA 5GZND 1S8DB 2E27L 2XZCH 3E2HC 4L8BB 3MMEB 1P4LA 2WLYA 4N90E 2HKHL 4S2SB 2CLZA 3C6LB 1RUAH 3UPRB 4KAQL 5IFAH 1A7RL 1VPOL 2GUOA 1O7SA 4I3SH 1QD0A 3L3JB 1NCCL 4FQQB 1KGCD 3SKUD 3REWB 4LCYA 1QRND 5CLWA 2BNRE 4DKFH 1RJLA 4JGUA 3ULUC 3IJSB 4OZGA 3QHZH 4XTRC 3PG2A 1YNTA 1VB9A 4P2OB 5B21A 4WVRA 4JFZL 2X6MA 4RGNE 4HLZG 3RIAF 2OZ4H 3P0VH 1MCOL 4CVXA 3W0WD 3BN3B 3QEQB 4PJ9D 4PJFF 3FT2A 1LDPL 5DGRA 1ACYL 3OX8A 3GBML 4G7YH 1ZLWH 2JCCE 5BVJB 8FABB 3D69A 4YJZL 3TV3H 1I9RH 1JFQL 3O2DH 4Q97A 5E6YA 1I7TB 1VFAA 2EIBA 2BX5A 4F33B 4PJHE 4XP4L 5J6GA 1H8NA 3O81A 4NZRL 4UQ2A 2LV4A 4Y2OA 4TULL 4PP2B 5KANG 3OAUL 1S7XA 3EFDL 4FQ1L 5FUOH 5JO5A 1K5NA 4HGWB 4R9HA 4KGLA 3RWGB 2OP4H 4MZ3A 5EH1A 5E7BA 25C8L 5LQBH 1DL7L 3EDDA 4IMKA 2NZ9C 3QPQC 4Q2ZA 1HHGB 2F5BL 2CDEB 4QHNB 4U05A 7FABL 1ADQH 3B9KC 4AIZA 3VGAB 2OSLA 3OZ9L 3QHFH 4KRNA 2HTKD 2FX8L 1IGMH 4MNQB 4RMVA 2P48B 1CICB 4YE4H 5HPMB 5IMKB 1I3RB 1E4XH 3L9RB 1OSPH 3VE0A 1K6QH 3WKNA 3MRQA 2WQ8A 1OAXH 1RZJH 3P4MA 3QIWB 3P11H 5CGYC 5DK0A 2N7BA 4TSCL 1RMFL 2H32B 3KXFD 2ZOLB 1MELA 5GSRA 5FGCB 2VDRH 4YR6B 4GRWE 1EMTL 4MX7B 5DK2B 1OP5H 2F5BH 3MXWL 5DI8A 5TE6H 4E0RB 2IFGA 1CGWA 3CFKA 3IDMB 2EH7L 5K9OA 3OJ2C 1GSMA 4EI5A 3V8CA 5L9DL 2GITB 5L2KA 1QZ1A 4YHKH 4OLUL 1OCWL 2VDQH 3QFJD 3HPLB 3NBNA 3U2SB 1IILE 3BPCA 1WISA 3MLRH 4TULH 2JK5A 2Q3AA 4Z7UA 1QNZH 4NJ9H 2QSQA 3BEVA 2FIRT 2WUCL 1A47A 5H35A 3U36B 2ED8A 4WTWA 2GFBA 4AK1A 3BQUB 5D7LB 1HSAB 3T3PF 1MEXH 4HSQA 4BUHA 1UENA 2X9YA 1GIGH 4N1EA 2RR3A 2FGWL 2DWEB 3KPRB 1FIEA 5DURD 2IC2A 5HGGS 4NO2A 5FO8B 1UXWA 2NY0D 3QPQD 3F5WB 1BECA 3IXTA 4HZLA 2NQCA 2H8PA 2P5EB 3MODH 3MV7B 1QG3A 3WJJC 1Z5LA 1J1OH 4I3RL 5F70A 3KPNB 4M6ML 4K71C 4EUPA 3MCLH 4YO0B 1DVFA 5GRYA 2HN7A 4Y4HA 4Y5VA 4XB7A 2C5DC 2NCMA 1UJ3A 4P2RA 2ZUVA 1TZGL 3PABB 4NQDB 2H3NA 2R2HB 5DYOA 1H3VA 1RVFH 1B3JA 1NC4A 1TQCC 4P2OA 3MLTA 5BQ7B 2BSED 3G6JA 1DFBL 3WFEL 3GI8H 4U6YA 3VXRA 3BKYH 2QQNL 5JQHC 3GSQA 1JGDB 1MVFA 5JHDB 3LCYA 4P4KC 1J1XL 4LCWB 3S6CA 3LKQB 1BQUA 3I50L 2YKLH 1V3LA 5EO0B 1PFCA 5FK9B 3SKJH 1T1YA 3HUJB 4Y7MA 3ZZ1A 5D1ZC 2FSEA 3KJ6H 1LK2B 3EYQD 1YEGH 1NEZG 2DTML 1BIIA 1TNMA 3KGRA 1CVRA 4LNRA 4PJCB 2EZ0D 3PDOB 3PWJB 5JQ6L 4GG6E 1C7TA 3Q48A 2NTFA 3D0LA 4QTHB 4Z7VF 4PP1C 3U30C 3S88H 3C09C 1C1EL 1FG9C 1NJ9A 2GK0A 4GG8A 5HYSB 3BRFA 4GG6A 3F6IA 1VKXA 2BNRB 3CU1A 3MV9B 2X4RB 2FECL 4H26B 4Z7QF 3MV11 4PJBB 5IQ7H 4X9HA 3TT1L 4FQXB 1MFDH 3QFDB 3SY0A 2Z8RA 3SDXA 1U2HA 3MV9D 4HXBL 3G5VA 1CWVA 1S9WA 1NSNH 1OGAE 2MQ0A 4HUVA 1BD2A 5K9QI 4NN6B 1ZLUH 1UM6L 1JUFA 3Q1SL 1G6RL 5C08D 2WUBH 4NCC2 43C9B 4NN5C 1NC4D 1PKQB 1ORSA 1LD9A 1OB1A 1UEMA 4FOMA 5ALBL 3IVKB 4OLYL 1AY1H 1NAML 3FB8A 4XPTH 5ESVB 4K71B 1DBKH 4TRPH 3VH8G 1JTPA 1T04A 2H2SC 1F3DH 1YJDC 4G8GE 4JG1H 4NGHH 4Y4HD 3EGSB 1AHWA 4X0KA 3EYFA 1DVFD 4Z7NE 3NA9L 1C7SA 4RFOL 5C9JB 1DUZA 1I85C 2CKNA 3T09A 2ZP0T 3VFUA 1UCBL 2OXHA 4PRNB 5J6GB 5EB9A 4YPJA 3P30L 1QLFA 2BY0A 4PJ5D 3U4EB 4P46A 1XF1A 3L3GA 1OF2B 2K7QA 1CGSL 1U8HA 5BMFL 4HJJH 4JZOA 5KVEH 4Y2DB 4DEPC 4ZFOL 5LAXB 4JO4H 4DK3A 2DI7A 4UV7H 5IB3A 3MRPA 4X6EB 3ZYZA 3IRZA 5C0EA 2HT2C 4PD4K 5C0GA 3L1OL 3IDJA 1DSFL 1HILA 1EAJA 1RUPH 2H32H 4QOKE 3UMTA 3JVGA 1G7JB 5EWIH 5SX4H 4M02A 3VWJA 1AR1C 3RWEB 4ELKB 5DF0A 1I1YA 4Y1AE 5CJBA 2LTQC 1JYVA 2AXFB 5BRZE 3G04B 3QPXL 4X99A 1A4KA 3REWA 2A9NH 3C08L 1X5KA 2WP3O 4LRIC 3VXUB 3GO1L 3TM6A 3QUXB 4OF5A 4Y16D 5DHYA 1KIQB 2YPLA 4F9PC 5AYQA 1A7OL 3QIWC 4KKLD 4JREB 1GOHA 2QKIA 4PGJA 3RDTA 4HH8A 3HZMB 2AJ3A 4M7ZB 4GW5B 3KJ6L 4EI5B 3BWUC 2NYYD 1NMAL 2YPLE 5I76B 5DVKA 4O58L 3RKDC 2YK1H 1KN2L 1CTNA 1RJYB 4APQA 4QXUH 5IBTH 1UXSA 1SVZA 3UBXG 5FO9B 3EFFA 4H8WL 3I6GB 3SJVE 3BEWA 2Q8BL 3SGKA 4OGYL 2Q8AL 2DQTH 3ULUH 4JGMA 1LO5B 3QUYC 4LIQL 1HQRA 4MNGE 3BGFB 3RI5F 4NIKB 3MJ7B 5IR1A 4IIQA 1AI1H 5FGBC 4Q9RL 2GEEA 1XF3B 1V7NH 5FYJU 1NCNA 1GGYA 2EYSA 3L5XL 5CZXD 3ZDYE 1CDCA 4JHAL 4JFYB 1U3HA 3LKSB 4OD2A 2EDOA 4KDTA 3KJ4C 4RFEB 5DJ8B 5HYQA 1FVEA 2FHCA 4Z7WE 1ADQA 4PRNA 3N9GH 5E24E 2XI9A 5IB5B 1BAFL 4MCZB 1WAAF 1S9WB 3WIHH 3MYJB 2X09A 1WC7B 1A3RH 5MHSD 3GSWA 3UBXA 4HBCH 1T7WA 4HPOH 5IEKB 4A2MA 2FHFA 3IDNB 4XVJL 1S3KL 4XMPL 3QCVL 1IGYA 4U1LA 4XNYL 4UU9B 4ZOBA 5IEHB 1CL7H 1ZEAH 1WLHA 1F5WA 1YDPB 4Y5XC 3HAEA 4QRUA 3CMGA 1IKNC 5DEZA 5GS2H 5E99L 5A3IC 1LQSR 4WHYH 4RX4A 2BY3A 5F7MC 3FO1B 3VGHA 2G9HA 5T1MB 5TE7L 4XCFH 4UINL 1KENL 1KCUL 1CL7L 2A74A 2GUOB 3FRUA 3A6OA 1EMTH 3G5XA 4K8RH 4M61A 2C1PB 4M7LL 3LPWA 3G5YA 2NXYB 3MROA 4OCLC 1ULVA 2DM2A 1H0DA 3ZO0A 4YDJA 3LMJL 5JHDE 5LKNA 2R1WA 2A77H 4Y19B 1BAFH 1QO3B 4XPBH 1DBBL 5EOTB 4Z95L 4WV1C 1RAMA 4GRWB 2FYYB 4OV5A 4R97B 5IBLC 4LNVA 1U8QA 7FABH 2AJSH 4JRYE 5DRZB 3TBVA 5D7SH 4PV8A 4I3GA 4Y5VC 4IDLA 4JN2B 2NLJB 4XAWL 4Y19D 5TDPA 4GW1B 3VJ6A 2X44D 2RJMA 4IRSC 1IVLA 4FABL 4P5TB 2F53E 2AEIT 3IJYB 3L3HA 3OKDB 5TJWK 5CBEB 1RV6X 1VGEL 4HUVB 5EIIA 4MXQC 1B88A 5JOPD 1OL0A 4KVCH 5BQ7A 4FP8H 3DNKA 4NZRH 1XR9A 1YEJH 1G7MB 3KXFB 2DIAA 1I1CA 2BRRL 4PRIB 4BKLA 5E4EC 4ZFGH 3H7BA 2NY6D 3AXLA 1MJJA 3B9DA 3MLUL 5B3NA 3JV0A 5C0FA 1GC1H 4AH2B 4H88L 1T5WB 4RAVB 4K2UH 4D9RD 3MRRA 3VXNA 3WUWA 3IAGC 4OJFL 3EFFB 4JFEB 1DQJA 3RL1A 4G9DA 4ZS7L 3RVVC 4OGZA 5IEKA 3PWVB 1LEGB 1D9KB 3PDOA 1G7PA 2X1PA 4ZXBD 3VD3A 3IETB 4YBLB 1MQ8A 5IF0A 2CDGB 3QQ4A 3TZVD 4OF0A 1JPSH 1NAMB 2R8SH 4IJ3B 4JRXD 4OZIA 4BZ1L 5IFAL 2J88L 2H6PA 1C16A 1I7UA 3IAQA 4WU5A 5HHMB 5ESQA 5AZ2L 2XZCL 4F7PA 2H32A 3VRLF 2NR6C 3UTPE 1MCCA 3DYMA 3B8YA 1RIHL 1ZHBB 4NT6A 3U2SA 1I8KA 3RDTC 2WP3T 2CMRL 4AY0A 3LRGA 4O2FB 4L8SB 4OIIH 5IJKC 1D6VL 1RIUH 2F53A 3TFKD 4HS6B 2HJKA 4MNGA 1RHHA 1EVTC 1QFWH 4XNMA 4F7TA 3CFCH 4OZHF 3CSYB 5CJ5A 4C83B 15C8H 3RQ3A 4G6FB 1YEFH 1YYMH 2QTEA 3KPTA 5DD0L 3V5DA 4U0QB 3QXDA 5A2FA 3KLSA 3ILQC 4GG6B 1PVHA 4LLYA 5HGBA 5I30H 4TUJA 3O3EA 4KTEL 5E6ZA 1JHKL 4HAGA 1TTUA 3BIBX 1DBBH 4NO0A 1JGVL 2OI9B 4M6OH 5LWYL 2EDHA 4UIKH 4G6KH 4ENEC 1KC5L 3GMQA 5IW3A 1QSEA 5F7LB 1CFQB 2RIKA 1I3GL 1XMWA 2C3WA 1A1MB 4UV4H 5D70H 3TIEA 3V6BR 3ZKND 4JZNB 2NY5C 1A4JB 5GJTL 2VLKB 3L6FB 4JY6B 4RMUA 2HJLA 3U6RB 1OGAB 5IG7B 1YMMB 2OL3H 4W68A 2NXZD 4WHYG 4A6YH 4GKSA 3VG9C 4IBLT 1E6OL 3BRGC 5J7CC 4FQIL 3OMZA 5T1DL 2QQKH 3MBEC 3E8UH 4TUKL 1UGNA 2C1OA 2NR6D 2NY5H 3QDHA 5I73B 2E6QA 1D9KA 4XMKH 3HZVA 5I0DA 3CLFH 4IRJA 2GSGB 3QO1A 5E2VL 4MCYA 4HG4J 2RCSH 3MYZA 3O9WD 1OLLA 1VFBB 3KLAB 1K4CA 1VGKB 2JJUA 3WNLA 4EN3C 5HDQH 3WS3B 4LFHG 3VFPB 1VFMA 1H3PL 4LDOB 4PJXB 1W0VB 2X7LB 4BQ6A 2L0DA 2X1XR 4IHOA 3PP4L 5ACMA 5JQ6H 5I1DA 3ZL4H 5K59E 4WGWB 5DJ6A 3MUHL 1JMXA 2NNAA 2CLRB 2D9CA 3ABZA 4JFFE 5SV4A 1G7MA 2GJ6D 3WN5B 5C08B 4HH9B 2QADC 1RZKC 3BWAB 1BIIB 2EDQA 4R26H 3LH2L 3MGOB 2VLRD 3ROOA 2D0GA 2VDML 4U1JB 1FLTX 1NEUA 4DGVH 1SJHA 1FZJA 4WI4A 5CP3H 2UV3A 1YPZA 3PIQB 5CEXA 2J3SA 5EU5A 2X89A 4PY7B 2VC2H 3DX9B 3WHE1 1GZQA 4V2CB 1MH5A 3S8WA 5GSVA 4P48A 5EOQL 1A9BB 2FJGA 1Q72H 1NL0L 4G6MH 5EIVA 3VRIB 3KYKH 3FT2B 4KDTC 1B4JH 4YEEA 3V5KB 1JCKA 4IRSA 1J8HA 1WZKA 4DUVA 3T3ME 4PJAF 1VFAB 3BXNA 4M6MH 4HGMA 2DQEL 3LEVH 3MRGA 5DGQA 5BZWA 5CEZH 3DJ9A 4R97C 3HKFA 5C07D 3D39E 3C60A 3REVB 1DQML 4OFIA 4C56D 2R0ZH 4P5TA 5TH2B 2JIXB 2YPLD 4OD1H 3MA7A 3D85D 4HIXH 1P7KB 1U9KA 1RJLB 5DFWH 3EJYD 5I1JL 3BE1H 4S11A 3MQIA 1SBBA 2NXYC 3TZVB 3M1BB 2X4RA 1KB9K 2YD2A 4MA3A 1A0QL 4JFDA 3MACH 3AM8C 1E4WH 3VWJD 1YNLH 3S37X 4N0RA 4XPGL 2P43B 3RVXD 3QUZD 1P1ZA 5L6YL 5F7WC 2DQFA 3ZHLA 1IRAY 4XCEA 1A1NA 1OTUD 5BVPH 1VADA 3BMVA 1S7QA 4OGAD 2YN3A 1KOAA 1L9MA 3V0VB 1P2CB 5E2WL 1KCVH 5I1DB 1QVOB 5TQ2L 2M2DA 4U3CA 5D7KE 3RGVA 5JLZB 1A7BA 3P9LB 4ISVA 3K74B 3QEGH 5HHOB 5HYQB 2FR4B 4XBGB 1OHQA 2X1OA 5DMKB 3CDCA 1T3FA 5DUPL 4UNTA 3N1GC 2GSIA 4X0KB 1CCZA 4GXVL 3TESA 3RL2A 2GCYB 3VFRA 1MFBL 4FFVD 1H9VA 4PG2C 1IAIH 3CFBB 3BIKB 5I1GH 1HEZB 1TNNA 2LU7A 3UJJL 2GKIA 4JQIH 3TBTB 2A6KA 2PTUA 3BEWB 5ALBH 2VLKE 5D71L 4OSUL 3BSZL 3MRNB 1FC2D 5JDSA 1GPOH 1YA5A 1GGCH 4N0UA 1F02I 4PJBA 5I8KL 3TVMB 3PP3K 4GBXB 4I18A 3VXUA 5DD1H 1QBMH 3MRJB 4HUXA 4JJHA 3BEVB 4K3GA 5D1QC 2I9LB 4WJ5A 5LWYH 3H3BC 3D39A 4PRDB 1JGEB 2UUDK 1PAMA 2DQHL 4LPCA 3R1GL 3VI3F 3WMSA 3VGDA 1MFBH 1EIBA 1A4JA 5GGTH 1XGRA 5JW4R 3OKNB 1AJ7L 4XH2B 3UTQB 4PLJD 3SGDH 5I76A 1CD0A 4OUUB 1YNKH 1XF2B 4UU9A 1QFWL 2NLJA 5JMRA 5IVZB 2FRGP 3BAEH 4GO6B 5FO9A 5DWUL 4LCYB 1NCDL 4G8EA 3PL6B 4HHAA 2YKLL 1EXUA 1IGFL 5ESQB 3QZWA 4KUZL 2Q1EA 4GAFB 3CSPA 3VXRD 1EVUA 5J89A 1JNJA 5L8LB 1B0WA 3JTSB 1J1XH 1NAKL 4OIIL 1QFOA 1QLFB 4MHHI 1J0IA 4YBQD 2NY2D 3UTZB 4WW2B 5E5MB 2P46B 2HJFB 4WHTB 1CICA 3VXPB 5IM7A 5IMMA 4NKIH 1OLZA 2PYEA 1NDMB 5EBGA 2OCFD 5DJZA 1IZKA 5C2UB 4MDJB 5CSBA 2LAGB 5IHUL 2G2RA 2VITB 4YGVA 4OQTH 3T0DA 4PJXA 4FZEH 2IH1B 4M61B 3RA7L 2IBZY 4S1SH 4W4OC 3MRBA 4LCIH 2O61A 3VXRB 4JFEA 5FECB 4G9FD 4HH9A 3O2DA 5D2NA 2JCCA 1I1YB 1OAZH 4K8RC 3ARFA 4RGND 3GMLA 3BE1L 3B8SA 1WK0A 1ITCA 2NX5D 4QHKJ 5KJRH 3KPLA 4OD3H 1MHPH 4CGTA 3IFLH 4YDKH 1NC2B 4ZS7H 1OTUC 3CZFA 4JFFD 1HH6B 3CLFL 4NHCH 1HSAA 1QVOA 2ADJA 4Z7WA 3QJFB 5T1DH 5GSVB 5MEQA 3QRGH 3NPSC 1MJ8H 2PW1A 4L4JA 3FCTB 3QAZC 2NXYD 3HRZA 4NKMA 3GI9L 5TF0A 2XZQH 3HPJB 2IMMA 3MLRL 2BVQB 3H9ZA 4NUGH 2CGRL 4EI5D 5IMOA 1VGEH 2PXYA 3RUGE 4YWGH 1E4KC 3EO9L 3BP5A 3CC5B 1IARB 4LSPL 5D6CA 3ULVE 4M4PA 5FYJL 2EDFA 3RZWA 5IHZB 1T2QH 1TJGH 4TNVK 4C56E 1A64A 5E2UH 4XC3H 4BUGA 1F4XH 5F7EH 4QRRA 3W11D 2MJWA 2CKBA 3JWOH 1DBMH 3HHRB 5HYJE 3RVTC 5EU7E 3T1FB 4DCQA 2GTWA 2YWYA 2HVJB 3UEZA 3HC4H 3S9DB 2ZSVA 1KXTB 2G60L 5B38G 4HKZB 5H2BB 4S1SL 4RDQG 1Q9LB 2C7UA 1CDBA 1IGJB 3DUSA 3VD7A 2AEQH 3EHBD 4NYLB 4XC3L 1C16B 1I7UB 2R4RH 3FO9A 5T1LB 2VLME 5E8NA 1AH1A 5CJXA 1LO3H 1CG9A 4XCFL 4YGVB 5E2VH 2WIIB 5HHOD 4YHIA 1II4E 5I8EA 1I9EA 3O9WB 5DLMH 3ZTJH 4M93B 4W6XB 2YSSA 4LLUA 1NEZB 3PJSB 35C8H 2NTFB 1AQKH 2P5EA 2N56A 5F89B 5T1KD 1TQCB 1TZHA 1H5BB 2O5YH 2Z0BA 3L3DB 4EEEA 4M43H 3V6FB 2VISB 1FGNL 4EN3D 4OFYA 3T2OA 4AL8H 5I1CL 1NANI 2VABA 3U0PA 4AQ1B 1JZ7A 2YPKB 3D6GA 3IFOB 3W0WA 3KS0H 4RQQA 5C6PB 4UTAL 2VZUA 3BW9B 4Y0GA 2J8UE 5GGTL 3HR5A 2PO6D 4PGEA 5I73C 5DJDA 3VGEA 2R2HA 3MBEB 3A6CH 1IFHL 1NBYA 3IFLL 3QNZA 4YDKL 1R0AL 3U9PH 1S78D 1SYSB 2YC1A 4GBXD 1BFTA 2NXZC 5EC2B 2F58H 5I66B 3UYPA 3ARGB 1FCCA 3BOVA 1TPXB 1FL3A 2F19H 2R0LL 2VN4A 3FOMB 1IAKA 3L5XH 3ZE0E 5F3BB 3V5HA 5EBWA 1MH5B 4HS8H 4A6YA 3SO3B 4HWBA 3RA7H 1NGXB 4KVCL 2AXHA 4GKSB 4OQTL 3GRWA 1D5BA 3VFWA 35C8L 1U3JA 3BYYA 4HCRA 3FB6B 1KFAH 4XBPA 1IM9D 2XTJE 5HI4C 5HHPB 2FATL 3HR6A 1A6PA 4M6NL 5FDWA 3EKCA 4AQOA 1KN2H 3RAJH 1T1XB 1ZGLB 1CK0L 2J88H 4IIQB 3FRPA 3QYCA 3W5NA 1BGXL 4NFCA 3EUUA 1QLRB 1BOGA 2G60H 3ARRA 1TJIH 1U8PB 2J8HA 4LLYB 5HGBB 1HH9A 3C6SA 3SGJA 5T1LA 1G7JA 1A7OH 4X83A 3W0WB 1OW0A 4FFWD 4PJEE 5DEFA 3RY5A 3BISA 4GSDH 4BK5A 3KPMA 5E8EB 5D7JA 2F54A 5TQ2H 3S34H 1SYVB 4WWKD 1S9XA 4YFLF 4WTXA 1JRHI 3QUMA 5IV2B 5F44A 4UQ3B 3I2CL 4N9OB 4L5FL 3S97C 4Q2ZB 2BRRH 4EOWH 4YDIH 4N5EC 2E9IA 5F72S 4AEIH 5DMYA 1BP3B 2Z93A 3MREB 4KHTL 1E4WL 3LEXB 1U42A 3TO4D 2IG2H 3MJ6A 3MRCA 1JZ4A 5D8JL 5GZOD 4WHDA 4XNXL 3BDXA 3MX0A 4LVNC 3UYRH 3ARBB 3V0AC 1ZANH 4E42B 5J56B 2ITDA 1HKFA 4TNWF 1QFWI 3SCMB 3LSOB 4PJ9C 1IQWH 3QFJB 4KPHL 1EO8H 2CRZA 4M62L 5D7SL 3QI9D 3BP4A 1DQMH 5C0EB 2R0KH 3OKEB 3MJ7A 3PJSA 1UKTA 4U1IA 4C83A 4ZDHA 4G3YL 1FV1A 2BSSA 5L2KB 4HAFA 2PXYC 1T0NB 3GHEL 1SM3L 1UZ8A 4DWHA 4K94H 1RJZA 5D9SA 1YEDB 4YUEL 1A3LL 3CJJA 4X5XA 2KQNA 1EXUB 5KVGL 2KUTA 5I15L 3BGMB 1K9TA 3QDMB 1ZHLA 3PGDA 4X8XA 1P4IL 3X13A 4WI2A 4IOIA 3DVIA 4WV1B 5E6IA 2XPGA 5CWSB 2FX7L 5KS9F 1JPTH 3NABH 1TVHA 1BQLH 4NDMA 1Z3GH 5E00A 3MCKA 5DD3L 5TFSL 4EIGB 3OKDA 5IBUB 5CBEA 1Y0LB 4XGZA 2OBGA 2F8XC 1YNTB 2PTTB 1OT1A 5IG7A 1VEPA 2AQ2A 1NAMA 2HH0H 3C9NB 4YAQB 1S5IL 2V7NA 3S3JA 4HC1L 3MBED 3GMPA 1IM3B 5D2NC 5IFHH 3WFDH 3NA4A 2CLVB 1CDIA 4Q6YA 4NC0B 4XPAL 5D93C 5I1LA 3REVA 1WBYA 3PL6D 1JNHB 4HIXL 1SY6A 5JHDD 1TVHB 2QR0A 1KYOJ 3QDGA 2R2CA 1YJDH 4K8RD 2ARJA 3FAXA 3DI2B 3K8MA 3CK0L 5FF6A 2HAZA 5F7DA 1MCDA 1PD6A 4RNRA 2FD6H 1IC5H 3L1OH 2A6JB 1GOGA 2HT3D 4JY5L 2DQDL 2DLHA 1V7NL 1NL0H 2OI9C 3K8KA 4Y5YC 4Z7VB 3DROB 3HS0B 3RI5K 4CVZB 3G6DL 3KPRE 1T1YB 4IMLA 4AG4L 4JO4L 5D7LD 1E4KA 4WFFD 1JZ2A 1R3LB 2BHYA 2BFVH 2W9EH 5D71H 3SO3C 4LHUG 4N1HB 4X6DB 4WDIA 3U83A 3QNZB 5EUOB 3DPBA 3ECBA 4ZO8A 3B6SA 4DVRH 3M17A 1FLRL 4RA0C 2X4QB 1ZLVK 4U1GC 5FV2A 4DFIA 4O02L 4M6OL 1U8NB 3KR3L 5EUOF 3V7MA 4NCC1 4R26L 5CZXC 4NKOA 2COQA 4KMQA 2VE6A 2EYTB 4AT6B 4PJGF 1J1PL 4U6HA 1V3JA 4CVZA 2WBJA 2GYSA 1EUUA 5EBWB 4J1UB 1A6VL 2YBRB 2VLJD 2YZ8A 2FO4A 3TBWA 5ID1A 5EBLA 2CRYA 3QEQE 2P24B 3QI9B 2QJDA 3VXTA 3NIDF 5T33H 2CIIA 2UZYB 1QFUH 5IB1B 1S7UB 4R8WH 3TN0C 4UB0L 2ADGB 3TO4A 3TBYB 4YK4B 1WBZA 1OM3L 3O11B 3JWOC 5GPRA 1F6LL 3T08A 2JB6B 1KEGH 3S98A 3MV7E 3QIWD 3L95B 4HMCA 4JY6A 3VFMB 1KJ2H 4ZAKD 1G6VK 5EZOH 5AAMA 1YNLL 3P4NA 4MB3A 5T33L 5ID1B 1QSFB 4WO4B 2EEBA 1G7QA 5F3HB 1KTRL 4JRYB 1JYWA 3QIBA 4KUCF 1EHLL 5GGVL 2CIIB 3NIGE 1QTYT 5LGHL 2F54D 1F4WL 4NSKA 2FEEI 2Q86A 1H8OA 3UO1L 5DHXB 4Z78B 1KJMA 3NCBB 1UG9A 2A9ML 1I1FA 4JRYD 1N8ZB 2APVA 1AKJA 1ZV5A 1Z9MA 4JKPL 4ZUVB 4D0DB 5BW7C 3UTSA 5IJKA 3OKKA 1T03H 4XCNB 2Z31A 3BH8B 4TNVF 1KIUA 2ADJB 5FYLE 3Q6GL 3LVEA 4O2CA 3ZDXE 3BDYL 1NGYB 1I7RB 4YIQB 5I1KH 4Y5VB 1SMAA 2QQNH 3DX7B 3WFCL 5I6XB 1BHGA 5DJ0B 5EOQH 1JGDA 5IBLD 3RX5A 2X4PB 4NO3B 4WDIB 1JWSA 4LCUB 4PJEB 1IM9A 4N90D 4FQPA 5CP7A 5I16A 5BS0D 3CVHH 3K2MC 1QEWB 5E56A 1M1SA 2FJHB 3NOIA 2XWBA 2EECA 3PP3H 3IU4H 2AI0H 1WV7T 4JY5H 1I9JH 1AFVL 5I1KL 3MCLL 2JE8A 5KSVB 3RVXC 1X7QA 3FFDB 4JG0H 1ACYH 2FJFB 2AJSL 1I7RA 1NGYA 4YIQA 3LQAC 4R96A 5I66A 1MOEA 3UDWC 1QRNE 3EYFB 2OLDA 4Y16B 6FABH 3C60C 3PWJA 1IL1B 2HLAB 4XRCB 3ULSA 4L4TD 2AKRB 5A3ID 4ZD3L 5C71A 1TENA 2X4SA 5CMAA 1BZ7B 4RISH 3RNQA 1LNUA 3QG7H 4L4VD 4M3KB 4R4ND 2QQLH 2ZUXA 3OGCB 5ACLA 1DVFC 4NHUA 1A7RH 1VPOH 3CFKB 3FO0L 4NOFA 5IQ9B 5EU6E 1K8IB 2HH0L 5ALCL 4FQHA 4J8RB 5D72L 4EN3A 3FZUC 3DUSB 1FP5A 3E8UL 4NZJA 4PBXA 3F8UB 4JDVA 3SDXB 3WLWC 4LPTA 4N0CC 1OM3H 1XF2A 5LVEA 3T0EA 3P77B 4MJ5B 2P8MB 5I1AA 3TYFB 5F7FA 3INUH 3MJGX 1GXEA 4R8WL 2EH7H 5H8DA 4CU6A 1IGTB 5GISH 4B53A 4H5SB 5K93A 2DLGA 2ATPA 4D0BB 1MWAA 2P24A 1A3RL 2IANA 1I3GH 5EU4A 3UC0H 5A1AA 1WEJH 3E6FB 4XHJD 1AO7A 5D1ZA 3BN9D 3UBXB 4G6KL 1Y6KR 5HI3D 2I25N 4G3YH 4Z18A 5FYLL 1CXIA 4TUOB 3IXTB 1L0YA 4HZLB 1JHKH 3DX9A 4MGXA 3DO7A 4M5ZL 4J3TA 4TSBL 2W0KA 3PV6B 3T0VA 4Z8FL 2YD8A 2EC9T 5FAAA 2DMKA 3BPLC 1NGQH 5E2TL 5HTSA 1MNUL 4IOFD 1UH3A 4WUUD 3DURB 3UC0L 3BZEB 1JV5A 3CMOL 1CDUA 3Q6FB 3DETC 1JPST 2CGRH 2JJSA 3CFBA 3C2AH 3LDBB 2FL5B 5D7LE 2PXYD 4MXVF 1JGEA 2BXZA 4F7EA 3ULUL 2HRLA 2WAHA 2AS5M 2EDNA 3IDIB 4TN9A 1J0KA 1U2CA 1J10A 3B9VA 2YD7A 4HJ0C 4UZGA 4I2XA 5GGRA 3QDJD 3J8F7 1FZKB 1M71A 2YPKA 3CD4A 4RZCA 2Y7QA 4QXTA 4LMQE 4HEME 4PJIA 2FHBA 3MXWH 4N0UB 3GBNL 4QF1B 4XNYH 2ZCHL 4KMTL 1MWAH 2BC4B 3O41B 3VA6A 3SOBL 3QNYA 2V17H 1U95A 1MPAH 1RURL 4LSQL 3WKMH 3U7YH 2VLRE 1WCBA 2YRZA 2I60L 5IUSA 3ARFD 1FL5B 3F7VB 5C0AB 3K1KC 4LHJB 5EDXA 4WI7A 4FZEL 1I3VA 4O4YH 3EJYC 1JE6A 2BHUA 3RGVC 3M07A 4UTBH 3VXSE 2DOCA 2Z4QB 1JHLL 5CGYD 1Q94A 4B50A 4I0PD 1CICC 3B2UC 3EFDH 2MFNA 1UJ3B 2B1HH 1QSFD 5D2LB 4KJPD 1CG9B 4X6EA 1K85A 5DWUH 5KVGH 4RRPA 2FEDC 3VFTA 4MX7A 5DK2A 4P3WA 2D7NA 5HVFB 3GUTB 4HS3B 3D87B 1HHJB 4PB0H 5GGVY 5T5NF 3QWRA 1RU9L 3G5YB 5F1SA 5IB4A 5IB2B 3CFJA 1KYOK 1DQLL 4BH8B 4U1NB 4HIEA 4LQFH 1DLFH 4QRPD 1DANT 5FYKL 2GJZB 4LAQH 2DQFB 2WBJC 4QRTA 1BMGA 5C9JA 4U1IB 1WBYB 2A77L 2CSPA 4NQUA 1NFDA 3DX7A 4R3SB 3TT3H 2ICWA 1AY1L 1NAMH 4XPTL 3L5WB 3PXJA 4DZ8B 4M8QA 4ERSL 4FQJL 4PV8B 1N0XL 2BP3A 1NBYB 3T2NL 2WUBL 1SVCP 4I18C 1CFTB 3IXAB 3D48R 1NCCH 1X3DA 4UINH 2VYRE 5DURB 4MDIB 3WO4C 2EEAA 3HC0A 4L8CB 4N5UA 3AU1B 4QNPE 4UBDD 4EOWL 1RUAL 3FFCA 1WBZB 3I3EA 4OBSA 3D2UA 4Y4KB 3QUKB 2NZ9D 5TPWL 2EXYC 4GRLD 2ESVE 3C6LD 1T7YA 3BXNB 4MB4A 5MP6H 1N5AB 1QLEL 4GKNA 4PJ7E 4QF1A 4WWKC 4P23A 3GIVA 3IJHB 2N4IA 5LCVH 5CIPH 4GAJH 1IT9L 2B8OT 4Y4KD 3QIBC 5ISZA 2QHLA 3MRRB 1EZVY 4TTDC 3ARDC 5I19H 2O93L 3SPVB 1CYGA 4XGZB 3RPKA 3FQNA 4QKXB 2QL1A 2YD4A 5MENB 3V79C 5CIPA 3E2HB 4JPVL 5F8RC 3QXTA 2YD6A 1YEIH 3I6KB 2YA0A 4HUMB 4BZ2H 2ID5A 1NGWA 1IC7H 5A43C 5FYKU 3FQWA 3T65B 1NLDH 1P9MC 2OMNA 1MHCA 3FL7A 3NMEA 4EN3B 1S9VB 3BN9C 3CFEA 5C0CD 5ICXB 1CFSB 2BOBB 2R69L 5DO2C 5D9SB 3AVEA 5E2WH 3MUJA 4DVRL 3CU7A 4Z76A 5BS0A 4PJ5E 4X6CA 2EDRA 3PGCA 3OAYH 1P2CA 5KSUB 5JIIA 4KQ3H 2Q3ZA 5C0IB 4F57H 3GRWH 3JUZA 1TXKA 4G80A 1XZ0B 3EOBB 1NFKA 2G5BA 5JPNB 1MCFA 1FFOA 2J7LA 2PETA 2Y4SA 4Y88A 4UNVA 4UBDC 4LCCB 4OAWB 3I85A 3GIZL 5GRVL 4O9HH 1BEYH 4NQVB 2QHRH 2WWMD 4RAVA 3WNOA 4EDWL 4Q0XH 4JRYA 4R4FL 5KSAD 1WIPA 2CR6A 2YD5A 2Z93B 3MREA 4Z0XA 2A2QT 3G04A 1GGBH 2EIDA 3OKLB 3EDEA 5KSBF 5HDBE 2OK0L 3EOBA 3IFOA 4PJCF 1AP2A 2HFFA 4KRPB 4LVHC 1DCLA 4ZAKB 3GJEB 5D2LA 3S35H 2X4TB 1JK8A 2VDLL 1LK2A 4I77H 5FYLD 3DX6B 2AK4D 1CZ8H 4UT7L 3PIQA 4UOW0 4E9LA 4C56B 5GGQH 1PX3A 5IFHL 3PHOA 1ZHBA 4NT6B 5T3ZE 4OLZH 3DECA 2AJ3B 2DJSA 4M48L 3BUTA 2FEDD 3TBVB 2A0LD 1V3MA 3DVGB 2B39A 5IESL 5KANI 2E3VA 3K7UA 4LARL 3WSQL 4P0DA 5IW1B 1S7SB 3GI8L 4NQSA 4NQCD 2X89D 3SEPA 1YC8A 2X4NB 3BP7A 4NC1C 5JW3L 4Y1AB 3TN0B 5CD5C 1MVUA 1XIWD 2R4RL 4HLJA 4R4BB 4DAGH 2CK2A 2OYPA 1LHZA 2VLJA 3ZYJA 2EICA 1NCDH 1X7QB 2AJYL 1PLGL 1JGUL 4P9HL 2W60A 1VGKA 1BBJB 5EOCH 5D5MA 4BKLB 3STZB 2XTLA 1SM3H 1XF3A 3QEQA 3WKML 3S4SA 2UYLA 3B5HA 4G9FB 2V9QA 3MRLB 1YYLL 3PWPB 1R5VB 3CDGB 4JFHD 4X6BA 4PJ8B 2R56H 2BSTA 1E6JL 4XWGH 4DKAA 1YECL 3TH2T 2VR4A 4O2CB 4GUPA 4JM4H 5DHVA 4TUKH 5ADPL 2NY6C 3VGGA 5F97E 4K7PL 3UTSB 4IRJD 4BQCA 2UVFA 4FQIH 3QDGB 4ZAKC 1X5HA 1PZUB 3KG5A 4MQSB 5DC0A 1NSNL 2Z35B 4K3JL 2XKUA 1KJVA 2DKSA 4NNXB 1K3ZA 2Y07H 3BVNB 3FFCE 4L5FH 3DARA 1FE8H 3LD8C 2Q76B 2HT2D 2UVEA 1Q0XH 1B6UA 4UV4L 3FFDA 4R0LC 3QXWA 4QHLA 4DTGL 1CFSA 2BOBA 4IRSB 4KJWD 3OX8B 3LIZL 4GOSA 4NYLA 5GZNC 4RFNC 4X7TA 2B5IB 1DTUA 3PL6A 4HHAB 2CUHA 4RWHA 4X6CB 4M8QB 3WIHA 4RBPH 1FAIH 2F8OA 3BP6B 4HK3N 4DZ8A 3WDHA 1FN4A 2P8PA 4OLXH 1HOCA 3VH8A 4N0YH 3S4SG 3WD5L 2FLRT 3LS5H 2OR9L 4M1DL 3SDDB 5IMLA 4GXVH 1OSPL 1U3YA 3I02B 5K9JL 5HVWA 1TJIL 1KB5L 1SBSH 5DUPH 4P23C 3U7WH 3SKNB 1DBJH 5E70A 2W0FA 1BM3L 4U1JA 2LE9A 8CGTA 3OAYK 2FYYA 3RUGA 5BZDB 4QTIH 2JKXA 3RWHA 1UZ8B 3ZE2F 2F53D 5ICZB 5IROA 5C09D 4X4XA 3ARGD 1DUZB 5IIEA 5CLTA 4MHHG 2B1AH 3EYUL 4UDUB 2DQJH 4X80H 5JW4N 4KZEH 2HYMA 4GW4A 1P9MA 3RRQA 2B5IC 2Y23A 4FQCL 4PRHB 5DSCB 1FL6B 5GJSH 3RWIA 5C2BH 4PJHB 1BWMA 1YEKL 1L0QA 4BFGA 4HC1A 4XMLL 2MTPA 3IFPB 3FT3A 4JFOA 4M03A 3TZVA 3HE7C 1BVZA 5DQDL 5DZLA 2ED9A 1FNSL 3DX8B 3SDXF 2MCPL 2XFXB 3CVHA 4F33A 2ICWB 1I7TA 2ZUYA 2IGFH 4OJFH 3VD5A 4U1MB 3SCMC 3I3DA 4Z5RB 3BPOB 2XV6B 2ZCLL 1M7DA 1I8MA 1CDHA 2AI0L 4PJ8C 3RIFF 1MFCL 2IJ0C 4MNHA 3AY4A 3O0RL 4FP8L 2HFTA 3AMLA 4RDQF 5L2KE 5JIHA 4F7EB 2VXSL 1U92A 5AUMB 4L3EE 2K9UA 1VADB 3CZJA 1CBVH 2AEPH 4EUPG 4PRID 4PTUA 1FYTE 2YEZA 5EU5B 2GI7A 1CGTA 5I74C 3C5SA 3QUZC 1ZS8A 4D0BA 4V1DA 2VDMH 2V5TA 5IFJB 3VFRB 4KJQD 4WRLA 4OCXL 1D5ZB 2QV2A 3ZYOA 2VL5B 4HT1H 3I6KA 5GGSA 4OCRH 3OL2A 2GJZA 5EU3B 1A8JH 2R29H 3KYAA 2AK4E 3RNKA 1XIWB 1FDLL 2GCYA 1ZA6B 3MA7B 1BVKB 3SOBH 3V5DB 4YEFA 3OZ9H 2VQUA 4ZTOL 1H0DB 1T66D 2EDLA 1LO2L 1C5DA 3CVIL 5IHLB 1MJ7H 1OTTD 1IGCH 4QRQB 3LQZB 3VFSB 4OGAC 5JW3H 5EA0L 3ARUA 2IALA 4OIBA 1NH6A 3CIQA 1IC4H 1A2YA 4G8FB 1MF2L 4Y1AA 3TN0A 1CQYA 1EBAA 5GRJL 6CGTA 5C0RL 3IJHA 4FQ1H 4L3EA 4PV9A 5FUOL 1PJ9A 4OLWL 3HA0A 3OKEA 3UTTE 3THMH 2APXA 4OKDA 5JPNA 5E08H 5C9KA 2HLFC 4MSWA 1TZIA 2BNUA 3QHTC 1UXWB 4FQHB 4J8RA 2EC9U 4XCCH 1EERB 2GT9B 5LGKA 5GGQL 5JHLH 3F7PC 2EDYA 5J57B 3QQ3A 2J6EL 1S3KH 4GBXA 4G7YL 1PY4A 5ADPH 5C8JA 5JXEC 5AZEL 2BMKA 1CXFA 1EEQA 1JPFB 2VDLH 4KK6C 5J4MA 4GS7C 2YPVH 1IQDA 4X6CE 2BSTB 3ME0A 5B8CA 4X4YA 1MNUH 1KNOB 5JDJA 3HG1B 1C12A 5KVFH 1E6JH 4NBZB 4XWGL 4M3JA 4LLVB 3C5ZB 1GJIA 4HD9A 2ORBH 4C59B 4ZFFA 3KR3H 3MOBL 3E6FA 4WFHD 4Z9KB 2A1WH 3QZWG 1UM4H 2H3NB 3RTQB 3RZCC 4JHAH 4XNQB 1CR9H 1B4JL 2BCKB 4HF5H 2FEEL 2P5ED 1X5JA 2PYFA 3AS0A 1L6XA 1X5ZA 4OD2B 4BM7A 2AJZB 1CFNA 4MXWH 3C8HA 5C0BA 5E4IA 5F21B 3TA3B 5GISL 2AJXH 2VLKD 1T5XA 3UTZA 3K81A 3DIFB 1XZ0A 4M93C 4ZODA 3MRFA 1G7HA 3O9WC 2ICES 3VI3E 2QR0B 3C8KB 1K8DA 2J1KA 1KCLA 1WFNA 1YPZB 4EJ1C 1X4ZA 3SE3A 2IH1A 2VLJB 1SY6L 4G7VL 1TJHH 1FNFA 2X40A 4M48H 5IHZA 4XNZB 4WW2F 4LKXA 2AXGB 4APQD 1JK8B 2AV7A 2R39A 2KKQA 3QG7L 2XKNB 1WWAX 1G7LB 2IPUK 4YHZH 5CHNA 1U92B 2E5EA 1F45A 1CF8H 5F7YC 4AMKL 1HILB 3AS1A 1ROWA 3WFDL 5BZWB 3MRHB 3MRGB 3RJQB 4HC1H 3