1F2QA

Crystal structure of the human high-affinity ige receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
167
Chain Sequence
KPKVSLNPPWNRIFKGENVTLTCNGNNFSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human high-affinity IgE receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT
total genus 32
structure length 167
sequence length 171
ec nomenclature
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f2qA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f2qA02
3T4AB 1IE5A 3MCKB 1UZ6F 3O2VL 4MNQB 5F1SA 4JM2C 2JIXA 5GISH 1A6WL 2CLRB 5JW4Q 4HHAA 3GMMA 2A77H 5CMAB 4G8FA 3VFUB 3NGBC 1KLUA 2UZIH 3O4LE 4QNPE 4DKDC 2DYPB 3ZE2F 4UILH 4NSKB 5ENWA 5IEKB 1JGUH 4G6AD 3IDGA 2BHUA 1X7QA 2G75A 1Q9LA 2NY5C 3PIQB 3RU8L 5D7JD 3W2DH 1PVHA 2CXGA 3FQUB 3EJZD 4ZS7L 1KCSL 3FL7A 3PWJA 3TV3H 3V0WL 4YR6B 5ICXA 1UB6A 1ZS8A 1YEJL 5TGBA 3BW9B 3P73B 3OKOB 2ADIA 1FL6B 1AXTL 5HDQH 2HLFD 4KRPD 1C5DA 1JYXA 5JR1H 3RVUD 3WFDL 1IGFL 1HNGA 3QIBD 4QXUH 3REWA 3KR3L 1MFEH 1MJ8L 3FMGL 1UENA 1Q9WA 4BZ1H 5EULV 5EUOF 1T1ZB 4K8RH 2W0FB 2NY6D 3RA7L 5I9QC 3C5SB 3CXHK 5GRJL 4XCCH 1CFBA 5DMJB 3BKJL 3QJFA 5CJBA 1NCDL 1HQRA 1T21A 2FX8L 3S36H 1TETH 3IDMB 3OG6B 4L3AA 3EJZC 1IARB 4X6CF 5D1QD 2MKWA 2VXVL 3ZO0A 1W72A 1IAIM 3JZ7A 2F54B 2XQBH 5IHZA 1MFCL 3T2PA 2R0KH 4IHOA 5DRNB 2PCPB 1NCCL 5HDLA 3UPRA 4M93C 4OTXL 4N0FA 3AUVA 2ATPB 5FA4A 5GJTL 3MYJB 3ARDD 3MLUL 4CADB 1NPUA 2C3XA 1VDGA 4PG9B 1T22A 1T66C 2EDKA 3FCTA 3FQWB 4JY6A 3ZTNH 1BZ7B 5KSBE 4PJ9D 4AT6B 3O6FA 3IAGC 2VRAA 3KYNB 5JPMB 5BMFL 2OTWB 2ESVD 2MPAL 3C6LD 4I3RH 2QSVA 5C0BE 4OFDA 3DURA 3UTZB 4X8JB 3JWOL 3MBEA 5D1ZD 1U8OA 2DQTL 2EXWC 4H1LB 3GI8H 3C5ZB 1YEGL 2Q86B 1UZ8A 1AXIB 1Z0MA 43C9A 1JHKL 5J9PB 3BPOC 2PYED 2DQIH 2FX8H 4KXZI 4R2GC 5D71H 4ZPTB 3IXAB 2YUVA 3I85A 3ARGB 3QQ9C 2DQFA 1UACH 4F3FB 4V1DE 5FIEA 1UH4A 4DTGH 1RIVL 2R1WA 4OCRL 2XWTB 3DRQB 5C0BD 2NY1C 4OSUH 3CUPA 4GMSL 5IEHB 2MQ0A 4IIQC 4HWEL 1WFNA 5D1ZA 4XX1E 5D1QA 1DP0A 3HFML 4PG2C 3HUJA 2A9MH 4FXKB 4KVNL 4RISL 4U2ZA 1PX4A 3RVXD 5I8CA 4OV5B 1A9BA 1YEKL 1M6OB 2YS4A 2NXYD 5CINH 2PYFA 5CUSH 1AGDB 1T89C 4LMQI 3A67L 2Q87A 1F90H 2CD0A 5B4MD 3VWKB 2HMID 4NQUA 4RGOH 4XP4L 1OM3L 1V3MA 1A7NL 1UVQB 4LGSB 1JJUA 1T2XA 4LNRB 2VDMH 3X14B 3EJYD 1GGYA 1KB9K 3P9LB 4NNXA 4Q9RH 3V6BR 1UM4L 3TCLB 3MO1A 4M7KL 4PJXF 2X4OA 1YMHB 5D7LA 2I60L 2VDKL 2EYTB 2GIYA 1DEEB 2I27N 1Y6MR 3C08L 3D39D 4R3SA 4XAKE 3KR3H 1WEJL 2BXZA 3HI1B 1RUAL 3CNKA 4AT6A 2H6PA 3TLRA 2BNUA 2NPLX 4HGMA 2IAMB 3FONA 1J0HA 1W8NA 1X4ZA 3UTZA 4PJ8C 3OB8A 1RZIA 2XT1B 1JWSA 4XPTL 1UZ8B 2FATL 4W70A 3RX8A 5IB4B 2YWYA 4JZOB 5DFWH 2CUIA 3PHOA 5C0GA 5J89A 5C0FB 3L5IA 3TWCH 3EOBB 5ITFA 3IDUA 2R56H 1CS6A 1GPOL 4X7EC 3H0TB 2R0LL 4QY8A 3D18B 5HJ3A 3VXTA 1CD1B 2A73A 2OR7A 4XHQA 1K2DA 2BNRB 3HMWH 1I7RB 1W72H 3Q5TA 1ZSDB 2AKRA 4N8PA 1ZKAA 4K3DL 4KMLB 5FUZH 3ZL4H 4ODXB 2UV3A 5MHSD 3ARWA 3OJDA 1HOCA 1OAKH 3C60A 1RK1B 4Y89A 2F58H 4ZFZA 2F5BH 1MREL 2XKUA 3FO9A 3AY4A 3OKDA 5DJXB 1DR9A 1UXWA 4EVNB 1U3HA 3ZLQC 2XY2A 4ZNEA 4XCNA 5J7CC 4OI7A 2DQUL 5KZCB 4S1QH 4DOHB 1CF8H 3DTXB 2YPKA 3UX9B 4Z7WB 1ZA3B 1N2RB 1D6VH 1E4XL 1FZKB 4NCDA 4OI8A 2GT9B 1NDGA 4H88H 1DL7H 4I3GA 4YHML 1VEMA 5E5MA 5TE6L 1I3VA 1PQZA 4YH6A 1P6AB 1OVZA 3ULVL 3FO0L 2AJSH 5IW1A 5DJ2B 1K3ZA 1T6WA 4GMTL 4NC2B 2ESVE 1PLGL 1NFDA 4M6MH 5HVHC 2AS5M 3UZEA 5E6ID 3TZVB 4R7DA 4PGEA 3CX5J 1TPXB 2X09A 4JPKL 3U0PA 4UAOC 4NQCB 2DTML 3SDAD 4UT7L 5DRZA 2EO1A 1QOKA 4PJFF 1CK0H 4UIKL 3O2DL 1UEYA 3QEGL 5E56A 2HKHL 3WHE0 2K3TA 1RJYA 4WFHD 5GSRB 5FK9B 2FB4L 4S1DD 1HSAA 4XPGH 3MLRH 5FEBA 3G9AB 3H9SE 5BXFA 3SKNB 1F3JB 5DTFB 1E4KC 1D9KC 4GRWH 3QZWA 3VJ6A 1FBIL 2NYYD 3OZ9L 1TXKA 5DEFA 3L3JA 2WWKT 3JUZA 1MVUB 4PTUA 3QHZL 1DUYA 3C6SA 5IVOA 3SDAC 4U1LA 1VSCA 3W9DB 5IMMA 3WJLC 3AREB 3RVTD 1TJGH 2B0SH 4U6VL 4LPTA 3VGAB 1EZVY 4P4KC 1I3RA 2J1KA 4R26H 4JRXE 1HHKB 3RU8H 5CUSL 2B2XL 3GSUA 3WFBL 1DFBL 3IDJB 3IDYC 4J3VA 1JPTL 2FBJH 4UB0L 2FHCA 1T04A 1FVEB 3LKPB 4UINH 4Y5XB 1W0YT 1I1AC 4P3CL 5LQBL 1MHPL 2E7HA 3BZFB 4QHKI 2CQVA 1Q0XL 1BFTA 4GKSB 1KPRB 4LSUH 5FYLH 3BD4A 2ARJA 2GJ6D 1WQVT 2YA0A 2ZNWA 4XMPH 4LL9A 2QHLA 3QI9C 4ZFFA 2P8LB 5CJQL 3MJ9L 1FSKC 5ACLA 2JJWA 2DYPD 3WKMH 4XWGH 4F2MA 1K4CA 4OGYH 1DBBL 3FOMA 4ODVL 4XZUB 3MR9A 4YDJA 3GSWA 2NY1B 5EIVA 1EGJH 2GTZB 1P9MA 5ACMA 4UV4H 3UYRL 1A1NB 1YEDB 2YN5A 5DA0B 4HWBL 1CFTB 3PWPA 3UC0H 2VZSA 3QUXC 4P2QD 5DFVC 4NHUB 3T4AA 1R6VA 4MXQD 4G9FB 1JRHH 1PZ5B 3Q5YA 3VDBA 4FMKA 4HIXL 1C7SA 1IM3B 4OUUB 1HSAB 5CWSA 1CICD 1HH6B 3NZHH 4Q7DA 3N06B 2DYPA 2VZTA 5ELIA 4LRNH 2VZOA 2HJFB 3WNMA 3TESA 4XBPA 1HH9A 3AC0A 5D9SB 1DUYB 1MVFA 1KB5H 4U1LB 5ADPL 3C5ZD 4PB0H 4TVPE 4HPOL 1CTNA 4Z0XA 2VL4A 5D71L 1GC1L 4J23A 3WJJC 4LIQL 4KDWA 1UJ3A 5DJDA 5LGHL 4HS6B 1Z5LA 2CDEB 4TUJA 1N8ZB 1FYTA 1FAIL 3Q6GL 3FFDB 2G9HB 2OSLA 8CGTA 1T83A 3D48R 1AXSA 4HG4J 2O5ZL 1B2WH 1RULL 4HQQL 1IGFH 5DMGD 3QNXB 4MYWB 5L2KB 5L2KE 4X5WB 1S7TA 1VKXB 3QDAA 2RCSH 2HRPH 5I1CH 4DEPC 2CDGA 3IXTB 4KJWC 1UCBH 4ELME 3IS1X 4G7YH 5IV2A 5DVKA 2HFTA 1NANI 5C8JB 2PXYB 3QISA 2C3WA 2IBZX 4IHOB 5DRNA 1ZWIB 1KFAH 2R69H 1RZJH 3E6HA 2NY2D 4OBRA 1KCVL 2R29H 2RR3A 1FYTD 4YHOL 4Y5XC 2VERN 1KTLB 4J4PC 5HYFA 4XNXH 3CVHL 3KPOA 4BSWB 3EUUA 3D6GA 3JTSB 3MRNB 4JHZA 4RBPK 3I9GL 4EOWL 4PD4K 3WO4B 5C09A 1N26A 4YEEA 2A9NH 3LRSA 2AK4E 1CFTA 4MDJA 2IPUG 1JGLH 4CU8A 1KC5H 5F9OH 5J6GA 1T1WA 1S9VA 4G9FA 4OGAD 4ORZC 1EXUA 3RDTB 1JZ4A 2W59A 3EHBD 1MJ7L 2BNQA 4PJ7A 1Q1JH 43CAA 3S4SG 4DN3L 5I0DA 1RK0A 1L0YA 5BVPH 4QOKA 2BOCA 5B3NA 3AGVA 2W92A 3VWKD 2XKNA 3BGFB 3LKNA 5E8EA 1XGQB 5E8PB 5JOFA 3CDFA 2W0KA 4IMKC 1HCFX 4MB3A 5B3JF 4JFXA 1VGEL 3BDBA 4NKDA 4M1CC 5DMIH 3TBVB 1NDMB 4HSQA 5D93C 1K5NB 4W4OA 4PRNB 3LEXA 5JNYA 4XXDB 5C07D 1XF1A 1Z5LB 4LCUA 1TPXC 4GQ9H 3TBSA 4UUJA 4EI5D 4GAJH 3BKML 7CGTA 5E00A 1AGBA 4GW1B 1TTUA 3SQOL 1OGAE 5TDNA 5CIPA 5I8CB 1DVFB 4ZO7A 5T33L 3HR5A 1Q9KB 4XP6L 1T1XB 3ULUD 1S7TB 4F7TB 2BFVH 3NPSC 2EYRA 2QL1A 1SYSB 1UVQA 4NRZB 5T1KA 4C4KT 4YHIB 3NN8B 2AVGA 5I1AB 3S34L 1AE6L 4AIZA 1LEIA 1S7UA 3QG7L 4Y1AB 4TSCL 5SWSA 1KB9J 1GOGA 3HA0A 4FFVC 4ZUVB 3JWDC 4HKZB 1ZT7B 2LVCA 5LWYL 4AJ0A 3SDAB 4JKPL 1XGTB 4X7FC 3VGGA 4C56B 1JCKA 1JPFA 4NRYB 4XP1H 5E99L 3H2WA 5BV7H 5KSBA 4Z8FL 15C8H 2OMBA 1L9NA 3BP6B 1FAKT 4XGZB 4KZDH 5FYJH 1S5HB 3U2SB 4F15B 3O9WC 2Z9TA 2UUDH 4PP2A 3SE8L 2EDWA 1S9XA 3SPVB 3HE6B 4UV7H 2G60H 5CD5C 1IKFH 2EH8H 3TNMB 4RWHA 1IGML 4KQ4H 2DQJH 5C6TH 4N5EC 3NCFB 3UZVB 4RMUA 5EA0L 4I2XB 4MMXC 4IMLA 1GGTA 1K8IA 3B8SA 4OM1H 5KZCD 4ODBD 2BNQB 4KV5F 5DD5H 5JIIA 3GUTB 4YO0B 2X4SA 3IT8D 4ZSOB 1HHHA 3HG1A 3P30H 2NXZD 1DSFL 1KG0B 2OQJB 4APQD 2AABL 3GMLB 5IJKC 2ZPKH 4JM2D 5DWUH 1Q0YH 3VFPB 3CXDL 2FLBT 4FS0A 4JE4B 4XP9L 2P42B 1MH5B 1KXTB 3LEXB 2JCCF 4TNWF 5JNYB 5DK0A 4MB4A 1FJ1B 5DHXB 3TBSB 4QRRD 4ZFZB 5IHLB 2BRQA 1QP1A 1LK2A 4JB9H 2F74B 2CPCA 1JTPA 5IB3A 3N1GC 4JREC 3HUJE 4NC0B 3BI9X 5TFSH 1SVCP 2N4IA 4ZPVA 4R0LB 4LVNB 4NFBA 1NCBL 3BP7A 3KHOA 4OZGE 3ZE0F 4P2QB 3VFRA 3U0WL 3HNTL 4WO4A 5ERWB 4ETQA 3SGEI 2GJ6B 4JFDD 1IQWL 2V5SA 1ORSA 3WIIL 4LSVH 4YBQD 1AJ7L 1U8NB 3VI4E 1T0MA 4HUNB 4YHIA 4OD2B 4DUVA 3I2CH 3TFKD 3T3PF 1A2YA 3LB6C 4NOFA 1FVDB 1QLRB 4Y1AA 4OIAA 3GJFB 5SWSB 2GK2A 1MCOH 3VXOB 1WWAX 4PJAE 1H8OA 2XN9A 4QHNA 2DN7A 3GHBH 4OLXH 2R2BA 1NC4B 1H8SA 3VWJA 5C0AD 4U0RC 3NIDF 4FQ2L 1FFQA 1KCUH 2FDBP 4CMMA 3LRHA 5D8JL 4U6XB 3CSPA 4NQSB 2I26N 3C5JA 3DHMA 4AG4L 4M7LL 1CL7L 1T0PB 3KPTA 5JMOC 3K2UL 5I71C 2DAVA 1S8DA 5IKCB 2R1XB 1E4WL 4LEXL 4X5XA 1CLYH 1G7HB 5DVNA 1CL7H 1U3JA 1YEGH 4JZNB 3ZT7A 4YBQC 1YYLL 2ILLA 4JFDA 4ZAKA 1QRKA 4L9DA 5B21A 2P8MA 1E4JA 1RZFL 1VFAB 3UYOD 3MCG1 2YEZA 5GGRB 4J3OC 3NOIA 1S7RA 3ZHDA 3Q1SL 4Y16A 5D5ME 2CIKB 3RL2A 4YO0A 5CCKH 4D0CB 5IFAH 4N1CA 4ZSOA 3DETC 1I9IH 4KAQH 2RGSA 2DMKA 2V9TA 1U95B 4ZOAA 5E2JA 2Y07L 3VXNA 2VDLL 1V05A 5E2UL 5FKPA 4WUKL 5C7XL 3VFVA 1F2XK 1H0DB 3UP1A 1T2JA 3PL6D 4OTXH 1EEYA 5HI5C 1BVLB 1BQLL 2VLLA 1U8QB 4LCCB 5IW6A 3DO3A 1BVKB 5MENA 3L9RA 1T20A 5FAAA 4Q0XH 4PGCA 3V6OA 2IH3A 2F15A 1EVUA 4LBEB 1CGSL 5ANME 2NY1D 3BP7B 4Y5VB 3PXHA 5DF0A 5C70A 3OR6B 1FDLL 5I66B 5FHAH 1BZ9B 3OAUL 5C0CE 3BXNB 2A9NL 5ITBL 2VISB 3B5GA 5IHBA 2L7UA 3G08B 4FQCL 3X13B 5E2WL 1ZVSA 5EOTB 4YFEA 2FECL 3WDHA 1A8JH 3W9EB 1WITA 4PJIB 4PTTA 4LCYA 1S9WA 3OR7B 3GMQA 3GJFA 3GSQA 1OAXL 2C3VA 2OL3L 2ZG2A 4NZJA 4ZFFB 1AO7B 5DJAB 1NAKH 5B4MC 1KFAL 1RY7B 2R69L 1JF5A 3BN3B 4OFVA 5E2VL 5EUOE 3VWJB 2OBGA 5IBLD 2BJMH 4JM2B 3MR9B 1LP9A 3MGAA 1R0AH 2UZIL 1DDHA 3IFNH 5ETUA 4FFYL 4W81A 1OD9A 4Z78B 1R0AL 4L4TB 5K9JH 1G7HA 2CUHA 4PV8A 4DKFL 1A3QA 1P1ZB 4OZHA 1GL4B 1JV5B 4QWWD 4RQQA 5F70A 3EYSL 5ICYB 4GRWE 5E8NA 3B9DA 3DIFB 3SJVB 1AQKL 4FQLH 4YXHH 1QVOB 1QBML 4P9HL 4Y16B 4LDEB 5DUBB 1IQDA 1R3LA 4WY7L 1NCAH 3ZHKA 3MACL 2AQ3A 3BDXA 1A6VL 3CLEH 4WW1A 1MHHB 4M8QB 3DV6A 1P7QA 1QKZL 3MBXH 1LO2L 3AU1B 5M95B 1A7QH 2HJFA 5A16B 3TN0B 2RAMA 1IGIH 1IC7H 1EEYB 4BUGA 1X44A 5SWSE 2VLLB 3ARGD 4HULB 4PGJA 1U92B 2IMMA 1KEMH 4D2NA 5T3XL 3R06B 5E4EC 4MAUL 3THML 4HS6A 4WDIA 2NY4C 1QSZA 3G6JF 1E28A 1NH6A 1FYTB 4HWUA 1HN1A 3IJHA 3MA7A 3SOBH 1CFSB 1N7ML 1OAQH 2HRLA 2MNUA 5EC1B 4GG6A 5C0RL 1A22B 1DANU 1G7LA 4WFFE 4XNMB 4QF1B 1KXVC 5FGRA 3BFOA 3ECBB 1SMAA 1ZK9A 3EYVB 3S4SB 4NN6C 3KWWA 5GS0D 1LO3L 5EOCH 5CJOH 4PJIA 4R9HA 4MCZB 3GMQB 1VEOA 3MV11 3RNQB 1FLRL 2BZDA 2X1WL 5EO9A 5F7EL 5ESVA 4Y5VC 4KK9D 1FC2D 4LOUC 4WI8A 4KROC 5HYJB 2OP4L 4GG8B 3QQNA 4X4ZA 2OZ4A 2RB8A 2OR8A 3GSXB 3HZYA 4X98A 4L4JA 4WW2B 4K71C 5ETUB 5JHDE 1LGVA 1DEDA 4NCC2 5J13B 4RFOL 1N64L 2OI9C 4PB0L 5ISZA 5GS0C 1A47A 1HZHL 1OTSD 3TNNA 5I18L 3UDWA 2D2OA 4RQQB 3V4UH 2CRMA 4E41E 1I8KA 5E8NB 1T1WB 4YX2H 5I1GL 3TBWB 1D5BB 5MERB 4JFFB 1TLKA 3U1SH 4ZS6C 3K1DA 1INEL 3P0YL 3DV6B 5A3ID 3LHPH 2YC1A 1XF3B 4RWYH 4CDHA 4K3HA 2OTWA 4MZ3A 3W81A 3LKNB 5E8EB 5JOFB 4KRLB 4JDVB 2EDYA 4ZUWB 3GJFH 5GGVH 1NEZA 2YHGA 4M6ML 4C54A 4Z7VA 3T2OA 3FO2A 3MV7B 4I0PA 1HKLH 2ZWLT 2P7TB 4FQ1H 5F3BA 2ZUQB 4FABL 1KULA 5IIEB 4HC1H 4AZ8A 3SDXA 5T1KD 3TH4T 4HIHB 3L7EA 7FABH 3QPQD 3VWJD 3GSNB 3KLDA 3F7PC 1H8NA 5EC1A 5HGAA 4M7LT 1MQKL 5IESH 2NY3B 2UYLB 3TIEB 5I76A 3S3SA 2ADFH 3ECBA 3ZKXC 5BO1H 1NMAL 1T1XA 3EYVA 4HXAH 3CUPB 3OZ9H 4I1NB 2ICWJ 5DURD 1AD9B 2EYRB 5IEHA 2DBJA 4EIGB 3QIWC 1EHXA 3P9MA 2FEEI 1DCLA 2X89D 5I1AA 3V79C 1LEIB 1ADQH 1FRGL 4X6DA 4ZFOB 4JKKA 4OV5A 4ZUVA 2V7NA 3MRFB 1M6OA 4PYHA 4XAWL 5TF1L 4JZJB 2JLLA 3QBTB 4PUBL 3O8XD 3MV9A 2CRZA 4JFYA 4PRID 5EU4A 2J8UE 4K7PH 4NQDA 3RWDA 4JY4B 4H25B 1OQXA 4HWBH 4XHJD 5K9QI 3QJHA 3P9LA 3LS5L 3HE6A 4ZO6A 4KKCC 4HUMB 4M03A 3SDYH 4LLWB 2APFA 3J8F7 5HYQB 4TNVK 2NTFA 4M62H 4HUUB 1ZTXL 5EORH 4QRRA 4LKCB 3D25B 5CJQH 2DQEH 3S5LG 2XZCL 5IQ7H 4RAUA 4PJAB 4K7FB 3SCMC 3KLAB 4FQJH 4IDJL 1GZQA 1J1OL 1SM3H 4EN3A 1U8IB 4Y19B 4NJAL 5F6IC 3S37H 1E6JL 3T04D 1KNOB 4M1DL 2BY3A 3GO1H 1GC1H 4Y4FA 3QG6B 3MV7A 1U58B 4WUUA 3RTQD 4P49A 1LVEA 4PRHE 1A14L 1IAOA 5D70L 1ZHKB 3HPJA 2M8XA 1AGEB 4P9ML 3HMWL 4MJ4A 1I8MB 2X89A 5A2KH 3P4OA 4P4KB 4XT1C 3V4PH 3GB7A 5FDWA 1G7JB 2BSED 3FAWA 2KBGA 1CT8B 2IEPA 4QGYA 3PL6B 4P2QA 3VFRB 2H1PL 3RWCA 5E6IB 1NBZB 4EI6A 3UTSE 3L5HA 1U2CA 3T0EE 4B0MM 3ARBB 3GMPB 4EUPB 1U8NA 4UIMB 3BIKA 4OD2A 4R96B 3RTQC 3S36L 1EX0A 1OT1A 1LO5A 4UAOB 4QRTB 2GUOB 4H0GA 2ZJSL 4PY8J 5CZKA 4HAFA 4PJ9A 2OL3B 3QO0B 4PJ8A 4G43A 1ZVYA 4MQSB 1ZA3A 3MV9B 3CFDB 3MLWH 1KCLA 2FO1A 1I85C 1A6PA 2VDML 3QHZH 1EFQA 3MNZA 4U7KA 5F1IB 1FO0L 3K4ZA 3DO7B 2KKQA 2BSSB 1HDMB 3PQYE 4YHPB 1G9ML 4PGDB 2NY2C 3ARPA 4LARL 4JFEA 1ZLVH 5AWNL 1HILB 4RNRA 1ZXQA 4KTYA 1IAIL 5DD3L 2YEZB 5DS8B 3EYSH 5F9WC 2CDFB 3QDMD 4WGWB 3T1FA 4KGJA 4UT7H 4ZUUA 4Y7MA 4Y19D 2YA2A 4JFPB 1I8IB 1BREA 3HS0A 4JO3L 1Z9SA 2BC4B 4NQCA 3MUHL 3IRPX 3H3BC 1U95A 4JG0H 5BQ7B 2HFGL 3FN9A 5FKPB 3MBEC 4OCWH 3STLB 5J12B 1QUNA 4H20L 3RHWK 2ED9A 4Y4FB 5FO9A 3VFMB 4E0RB 3B5HA 4XP5H 1F02I 3X3FL 2FD6H 5FK9A 2DM3A 4LSPH 4M3KB 2XTLA 3TA3A 3DARA 4R4BA 1I1AB 3IKCB 5F71A 3ARUA 2CXKA 2NXYC 5T1DH 4HH9B 4AEIH 3O81A 4YUEL 3SOBL 5J1AB 1P7KA 4G8GB 1PY4A 5DK2B 3BEVA 4L4TE 2E9IA 3BZDA 3DX8A 3MGOB 5EZJA 2J8UB 3LEYH 1GH7A 4BZ2H 5JW3L 2AEIT 3NGBB 3CZFA 4RGOL 5KVGH 2XN9D 1FP5A 3O9WA 3GIVB 2DD8H 3WD5H 4BA8A 4XPFH 5KSAD 4N0UE 4PRIA 1OAYH 1T5XA 3O3BA 2OL3A 3P77A 1B9ZA 1KEGH 1VACA 2IG2L 3RDTC 1JGVH 4NO3A 4QHMA 1LO3H 2V7HB 3CU1A 3ME0A 4R8WH 3TN0D 1BIIA 2F5AH 1VADA 1EIBA 5GGTH 4K3EH 4F9PC 1A6TB 2ZUQC 5E8DH 4PJAF 1XZ0B 3WFHB 3VFOB 2HA1A 3B6SA 4YXLL 5ESQA 4G6MH 4JFDE 1G7IB 3Q1SH 1UB5A 5FHBL 1ZA6B 3ZE2E 5JHLL 1CXEA 4JLRA 4X6BB 2M26A 5DRWB 4ZFOL 3W39B 3WL9A 3T1FB 3RGVB 4TNWK 1H3WM 1R3KB 3FOMB 4A2LA 1IQDB 1R3LB 1JGDB 4QHLA 4YDJB 3SGKC 2DQUH 1MFNA 4ZD3L 1X5AA 4GKNA 4JGMA 3FZUC 3S97C 2DLIA 3QXAB 4RDQF 4F7CA 3RPIA 5DD6A 2NLJA 1F13A 1YEDA 2VDOH 3TN0A 4GO6B 4J2XA 2AV7A 5KAQG 2NX5A 4HGWA 3NFPB 4KVCH 5HI3D 2XA8L 2LAAA 1FNEB 4K3DH 3OGCA 2HJLA 2Z8SA 3BO8A 4F58L 3R06A 4H0IA 4OUUA 1MRCL 3U9UB 2EDBA 1FG2A 1HH6A 3FTGA 2VXSL 1FNSL 1CK0L 4R7NB 2X5PA 3MMEA 2IGFL 2BVUA 5C0IA 4RIRA 1BF8A 1KB5A 3O0RH 4GG6B 5BW7A 1KCSH 1G7LB 1IKFL 1XAUA 1IC5L 1FZMB 3EAKA 3OAYK 1KIRB 3C6LB 5GS3A 4Y2DB 1JK8B 4XPAH 3MJ7B 2O93L 3W11D 3LKSA 1JI2A 1IEAB 2OTUA 3S88L 3O3EA 3TJEL 1NAKL 3UTSA 3FO0H 3OKLB 3OKMA 3VFNB 5CFHA 1R5WA 1H3UA 1P7HL 3UTOA 2VXQL 4PJEF 4XP9H 5K9KB 4ESKA 1U6AL 1BOYA 1UADC 4MA7L 1HSBA 4NO0D 1VGKB 3DBXB 5KN5A 3DROB 4G9FE 1CXFA 2FX9H 1N5AB 3RIFK 2GJZA 1G0DA 4JHAL 4NQED 1NFKA 1CDYA 3WFEL 4KQ3L 1G7IA 4JRYB 4GQ9L 2PETA 5EBMB 3E6HB 5C08B 4LIQE 3I84A 3CAFA 4HDIA 3T1WA 3U7YH 2Q8BH 2ADGA 5BZDB 5F9WB 3Q3GA 3CLEL 4TRPH 3UO1H 5LJYH 3RL1A 5HHMB 1YC7A 3MRCB 2NYYC 4YHKL 3TF7C 3WEXA 3UJTL 1NCWL 4YHZL 3EYUH 1M7XA 2IG2H 2LTQB 3QXAA 3BRGC 1F4WH 1IGCH 1AI1L 2P1YA 2YC1B 3ZDXE 3EO9L 4APQB 2VDRH 3WS3B 2Z93B 1FORL 4QCIB 1GZPA 1UA6L 5KSVB 1IGCL 1MPAH 2OLDA 3WXVL 4Z7VB 3ARRA 2CRYA 3HUJF 1S7WB 4MA7H 3RDTA 5K9QG 1CU4L 1ZT1B 5D7JA 1VHPA 3HE7B 4LK4A 4PJ7B 1KLGA 2M2DA 3O6KH 1S7XB 4XC1H 43CAB 5IVNA 3K74B 1QLEH 3NTCH 3WDJA 1MFCH 2XN9E 5HI5D 3MGTA 5IUSA 1LO4L 3WBDA 3DX6B 1D5IH 5HPMA 3F5WA 2VYRE 2P8PB 2H32H 4K94C 5L0QB 3QNZA 5DQDL 5DHVH 2WQ8A 3CH1B 1LO4H 3UXFA 4G6KH 4YGVA 4F8TA 4ONFH 1PFCA 4LVOC 3BZ4A 4WEUD 1A6ZB 3HC3L 4MJIE 5F1KC 3NVQA 2R56L 3SDCB 3BJLA 3IB4A 1M7DA 4BQCA 1CFQB 1SEQH 3EJJX 2JJSC 5JPNB 2XWBA 1LNUB 3KPLA 2DKMA 4UV7L 5SX5K 5F88B 2VXSH 5D7IB 4KMTL 4GH7B 4V1DB 5KANI 1ZGLP 1OAZH 1M1SA 5DQJB 2F5AL 1VGKA 3DBXA 1KTRL 3R0MA 3ULUH 4XPAL 4LPVA 5T1MB 3W2DL 2E3VA 4HPYL 1UXSB 4PJCA 5IROA 3W82A 2H26A 2O5ZH 3DI2B 1TZGH 4BQ8A 5EU6B 3KPSA 1I7TB 5BRZA 1J12A 3MLRL 3MNVB 3DMMB 3QRGH 3FB5B 3NIDE 3G9VA 4LLDB 4HUUA 4C56A 3IAPA 1LMKA 3L3HA 1K85A 5H35A 5KSBB 1JE6A 4U6HB 3MRDB 3RWJB 1X6LA 2MCPL 1CVRA 5FGCE 1BEYL 2QTEA 1Y0LA 2GKIA 4HLZH 4NZRH 3H9HB 3WS3A 1FN4A 4X99A 5EUOA 5IWLA 4KK8D 5F6HJ 3CFKA 1J0JA 3L5XL 1RZ8B 5D2LB 3FRPA 4IMLB 4GRLC 4HKBA 4KK6D 4X80H 4Z7WE 3V6ZA 3MLTB 4O4YH 5L9DL 1C1EH 4R90L 3GMLA 2GITA 3GB7B 5FDWB 1G7JA 1JZ2A 1MCOL 4CVUA 4HIJA 3SKJL 1ZHBB 4J8RA 5GGTL 5AD0A 1MLCB 3RRQA 2ZOKA 4XB8A 5FYLE 3BEWA 4YGVB 1Q1JL 5F9JB 3LOWA 5DO2C 3NFNA 3FFCB 1U41A 4EUPA 4PJHB 2JKXA 3O3DA 3WUWG 1EFXD 1YN6A 3LQAL 4I0PD 3LPGA 3H7LA 4KK6C 4MJ5A 1JYWA 4LSSL 1NGXB 5F89A 5L8LB 1UT9A 5IOPA 1MWAB 2FJFA 2L0DA 3N50A 1ORSB 4AH2A 5D7SL 5D2LE 4FTVA 2VIRA 4OT1L 1T0MB 4F7MA 1YYML 5JXAL 5FYKL 4I48A 2DICA 5I8KL 1XGYL 4WU5B 4MS8D 4U7MA 1I1FB 3KNBA 2VXTH 3LN5A 5BRZB 4L1DA 1PZUB 1JUFB 4LKXB 1AHWA 1K8DB 1SBSH 4XNZC 4PP1D 4PJIE 4M7JL 5DMYA 4YGAB 3IETA 4NQSA 3EKCA 1S5IL 1TNNA 4XNXL 4FXGB 3QFDA 1AGCA 3QDGA 3RJDA 4OZIA 2MWCA 3LQZA 3S37X 3H9HA 1FN4B 4X99B 3VXPB 3QULB 1KLUB 5F8QC 3ZE0E 2IPTL 3STLA 1ND0B 1L0QA 5IG7A 3VFMA 2YD9A 1F4YH 1BFOA 1I8LC 1LEGA 2DBLL 2VDPH 3WE6B 6FABH 5IEKA 1MF2L 5D2NE 3GMRA 3U6RB 1GIGL 1SBBA 4KPHH 4R4BB 3B3IB 5JXAH 4PGBA 5LWYH 3D85A 4Z0BL 1KJMB 5D7IE 3BWAB 2Q3AA 2VDQL 4JHWH 5FYKD 5DJ0B 5C0BA 1QPXA 2BHZA 1SHMA 1C5BH 4Z5RB 2QHRH 1X5IA 1BVLA 1Z3GH 5D2LF 4Z7UB 1EDQA 3VH8B 1LQSR 3CK0H 2OJEB 5F9JA 3JWDH 5F1NB 3HC0B 5B38B 1XH3B 4OZ4A 4PY7A 3FB6B 5CS7A 1P5UA 4UILL 1T1ZA 1KCVH 2R29L 3LDBC 3KPRA 3T4YA 3TIDA 1LDPL 2X70B 1ZLSL 2IALB 4M5ZL 2NY3C 2B1HL 5I1IH 2F54A 4QHMB 1I1CA 3T3ME 4NQEB 2Q7NA 3BXNA 1ZLSH 4F7EA 3OAZK 3D85D 2HFGH 2AK1H 2Y06H 2CIIA 2UWEA 3H6JA 1FV1A 1AR2A 1TZHA 1F42A 2VIRB 1LHZA 2VWEE 2BOBA 4O5LL 3W9EA 1T22B 3OXRB 5GGRY 5GS1C 3VXQA 3EYOB 3WFHA 1I1YA 5J1TC 4RGNB 5I15H 4E42B 3KXFA 5TF0A 3MRRB 4W68A 1C08A 1UB5B 5D72L 5IB2A 3S36X 3RWFA 2P5EA 4F80A 3ZKND 4YHYB 5EN2B 1IMHC 3ULVD 3FQTB 3QIUB 1A0QH 4JM2A 4M7LH 3WNLA 5EU5B 4DEPB 1UKQA 3MA9H 1UH2A 3QWQB 3JWOC 2AQ2A 3SQBA 2W1NA 3FRUA 4KKCD 2FEEL 3W5MA 1MCPL 3D39E 5J06A 4MWFB 1NC2A 2RFXB 1CBVH 3PP3H 1BFOB 3GDBA 3HNSH 2AGJH 2HFEA 1IFHL 2BDNH 3BO8B 3OGCB 4ZXBA 4MD4B 3P4MA 2C7UA 4AEFA 1KJ2H 4Q97A 3OAZH 3B3IA 3ULVE 3GKWH 3RNKB 2JB5L 4I18A 4OGXL 1DBKH 4YLQT 4H8WC 3L1OH 5LAXB 4U1GB 3SY0A 1E6OH 3MUGB 2R0ZL 1A21A 4NZUH 3GKWL 1YPZF 4UQ2B 1MIMH 4MAYD 1YDPA 2F8XC 5DRXA 2AJYL 3BH8A 3TFKC 4HBCL 2VQTA 1BLNA 3T77B 2AXHA 4OBSA 1XIWC 3BKCH 2NW2B 3QXDA 6FABL 1JP5A 3MV8D 4O02L 3UTSB 4U3HA 4KPHL 2BRRH 4ZXBD 1ZGLB 4JFQA 5CEZL 4OLYH 3U0TB 5FM5O 4RAHA 2MHAB 1QBLH 5I1GH 4I77L 2OS7A 1RMFL 4NNXB 3QWOA 1QRNE 4Z7OE 2D0FA 1YMHA 2K7QA 5TE4H 1MHEB 5DC4B 4LQ1A 4BZYA 4PRPB 2HJKB 1W0WB 5FB8A 5JXED 3OXRA 1N59A 1EEZB 4YFLF 4G7VL 4C56E 4RWYL 4X4YA 1IGMH 1FDLH 2Y5TB 5ILTL 4LP4A 3HN3A 3V52H 4L8BA 1X9QA 3ZTJG 1G0YR 4N68A 5KTEL 3ULVF 2NW3B 3IFOB 4ZXBC 3QXUA 4MSWA 3H9SA 1F8TH 2I9TB 3MOBH 1OSPL 2X4NA 4M4PA 3WHE1 4AENB 1BWWA 3ILPA 1CGUA 4JN1L 1OPGL 3AS2A 4Q2ZA 1HEZB 3NIFE 3G5ZB 5AYQA 1NAMA 3KAAA 3LPWA 1DQQB 4YHKH 5C0FA 4C59B 1NC2B 2HVKA 2NZIA 1GZPB 2FRGP 2CUMA 1I7UB 2D31A 3ILQD 1RIHL 4O58L 2L4OA 2VQ1A 4MD4A 5I15L 5I1HL 2ICWI 5I17A 1YC8A 5CD3B 1MIEH 4OM0L 5KS9B 3UTQB 1ZAGA 3WKML 5LAXA 4JKLA 3SY0B 1KSRA 2E9WA 32C2A 4BFIB 4NZTL 5EWIL 5HPMB 4OLWL 4H8WL 1KEML 1X5XA 4DW2H 4GAGH 1U3HB 5CGYD 4NFDA 4XCNB 1QR4A 3LMJL 4O4YL 5K9JL 1FNGB 5EBGA 1JF6A 4N1EA 2GCYB 4ZTPL 6CGTA 5J4MA 1I9EA 4HIHA 3O3AA 2XOTA 1B6DA 1BQHA 3QIBA 4HJGB 2BNQD 4ZOCA 1I4FB 4OLXL 4TTGA 1KCRL 3MRQB 4JFQB 2A6DA 4WY7H 3B43A 4PJBB 5KVMC 4R2GB 5GRJH 5F7UA 4KHXH 3FQNA 1HQ4A 5DQ9B 1H5BA 5C07B 3C09C 4W6WB 5CAYB 1NFDB 3FFCE 1BBJB 1JBJA 1PDKA 4IRJB 4QXTB 4N0RA 4S1QL 5FYKH 3JV4B 5E08H 1JIBA 1JTOA 3JVGC 3KPSB 3O6LL 4L8BB 4BK5A 2C4FU 5T3XD 5GRZA 4NKMB 1NBQA 5BCAA 3BWUC 4WWKC 5EU7E 4L3CA 5IF0B 1AQKH 3B2UD 1KENH 1CLCA 2Q20A 3U4BH 1VCAA 1TVDA 4U1MA 3MLZL 3BYTA 3GIZH 3MJ8A 2PYEE 3U82B 4LAQL 4J6RH 4OZGB 4G8FB 4EQ3A 3VFUA 3AAZA 4FFYH 1QKZH 3RZCC 1IAKB 2G2RA 3AMLA 3C87A 1AIFB 2B4CL 2BVOA 3LDBB 3TP4A 1EFXB 5LG1A 4GKZA 1U8LB 3EFDL 4MHHI 4OCMC 3WS6A 2P5EE 2X4QA 2D7PA 2VDPL 1IM9D 3D39A 4Y4FD 4WFFD 4FQLL 2HVJA 3FT3B 5JO5B 2DQGL 1MCWW 2HTLC 4XMLH 4G3YL 3BRDA 1EMTH 1XR8A 2Z91A 2IANB 3OKEB 2Y5EA 4IDLA 2GHWB 3SO5A 5GS1B 3QCUH 2GTWA 3MODH 1HHKA 3QG6A 4NN5B 4GXUM 1N64H 2FB4H 1D6EA 3G6DL 5D7JC 4P9MH 5D4QA 2VMFA 4POUB 2IADA 5HVGB 3LKPA 3NCJH 1Z0NA 3WXWL 3EO1B 1PG7L 2BMKA 3A6OA 1QBAA 1UC6A 1BFVH 2DKSA 2Y72A 3IDMA 2AK4A 5ECJE 4YBLB 3IDIB 4NO5A 1YEFL 3GGWA 2VUOA 5T3ZD 5FA4B 3DRTA 4KJPC 3SDDA 2NY6C 4K2UH 4R96A 3K0WA 3OJVC 5DA4A 3V95A 3U7YL 3GSWB 2DWDB 1YY8A 5HDBE 1BZ7A 4M8VA 4YXHL 4ZTPH 3KPSE 2FO4B 3TJEH 5J6HA 1JUFA 4LKXA 1FQ9C 1A6WH 3QSKB 1OSPH 4QKXB 1JL8A 2ZUUA 5KVDH 1A6UH 3IETB 2VWEC 2ITCA 2WMPA 4YXKL 1ERNA 5F9OL 2HN7A 3MPCA 1MWAL 2Q8AL 3VXSA 4NQEE 2ZZUT 4YE4H 4G6FD 3C6LC 4ZPTA 1U8LA 4Q9QH 1E4KA 3SDDD 3D5OF 5I8OH 4MD5B 1QEWA 3PV6A 1C7TA 1ED3B 4EXKA 3MRKB 2YUXA 3QIUC 5BOPA 3NCYP 5ALBH 3M8OH 5ALCL 4NRXA 3NH7L 4JANB 4Q6YA 1KJMA 3KYKL 2CDEA 4M1GL 4UNUA 1BJ8A 4HLZG 4OD3L 1P2CA 2F5BL 4P4RA 4HUVA 3A6BL 5D8JH 5F1NA 5T5FL 1CIUA 1S9YA 2KH2B 5HD8C 3MJ9A 3BYYA 3SDDC 1RJZA 3QUZD 3WNKA 3CZJA 4Y5YC 1MNUH 5ID1B 2MMXA 1YEKH 3TT3H 2X70A 4CN6A 3IXTA 4AM0B 5FO7B 5HGBA 1V5JA 3K3QA 2ARJQ 4LNRA 4QLRA 2DOCA 2WIMA 3X14A 5DD0H 1CE1H 3HC4L 3KLHC 4N9GB 4F7EB 3VFTB 1ZWIA 3CFJA 4ZNEE 3TCLA 1YMMB 3P4NB 4JPWH 1CICC 2O5XL 4NHCH 5EIIA 3RPKA 2BOBB 4RFNB 3MLWL 3KDMA 5E9DA 4PJ5E 1CXIA 2CLVA 1IAII 3VE0B 2H3NB 1D3CA 2VLRD 3KYOB 4XNYL 1A14H 3HC3H 4NQXB 5GRUL 3GKZA 5E5UB 2AERT 2P5EB 5DEZA 3AXLB 2IAMA 1RJLA 3BQUB 1NGZA 4CVWA 1OB1A 4K3JH 3V0VA 1MCCA 1BIIB 4JCLA 4Q6IC 3QXVA 4MAYB 1EXUB 4FQQB 4K7PL 4CVZA 1RZJL 4MA1C 4KTDL 1M71A 3VXSB 3BIBX 1R5VA 5C6TL 3S88H 1FVCB 2E7CA 1W0VA 5FV2A 2R2EB 2XKNB 4HFUL 4KFZC 2VAAB 4QY8B 4G80A 2BNRA 4UNTA 4KXZH 4KJWD 5HHNB 5F72S 5CBAB 2P44B 4ODWB 4WJ5B 3TBVA 4GKNB 4NO2B 3PG2A 4PBXA 1KJ2A 1XGPA 1H15B 5E24E 1BBDL 1J5OH 4N0CD 1AFVL 4NZDA 4OCYH 3Q6GH 3BD3A 1F58L 5E00B 4A6YL 2LAGB 4G8IB 3S37L 2VXQH 1MFAL 1FNEA 3EDFA 3U46A 4K3JL 3T8XB 1F6LL 1MREH 4D9LL 4JZJC 1U8HA 4GXVH 4M61A 2FR4B 5GSVA 2E6PA 1D7FA 3WXWH 4HKJB 1RJZB 4OQTA 3V7AE 3QP3A 4YUEH 3QXDB 4R4NC 3W0WA 3WKNA 1TITA 3DNKA 1RFDH 4H26A 3KYMB 2DMBA 3VGAC 2AK1L 3SDCD 3VGFA 1YECL 4NYLA 4UOW1 1PEZA 2FCBA 3MRPA 3X3FH 1NEZG 4PREB 1AXTH 2Y9RT 3RKDD 3LKSB 3BKMH 3MJGX 2N7BA 5FGCB 4OCWL 4HKZA 1AGFA 2W60B 1W0WA 5CMAA 1N59B 3OBAA 3MV01 5IT2L 5INDA 5TE4L 1II4E 4XP5L 1KYOJ 3KYOA 1V8HA 5L7XL 2AEQL 2Y5TA 4PR5A 1OTTD 1QFWM 1DQML 4BYHA 4TVPH 5F6IB 4NBXB 4G8GE 1PGRB 4PS4L 3QNYB 1LWRA 2NW3A 4FZEL 2CSPA 4IEFB 1ES0B 2AXFA 1H9VA 2I07A 5EU6D 1N3NB 4UDTA 4ZSOE 1T80A 4EI5C 4FQQA 1CBVL 4U1JB 3DECA 3RBGA 2YPLA 4Q2ZB 2LV4A 3P73A 1NAMB 4I2XE 3BIAX 1DQQA 4ZD3H 3KJ6H 3SKOA 5HHQB 1MELA 4HBCH 3OKNA 1CD8A 1QSFE 5EBMA 3MTRA 1F3JA 5DTFA 2WV3A 3HG1B 1TCRB 4OFYD 5D70H 3BKCL 2XTJD 1PAMA 3KJ4C 3VFPA 4JJ5A 1OTTC 1X5KA 4Z77B 5T3ZH 2WUBH 4L8SC 1BGXL 2AK4D 2NR6D 2I5YL 3HI5L 3O2DA 1QACA 2JK5A 3G04A 2W0FA 3C5SA 1FC1A 4JO1L 4Y4HB 2Q7YB 1NFIA 4YDIL 1FJ1A 5CHNA 4G3YH 4JFFE 4JQIH 1CZ8H 4FFVD 4WI5A 4G8IA 1EO8H 2JELH 1F97A 3O6FC 1ORQA 4WHCA 2EKJA 5DGQA 4CN1A 4R0LA 4WI4A 2ORBH 4H88L 4P59H 4JPKH 4KROB 1QFHA 4KUCD 2Y6SC 3VXRE 1BQHB 3QIBB 5IFHL 2H32A 3V0AC 4ODTH 3DXAB 1PSKL 4FQIL 5CD5D 4PJBA 2DJ4A 5FYLD 3DX6A 3X11A 1A7OL 5DEGB 2G5BB 1EBAA 2FX7H 5I74C 1AC0A 1JGVL 2DB8A 4X7SL 1JMZA 3OKYA 5C07A 3QQ4B 1XIWA 4HZLB 1HHIA 3ZDXF 3O6FD 5ID0B 15C8L 1F4XH 3QUYA 5M7QA 5JUEL 1FIGH 4NGHH 3H9SD 5A1AA 2GY7B 1F4XL 5F9DC 5CP7A 1V7ML 5DUMH 2ID5A 3FZUD 3ARYA 2ORBL 2EH7H 3NZ8B 4IOIB 3TCXA 5DZOA 4U3XA 4AYFA 3F7VA 4WTZG 5GGRA 2J2ZA 3S8WA 1FGVH 3QXTA 4GRWF 3SKOB 4XCYA 5D1ZB 3NBNA 3DYPA 3V5DB 5BS0D 3MX0A 1V3LA 2G2RB 1AIFA 1ZE3C 4IBLT 1TCRA 1OF2A 2VH5H 5EU3B 4KRPB 1FE8H 4M6OH 4FHBD 4PBWD 4ELMF 1UM6L 1JFQL 4M93B 3MRLB 4YHYC 1TJGL 2B0SL 1L6XA 3EFDH 2XWJA 1XCQB 3JBG7 3G6AB 4TN9A 4KJYA 1G9NH 3LKQA 3LB6D 4HX1A 5C07E 2V2TB 1GJIA 5FYLL 1BVKA 4IOSD 3OKEA 5DZNA 2BNRE 5AWNH 1KXQE 1N8ZA 3ES6A 3MJ9H 4WV1B 5HYEA 1RHHA 2DIBA 4K55A 4MX7B 4TUKL 1WCQA 5ENWB 4FOMA 2X4OB 2OSLB 4ODVH 2G75B 1EV2E 3C5ZC 2EDNA 5HHVH 2IADB 1LD9B 1W72L 2CMRH 5L2KA 3L3DB 4MNGA 4P46B 1WV7T 2ADIB 1JHLL 1SJXA 2GQHA 3HPLA 5HHPA 2YXFA 4OCXH 1RHFA 1T03H 3LHPL 1TQCB 1UWGL 1QZ1A 4HT1L 1OLLA 1A3RH 1EAPA 1Q9WB 5IB4A 3I6KB 5MEPB 3LEVH 1MPAL 2DI8A 4HFUH 4L3ED 5AEAA 3MLVH 1DQMH 3TYGL 3HRPA 1NKRA 4F15C 3VGHA 4G9DA 3JV6A 5J6HB 4UTBL 2J5LC 2YPLD 1I9JL 2HH0H 5IOPB 1H5BC 5DR5L 1P1ZA 4OZHB 3PF2A 3UO1L 5HHVL 2DLEA 2NY7H 2ATPA 2E7MA 4A6YH 1HOCB 2Q3ZA 5F7KC 5GS2D 5B39G 2X9XA 3CFEB 4O00A 1EUUA 4KI5C 5JDSA 2ZNXA 4QOKB 2Z4QB 5J3HC 5EU3A 3DX9A 4PJCF 1AHWB 1K8DA 2C4FT 1RI8A 4ZOBA 3AU1A 3BMWA 3LZFH 1FIGL 4JFXB 4N8CH 3MBEB 3TO4D 1U92A 5IMOB 43C9B 4JPIB 4HK0A 2DBLH 2AEPH 3MRHA 4P3CH 3ILQC 1GYAA 1YEEH 3D9AH 3N1QC 4TVPD 1TIUA 4QGTA 4R90H 4Y0GA 5FOBB 1CFSA 2B1HH 5I1IL 4LVNC 1E4XI 4P2OC 4WCYH 5H37H 5DJZB 4DQOH 3GMNB 4OLZH 3C9NA 3QDHA 4S1RL 2HAZA 4XNMA 4LPXA 3U6RA 5C3TA 1D5XA 3OSKA 3L3GA 4G6JL 2OR9L 4PGEB 4HCRA 3IF1A 1EHNA 3V7MA 4DAGH 1DN0A 3DUHA 4OGYL 4OF0A 3NFSL 5BJTB 2DM4A 4X6EA 4HS3B 1SEQL 1IGIL 5B8CB 5C0BB 3HPLB 5HHPB 4GXVL 3QA3A 3RNQA 4U1SA 5SX5H 3VFTA 4JRXB 5B38A 4CN4A 3FB6A 3LV3B 3SGDI 4EDWH 2DM7A 3BE1H 3T65A 2APXA 1NGQH 1A7NH 4Q9QL 4YC2B 3QUKB 1BD2B 4HBQA 1CGTA 1HYRC 2H3NA 4LSSH 1G7MB 2OTPA 3LS4H 4PB9L 5CKGA 5I8EB 3N1PC 2EZ0C 4YQXH 4PP2B 1PG7X 4X4XB 4O2FA 4KMTH 4ZTOL 1SMOA 2IF7A 3FQRA 5I6XB 5C0ND 1RUKH 4HF5L 4LSRH 1Q0XH 5D7LB 3UJIL 3W9DA 5IMMB 4IRSC 1NGYA 4WI2A 1CGSH 5C0CA 4HPYH 4LP5A 2VH5L 1I3RB 3KXFB 2PTUA 1HXMB 4GRLD 5EIQA 5A43C 1C08B 5TDPB 4JG1L 4JR9H 3B2UC 4ODHL 4Q0XL 4UNVA 3O41B 3S34H 4BSJA 2O61A 3RA7H 3U9PH 5E2WH 2P48B 2E9BA 3ULVH 2VDOL 5HXMA 3K4AA 5AZEL 5IIEA 4KGLA 2BERA 4G6KL 3GSNA 3U1SL 3G5YA 2AJUH 2HP4A 5F7DB 2HT4D 3HZVB 3GMNA 3RWHA 2FYYA 4JRYD 2E6QA 3D18A 5HJ3B 3VXTB 1K2DB 1W8OA 1OHQA 4B7IA 4HKJA 4PJDF 3RNKA 5E8DL 5GGSA 2APWA 4HUXA 4HWZA 4ODXA 3BSZH 1UM5L 3OJDB 1OQOA 1RIUH 3C60B 4PRHB 2VLKB 2E7LA 2HKHH 2VQUA 4QTIL 1BPVA 2EH8L 4NYLB 5F7EH 3MRPB 1FGVL 2EC9T 2K7PA 3F62A 2B1AH 2AEPL 4PJXB 3MRFA 3DVNA 1UKTA 4G9FD 4LPUA 5TE7H 1DL7L 3T0XA 2X1PA 1L7TH 4Z7WA 4LLQB 3R1GH 4JY5L 4Z95L 1UACL 3TYFB 3L5WB 3HMXH 2YPVL 5E4EB 5EO0A 1T66D 5FKAB 4BFGA 1X4XA 3PGDA 5DSCA 4WNQA 5ANMB 2AI0L 5C09E 3B9KB 4X4XA 3EDDA 5MI0B 1INQA 1HIMH 3G6DH 4XH2B 2D7QA 3OPZL 3VRIA 4W4OC 2PTTB 3QPQC 4KDVA 1QFPA 2HJKA 2X7LA 3VWJC 1HIML 2Q8AH 5FB8B 1UJ3B 3UTPE 1OAQL 1SVZA 4GSDL 3DOSA 3TZVA 3L5XH 2VITA 4AY0A 5HYSA 2CIKA 2YK1H 3THMH 1RURH 2VLJB 3V5HA 2WWMD 1DQDL 1U8IA 4Y19A 3S35X 1VENA 4O2EB 5E94B 4Z77A 3TV3L 4X7TA 5HGGS 4HCRH 2JK5B 3SBWA 2V5YA 3VU2A 2WANA 5I73B 1HEZA 3G5ZA 2Q7YA 4Y16D 3GI9L 3PDOB 4MA8H 2E7LC 1MCNA 4OCNC 4DN4L 4PV9B 4PJDB 4YWGL 5J13C 2VR4A 3NA4A 1GGCL 5IR1A 4K8RL 4KHTL 4EEEA 3RQ3A 2WK2A 4RRPA 2W9DL 4FA8A 4LLAA 2DRUA 3MV7D 5E6IA 1NCDH 1ZT4B 5F3HA 5C6WH 2HTKC 3PWPD 3AREA 3ZSSA 1PD6A 1G9EA 3BP5B 2VLKA 2XQBL 1TVHA 2GAZB 1R3IH 2HLAB 4FZ8H 4UIMA 4LQFH 5ITBH 2E5EA 4OT1H 3L7FB 2G5BA 4RMVA 1IEBA 4WHTB 4LCYB 3ZKXB 2GUOA 4YDVA 1GCFA 3QUZC 1DBAL 3QZWG 4PJ9B 4GBXA 1FL3A 3IGAB 3ZDYF 4GG6E 2ARWA 3VXSE 5LGJB 2ERJB 3ZYIA 3V0WH 5I75C 3QUYB 4Y5XA 4P46C 1B90A 3QRFM 2NY0C 2PO6C 3MRQA 1QA9A 1PKQE 4XP6H 5DSCB 4WNQB 3B9KA 2DQTH 5J56B 2C4XA 4L4TA 3ZE1F 4XH2A 4E41D 3U36A 1YN7A 3UJIH 1MAMH 1AR1D 3VRIB 4HV8A 3RJQB 1X5LA 4TULH 3E6FA 4QOKD 4TSBH 4IJ3C 4PRNA 3T0DA 4NWUL 4F2MB 3QDGD 1K4CB 1N5YH 1A5FH 4LCUB 4FRWA 2A74B 2E8ZA 2AJ3B 3TJHC 1AKJB 5DHVA 1B2WL 2A6KA 3ARSA 1N0XH 4N0UA 2VLJA 3CVHB 5D1XB 3V5HB 3GBNL 3QCVH 1P7QB 5TDNB 5JQ6H 4O2CA 4L8DB 3MREA 4LCWA 4HAGA 1QNZH 1RIHH 4HMEA 1FFPB 1KN4L 1AD0B 4POYA 1DQJB 2IBGA 3NCYS 1UJ3C 3D3VE 2AJXL 2WW8A 5I1HH 2P5WD 3MOAH 1QNZL 1SYSA 4NRZA 1ADQL 1IM3A 3VDCA 5T1KB 5A2LH 2KZ1B 4YIQA 3OV6A 3CLFL 1E28B 3IKCA 1WC7B 2ICCA 3V9FA 1H3GA 5F7LB 3IS0X 4MX7A 3U79A 1C8PA 5IR1B 4XMLL 1WSST 1J0ZA 4ISVA 4QHKJ 5HPOA 3VD5A 3QPXL 4U1KA 4JG0L 5IBUG 4S1RH 2K9UA 3RY4A 1KELL 5GS0H 4K8RC 1BD2E 1IGTB 5K9OB 2NY4D 4WW2F 4P46A 5FUZL 3A6CH 5A2IH 1NJ9A 4ELKA 2DQHL 1D5ZA 2B1AL 3PJSA 1KV3A 3L7FA 2Z8WC 3H3KA 4JN1H 3TT1L 4NJ9L 4ENEC 2C26A 2GY5A 3ZTJH 2VKXA 4PRIB 1RSFA 3TNMA 2VLRE 5C9JB 1RMFH 1FL3B 1BX2B 3IGAA 5JQHC 2ZKHL 4PJ5D 3D87B 5MEPA 4RMTA 2V7HA 1UCBL 4PJ7E 4WI9A 2WBWB 2R23B 4HIEA 5D7KE 3QNXA 4HT1H 4PJGA 3MBED 1XGRB 4JDZB 3KPNB 4LRIA 1G6RA 2YWZA 4X9IA 5IV2B 3QFJB 5ICZA 3Q2CA 1VB9A 4GXUN 1G9NL 3E8UL 1OP3K 3FQXB 4KU1A 4FP8H 2JB6B 4DVBA 2YKLL 2EIDA 3RWEB 4NUGL 3MRBA 5I2IB 5IMLB 3VXMA 2V2XA 3CD4A 3E1F1 1ACZA 5E08L 3BPLB 4HUWB 1IC4H 2A74A 3MV8E 3L95B 5JORB 1QSVA 2QR0B 2F74A 2VSDA 5JDSB 3JTSA 3MRNA 1DFBH 2IQ9H 5FCUH 1F11A 1KJ2L 1S5IH 4J3WA 3T08A 3B9AA 3FHAA 2BY1A 1ULVA 4MJID 1FFPA 5KS9E 3DUUA 4JDTH 2FD6L 4HHAB 4XVJL 2P7TA 4ALAL 5FHBH 1FLRH 4YIQB 4F7PA 5C3LD 3SDXB 4X6DF 4RRPG 3VRJA 4EUPH 4OZHE 3ARFD 1QLRA 3RDTD 1CF8L 2ICWA 1KTDB 1U9KA 3D2UD 1U8PA 3M17A 4LHUG 5HGAB 1CCZA 3CSGA 1OP3H 2F53B 1NC4D 1FZOA 3EW3B 4N8VA 4XCFH 3ZKQD 2J4WH 4RFOH 3MV7E 1UB6B 4HS3A 1K9TA 1T3FB 4PJXE 5AUMB 1FAIH 4XXDA 3VXME 2R1XA 3PJSB 1Z9LA 3NFSH 4F57L 5DJYB 4Y4KA 5IBUB 4DGYH 1P2CB 4NZTH 5EWIH 3OKMB 4X6DB 3G6JB 3LH2H 3VFSB 3NA9L 3ARFC 1U8KA 1X5JA 3LV3A 3HR5B 1Q9KA 2EEAA 3J7HA 1P4IH 1JI1A 2EEBA 1B6UA 5CLTA 3QJFB 3VI3E 4KY1H 1HQRB 4AM0A 3D3VA 3C8KB 1N5AA 4HJJH 2R9HD 4QT5A 4JREB 2ZJSH 2GJZB 2XI9A 3NN8A 5L9DH 2D03L 1I3GH 4O2FB 1PSKH 5FDYA 2XICA 3FQRB 3W0WE 1CDBA 4LLWA 2HT2C 4LCCA 3ARDB 2Y36H 4QXWA 5I2IA 3QDME 2B39A 3RZCD 3UTTA 5MENB 3ZE1E 5IM7B 3MRCA 5IB1A 2UVFA 4QRRB 2LU7A 2IH3B 5BRZD 5F7HA 3KHQA 4V2BA 2QHRL 3O6FB 4ZDHB 3D0VB 3U2SA 3RVWD 2HLFC 1ZVHA 1GVIA 3KLAA 3O41A 5DC9B 3HAEB 2HTLD 3OR6A 4HD9A 4NKIH 5KSVA 2R9HC 3JTTA 3V0VB 4PJDE 1CD0A 3VG9B 2D9CA 4M00A 5FOJA 1LE9A 1BMGA 3OKKB 1XF5A 3DWTA 5E95B 4L8CA 3ESVF 2NXYB 5IESL 1GC1C 1R3JA 1MCJA 1OY3B 1DQTA 2X4SB 4Y4KC 1KTDA 5I74B 5AG8A 3MV9D 2C3VB 4PJIF 5H94A 2DQFB 3JWNC 2FYYB 4HLJA 2FSEB 2VAAA 2VDNH 3RWHB 2F53A 4TVPL 5HHNA 1Y6KR 1TJIL 3B9EA 3WHXA 2D0HA 3FHQA 4ODWA 4WJ5A 1T7YA 2VUYA 1LP9E 3SHSA 1T89A 3S9DB 1JFQH 4HWZB 5IT2H 5DK0B 3HAEH 3NAAH 3UPAA 4M43L 1EJOL 4GG6F 1LO0H 3TVMA 1ITCA 4KI5F 1M7DB 2NX5D 3GBLA 2Z31C 2R4RH 4PV8B 3GNMH 4KJPD 5F96H 1CVSC 4OLUH 1LO0L 4OZFA 3ZHLA 3T8XA 1U8HB 4M61B 3CFCL 5H37G 5GSVB 1JNLH 5TDOA 1KBGL 4G42A 2P5WE 2EXWD 3MRGA 3SEPA 3BGMA 3VXRB 2NZ9C 1RULH 4OF5A 4NQDE 5EO0B 5FKAA 3BN9D 4JKMA 5DXWA 4HEPG 2ENSA 4KRPC 3RVUC 1HDMA 1BOGA 1SY6A 3AS0A 1FVDA 5MEND 3N1MC 4C4KO 5KSAB 2B8OT 5H2BA 1P4LB 1L6ZA 2AI0H 3VXOA 2DL9A 2MKLC 1HILA 4RNRB 4IOFD 1HYSD 2Z31D 4FG6D 3MNVA 2W60A 1DEEA 2APVA 1MHCA 2IWGA 3ZTNL 3U4AA 1A7PH 4KUZL 4KKBD 3VRLF 4TSBL 2DTMH 4R4FL 5I19L 4ODUA 3EO9H 4MQ7A 5IKCA 4M7JH 3HAEA 5BQ7A 3QIUD 5C0JB 1LDPH 4X5XB 4PG2A 4JFED 4H5SA 1L9MA 1NANH 4WIQA 4HS8H 5E5RB 4X7TB 3N9GH 2WUCH 4XPBH 3WFBH 2DDQL 2F8OA 1LE9B 2JJTA 1ADQA 2YPLB 4F9LA 4KI5D 1QFWL 2CGRH 3V6ZB 4LLVB 1K3IA 1PBYA 4Y8DC 3V2AR 1CLZH 1G1CA 2QJDA 4Z7VE 1OGAB 3VXNB 4HMDA 1P7KB 2D3VA 3TO4C 4J12A 2N7AA 1N0LA 2YSSB 5AD0B 3MOAL 4BFBD 1KGCE 2GYSA 5EPMA 1IAIH 4D9LH 4RX4D 2VDQH 1A9EA 4JHWL 3T0EA 5IW6B 1FFRA 2X4PA 1QO3A 4ZS7H 4NUGH 1TVHB 2GAZA 1J1XH 1OW0A 3RZCB 3BZEB 4PGCB 2V5MA 5ISZB 5FYJD 1VPOL 1ORQB 4E41A 4OZFB 3KPPA 3MOBL 1T5XB 1D5BA 5IFHH 3GSOB 4ORGB 4JFFA 5D5MB 1TQCC 4NHCL 2GT9A 1QR1A 1JPTH 2FBJL 1PEWA 5C0DA 3E0GA 3CDCA 3MLPA 1PQZB 5E6YA 3V8OA 4FQHA 4WEMB 4DOHE 2Z31B 3X11B 2VJXA 3WIHH 2AAVA 1FE8L 2IAND 4IRJC 5KSAA 4X4MA 3HTLX 4LCIL 5C08D 1B88A 4PS4H 3RUGF 1XF2A 5FECB 3IDYB 4MDIA 4HZLA 2R4RL 3RAJH 1Z6JT 5DRWA 2VC2L 5CZXD 3K81A 2Q8BL 5F44A 3V6OE 3AM8A 4S10A 5CILH 4ODUB 3QDJB 3QEQA 4KC3B 3DHJA 1UWXH 4FQXC 5B22A 3BP4B 4NCC1 4F37K 1D6VL 1E4XH 5T3ZE 4O2CB 4OAWB 2EICA 3NTCL 1JV5A 2NX5B 1MQ8A 4CAGA 4GRMB 4I5BA 3TPUB 1MJUH 1A7BA 4X6CB 1BECA 1RJYB 4IRJD 2APBA 4I0PC 3T0EC 5DUBA 1QSEB 3P9MB 4XCYB 4LLVA 1FG2B 4M6OL 1XMWA 5DHYA 2OZ4L 1BIHA 4WW1B 4MNQE 1F00I 5JDJA 5BZWB 2GEEA 1T7VA 3BD5A 5DEFB 3BPNB 3IU3B 4U3CA 1CU4H 1WZ1H 1FZMA 3N85H 4XWOC 5CJXA 1NLBH 2W65B 1F4AA 4UIKH 4AL8L 2JJVA 1A9EB 1IC5H 3K8LA 4PY7B 3T3MF 1N7MH 3WDIA 2P24A 3RKDC 2WUCL 4XPBL 5M94B 3CSYB 2D4FA 4WV1A 1RZFH 4BELD 3U30B 3AMKA 4LSDA 4JKPH 4QRQB 1N6QL 4LHQB 2E6JA 5C9JA 3R4DA 3D0LA 2VZ3A 2Y1VA 3QI9A 2NTFB 3CJJA 2QQLH 2ICEB 3SDXE 1FVEA 2V9QA 4Q6IB 3VG9C 1BP3B 3D25A 5EZOL 3S4SA 3L3DA 4F9LC 5C0DB 2V6HA 4PLJD 4BQ6A 2GI7A 4K71B 1ZEAH 1RZKL 4L3EA 4DN3H 4OZIF 1D9KD 3VD7A 5I1EH 3SE4C 5C2BH 4WO4D 5DJ8B 5MHSE 1RAMA 4O9HH 4HWBA 3QEHB 4ZUSA 3MRRA 4LLUB 5IB2B 2ZOLA 3ARFB 4HKXB 5BZDA 1DJSA 1CDHA 3Q3GB 1YEIH 3S35H 3UYPA 2PW2B 4YHNA 2AABH 2BVQB 3RVTC 4KRNA 4KKAC 3SKJH 4R6UA 4I9WD 1KJVA 2GTZA 2EO9A 4UINL 1R3HB 3L6FA 4CUCA 4ERSH 1A1NA 4P2RA 4NKQB 1DBJL 2ZCLL 4PLJC 3TNNB 3INUH 5F21B 5MI0C 5IJVB 5KSBF 1JGEA 3FO1A 1NSNL 1BQSA 3GI9H 1YEHL 3C2AL 4YDKL 3ARXA 2X4TB 4JB9L 3QCTH 1RUAH 4O51A 5D7JB 4XNYH 3ETBF 2BVTA 1BFVL 1FLTX 2QADD 4CVXB 4NNYA 2FX9L 3VRJB 1DQLL 4QEGA 5EBWB 5IHUH 5GS2H 5F8RC 2COQA 3DX9B 5BZWA 1EO8L 1XF3A 1FL5B 3M17B 4ETYA 4XBPB 5ALCH 4XPTH 3FFCD 5IHUL 2Z35B 1NEZB 3O6LH 4X7CC 4JQXC 2YOCA 1ZMYA 1GGIH 4N8VB 3U83A 1DQDH 1R3IL 3DSFH 3VI3F 3HI5H 4P2RD 2BP3A 1J10A 3DO7A 2QQKL 3BH9A 4Y4KB 4BZ1L 2D7MA 5DYOA 1RUQL 5SV4A 1F2QA 3RTQA 3UROR 4W4NA 4XVTL 1DBJH 3FFDA 1LE5A 4YXLH 1HINL 3D0LB 3KPLB 3OWEA 5JHDA 2EIZB 2JB5H 3X12B 5LBSL 3OF6D 4YHLL 1JHTB 2HTKD 3TT3L 1EJ6A 2KDGA 5JHLH 4WWKA 2DQJL 5DQJA 2GFBA 2JF1A 1FZJB 2BVEA 2WINB 4X6EB 1L7IH 2AJZA 4ZUTB 2CDGB 3SGJC 3D3VB 4HEME 1U2HA 1WT5A 5DD5L 1JYVA 3TA3C 4JM4L 2FJGB 3LKOB 1NLBL 4B41A 4X4YB 1WCBB 4P5TD 4NM8L 5F7MC 5JZ7C 2LABA 4U1SB 4BZ2L 5JW3H 3RKPA 4WU7B 4MJ6B 5EU6A 1NCTA 2ATKA 1VGEH 4ZFOA 4OLVH 5FF6A 1I9RH 3MRIB 2IBZY 4L3EE 3IFOA 4LLDA 1KTLA 3VXRD 3D69A 2FEDD 4JFYB 5EU4B 5H35B 5C7XH 3RWDB 4P9HC 1RIVH 3BPCA 4OCRH 3SCMA 4GRWB 1OTUD 4MD0A 2YPLE 4MAYC 4N0YH 1ZLUH 4XBEH 2AJVL 2XZQL 3TH3T 1QG3A 3GM8A 5GXBB 4BQ9A 4TQEL 1JGEB 3FO1B 4YNYA 2MCPH 4OD1L 3TA3D 2D31B 3PGFH 1ONQA 1UKSA 4Q9CA 3PGCA 4Z7VF 3ARVA 5DMGC 3TJHD 3OKKA 5HDBF 2J88H 4TTDD 4U6TA 3E2HC 4L8CB 5TQ2H 4MZ2A 1EBPA 4L1HA 4FTVD 3TPKA 3O4OB 2WQRA 1A02N 1UWEL 4NNYB 4P59L 1O7SA 3VD9A 4I0CC 5EU7C 1OGTB 1E4WH 5CP3H 2HH0L 2VLRA 5GIRA 3EOAA 5FO8B 4I18C 2FSEA 5EUKB 5DMKB 3FB8A 3VMNA 1AKJD 4HIJB 4OLVL 1UH3A 1F4HA 1P7QD 1J88A 3I02B 3QUMH 2IC2A 2A0LC 4LARH 2A1WH 1CFVH 5ADOH 2DMCA 4KVCL 1FPTL 2D4DA 2OM5A 3U30C 4XMKH 2YD7A 3RTQB 4C56D 4JHAH 2DS4A 5ESQB 1T03L 1ZLUK 2D0GA 1MIEL 3GHEL 4OM0H 5CIPB 4LLYA 1BVZA 4U0RB 1UM5H 3PL6A 3RGVA 5CEZE 4OGAC 4LOUD 5F89B 2GFBB 5LCVL 1ZLWH 4U1HA 3VXRA 2W9LA 5F6HI 4EDWL 3RUGE 3ARBA 3GMPA 5DD6B 5L6YH 2NLJB 3VW3H 1OCWL 1U42A 3BIKB 4Y2DD 3U48A 1NUNB 1WCBA 2Y36L 3MRMB 1C5CL 4EN3D 4MJ6A 2VXUL 2BCKB 3MLYH 5H2BB 1Q0YL 3H8NA 3LSOB 2ATKB 2DJSA 2GK0B 3KLSA 3DVNB 5EOQL 2A6IA 1G7QA 3OAUH 3PQYA 3QO0A 4PJ8B 5DFTA 1XGTA 5JR1L 3VG0H 3IVKB 3TYFA 4G8EB 5FM8A 3QO1A 1MCWM 2FBOJ 1TJIH 1KB5B 3GSRA 3ULSB 1AQDB 4D0DB 5JA9A 4H5SB 5FGBA 1NAMH 3O4LA 2NY5L 1S78D 2ZUSA 3UC0L 4PJEA 1PKQA 2X7LB 1ACYH 4M1DH 4I2XA 4M5YL 1U0QA 2OTUB 1YPZB 2Y07H 3M07A 1JNNH 4OV6F 4K07A 1YEEL 5JO5A 1HHHB 1T5WA 3VD3A 4PRIE 2FZ3A 1KG0A 2OQJA 4WTZA 1B4JH 4Q74A 4WENB 3QDMB 3ZZ1A 2OXGA 3D85B 3VCLB 5DMKA 1VEPA 1NBYB 5GPRA 5DJ0A 4O2EA 5E94A 2YSSA 1A4KB 4K94H 5EZIH 5IBTL 5HGDA 4LSPL 2R8SH 3VH8A 3DROA 2NY4B 3NPZB 1L4IA 3P40A 4KK5D 2B7DT 2ERJC 5I75B 3OF6A 1E6OL 3EO0A 3KPRB 4PV9A 5IB3B 3QIWD 2ZSVA 3LKRB 4E41B 4LLYB 4G8GA 2IALA 3BPNC 2H1PH 4UQ3B 5T1LA 5MEQA 1J87A 1YJDL 4XPHL 4AEEA 3GSOA 2C1OA 4A6YB 3MV8A 2J7LA 1ZT4A 4S0TD 4WO4B 5ERWA 4L9LB 3R1GL 2HLAA 3HAEG 3N9GL 1GGBL 3JUYA 4HIXH 3VXQB 2Z93A 4QCIA 1IL1A 1J9CT 4PRBA 1ITBB 1NGWB 4KUZH 4HW6A 4NQCE 1XF2B 4GRLA 2RCSL 4WEBL 5HI4D 3NIFF 3QWRD 1KLFA 2BNQE 1CXHA 3QIUA 3WIFB 1C16A 4WWID 1BHGA 5KSUA 2EIEA 1REIA 3MLSL 4PJFA 3MROB 1C5BL 3FRUB 3FT2B 1O7VA 3MNWA 4MWFA 4NQDD 3KPRE 2UVEA 3ZKNC 1JN6A 4P9HH 3BAEH 2A83B 1RUPL 4KV5E 1MCRA 4FFZL 4QRSB 5D1QC 3LEVL 4GRMA 5SWQA 3E6FB 3EZJB 4I5BB 4H1LH 4MD5A 3W39A 1J8HB 4MJIB 4MQTB 5F7WC 1R3KA 2HT4C 2C7UB 4CGTA 3A6CL 1C12B 4G5ZH 1WAAE 1AKJA 5DHVB 3O9WD 4M48L 3V6OC 4DAGL 4F7CB 3HI6H 4OIIH 2EKSB 4U6YA 4G6JH 3VCLA 1YEHH 3C2AH 5CEXB 4M48H 3VFVB 3IU3A 4LCWB 1T2QH 4XTRD 2AV7B 2JJTC 1YY9D 1J05B 2I24N 2F19L 4G7YL 2ITDA 2D7OA 1EEQA 1S9YB 2XZAL 5B38G 2I25N 3U9UA 5I1JH 2NQCA 4QRQA 5D96B 3L3OB 2YRZA 4M3JA 1KELH 4QTHB 2IQAA 5JOPE 1JPGA 3LQAC 5IW3A 2W0PA 2MTPA 5I1LB 2C1OB 4O02H 2X9WA 3VXUA 4BQBA 5FUCE 5DVMA 5GGQL 3MJ6A 4RGMC 1NKOA 2XYCA 4ZAKC 5I6XC 1A6AB 4Q6IA 4PB9H 2XRAL 4P5TB 1KT2B 4KDTC 4TPRL 5HHOB 4J3UA 2JIXB 4WRLA 2LU4A 4TQEH 2CLRA 4XTRC 3X13A 3O4OC 5EOTA 4TOYH 4CW1B 1YY9C 1TVBA 3KG5A 5D72H 1YNKL 3DJ9A 1EGJA 1MRDL 2ZKHH 4XNQB 4PRBB 2CLVB 4OLZL 2M1KA 4Z7UE 1ZTXH 3ZSTA 1O0VA 2R0ZH 3MFGB 4NZUL 3G5VA 1G9MC 4F33B 5L0QC 3N1FC 1RZ8A 5D2LA 3ZDZF 4PJCE 2XZCH 1QLFA 4X6FA 2JELL 2X4UA 1NGZB 1GGUA 2R23A 4HIEB 2BVQA 4HC1A 3MLTA 3I6GA 1CTOA 3ARDC 2X4NB 3C09B 4D0BB 4EDXA 4NIKB 1TTFA 5DLMH 2NTSP 2DWEA 5TQ0L 1R3HA 3BW9A 4OSUL 3IJSA 4RFEB 1ETZA 3HNSL 2HMIC 4RZCA 5GJSL 4AL8H 1DBAH 4V1DD 4EIZC 3FQXA 4YHMH 5DLML 3EBAA 5D7SH 3LD8B 1I75A 1W0VB 5ICYA 3RP1A 2OJZH 5TF1H 2R2EA 1T6VN 1JZ6A 1VFUA 1KJ3H 4HK3N 1OAUH 5L88L 4OB5H 4HUWA 3PP4H 3L95A 4N0YL 1M05B 1MHHA 3OL2A 2EKSA 4U6YB 2LQRA 4I77H 4NC1E 4WW2C 3R0NA 4LSTH 3ARBD 2R8SL 1GGCH 4I3SH 2HFFB 5GRYA 3VXUD 1MWAA 2FJFB 1BQHG 3MRJB 4WGVB 1S7WA 4KDTA 5AYUH 1F3DJ 1WK0A 1FNGA 3MYJA 4CADA 3HE7A 4R26L 5IMKA 1HE7A 4PG9A 1FIEA 3FCTB 3O3AB 3MA7B 5LXGH 5DYOB 3LN5B 2PXYC 1FO0A 5DR5H 3KXFD 3NACH 1NCAL 1EA9C 5CGYC 3X12A 4NJ9H 2K1MA 3GK8L 1FZOB 1FFNA 3DURB 1A6AA 2MQ3A 3RVXC 1HINH 3RBSA 4OIIL 1OPGH 1IILE 3QNZB 5HHOA 3UJJH 2DQHH 1PG7W 3KWWB 2Q86A 2ZCLH 1AGFB 5IROC 3BKYL 3K80A 3P0YH 3TT1H 2F53E 3O45A 1CFQA 4XNQA 3NIGF 1IT9H 3V4PL 5GRUH 4JVPA 5T3XH 5KG9B 2ZCKL 4WU7A 1CE6B 2YMXH 3ROLA 2VABA 4XWGL 1P4IL 4F33A 1Y18B 5IFJA 4LVEA 3VFSA 3EGSA 1RZ7H 4NKMA 1RFDL 4RGMB 3QNYA 1AHWC 4RFNC 4L3CB 5IF0A 3I6GB 4XP4H 2FIKA 1YECH 4D9QE 4OZGF 3RWGA 1IJ9A 1GAFH 1H3VA 2LFGA 4PJCB 2CLZB 5DGRA 2P5WA 2YKLH 4OZGA 3QIWB 4YAQB 1UGNA 2BVPB 3IFPA 3KYAA 3RZWA 4YNYB 5CJOL 2R1YB 4BKLA 3HUJB 1KCUL 4P23A 4YJZL 3ZYZA 3UBXA 2QV2A 3DMMA 2OK0L 1ACYL 3SBWC 1UFUA 1U91B 2YXMA 1A5FL 4U6HA 4NKOA 3TIDB 5E2TL 4OKVB 1AFVH 2OP4H 3D0VA 4KUCF 3WSQL 5JW5B 5CHNB 2IANA 3QDJD 3QFJE 2HFFA 1XT5A 4HWNA 1CDJA 5I73C 3P9WB 4L8SA 4PLKC 3FO2B 4MAUH 1OGAD 1WFTA 3C2SA 3GBML 3DSNA 5IBTH 2R39A 2UWEB 2QLVB 1YUHB 5EC2B 1C1EL 3B2VH 4FN0A 3QUYC 2FH6A 3L7EB 1R3JB 2KQMA 3DX7A 1EO7A 3B83A 1MY5A 1XGUA 5DI8B 3HI1A 2H6PB 3V5KB 3OJ2C 3HKFA 3TIEA 3CH8A 1MI5A 1Q8MA 4GBXD 1MJ8H 2NMSA 5C0AA 2QSCH 4U1HB 2EDJA 3O2DH 12E8L 4XBEL 3I3EA 2AXGB 2DQCH 1I7ZA 1RUMH 3FFCA 5ESAA 4HIIA 4I4WA 4IRSB 1YEJH 3VXMD 1OD7A 1HHJB 5D1XC 1QRNB 4OZFG 1YY8B 3ROLB 2VABB 5EH1A 2FO4A 2HFEB 2V7NB 4FZEH 5CP7B 2A6IB 3PQYB 1N0XL 1CD1A 1BBDH 2A73B 4XNZB 3MRGB 5ABDE 1A4JB 4PRDA 1MCSA 3UTSD 1ZSDA 3SKMA 3IVKA 2EE3A 2AJSL 2P43B 4NQDB 4ONHA 5E6IC 4ERSL 1IKNA 5BS0E 3QHTC 4JY4A 3RWGB 3VG0L 4F7MB 1OAXH 2HT3C 2OL3H 5FUCC 1AQDA 5JOPD 3W5NA 2P5WB 1WEJH 4NQVA 1BOGB 1TQBC 1AC6A 4U6VH 4D0DA 5EZLB 4M02A 9CGTA 2UZYB 3PWLA 5MEOB 5F93C 3FOLB 1HI6B 5J0BA 4BKLB 4NZRL 4MNHB 1DVFC 4PJEB 2WM0A 5SX4H 4OCLC 1IGYB 5GGTA 4YE4L 3EZ8A 2APTA 2NW2A 2C1PA 1N2RA 3IFLH 5JLZB 1LEKB 3QFDB 2ESVB 2P46B 3EDEA 3QCUL 5I9QB 1OTSC 1D9KA 1JNNL 5JW4M 1FHGA 2VL5A 2WSKA 2FGWH 1JZ7A 3ES6B 4POZD 3WUWB 2VDRL 4L8SB 1RHHB 4MA8L 3NCEB 1U58A 2XTJB 1XCTA 4P4RB 1L0XA 4YZFE 2PYEB 3GSNH 4P3DB 3TZVC 4HK3J 1NQBA 3HPJB 1I8MA 3U0PB 4P4KA 1DN2A 1DANT 3HMXA 4KVNH 4LDLB 4RISH 5KVDL 4CDGC 3HB3D 3AB0B 4Z5RA 4EXPX 5C9KA 3RWCB 4J3XA 2VLME 5I0ZA 4KMQA 5E7BA 3H42L 3CFJB 3HC0A 3WD5L 2DQDL 1KENL 5IVXF 4POZC 4YPJA 1NFDE 2X44D 4NN7C 1CR9L 4MLSA 5GSRA 2EYSB 1I1AD 3RZCA 1YYLH 3BZEA 4LHJB 2R0WL 4TYUA 2X9YA 4LPCA 3T4YB 1CD9B 1QRNA 1S7SB 1S3KL 1IVLA 1NGWA 2PF6A 1TMCB 1PYWB 3B2VL 3KPPB 3QZWB 2VNCA 1YNLL 2R0WH 2DD8L 3DGGB 2FL5A 2J8UF 4G9DB 2KUTA 3JV6B 3MOQA 3AXLA 1A4JA 1GHFL 3BUTA 5IVZB 4I9WE 4O5LH 1C16B 1P84J 1J0KA 4HXBH 1E27B 4OUOA 3TBTA 4WFED 5F1IA 4GAJL 3H7BB 1J1PL 2BSSA 4CVZB 4YHPA 1H3TA 3FT2A 1I1YB 4PGDA 4BUHA 3PWLB 1R5VB 5A2JH 5DJ6B 1FVCA 4JCMA 2Z4QA 5FECA 4YPGB 4OIBA 3VDAA 4KKLD 3BPLC 4NM8H 1MY7A 2EE9A 5EN2A 1Q72L 4PLOB 1IEHA 3LIZL 1CXLA 4PJ5B 2XACC 2F53D 1T04B 3HS0B 3CU7A 3PV7A 4P5KA 1K6QH 2H9GA 4B7LA 2EDTA 5KW9H 1N4XH 2RFXA 2HWZH 2V5TA 4GKSA 4JGUA 4DZBA 3MFFA 4NNPH 4JFEE 4LAQH 3MLUH 4Z7WF 2MOVA 3EDJA 3P4MB 2YMXL 4DFHA 1BBJA 4JO1H 1FGNL 5DHYB 2G5RA 2C9AA 4KKLC 1CDCA 2XZZA 2EE6A 1NL0H 3GRWH 4UI2A 4Y4HD 5FUOH 4HH9A 3H3PL 2Q76B 3WMSA 2YUWA 4QRPD 4CNIA 1CN4A 5KOMC 3QQ3B 4CU7A 4M4RA 2NZ9D 3OB0H 1S7VA 4RMQA 2BSRA 4IM8A 2DQGH 1T83C 5I1LA 3VXUB 3MGOA 5EZJB 4ZFGL 1TJHL 3ULUL 5DRXB 2J8UA 2Y25A 3BH8B 5EA0H 2ZPKL 1MEXH 5GGUB 2VSCA 1KC5L 4Q9RL 2CKBB 3UJJL 1Q9OB 1TVBB 4K9EL 1QSEE 4LLMA 3NAAL 4U7SA 3QCTL 3QWRA 5INDB 5KJRH 1BZQK 3CXHJ 5IVXA 2OK0H 2X4RB 4I0KA 1ZGLA 3CMGA 2FL5B 1L7TL 3EYQC 1F45A 2SEBB 4U1IA 5GISL 4QRPE 2ZCHH 3DUSB 2X4UB 5L7XH 2F8VA 1V7NH 5I1CL 3MUZ1 1ES0A 2HKFL 4NBZB 2VXVH 2PR4L 5I1DB 2MJWA 5FA3B 2DWEB 4WUUD 3VFGH 3LEYL 4L3EB 3LMJH 1XR8B 2Z91B 4PJHE 4RFEA 5DJDB 4RZCB 3ORJA 1CDIA 1EGJL 2J5LB 3GM0A 5GS1A 2B5IC 3BE1L 5KVGL 4KRMB 4URTB 3SE3C 2G9HA 1AXSB 2QKIA 2PW2A 4MVBC 4YHNB 4PJ5A 1JGDA 1RQ5A 3T0VA 4D8PA 1ODAA 5C0AE 4C83A 2OCFD 4OFPA 2I9TA 3EYQD 1WWBX 1UZ6E 3I9GH 4ONFL 5T33H 1KJ3L 1RZGA 3EO1A 3LS5H 4Y4HA 4H0HB 2FWOB 3L6FB 1IM9B 2J6EL 2WIIB 3HLAB 3AREC 1MFAH 3FB7B 4AMKH 2HVKB 4P2QE 4NWTL 4IMKA 3MFFB 2R2CA 2FJHB 2XTJC 1F4WL 3IDIA 3L1OL 3OX8A 4DGIH 3BUYB 5D6CB 2NNAA 5EOCL 3HZVA 4K3EL 1J0YA 1CZ8L 1MWAH 2E7BA 4AIOA 1R24A 4JR9L 3QEQE 4NN6B 4MJ2A 3UTQA 4R7NA 4UT9H 2DWDA 1VA9A 1W2KT 5EFIA 1BJMA 3ISWA 1EZVX 1QQDA 3JV5A 4CNIB 5D2NC 4GS7C 4KQ3H 3EJYC 4N90E 3O6MH 4MNQD 1WZ1L 3N85L 5IWLC 3STBA 4DJMA 2XFXA 5DMIL 4MXVE 2IFFL 3C6LA 4PY8I 1MLBB 2Q6WA 4DKEH 3QAZC 4QRRE 1MRDH 3ARED 4PRAB 2NY3D 5J6GB 1QRND 4PJXA 4DGYL 2OZ4H 2ICES 3ULUC 1KN2L 1FSKB 4JFHE 4JQVC 3SGEH 4UT6H 3QXWA 4HJGA 4K9EC 4C55A 1OAUL 2BY2A 2LU3A 5L88H 2EIZA 2SEBA 4ZG1A 3WFCL 3QHFL 5K9KA 2B2XH 3NZ8A 4IOIA 3I6LE 4NKDB 4ZUTA 1EJOH 2